1PQ8A

Trypsin at ph 4 at atomic resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq8A01
3SU6A 2ZU4A 3HKJB 2ZCHP 3SV7A 4UFEH 5EQRA 3AASA 3E0NB 4RSPA 1TA2A 1AIXH 3BIUH 3F9GA 1GJCB 2ZFSA 2CXVA 5PTPA 3T28A 1PPBH 2FOBA 1GHVH 2F9VA 3V7TA 1SVPA 1HIAB 4AG1A 2Z9JA 3VB5A 3ZZBA 1MKXK 3GY5A 4E06H 2CGAA 5ESBA 1FAKH 1P9SA 1Y3VA 1HAHH 2P3TB 4RKJB 1CGHA 1MTVA 3MNBA 2A7CA 1A5IA 1C1MA 1D6RA 3RC4A 3SNBA 1BRBE 1RTKA 4MPWA 3RU4E 3QGJA 2QXIA 4CHAB 2G5VA 3HPTB 3MH4A 1KXCA 2NU2E 4CR5A 1ANCA 2UUFB 1ZTJA 4Y7BA 2XC0A 2LPRA 2BOHB 1V2RT 5L2ZH 1K22H 1SFIA 3Q3KA 2P3FH 1TQ0B 2SGDE 2O8WA 1P2IA 4Y76A 5DG6A 3RLYH 1L0ZA 3E3TA 1GJ5H 2G52A 2VWNA 2B8OH 2QA9E 1B0EA 1QL7A 1GHWH 1HAZB 2FMJA 3E8LA 3SZNA 3SJKA 1C1PA 1Q2WA 1JIMA 1S83A 1ELTA 5EXNA 1ANBA 1GJ7B 1P3EA 1TX6A 1QBVH 4WVPE 4ABFA 1C1TA 4CBNA 4U01A 3A85A 1GGDC 2HNTC 1T4UH 3GISB 1IQHA 4CRBA 3U1JB 5C1XA 2RG3A 5FX6A 2VIDA 1C2MA 3RXCA 2G4TA 2B9LA 3BTEE 3UNQA 1AKSA 1BMLA 1AI8H 2BXTH 5A0AE 2BX4A 3BEUA 4FU7A 2TGAA 3A84A 3K9XB 2OD3B 1WU1A 1QHRB 4A5TS 2BDCA 1THPB 2ZKSA 3BEFB 1UVUH 4B1TA 2ODQA 1L1JA 6CHAB 2BDHA 2AS9A 2PSXA 1V2ST 3B23B 2FI4E 1ESTA 2J34A 2BB4A 3LC5A 1MMJN 1O2VA 1YCPM 1TWXB 3ZZ8A 1P10A 3KQDA 5DO4H 1J8AA 5TCAA 1EB1H 4IN1A 1OYTH 2XYAA 2PKAA 4ZROA 1P01A 1C2KA 2O8MA 2B7DH 4OS7A 2J2UA 4Y8ZA 5A0BA 4D9RA 1UO6A 1ELGA 2GCHG 1F5RA 3VB7A 3K65B 1GMDF 4K1EA 4WF8A 3K2UA 2G5NA 1GMHG 1W7GH 1UTNA 3KN2A 1DLKB 4TY7A 3S0NA 1UTJA 1KXAA 1G2LA 2V3HH 5C20A 2P16A 2W3KA 3H5CB 3EA9A 3SW2B 1A2CH 1S0RA 2OBOA 2Z9LA 3PMJA 3ZVCA 3TGIE 3LT3A 2W26A 4JCNA 1BMAA 4KKDA 1FJSA 3PO1B 4MVNA 1QB6A 3RM2H 4UONA 3FP6E 3W94A 3QLPH 1IQKA 3EE0B 3MWIU 1O0DH 2HGTH 3RXMA 2FESH 2WUBA 1ELVA 3MNCA 2BZ6H 4ESTE 2ZG0H 4MQAA 2IJOB 1ELDE 3MH6A 4WXVA 1YP9A 1DDJA 1TNGA 4Y6DA 1O5DH 4MNYA 8LPRA 1ANEA 2ZFQH 4ABIA 1QA0A 1LHFH 3FFGA 1SQAA 2ZHDA 3BG4C 1S85A 1OWIA 4B71A 4ABGA 1LVOA 1XUHA 1NRQH 1DVAH 1TOCB 1YPHC 1BTZA 3Q76A 1TRYA 3KNXA 1KXDA 3RXDA 1O2LA 1BBRK 3A7VA 4D7GA 1O2MA 1QGFA 1F5LA 1ZOMA 4J2YB 1MZAA 1XVOA 4IW4E 3UNSA 3EA8A 2ZWLH 1ESBA 4X6OA 3SV2H 1MKWK 5E0HA 3MU8A 2ZIQH 3T29A 1O39A 3A7WA 5EU8A 1QR3E 2ZFRH 2FLRH 3H7OA 1F2SE 5FBEA 1LHGH 1TGTA 4Y0YE 1YPEH 3ZZ3A 1EATA 4GCHG 4PROA 2WUCA 1HAVA 3ENSB 4CREA 2GT8A 4ZXYH 1GI9B 3GY2A 3P6ZB 1GMCG 2FI5E 3KQCA 1FY3A 4NG9H 2ALVA 4AORA 2ZTYA 1O3CA 1EB2A 5DP9A 3E16B 1C1UH 1AZ8A 4MTBA 1XXFA 4FUDA 2F9NA 3HKIB 1VZQH 4DVAU 2ZCLP 4O97A 3MYWA 1OS8A 4ABBA 1O5BB 1TGSZ 3S7KB 3SHCH 2AERH 2ZQ2A 2VWMA 1GJ9B 2ESTE 3VEQB 1VGCB 4NIWA 4X2VA 2H9EH 2C4FH 2A4GA 3UPEA 2UUKB 1A4WH 2FX4A 1GDQA 2WYGA 2ZTXA 1GHAF 3TJNA 2BVXH 2Z94A 4A1TA 1DSUA 1BA8B 1BDAA 3MHWU 1NRRH 2UWLA 3BV9B 1E0FD 1LO6A 3UR6A 3VFEA 1GI8B 2OUAA 1GBFA 1ZHPA 5HMAA 1ETRH 1RS0A 3RXVA 2P94A 1ELCA 3SJ9A 3ZVBA 5A09A 1BJVA 4ABDA 1QJ1B 2VGCC 1HPGA 1SGNE 1GBAA 2AIPA 1SGQE 3M7UA 4JK6A 3RXJA 5GWZA 1KY9A 1PFXC 1T8NA 3CP7A 5C3NA 2F9UA 4Q7ZA 2GD4B 1WAYB 3BTFE 3QTVH 2UUYA 3S69A 1SGDE 3EA7A 2XNIA 1T32A 1ZHMA 4UDWH 1HJ9A 1LCYA 2AYWA 1EP5A 1GJ4H 1OWJA 1W0ZU 2KAIA 4AZ2B 2BY7X 1J17T 1NM6A 4MNXA 1HV7A 4IC6A 5C2ZA 2H9TH 1FV9A 1JWTA 2QIQA 1O38A 2H5CA 3DHKH 5HGGA 1DFPA 4H4FA 2BVSH 3P8NA 1GHBF 1ZPBA 4ISIH 3RXOA 3UWIA 1A0HB 4JZFH 1A5GH 6LPRA 3TIUA 1DPOA 3S9CA 1HJAC 4ZMAH 4IMQA 3E0PB 1CA0C 1ARBA 2TBSA 2XBWA 1GBDA 1TBZH 4HFPB 3AW0A 5E8EH 1SGFA 3PTBA 1EZQA 1MTNC 2A2XH 2CMYA 1A3BH 1NU9A 1SC8U 2H2ZA 2FP7B 3E1XB 1G3DA 1D3QB 2PGQB 2GP9B 5DPAA 1WQVH 2HALA 3RXHA 2PHBA 3ELAH 2RDLA 1JOUB 4OS2A 1EAIA 1G9IE 2GVFA 2ZNKH 1ZPZA 1T8OA 2XCNA 1C5NH 4X8TH 5F6MA 1G32B 1P9UA 3ZZ5A 3C1KA 2J92A 1G30B 1ZYOA 5FX5A 1EX3A 3UQVA 4SGBE 2AGEX 1EKBB 4F4OC 1V2TT 1T8LA 2P3UB 4X2WA 4X6MA 1ZRKA 2A31A 1S0QA 1NFWA 4Y10E 1L4DA 4X1SU 1NRNH 3S9AA 2IOTA 1O2UA 4KTSA 1O3EA 1CGJE 4AYYB 3RXRA 4LZ1H 1C2IA 2QF3A 4JYTA 6ESTA 3IG6B 1VITF 2AMQA 2BZAA 2OP9A 1FY8E 1GBIA 2ZQ1A 1S6FA 1HBTH 1RTFB 1F0SA 2A4OA 3LH3A 4YT7H 1SFQB 3STIA 1SLXB 2R2MB 2VIOA 3U8OH 1TBRH 1Z6JH 1SLVB 1YPGH 2D2DA 4FUGA 1DWCH 1THSH 1ZJKA 1KLJH 3KF2A 4ABAA 1TAWA 3LJJA 3LGYA 1P57B 2FI3E 2ZFTA 1C1SA 2NU1E 1DY9A 1O37A 4X6PA 1GJAB 3UNRA 2WV5A 3IITA 2W3IA 1H9HE 4X8VH 2R3YA 4K3JA 2BY8X 3PMBB 1NS3A 3L6PA 1O3AA 2PGBB 4GPGA 1YKTA 2ZPSA 1K1LA 3LONA 3M5OA 1YPHE 1GDNA 1DANH 3DUXH 4XFQA 2JH5D 1QJ7B 4CHAC 5LH8A 4GHQA 4BAKB 4H42U 2FZZA 5T3HA 3SI4H 4Q2KA 4X0WU 1KDQA 2Z9GA 1UVTH 1UTLM 2J4IA 2P59A 4BTUB 3ZVAA 5JB8S 1XKAC 3CS7A 1HXEH 1DT2A 3D23A 1N6XA 1O5GH 3TITA 3KL6A 1DE7H 3A80A 2BLOA 4YOJA 1IAUA 2AH4X 4DG4A 1QJ6B 1MKXH 4U32A 1B5GH 3FP7E 5LGOA 2XBVA 1BTUA 1LKBA 3T2NA 4IBLH 2OC1A 2ZO3H 2AIQA 3A86A 5F03A 1BRUP 3A81A 1ETSH 1ZTKA 2FOFA 1V2JT 2BD3A 1BRAA 2GV7A 3RMLH 2BTCE 1H9IE 1HB0B 1O34A 2XWBI 4FVDA 3A7YA 1WOFA 3A83A 2BDBA 1AMHA 1ZTLA 1P06A 3LDXH 1O2ZA 3Q77A 2VU8E 1SHYA 1DS2E 4K1SA 2VVCA 4JMYA 3TK5A 1GI3A 2PWXA 5E2OA 1O2TA 3QN7A 2BX3A 3SQEE 1AFQC 1EAUA 2FODA 3P95A 2P95A 5L6NH 2WYJA 1BBRH 3FANA 1C2GA 5DJ7A 2GKVE 2STBE 1HGTH 5ETXA 5J4QA 2PUXB 3A7XA 1MCVA 1P2OA 1QCPA 1OWDA 2VIQA 3LU9B 3MFJA 5FCRA 1UK2A 1EZUC 5C1UA 1LVMA 7LPRA 1NZQH 4E05H 3E91A 1YC0A 1UTQA 4THNH 1C4V2 1PPZA 