1PQ8A

Trypsin at ph 4 at atomic resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq8A01
1SGTA 3R3GB 2UUFB 5EGMA 1K1IA 4FU7A 4YT7H 5GCHF 3FAOA 1HAGE 4UFGH 1O3GA 3MU8A 1CT4E 4ZAEA 2BD5A 2A7CA 1V2WT 4HZHA 4LZ1H 1U6QA 3RC6A 2XXLA 3RXGA 1FN6A 2QV1A 1S82A 2BDYA 1K1NA 1O2ZA 1F0TA 5F8ZA 1CHOG 4AYVB 1Z8JB 1QB1A 1K28D 5FCKA 1LHCH 2ZU5A 2ZDMA 3ZVEA 2CF8H 3QZQA 3O8DA 4Q2KA 1TQ7B 2ESTE 4OS7A 2ZPRA 1TIOA 5A2MH 3SORA 4X8TH 2AMQA 1J9CH 1FMGA 5EW2H 1O2SA 5DP6A 1TNLA 1OP0A 2C8WB 2ZWLH 3RMNH 3EA7A 2GV6A 4NIVA 2FMJA 2VH6A 4MNWA 5FHTA 1HIAA 2ZF0H 3E90B 3BTME 3M3SA 3SJ8A 1JIRA 4HGCA 3GICB 4YT6H 2WUCA 3F1SB 3NCLA 4HI3A 1BQYA 2OC0A 1K1OA 1ZRBA 4OS1A 1GG6B 1MU8B 3AVZA 1FZZA 4ABGA 3ZYEA 2V35A 3VPKA 2F9VA 1Z8GA 3P8FA 4MVNA 1C5PA 4ABDA 1SGCA 1MKWH 4CRCA 4KTSA 2SGPE 3AW0A 1BRCE 4D7GA 4LXBH 2G51A 4XBBA 3GY7A 2JH6D 2BDIA 4DJZB 3IWMA 1O0DH 3LT3A 1SGYE 1DDJA 3O8CA 1SVPA 3GY3A 1IQFA 1AWFH 3TK5A 1T7CA 1THRH 2ZIQH 4ISOA 1EAWA 4INKA 1ID5H 3IG6B 1J14A 1EJMA 2BHGA 3EE0B 3F9FA 1ZGIA 5FBIA 3LC3A 4Y0ZE 2ZHEH 4BTUB 3E1XB 1TABE 4A5TS 1IHTH 4FUEA 3SHCH 4B74A 1O5EH 1ELBA 1FY1A 3ZVAA 1KXBA 1SQTA 2AIQA 4ESTE 4K1SA 5AF9H 2VU8E 3DFJA 1HDTH 3SV8A 1JOUB 1YPMH 4WMFA 3ZYDA 1ETTH 1VZQH 4BAOB 3TH2H 4IN1A 1IQLA 2UUYA 1MKXK 3F6UH 3G01A 1PPFE 1MCTA 2CGAA 1PFXC 3K6YA 2HWLB 3ZZ4A 6CHAB 1GCTC 1SGPE 4CRFA 3KQDA 4X0WU 1XUGA 1O3MA 2OXSA 3RMMH 2VIWA 1CSOE 1E34B 4FXGH 2XBVA 5FX5A 3RXFA 1FY3A 1RJXB 2ZFQH 3SW2B 1PPBH 1TNIA 3GCNA 1O3LA 2FXRA 1O32A 1TA2A 1C1MA 1VJAU 2FS8A 4I8HA 1QNJA 4OS6A 4D8NA 5GJ4B 1V2OT 3KCGH 3VXFH 1HJ8A 4Y0YE 1LTOA 1F7ZA 1QBOA 1F5LA 4X1NU 4ABFA 1GI0A 4AZ2B 1GJ6A 3SV9A 3UOPA 1C2KA 5CHAB 3N7OA 3P8OA 1O35A 1BA8B 3TJNA 2PFEA 3ZZ3A 1SG8B 2H5CA 1WQSA 1D6RA 4OGYA 2VWOA 1ELVA 1GWAA 1O30A 4AFSA 3PMBB 1ZTJA 3T5FH 1TONA 3RU4E 1NPMA 4U32A 1Y3WA 3HPTB 2VGCC 4Z0KA 2Q6DA 1NT1A 3PV4A 2UWPA 2VIQA 4BTIB 1WTGH 1EJNA 1FNIA 1HXEH 1SBWA 4I33A 1O2LA 2BD7A 2ZCHP 1P05A 1G2LA 1P03A 1UTNA 2G4UA 2O8MA 3T27A 2ZG0H 4FUBA 4JZDH 1GDUA 1ZGVA 1HCGA 1O2UA 4NA7A 4KTCA 1OOKB 2FIRH 2FTMA 1GBMA 3PWBA 1YP9A 4BANB 2ANMH 2F9NA 2P8OB 2PKAB 1OS8A 1H8IH 2G5NA 5EQQA 2XCFA 5C67A 3E6PH 1YC0A 2BY6X 4YO9A 4UD9H 2HGTH 1O2VA 2ZGJA 2V3OH 1EZQA 3NPSA 2WYGA 1P8VC 2R9PA 1HJ9A 1NRNH 2BVRH 4NIYA 2FM2A 2A2QH 2SFAA 3SU5A 5CHAC 3D62A 3B23B 1ACBE 2NU4E 5E0GA 1P10A 9ESTA 4TPIZ 1V2RT 1O3DA 4AOQA 1MU6B 1DWBH 3GCTF 4TY7A 2BY9X 2ZHFH 4MPXA 2WV4A 1BBRE 1TOCB 2RCEA 3SUGA 3ZZCA 4BXWA 6GCHF 3URCA 2RG3A 1UTQA 5C1YA 4O3TA 1AKSB 4NGAH 2Z9JA 1QQUA 1FAXA 1UVSH 4FU9A 1GJ5H 4I32A 2SGEE 3NZIA 4CR5A 2J92A 3M36A 4K2YA 1TBQH 2Z7FE 5L2YH 3UNSA 2AIPA 2GDDA 3GDSA 4FU8A 4CHAB 1DY8A 3BTGE 4A6LA 4NSVA 4JZEH 4H6SB 1O3AA 1EZXC 