1PQ8A

Trypsin at ph 4 at atomic resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq8A01
3MH7A 3PMAB 3MU8A 3UTUH 2VWMA 1C2GA 3ZZBA 1ZTKA 3RXCA 1WSSH 4LXBH 2DUCA 3QGJA 1LO6A 5JBCS 1YF4A 1KIGH 4D7FA 5L30H 5JDUB 2FTMA 2PLXA 3D23A 5FAHA 1HDTH 1GMDF 5EGMA 4NZQA 3QLPH 3HPTB 1AUJA 4ZAEA 3RU4E 5C1UA 4ZHLU 1O2UA 1OXGA 1UK3A 4MPWA 4GHQA 2ZGCA 4WY3A 2HGTH 4K1TA 3SJKA 4FUBA 1TNJA 1ZSJA 3ATMA 1XMNB 4Q80A 1ELTA 3FFGA 1T4VH 3KEEA 4JCNA 1ZSKA 1O3NA 2R0KA 1B5GH 1QGFA 2J94A 1TRMA 5E2PA 4Y71A 2HVXA 4X6OA 2VGCC 3BTKE 5C2ZA 4DJZB 1S82A 1AWHB 1K1LA 3BTFE 3P95A 1ELCA 5DP8A 2AH4X 3FAOA 2ZQ2A 3M36A 1C1RA 3BEIB 3MNXA 4O3UA 1TGBA 3UWIA 1JIRA 1BMNH 1TGSZ 1QCPA 3A8AA 3D65E 1EPTB 2NWNA 1DFPA 3VFEA 2H9TH 1HIAA 3MWIU 3P92A 4KELA 1TPOA 1ELBA 1KSNA 5EXMA 2G5VA 3K2UA 3ZVDA 1O37A 5EXLA 1O3CA 2V3HH 4Y0ZE 1DWEH 3RLYH 1S0QA 3UFAA 1VJAU 2SGPE 3DFJA 4FU9A 3SV7A 5C3NA 1GHYH 2QV1A 1CT2E 1IQLA 1NU9A 4ZHMU 4AZ2B 4OS7A 3SQEE 1ETSH 1UHBB 1KTSB 5GPIB 1C5UA 2QN5T 4INLA 2ZGJA 1D3DB 1FJSA 1YYY1 3SUFA 4WXIA 2D1JA 4YO9A 1JIMA 1YLDA 3T25A 3ZZAA 2ZU3A 2TGAA 1W7XH 1SOTA 4JZ1A 1UVOA 1ZHRA 1KYNA 1PPHE 4YM9A 4Y8YA 2B0FA 1WBGB 4ABGA 1HJ9A 3UOUA 4INKA 3M3SA 1U6QA 1C1MA 1ZJKA 3BTGE 3PTNA 3MNBA 1NY22 2ZPQA 4NZLA 5EW1H 5GCHG 2B7DH 1GI9B 3NCLA 4GSOA 3RXQA 5CHAB 1BJUA 4A1TA 2BY9X 3RU4D 3EYDA 2ESTE 2A5AA 9ESTA 5LPEA 2PKSC 1A1RA 1BRBE 3TH2H 2XCNA 3QWCH 3MNSA 5AFYH 2H9HA 1B0EA 2VGCB 1XXFA 1GI1A 1EP6A 4OS2A 5C5OA 1YBWA 4I32A 4FU8A 4D8NA 1O3PB 4ZXXH 1DANH 4BAMB 1EP5A 1V2WT 1GMHG 1THRH 4TWYA 2P93A 1C5ZB 3HGPA 1G3CA 3RU4T 4FXGH 2WPIS 5FBIA 4A5TS 1VCWA 4A92A 1GCTC 2C8WB 1MKWH 2VIVA 1LVYA 3LGTA 2XC0A 2Y5FA 3LGWA 1DPOA 1DSUA 4Y8XA 3U8TH 1LPZB 2OC1A 1NPMA 3SHCH 3FANA 1LPKB 3MO6A 1GBMA 3T62A 1MBMA 3LIWA 3ZYEA 5K7RA 2FWWA 3HK6B 1PFXC 3ATKA 4GVUA 2PR3A 1QFKH 1YM0A 5I25A 1CHOG 1YC0A 1AWFH 1BBRK 3MFJA 1O2RA 2BMGB 3M7QA 2XWAA 4WMDA 1MKWK 4FVBA 3U8OH 1O2KA 1GJ9B 3SW2B 4ABEA 4BTUB 1GMCG 1EJAA 5FPYA 1Z8JB 1C2IA 2AMPA 3A8DA 4HTCH 3AW1A 1P2OA 1HNEE 1VGCC 5DG6A 3SGQE 1CU1A 5EOKA 3URDA 1H9LB 2BXUH 1Z7KA 4Y8ZA 1HB0B 2ZI2H 4KTSA 2W7UA 3SU1A 1UTPA 1O3FA 1YPEH 4MLFB 5F8TA 2PTNA 2O8WA 1EZSC 1E35B 1LKBA 1O3IA 8LPRA 4WWYA 1XUJA 2FI4E 3RDZA 4CH8B 2FESH 2FMJA 1MTUA 1T31A 1ZYOA 1Y5BT 3SJIA 6GCHF 4Y10E 3PLPA 2O8LA 4E7NA 1F5RA 1DT2A 1IQKA 1E37B 1K1JA 1BRCE 1QA0A 4ASHA 2BLVA 2BLWA 2VVCA 5E8EH 3KNXA 1GL0E 1K22H 2GGVB 2PKSB 1DUEA 1KXBA 4IBLH 4A1VA 2V3OH 2WV4A 3LT3A 2UWOA 3W95A 4Y76A 2HWLB 4UDWH 3VB4A 1KY9A 1P3CA 2Z9IA 2XXLA 2ZG0H 4OS6A 1O39A 3TGJE 1F0UA 1QL8A 1W12U 2ZO3H 5I46H 2AYWA 1NRNH 1FPCH 2QGRA 1JOUB 2RDLA 1DXWA 1O2NA 1GJ5H 1BT7A 1BHXB 3TK5A 1QBNA 5A0AE 1IOEA 1KXAA 1ZPBA 3LGYA 7LPRA 1ZTJA 1GCTB 3M35A 1MCTA 3M5LA 3SNAA 1VITH 2UWPA 5FPSA 2JETB 2BY8X 1BJVA 1UCYH 3A7WA 4HI3A 1EPTA 3ZZ9A 3V12A 1W7GH 2V35A 2XBYA 3SUDA 1O3MA 4CR5A 1SGIB 1C2MA 1PPZA 3SV6A 1YPJH 3M3VA 1W3CA 3GY6A 1VITF 1AB9C 1OWIA 1Z1JA 4U32A 2ZU2A 3TIUA 1LVBA 2PW8H 4X1PU 4Y7BA 3U1IB 1LQEA 3LGIA 3GOVB 1C4V2 5AFZH 2Y6TA 5PTPA 4DG4A 2XYAA 2GMTC 2STAE 2AERH 1SHYA 4KTCA 2QYIA 4CRCA 1FY4A 1OYQA 3I29A 1UCYK 5TCCA 1KXEA 1WYKA 1EB2A 1TALA 5JB9S 2ZPSA 1LHFH 1NFXA 2ZDLA 1RD3B 4B71A 1O33A 2HLCA 1HJAC 1HV7A 2QXGA 1NRQH 3BTDE 1UHBA 1VGCB 3TGIE 1O2VA 2FO9A 1INCA 1L4ZA 2YNAA 1CBWC 2ZP0H 3PV4A 1C5OH 2STBE 3O8CA 5ABWA 2C8ZB 1RTLA 1S5SA 2BDAA 2FODA 4X2YA 2ZC9H 3BIUH 1AD8H 1AFEH 3RMMH 5LGOA 4XBBA 1QB6A 4H6SB 1C2HA 3NZIA 2P3UB 2IJOB 6CHAC 1HLTH 1G32B 1TGTA 3TLOA 1TPPA 1Y3YA 5DP9A 4HZHA 1A46H 1P2KA 1ANBA 3A82A 4OGYA 3VPKA 1OSSA 2J92A 4JMYA 1O36A 2BOHB 1HUTH 3STIA 2GV6A 1ABJH 1O5AB 3L33A 4Y79A 3VGCC 4K8BA 1TA6A 2GCHG 3RP2A 4ABBA 1EQ9A 3ZVGA 3OX7U 5EQRA 1FIWA 1QA7A 1D3TB 1H9HE 1O2PA 4LOYH 1BTXA 3SO3A 3LH1A 2GP9B 3IITA 3MU5A 1NU7B 4H42U 4GPGA 3LPRA 3K9XB 4R8TB 1K1OA 1UO6A 5HM9A 3D62A 3PM3A 1QBOA 3QZQA 1DOJA 1BMMH 2FLRH 3DA9B 3ODDA 2OUAA 3O8RA 1Q2WA 2SGEE 3RXSA 4NWLA 3A86A 3RMLH 3GDVA 3TK9A 5LPFA 1NO9H 2P95A 2XNIA 1MH0A 2H5CA 1Z8IB 2PFEA 1AE8H 1P0SH 1ESBA 4X8SH 3SOSA 2AS9A 1SOZA 4AORA 4OS5A 4ABHA 1DSTA 3RM0H 3TPIZ 2UWLA 1C1UH 1A7SA 3UY9A 4GCHG 1WUNH 4F49A 3SUEA 1GDNA 1IHSH 2ANYA 3QDZB 2Z9LA 2D2DA 3RXMA 2TGTA 1V6DA 2VU8E 3EA7A 1F2SE 3AAVA 1CBWB 1FZZA 2ODPA 4MPXA 1HJ8A 1O5CB 3SN8A 3MU4A 4IMQA 2C90B 5FCRA 5GJ4B 1NFUA 2P59A 2J2UA 5J4SA 1P04A 5HXFA 3H7OA 5F8XA 1HRTH 1HXFH 2IPHA 6CHAB 3A8CA 2GDEH 3ZVAA 5DO4H 2ZNKH 1GJ4H 4UD9H 4WJG2 2ANWA 5E0HA 3LOXA 1CGHA 2CMYA 1FY5A 1GBDA 5DK1A 4I8LA 1MTVA 1RIWB 1V2LT 2XWBI 1C1WH 3SQHE 1KLJH 3UOPA 1TIOA 2A32A 1AHTH 3VB5A 1FY1A 2FTLE 1GBBA 3SV8A 3RXFA 8GCHF 1K1PA 2ZGXH 3SORA 4AGJA 2Y7XA 1K1IA 5ETXA 3VGCB 2RA3A 3B8JA 3RLWH 5JBTA 4I8GA 2BY7X 2A4OA 1SGFG 2O8MA 5GIBA 1IQMA 2F9BH 5DP4A 1LHDH 3AVZA 5HMAA 4FUHA 1EXFA 1A5HA 2CJIA 4E7RG 2J9NA 2V0BA 3PLBA 3T29A 4U01A 1AZZA 5FXLA 1NTPA 1T8MA 4ISLA 4FU7A 2B9LA 1CA8B 3A7YA 2YOLA 1ZPZA 1W13U 3IG6B 3SU3A 2G52A 1HAIH 2A1DB 3P17H 3RXAA 1DY9A 1TMTH 3ZZ8A 1OWHA 1TNHA 1GHZA 4D9RA 2AGIX 1W10U 1T32A 1THPB 4DY7B 4F4OC 3TVJB 1O3OA 1SSXA 1YPHE 1GI3A 2A4GA 4YTAA 1K21H 2EA3A 4MPUA 2FOGA 