1O2IA 2XC5A 4ZHLU 1TPPA 2C8YB 1N8OB 4XBBA 1XUGA 2HWLB 4D7FA 1KTSB 1O2WA 1GMDG 3A7ZA 3MTYA 3SNEA 4YTAA 5EPYA 4FXGH 6CHAC 3L3TA 1LPKB 1C5LH 4O9VA 1TX7A 2I6SA 1BTXA 1XM1A 2PV9B 3QGNB 1CQQA 2OC0A 1DSTA 1RRKA 2GV6A 1A0JA 3SO3A 2FOHA 1O2XA 1TNKA 4CH2B 4BXWA 6GCHF 1C2DA 2FOMB 4KP0A 4K8BA 2VWLA 3A8BA 4UFDH 5TCCA 8GCHF 3ZZ4A 4BAOB 5A8ZA 4NA8A 3V12A 5ESTE 1C1NA 4H6SB 2PTCE 1V2WT 3RLWH 3UWJH 2ZA5A 3TGJE 1OP0A 1O2PA 5EW1H 5AHGH 3W95A 1HJAB 2WPKS 4NIXA 1F5KU 1JMOH 1W14U 3M3VA 4GHTA 1UVPA 1BQYA 5HYOA 2A5AA 4OS4A 3GCHC 1A61H 3OU0A 3SU0A 1P12E 3FZZA 2Y5GA 1EJAA 1O3IA 2Y80A 4M7GA 1PQAA 1SQTA 3EDXB 3ZVEA 1V2NT 2ZCKP 5DP6A 2A5IA 5AFZH 5GDSH 4A6LA 4Y71A 3SGQE 2J9NA 3TLOA 2QXHA 1RD3B 3A89A 1ZMJA 2QC2A 2ZF0H 2BLWA 1C9PA 1VR1H 4RN6A 1AD8H 1EQ9A 1UTPA 1YM0A 4ABEA 3QZRA 3T27A 1TABE 3NWUA 1EJNA 1C5VA 1NPMA 1AVXA 1N8OC 2ANKH 4MPUA 2YOLA 3LGTA 4I8HA 1BITA 2D26C 4X2YA 3LGIA 2VH6A 3BTKE 2SGAA 2ZDLA 1BTYA 1BHXF 1FLEE 1LVBA 4KELA 1V2PT 1WCZA 2AEIH 3RXEA 2FIRH 3GDUA 5EXLA 5JDUB 1TONA 1MKWH 1NESE 2ODPA 1EZXC 1QY6A 3O8DA 4AG2A 1FONA 2Y7ZA 2ZEBA 2ZGBH 3A87A 4IGDA 2Q6GA 3EYDA 2O8TA 3GYLB 2XRCA 1C9TA 4ISHH 3NK8A 1AWFH 1TNHA 3E6PH 1AVWA 1OWEA 2R3UA 4B74A 1GHXH 4INKA 4WH8A 4MPVA 1H9LB 1O3PB 1XX9A 1YLCA 3URDA 1MH0A 4K8YA 1YLDA 2H6MA 2D8WA 4ZKSU 3U1IB 1BJUA 5C5NA 1MU6B 1DUEA 5FAHA 2RA0A 2ULLA 3LGVA 3OY5U 2O8LA 1VITH 1TGBA 3ZYDA 4Z0KA 1T4VH 2JH0D 1DUAA 4O3TA 4A1VA 4GVUA 4DIHH 3LGUA 3GDVA 2CHAB 1G3EA 1GJ6A 2XBYA 2FYQA 4UD9H 1N1LA 1CVWH 1TPSA 3RXLA 1W3CA 2GCHF 4ZAEA 3SNDA 3VGCC 3A82A 1LVYA 1FN8A 2VJ1A 2Y81A 1C5UA 1GBKA 2G51A 3PM3A 3VB6A 1GBEA 4KTUA 2PTNA 5H4IB 2PKAB 2ZDVH 1V2MT 4AFQA 1UVOA 2BY6X 3SI3H 6GCHG 3TNSA 2Y5HA 3ATLA 3RMMH 5GCHG 5T6FA 4DURA 4Y7AA 1AB9B 2BM2A 3KQBA 2QGRA 4H6TA 1FDPA 5E2PA 2B0FA 2QXGA 3M7QA 4K69A 1ANDA 3GCHB 1S84A 3PMHB 4GUXA 4CRAA 2XC4A 3GCTF 2ALPA 1FUJA 4FUCA 1OSSA 1SGCA 3M61U 1C1RA 4OGXA 1CE5A 1UK3A 1PQ8A 1L4ZA 1P2MA 3ITIA 3URCA 2SNWA 2RA3A 3SJIA 2BYAX 4Y8XA 2Z3DA 1B7XB 1ACBE 4DY7B 1O2KA 1DXWA 4I8LA 1QA7A 5FPSA 3AW1A 5DP4A 1DY8A 3TJVA 4AFZA 1JBUH 2CF8H 1NRSH 5T6GA 1YYY1 1P0SH 3EGKH 1GI4A 3PLPA 3RXUA 1GMCF 4YT6H 1P2QA 2ZHWH 3TH4H 3BTHE 4JYVH 1O33A 2FTLE 5K0HA 2R0KA 3RXAA 5SGAE 1P02A 1P3CA 1SR5C 5CE1A 3TGKE 1GCTC 1GWAA 3TNTA 4HTCH 4IMZA 1L1GA 1H1BA 1C5ZB 1O3NA 1TRNA 3RXIA 2DUCA 7GCHF 3ZZDA 1MQ6A 2FOCA 2ZPQA 3V13A 3BF6H 1IQLA 2W5EA 4CRDA 1SG8B 1GBHA 1TLDA 1RTLA 2GMTC 1MTNB 4DJZB 1XUKA 3ZZ7A 4J1YA 1O30A 1O3FA 1TNJA 1G2MA 1P04A 2ZFFH 1NFUA 4XDEA 2BY5X 4WY3A 4NIVA 1Y5UT 4MNWA 1G3CA 5LPFA 3UQOA 1Z71A 1AY6H 3HATH 4DGJA 3DFLA 8GCHG 4FUJA 3LGWA 1PPGE 4MNVA 3U8RH 1C5MD 3ZVDA 2A45B 1Y3WA 1NY22 2CF9H 2R2WU 1AN1E 4OS1A 1ZR0A 1FI8A 1FPCH 1RFNA 1GI0A 1LHCH 2R0LA 4CBOA 1NN6A 5EG4A 2H9HA 2BD2A 2GGVB 2ANYA 3GY7A 3PWCA 1HAOH 3QZQA 4BXSA 3RXTA 3BTGE 1QRZA 2FYRA 3RMNH 3OY6U 1XUIA 4Y8YA 2IPHA 3GICB 5LPEA 4UE7H 1ZJDA 3TH2H 2G4UA 5JBTA 4Y79A 1DITH 3M5NA 1O2QA 5B6OA 1UTMA 4XBCA 1F92A 1BUIA 3ZVFA 4UEHH 5EXMA 3NCLA 4FVBA 1HCGA 4I7YH 2QAAA 1MU8B 1C2HA 3K6YA 4VGCB 1KXEA 5F8XA 1CT4E 3GCTG 4NA7A 1K1NA 4AFUA 1SGEE 1QQ4A 3OYPA 1BTWA 3RXFA 3HGNA 3NZIA 3D65E 4MPXA 3UIRA 1ZMNA 1E36B 1Z8GA 1C1WH 1C4Y2 1FY4A 1HFDA 1GHBG 2CV3A 2XTTB 4BOHA 1UCYK 2JH6D 3PROA 2GCTC 4Q7XA 1Z8IB 2FX6A 2ZGHA 4XBDA 2Z9IA 1SLWB 4FUIA 1HRTH 2FLBH 2KAIB 1MTWA 4BTTB 1C1VH 4UFFH 2FOGA 1GPZA 1EP6A 1DXPA 3CENA 3GY3A 1T31A 3SUFA 2BQ6B 2GTBA 1MTUA 5JBAS 2P8OC 1GVZA 5DP8A 1J9CH 1F0TA 2JETC 1TPAE 4AOQA 1UK4A 1FNIA 1SGPE 1TPOA 2GCTB 5DKMA 5JB9S 1VITG 2TGTA 2O8UA 1QB9A 2A7JA 4WXIA 4NSYA 1QNJA 2FM2A 3TJOA 3SUEA 1GMHF 3VXFH 3MU5A 4WMEA 5FCKA 3T25A 1WBGB 1WSSH 1EAXA 2V6NA 2ANMH 1BMNH 1YCPK 2FDAA 3TH3H 1H4WA 3P8GA 1K2I1 4QT8C 3DFJA 1F0UA 2Z3CA 1GBCA 4I8JA 4RKOB 3ZZ6A 1A5HA 1ELFA 2BVRH 1Z6EA 3A8AA 5L2YH 4NFEA 3U98H 3SJ8A 1O3HA 4LOYH 3OSYA 3SBKA 5AF9H 3SU4A 2VIVA 1GL1A 4XOJA 3C27B 5E0GA 2BD9A 1SOZA 4U30A 1ELBA 5I25A 3VPKA 3U9AH 1CA8B 2G00A 2OQUA 2Z3EA 1LQEA 1BTHH 2BXUH 1CHOF 3QWCH 4NZLA 3VXEH 1A3EH 5J4SA 1S82A 4JYUH 1V2QT 3EAJA 1IOEA 1MBMA 1U6QA 1EASA 2GDDA 2I6QA 4X1QU 1TE0A 3JZ2B 1O5EH 2BY9X 1DWDH 1MCTA 2FEQH 1C5WB 2STAE 1HAXB 4AB9A 1LPGB 3PWBA 1A46H 1B0FA 1K28D 1VCWA 3R0FA 8KME2 3Q00A 1C5PA 4R0IA 2PSYA 2QN5T 3TK9A 3P8FA 1Y8TA 1G36A 1YPJH 2SGFE 3SN8A 5IYTA 3S7HB 2VINA 1C5SA 1KLIH 1O5AB 3MO9A 1GL0E 1LHEH 4TWWA 3ATWA 4Q80A 1GCTB 1Z7KA 2BDAA 4KGAA 1KXFA 4ZKRU 4HGCA 2C8XB 3KEEA 2C8WB 1E38B 1ZPCA 1KYNA 3D49H 3SOSA 3O8BA 1FPHH 2OBQA 1O5CB 2LNCA 2AMDA 1W0YH 2BDYA 5AFYH 2VWOA 2H5DA 1EJMA 1Y5BT 4YZUA 3MOCA 1A1RA 3SGBE 1UJ1A 1PYTD 5DP5A 1RGQA 2Q1JA 5C1YA 5GPIB 2AMPA 5I46H 3TVJB 4CH8B 2F9BH 4TPYA 3CS0A 3F9EA 1P2NA 2OXSA 3UR9A 2A4RA 2WV4A 1HJ8A 2F3CE 1DX5M 1BTPA 5CHAB 1O2SA 3GY8A 4AGKA 4BAQB 1Z8RA 2BDIA 1G37A 1VCPA 1FIZA 3LOXA 2NU0E 1K1IA 1BBRE 4YLQH 1TNIA 1O3DA 3MI4A 1TIOA 4B2BA 1SI5H 2TGDA 5CMXH 1YGCH 1QURH 1M9UA 2GT7A 3NUMA 3QO6A 4MLFB 2IN2A 1D9IA 2BMGB 1IQIA 4R8TB 3ZZCA 1SOTA 2M5TA 2ZECA 1AUJA 2FXRA 2W7SA 1OKXA 1CHOG 3KHVA 1ZSLA 1Z1IA 2H1UA 1J15A 1DWEH 2ZDKA 1O5FH 2C8ZB 2F83A 1QTFA 