2ANYA 3GY6A 1FLEE 1Y3XA 1L1JA 1IQNA 1BRAA 3PTBA 8ESTE 2TBSA 1FAKH 2C8ZB 2WPHS 3D65E 2J9NA 3KQBA 3BN9A 5JBBS 3FFGA 1GPZA 2ASUB 4MLFB 4K1TA 1LPZB 3OYPA 2EI8A 1ZR0A 1HLTH 2G81E 4YOGA 2H2ZA 1GI7B 5GXPA 1C5SA 2J94A 5FBEA 1QL8A 1ETSH 2J34A 2QAAA 2SGAA 2ZHDA 4TY6A 1GHAF 3DA9B 1BZXE 1N6XA 1TQ0B 1LVMA 1SPJA 1PPHE 4ZH8A 1H1BA 5LPFA 4AX9H 1C2FA 1TPPA 4X6PA 1F0RA 2BYAX 4UFEH 1DANH 5HM9A 1ZYOA 1GMDF 5EQRA 1GBTA 1ZJKA 3EYDA 5ABWA 2FWWA 2YNAA 3PWCA 1O2MA 1QBNA 3A7TA 1C2JA 1YLCA 1ZPZA 4B1TA 1O33A 1SSXA 3M61U 2FPZA 4K3JA 1VCWA 4NA8A 5IYTA 3H5CB 4U30A 4A1XA 1Y5AT 1XKAC 4CHAC 2JKHA 1FY5A 2A31A 4TWWA 3CENA 2JH5D 4IS5A 2P3TB 2CXVA 3RXLA 2QF0A 2K1QA 3UPEA 3RXMA 1GI9B 3R0FA 1K9OE 2PKSB 2QXJA 4AFZA 3ZVDA 1CVWH 1T8LA 1B0EA 5HYOA 2XRCA 3TK9A 1AUJA 1C4Y2 1IQHA 2Y81A 4DIIH 3RXOA 5GCHG 4ZKRU 2OBOA 7KMEH 3KF2A 2BZ6H 1P09A 1V2NT 1E38B 3RU4T 3P70B 3RXDA 1FDPA 4RN6A 2VIDA 1C5ZB 1SLVB 1HPGA 3SU4A 2XCNA 3TVJB 3SNBA 3AW1A 3LGYA 4K60A 1GI1A 1S5SA 1F92A 2BLWA 2C4FH 1ABJH 1TAWA 3FP8E 4MPUA 1C5QA 2ZECA 3PLBA 1MQ6A 4CREA 1YPEH 2F83A 3A85A 1Q2WA 3I78A 1AZ8A 4U01A 3Q76A 3TPIZ 1GVKB 1HBTH 2J95A 1TRNA 1A2CH 1GBCA 1Z1JA 3RXEA 5K7RA 1AVGH 1PQ7A 2FX6A 3SI3H 1RIWB 3LGWA 2VIPA 1L1NA 1DFPA 4UE7H 2Z9IA 1CA8B 1BTUA 1V2VT 4YLQH 2RA3A 2Y5GA 1ELDE 4OS4A 1MTUA 1NFUA 3M5MA 7GCHF 3T29A 1EB2A 1ESAA 2OTVA 2PGBB 1AB9B 1AI8H 2PKSC 4H4FA 1YCPH 2ODPA 4XSKU 2TGDA 1UVOA 2ULLA 1P12E 1G36A 3FANA 1TRMA 1C1TA 1P9SA 1T32A 1YKTA 1JXPA 1Y3VA 3QX5H 5A0AE 4HFPB 1HAOH 4PROA 1H9HE 1C2GA 3MFJA 1NU7B 3MI4A 1VITH 1NZQH 1WOFA 2J4IA 3GDUA 1PPZA 2F9OA 4RKJB 1BJUA 3ZV8A 2GT7A 3SI4H 5EU8A 1O3BA 4NIXA 3UNRA 2P93A 3A81A 3LH1A 4ZKNU 2QF3A 2R2MB 4JK6A 4ZHMU 1B7XB 2QXHA 3RXBA 1BMMH 2FOCA 1GJ8B 1V6DA 3MNCA 3U69H 1ESBA 5C20A 1GBBA 1OWHA 1QJ7B 3RMLH 4JZ1A 3ATKA 1BTHH 1P2OA 5DP3A 4RKOB 1HAVA 3RXJA 2FS9A 2PW8H 1O3JA 4IMZA 1O2TA 1C2MA 1ELGA 4IGDA 5ESBA 1RIWC 5A8ZA 1OWEA 3GY8A 3H7TA 4JYUH 4FUJA 3L6PA 4SGBE 1T31A 4GPGA 1RRKA 4IBLH 1ELEE 4FUDA 1K21H 1P01A 5L2ZH 1ORFA 1AB9C 1RXPA 1FN8A 1IQGA 8GCHF 1MD7A 1ELCA 1GJ9B 2FLBH 4AB8A 3GYMA 2FOFA 5FXLA 3I77A 1P2JA 3RXAA 1VGCB 3UY9A 5EPNA 3ATLA 5EW1H 4WF8A 2O8UA 4DIHH 3NKKA 1W14U 1O31A 1MKWK 1O3HA 2ZC9H 4I8KA 1NROH 4FUIA 1C5VA 1WAYB 1TX8A 3VB4A 2BQ7B 3GOVB 4WVPE 4X6NA 1W12U 1O3KA 1AD8H 1UVPA 2GGVB 3VB3A 1AMHA 2AFQB 3A88A 1ABIH 1GHBF 1O5CB 1XUJA 4K1EA 1C1UH 2OQ5A 1BTZA 1GGDB 4X1SU 2WPMS 1DY9A 4GCHF 1OYTH 3IITA 3VFEA 2RA0A 4XBDA 4DW2U 2F9PA 1C5OH 1GDNA 1ETRH 3VB6A 1O2QA 2GDEH 4AN7A 3MOCA 1YPJH 1OP8A 4BOHA 2THFB 1EJAA 2DE8A 2G00A 1C2IA 2P16A 3RXKA 1NY22 4FUHA 1F2SE 3JZ2B 5FPSA 2JETC 3A7VA 3Q3XA 1F0SA 3BTDE 1YLDA 2QCYA 1BMLA 1LVYA 1SGNE 2WUBA 1EX3A 2BDBA 2ZDLA 