2OD3B 2XBWA 1SGFA 2OBQA 1MKXK 5ESTE 2BLQA 1ETRH 3SJOA 2FOHA 4K5ZA 1GHBF 4Q7ZA 4SGAE 4AB8A 1FN6A 4FUEA 4ZROA 1G37A 2Z9GA 3SGBE 4AFQA 1KLTA 1YKTA 2ZHWH 3MTYA 4X2VA 2C3SA 4TPIZ 4XBCA 5G4BA 5CHAC 3RXBA 1TONA 1FUJA 3GDSA 1TPSA 2PWXA 1SLWB 2ZCHP 2XBXA 2UUYA 4NIWA 1LMWB 4DURA 1TAWA 2XC4A 4NIVA 2ZTZA 1UVTH 2VIOA 3RXJA 2OC0A 1BBRE 1TQ0B 1QL9A 2NU2E 2PSXA 1HFDA 4IC5A 5K0HA 1W2KH 1NN6A 3PMJA 5BPEA 3QZRA 4AOQA 2G4UA 3BTWE 1GG6C 1RFNA 1AKSB 4DOQA 1VR1H 2BD3A 1ZHMA 5ESBA 2ANMH 1NFWA 3CS0A 1PQ7A 2P3TB 4KP0A 4AFUA 3UREA 5T3HA 2Y5GA 4AFSA 4KKDA 1SLXB 4NWKA 1Z8GA 2AIQA 3BTME 2BVXH 1L1JA 2FOCA 2ZFQH 1P2QA 1WAYB 4WH6A 4BTIB 3F68H 1HAHH 4Q2KA 3RXUA 1S0RA 2Y82A 3VB6A 1QRWA 1WOFA 2SGAA 3ZV9A 2SFAA 3GISB 3TK6A 1OWJA 3MH5A 5DP7A 5SGAE 2JH5D 4UFGH 4O9VA 1D4PB 1A5GH 3TITA 3EA8A 2WUCA 5EW2H 1HBTH 2R3YA 1ESAA 2ZECA 2VIQA 3M61U 1P06A 4SGBE 3AW0A 1LVMA 1O2QA 5GWZA 1J17T 3BTTE 1ZLRA 1GBTA 2ZEBA 4XSKU 1TMBH 3S0NA 1V2QT 2JKHA 4K60A 2IOTA 2ZKSA 1NFYA 1S85A 1GWAA 1GI5A 2BQ6B 1HAGE 2FEQH 1UTJA 3TNTA 3HATH 1F92A 1A3BH 2SGDE 2O9QA 1HAZB 4B2CA 1GCDA 2FI3E 1QB9A 1C5XB 4WVPE 2OXSA 1E34B 4XE4A 2QXJA 1V3XA 4X6NA 1AU8A 1CO7E 5A09A 3URCA 4RN6A 3U1JB 3PMHB 1ZRBA 4CH2B 1TQ7B 5EPNA 1EOJA 2OTVA 4MPVA 3SGAE 1SGRE 2Z3DA 4K8YA 4IW4E 2GT8A 5A2MH 3A87A 3MHWU 4JYVH 3DUXH 2VIWA 2ZTYA 3V7TA 1D6WA 1QY6A 1C1NA 3T2NA 1QJ1B 5GDSH 2NU0E 1DITH 4H4FA 1ELGA 5GCHF 5CMXH 1P9UA 4BOHA 3TGKE 1MBQA 1W8BH 4JYUH 2BYAX 5JPMH 1JMOH 4O03A 1C4U2 1GG6B 1P02A 3PTBA 4OGXA 3UNQA 4D76A 2CF9H 2XRCA 1L4DA 3A83A 2LNCA 2RG3A 1LHCH 1F0SA 4MNWA 2H5DA 5DGJA 3ZVBA 2C8XB 3H7TA 3L6PA 1BB0B 1OWDA 4TY7A 1O2TA 1O3LA 3BEFB 1EZUC 1DVAH 2JETC 3HGNA 2VINA 4FUDA 1TNLA 3K65B 2VWNA 1EJMA 3PWBA 3B9FH 3PROA 1SL3A 3MH6A 2FX4A 4RSPA 2FOEA 1Y3VA 1A2CH 5EU8A 3NK8A 1UTQA 2GDDA 2ZA5A 4ZUHA 3RXEA 3RXHA 4DW2U 1CHGA 2HPPH 2HNTE 3S9CA 1FY8E 5E0JA 3C27B 1QURH 1MTSA 4ZH8A 1V2NT 3AASA 2RCEA 3M7TA 3Q76A 2OINA 1C5LH 1SGQE 5E0GA 5T6DA 1DM4B 1Q31A 1AVWA 1CHOF 2ODYB 3E91A 1C2KA 1EASA 1VCPA 2VIPA 4DIHH 4B73A 2QIQA 1ELAA 5DJ7A 1TRNA 2GZ8A 2BB4A 1C4Y2 1GBAA 1ARBA 1JWTA 1SBWA 3ZZ4A 1NRRH 1UTNA 3KQBA 3B23B 1V2PT 4TPYA 1S6HA 1A4WH 4NFFA 3A7XA 2OQ5A 3RC4A 2W5EA 1EAUA 3KIDU 4MQAA 3UR9A 6GCHG 1C1VH 1ORFA 2ZTXA 1RTKA 3RXDA 4BNRA 1NROH 2GT7A 1C5WB 1M9UA 3M37A 4FUCA 3MO3A 3FP8E 4JZEH 1C2DA 1C5RA 5C1YA 1HAVA 5GXPA 1TNIA 3S9AA 2BVRH 1RTFB 2W3IA 3BSQA 3GY8A 2BDBA 1C1TA 2UUJB 3V0XA 1P2MA 3RMOH 4AG2A 3LC3A 2C4FH 3BG4C 1O35A 1KXDA 4LZ1H 2PSYA 2CXVA 1UVSH 2ZCLP 3ZZ6A 2BDGA 1HGTH 1AKSA 1TBZH 1G2MA 2XBVA 3P70B 3RXGA 1K1MA 2WYJA 4CBNA 3ATLA 4ABFA 1GJ8B 1CT4E 1TX7A 4K1SA 1TNKA 4I31A 2ZGHA 5E2OA 4TYDA 1KXCA 1AZ8A 5IDKA 4NA9H 4XFQA 2ZDMA 1OOKB 4VGCC 3U8RH 4A1XA 4AN7A 1Y3WA 5H4IB 3H5CB 5TCAA 1O3HA 4B2AA 2PGBB 5JBAS 4K1EA 1TFXA 3QUMP 1C1SA 5LPRA 2BDHA 1SQTA 3MU1A 1GJ6A 4NIXA 3MI4A 1TOCB 2JH0D 2Q6DA 1PPCE 4NG9H 1ANDA 1AUTC 4IGDA 1OYTH 1ELVA 4O3TA 2ZU4A 1TOMH 2Z7FE 3ZVCA 1Z8RA 1Y5AT 2ZDVH 3DT0H 1S83A 1ZMLA 1XUKA 2SNWA 4Q7XA 1IAUA 1L2EA 2BD2A 2W26A 1DDJA 4FUGA 4FUFA 4Z6AH 4NSYA 4TWWA 3RMNH 1BTPA 3CENA 1A0HB 3SNBA 3GCTG 3E0PB 1UTLM 1BMAA 1XUGA 3LGVA 3GY7A 1PPFE 1QB1A 1WQVH 2F9VA 1TX6A 5JB8S 4DIIH 1OX1A 1O5DH 2J95A 4YESB 3Q77A 2VWOA 4JK5A 3ESTA 1MQ6A 1BTWA 2VJ1A 1ZHPA 1SLVB 2FM2A 2A5KA 1PYTD 3ENSB 1H8DH 1BQYA 1Z71A 2FI5E 7GCHG 5A0BA 1QNJA 1MAXA 1W11U 5EG4A 1J9CH 1ID5H 2SNVA 1W0ZU 4OS1A 3U9AH 1BTUA 2CGAA 3Q3KA 2WPJS 3QX5H 1V2RT 2OBOA 4QT8C 1RIWC 4ABIA 4ISIH 5B6OA 2R9PA 1P01A 3KQCA 1GHAG 2J4IA 6ESTA 2Y80A 1G2LA 4CR9A 2RA0A 3BG4B 3UQOA 4E06H 3RXIA 4UFEH 3T5FH 2BZAA 1MU6B 1CGJE 3SU4A 3SNEA 5T6FA 2TPIZ 2TRMA 1TLDA 1YPHC 5FBEA 1BTHH 4THNH 1NS3A 5DP3A 2BM2A 1HAXB 1C5NH 1AY6H 1O2MA 2Z9KA 3SBKA 2FOMB 1IQJA 3D49H 2BDYA 1TMUH 1C1PA 2QF0A 5AVDA 2H2ZA 2G00A 1MTNC 2C8YB 2FP7B 1F7ZA 1GI0A 2ODQA 2GCHF 4YZUA 2EC9H 3ZV8A 2ZFTA 1LQDB 3PYHA 1Z1IA 4VGCB 1C9TA 4XBDA 1RXPA 3ZZ3A 1G36A 1NC6A 1SLUB 1SC8U 7KMEH 1O3GA 1N6XA 3EQ0H 1J14A 4E05H 3DFLA 3F9GA 1FNIA 3OTJE 1T8OA 5AHGH 4X6PA 1DUAA 1FONA 1BZXE 3A7ZA 3S7HB 3E8LA 2BD7A 2BXTH 4IN2A 4B1TA 1O2YA 3MU0A 1ZGIA 1O30A 1MZAA 1QRXA 5C67A 2G5NA 3E6PH 1EB1H 3BTHE 1E36B 4CRDA 1RRKA 2BY5X 3BEUA 1LHGH 1BMLA 1P9SA 3UNSA 1N8OC 4BAKB 1ZJDA 1P8VC 1IQGA 1A0JA 3GY2A 1K2I1 3V3MA 1V2OT 4GHTA 2O8UA 1T8NA 4IS5A 1QR3E 3T26A 3O8DA 1SGEE 1O3AA 3LH3A 2QXIA 4AFZA 2LPRA 1AVGH 2G55A 3F9HA 1EAIA 1ZOMA 1RGQA 1ESTA 1C9PA 4AYVB 1ELDE 2FDAA 3ELAH 3KF2A 4Z0KA 2PTCE 3KCGH 2FOFA 2ZDAH 3EE0B 2GCTC 1CVWH 1SFIA 4XOJA 1BHXF 1FLEE 1GJ7B 2P3FH 2F91A 2XC5A 5A8YA 4NIYA 3RXVA 1GBEA 4X0WU 3LONA 3SU6A 2ZZUH 3BTQE 3SJ9A 2F9NA 3TH3H 3GCNA 4JK6A 4AGKA 1FY3A 2BHGA 1XXDA 4K69A 3BIVH 1Z6JH 1FMGA 2PKAB 2ZPRA 4U30A 2ZQ1A 4X2XA 2OQUA 3N7OA 1G30B 5EPYA 3RUOA 4ZKRU 3FVFB 1MTNB 5EXNA 1NZQH 1C1QA 1RS0A 3EGKH 1DICA 1C2LA 1BIOA 7ESTE 1FIZA 1ZGVA 1G3EA 1W0YH 3PO1B 2SGQE 2H1UA 2HRVA 1YCPM 3RXRA 1YCPH 4FUJA 1P09A 4H6TA 3ITIA 1N6YA 1XKBC 1XKAC 1IQIA 2OC7A 3A85A 4ABDA 2GD4B 2P94A 2AMDA 4J2YB 2A7CA 4MNXA 4UE7H 1Q3XA 2WINI 1MMJN 2BX3A 4WF8A 2QY0B 1O2ZA 1QTFA 3AAUA 2ZWLH 