1FZZA 2Z6BD 3MH5A 1AE8H 5GXPA 1ZSKA 1VGCC 4FUEA 1GJ8B 1IQNA 2VB0A 3PTNA 1MTSA 1O3GA 5A0CA 4OS6A 1XMNB 1C5QA 1K1JA 2ODYB 1TOMH 4FUHA 1QIXB 2XW9A 9ESTA 2EC9H 3MNSA 2OQ5A 4AN7A 4TY6A 4GAWA 1V2LT 3AVZA 1Z8JB 3RC6A 4LZ4B 3DT0H 3SU2A 1HDTH 1RIWC 3B9FH 4INHA 4SGAE 1DLEA 4I33A 1Y3YA 3LH1A 1LDTT 4F49A 5A8XA 2BD7A 2F9PA 1O32A 4Y11E 4E7NA 1O31A 2Y5FA 1JXPA 1SGRE 5HM2A 1RIWB 1SHHB 1V3XA 1S6HA 4BAMB 5ABWA 1NU7B 3A8CA 1TRMA 1BCUH 2A32A 3UUZA 1EPTA 2PKSC 1TMUH 4X1RU 1SLUB 2DE9A 2VVVA 2V35A 4K2YA 2CJIA 1PQ7A 2O9QA 3ATKA 1ARCA 5BRRE 2BQWB 3PB1E 2DE8A 1GI1A 1J16A 3V0XA 2ZHEH 1CO7E 3MU1A 1ZHRA 4WWYA 1D4PB 1K21H 1W13U 3LC3A 3PV4A 1FMGA 2ZHQH 3RP2A 1FQ3A 1YF4A 2HVXA 1LTOA 2ZP0H 1ZRBA 2K1QA 2F91A 1GHYH 1TNLA 2SGEE 1LQDB 5FBIA 1IQMA 4DW2U 1LKAA 1UTKA 3RC5A 1THRH 2WPMS 1S5SA 2PFEA 3UOUA 1QBNA 3NXPA 1GVKB 1C2FA 5GJ4B 3WY8A 3HGPA 1Y5AT 3ZV9A 3FZDA 5TJXA 3BIVH 3PLBA 2VNTA 5DP7A 1CT0E 3KGPA 5FPTA 1O3MA 3MH7A 2V3OH 4NWKA 4XSKU 2ZU3A 3RXGA 4A1XA 2GZ9A 3QK1A 3SU1A 3H7TA 1HUTH 3SORA 1IQJA 1DWBH 1EZSC 2OCVB 2WPIS 1MBQA 1GI6A 2EI6A 1CU1A 2J38A 1SGTA 3LPRA 5F8TA 4IC5A 2C93B 3PYHA 2QV1A 3GOVB 1O3KA 2PLXA 5FXLA 4ZHMU 3MU0A 4D8NA 2Q6FA 3KQEA 2TGPZ 1GI2A 1HLTH 1PPEE 1P09A 1HAPH 1SBWA 1ZLRA 4ISOA 3B8JA 3MU4A 5BPEA 1OX1A 4MDSA 1BMMH 2OC8A 1T7CA 4WMFA 4AYVB 1PPHE 4B76A 3BTDE 3MO3A 1GDUA 5F8ZA 4DIIH 2BD8A 2BHGA 2Z9KA 3MMGA 1OWKA 1TBQH 2Y7XA 4AB8A 4D76A 3AAVA 2A2QH 2OTVA 5IDKA 1ABJH 1GBLA 4YOIA 1PYTC 3SU3A 1UHBA 1NTPA 1P2JA 2UWOA 2ZFPH 3ESTA 3RU4T 4MG3A 1WTHD 3F68H 4CRGA 4CRCA 1CGIE 1TFXA 1ZMLA 3GYMA 1V2KT 4YLUA 1A7SA 3FP8E 3V3MA 3UY9A 2YNBA 2SGPE 4D9QA 4Z6AH 5DGJA 2ZU2A 1F7ZA 1X7AC 1E35B 1HYLA 1QB1A 1OP8A 2NWNA 2Z7FE 3LIWA 1J14A 4O03A 5EODA 3PO1C 1RJXB 1ZZZA 4I8GA 2EI8A 4JZIA 1OPHB 1SL3A 2P8OB 4AFSA 3BTQE 1XUFA 1IHTH 1PPCE 1EPTB 4ISNA 3ATMA 4NIYA 3BTTE 3M36A 4XE4A 8ESTE 1W8BH 3DA9B 1AWHB 2GMTB 3HK3B 1JIRA 1FIWA 4JZEH 2ZPRA 2ZU1A 3L33A 1FN6A 3GY6A 2FS8A 1TMBH 2NU3E 4ZH8A 2BLVA 3MO6A 5GIBA 3RM0H 1W10U 1MAXA 2FOAA 4B2CA 4X1PU 3P70B 1O2RA 2BDGA 4ABJA 3AAUA 3ODDA 1SGFG 4ZHAA 2GX4A 3RXSA 2HLCA 1BT7A 2FWWA 7GCHG 3F9FA 4VGCC 1GCDA 1L1NA 4X6NA 1NRPH 4A92A 2EEKA 2GZ7A 2VIPA 2AGIX 4JZ1A 3RUOA 2J95A 2R9PA 1KIGH 2Q6DA 3M3SA 1MD8A 2ZHFH 1EAWA 3BTME 2EI7A 4TWYA 1BB0B 4Y0ZE 3R3GB 1XVMA 4CR9A 2Y6TA 2A4QA 1LHDH 3ZV8A 1GJBB 2EA3A 1EPTC 2XXLA 1TGNA 2Y82A 4ZKOU 1NFXA 1SB1H 4ABHA 2G55A 2VVUA 3ZYEA 5E0JA 5EQSA 1AFQB 1GG6C 1HAVB 1P11E 1SPJA 5A8YA 2OINA 5A2MH 3M35A 1AZZA 4WJG2 5L30H 1MAYA 1NT1A 2TIOA 2QY0B 4ZUHA 1O3OA 1C4U2 3F6UH 2HNTE 5C5OA 1E34B 1O2GH 2ZGXH 3QTOH 3RDZA 4GLYA 1O35A 1AHTH 3GY4A 2D1JA 5HM9A 2UWPA 3OTJE 1UTOA 3TK6A 5G4BA 3RXKA 3GCOA 3BN9A 1KXBA 1XXDA 2HRVA 4Q7YA 4YESB 1ID5H 3STJA 1TQ7B 1C2JA 1ABIH 4B2AA 1UHBB 3SHAH 4JZDH 3FVFB 4JK5A 1QL8A 3M37A 1ELEE 1P2KA 3F1SB 1EXFA 1WUNH 2ZU5A 2VIWA 2QYIA 3E90B 1WYKA 3QX5H 3M3TA 1C1QA 3ZZ9A 1HNEE 2V0BA 1GHAG 4LXBH 1CBWC 1V2UT 3LJOA 1L2EA 1Q31A 3Q3YA 4NCYA 4GCHF 3T26A 1AGJA 5EOKA 1QFKH 4GSOA 1UMAH 1UCYH 2G8TA 5EQQA 4AGJA 2PW8H 1AVGH 4TYDA 4K60A 3UTUH 2FO9A 2W7UA 3VB3A 4NZQA 2BOKA 4FU8A 1KSNA 2C90B 3ODFA 4ZXXH 1MD7A 3ATIA 4K1TA 3U69H 1V2OT 2WPLS 4BAHB 3QDZB 1Y3XA 1O2YA 3SUDA 3ZVGA 2GZ8A 5T6DA 5FPYA 4E7RG 3A8DA 3N7OA 1H8IH 1OP2A 3G01A 2BQ7B 1C5YB 2ZI2H 1OWHA 1GBJA 1P8VC 3SQHE 2TPIZ 1SGYE 3K6ZA 1JRTA 3P17H 5CHAC 1QBOA 2XWAA 2QXJA 1WV7H 1SMFE 4BNRA 3SV8A 1D6WA 5JPMH 1YPKH 4B75A 2ZGJA 1ZGIA 1IHSH 2FS9A 3T5FH 1C5TA 1Y59T 1AO5A 5JBCS 3M5LA 1OXGA 2QF0A 4NWLA 3SUGA 1YPLH 3SV6A 3UFAA 1OYQA 4HZHA 4DOQA 2ANWA 3FAOA 1ELAA 1YPMH 4B73A 1O2HA 4OS5A 3MNXA 5LPRA 1GHZA 2P93A 5DK1A 2CHAC 1NC6A 4ISLA 3S9BA 2PKSB 3TPIZ 1QRXA 2FTMA 3UREA 7KMEH 3UOPA 1N6YA 2A7HA 2WPHS 1JRSA 1ZSJA 4NGAH 3SJOA 4TPIZ 1C5OH 1PJPA 2WINI 1FY5A 1BHXB 1HAIH 1H8DH 2F9OA 5C67A 1EOLA 1DOJA 1BZXE 1TMTH 1TGCA 1DICA 1XKBC 2AFQB 4DCDA 1GBBA 1SGIB 2AGGX 3QUMP 5JBBS 1P03A 1CT2E 2XBXA 1O36A 2HPQH 1FXYA 1O2OA 3OX7U 2B5TB 1K9OE 1ORFA 3A7TA 1TYNA 3D62A 4AX9H 3I29A 2YNAA 1GI7B 2UUJB 1CSOE 2FPZA 3RXQA 3LKWA 1BOQA 1ZGVA 1DM4B 5FHTA 1C5XB 1EOJA 5DP3A 1D3PB 2HPPH 1SSXA 2ZDAH 1BRCE 2SGQE 2VGCB 1ESAA 3RMOH 1AB9C 4OGYA 3RU4D 4KTCA 4I8KA 1C5RA 2C3SA 4IS5A 1K1OA 1WTGH 1Y3UA 4FU9A 4BANB 3PLKA 1F0RA 1CHGA 1PPFE 3O8CA 1AE5A 3IWMA 3SNAA 3RXBA 5EPNA 3M5MA 2ZGCA 1INCA 1CBWB 1KDQB 1MQ5A 1IQFA 2NU4E 3BSQA 1HIAA 3BTWE 3BG4B 3T62A 1QL9A 3SV9A 5AVDA 9LPRA 1C2EA 2VH0A 2HNTF 1O3JA 1FY1A 2HOBA 3O8RA 4NFFA 1TB6H 3A88A 3Q3XA 1V2VT 5EGMA 1EUFA 2ZTZA 4UFGH 1GVLA 2PUQH 1Q3XA 3RXPA 2CN0H 3P8OA 1O3BA 3EQ0H 4I32A 2THFB 1LPZB 4NA9H 1GGDB 1HAGE 1S81A 1K1MA 1KTTB 4DT7B 2XCFA 2OLGA 3KCGH 4FUFA 3TU7H 1YCPH 5HXFA 4A7IB 1HAYB 1LMWB 1GBMA 3ZZAA 2ZDNA 2BD4A 1AUTC 1TALA 1W7XH 4CRFA 5GCHF 2ZZUH 2QCYA 4X8UH 1W12U 3DD2H 4IN2A 1VJ9U 1A0LA 3BG8A 7ESTE 1O2JA 3KIDU 2ZC9H 1RXPA 1W2KH 2G81E 1OOKB 3BEIB 1MUEB 1NROH 3P92A 4NSVA 1KLTA 1O2NA 1K1PA 2A1DB 4I31A 4INLA 3TJUA 3I77A 4HI3A 5K7RA 1GG6B 4ZKNU 1AU8A 4WH6A 1D3DB 1TA6A 4U2WA 1D3TB 4O3UA 2TRMA 1Z1JA 4YOGA 1FAXA 1W11U 3I78A 4X8SH 3VB4A 4BTIB 1V6DA 1IQEA 1UCYE 1VCQA 1AKSB 4LK4A 1P05A 3VGCB 1YBWA 3JZ1B 1SQOA 3NKKA 2A0QB 4FUBA 4X2XA 4K5ZA 4YO9A 3GDSA 3SU5A 4YM9A 5JYIA 3HK6B 1HXFH 2PR3A 2A5KA 1CA0B 1WQSA 1GJDB 1O3LA 1GI5A 2FOEA 1XUJA 1IQGA 1QQUA 1C1OA 1ETTH 3M7TA 2JKHA 2RCEA 2BLQA 1AFEH 3F9HA 3SGAE 1BIOA 1NFYA 1E37B 1NO9H 2SNVA 1C2LA 3SNCA 5EW2H 3PMAB 4WMDA 1T8MA 3GCNA 4X1NU 2WPJS 1PQ5A 2J94A 1GBTA 1QRWA 2SFAA 1G3BA 1VJAU 1UVSH 2GDEH 2ILNA 2ASUB 3U8TH 2JETB 2OC7A 2ZDMA 3NPSA 4ASHA 2BD5A 1TX8A 1AQ7A 1MZDA