4E06H 1EOJA 1CGIE 1PPEE 3HATH 5JPMH 1VGCC 1AVXA 1BMAA 1C2DA 4X1RU 2XC0A 1VITF 3ZV9A 2Y82A 1SLUB 3BF6H 1FPHH 4UONA 5A8XA 3RLYH 1JMOH 2SGQE 3M3VA 4TPYA 2NU3E 4ZMAH 2BB4A 4JYVH 1BMNH 1AHTH 3MYWA 1TNKA 2Y80A 1P3EA 1CU1A 1LCYA 1XUFA 3VXEH 1EB1H 1O3IA 1OYQA 1RTLA 4DT7B 2QA9E 2ZGXH 4CH2B 2GCHF 2FESH 1DPOA 1N1LA 4E7RG 1ZTLA 8LPRA 1GGDC 1A3BH 2DE9A 1O5DH 1BITA 3PLKA 2QIQA 1E37B 2Z9GA 5HM2A 1KSNA 3GCTG 3TU7H 3SNCA 4DCDA 4ABBA 1HFDA 1W13U 1DWEH 2GTBA 3UQVA 1P2KA 3SU3A 3V7TA 1C1QA 1EAIA 4BAKB 1TBZH 6GCHG 2VNTA 3C27B 3BEIB 2ZHQH 5J4SA 1ZSJA 1UTMA 5EODA 4U2WA 2BOKA 5H4IB 1ZZZA 1UCYE 4A1TA 2SNWA 1W7GH 2HNTF 2W7UA 5EOKA 2Z6BD 2P59A 3A7ZA 3D23A 2LPRA 5JB8S 3PO1B 1O5BB 3U1IB 1MQ5A 3PM3A 1FPCH 4DURA 2GCTB 4X6OA 2TRMA 2ZA5A 4INHA 1O2IA 1QL9A 4WWYA 5HMAA 4Z6AH 1K1PA 3GY4A 1ELAA 1Z8RA 3TLOA 1GMHG 1O2KA 4NA9H 4F4OC 4VGCB 3P6ZB 1HXFH 3LC5A 1MD8A 1QL7A 2QGRA 3VB5A 3QUMP 2TIOA 4ZROA 5DP4A 2FODA 4DY7B 1OWIA 2V0BA 1NC6A 1QJ6B 1GHAG 1V2JT 5EPYA 1TWXB 3RXPA 1HAXB 2ALVA 2FOHA 3MWIU 1DSTA 2NU1E 4J2YB 3URDA 4AG1A 1GJ4H 1BJVA 1DWDH 2VIOA 2WINI 5EQSA 3BG4B 1ZRKA 2EC9H 2RDLA 3RXIA 1FIZA 1AE8H 1UK2A 5E0JA 2XTTB 1GG6C 2BMGB 3SNDA 2FI4E 5BRRE 1BRUP 1ARCA 3BTKE 2WPKS 2W7SA 3A87A 4A1VA 2QYIA 2R2WU 4YOJA 4ZKOU 4R0IA 3A89A 3HK3B 3KQEA 2QN5T 1EAXA 5C5NA 3K6ZA 1A0HB 1C4V2 1WSSH 3TH3H 1EPTA 1HB0B 4AGJA 5I25A 4X2YA 5DP7A 4CRBA 2QC2A 2B8OH 1SFIA 2H9HA 1O5AB 3PO1C 1EQ9A 4QT8C 4ABEA 1ZSKA 1S6HA 3STIA 1LMWB 1ZHPA 1C2LA 2BOHB 2W26A 3LJJA 3BTFE 1WTHD 1QCPA 1W3CA 1BTWA 1LPGB 2B7DH 1W11U 1Y5BT 3LDXH 3RU4D 1O5GH 4LZ4B 3S7KB 1MMJN 1C5WB 1GI6A 3NWUA 1ESTA 2UWOA 1W7XH 3F68H 5FPTA 2VB0A 3PROA 2EI7A 3SUEA 1MTWA 1V2QT 3T62A 1SGQE 1Q3XA 4Y79A 5GWZA 1IQEA 5AFYH 2W5EA 3EGKH 1YPLH 4WJG2 4JMYA 1ELFA 2OC7A 1HGTH 3W94A 3BTQE 4UFFH 5DJ7A 1BB0B 2ZGCA 2GP9B 1TPAE 1FQ3A 4B76A 3MO9A 1ZHRA 4AGKA 6CHAC 1M9UA 3UREA 5L6NH 1GBEA 4KGAA 3UWIA 3VEQB 4ABAA 2BXUH 4JK5A 4OGXA 5HXFA 1O3EA 1C5YB 2BDGA 1S84A 4JZFH 1FXYA 4Q7YA 2O9QA 4IC6A 1O2RA 4K69A 3RUOA 4X6MA 2EEKA 3B9FH 1O2HA 2FOGA 5F8XA 1GL0E 1SLWB 1CHOF 1EATA 1SI5H 3K9XB 1MTSA 3RXTA 1UTOA 2OINA 1A7SA 3HGPA 3KQCA 3RXUA 2HPPH 1TNGA 4JYTA 1RFNA 3I29A 1BCUH 1GBFA 2FO9A 1TX6A 3A8CA 3OX7U 1C1OA 3P8NA 1P2NA 3TGJE 1GBJA 1IQKA 5E2OA 5DGJA 3UUZA 1ANBA 4JCNA 4CRAA 4XOJA 1TGBA 3MO6A 1DWCH 4XE4A 2YOLA 2PUQH 2GT8A 1GI3A 4ZXYH 3GCHB 1D3PB 1P0SH 2AYWA 3SHAH 1HJAB 2OQUA 3LGTA 1UVUH 1AUTC 1XXDA 2FDAA 2UUKB 1ZLRA 3P95A 2NWNA 1C1WH 5T3HA 3UOUA 2HLCA 3MH4A 3P8GA 2WYJA 1GMCG 2FI3E 2Z9KA 2D2DA 4ISIH 1O2PA 2IJOB 4LK4A 2AMDA 2ZFPH 7ESTE 1O37A 5SGAE 3AAVA 1JRTA 2Z3DA 2P8OC 3RXHA 1DSUA 3H7OA 1F5KU 3M37A 1TBRH 5DKMA 2A4RA 1MZAA 4OS5A 5DO4H 2VWMA 2PV9B 9LPRA 