2QF3A 3UR6A 3M7UA 4MNVA 1H9IE 1ZRKA 3BG8A 1SGTA 1GHBG 4YOJA 1MCVA 1P2JA 1D3QB 1YCPK 1MD7A 3SU2A 2HALA 1F0RA 1FPHH 1GMDG 3OY5U 1N8OB 2G8TA 1VJ9U 4YOIA 2TGPZ 2YNBA 3MMGA 1JRSA 1V2TT 1P05A 3TH4H 1HAVB 3A89A 1SGNE 3ODFA 3S9BA 4Y0YE 1AO5A 5DPAA 2BD9A 2FS9A 1YPKH 1PPBH 3LJJA 4I7YH 1J16A 3W94A 1NRPH 1ETTH 4I8HA 4X1QU 1GI7B 4I33A 3BN9A 2EI8A 5DKMA 4ISNA 3SV2H 2GCTB 4NFEA 1UK2A 4UFFH 3OY6U 1BRUP 4YT6H 1DWDH 3SI3H 2HNTC 1SR5C 2QAAA 4ZXYH 2GVFA 1O5EH 1XUHA 3JZ2B 3E16B 1LCYA 4I8KA 2NU1E 1T8LA 3BTEE 3LU9B 2AGEX 1E38B 4FUIA 1QL7A 3GY4A 1QIXB 1IQNA 3I77A 1SGCA 2TGDA 2VIDA 1UVPA 2BOKA 1C5SA 4X1SU 2A7JA 2BZ6H 4JZFH 5BRRE 1YPLH 1GBCA 1XX9A 4K2YA 2A5IA 2VNTA 4BXSA 1PYTC 4BXWA 4NSVA 4NCYA 1EUFA 5HGGA 2ZGBH 4BANB 1S6FA 1YPGH 3QO6A 1O2OA 3VXFH 1RJXB 3TNSA 4GUXA 5DP5A 4UFDH 2P8OC 1OWEA 3TJUA 2F9PA 3A8BA 3A80A 1HPGA 2NU3E 1V2KT 1VZQH 1SMFE 1L1GA 3A84A 2OLGA 1TE0A 1BA8B 1P03A 1O2IA 3ZZ7A 1FV9A 2CHAC 4JYTA 3NUMA 3NPSA 2XTTB 2HPQH 2ZHDA 1GJBB 1QQ4A 1PQAA 4ZKNU 3E1XB 2NU4E 1DWCH 3FP6E 4IN1A 2ZU1A 4YT7H 2Z94A 1O2JA 5EQQA 3F9FA 1O3JA 4AG1A 2ZFSA 2PUXB 2GTBA 5EQSA 1ZZZA 3GYLB 3KQDA 4J1YA 1ZR0A 3WY8A 3S69A 1EATA 2ZFPH 1KDQB 3KQEA 5CE1A 3QTVH 1O2GH 6LPRA 3SU0A 1O3KA 2VVVA 2P16A 8ESTE 1H1BA 4ZKSU 8KME2 1C5TA 1WV7H 1HAYB 1HAPH 1AIXH 2VB0A 3EA9A 1CSOE 4NA7A 3SHAH 2KAIB 1UCYE 1UK4A 3S7KB 3R0FA 1C5QA 1GJDB 5EODA 2Q6GA 1P2NA 2BVSH 1O5GH 1P57B 2Z9JA 4CRFA 1V2VT 4YLUA 1O31A 2Z3CA 3E3TA 4A6LA 2D8WA 4MDSA 4BAQB 3GY5A 3GICB 1DXPA 4DCDA 5DP6A 5L2YH 4WXVA 1PPGE 1LVOA 2IN2A 1UVUH 1O32A 1AVXA 1GI2A 1UMAH 1ZPCA 2BD4A 3M5OA 1DX5M 2B8OH 1X7AC 1GHVH 2EEKA 3E0NB 3O8BA 4INHA 1BTYA 3K6ZA 2PKAA 3PWCA 3QGNB 1S81A 1GDQA 1Y3XA 2J38A 1AGJA 1C2JA 1GMHF 4ZMAH 2VH6A 3UQVA 1SVPA 2R2MB 1XUIA 4WH8A 1O5BB 1BBRH 1CT0E 2FIRH 1DS2E 2A4QA 2AMQA 1CGIE 2AFQB 1C2EA 3Q3XA 1HXEH 2OP9A 3R3GB 1K1NA 1D9IA 3GCHC 2ALVA 1V2ST 2BQWB 2EI7A 1TX8A 4DT7B 4B74A 1AN1E 3M3TA 4MNYA 4X8TH 3LC5A 2P8OB 5FX6A 2ZFFH 4ABJA 3TU7H 1IQHA 1THSH 1CQQA 4AB9A 3VXEH 2F3CE 3PLKA 2WYGA 2AEIH 1LDTT 3NWUA 3U98H 1FQ3A 2CHAB 2AGGX 2ZHQH 2THFB 2BY6X 1CE5A 4RKOB 2WV5A 4M7GA 3SI4H 2A2QH 1WCZA 1GMCF 1GVLA 1UTMA 2DE9A 1GVKB 4X1RU 1DWBH 1TBQH 1PJPA 1UJ1A 2BQ7B 4X8VH 3T27A 2ZHFH 3UIRA 3CP7A 4LZ4B 3SJ8A 1BRAA 4MG3A 1MAYA 2PV9B 1YGCH 1A0LA 4X6MA 1GHXH 5HM2A 1SHHB 4B76A 1ZMNA 1OP8A 3A7TA 3ZYDA 2F9UA 1SGYE 3T28A 1O38A 3GYMA 2BDIA 1QJ6B 4NA8A 4R0IA 2FYQA 5FHTA 2W7SA 4XDEA 3DHKH 4OS4A 5FCKA 1GL1A 3RXPA 1LKAA 3FP7E 5T6GA 1EKBB 3HKJB 2F83A 1NESE 2A4RA 1IQEA 1GGDC 3M5NA 2BDCA 2FLBH 1LHEH 1E0FD 3I78A 3P8OA 3A81A 4GAWA 3VEQB 1P11E 1W14U 2CN0H 2WPHS 3EDXB 3RXOA 4BAOB 3QK1A 1P2IA 1NRSH 3F1SB 1C5VA 5A0CA 1NM6A 3LJOA 4WMEA 3L3TA 4AYYB 4CHAC 2FYRA 2Y7ZA 3KHVA 1KXFA 1C5YB 1P3EA 1MUEB 2GZ9A 1O3EA 3PB1E 3SZNA 3ZVEA 1C5MD 2FOAA 1TNGA 3RXLA 3TJVA 3GY3A 1VITG 1TPAE 4YLQH 4CREA 1AE5A 3U69H 3Q3YA 2A7HA 2VH0A 2PUQH 1OWKA 2ANKH 3P6ZB 1VCQA 3GCHB 1SG8B 5A8ZA 2G81E 1ANEA 2UUFB 1ELEE 1TGNA 3BF6H 1EOLA 1FAXA 1P12E 2TIOA 5HYOA 2EI6A 1Y3UA 4UONA 4Y6DA 3V13A 2ULLA 1WTHD 2OCVB 1GJAB 2R0LA 2R2WU 4BAHB 1MTWA 5F03A 4B2BA 1O2SA 3SNDA 2Q6FA 1AQ7A 2ZHEH 5L2ZH 3C1KA 2ASUB 1PQ8A 1OKXA 4CBOA 1ZTLA 1H8IH 2ZF0H 2A0QB 1TA2A 2FS8A 2QCYA 1B0FA 4D9QA 2H6MA 2ZIQH 3JZ1B 1G9IE 3FZDA 1Y5UT 3UUZA 5FX5A 2QXHA 3GCTF 3VB3A 1G3BA 3KGPA 1JBUH 2BTCE 5FPTA 4A7IB 2ILNA 3STJA 1UTKA 1DLKB 2XW9A 3NXPA 1CA0C 1ARCA 3ZZCA 4ZKOU 2HNTF 4O97A 1KDQA 3RM2H 3UPEA 2H9EH 3OU0A 3CS7A 5L6NH 4CRAA 1TB6H 4FVDA 1GJCB 3ATWA 3QN7A 1V2MT 1ANCA 1BDAA 7GCHF 2Y81A 1GBJA 2AIPA 1KLIH 1PQ5A 2WPMS 1FI8A 1HAOH 4MTBA 3Q00A 1OS8A 1TWXB 2WPLS 1GGDB 5C20A 1F5LA 1Y59T 5JYIA 1GI8B 1PPEE 1AFQC 2GKVE 2WPKS 1BOQA 2KAIA 2I6SA 1B7XB 2XCFA 2PHBA 3NKKA 2B5TB 5J4QA 1GI6A 2BX4A 2OC8A 3ZZ5A 1N1LA 1GDUA 3MH4A 4X1NU 1ZSLA 1GHAF 1SQOA 1JXPA 1QRZA 2FXRA 4CHAB 2Z3EA 2M5TA 1WTGH 1SFQB 1BCUH 1ELFA 1HIAB 3ZVFA 1BTZA 1K28D 3HK3B 2GZ7A 1HYLA 3LGUA 1IQFA 2A2XH 3OSYA 4ISHH 4X2WA 2QA9E 1T7CA 2ALPA 3MO9A 3PO1C 1LPGB 5AF9H 1O0DH 3QTOH 2BD8A 1D6RA 2R3UA 1MZDA 1GPZA 1KTTB 1MU8B 1SGPE 1AB9B 2G51A 3DD2H 4JZIA 2Y5HA 1WU1A 1GI4A 5TJXA 1XVMA 1OP2A 1T4UH 2GX4A 5JBBS 4X8UH 2CV3A 3VB7A 1OPHB 2GMTB 1EAWA 1EAXA 2W3KA 2ZDKA 4ABAA 1O2LA 1GBHA 3TJNA 1XUFA 4IMZA 1O34A 1TABE 1LTOA 1QJ7B 1BITA 2V6NA 3GDUA 4MVNA 4GCHF 3F6UH 5C5NA 4LK4A 1P10A 4KGAA 1JRTA 1HJAB 3MYWA 1O5FH 3E90B 1L1NA 2HOBA 2BD5A 1IHTH 2FPZA 1FXYA 3MOCA 1QQUA 3K6YA 4PROA 1NT1A 3RC5A 1V2UT 3A88A 1GHWH 4K3JA 1O2WA 2A31A 1CA0B 3BV9B 1F5KU 2WUBA 1GBKA 4U2WA 3RC6A 2A45B 3KN2A 4TY6A 1C5PA 2GV7A 3EAJA 4Y11E 4CRBA 2ZU5A 4ZHAA 4ESTE 3OYPA 3KL6A 1FN8A 4D7GA 4WMFA 1O2HA 8GCHG 1J15A 3HKIB 1DLEA 3SNCA 2QC2A 1C2FA 3ATIA 3PMBB 1XVOA 4BTTB 1L0ZA 1GVZA 3P8FA 1ACBE 1AI8H 1O3DA 3UNRA 1AFQB 1O3BA 2BLOA 1DY8A 2D26C 3IWMA 1SB1H 1AMHA 3A7VA 9LPRA 2ZCKP 1SPJA 4HFPB 1HCGA 3RXTA 2C93B 1ABIH 5IYTA 1YPMH 2ZDNA 4HGCA 3ZZDA 2FOBA 1DE7H 2FZZA 5LH8A 1GBFA 5F8ZA 1MQ5A 2VVUA 4IC6A 4ISOA 1UTOA 3P8NA 2FX6A 2G4TA 4NGAH 3LDXH 4YOGA 1V2JT 1EPTC 4Y7AA 1A5IA 5A8XA 3G01A 1H4WA 1FDPA 4DGJA 1QBVH 1A3EH 1Z6EA 1SGDE 3SUGA 1SQAA 2JH6D 2VWLA 2TBSA 2ZFRH 3MNCA 4Q7YA 1EZQA 2SGFE 1GBLA 2K1QA 1C1OA 2Q1JA 3LKWA 3P8GA 4GLYA 1A61H 4JZDH 1BUIA 1MKXH 1OP0A 1TRYA 1ZMJA 1TBRH 5F6MA 1J8AA 5C1XA 1TYNA 2UUKB 4RKJB 1EX3A 3TJOA 1QHRB 4AX9H 1D3PB 1GBIA 3RXKA 1G3DA 1FAKH 4B75A 2Z6BD 1TGCA 1F0TA 2PGQB 4KTUA 2DE8A 3UWJH 3SV9A 1XM1A 2I6QA 1YP9A 2CF8H 2J34A 1MD8A 4I8JA 1SI5H 3GCOA 4CRGA 1WQSA 2O8TA 3FZZA 1EZXC 4DVAU 4UEHH 1YLCA 1K9OE 1S84A 1Y8TA 2F9OA 1O2XA 3M5MA 3SU5A 1EJNA 3F9EA