chains in the Genus database with same CATH superfamily
3SU6A 2ZU4A 3HKJB 2ZCHP 3SV7A 4UFEH 5EQRA 3AASA 3E0NB 4RSPA 3PV2A 1TA2A 1AIXH 3BIUH 3F9GA 1GJCB 2ZFSA 2CXVA 5PTPA 3T28A 1PPBH 2FOBA 1GHVH 2F9VA 3V7TA 1SVPA 1HIAB 2J98B 4AG1A 2Z9JA 3VB5A 3ZZBA 1MKXK 3GY5A 4E06H 2CGAA 3FOAA 5ESBA 1FAKH 1P9SA 1Y3VA 1HAHH 4ASUD 2P3TB 4RKJB 1CGHA 1MTVA 3MNBA 2W6JD 2A7CA 1A5IA 1C1MA 1D6RA 3RC4A 3SNBA 1BRBE 1RTKA 4MPWA 3RU4E 3QGJA 2QXIA 4CHAB 2G5VA 3HPTB 3MH4A 1KXCA 2NU2E 4CR5A 1ANCA 2UUFB 1ZTJA 4Y7BA 2XC0A 2LPRA 2BOHB 1V2RT 5L2ZH 1K22H 1SFIA 3Q3KA 2P3FH 1TQ0B 2SGDE 2O8WA 1P2IA 4Y76A 5DG6A 3RLYH 1COWD 1L0ZA 3E3TA 1GJ5H 2G52A 2VWNA 2B8OH 2QA9E 3UAIC 1B0EA 1QL7A 1GHWH 1HAZB 2FMJA 3E8LA 3SZNA 3SJKA 1C1PA 1Q2WA 1JIMA 1S83A 1ELTA 5EXNA 1ANBA 1GJ7B 1P3EA 1TX6A 1QBVH 4WVPE 4ABFA 1C1TA 4CBNA 4U01A 3A85A 1GGDC 2HNTC 1T4UH 3GISB 1IQHA 4CRBA 3U1JB 5C1XA 2RG3A 5FX6A 2VIDA 1C2MA 3RXCA 2G4TA 2B9LA 3BTEE 3UNQA 1AKSA 1BMLA 1AI8H 2BXTH 5A0AE 2BX4A 3BEUA 4FU7A 2TGAA 3A84A 3K9XB 2OD3B 1WU1A 1QHRB 4A5TS 2BDCA 1THPB 2ZKSA 3BEFB 1UVUH 4B1TA 2ODQA 4TSFD 1L1JA 6CHAB 2BDHA 2AS9A 2PSXA 1V2ST 3B23B 2FI4E 1ESTA 2J34A 2BB4A 3LC5A 1MMJN 1O2VA 1YCPM 1TWXB 3ZZ8A 1P10A 3KQDA 5DO4H 1J8AA 5TCAA 1EB1H 4IN1A 1OYTH 2XYAA 2PKAA 4ZROA 1P01A 1C2KA 2O8MA 2B7DH 4OS7A 2J2UA 4Y8ZA 5A0BA 4D9RA 1UO6A 1ELGA 2GCHG 1F5RA 3VB7A 3K65B 1GMDF 1YY3A 4K1EA 4WF8A 3K2UA 2G5NA 1GMHG 1W7GH 1UTNA 3KN2A 1DLKB 4TY7A 3S0NA 1UTJA 1KXAA 1G2LA 2V3HH 5C20A 2P16A 2W3KA 3H5CB 3EA9A 4TT3D 3SW2B 1A2CH 1S0RA 2OBOA 2Z9LA 3PMJA 3ZVCA 3TGIE 3LT3A 2W26A 3PRDA 4JCNA 1BMAA 4KKDA 1FJSA 3PO1B 4MVNA 1QB6A 3RM2H 4UONA 3FP6E 3W94A 3QLPH 1IQKA 3EE0B 3MWIU 1O0DH 2HGTH 3RXMA 2FESH 2WUBA 1ELVA 3MNCA 2BZ6H 4ESTE 2ZG0H 4MQAA 2IJOB 1ELDE 3MH6A 4WXVA 4ZCNA 1YP9A 1DDJA 1TNGA 4B6EA 4Y6DA 1O5DH 4MNYA 8LPRA 1ANEA 2ZFQH 4ABIA 1QA0A 1LHFH 3FFGA 5GNDA 1SQAA 2ZHDA 3BG4C 5C17A 1S85A 1OWIA 3VG8A 4B71A 4ABGA 1LVOA 1XUHA 1NRQH 1DVAH 1TOCB 1YPHC 1BTZA 3Q76A 1TRYA 3KNXA 2OK5A 1KXDA 3RXDA 1O2LA 1BBRK 3A7VA 4D7GA 1O2MA 2LELA 1QGFA 1F5LA 1ZOMA 4J2YB 1MZAA 1XVOA 4IW4E 3UNSA 3EA8A 2ZWLH 1ESBA 4X6OA 3SV2H 1MKWK 5E0HA 3MU8A 2ZIQH 3T29A 1O39A 4B6FA 3A7WA 5EU8A 1QR3E 2ZFRH 2FLRH 3H7OA 1F2SE 5FBEA 1LHGH 1TGTA 4Y0YE 1YPEH 3ZZ3A 1EATA 4GCHG 4PROA 2WUCA 1HAVA 3ENSB 4CREA 2GT8A 4ZXYH 1GI9B 3GY2A 3P6ZB 1GMCG 2FI5E 3KQCA 1FY3A 4NG9H 2ALVA 4AORA 2ZTYA 1O3CA 1EB2A 5DP9A 3E16B 1C1UH 1AZ8A 4MTBA 1XXFA 4FUDA 2F9NA 3HKIB 1VZQH 4DVAU 2ZCLP 4O97A 3MYWA 1OS8A 4ABBA 1O5BB 2KX4A 1TGSZ 3S7KB 3SHCH 2AERH 2ZQ2A 2VWMA 1GJ9B 2QE7D 2ESTE 3VEQB 1VGCB 4NIWA 4X2VA 2H9EH 2C4FH 2A4GA 3UPEA 2UUKB 1A4WH 2FX4A 1GDQA 2WYGA 2ZTXA 1GHAF 3TJNA 1SQRA 2BVXH 2Z94A 4A1TA 1DSUA 1BA8B 1BDAA 3MHWU 1H8ED 1NRRH 2UWLA 3BV9B 3KYGA 1E0FD 1LO6A 3UR6A 3VFEA 1GI8B 2OUAA 1GBFA 1ZHPA 5HMAA 1ETRH 1RS0A 3RXVA 2P94A 1ELCA 3SJ9A 3ZVBA 5A09A 1BJVA 5HIYA 4ABDA 1QJ1B 2VGCC 1HPGA 1SGNE 1GBAA 2AIPA 2K8IA 1SGQE 3M7UA 4JK6A 3RXJA 5GWZA 1KY9A 1PFXC 1T8NA 3CP7A 5C3NA 2F9UA 4Q7ZA 2GD4B 1WAYB 3BTFE 3QTVH 2UUYA 3S69A 1SGDE 3EA7A 2XNIA 1T32A 1ZHMA 4UDWH 1HJ9A 1LCYA 2AYWA 1EP5A 1GJ4H 1OWJA 1W0ZU 2KAIA 4AZ2B 2BY7X 1J17T 1NM6A 4MNXA 1HV7A 4IC6A 5C2ZA 2H9TH 1FV9A 1JWTA 2QIQA 1O38A 2H5CA 4F48B 3DHKH 5HGGA 1DFPA 4H4FA 2BVSH 3P8NA 1GHBF 1ZPBA 4ISIH 3RXOA 3UWIA 1A0HB 4JZFH 5EJZA 1A5GH 2VBCA 3TIUA 1DPOA 6LPRA 3S9CA 1HJAC 4ZMAH 4IMQA 3E0PB 1CA0C 4F55A 1ARBA 2TBSA 2XBWA 1GBDA 1TBZH 4HFPB 3WWBA 3AW0A 5E8EH 2KFWA 1SGFA 3PTBA 1EZQA 1MTNC 2A2XH 2GJGA 2CMYA 1A3BH 1NU9A 1SC8U 2H2ZA 2FP7B 3E1XB 1G3DA 1D3QB 2PGQB 2GP9B 5DPAA 1WQVH 2HALA 3RXHA 5DN6D 2PHBA 1W0JD 3ELAH 2RDLA 1JOUB 4OS2A 1EAIA 1G9IE 2GVFA 2ZNKH 1ZPZA 1T8OA 2HLDD 1C5NH 2XCNA 4X8TH 5F6MA 1G32B 2WPDD 1P9UA 3ZZ5A 3C1KA 3ZIAD 2J92A 1G30B 1ZYOA 5FX5A 1EX3A 3UQVA 1E1RD 4SGBE 2AGEX 1EKBB 4F4OC 4Z1MD 1V2TT 1T8LA 2KM0A 2P3UB 2W6ID 4X2WA 4X6MA 1ZRKA 2A31A 1S0QA 1NFWA 4Y10E 1L4DA 4X1SU 1NRNH 3S9AA 2IOTA 1O2UA 4KTSA 1O3EA 1CGJE 4AYYB 3RXRA 4LZ1H 1C2IA 2QF3A 4JYTA 6ESTA 3IG6B 1VITF 2AMQA 2BZAA 1VKYA 2OP9A 5KECA 1FY8E 1GBIA 2F43B 2ZQ1A 1S6FA 1HBTH 1RTFB 1F0SA 2A4OA 3LH3A 4YT7H 1SFQB 3STIA 1SLXB 2R2MB 2VIOA 3U8OH 1TBRH 1Z6JH 1SLVB 1YPGH 2D2DA 4FUGA 1DWCH 1THSH 1ZJKA 1KLJH 3KF2A 4ABAA 1TAWA 2J5UA 3LJJA 3LGYA 1P57B 2FI3E 2ZFTA 1C1SA 2NU1E 1DY9A 1WDIA 1O37A 4X6PA 1GJAB 3UNRA 2WV5A 3IITA 2W3IA 1H9HE 4X8VH 2R3YA 4K3JA 2BY8X 3PMBB 1NS3A 3L6PA 1O3AA 2PGBB 4GPGA 1YKTA 2ZPSA 1K1LA 3LONA 3M5OA 1YPHE 1GDNA 1DANH 3DUXH 4XFQA 2JH5D 1QJ7B 4CHAC 5LH8A 4GHQA 2IJD1 4BAKB 4H42U 2FZZA 5T3HA 3SI4H 4Q2KA 4X0WU 1KDQA 2Z9GA 1UVTH 