3HK6B 3E8LA 2CV3A 4Y8XA 3RM2H 1OP2A 1Z6JH 3SGQE 4MTBA 1SLXB 5JBTA 2D26C 2ZU1A 4MPWA 2FZZA 2HALA 3BIVH 3M5NA 5LH8A 3OTJE 3TGKE 2F3CE 1OKXA 2TPIZ 1DM4B 2OD3B 4TWYA 3T25A 3ZZ8A 4DG4A 1T8OA 1ZMLA 8GCHG 2BQWB 3PMJA 4WH6A 1KLTA 4Y11E 4R8TB 2BLQA 1GI2A 1YCPK 1K1JA 2ODYB 1GJAB 4YZUA 3SNEA 1O2YA 1JRSA 2AGIX 3UQOA 4WMDA 2ODQA 3E91A 1AFQB 3ELAH 2BXTH 1FONA 2STBE 3GCHC 4WY3A 1UTJA 1MAYA 1AE5A 2H9EH 1JBUH 1DLEA 1ZJDA 3U98H 1SB1H 4D7FA 1TGTA 1AGJA 1XMNB 3DUXH 2Z3EA 4Q7ZA 2ZQ1A 2HPQH 1V2LT 4B2CA 6LPRA 3KL6A 4K8YA 3M5OA 3U8TH 1ZPBA 4CH8B 2ZFRH 4I7YH 1J8AA 1EUFA 5FPYA 2STAE 5GIBA 3K65B 3A80A 3TH4H 1MZDA 1S0QA 1LHFH 2LNCA 1GBHA 5F6MA 2AMPA 1LQDB 4MNXA 1QFKH 1Z8IB 1FY4A 1KYNA 1HAVB 4Y8ZA 5TCAA 3NUMA 2Z3CA 4I8GA 1QRZA 3RDZA 1ANDA 2BD3A 3BEUA 3TITA 2XBWA 1DVAH 1MTNB 1IHSH 1P06A 3RXSA 4MNYA 2BY5X 4B71A 3K2UA 2H5DA 1SGRE 3SO3A 2WPLS 3LGVA 1P04A 1DE7H 1FI8A 1P57B 2M5TA 1DUAA 2ZO3H 5FX6A 2ZFFH 1NO9H 1SR5C 1V2KT 3S9AA 3STJA 2PSXA 2NU2E 2AH4X 1O38A 3GCOA 4Y10E 2WV5A 1V2TT 2BY8X 3ZVGA 1MUEB 1GBIA 3PMAB 1JWTA 3KN2A 2IOTA 3QGNB 2BDCA 1AN1E 2GZ9A 1CHGA 1H4WA 1S83A 1K2I1 3OY6U 2P3FH 4NFFA 5DK1A 3ATIA 1UTKA 1T4UH 4ISHH 1NFWA 3GY5A 2ILNA 3NXPA 1TFXA 1KY9A 3M7QA 1SOZA 3TJVA 3PLPA 2AEIH 1HNEE 1QR3E 1DX5M 2H9TH 1GI4A 1O3PB 1RS0A 1C9TA 3LJOA 1PPGE 2ANKH 1NS3A 4GVUA 1Z71A 2CF9H 4NWKA 1YBWA 1OWJA 4XDEA 1UHBB 3A8BA 2HVXA 2XW9A 1A5GH 3C1KA 1MH0A 3SJKA 3EA8A 1TGCA 1K1LA 3FP6E 3Q00A 1SQAA 1ZSLA 2GMTB 1S85A 1A3EH 4F49A 2AERH 2PLXA 4KELA 1UMAH 1XKBC 1EAUA 1ANCA 1G32B 3QTVH 1T4VH 4ZHAA 3ESTA 2PR3A 2Y5HA 1BIOA 5L30H 3ZZ6A 3Q77A 5DPAA 2A7JA 3V12A 1O2XA 3DD2H 2ZGHA 4CRDA 5PTPA 1GHVH 1KLJH 2A5AA 1SHHB 1BDAA 1W8BH 5T6FA 1LHGH 2A1DB 1O3NA 3MNSA 1SC8U 1O2OA 1KTSB 3PB1E 2ZEBA 5FCRA 5EXMA 4A7IB 3RXQA 1P11E 3KEEA 4THNH 3ITIA 2ANWA 5C1UA 4AYYB 3MH5A 4BAHB 3BIUH 4TYDA 1OXGA 3A82A 3MH6A 2Z94A 1THPB 3HKJB 1EP5A 1TLDA 2Q1JA 4NFEA 1F5RA 1HUTH 1AVWA 1QB6A 3A83A 3EA9A 3E3TA 3HKIB 3QGJA 3SU0A 2FOEA 1E36B 2FYQA 1C5UA 3MNXA 2ZU3A 2Q6FA 1MBMA 2V3HH 4CRGA 3RC4A 1Y3UA 1KXAA 3QDZB 1Y5UT 4K5ZA 3CS7A 1OSSA 1VCQA 1RTKA 2HNTE 1WYKA 1BUIA 5C2ZA 1QTFA 1XVOA 1IQMA 1YGCH 2GMTC 1CT2E 1DT2A 2ZFTA 1DLKB 3ZZ7A 3UTUH 2A2XH 2XWBI 3QLPH 1C5NH 3F9HA 1ZTKA 2C8XB 1GBKA 1EZUC 2ZDAH 1T8MA 1V2PT 3QZRA 2F9UA 3LGIA 3KHVA 3GYLB 3UNQA 5GDSH 3E0NB 1TGSZ 3U1JB 1FIWA 1GBDA 1UHBA 3A8DA 1XVMA 3LOXA 4IMQA 1IQJA 3MMGA 2ZU2A 3HGNA 4GUXA 2GVFA 1BHXF 4H6TA 1S81A 1C2EA 3SZNA 5F8TA 1YPHC 2D1JA 1V2UT 3ZZ9A 4FVDA 2FYRA 2CHAB 1YYY1 5LPRA 1P2MA 3SV6A 4IW4E 3TIUA 1O2WA 2G52A 3FVFB 2Y7XA 1Q31A 1SFQB 3F9GA 1L0ZA 1EXFA 3Q3YA 4ASHA 1GJBB 3P92A 5LPEA 4ISLA 3ZZBA 2V6NA 2VVUA 3DFLA 3JZ1B 1PYTC 3ZZAA 1D9IA 5EXLA 2FOBA 