chains in the Genus database with same CATH superfamily
3MH7A 3PMAB 3MU8A 3UTUH 2VWMA 1C2GA 3ZZBA 1ZTKA 3RXCA 1WSSH 4LXBH 2DUCA 3QGJA 1LO6A 5JBCS 1YF4A 1KIGH 4D7FA 5L30H 5JDUB 2FTMA 2PLXA 3D23A 5FAHA 1HDTH 1GMDF 5EGMA 4NZQA 3QLPH 3FO8D 3HPTB 1AUJA 4ZAEA 3RU4E 5C1UA 4ZHLU 1O2UA 1OXGA 1UK3A 4MPWA 4GHQA 2ZGCA 4WY3A 2HGTH 4K1TA 3SJKA 4FUBA 1TNJA 1ZSJA 3ATMA 2WZQA 1XMNB 4Q80A 1ELTA 3FFGA 1T4VH 3KEEA 3NRLA 4JCNA 1ZSKA 1O3NA 2R0KA 1B5GH 1QGFA 2J94A 1TRMA 5E2PA 4Y71A 2HVXA 4X6OA 2VGCC 3BTKE 5C2ZA 4DJZB 1S82A 1AWHB 1K1LA 1KMHB 3BTFE 3P95A 1ELCA 5DP8A 2AH4X 3FAOA 2ZQ2A 3M36A 1C1RA 2KCAA 3BEIB 3MNXA 4O3UA 1TGBA 3UWIA 4P00A 1JIRA 1BMNH 1TGSZ 1QCPA 2F4LA 3A8AA 3D65E 1EPTB 2NWNA 1DFPA 3VFEA 2H9TH 1HIAA 3MWIU 3P92A 4KELA 1TPOA 1ELBA 1KSNA 5EXMA 2G5VA 2XOKD 3K2UA 3ZVDA 1O37A 5EXLA 1O3CA 2V3HH 4Y0ZE 1DWEH 3RLYH 1S0QA 2VBCA 3UFAA 3F3BA 1H8ED 1VJAU 2SGPE 3DFJA 4FU9A 3SV7A 5C3NA 1GHYH 2QV1A 1CT2E 1IQLA 1NU9A 4ZHMU 4AZ2B 4OS7A 3SQEE 1ETSH 1UHBB 1KTSB 3WWBA 5GPIB 1C5UA 2QN5T 4INLA 2ZGJA 1D3DB 1FJSA 3EE7A 1YYY1 3SUFA 4WXIA 2D1JA 4YO9A 1JIMA 1YLDA 3T25A 3ZZAA 2ZU3A 2TGAA 1W7XH 1SOTA 4JZ1A 1UVOA 1ZHRA 1KYNA 1PPHE 4YM9A 1SQRA 4Y8YA 2B0FA 1WBGB 4ABGA 1HJ9A 3UOUA 4INKA 3M3SA 1U6QA 1C1MA 1ZJKA 3BTGE 3PTNA 3MNBA 1NY22 2ZPQA 4NZLA 5EW1H 5GCHG 2B7DH 1GI9B 3NCLA 4GSOA 3RXQA 5CHAB 1BJUA 4A1TA 2BY9X 3RU4D 3EYDA 2ESTE 2A5AA 9ESTA 5LPEA 5EIYA 2PKSC 1A1RA 1BRBE 3TH2H 2XCNA 3QWCH 3MNSA 5AFYH 2H9HA 1B0EA 2VGCB 1XXFA 1GI1A 1EP6A 4OS2A 5C5OA 1YBWA 4I32A 2EQNA 4FU8A 4D8NA 1O3PB 4ZXXH 1DANH 4BAMB 1EP5A 3OE7D 5B6LA 1V2WT 1GMHG 1THRH 4TWYA 2P93A 1C5ZB 3HGPA 1G3CA 3RU4T 4FXGH 2WPIS 5FBIA 4A5TS 1VCWA 4A92A 1GCTC 2C8WB 5EJ1A 1MKWH 2VIVA 1LVYA 3LGTA 2XC0A 2Y5FA 3LGWA 1DPOA 1DSUA 4Y8XA 3U8TH 1LPZB 2OC1A 1NPMA 3SHCH 3FANA 1LPKB 3MO6A 1GBMA 3T62A 1MBMA 3LIWA 3ZYEA 5K7RA 2FWWA 3HK6B 1PFXC 3ATKA 4GVUA 2PR3A 1QFKH 1YM0A 5I25A 1CHOG 1YC0A 1AWFH 1BBRK 3MFJA 1O2RA 2BMGB 3M7QA 2XWAA 4WMDA 1MKWK 2L6OA 4FVBA 3F0OA 1O2KA 3U8OH 1GJ9B 3SW2B 4ABEA 4BTUB 3OEHD 1GMCG 1EJAA 5FPYA 1Z8JB 1C2IA 2AMPA 3A8DA 4HTCH 3AW1A 1P2OA 1HNEE 1VGCC 5DG6A 3SGQE 1CU1A 5EOKA 3URDA 1H9LB 2BXUH 1Z7KA 4Y8ZA 1HB0B 2ZI2H 4KTSA 2W7UA 3SU1A 1UTPA 1O3FA 1YPEH 4MLFB 5F8TA 2PTNA 2O8WA 1EZSC 2JIZD 1E35B 1LKBA 1O3IA 8LPRA 4WWYA 1XUJA 2FI4E 3RDZA 4CH8B 2FESH 2FMJA 1MTUA 1T31A 1ZYOA 1Y5BT 3SJIA 6GCHF 4Y10E 3PLPA 2O8LA 4E7NA 1F5RA 1DT2A 1IQKA 1E37B 1K1JA 1BRCE 1QA0A 4ASHA 2BLVA 2BLWA 2VVCA 5E8EH 3KNXA 1GL0E 1K22H 2GGVB 2PKSB 1DUEA 1KXBA 4IBLH 4A1VA 2V3OH 2WV4A 3LT3A 2UWOA 3W95A 4Y76A 2HWLB 4UDWH 3VB4A 1KY9A 1P3CA 2Z9IA 2AHME 2XXLA 2ZG0H 4OS6A 1O39A 3TGJE 1F0UA 1QL8A 5KGOA 1W12U 2ZO3H 5I46H 2AYWA 1NRNH 1FPCH 2KCPA 2QGRA 1JOUB 2RDLA 1DXWA 1O2NA 1GJ5H 2RFKC 1BT7A 1BHXB 3TK5A 1QBNA 5A0AE 1IOEA 1KXAA 1ZPBA 3LGYA 7LPRA 3F0PA 1ZTJA 1GCTB 3M35A 1MCTA 3M5LA 3SNAA 5EJZA 1VITH 2UWPA 5FPSA 2JETB 2BY8X 1BJVA 1UCYH 3A7WA 4ZCNA 4HI3A 1EPTA 3ZZ9A 3V12A 1W7GH 2V35A 2XBYA 5CHBA 3SUDA 1O3MA 4CR5A 1SGIB 1C2MA 1PPZA 3SV6A 1YPJH 3M3VA 1W3CA 3GY6A 1VITF 1AB9C 1OWIA 1Z1JA 4U32A 2ZU2A 3TIUA 1LVBA 2PW8H 4X1PU 4Y7BA 3U1IB 1LQEA 3LGIA 3GOVB 1C4V2 5AFZH 2Y6TA 5PTPA 4DG4A 2XYAA 2GMTC 2STAE 2AERH 1SHYA 4KTCA 2QYIA 4CRCA 1FY4A 1OYQA 3I29A 1UCYK 5TCCA 1KXEA 1WYKA 1EB2A 2L74A 1TALA 5JB9S 2ZPSA 1K0HA 1LHFH 1NFXA 2ZDLA 1RD3B 4B71A 1O33A 2HLCA 1HJAC 1HV7A 2QXGA 1NRQH 3BTDE 1UHBA 1VGCB 3TGIE 1O2VA 2FO9A 1INCA 1L4ZA 2YNAA 1CBWC 2ZP0H 3PV4A 1C5OH 2STBE 3O8CA 5ABWA 2C8ZB 1RTLA 1S5SA 2BDAA 2FODA 4X2YA 2ZC9H 3BIUH 1AD8H 1AFEH 3RMMH 5LGOA 4XBBA 2HVYB 1QB6A 4H6SB 1C2HA 3NZIA 2P3UB 2IJOB 6CHAC 1HLTH 1G32B 1TGTA 3TLOA 1TPPA 1Y3YA 5DP9A 4HZHA 1A46H 1P2KA 1ANBA 3A82A 4OGYA 3VPKA 1OSSA 2J92A 4JMYA 1O36A 2BOHB 1HUTH 3STIA 2GV6A 1ABJH 2OK5A 1O5AB 3L33A 4Y79A 1YY3A 1W0KD 3VGCC 4K8BA 1TA6A 2GCHG 3RP2A 4ABBA 1EQ9A 3ZVGA 3OX7U 5EQRA 1FIWA 1QA7A 1D3TB 1H9HE 1O2PA 4LOYH 1BTXA 3SO3A 3LH1A 2GP9B 3IITA 3MU5A 1NU7B 5C17A 4H42U 4GPGA 1E1QD 3LPRA 3K9XB 4R8TB 1K1OA 1UO6A 5HM9A 3D62A 3PM3A 1QBOA 3QZQA 1DOJA 1BMMH 2FLRH 3DA9B 3ODDA 2OUAA 3O8RA 1Q2WA 2SGEE 3RXSA 4NWLA 3A86A 3RMLH 3F2HA 3GDVA 3TK9A 5LPFA 1NO9H 2P95A 2XNIA 1MH0A 2H5CA 1Z8IB 2PFEA 1AE8H 1P0SH 1ESBA 4X8SH 3SOSA 2AS9A 1SOZA 4AORA 4OS5A 4ABHA 1DSTA 3RM0H 3TPIZ 2UWLA 1C1UH 1A7SA 3UY9A 4GCHG 3SYJA 1WUNH 4F49A 3SUEA 1GDNA 1IHSH 2ANYA 5HKKD 3QDZB 2Z9LA 2D2DA 3RXMA 2TGTA 4ACAA 1V6DA 2VU8E 3EA7A 1F2SE 3AAVA 1CBWB 1FZZA 2ODPA 4MPXA 1HJ8A 1O5CB 3SN8A 3MU4A 4IMQA 2C90B 5FCRA 5GJ4B 1NFUA 3PRDA 2P59A 2J2UA 5J4SA 2IJD1 1P04A 5HXFA 3H7OA 5F8XA 2M2AA 1HRTH 