1UTLM 2J4IA 2P59A 2WV9A 3PV5A 4BTUB 3ZVAA 5JB8S 1XKAC 3CS7A 1HXEH 1DT2A 3D23A 1N6XA 1O5GH 3TITA 3KL6A 3SZEA 1DE7H 3A80A 2BLOA 4YOJA 2YMSC 1IAUA 2AH4X 4DG4A 2QF4A 1QJ6B 1MKXH 4U32A 1B5GH 3FP7E 5LGOA 2XBVA 1BTUA 1LKBA 3T2NA 4IBLH 2OC1A 2ZO3H 2AIQA 3A86A 5F03A 1BRUP 3A81A 1ETSH 1ZTKA 2FOFA 1V2JT 2BD3A 1BRAA 5CHBA 2GV7A 3W1EA 3RMLH 2BTCE 1H9IE 1HB0B 3FKSD 1O34A 2XWBI 4FVDA 3A7YA 1WOFA 3A83A 2BDBA 1AMHA 1ZTLA 1P06A 3LDXH 1O2ZA 5CDFE 3Q77A 2VU8E 1SHYA 1DS2E 4K1SA 2VVCA 1WXRA 4JMYA 3TK5A 1GI3A 2PWXA 5E2OA 1O2TA 3QN7A 2BX3A 3SQEE 1AFQC 1EAUA 2FODA 3P95A 2RFKC 2P95A 5L6NH 1BBRH 2WYJA 3FANA 1C2GA 5DJ7A 2GKVE 2STBE 1HGTH 5ETXA 1MABB 2PUXB 5J4QA 3A7XA 1MCVA 1P2OA 1QCPA 1OWDA 2VIQA 3LU9B 3FN8A 3MFJA 5FCRA 1UK2A 1EZUC 5C1UA 1LVMA 7LPRA 1NZQH 4E05H 3E91A 1YC0A 1UTQA 4THNH 1C4V2 1PPZA 1O2IA 2XC5A 4ZHLU 1TPPA 2C8YB 1N8OB 4XBBA 1XUGA 2HWLB 4D7FA 1KTSB 1O2WA 1GMDG 3A7ZA 3MTYA 3SNEA 4YTAA 5EPYA 4FXGH 6CHAC 3L3TA 1LPKB 1C5LH 4O9VA 1TX7A 2I6SA 1BTXA 1XM1A 2PV9B 3QGNB 1CQQA 2OC0A 1DSTA 1RRKA 2GV6A 1A0JA 3N7EA 3SO3A 2FOHA 1O2XA 1TNKA 4CH2B 3UB0A 4BXWA 6GCHF 1C2DA 2FOMB 4KP0A 4K8BA 2VWLA 3A8BA 4UFDH 5TCCA 8GCHF 3ZZ4A 4BAOB 5A8ZA 4NA8A 3V12A 2PP6A 5ESTE 1C1NA 4H6SB 4XRNA 2PTCE 1V2WT 3RLWH 3UWJH 1BMFD 2ZA5A 3TGJE 1OP0A 1O2PA 5EW1H 5AHGH 3W95A 1HJAB 2YMSD 3KYFA 2WPKS 4NIXA 1F5KU 1JMOH 1W14U 3M3VA 4GHTA 1UVPA 1BQYA 5HYOA 2A5AA 4OS4A 3GCHC 1A61H 3OU0A 3SU0A 2WHXA 1P12E 3FZZA 2Y5GA 1EJAA 1O3IA 2Y80A 4M7GA 2KCAA 1PQAA 1SQTA 3EDXB 3ZVEA 1V2NT 2ZCKP 5DP6A 2A5IA 5AFZH 5GDSH 4A6LA 4Y71A 1W0KD 3SGQE 2J9NA 3TLOA 2QXHA 1H8HD 1RD3B 1E79D 3A89A 1ZMJA 2QC2A 2ZF0H 2BLWA 1C9PA 1VR1H 4RN6A 1AD8H 1EQ9A 1UTPA 1YM0A 4ABEA 3QZRA 3T27A 1TABE 3NWUA 1EJNA 1C5VA 1NPMA 1AVXA 1N8OC 2ANKH 4MPUA 2YOLA 3LGTA 4I8HA 1BITA 2D26C 4X2YA 3LGIA 2VH6A 3BTKE 2SGAA 2ZDLA 1BTYA 1BHXF 1FLEE 1LVBA 4KELA 1V2PT 1WCZA 2AEIH 3RXEA 2FIRH 3GDUA 5EXLA 5JDUB 1TONA 1MKWH 3DSGA 1NESE 1K0HA 2ODPA 1EZXC 1QY6A 3O8DA 4AG2A 1FONA 2Y7ZA 2ZEBA 2ZGBH 3A87A 4IGDA 2Q6GA 3EYDA 2O8TA 3GYLB 2XRCA 1C9TA 4ISHH 3NK8A 1AWFH 1TNHA 3E6PH 1AVWA 1OWEA 1EFRD 2R3UA 2QF5A 4B74A 5EJLA 1GHXH 4INKA 4WH8A 4MPVA 1H9LB 1O3PB 1XX9A 1YLCA 3URDA 2KCYA 1MH0A 4K8YA 1YLDA 2H6MA 2D8WA 4ZKSU 3U1IB 1BJUA 5C5NA 1MU6B 1DUEA 5FAHA 2RA0A 2ULLA 3LGVA 3OY5U 2O8LA 1KMHB 1VITH 1TGBA 3ZYDA 4Z0KA 1T4VH 2JH0D 1DUAA 4O3TA 4A1VA 4GVUA 4DIHH 3LGUA 3GDVA 2CHAB 1G3EA 1GJ6A 2XBYA 2FYQA 4UD9H 1N1LA 1CVWH 1TPSA 3RXLA 1W3CA 2GCHF 4ZAEA 3SNDA 3VGCC 3A82A 1LVYA 1FN8A 2VJ1A 2Y81A 2JDID 1C5UA 1GBKA 1UW7A 2G51A 3PM3A 3VB6A 1GBEA 4KTUA 2PTNA 5H4IB 2PKAB 2ZDVH 1V2MT 4AFQA 1UVOA 2BY6X 2EY4C 3SI3H 6GCHG 2V3MA 3TNSA 2Y5HA 3ATLA 3RMMH 5GCHG 5T6FA 4DURA 4Y7AA 1AB9B 2BM2A 3KQBA 2QGRA 4H6TA 1FDPA 5E2PA 2B0FA 2QXGA 3M7QA 4K69A 1ANDA 3GCHB 1S84A 3PMHB 4GUXA 4CRAA 2XC4A 3GCTF 2ALPA 1FUJA 4FUCA 1OSSA 1SGCA 3M61U 1C1RA 4OGXA 1CE5A 4M9FA 1UK3A 1PQ8A 1L4ZA 1P2MA 3ITIA 3URCA 2SNWA 2RA3A 3SJIA 2BYAX 4Y8XA 2Z3DA 1B7XB 1ACBE 4DY7B 1O2KA 3WWFA 4I8LA 1DXWA 1QA7A 2AHME 5FPSA 3AW1A 5DP4A 1DY8A 3TJVA 4AFZA 1JBUH 2CF8H 1NRSH 5T6GA 1YYY1 1P0SH 3EGKH 1GI4A 3PLPA 3RXUA 3DCLA 1GMCF 2XNDD 4YT6H 1P2QA 2ZHWH 3TH4H 3BTHE 4JYVH 1O33A 2FTLE 5K0HA 5B6LA 2R0KA 3RXAA 5SGAE 1P02A 1P3CA 1SR5C 5CE1A 3TGKE 1GCTC 1GWAA 3TNTA 4HTCH 4IMZA 1L1GA 1H1BA 1C5ZB 1O3NA 1TRNA 3RXIA 3N99A 2DUCA 7GCHF 3ZZDA 1MQ6A 2FOCA 2ZPQA 3V13A 3BF6H 1IQLA 2W5EA 4CRDA 1SG8B 1GBHA 1TLDA 1RTLA 2GMTC 1MTNB 4DJZB 1XUKA 3ZZ7A 4J1YA 1O30A 1O3FA 1TNJA 1G2MA 1P04A 2ZFFH 1NFUA 4XDEA 2BY5X 4WY3A 4NIVA 1Y5UT 4MNWA 3F0OA 1G3CA 5LPFA 3UQOA 1Z71A 1AY6H 3HATH 4DGJA 3DFLA 8GCHG 4FUJA 3LGWA 1PPGE 4MNVA 3U8RH 1C5MD 3ZVDA 2A45B 1Y3WA 1NY22 2CF9H 2R2WU 1AN1E 4OS1A 1ZR0A 1FI8A 1FPCH 1RFNA 1GI0A 1LHCH 2R0LA 4CBOA 1NN6A 5EG4A 2H9HA 2BD2A 2GGVB 2ANYA 3GY7A 3PWCA 1HAOH 3QZQA 4BXSA 3RXTA 3BTGE 1QRZA 2JJ1D 2FYRA 3RMNH 3OY6U 1XUIA 4Y8YA 2IPHA 3GICB 5LPEA 4UE7H 1ZJDA 3TH2H 2G4UA 5JBTA 4Y79A 1DITH 3M5NA 1O2QA 5B6OA 1UTMA 4XBCA 1F92A 1BUIA 3ZVFA 4UEHH 5EXMA 3NCLA 4FVBA 1HCGA 4I7YH 2QAAA 3OFND 1MU8B 1C2HA 3K6YA 4VGCB 1KXEA 5F8XA 1CT4E 3GCTG 4NA7A 1K1NA 4AFUA 1SGEE 1QQ4A 3OYPA 1BTWA 2WZQA 3RXFA 3HGNA 3NZIA 3D65E 4MPXA 3UIRA 1ZMNA 3CNRA 1E36B 1Z8GA 1C1WH 1C4Y2 1FY4A 1HFDA 3F3BA 1GHBG 2CV3A 2XTTB 5EIYA 4BOHA 3F2HA 1UCYK 2JH6D 3PROA 2GCTC 4Q7XA 1Z8IB 2FX6A 2ZGHA 4XBDA 2Z9IA 1SLWB 4FUIA 1HRTH 2FLBH 2KAIB 1MTWA 4BTTB 1C1VH 4UFFH 1NBMD 2FOGA 5KGOA 1GPZA 1EP6A 1DXPA 3CENA 3GY3A 1T31A 3SUFA 2BQ6B 2GTBA 1MTUA 5JBAS 2P8OC 3FO8D 1GVZA 5DP8A 1J9CH 1F0TA 2JETC 1TPAE 4AOQA 1UK4A 1FNIA 1SGPE 1TPOA 2GCTB 5DKMA 5JB9S 1VITG 2TGTA 2O8UA 1QB9A 2A7JA 4WXIA 4NSYA 1QNJA 2FM2A 3TJOA 3SUEA 1GMHF 3VXFH 3MU5A 4WMEA 5FCKA 3T25A 1WBGB 1WSSH 1EAXA 2V6NA 2ANMH 1BMNH 1YCPK 2FDAA 3TH3H 1H4WA 3P8GA 1K2I1 4QT8C 3DFJA 1F0UA 2Z3CA 1GBCA 4I8JA 4RKOB 3ZZ6A 4FETA 1A5HA 1ELFA 2BVRH 1Z6EA 3A8AA 5L2YH 4NFEA 3U98H 3SJ8A 1O3HA 4LOYH 3OSYA 3SBKA 5AF9H 3SU4A 2EQNA 2VIVA 1GL1A 4XOJA 3C27B 5E0GA 2BD9A 1SOZA 4U30A 1ELBA 5I25A 3VPKA 3U9AH 1CA8B 2G00A 2OQUA 2Z3EA 1LQEA 1BTHH 