1NFXA 2PTCE 1PQAA 1ZMJA 1K22H 1NRQH 1TMTH 4X2VA 3L33A 3M7UA 4YLUA 1Y3YA 1SGFA 1AIXH 4D9QA 4WMEA 1TPOA 1TALA 1FJSA 1KLIH 4WH8A 3BG8A 3PYHA 3M35A 2G8TA 2C3SA 1D3DB 3RC5A 1W10U 1EPTB 2CMYA 1XUIA 2ZNKH 2VVCA 2HOBA 1E35B 4MG3A 1O34A 1O2GH 4NCYA 4Y7AA 1LHDH 4NZLA 3U8RH 4DOQA 2QXIA 2TGTA 2P95A 1HAYB 1S0RA 1AFEH 2A45B 5B6OA 4Y6DA 1KXFA 2OCVB 1QHRB 2XC5A 5JB9S 5C1XA 3FZDA 2C8YB 3SQHE 1TOMH 1V2ST 2ZI2H 3BTTE 4E05H 1TMUH 1VJ9U 2CHAC 4IN2A 5AVDA 1PQ5A 1AU8A 5ESTE 1NTPA 1EKBB 2PUXB 4X2WA 3WY8A 1AWHB 2O8WA 1O5FH 2TGAA 1NM6A 4CBOA 1GBAA 1NESE 3DHKH 3M7TA 1GCTB 3RM0H 1IAUA 1QURH 1XM1A 1BTYA 1YPKH 5JDUB 1FUJA 2BDHA 2BDAA 2A5KA 1DICA 2BQ6B 1DS2E 3CP7A 2VINA 5LGOA 4X1PU 3S7HB 4YTAA 4UFDH 3BV9B 2FEQH 2WPIS 3A7WA 3AAUA 2C93B 3SV7A 5C3NA 4ZKSU 1QA7A 1UCYH 2OLGA 4BTTB 1A5HA 1O3CA 1A46H 1W0ZU 2KAIA 5TCCA 1HAPH 1G3DA 1NRRH 4J1YA 3V13A 2FX4A 4WXVA 5JBAS 3SU2A 1CA0B 2ZPQA 1B5GH 3LH3A 1EPTC 5BPEA 2A4QA 4GHQA 4FUCA 3LKWA 3MU0A 3ZZ5A 5J4QA 1GJDB 1DITH 5GPIB 4DVAU 3Q3KA 2UWLA 2OC8A 1UK3A 2XC4A 1GMDG 1ANEA 2FOAA 3TGIE 4XBCA 1LKBA 4KP0A 2VGCB 4MNVA 1EZSC 2OUAA 4JZIA 1D6WA 4NWLA 1FY8E 2B5TB 1TX7A 5I46H 3SGBE 4HTCH 2R3YA 2XBXA 4O9VA 3QWCH 8KME2 1C5XB 3OY5U 1W0YH 1LHEH 2HNTC 1GHWH 3TNTA 4Y76A 1C5LH 2ZHWH 1KDQB 3S69A 4FUGA 3MU4A 1A0LA 1BBRK 4ZXXH 2BD8A 1GBLA 2VVVA 4I8LA 4YM9A 4X8UH 5CE1A 3SN8A 2GCTC 1C2HA 1DOJA 3FP7E 2OC1A 1HAIH 4AFUA 4NSYA 1G3CA 4B2AA 1P3CA 4O3UA 3OSYA 2W3KA 1Y59T 4KKDA 2PWXA 4VGCC 2BLVA 1QRXA 3TK6A 1CA0C 4YESB 5FAHA 5G4BA 1CGHA 1P2IA 1GL1A 4BAMB 2ZQ2A 5A09A 5JYIA 1H9LB 1UO6A 4O03A 2FTLE 2ZGBH 2VJ1A 5E8EH 1HAHH 1NN6A 1DUEA 1XX9A 3SJIA 3ZVFA 1B0FA 3V3MA 3BG4C 1RTFB 1A1RA 3GDVA 1GJ7B 3BTEE 1AQ7A 1QB9A 3RXVA 3VB7A 1AY6H 4Q7XA 1ZHMA 2OBQA 3VGCB 4E7NA 1TNJA 2Y5FA 1CBWB 3UIRA 3RP2A 2FOMB 2O8TA 2BLOA 1OX1A 2SNVA 3BSQA 2ZU4A 5AHGH 1NFYA 2VWLA 1PQ8A 1GHXH 2EA3A 1OPHB 3A7YA 2H6MA 1KXCA 2GKVE 2ZZUH 1IOEA 1P02A 2PSYA 7GCHG 3O8BA 3W95A 1UVTH 1G3BA 3SUDA 4H42U 3TJOA 2ZTXA 4INLA 2ZPSA 3GISB 3SQEE 2C90B 2GX4A 2B9LA 3D49H 1GI5A 3PTNA 5DP9A 2BVSH 1MKXH 3T28A 3QN7A 1VCPA 1V2MT 1KDQA 1BT7A 1A5IA 3MH7A 3QTOH 2GV7A 2H1UA 3EDXB 2ZCLP 2IPHA 1WBGB 1BBRH 1L4ZA 3T2NA 5F03A 2AS9A 2UUJB 4I31A 4B2BA 1KXDA 4KTUA 5IDKA 3ATWA 1LDTT 3SU1A 2PTNA 4FUFA 1LO6A 3VGCC 1EASA 3SUFA 3E0PB 1QY6A 1CBWC 3MU5A 2Q6GA 1HRTH 3U8OH 1LPKB 1EP6A 1P2QA 3UFAA 1SGFG 3SJOA 1A4WH 3RXCA 1NU9A 2J38A 2J2UA 4AG2A 2ZDNA 2GD4B 1JIMA 2ZTZA 2A5IA 4MQAA 4XFQA 4UEHH 2VWNA 3TJUA 1SL3A 3P17H 5TJXA 4BNRA 4MDSA 1QBVH 3SJ9A 1J17T 1XUKA 3QK1A 5DP8A 1C9PA 5T6GA 1RD3B 1GHYH 1QA0A 1VR1H 1GMHF 1Y8TA 1CQQA 2I6QA 2ALPA 2R0KA 1HV7A 3GY2A 4OS2A 2BD9A 2BZAA 2G55A 3MO3A 5JBCS 5A0CA 2SGFE 1SQOA 2QXGA 