1HXFH 2IPHA 6CHAB 3A8CA 4YXWD 2GDEH 3ZVAA 4Z1MD 5DO4H 2ZNKH 1GJ4H 4UD9H 4WJG2 2ANWA 5E0HA 2K0QA 3LOXA 1BMFD 1CGHA 2CMYA 1FY5A 1GBDA 5DK1A 4I8LA 1MTVA 4TT3D 1RIWB 1V2LT 3PRBA 2XWBI 1C1WH 3SQHE 1KLJH 3UOPA 1TIOA 2A32A 1AHTH 3VB5A 1FY1A 2FTLE 1GBBA 3SV8A 3RXFA 8GCHF 1K1PA 2ZGXH 3PV5A 3SORA 2Y7XA 1K1IA 5ETXA 4AGJA 3VGCB 2RA3A 3B8JA 3RLWH 5JBTA 4I8GA 2BY7X 3MQKC 2A4OA 1SGFG 2O8MA 5GIBA 1IQMA 2F9BH 5DP4A 1LHDH 3AVZA 5HMAA 4FUHA 1EXFA 1A5HA 2CJIA 4E7RG 2J9NA 2V0BA 3PLBA 3T29A 4U01A 1W0JD 1AZZA 5FXLA 1NTPA 1T8MA 4ISLA 4FU7A 2B9LA 1CA8B 3A7YA 2YOLA 1ZPZA 1W13U 3IG6B 3SU3A 2G52A 1HAIH 2A1DB 3P17H 3RXAA 1DY9A 2EY4C 1TMTH 3ZZ8A 1OWHA 1TNHA 1GHZA 4D9RA 2AGIX 1W10U 1T32A 1THPB 4DY7B 4F4OC 3TVJB 1O3OA 1SSXA 1YPHE 1GI3A 2A4GA 4YTAA 2KX4A 1K21H 2EA3A 4MPUA 2FOGA 2OD3B 2XBWA 1SGFA 2OBQA 1MKXK 5ESTE 2BLQA 2JDID 1ETRH 3SJOA 1WXRA 2FOHA 4K5ZA 1GHBF 4Q7ZA 4SGAE 4AB8A 1FN6A 4FUEA 4ZROA 1G37A 2Z9GA 3SGBE 4AFQA 1KLTA 1YKTA 2ZHWH 3MTYA 4X2VA 2C3SA 4TPIZ 4XBCA 5G4BA 5CHAC 3RXBA 1TONA 1FUJA 3GDSA 1TPSA 2PWXA 1SLWB 2ZCHP 2XBXA 2UUYA 4NIWA 1LMWB 4DURA 1TAWA 2XC4A 4NIVA 2ZTZA 1UVTH 2VIOA 3RXJA 2OC0A 1BBRE 1TQ0B 1QL9A 2NU2E 2PSXA 1HFDA 4IC5A 5K0HA 1W2KH 1NN6A 3PMJA 5BPEA 3QZRA 4AOQA 2G4UA 3BTWE 1GG6C 1RFNA 1AKSB 4DOQA 1VR1H 2BD3A 1ZHMA 5ESBA 2ANMH 1NFWA 3CS0A 1PQ7A 2P3TB 4KP0A 2J5UA 3UREA 4AFUA 2W6JD 5T3HA 2Y5GA 4AFSA 4KKDA 1SLXB 4NWKA 1Z8GA 2AIQA 1YLNA 2BVXH 1L1JA 2FOCA 3BTME 2ZFQH 1P2QA 1WAYB 4WH6A 4BTIB 3F68H 1HAHH 4Q2KA 3RXUA 3N7EA 1S0RA 2Y82A 3VB6A 1QRWA 1WOFA 2SGAA 3ZV9A 2SFAA 3GISB 3TK6A 1OWJA 3MH5A 5DP7A 5SGAE 2JH5D 4UFGH 4O9VA 1D4PB 1A5GH 3TITA 3EA8A 2WUCA 5EW2H 1HBTH 2PP6A 2R3YA 2GJGA 1ESAA 2ZECA 2VIQA 3M61U 1P06A 4SGBE 3AW0A 1LVMA 1O2QA 5GWZA 1J17T 3BTTE 1ZLRA 1GBTA 2ZEBA 4XSKU 1TMBH 3S0NA 1V2QT 2JKHA 4K60A 2IOTA 2ZKSA 1NFYA 1S85A 1GWAA 1GI5A 2BQ6B 3OFND 1HAGE 2FEQH 1UTJA 3TNTA 3HATH 4B6FA 1F92A 2XNDD 1A3BH 2SGDE 2O9QA 1HAZB 4B2CA 1GCDA 2FI3E 1QB9A 1C5XB 4WVPE 2OXSA 1E34B 4XE4A 2QXJA 1V3XA 4X6NA 1AU8A 1CO7E 5A09A 3URCA 4RN6A 1VKYA 3U1JB 3PMHB 1ZRBA 4CH2B 1TQ7B 5EPNA 1EOJA 2OTVA 4MPVA 3SGAE 1SGRE 2Z3DA 4K8YA 4IW4E 2GT8A 2YMSD 5A2MH 3A87A 3MHWU 4JYVH 3U28C 3DUXH 2VIWA 2ZTYA 3V7TA 1D6WA 1QY6A 1C1NA 3T2NA 1QJ1B 3N99A 5GDSH 2NU0E 1DITH 4H4FA 1ELGA 5GCHF 5CMXH 1P9UA 4BOHA 3TGKE 1MBQA 1W8BH 4JYUH 2BYAX 5JPMH 1JMOH 2J98B 4O03A 1C4U2 1GG6B 1P02A 3PTBA 4OGXA 3UNQA 4D76A 2CF9H 2XRCA 1L4DA 3A83A 2LNCA 2RG3A 1LHCH 1F0SA 4MNWA 2H5DA 5DGJA 3ZVBA 2C8XB 3H7TA 3L6PA 1OHHD 1BB0B 2LELA 1OWDA 4TY7A 2V7QD 4Q4LA 1O2TA 1O3LA 3BEFB 1EZUC 1DVAH 2JETC 3HGNA 2VINA 4FUDA 1TNLA 3K65B 2VWNA 1EJMA 3PWBA 3B9FH 3PROA 1SL3A 3MH6A 2J97A 2FX4A 4RSPA 5DSFA 2FOEA 1Y3VA 1A2CH 5EU8A 3NK8A 1UTQA 2GDDA 2ZA5A 4ZUHA 3RXEA 3RXHA 4DW2U 1CHGA 2HPPH 2HNTE 3S9CA 3KYFA 1FY8E 5E0JA 3WWFA 3C27B 1QURH 1MTSA 4ZH8A 1V2NT 3AASA 2RCEA 3M7TA 3Q76A 2OINA 5HIZA 1C5LH 1SGQE 5E0GA 5T6DA 1DM4B 1Q31A 1AVWA 1CHOF 2ODYB 3E91A 1C2KA 1EASA 1VCPA 2VIPA 4DIHH 4B73A 2QIQA 1ELAA 5DJ7A 1TRNA 2GZ8A 3CNRA 2BB4A 1C4Y2 1GBAA 1ARBA 1JWTA 1SBWA 3ZZ4A 1NRRH 1UTNA 3KQBA 3B23B 1V2PT 4TPYA 1S6HA 1A4WH 4NFFA 3A7XA 2OQ5A 3RC4A 2W5EA 1EAUA 3KIDU 5IK2D 4MQAA 3UR9A 6GCHG 1C1VH 1ORFA 2ZTXA 1RTKA 3RXDA 4BNRA 1NROH 2GT7A 1C5WB 1M9UA 3M37A 2KR7A 4FUCA 3MO3A 3FP8E 4JZEH 1C2DA 1C5RA 5C1YA 1HAVA 3OTPA 5GXPA 1TNIA 3S9AA 2BVRH 1RTFB 2W3IA 3BSQA 3GY8A 2BDBA 1C1TA 2UUJB 3V0XA 1P2MA 3RMOH 5C0TA 4AG2A 3LC3A 2C4FH 3BG4C 1O35A 1KXDA 4LZ1H 2PSYA 2CXVA 1UVSH 2ZCLP 3ZZ6A 2BDGA 1HGTH 1AKSA 1TBZH 1G2MA 2XBVA 3P70B 3RXGA 1K1MA 2WYJA 4CBNA 3ATLA 4ABFA 1GJ8B 1CT4E 1TX7A 4K1SA 1TNKA 4I31A 2ZGHA 5E2OA 4TYDA 1KXCA 1AZ8A 3VG8A 5IDKA 4NA9H 4XFQA 2ZDMA 1OOKB 4VGCC 3U8RH 4A1XA 4AN7A 1Y3WA 5H4IB 3H5CB 5TCAA 1O3HA 4B2AA 2PGBB 5JBAS 4K1EA 1TFXA 3QUMP 1C1SA 5LPRA 2BDHA 1SQTA 3MU1A 1GJ6A 4NIXA 3MI4A 1TOCB 2JH0D 2Q6DA 1PPCE 4NG9H 1ANDA 1AUTC 4IGDA 1OYTH 1ELVA 4O3TA 2ZU4A 1TOMH 2Z7FE 3ZVCA 1Z8RA 1Y5AT 2ZDVH 3DT0H 1S83A 1ZMLA 1XUKA 2SNWA 4Q7XA 1IAUA 1L2EA 2BD2A 2W26A 1DDJA 4FUGA 4FUFA 4Z6AH 4NSYA 4TWWA 3RMNH 1BTPA 3CENA 1A0HB 3SNBA 3GCTG 3E0PB 1UTLM 1BMAA 1XUGA 3LGVA 3GY7A 1PPFE 1QB1A 4FETA 1WQVH 2F9VA 1TX6A 5JB8S 4DIIH 1OX1A 1O5DH 2J95A 4YESB 3Q77A 2VWOA 4JK5A 3ESTA 1MQ6A 1BTWA 2VJ1A 1ZHPA 1SLVB 2FM2A 2A5KA 1PYTD 3ENSB 1H8DH 1BQYA 1Z71A 2FI5E 7GCHG 5A0BA 1QNJA 1MAXA 1W11U 5EG4A 1J9CH 1ID5H 2SNVA 1W0ZU 2QF4A 4OS1A 3U9AH 1BTUA 2CGAA 3Q3KA 2WPJS 3QX5H 1V2RT 2OBOA 4QT8C 1RIWC 4ABIA 3PV2A 4ISIH 5B6OA 5T1VA 2R9PA 1P01A 3KQCA 1GHAG 2J4IA 6ESTA 2Y80A 1G2LA 4CR9A 2RA0A 3BG4B 3KQ5A 3UQOA 4E06H 3RXIA 4UFEH 3T5FH 2BZAA 1MU6B 1CGJE 3SU4A 3F2FA 3SNEA 5T6FA 5CDFE 2TPIZ 2TRMA 1TLDA 1YPHC 2J98A 5FBEA 1BTHH 4THNH 1NS3A 5DP3A 2BM2A 1HAXB 1C5NH 1E79D 1AY6H 1O2MA 2CK3D 2Z9KA 2FOMB 3SBKA 1IQJA 3D49H 2BDYA 1TMUH 1C1PA 2QF0A 5AVDA 2H2ZA 2G00A 1MTNC 2C8YB 2FP7B 1F7ZA 1GI0A 2ODQA 2GCHF 4TSFD 4YZUA 2EC9H 3ZV8A 2ZFTA 1LQDB 3PYHA 1Z1IA 4VGCB 1C9TA 4XBDA 1RXPA 3ZZ3A 1G36A 1NC6A 2WHXA 1SLUB 1SC8U 7KMEH 1O3GA 1N6XA 3EQ0H 1J14A 4E05H 3DFLA 3F9GA 1FNIA 3OTJE 