2BXUH 1CHOF 3QWCH 4NZLA 3VXEH 1A3EH 5J4SA 1S82A 4JYUH 1V2QT 3EAJA 1IOEA 1MBMA 5T1VA 1U6QA 1EASA 2GDDA 2I6QA 4X1QU 1TE0A 5HKKD 3F2FA 3JZ2B 3DSOA 1O5EH 2BY9X 1DWDH 1MCTA 2FEQH 1C5WB 2STAE 1HAXB 4AB9A 1LPGB 3F0PA 3PWBA 1A46H 1B0FA 1K28D 1VCWA 3R0FA 8KME2 3Q00A 3OE7D 1C5PA 4R0IA 2PSYA 2QN5T 5KEDA 3TK9A 3P8FA 1Y8TA 1G36A 1YPJH 2SGFE 3SN8A 5IYTA 3S7HB 2VINA 1C5SA 1KLIH 1O5AB 3MO9A 1GL0E 1LHEH 4TWWA 3H09A 3ATWA 4Q80A 1GCTB 1Z7KA 2BDAA 3KQ5A 4KGAA 1KXFA 4ZKRU 4HGCA 2C8XB 3KEEA 2C8WB 1E38B 1ZPCA 1KYNA 3D49H 3SOSA 3O8BA 1FPHH 2OBQA 1O5CB 2LNCA 2AMDA 1W0YH 2BDYA 5AFYH 2VWOA 5DSFA 2H5DA 1EJMA 1Y5BT 4YZUA 3MOCA 1A1RA 3SGBE 1UJ1A 1PYTD 5DP5A 1RGQA 2Q1JA 5C1YA 5GPIB 2AMPA 5I46H 3TVJB 4CH8B 2F9BH 4TPYA 3CS0A 3F9EA 1P2NA 1OHHD 2OXSA 3UR9A 2A4RA 2WV4A 1HJ8A 2F3CE 1DX5M 1BTPA 5CHAB 2KZ4A 3NRLA 1O2SA 3GY8A 4AGKA 4BAQB 1Z8RA 2BDIA 1G37A 1VCPA 1FIZA 3LOXA 2NU0E 1K1IA 3AK5A 1BBRE 4YLQH 1TNIA 1O3DA 3MI4A 1TIOA 4B2BA 1SI5H 2TGDA 5CMXH 1YGCH 1QURH 1M9UA 2GT7A 4ACAA 3NUMA 3QO6A 4MLFB 2IN2A 1D9IA 2BMGB 1IQIA 4R8TB 3ZZCA 1SOTA 2M5TA 2ZECA 1AUJA 3EE7A 2FXRA 2W7SA 1OKXA 1CHOG 3KHVA 5HIZA 1ZSLA 1Z1IA 2H1UA 1J15A 1DWEH 2ZDKA 1O5FH 2C8ZB 2F83A 1QTFA 1FZZA 2Z6BD 3MH5A 1AE8H 5GXPA 1ZSKA 1VGCC 4FUEA 1GJ8B 1IQNA 2VB0A 3PTNA 1MTSA 1O3GA 5A0CA 4OS6A 2XOKD 1XMNB 1C5QA 2ODYB 1K1JA 1TOMH 4FUHA 1QIXB 2XW9A 9ESTA 2EC9H 3MNSA 2OQ5A 4AN7A 4TY6A 4GAWA 1V2LT 3AVZA 1Z8JB 3RC6A 4LZ4B 3DT0H 3SU2A 1HDTH 1RIWC 3B9FH 4INHA 4SGAE 1DLEA 4I33A 1Y3YA 3U28C 3LH1A 1LDTT 4F49A 5A8XA 2BD7A 2F9PA 1O32A 4Y11E 4E7NA 1O31A 2Y5FA 1JXPA 1SGRE 5HM2A 1RIWB 1SHHB 1V3XA 1S6HA 4BAMB 5ABWA 1NU7B 3A8CA 1TRMA 1BCUH 2A32A 3UUZA 1EPTA 2PKSC 1TMUH 2JJ2D 1YLNA 4X1RU 1SLUB 2DE9A 2VVVA 2V35A 4K2YA 2CJIA 1PQ7A 2O9QA 3ATKA 1ARCA 4DT4A 5BRRE 2BQWB 3PB1E 2DE8A 1GI1A 1J16A 3V0XA 2ZHEH 1CO7E 3MU1A 1ZHRA 4WWYA 4RT0A 1D4PB 1K21H 1W13U 3LC3A 3PV4A 1FMGA 2ZHQH 3RP2A 1FQ3A 1YF4A 2HVXA 1LTOA 2ZP0H 1ZRBA 2K1QA 2F91A 1GHYH 1TNLA 2SGEE 1LQDB 5FBIA 1IQMA 4DW2U 1LKAA 1UTKA 3RC5A 1THRH 2WPMS 1S5SA 4AC9A 2PFEA 3UOUA 1QBNA 3NXPA 1GVKB 1C2FA 5GJ4B 3WY8A 3HGPA 1Y5AT 3ZV9A 3FZDA 4RT1A 5TJXA 3BIVH 3PLBA 2VNTA 5DP7A 1CT0E 1FX0B 3KGPA 5FPTA 3F2GA 2CK3D 1O3MA 3MH7A 2V3OH 4NWKA 4XSKU 2ZU3A 3RXGA 4A1XA 2GZ9A 3QK1A 3SU1A 3H7TA 1HUTH 3SORA 1IQJA 1DWBH 1EZSC 2OCVB 2WPIS 2K0QA 1MBQA 1GI6A 2EI6A 1CU1A 2J38A 1SGTA 3LPRA 5F8TA 4IC5A 2C93B 3PYHA 2QV1A 3GOVB 1O3KA 2PLXA 5FXLA 4ZHMU 3MU0A 4D8NA 2Q6FA 3KQEA 2TGPZ 2YMSB 1GI2A 1HLTH 1PPEE 1P09A 1HAPH 1SBWA 1ZLRA 4ISOA 3B8JA 3MU4A 5BPEA 1OX1A 4MDSA 1BMMH 2OC8A 1T7CA 4WMFA 4AYVB 1PPHE 4B76A 3BTDE 3DSPA 3MO3A 1GDUA 5F8ZA 4DIIH 2BD8A 2BHGA 2KCPA 2Z9KA 3MMGA 2F4LA 1OWKA 1TBQH 2Y7XA 4AB8A 4D76A 3AAVA 2A2QH 2OTVA 5IDKA 1ABJH 1GBLA 4YOIA 1PYTC 3SU3A 1UHBA 1NTPA 2UWOA 1P2JA 1SKYE 2ZFPH 3ESTA 3RU4T 4MG3A 1WTHD 3F68H 4CRGA 4CRCA 1CGIE 1TFXA 1ZMLA 3GYMA 1V2KT 4YLUA 1A7SA 3FP8E 3V3MA 3UY9A 2YNBA 2SGPE 4D9QA 4Z6AH 5DGJA 2ZU2A 4Q63A 1F7ZA 1X7AC 1E35B 1HYLA 1QB1A 4RI0A 4I86A 1OP8A 2NWNA 2Z7FE 3LIWA 1J14A 3N7DA 4O03A 5EODA 3PO1C 1RJXB 1ZZZA 4I8GA 2EI8A 4JZIA 1OPHB 1SL3A 2P8OB 4AFSA 3BTQE 1XUFA 1IHTH 4YXWD 4P02A 1PPCE 1EPTB 4ISNA 3ATMA 4NIYA 3BTTE 3M36A 4XE4A 8ESTE 1W8BH 3DA9B 1AWHB 2GMTB 3HK3B 1JIRA 4XD7D 1FIWA 4JZEH 2V7QD 2ZPRA 2ZU1A 3L33A 1FN6A 3GY6A 3SYJA 2FS8A 1TMBH 2NU3E 4ZH8A 2BLVA 3MO6A 5GIBA 3RM0H 1W10U 2HVYB 1MAXA 2FOAA 4B2CA 4X1PU 3P70B 1O2RA 2BDGA 4ABJA 3AAUA 3ODDA 3WW7A 1SGFG 4ZHAA 2GX4A 2IPQX 3RXSA 4ACBA 2HLCA 1BT7A 2FWWA 7GCHG 3F9FA 4VGCC 1GCDA 1L1NA 4X6NA 1NRPH 4A92A 2EEKA 2GZ7A 2VIPA 2AGIX 4JZ1A 3RUOA 2J95A 2R9PA 1KIGH 2Q6DA 3M3SA 1MD8A 2ZHFH 1EAWA 3BTME 2EI7A 4TWYA 1BB0B 4Y0ZE 3R3GB 2KR7A 1XVMA 4Q4LA 2Y6TA 4CR9A 2A4QA 1LHDH 3ZV8A 1GJBB 2EA3A 1EPTC 2XXLA 1TGNA 2Y82A 4ZKOU 1NFXA 1SB1H 4ABHA 2G55A 2VVUA 3ZYEA 5E0JA 5EQSA 1AFQB 1GG6C 1HAVB 1P11E 1SPJA 5A8YA 2OINA 5A2MH 3M35A 1AZZA 4WJG2 5L30H 1MAYA 1NT1A 2TIOA 2QY0B 4ZUHA 1O3OA 1C4U2 3F6UH 2HNTE 5C5OA 1E34B 1O2GH 2ZGXH 3QTOH 3RDZA 4GLYA 1O35A 1AHTH 3GY4A 3OEHD 2D1JA 5HM9A 2UWPA 3OTJE 1UTOA 3TK6A 5G4BA 3RXKA 3GCOA 3BN9A 1KXBA 1XXDA 2HRVA 4Q7YA 4YESB 1ID5H 3STJA 1TQ7B 1C2JA 1ABIH 4B2AA 1UHBB 3SHAH 3OTPA 4JZDH 3FVFB 4JK5A 3PRBA 5FL7D 1QL8A 3M37A 1ELEE 1P2KA 3F1SB 1EXFA 1WUNH 2ZU5A 2VIWA 2QYIA 3E90B 1WYKA 3QX5H 2L74A 3M3TA 1C1QA 3ZZ9A 1HNEE 2V0BA 1GHAG 4LXBH 1CBWC 1V2UT 3LJOA 1L2EA 1Q31A 3Q3YA 4NCYA 4GCHF 3T26A 1AGJA 5EOKA 1QFKH 4GSOA 1UMAH 1UCYH 2G8TA 5EQQA 4AGJA 2PW8H 1AVGH 4TYDA 4K60A 3UTUH 2FO9A 2W7UA 3VB3A 4NZQA 2BOKA 2JIZD 4FU8A 1KSNA 2C90B 3ODFA 4ZXXH 1MD7A 3ATIA 4K1TA 3U69H 1V2OT 2WPLS 4BAHB 3QDZB 1Y3XA 1O2YA 3SUDA 3ZVGA 2GZ8A 5T6DA 5FPYA 4E7RG 5EJ1A 3A8DA 3N7OA 1S6LA 1H8IH 1OP2A 3MQKC 4FOUC 3G01A 2BQ7B 1C5YB 2ZI2H 1OWHA 1GBJA 1P8VC 3SQHE 2TPIZ 1SGYE 4OM9A 3K6ZA 1JRTA 3P17H 5CHAC 1QBOA 2XWAA 2QXJA 1WV7H 1SMFE 4BNRA 3SV8A 1D6WA 5JPMH 1YPKH 4B75A 2ZGJA 1ZGIA 1IHSH 2FS9A 3T5FH 1C5TA 1Y59T 1AO5A 5JBCS 3M5LA 1OXGA 2QF0A 4NWLA 3SUGA 1YPLH 3SV6A 3UFAA 1OYQA 4HZHA 4DOQA 2ANWA 3FAOA 1ELAA 1YPMH 4B73A 1O2HA 