1BRBE 4O97A 3PMHB 1CO7E 1MCVA 3MNBA 2A0QB 1HJAC 4AFQA 4IC5A 4Y7BA 2ZDKA 2D8WA 3BEFB 5CMXH 1GHBG 2PKAA 1YPHE 1WQVH 1MAXA 3KNXA 2ZFSA 3ZVBA 4M7GA 2ZKSA 3MU1A 1NRPH 2FI5E 4GCHG 4X1QU 1PYTD 3BTWE 1LVOA 1TB6H 2BX4A 5A0BA 2XYAA 2F9BH 1C1PA 4GLYA 1D4PB 1G37A 1OWKA 4X2XA 3LU9B 4NG9H 1UTPA 3S9BA 3RXRA 5DP5A 4BAQB 1UJ1A 1XUHA 4YOIA 4A92A 3S0NA 3SOSA 1THSH 4AB9A 1YCPM 3MHWU 2HRVA 1YPGH 2ZTYA 3SNAA 1C1RA 1KXEA 4GSOA 1N6YA 3A86A 1UTLM 2BVXH 3KIDU 3UR9A 1K1MA 1QQ4A 1T8NA 1N8OB 2BM2A 5HGGA 1GDQA 1AKSA 3A8AA 4DGJA 2ZP0H 1H8DH 1LQEA 2GZ8A 1AZZA 3FZZA 2Y7ZA 2EI6A 1GVZA 1VITG 1J15A 3OU0A 4AORA 1DXPA 1SGEE 4GAWA 4I8JA 4NZQA 2P3UB 3DT0H 3SBKA 2YNBA 4FVBA 1LVBA 1AFQC 4D9RA 5E2PA 1SMFE 5EG4A 2BD2A 1TMBH 4ABIA 2PHBA 4ABHA 2F91A 1TE0A 1NRSH 2O8LA 1EOLA 3LONA 1IQIA 2GCHG 3B8JA 1INCA 1O3FA 1O3OA 3LGUA 4BXSA 1ZMNA 1FV9A 1GJCB 1BTXA 3ZZDA 2W3IA 2BX3A 2VH0A 5A8YA 1HYLA 1LKAA 1C5RA 1S6FA 2G5VA 3F9EA 4X8SH 3TNSA 1UK4A 4ABJA 1E0FD 1ELTA 1TNHA 2B0FA 3MTYA 1SGIB 1OWDA 1MTNC 1O39A 3SV2H 1O2JA 1D3QB 1QRWA 3LPRA 1PJPA 4LOYH 4D76A 1N8OC 4Y71A 5K0HA 1A0JA 3UWJH 1TGNA 1A61H 1CGJE 1Z6EA 4K8BA 3SGAE 3T26A 2XNIA 1BOQA 2A32A 1L4DA 2G4TA 1TA6A 1AO5A 1TPSA 1L2EA 3S9CA 3SU6A 1L1GA 1CT0E 3UR6A 2BY7X 1X7AC 1G2MA 1O36A 1YF4A 2P94A 1G9IE 1MTVA 2BTCE 3L3TA 3EAJA 3A7XA 3NK8A 3ZVCA 1Z1IA 1QGFA 2JH0D 1GVLA 2R0LA 4CBNA 2VIVA 3V0XA 1C5TA 1GMCF 1C4U2 1C1VH 1YM0A 3QO6A 2TGPZ 4Q80A 3E16B 2PGQB 1F0UA 4ISNA 2AGEX 3EQ0H 4CR9A 1WUNH 1QJ1B 1DXWA 1G30B 2ZCKP 4RSPA 2SGDE 1MBQA 1WU1A 2DUCA 1GI8B 1SGDE 2CN0H 2A4GA 1KTTB 1J16A 1GCDA 2JETB 1HIAB 2R3UA 3BTHE 3CS0A 1KIGH 5AFZH 4B75A 3ENSB 3ODFA 5ETXA 4X8VH 2NU0E 4GHTA 3M3TA 5DG6A 1C1NA 2Y6TA 2CJIA 1D3TB 1P9UA 1BTPA 2XBYA 2GZ7A 2ZDVH 2BD4A 1C5MD 1PPCE 1TYNA 4SGAE 2A4OA 7LPRA 1XXFA 2QY0B 3M5LA 1H9IE 3KGPA 3O8RA 1UCYK 4WXIA 1C1SA 2Z9LA 1CE5A 4Y8YA 1Z7KA 4B73A 5EXNA 6ESTA 5C5OA 1G3EA 1BHXB 1TRYA 1ZPCA 4ZUHA 4UDWH 2OP9A 3RLWH 5T6DA 2KAIB 1O2NA 3ODDA 4NIWA 1WCZA 1ZOMA 4ZHLU 1SHYA 2WPJS 1WV7H 3RMOH 2A7HA 2I6SA 2IN2A 2FP7B 1W2KH 5E0HA 2AGGX 1HAZB 1ARBA 4MPVA 1QIXB 1V3XA 3LIWA 3ATMA 3U9AH 3A84A 1RGQA 2XWAA 3AASA 1GHZA 2FLRH 1SOTA
chains in the Genus database with same CATH superfamily
1SGTA 3R3GB 2UUFB 5EGMA 3DCLA 1K1IA 4FU7A 4YT7H 5GCHF 3FAOA 1HAGE 4UFGH 1O3GA 3MU8A 1CT4E 4ZAEA 2BD5A 2A7CA 1V2WT 4HZHA 4LZ1H 1U6QA 3RC6A 2XXLA 3RXGA 1FN6A 2QV1A 1S82A 2BDYA 1K1NA 1O2ZA 1F0TA 4OM9A 5F8ZA 2J98B 1CHOG 4AYVB 1Z8JB 1QB1A 1K28D 5FCKA 1LHCH 2ZU5A 1NBME 2AHME 2ZDMA 3ZVEA 2CF8H 3QZQA 2OK5A 3O8DA 4Q2KA 1TQ7B 2ESTE 4OS7A 2ZPRA 1TIOA 5A2MH 3SORA 4X8TH 2AMQA 1J9CH 1FMGA 5EW2H 1O2SA 5DP6A 3OFND 2KFWA 1TNLA 1OP0A 2C8WB 2ZWLH 3RMNH 3EA7A 2GV6A 4NIVA 