1T8OA 5AHGH 4X6PA 1DUAA 1FONA 1BZXE 3A7ZA 3AK5A 2KM0A 3S7HB 3E8LA 2BD7A 2BXTH 4IN2A 4B1TA 1O2YA 3MU0A 1ZGIA 1O30A 1MZAA 1QRXA 5C67A 2G5NA 3E6PH 1EB1H 3BTHE 1E36B 4CRDA 1RRKA 2BY5X 3OEED 3BEUA 1LHGH 3N7DA 1BMLA 1P9SA 3UNSA 1N8OC 4BAKB 1ZJDA 1P8VC 2KCYA 1IQGA 1A0JA 3GY2A 1K2I1 3V3MA 1V2OT 4GHTA 2O8UA 1T8NA 4IS5A 1QR3E 3T26A 3O8DA 1SGEE 1O3AA 3LH3A 2QXIA 4AFZA 2LPRA 1AVGH 2G55A 3F9HA 1EAIA 1ZOMA 1RGQA 1ESTA 4HG6A 1C9PA 4AYVB 1ELDE 1UW7A 2FDAA 3ELAH 3KF2A 4Z0KA 2PTCE 3KCGH 2FOFA 2ZDAH 3EE0B 2GCTC 1CVWH 1SFIA 4XOJA 1BHXF 1FLEE 1GJ7B 2P3FH 2F91A 2XC5A 5A8YA 4NIYA 3RXVA 1GBEA 4XRNA 4X0WU 3LONA 3SU6A 2ZZUH 3BTQE 3SJ9A 2F9NA 3DSGA 3TH3H 3GCNA 4JK6A 4AGKA 1FY3A 2BHGA 1XXDA 4K69A 3BIVH 1Z6JH 1FMGA 2PKAB 2ZPRA 4U30A 2ZQ1A 4X2XA 2OQUA 3N7OA 1G30B 5EPYA 4DT4A 3RUOA 4ZKRU 3FVFB 1MTNB 5EXNA 1NZQH 1C1QA 1RS0A 3EGKH 1DICA 1C2LA 1BIOA 7ESTE 1FIZA 1ZGVA 2YMSB 1G3EA 1W0YH 3PO1B 2SGQE 2H1UA 2HRVA 1YCPM 4AC9A 3RXRA 1YCPH 2HLDD 4FUJA 1P09A 4H6TA 3ITIA 1N6YA 1XKBC 1XKAC 1IQIA 2OC7A 3A85A 5F53A 4ABDA 2GD4B 2P94A 2AMDA 4J2YB 2A7CA 4MNXA 4UE7H 1Q3XA 2WINI 1MMJN 2BX3A 4WF8A 2QY0B 1O2ZA 1QTFA 3AAUA 2ZWLH 2QF3A 3UR6A 3M7UA 4MNVA 1H9IE 1ZRKA 3BG8A 1SGTA 1GHBG 4YOJA 1MCVA 1P2JA 1D3QB 1YCPK 1MD7A 3SU2A 2HALA 1F0RA 1FPHH 1GMDG 3OY5U 1N8OB 2V3MA 2G8TA 3UB0A 1VJ9U 4YOIA 2TGPZ 2YNBA 3MMGA 1JRSA 1V2TT 1P05A 3TH4H 1HAVB 3A89A 1SGNE 3ODFA 3S9BA 4Y0YE 1AO5A 5DPAA 2BD9A 2FS9A 1YPKH 1PPBH 3LJJA 4I7YH 1J16A 3W94A 1NRPH 1ETTH 4I8HA 4F55A 4X1QU 1GI7B 4I33A 3BN9A 2EI8A 5DKMA 4ISNA 3SV2H 2GCTB 5GNDA 4NFEA 1UK2A 1H8HD 4UFFH 3DCLA 3OY6U 1BRUP 1EFRD 4YT6H 1DWDH 3SI3H 2HNTC 1SR5C 2QAAA 3FKSD 4ZXYH 2GVFA 1O5EH 1XUHA 3JZ2B 3E16B 1LCYA 3H09A 4I8KA 2NU1E 1T8LA 3BTEE 3LU9B 2AGEX 1E38B 4FUIA 1QL7A 3GY4A 1QIXB 1QZ8A 1IQNA 3I77A 1SGCA 2TGDA 2VIDA 1UVPA 2BOKA 1C5SA 4X1SU 3UAIC 2A7JA 2BZ6H 4JZFH 4OM9A 1YPLH 5BRRE 1S6LA 1GBCA 1XX9A 4K2YA 2A5IA 2VNTA 4BXSA 1PYTC 4BXWA 4NSVA 4NCYA 1EUFA 5HGGA 2ZGBH 4BANB 1S6FA 1YPGH 3QO6A 1O2OA 2KCOA 3VXFH 1RJXB 3TNSA 4GUXA 5DP5A 4UFDH 5FL7D 2P8OC 1OWEA 3TJUA 2F9PA 3GS9A 3SZEA 3A8BA 3A80A 1HPGA 1V2KT 2NU3E 1VZQH 1SMFE 1L1GA 3A84A 2OLGA 1TE0A 1BA8B 1P03A 1O2IA 3ZZ7A 1FV9A 2CHAC 4JYTA 3NUMA 3NPSA 2XTTB 2HPQH 2ZHDA 1GJBB 1QQ4A 1PQAA 4ZKNU 3E1XB 2NU4E 1DWCH 3DSPA 3FP6E 4IN1A 2ZU1A 4YT7H 2Z94A 1O2JA 1NBME 1MABB 5EQQA 3F9FA 1O3JA 4AG1A 2ZFSA 2PUXB 2GTBA 5EQSA 1ZZZA 3GYLB 3KQDA 4J1YA 1ZR0A 3WY8A 3S69A 1EATA 2ZFPH 1KDQB 3KQEA 5CE1A 3QTVH 1O2GH 6LPRA 3SU0A 1O3KA 4B6EA 2VVVA 2P16A 8ESTE 1H1BA 4ZKSU 8KME2 1C5TA 1WV7H 1HAYB 1HAPH 1AIXH 2VB0A 3EA9A 1SKYE 1CSOE 4NA7A 3SHAH 2KAIB 1UCYE 1UK4A 3S7KB 3R0FA 1C5QA 1GJDB 5EODA 2Q6GA 1P2NA 2BVSH 1O5GH 1P57B 2Z9JA 4CRFA 1V2VT 4YLUA 1O31A 2Z3CA 3E3TA 4A6LA 2D8WA 4MDSA 4BAQB 3GY5A 3KYGA 3GICB 1DXPA 4DCDA 5DP6A 5L2YH 4WXVA 1PPGE 1LVOA 2IN2A 1UVUH 1O32A 1AVXA 1GI2A 1UMAH 1ZPCA 2BD4A 3M5OA 1DX5M 2B8OH 1X7AC 1GHVH 2EEKA 3E0NB 3O8BA 4INHA 1BTYA 3K6ZA 2PKAA 3PWCA 3QGNB 1S81A 1GDQA 1Y3XA 2J38A 3W1EA 1AGJA 1C2JA 1GMHF 4ZMAH 2VH6A 3UQVA 1SVPA 2R2MB 1XUIA 4WH8A 1O5BB 5KEDA 1BBRH 1CT0E 2FIRH 1DS2E 2A4QA 2AMQA 1CGIE 2AFQB 1C2EA 1COWD 5C0UA 3Q3XA 1HXEH 2OP9A 3R3GB 1K1NA 1D9IA 3GCHC 2ALVA 1V2ST 2BQWB 2EI7A 1TX8A 4DT7B 4B74A 1AN1E 3M3TA 4MNYA 4X8TH 3LC5A 2P8OB 5FX6A 2ZFFH 4ABJA 2K8IA 3TU7H 1IQHA 1THSH 1CQQA 4AB9A 3VXEH 2F3CE 3PLKA 2WYGA 2AEIH 1LDTT 3NWUA 5C94A 3U98H 1FQ3A 2CHAB 2AGGX 2ZHQH 2QF5A 2THFB 2BY6X 2RDEA 1CE5A 3FN8A 4RKOB 2WV5A 2F43B 4M7GA 3SI4H 2A2QH 1WCZA 1GMCF 1GVLA 1UTMA 2DE9A 3WW7A 1GVKB 4X1RU 1DWBH 1TBQH 1PJPA 1UJ1A 2BQ7B 4X8VH 3T27A 2ZHFH 3UIRA 3CP7A 4LZ4B 1WDIA 3SJ8A 1BRAA 4MG3A 1MAYA 2PV9B 1YGCH 1A0LA 4X6MA 1GHXH 5HM2A 1SHHB 1NBMD 4B76A 1ZMNA 1OP8A 3A7TA 3ZYDA 2F9UA 1SGYE 3T28A 1O38A 3GYMA 2BDIA 1QJ6B 2WSSD 4NA8A 4R0IA 2FYQA 5FHTA 2W7SA 4XDEA 3DHKH 4I86A 4OS4A 5FCKA 1GL1A 3RXPA 1LKAA 3FP7E 5T6GA 1EKBB 3HKJB 2F83A 1NESE 2A4RA 1IQEA 1GGDC 3M5NA 2BDCA 2FLBH 1LHEH 1E0FD 3I78A 3P8OA 3A81A 4GAWA 3VEQB 1P11E 1W14U 2CN0H 2WPHS 3EDXB 3RXOA 4BAOB 3QK1A 1P2IA 1NRSH 3F1SB 5HIYA 1C5VA 5A0CA 1NM6A 3LJOA 4WMEA 3L3TA 4AYYB 4CHAC 2FYRA 2Y7ZA 3KHVA 1KXFA 1C5YB 1P3EA 1MUEB 2GZ9A 1O3EA 3PB1E 4Q63A 3SZNA 3ZVEA 1C5MD 2FOAA 1TNGA 3RXLA 3TJVA 3GY3A 1VITG 1TPAE 4YLQH 4CREA 1AE5A 3U69H 3Q3YA 2A7HA 2VH0A 2PUQH 1OWKA 2ANKH 3P6ZB 1VCQA 4RT1A 3GCHB 1SG8B 5A8ZA 2G81E 1ANEA 2UUFB 1ELEE 1TGNA 3BF6H 1EOLA 1FAXA 1P12E 2TIOA 5HYOA 2EI6A 1Y3UA 4UONA 4Y6DA 3V13A 2ULLA 1WTHD 4ACBA 2OCVB 1GJAB 2R0LA 2R2WU 4BAHB 1MTWA 5F03A 4B2BA 1O2SA 3SNDA 2Q6FA 1AQ7A 2KFWA 2ZHEH 5L2ZH 2IPQX 3C1KA 3ZIAD 2ASUB 4M9FA 1PQ8A 1OKXA 4CBOA 1ZTLA 1H8IH 1FX0B 2ZF0H 2A0QB 1TA2A 2FS8A 2QCYA 1B0FA 4D9QA 2H6MA 2ZIQH 3JZ1B 1G9IE 3FZDA 1Y5UT 3UUZA 5FX5A 2QXHA 3GCTF 3VB3A 1G3BA 3KGPA 5EJLA 1JBUH 2BTCE 5FPTA 4A7IB 2ILNA 3STJA 1UTKA 1DLKB 2XW9A 3NXPA 1CA0C 1ARCA 3ZZCA 4ZKOU 2HNTF 4O97A 1KDQA 3RM2H 3UPEA 2H9EH 3OU0A 3CS7A 5L6NH 4CRAA 1YWUA 2QE7D 2JJ1D 1TB6H 4FVDA 1GJCB 3ATWA 3QN7A 1V2MT 1ANCA 1BDAA 7GCHF 2Y81A 1GBJA 2AIPA 1KLIH 1PQ5A 2WPMS 1FI8A 1HAOH 