4OS5A 3MNXA 5LPRA 1GHZA 2P93A 5DK1A 5C94A 2CHAC 1NC6A 4ISLA 3S9BA 2PKSB 3TPIZ 1YWUA 1QRXA 2FTMA 3UREA 7KMEH 3UOPA 1N6YA 2A7HA 2WPHS 1JRSA 1ZSJA 4NGAH 3SJOA 4TPIZ 1C5OH 1PJPA 2WINI 3GS9A 1FY5A 1BHXB 1HAIH 1H8DH 2F9OA 5C67A 2LP6A 1EOLA 1DOJA 1E1QD 1BZXE 1TMTH 1TGCA 1DICA 1XKBC 2KCOA 2AFQB 4DCDA 1GBBA 1SGIB 2AGGX 3QUMP 5JBBS 1P03A 1CT2E 2XBXA 1O36A 2HPQH 1FXYA 1O2OA 3OX7U 2B5TB 1K9OE 1ORFA 3A7TA 1TYNA 2M2AA 3D62A 3I29A 4AX9H 2YNAA 1GI7B 2UUJB 1CSOE 2FPZA 3RXQA 3LKWA 1BOQA 1ZGVA 1DM4B 5FHTA 1C5XB 1EOJA 5DP3A 1D3PB 2HPPH 1SSXA 2ZDAH 1BRCE 2SGQE 2VGCB 1ESAA 3RMOH 1AB9C 4OGYA 3RU4D 4KTCA 4I8KA 1C5RA 2C3SA 4IS5A 1K1OA 1WTGH 1Y3UA 4FU9A 4BANB 3PLKA 1F0RA 1CHGA 1PPFE 3O8CA 1AE5A 3IWMA 3SNAA 3RXBA 5EPNA 3M5MA 2ZGCA 1INCA 1CBWB 1KDQB 1MQ5A 1IQFA 2L6OA 2NU4E 3BSQA 1HIAA 2J98A 3BTWE 3OEED 3BG4B 3T62A 1QL9A 3SV9A 5AVDA 9LPRA 3OAAD 1C2EA 2HNTF 2VH0A 1O3JA 1FY1A 2HOBA 3O8RA 4NFFA 1TB6H 3A88A 3Q3XA 1V2VT 5EGMA 1EUFA 2ZTZA 4UFGH 1GVLA 2PUQH 1Q3XA 3RXPA 2RDEA 2CN0H 5C0UA 3P8OA 1O3BA 3EQ0H 4I32A 2THFB 1LPZB 4NA9H 1GGDB 1HAGE 1S81A 1K1MA 1KTTB 5F53A 4DT7B 2XCFA 5IK2D 2OLGA 3KCGH 4P00A 4FUFA 3TU7H 1YCPH 5HXFA 4A7IB 1HAYB 1LMWB 1GBMA 3ZZAA 2ZDNA 2BD4A 1AUTC 1TALA 1W7XH 4CRFA 5GCHF 2ZZUH 2QCYA 4X8UH 1W12U 3DD2H 4IN2A 1VJ9U 1A0LA 3BG8A 7ESTE 1O2JA 3KIDU 2ZC9H 4HG6A 1RXPA 1W2KH 2G81E 1OOKB 3BEIB 1MUEB 1NROH 3P92A 4NSVA 1KLTA 1O2NA 1K1PA 2A1DB 4I31A 4INLA 3TJUA 3I77A 4HI3A 5K7RA 5C0TA 1GG6B 4ZKNU 1AU8A 4WH6A 1D3DB 1TA6A 4U2WA 1D3TB 4O3UA 2TRMA 1Z1JA 4YOGA 1FAXA 1W11U 3I78A 4X8SH 3VB4A 4BTIB 1V6DA 1IQEA 1UCYE 1VCQA 1AKSB 4LK4A 1P05A 3VGCB 1YBWA 3JZ1B 1SQOA 3NKKA 2A0QB 4FUBA 4X2XA 4K5ZA 4YO9A 3GDSA 3SU5A 4YM9A 5JYIA 3HK6B 1HXFH 2PR3A 2A5KA 1CA0B 1WQSA 1GJDB 1O3LA 2FOEA 1GI5A 2WSSD 1XUJA 1IQGA 1QQUA 1C1OA 1ETTH 3M7TA 2JKHA 2RCEA 2BLQA 1AFEH 2J97A 3F9HA 3SGAE 1BIOA 1NBME 1NFYA 1E37B 1NO9H 2SNVA 1C2LA 3SNCA 5EW2H 3PMAB 4WMDA 1T8MA 3GCNA 4X1NU 2WPJS 1PQ5A 2J94A 1GBTA 1QRWA 2SFAA 2GDEH 1G3BA 1UVSH 1VJAU 2ILNA 2ASUB 3U8TH 1QZ8A 2JETB 2OC7A 2ZDMA 3NPSA 4ASHA 2BD5A 1TX8A 1AQ7A 1MZDA
chains in the Genus database with same CATH topology
3SU6A 2ZU4A 3HKJB 2ZCHP 3SV7A 4UFEH 5EQRA 3AASA 3E0NB 4RSPA 1TA2A 1AIXH 3BIUH 3F9GA 1GJCB 2ZFSA 2CXVA 5PTPA 3T28A 1PPBH 2FOBA 1GHVH 2F9VA 3V7TA 1SVPA 1HIAB 4AG1A 2Z9JA 3VB5A 3ZZBA 1MKXK 3GY5A 4E06H 2CGAA 5ESBA 1FAKH 1P9SA 1Y3VA 1HAHH 2P3TB 4RKJB 1CGHA 1MTVA 3MNBA 2A7CA 1A5IA 1C1MA 1D6RA 3RC4A 3SNBA 1BRBE 1RTKA 4MPWA 3RU4E 3QGJA 2QXIA 4CHAB 2G5VA 3HPTB 3MH4A 1KXCA 2NU2E 4CR5A 1ANCA 2UUFB 1ZTJA 4Y7BA 2XC0A 2LPRA 2BOHB 1V2RT 5L2ZH 1K22H 1SFIA 3Q3KA 2P3FH 1TQ0B 2SGDE 2O8WA 1P2IA 4Y76A 5DG6A 3RLYH 1L0ZA 3E3TA 1GJ5H 2G52A 2VWNA 2B8OH 2QA9E 1B0EA 1QL7A 1GHWH 1HAZB 2FMJA 3E8LA 3SZNA 3SJKA 1C1PA 1Q2WA 1JIMA 1S83A 1ELTA 5EXNA 1ANBA 1GJ7B 1P3EA 1TX6A 1QBVH 4WVPE 4ABFA 1C1TA 4CBNA 4U01A 3A85A 1GGDC 2HNTC 1T4UH 3GISB 1IQHA 4CRBA 3U1JB 5C1XA 2RG3A 5FX6A 2VIDA 1C2MA 3RXCA 2G4TA 2B9LA 3BTEE 3UNQA 1AKSA 1BMLA 1AI8H 2BXTH 5A0AE 2BX4A 3BEUA 4FU7A 2TGAA 3A84A 3K9XB 2OD3B 1WU1A 1QHRB 4A5TS 2BDCA 1THPB 2ZKSA 3BEFB 1UVUH 4B1TA 2ODQA 1L1JA 6CHAB 2BDHA 2AS9A 2PSXA 1V2ST 3B23B 2FI4E 1ESTA 2J34A 2BB4A 3LC5A 1MMJN 1O2VA 1YCPM 1TWXB 3ZZ8A 1P10A 3KQDA 5DO4H 1J8AA 5TCAA 1EB1H 4IN1A 1OYTH 2XYAA 2PKAA 4ZROA 1P01A 1C2KA 2O8MA 2B7DH 4OS7A 2J2UA 4Y8ZA 5A0BA 4D9RA 1UO6A 1ELGA 2GCHG 1F5RA 3VB7A 3K65B 1GMDF 4K1EA 4WF8A 3K2UA 2G5NA 1GMHG 1W7GH 1UTNA 3KN2A 1DLKB 4TY7A 3S0NA 1UTJA 1KXAA 1G2LA 2V3HH 5C20A 2P16A 2W3KA 3H5CB 3EA9A 3SW2B 1A2CH 1S0RA 2OBOA 2Z9LA 3PMJA 3ZVCA 3TGIE 3LT3A 2W26A 4JCNA 1BMAA 4KKDA 1FJSA 3PO1B 4MVNA 1QB6A 3RM2H 4UONA 3FP6E 3W94A 3QLPH 1IQKA 3EE0B 3MWIU 1O0DH 2HGTH 3RXMA 2FESH 2WUBA 1ELVA 3MNCA 2BZ6H 4ESTE 2ZG0H 4MQAA 2IJOB 1ELDE 3MH6A 4WXVA 1YP9A 1DDJA 1TNGA 4Y6DA 1O5DH 4MNYA 8LPRA 1ANEA 2ZFQH 4ABIA 1QA0A 1LHFH 3FFGA 1SQAA 2ZHDA 3BG4C 1S85A 1OWIA 4B71A 4ABGA 1LVOA 1XUHA 1NRQH 1DVAH 1TOCB 1YPHC 1BTZA 3Q76A 1TRYA 3KNXA 1KXDA 3RXDA 1O2LA 1BBRK 3A7VA 4D7GA 1O2MA 1QGFA 1F5LA 1ZOMA 4J2YB 1MZAA 1XVOA 4IW4E 3UNSA 3EA8A 2ZWLH 1ESBA 4X6OA 3SV2H 1MKWK 5E0HA 3MU8A 2ZIQH 3T29A 1O39A 3A7WA 5EU8A 1QR3E 2ZFRH 2FLRH 3H7OA 1F2SE 5FBEA 1LHGH 1TGTA 4Y0YE 1YPEH 3ZZ3A 1EATA 4GCHG 4PROA 2WUCA 1HAVA 3ENSB 4CREA 2GT8A 4ZXYH 1GI9B 3GY2A 3P6ZB 1GMCG 2FI5E 3KQCA 1FY3A 4NG9H 2ALVA 4AORA 2ZTYA 1O3CA 1EB2A 5DP9A 3E16B 1C1UH 1AZ8A 4MTBA 1XXFA 4FUDA 2F9NA 3HKIB 1VZQH 4DVAU 2ZCLP 4O97A 3MYWA 1OS8A 4ABBA 1O5BB 1TGSZ 3S7KB 3SHCH 2AERH 2ZQ2A 2VWMA 1GJ9B 2ESTE 3VEQB 1VGCB 4NIWA 4X2VA 2H9EH 2C4FH 2A4GA 3UPEA 2UUKB 1A4WH 2FX4A 1GDQA 2WYGA 2ZTXA 1GHAF 3TJNA 2BVXH 2Z94A 4A1TA 1DSUA 1BA8B 1BDAA 3MHWU 1NRRH 2UWLA 3BV9B 1E0FD 1LO6A 3UR6A 3VFEA 1GI8B 2OUAA 1GBFA 1ZHPA 5HMAA 1ETRH 1RS0A 3RXVA 2P94A 1ELCA 3SJ9A 3ZVBA 5A09A 1BJVA 4ABDA 1QJ1B 2VGCC 1HPGA 1SGNE 1GBAA 2AIPA 1SGQE 3M7UA 4JK6A 3RXJA 5GWZA 1KY9A 1PFXC 1T8NA 3CP7A 5C3NA 2F9UA 4Q7ZA 2GD4B 1WAYB 3BTFE 3QTVH 2UUYA 3S69A 1SGDE 3EA7A 2XNIA 1T32A 1ZHMA 4UDWH 1HJ9A 1LCYA 2AYWA 1EP5A 1GJ4H 1OWJA 1W0ZU 