2FMJA 2VH6A 4MNWA 5FHTA 1HIAA 2ZF0H 3E90B 3BTME 3M3SA 3SJ8A 1JIRA 4HGCA 3GICB 4YT6H 2WUCA 3F1SB 3NCLA 4HI3A 1BQYA 2OC0A 1K1OA 2YMSB 1ZRBA 4OS1A 2KM0A 1GG6B 1MU8B 3AVZA 1FZZA 4ABGA 3ZYEA 2V35A 3VPKA 2F9VA 1Z8GA 3P8FA 4MVNA 1C5PA 4ABDA 1SGCA 1MKWH 4CRCA 4KTSA 2SGPE 3AW0A 1BRCE 4D7GA 4LXBH 2G51A 4XBBA 3GY7A 2JH6D 2BDIA 4DJZB 3IWMA 1O0DH 3LT3A 1SGYE 1DDJA 3O8CA 1SVPA 3GY3A 1IQFA 1AWFH 3TK5A 1T7CA 1THRH 2ZIQH 4ISOA 1EAWA 4INKA 1ID5H 3IG6B 1J14A 1EJMA 2BHGA 3EE0B 3F9FA 1ZGIA 5FBIA 3LC3A 4Y0ZE 2ZHEH 4BTUB 3E1XB 1TABE 4A5TS 1IHTH 4FUEA 4Q4LA 3SHCH 4B74A 1O5EH 1ELBA 1FY1A 3ZVAA 1KXBA 1SQTA 2AIQA 4ESTE 4K1SA 5AF9H 2VU8E 3DFJA 1WDIA 1HDTH 3SV8A 1JOUB 1YPMH 4WMFA 3ZYDA 1ETTH 1VZQH 4BAOB 3TH2H 4IN1A 1IQLA 4ZCNA 2UUYA 1MKXK 3F6UH 3G01A 1PPFE 2J98A 1MCTA 2CGAA 2YMSC 1PFXC 3K6YA 2HWLB 3ZZ4A 6CHAB 1GCTC 1SGPE 2KCOA 4CRFA 3KQDA 4X0WU 1XUGA 1O3MA 2OXSA 3RMMH 2VIWA 1CSOE 1E34B 4FXGH 2XBVA 5FX5A 3RXFA 1FY3A 1RJXB 2ZFQH 3SW2B 1PPBH 1TNIA 4B6EA 3GCNA 1O3LA 1MABB 1O32A 2FXRA 3N99A 1TA2A 1C1MA 1VJAU 2FS8A 4I8HA 1QNJA 4OS6A 4D8NA 3AK5A 5GJ4B 1V2OT 3KCGH 3VXFH 1HJ8A 4Y0YE 1LTOA 1F7ZA 1QBOA 1F5LA 4X1NU 3F2FA 4ABFA 1GI0A 4AZ2B 1GJ6A 3SV9A 3UOPA 1C2KA 5CHAB 3DSGA 3N7OA 3P8OA 1O35A 1BA8B 3TJNA 2PFEA 3ZZ3A 1SG8B 2H5CA 1WQSA 1D6RA 4OGYA 2VWOA 1ELVA 1GWAA 1O30A 4AFSA 3PMBB 1ZTJA 3T5FH 1TONA 3RU4E 1NPMA 4U32A 1Y3WA 3HPTB 2VGCC 4Z0KA 2Q6DA 1NT1A 3PV4A 2UWPA 2VIQA 4BTIB 1WTGH 3KQ5A 2KCYA 1EJNA 1FNIA 1HXEH 1SBWA 4I33A 1O2LA 2BD7A 2ZCHP 1P05A 1G2LA 1P03A 1UTNA 2G4UA 2O8MA 3T27A 2ZG0H 4FUBA 4JZDH 1GDUA 1ZGVA 1HCGA 1O2UA 4NA7A 4KTCA 1OOKB 2FIRH 2FTMA 1GBMA 3F0PA 1YP9A 3PWBA 4BANB 2ANMH 2F9NA 2P8OB 2PKAB 1OS8A 1H8IH 2G5NA 5EQQA 1VKYA 2XCFA 1YWUA 5C67A 3E6PH 1YC0A 2BY6X 4YO9A 2KCPA 4UD9H 2HGTH 1O2VA 2ZGJA 2V3OH 1E79D 1EZQA 3NPSA 2WYGA 1P8VC 2R9PA 1HJ9A 1NRNH 2BVRH 4NIYA 2FM2A 2A2QH 2SFAA 3SU5A 5CHAC 3CNRA 3D62A 3B23B 1ACBE 2NU4E 5E0GA 1P10A 9ESTA 4TPIZ 1V2RT 1O3DA 4AOQA 1MU6B 1DWBH 3GCTF 4TY7A 2BY9X 2ZHFH 4MPXA 2WV4A 1BBRE 1TOCB 2RCEA 3SUGA 4B6FA 3ZZCA 4BXWA 6GCHF 3URCA 2RG3A 1UTQA 5C1YA 4O3TA 1AKSB 4NGAH 2Z9JA 1QQUA 1FAXA 1UVSH 4FU9A 1GJ5H 4I32A 2SGEE 3NZIA 4CR5A 2J92A 3M36A 4K2YA 1TBQH 2Z7FE 5L2YH 3UNSA 2AIPA 2GDDA 4ACAA 3GDSA 4FU8A 4CHAB 1DY8A 3BTGE 4A6LA 4NSVA 2QF4A 4JZEH 4H6SB 1O3AA 1EZXC 2ANYA 3GY6A 1FLEE 1Y3XA 1L1JA 1IQNA 1BRAA 3PTBA 8ESTE 2TBSA 1FAKH 2C8ZB 2WPHS 3D65E 2J9NA 3KQBA 3BN9A 5JBBS 3FFGA 1GPZA 2ASUB 4MLFB 4K1TA 1LPZB 3OYPA 2EI8A 1ZR0A 5GNDA 1HLTH 2G81E 4YOGA 2H2ZA 1GI7B 5GXPA 1C5SA 2J94A 5FBEA 1QL8A 1ETSH 2J34A 2QAAA 2SGAA 2ZHDA 4TY6A 1GHAF 3DA9B 1BZXE 2V3MA 1N6XA 1TQ0B 1LVMA 3GS9A 1SPJA 1PPHE 4ZH8A 1H1BA 5LPFA 3WWFA 4AX9H 