4MTBA 3Q00A 1OS8A 1TWXB 2WPLS 1GGDB 5C20A 1F5LA 1Y59T 5JYIA 1GI8B 1PPEE 1AFQC 2GKVE 2WPKS 1BOQA 2KAIA 2I6SA 1B7XB 2XCFA 2PHBA 3NKKA 2B5TB 5J4QA 1GI6A 2BX4A 2OC8A 3ZZ5A 1N1LA 1GDUA 3MH4A 4X1NU 1ZSLA 1GHAF 1SQOA 1JXPA 1QRZA 2FXRA 4CHAB 2Z3EA 2M5TA 1WTGH 5DN6D 1SFQB 1BCUH 1ELFA 1HIAB 3ZVFA 1BTZA 1K28D 3HK3B 4RT0A 2GZ7A 1HYLA 3LGUA 1IQFA 2A2XH 3OSYA 4ISHH 4X2WA 2QA9E 1T7CA 2ALPA 2YMSC 3MO9A 3PO1C 1LPGB 5AF9H 3FOAA 2JJ2D 1O0DH 3QTOH 2BD8A 1D6RA 2R3UA 1MZDA 1GPZA 1KTTB 1MU8B 1SGPE 1AB9B 2G51A 3DD2H 4JZIA 2Y5HA 1WU1A 1GI4A 5TJXA 1XVMA 1OP2A 1T4UH 2GX4A 5JBBS 4X8UH 2CV3A 3VB7A 1OPHB 2GMTB 1EAWA 1EAXA 2W3KA 2ZDKA 4ABAA 1O2LA 1GBHA 3TJNA 1XUFA 4IMZA 1O34A 1TABE 1LTOA 1QJ7B 1BITA 2V6NA 3GDUA 4MVNA 4GCHF 1E1RD 3F6UH 2LP6A 5C5NA 4LK4A 1P10A 4KGAA 1JRTA 4F48B 1HJAB 3MYWA 1O5FH 3E90B 1L1NA 2HOBA 2BD5A 1IHTH 2FPZA 1FXYA 3MOCA 1QQUA 3K6YA 4PROA 1NT1A 4RI0A 3RC5A 1V2UT 3A88A 1GHWH 4K3JA 1O2WA 2A31A 2WV9A 1CA0B 3BV9B 1F5KU 2WUBA 1GBKA 4U2WA 3RC6A 2A45B 3KN2A 4TY6A 3DSOA 4P02A 1C5PA 2GV7A 3EAJA 4Y11E 4CRBA 2ZU5A 4ZHAA 4ESTE 3OYPA 3KL6A 1FN8A 4D7GA 4WMFA 1O2HA 8GCHG 1J15A 3HKIB 1DLEA 3SNCA 2QC2A 1C2FA 3ATIA 3F2GA 3PMBB 1XVOA 4BTTB 1L0ZA 1GVZA 2WPDD 3P8FA 1ACBE 1AI8H 1O3DA 3UNRA 1AFQB 1O3BA 2BLOA 1DY8A 2D26C 3IWMA 1SB1H 1AMHA 3A7VA 9LPRA 2ZCKP 1SPJA 4HFPB 4ASUD 1HCGA 3RXTA 2C93B 1ABIH 5IYTA 1YPMH 2ZDNA 4HGCA 3ZZDA 2FOBA 1DE7H 2FZZA 5LH8A 1GBFA 5F8ZA 1MQ5A 2VVUA 4XD7D 4IC6A 4ISOA 1UTOA 3P8NA 2FX6A 2G4TA 4NGAH 3LDXH 4YOGA 1V2JT 1EPTC 4Y7AA 1A5IA 5A8XA 3G01A 1H4WA 2W6ID 1FDPA 4DGJA 1QBVH 1A3EH 5KECA 1Z6EA 1SGDE 3SUGA 1SQAA 2JH6D 2VWLA 2TBSA 2ZFRH 3MNCA 4Q7YA 3OAAD 1EZQA 2SGFE 1GBLA 2K1QA 1C1OA 2Q1JA 3LKWA 3P8GA 4GLYA 1A61H 4JZDH 1BUIA 1MKXH 1OP0A 1TRYA 1ZMJA 1TBRH 5F6MA 1J8AA 5C1XA 1TYNA 2UUKB 4RKJB 1EX3A 3TJOA 1QHRB 4AX9H 1D3PB 1GBIA 3RXKA 1G3DA 1FAKH 4B75A 2Z6BD 1TGCA 1F0TA 2PGQB 4FOUC 2DE8A 4KTUA 3UWJH 3SV9A 1XM1A 2I6QA 1YP9A 2CF8H 2J34A 1MD8A 4I8JA 1SI5H 3GCOA 4CRGA 1WQSA 2O8TA 3FZZA 1EZXC 2KZ4A 4DVAU 4UEHH 1YLCA 1K9OE 1S84A 1Y8TA 2F9OA 1O2XA 3M5MA 3SU5A 1EJNA 3F9EA
chains in the Genus database with same CATH topology
3MH7A 3PMAB 3MU8A 3UTUH 2VWMA 1C2GA 3ZZBA 1ZTKA 3RXCA 1WSSH 4LXBH 2DUCA 3QGJA 1LO6A 5JBCS 1YF4A 1KIGH 4D7FA 5L30H 5JDUB 2FTMA 2PLXA 3D23A 5FAHA 1HDTH 1GMDF 5EGMA 4NZQA 3QLPH 3HPTB 1AUJA 4ZAEA 3RU4E 5C1UA 4ZHLU 1O2UA 1OXGA 1UK3A 4MPWA 4GHQA 2ZGCA 4WY3A 2HGTH 4K1TA 3SJKA 4FUBA 1TNJA 1ZSJA 3ATMA 1XMNB 4Q80A 1ELTA 3FFGA 1T4VH 3KEEA 4JCNA 1ZSKA 1O3NA 2R0KA 1B5GH 1QGFA 2J94A 1TRMA 5E2PA 4Y71A 2HVXA 4X6OA 2VGCC 3BTKE 5C2ZA 4DJZB 1S82A 1AWHB 1K1LA 3BTFE 3P95A 1ELCA 5DP8A 2AH4X 3FAOA 2ZQ2A 3M36A 1C1RA 3BEIB 3MNXA 4O3UA 1TGBA 3UWIA 1JIRA 1BMNH 1TGSZ 1QCPA 3A8AA 3D65E 1EPTB 2NWNA 1DFPA 3VFEA 2H9TH 1HIAA 3MWIU 3P92A 4KELA 1TPOA 1ELBA 1KSNA 5EXMA 2G5VA 3K2UA 3ZVDA 1O37A 5EXLA 1O3CA 2V3HH 4Y0ZE 1DWEH 3RLYH 1S0QA 3UFAA 1VJAU 2SGPE 3DFJA 4FU9A 3SV7A 5C3NA 1GHYH 2QV1A 1CT2E 1IQLA 1NU9A 4ZHMU 4AZ2B 4OS7A 3SQEE 1ETSH 1UHBB 1KTSB 5GPIB 1C5UA 2QN5T 4INLA 2ZGJA 1D3DB 1FJSA 1YYY1 3SUFA 4WXIA 2D1JA 4YO9A 1JIMA 1YLDA 3T25A 3ZZAA 2ZU3A 2TGAA 1W7XH 1SOTA 4JZ1A 1UVOA 1ZHRA 1KYNA 1PPHE 4YM9A 4Y8YA 2B0FA 1WBGB 4ABGA 1HJ9A 3UOUA 4INKA 3M3SA 1U6QA 1C1MA 1ZJKA 3BTGE 3PTNA 3MNBA 1NY22 2ZPQA 4NZLA 5EW1H 5GCHG 2B7DH 1GI9B 3NCLA 4GSOA 3RXQA 5CHAB 1BJUA 4A1TA 2BY9X 3RU4D 3EYDA 2ESTE 2A5AA 9ESTA 5LPEA 2PKSC 1A1RA 1BRBE 3TH2H 2XCNA 3QWCH 3MNSA 5AFYH 2H9HA 1B0EA 2VGCB 1XXFA 1GI1A 1EP6A 4OS2A 5C5OA 1YBWA 4I32A 4FU8A 4D8NA 1O3PB 4ZXXH 1DANH 4BAMB 1EP5A 1V2WT 1GMHG 1THRH 4TWYA 2P93A 1C5ZB 3HGPA 1G3CA 3RU4T 4FXGH 2WPIS 5FBIA 4A5TS 1VCWA 4A92A 1GCTC 2C8WB 1MKWH 2VIVA 1LVYA 3LGTA 2XC0A 2Y5FA 3LGWA 1DPOA 1DSUA 4Y8XA 3U8TH 1LPZB 2OC1A 1NPMA 3SHCH 3FANA 1LPKB 3MO6A 1GBMA 3T62A 1MBMA 3LIWA 3ZYEA 5K7RA 2FWWA 3HK6B 1PFXC 3ATKA 4GVUA 2PR3A 1QFKH 1YM0A 5I25A 1CHOG 1YC0A 1AWFH 1BBRK 3MFJA 1O2RA 2BMGB 3M7QA 2XWAA 4WMDA 1MKWK 4FVBA 3U8OH 1O2KA 1GJ9B 3SW2B 4ABEA 4BTUB 1GMCG 1EJAA 5FPYA 1Z8JB 1C2IA 2AMPA 3A8DA 4HTCH 3AW1A 1P2OA 1HNEE 1VGCC 5DG6A 3SGQE 1CU1A 5EOKA 3URDA 1H9LB 2BXUH 1Z7KA 4Y8ZA 1HB0B 2ZI2H 4KTSA 2W7UA 3SU1A 1UTPA 1O3FA 1YPEH 4MLFB 5F8TA 2PTNA 2O8WA 1EZSC 1E35B 1LKBA 1O3IA 8LPRA 4WWYA 1XUJA 2FI4E 3RDZA 4CH8B 2FESH 2FMJA 1MTUA 1T31A 1ZYOA 1Y5BT 3SJIA 6GCHF 4Y10E 3PLPA 2O8LA 4E7NA 1F5RA 1DT2A 1IQKA 1E37B 1K1JA 1BRCE 1QA0A 4ASHA 2BLVA 2BLWA 2VVCA 5E8EH 3KNXA 1GL0E 1K22H 2GGVB 2PKSB 1DUEA 1KXBA 4IBLH 4A1VA 2V3OH 2WV4A 3LT3A 2UWOA 3W95A 4Y76A 2HWLB 4UDWH 3VB4A 1KY9A 1P3CA 2Z9IA 2XXLA 2ZG0H 4OS6A 1O39A 3TGJE 1F0UA 1QL8A 1W12U 2ZO3H 5I46H 2AYWA 1NRNH 1FPCH 2QGRA 1JOUB 2RDLA 1DXWA 1O2NA 1GJ5H 1BT7A 1BHXB 3TK5A 1QBNA 5A0AE 1IOEA 1KXAA 1ZPBA 3LGYA 7LPRA 1ZTJA 1GCTB 3M35A 1MCTA 3M5LA 3SNAA 1VITH 2UWPA 5FPSA 2JETB 2BY8X 1BJVA 1UCYH 3A7WA 4HI3A 1EPTA 3ZZ9A 3V12A 1W7GH 2V35A 2XBYA 3SUDA 1O3MA 4CR5A 1SGIB 1C2MA 1PPZA 3SV6A 1YPJH 3M3VA 1W3CA 3GY6A 1VITF 1AB9C 1OWIA 1Z1JA 4U32A 2ZU2A 3TIUA 1LVBA 2PW8H 4X1PU 4Y7BA 3U1IB 1LQEA 3LGIA 3GOVB 1C4V2 5AFZH 