2KAIA 4AZ2B 2BY7X 1J17T 1NM6A 4MNXA 1HV7A 4IC6A 5C2ZA 2H9TH 1FV9A 1JWTA 2QIQA 1O38A 2H5CA 3DHKH 5HGGA 1DFPA 4H4FA 2BVSH 3P8NA 1GHBF 1ZPBA 4ISIH 3RXOA 3UWIA 1A0HB 4JZFH 1A5GH 6LPRA 3TIUA 1DPOA 3S9CA 1HJAC 4ZMAH 4IMQA 3E0PB 1CA0C 1ARBA 2TBSA 2XBWA 1GBDA 1TBZH 4HFPB 3AW0A 5E8EH 1SGFA 3PTBA 1EZQA 1MTNC 2A2XH 2CMYA 1A3BH 1NU9A 1SC8U 2H2ZA 2FP7B 3E1XB 1G3DA 1D3QB 2PGQB 2GP9B 5DPAA 1WQVH 2HALA 3RXHA 2PHBA 3ELAH 2RDLA 1JOUB 4OS2A 1EAIA 1G9IE 2GVFA 2ZNKH 1ZPZA 1T8OA 2XCNA 1C5NH 4X8TH 5F6MA 1G32B 1P9UA 3ZZ5A 3C1KA 2J92A 1G30B 1ZYOA 5FX5A 1EX3A 3UQVA 4SGBE 2AGEX 1EKBB 4F4OC 1V2TT 1T8LA 2P3UB 4X2WA 4X6MA 1ZRKA 2A31A 1S0QA 1NFWA 4Y10E 1L4DA 4X1SU 1NRNH 3S9AA 2IOTA 1O2UA 4KTSA 1O3EA 1CGJE 4AYYB 3RXRA 4LZ1H 1C2IA 2QF3A 4JYTA 6ESTA 3IG6B 1VITF 2AMQA 2BZAA 2OP9A 1FY8E 1GBIA 2ZQ1A 1S6FA 1HBTH 1RTFB 1F0SA 2A4OA 3LH3A 4YT7H 1SFQB 3STIA 1SLXB 2R2MB 2VIOA 3U8OH 1TBRH 1Z6JH 1SLVB 1YPGH 2D2DA 4FUGA 1DWCH 1THSH 1ZJKA 1KLJH 3KF2A 4ABAA 1TAWA 3LJJA 3LGYA 1P57B 2FI3E 2ZFTA 1C1SA 2NU1E 1DY9A 1O37A 4X6PA 1GJAB 3UNRA 2WV5A 3IITA 2W3IA 1H9HE 4X8VH 2R3YA 4K3JA 2BY8X 3PMBB 1NS3A 3L6PA 1O3AA 2PGBB 4GPGA 1YKTA 2ZPSA 1K1LA 3LONA 3M5OA 1YPHE 1GDNA 1DANH 3DUXH 4XFQA 2JH5D 1QJ7B 4CHAC 5LH8A 4GHQA 4BAKB 4H42U 2FZZA 5T3HA 3SI4H 4Q2KA 4X0WU 1KDQA 2Z9GA 1UVTH 1UTLM 2J4IA 2P59A 4BTUB 3ZVAA 5JB8S 1XKAC 3CS7A 1HXEH 1DT2A 3D23A 1N6XA 1O5GH 3TITA 3KL6A 1DE7H 3A80A 2BLOA 4YOJA 1IAUA 2AH4X 4DG4A 1QJ6B 1MKXH 4U32A 1B5GH 3FP7E 5LGOA 2XBVA 1BTUA 1LKBA 3T2NA 4IBLH 2OC1A 2ZO3H 2AIQA 3A86A 5F03A 1BRUP 3A81A 1ETSH 1ZTKA 2FOFA 1V2JT 2BD3A 1BRAA 2GV7A 3RMLH 2BTCE 1H9IE 1HB0B 1O34A 2XWBI 4FVDA 3A7YA 1WOFA 3A83A 2BDBA 1AMHA 1ZTLA 1P06A 3LDXH 1O2ZA 3Q77A 2VU8E 1SHYA 1DS2E 4K1SA 2VVCA 4JMYA 3TK5A 1GI3A 2PWXA 5E2OA 1O2TA 3QN7A 2BX3A 3SQEE 1AFQC 1EAUA 2FODA 3P95A 2P95A 5L6NH 2WYJA 1BBRH 3FANA 1C2GA 5DJ7A 2GKVE 2STBE 1HGTH 5ETXA 5J4QA 2PUXB 3A7XA 1MCVA 1P2OA 1QCPA 1OWDA 2VIQA 3LU9B 3MFJA 5FCRA 1UK2A 1EZUC 5C1UA 1LVMA 7LPRA 1NZQH 4E05H 3E91A 1YC0A 1UTQA 4THNH 1C4V2 1PPZA 1O2IA 2XC5A 4ZHLU 1TPPA 2C8YB 1N8OB 4XBBA 1XUGA 2HWLB 4D7FA 1KTSB 1O2WA 1GMDG 3A7ZA 3MTYA 3SNEA 4YTAA 5EPYA 4FXGH 6CHAC 3L3TA 1LPKB 1C5LH 4O9VA 1TX7A 2I6SA 1BTXA 1XM1A 2PV9B 3QGNB 1CQQA 2OC0A 1DSTA 1RRKA 2GV6A 1A0JA 3SO3A 2FOHA 1O2XA 1TNKA 4CH2B 4BXWA 6GCHF 1C2DA 2FOMB 4KP0A 4K8BA 2VWLA 3A8BA 4UFDH 5TCCA 8GCHF 3ZZ4A 4BAOB 5A8ZA 4NA8A 3V12A 5ESTE 1C1NA 4H6SB 2PTCE 1V2WT 3RLWH 3UWJH 2ZA5A 3TGJE 1OP0A 1O2PA 5EW1H 5AHGH 3W95A 1HJAB 2WPKS 4NIXA 1F5KU 1JMOH 1W14U 3M3VA 4GHTA 1UVPA 1BQYA 5HYOA 2A5AA 4OS4A 3GCHC 1A61H 3OU0A 3SU0A 1P12E 3FZZA 2Y5GA 1EJAA 1O3IA 2Y80A 4M7GA 1PQAA 1SQTA 3EDXB 3ZVEA 1V2NT 2ZCKP 5DP6A 2A5IA 5AFZH 5GDSH 4A6LA 4Y71A 3SGQE 2J9NA 3TLOA 2QXHA 1RD3B 3A89A 1ZMJA 2QC2A 2ZF0H 2BLWA 1C9PA 1VR1H 4RN6A 1AD8H 1EQ9A 1UTPA 1YM0A 4ABEA 3QZRA 3T27A 1TABE 3NWUA 1EJNA 1C5VA 1NPMA 1AVXA 1N8OC 2ANKH 4MPUA 2YOLA 3LGTA 4I8HA 1BITA 2D26C 4X2YA 3LGIA 2VH6A 3BTKE 2SGAA 2ZDLA 1BTYA 1BHXF 1FLEE 1LVBA 4KELA 1V2PT 1WCZA 2AEIH 3RXEA 2FIRH 3GDUA 5EXLA 5JDUB 1TONA 1MKWH 1NESE 2ODPA 1EZXC 1QY6A 3O8DA 4AG2A 1FONA 2Y7ZA 2ZEBA 2ZGBH 3A87A 4IGDA 2Q6GA 3EYDA 2O8TA 3GYLB 2XRCA 1C9TA 4ISHH 3NK8A 1AWFH 1TNHA 3E6PH 1AVWA 1OWEA 2R3UA 4B74A 1GHXH 4INKA 4WH8A 4MPVA 1H9LB 1O3PB 1XX9A 1YLCA 3URDA 1MH0A 4K8YA 1YLDA 2H6MA 2D8WA 4ZKSU 3U1IB 1BJUA 5C5NA 1MU6B 1DUEA 5FAHA 2RA0A 2ULLA 3LGVA 3OY5U 2O8LA 1VITH 1TGBA 3ZYDA 4Z0KA 1T4VH 2JH0D 1DUAA 4O3TA 4A1VA 4GVUA 4DIHH 3LGUA 3GDVA 2CHAB 1G3EA 1GJ6A 2XBYA 2FYQA 4UD9H 1N1LA 1CVWH 1TPSA 3RXLA 1W3CA 2GCHF 4ZAEA 3SNDA 3VGCC 3A82A 1LVYA 1FN8A 2VJ1A 2Y81A 1C5UA 1GBKA 2G51A 3PM3A 3VB6A 1GBEA 4KTUA 2PTNA 5H4IB 2PKAB 2ZDVH 1V2MT 4AFQA 1UVOA 2BY6X 3SI3H 6GCHG 3TNSA 2Y5HA 3ATLA 3RMMH 5GCHG 5T6FA 4DURA 4Y7AA 1AB9B 2BM2A 3KQBA 2QGRA 4H6TA 1FDPA 5E2PA 2B0FA 2QXGA 3M7QA 4K69A 1ANDA 3GCHB 1S84A 3PMHB 4GUXA 4CRAA 2XC4A 3GCTF 2ALPA 1FUJA 4FUCA 1OSSA 1SGCA 3M61U 1C1RA 4OGXA 1CE5A 1UK3A 1PQ8A 1L4ZA 1P2MA 3ITIA 3URCA 2SNWA 2RA3A 3SJIA 2BYAX 4Y8XA 2Z3DA 1B7XB 1ACBE 4DY7B 1O2KA 1DXWA 4I8LA 1QA7A 5FPSA 3AW1A 5DP4A 1DY8A 3TJVA 4AFZA 1JBUH 2CF8H 1NRSH 5T6GA 1YYY1 1P0SH 3EGKH 1GI4A 3PLPA 3RXUA 1GMCF 4YT6H 1P2QA 2ZHWH 3TH4H 3BTHE 4JYVH 1O33A 2FTLE 5K0HA 2R0KA 3RXAA 5SGAE 1P02A 1P3CA 1SR5C 5CE1A 3TGKE 1GCTC 1GWAA 3TNTA 4HTCH 4IMZA 1L1GA 1H1BA 1C5ZB 1O3NA 1TRNA 3RXIA 2DUCA 7GCHF 3ZZDA 1MQ6A 2FOCA 2ZPQA 3V13A 3BF6H 1IQLA 2W5EA 4CRDA 1SG8B 1GBHA 1TLDA 1RTLA 2GMTC 1MTNB 4DJZB 1XUKA 3ZZ7A 4J1YA 1O30A 1O3FA 1TNJA 1G2MA 1P04A 2ZFFH 1NFUA 4XDEA 2BY5X 4WY3A 4NIVA 1Y5UT 4MNWA 1G3CA 5LPFA 3UQOA 1Z71A 1AY6H 3HATH 4DGJA 3DFLA 8GCHG 4FUJA 3LGWA 1PPGE 4MNVA 3U8RH 1C5MD 3ZVDA 2A45B 1Y3WA 1NY22 2CF9H 2R2WU 1AN1E 4OS1A 1ZR0A 1FI8A 1FPCH 1RFNA 1GI0A 1LHCH 2R0LA 4CBOA 1NN6A 5EG4A 2H9HA 2BD2A 2GGVB 2ANYA 3GY7A 3PWCA 1HAOH 3QZQA 4BXSA 3RXTA 3BTGE 1QRZA 2FYRA 3RMNH 3OY6U 1XUIA 4Y8YA 2IPHA 3GICB 5LPEA 4UE7H 1ZJDA 3TH2H 2G4UA 5JBTA 4Y79A 1DITH 3M5NA 1O2QA 5B6OA 1UTMA 4XBCA 1F92A 1BUIA 3ZVFA 4UEHH 5EXMA 3NCLA 4FVBA 1HCGA