2Y6TA 5PTPA 4DG4A 2XYAA 2GMTC 2STAE 2AERH 1SHYA 4KTCA 2QYIA 4CRCA 1FY4A 1OYQA 3I29A 1UCYK 5TCCA 1KXEA 1WYKA 1EB2A 1TALA 5JB9S 2ZPSA 1LHFH 1NFXA 2ZDLA 1RD3B 4B71A 1O33A 2HLCA 1HJAC 1HV7A 2QXGA 1NRQH 3BTDE 1UHBA 1VGCB 3TGIE 1O2VA 2FO9A 1INCA 1L4ZA 2YNAA 1CBWC 2ZP0H 3PV4A 1C5OH 2STBE 3O8CA 5ABWA 2C8ZB 1RTLA 1S5SA 2BDAA 2FODA 4X2YA 2ZC9H 3BIUH 1AD8H 1AFEH 3RMMH 5LGOA 4XBBA 1QB6A 4H6SB 1C2HA 3NZIA 2P3UB 2IJOB 6CHAC 1HLTH 1G32B 1TGTA 3TLOA 1TPPA 1Y3YA 5DP9A 4HZHA 1A46H 1P2KA 1ANBA 3A82A 4OGYA 3VPKA 1OSSA 2J92A 4JMYA 1O36A 2BOHB 1HUTH 3STIA 2GV6A 1ABJH 1O5AB 3L33A 4Y79A 3VGCC 4K8BA 1TA6A 2GCHG 3RP2A 4ABBA 1EQ9A 3ZVGA 3OX7U 5EQRA 1FIWA 1QA7A 1D3TB 1H9HE 1O2PA 4LOYH 1BTXA 3SO3A 3LH1A 2GP9B 3IITA 3MU5A 1NU7B 4H42U 4GPGA 3LPRA 3K9XB 4R8TB 1K1OA 1UO6A 5HM9A 3D62A 3PM3A 1QBOA 3QZQA 1DOJA 1BMMH 2FLRH 3DA9B 3ODDA 2OUAA 3O8RA 1Q2WA 2SGEE 3RXSA 4NWLA 3A86A 3RMLH 3GDVA 3TK9A 5LPFA 1NO9H 2P95A 2XNIA 1MH0A 2H5CA 1Z8IB 2PFEA 1AE8H 1P0SH 1ESBA 4X8SH 3SOSA 2AS9A 1SOZA 4AORA 4OS5A 4ABHA 1DSTA 3RM0H 3TPIZ 2UWLA 1C1UH 1A7SA 3UY9A 4GCHG 1WUNH 4F49A 3SUEA 1GDNA 1IHSH 2ANYA 3QDZB 2Z9LA 2D2DA 3RXMA 2TGTA 1V6DA 2VU8E 3EA7A 1F2SE 3AAVA 1CBWB 1FZZA 2ODPA 4MPXA 1HJ8A 1O5CB 3SN8A 3MU4A 4IMQA 2C90B 5FCRA 5GJ4B 1NFUA 2P59A 2J2UA 5J4SA 1P04A 5HXFA 3H7OA 5F8XA 1HRTH 1HXFH 2IPHA 6CHAB 3A8CA 2GDEH 3ZVAA 5DO4H 2ZNKH 1GJ4H 4UD9H 4WJG2 2ANWA 5E0HA 3LOXA 1CGHA 2CMYA 1FY5A 1GBDA 5DK1A 4I8LA 1MTVA 1RIWB 1V2LT 2XWBI 1C1WH 3SQHE 1KLJH 3UOPA 1TIOA 2A32A 1AHTH 3VB5A 1FY1A 2FTLE 1GBBA 3SV8A 3RXFA 8GCHF 1K1PA 2ZGXH 3SORA 4AGJA 2Y7XA 1K1IA 5ETXA 3VGCB 2RA3A 3B8JA 3RLWH 5JBTA 4I8GA 2BY7X 2A4OA 1SGFG 2O8MA 5GIBA 1IQMA 2F9BH 5DP4A 1LHDH 3AVZA 5HMAA 4FUHA 1EXFA 1A5HA 2CJIA 4E7RG 2J9NA 2V0BA 3PLBA 3T29A 4U01A 1AZZA 5FXLA 1NTPA 1T8MA 4ISLA 4FU7A 2B9LA 1CA8B 3A7YA 2YOLA 1ZPZA 1W13U 3IG6B 3SU3A 2G52A 1HAIH 2A1DB 3P17H 3RXAA 1DY9A 1TMTH 3ZZ8A 1OWHA 1TNHA 1GHZA 4D9RA 2AGIX 1W10U 1T32A 1THPB 4DY7B 4F4OC 3TVJB 1O3OA 1SSXA 1YPHE 1GI3A 2A4GA 4YTAA 1K21H 2EA3A 4MPUA 2FOGA 2OD3B 2XBWA 1SGFA 2OBQA 1MKXK 5ESTE 2BLQA 1ETRH 3SJOA 2FOHA 4K5ZA 1GHBF 4Q7ZA 4SGAE 4AB8A 1FN6A 4FUEA 4ZROA 1G37A 2Z9GA 3SGBE 4AFQA 1KLTA 1YKTA 2ZHWH 3MTYA 4X2VA 2C3SA 4TPIZ 4XBCA 5G4BA 5CHAC 3RXBA 1TONA 1FUJA 3GDSA 1TPSA 2PWXA 1SLWB 2ZCHP 2XBXA 2UUYA 4NIWA 1LMWB 4DURA 1TAWA 2XC4A 4NIVA 2ZTZA 1UVTH 2VIOA 3RXJA 2OC0A 1BBRE 1TQ0B 1QL9A 2NU2E 2PSXA 1HFDA 4IC5A 5K0HA 1W2KH 1NN6A 3PMJA 5BPEA 3QZRA 4AOQA 2G4UA 3BTWE 1GG6C 1RFNA 1AKSB 4DOQA 1VR1H 2BD3A 1ZHMA 5ESBA 2ANMH 1NFWA 3CS0A 1PQ7A 2P3TB 4KP0A 4AFUA 3UREA 5T3HA 2Y5GA 4AFSA 4KKDA 1SLXB 4NWKA 1Z8GA 2AIQA 3BTME 2BVXH 1L1JA 2FOCA 2ZFQH 1P2QA 1WAYB 4WH6A 4BTIB 3F68H 1HAHH 4Q2KA 3RXUA 1S0RA 2Y82A 3VB6A 1QRWA 1WOFA 2SGAA 3ZV9A 2SFAA 3GISB 3TK6A 1OWJA 3MH5A 5DP7A 5SGAE 2JH5D 4UFGH 4O9VA 1D4PB 1A5GH 3TITA 3EA8A 2WUCA 5EW2H 1HBTH 2R3YA 1ESAA 2ZECA 2VIQA 3M61U 1P06A 4SGBE 3AW0A 1LVMA 1O2QA 5GWZA 1J17T 3BTTE 1ZLRA 1GBTA 2ZEBA 4XSKU 1TMBH 3S0NA 1V2QT 2JKHA 4K60A 2IOTA 2ZKSA 1NFYA 1S85A 1GWAA 1GI5A 2BQ6B 1HAGE 2FEQH 1UTJA 3TNTA 3HATH 1F92A 1A3BH 2SGDE 2O9QA 1HAZB 4B2CA 1GCDA 2FI3E 1QB9A 1C5XB 4WVPE 2OXSA 1E34B 4XE4A 2QXJA 1V3XA 4X6NA 1AU8A 1CO7E 5A09A 3URCA 4RN6A 3U1JB 3PMHB 1ZRBA 4CH2B 1TQ7B 5EPNA 1EOJA 2OTVA 4MPVA 3SGAE 1SGRE 2Z3DA 4K8YA 4IW4E 2GT8A 5A2MH 3A87A 3MHWU 4JYVH 3DUXH 2VIWA 2ZTYA 3V7TA 1D6WA 1QY6A 1C1NA 3T2NA 1QJ1B 5GDSH 2NU0E 1DITH 4H4FA 1ELGA 5GCHF 5CMXH 1P9UA 4BOHA 3TGKE 1MBQA 1W8BH 4JYUH 2BYAX 5JPMH 1JMOH 4O03A 1C4U2 1GG6B 1P02A 3PTBA 4OGXA 3UNQA 4D76A 2CF9H 2XRCA 1L4DA 3A83A 2LNCA 2RG3A 1LHCH 1F0SA 4MNWA 2H5DA 5DGJA 3ZVBA 2C8XB 3H7TA 3L6PA 1BB0B 1OWDA 4TY7A 1O2TA 1O3LA 3BEFB 1EZUC 1DVAH 2JETC 3HGNA 2VINA 4FUDA 1TNLA 3K65B 2VWNA 1EJMA 3PWBA 3B9FH 3PROA 1SL3A 3MH6A 2FX4A 4RSPA 2FOEA 1Y3VA 1A2CH 5EU8A 3NK8A 1UTQA 2GDDA 2ZA5A 4ZUHA 3RXEA 3RXHA 4DW2U 1CHGA 2HPPH 2HNTE 3S9CA 1FY8E 5E0JA 3C27B 1QURH 1MTSA 4ZH8A 1V2NT 3AASA 2RCEA 3M7TA 3Q76A 2OINA 1C5LH 1SGQE 5E0GA 5T6DA 1DM4B 1Q31A 1AVWA 1CHOF 2ODYB 3E91A 1C2KA 1EASA 1VCPA 2VIPA 4DIHH 4B73A 2QIQA 1ELAA 5DJ7A 1TRNA 2GZ8A 2BB4A 1C4Y2 1GBAA 1ARBA 1JWTA 1SBWA 3ZZ4A 1NRRH 1UTNA 3KQBA 3B23B 1V2PT 4TPYA 1S6HA 1A4WH 4NFFA 3A7XA 2OQ5A 3RC4A 2W5EA 1EAUA 3KIDU 4MQAA 3UR9A 6GCHG 1C1VH 1ORFA 2ZTXA 1RTKA 3RXDA 4BNRA 1NROH 2GT7A 1C5WB 1M9UA 3M37A 4FUCA 3MO3A 3FP8E 4JZEH 1C2DA 1C5RA 5C1YA 1HAVA 5GXPA 1TNIA 3S9AA 2BVRH 1RTFB 2W3IA 3BSQA 3GY8A 2BDBA 1C1TA 2UUJB 3V0XA 1P2MA 3RMOH 4AG2A 3LC3A 2C4FH 3BG4C 1O35A 1KXDA 4LZ1H 2PSYA 2CXVA 1UVSH 2ZCLP 3ZZ6A 2BDGA 1HGTH 1AKSA 1TBZH 1G2MA 2XBVA 3P70B 3RXGA 1K1MA 2WYJA 4CBNA 3ATLA 4ABFA 1GJ8B 1CT4E 1TX7A 4K1SA 1TNKA 4I31A 2ZGHA 5E2OA 4TYDA 1KXCA 1AZ8A 5IDKA 4NA9H 4XFQA 2ZDMA 1OOKB 4VGCC 3U8RH 4A1XA 4AN7A 1Y3WA 5H4IB 3H5CB 5TCAA 1O3HA 4B2AA 2PGBB 5JBAS 4K1EA 1TFXA 3QUMP 1C1SA 5LPRA 2BDHA 1SQTA 3MU1A 1GJ6A 4NIXA 3MI4A 1TOCB 2JH0D 2Q6DA 1PPCE 4NG9H 1ANDA 1AUTC 4IGDA 1OYTH 1ELVA 4O3TA 2ZU4A 1TOMH 2Z7FE 3ZVCA 1Z8RA 1Y5AT 2ZDVH 3DT0H 1S83A 1ZMLA 1XUKA 2SNWA 4Q7XA 1IAUA