1C2FA 1TPPA 4X6PA 2F43B 1F0RA 2BYAX 4UFEH 1DANH 5HM9A 1ZYOA 1GMDF 5EQRA 1GBTA 1ZJKA 2WZQA 3EYDA 5ABWA 2FWWA 2YNAA 3PWCA 1O2MA 1QBNA 3A7TA 1C2JA 1YLCA 1ZPZA 4B1TA 1O33A 1SSXA 3M61U 2FPZA 1W0JD 4K3JA 1VCWA 4NA8A 5IYTA 3H5CB 4U30A 4A1XA 5DN6D 1Y5AT 1XKAC 1S6LA 2JKHA 4CHAC 1FY5A 2A31A 4TWWA 3CENA 2JH5D 4IS5A 2P3TB 2CXVA 1COWD 3RXLA 2QF0A 2K1QA 3UPEA 4RT1A 3RXMA 2KX4A 1GI9B 3R0FA 1K9OE 2PKSB 2QXJA 4AFZA 3ZVDA 1CVWH 1T8LA 1B0EA 5HYOA 2XRCA 3TK9A 1AUJA 1C4Y2 1IQHA 2Y81A 4DIIH 3RXOA 5GCHG 4ZKRU 5HIZA 3OE7D 2OBOA 7KMEH 3UAIC 3KF2A 2BZ6H 1P09A 1V2NT 1E38B 3RU4T 3P70B 3RXDA 1FDPA 4RN6A 2VIDA 1C5ZB 1SLVB 1HPGA 3SU4A 3ZIAD 2JIZD 2XCNA 3TVJB 3SNBA 3AW1A 3LGYA 4K60A 1GI1A 1S5SA 1F92A 2BLWA 2C4FH 1ABJH 1TAWA 2EQNA 3FP8E 1C5QA 2ZECA 3PLBA 1MQ6A 4MPUA 1YPEH 4CREA 2F83A 3A85A 1Q2WA 3I78A 1AZ8A 4U01A 3Q76A 3TPIZ 1GVKB 1HBTH 2J95A 1TRNA 1A2CH 1GBCA 1Z1JA 3RXEA 5K7RA 1AVGH 4HG6A 1PQ7A 2FX6A 3SI3H 1RIWB 3LGWA 2VIPA 1L1NA 1DFPA 4UE7H 2Z9IA 1CA8B 1BTUA 1V2VT 4YLQH 2RA3A 2Y5GA 1ELDE 4OS4A 1MTUA 1NFUA 3M5MA 7GCHF 3UB0A 3T29A 1EB2A 1ESAA 2OTVA 2PGBB 1AB9B 1AI8H 2PKSC 4H4FA 1YCPH 2ODPA 4XSKU 2TGDA 1UVOA 2ULLA 1P12E 1G36A 3FANA 1TRMA 1C1TA 1P9SA 1T32A 1YKTA 1JXPA 1Y3VA 3QX5H 5A0AE 5KECA 4HFPB 1HAOH 4PROA 1H9HE 1C2GA 3MFJA 1NU7B 3MI4A 4TSFD 1VITH 1NZQH 1WOFA 2J4IA 3GDUA 1PPZA 2F9OA 4RKJB 1BJUA 3ZV8A 2GT7A 3SI4H 5EU8A 1O3BA 4NIXA 3UNRA 2P93A 3A81A 3LH1A 4ZKNU 2QF3A 2R2MB 4JK6A 4ZHMU 1B7XB 2QXHA 3RXBA 1BMMH 2FOCA 1GJ8B 1V6DA 4AC9A 3MNCA 3U69H 1ESBA 5C20A 1GBBA 1OWHA 1QJ7B 3RMLH 4JZ1A 3ATKA 1BTHH 1P2OA 5DP3A 4RKOB 1HAVA 3RXJA 2FS9A 2PW8H 1O3JA 4IMZA 1O2TA 1C2MA 1ELGA 4IGDA 5ESBA 1RIWC 5A8ZA 1OWEA 3GY8A 3H7TA 4JYUH 4FUJA 3L6PA 4SGBE 1T31A 4GPGA 1RRKA 4IBLH 1ELEE 4FUDA 1K21H 1P01A 5L2ZH 1ORFA 1AB9C 2QF5A 1RXPA 1FN8A 1IQGA 8GCHF 1MD7A 1ELCA 1GJ9B 2FLBH 4AB8A 3GYMA 2FOFA 5FXLA 3I77A 1P2JA 3RXAA 1VGCB 3UY9A 5EPNA 3ATLA 5EW1H 4WF8A 2O8UA 4DIHH 3NKKA 1W14U 1O31A 1MKWK 1O3HA 2ZC9H 4I8KA 1NROH 4FUIA 1C5VA 1WAYB 1TX8A 3VB4A 2BQ7B 3GOVB 1SKYE 4WVPE 4X6NA 1W12U 1O3KA 5T1VA 1AD8H 1UVPA 2GGVB 3VB3A 1AMHA 2AFQB 3A88A 1ABIH 1GHBF 1O5CB 1XUJA 1H8HD 4K1EA 1OHHD 1C1UH 2OQ5A 1BTZA 1GGDB 4X1SU 2WPMS 1DY9A 4GCHF 1OYTH 3IITA 3VFEA 2RA0A 4XBDA 4DW2U 2F9PA 1C5OH 1GDNA 1ETRH 3FO8D 3VB6A 1O2QA 1YY3A 2GDEH 4AN7A 2KR7A 3MOCA 1YPJH 1OP8A 4BOHA 2THFB 1EJAA 2DE8A 2G00A 1C2IA 3VG8A 2P16A 3RXKA 1NY22 4FUHA 1F2SE 5KGOA 3JZ2B 5FPSA 2JETC 3A7VA 3Q3XA 1F0SA 3BTDE 1YLDA 2QCYA 1BMLA 1LVYA 1SGNE 2WUBA 1EX3A 2BDBA 2ZDLA 4E06H 1EOJA 1CGIE 3PRDA 1PPEE 3HATH 5JPMH 1VGCC 1AVXA 1BMAA 1C2DA 4X1RU 2XC0A 1VITF 3ZV9A 2Y82A 1SLUB 3BF6H 1FPHH 4UONA 5A8XA 5EIYA 3RLYH 1JMOH 2SGQE 3M3VA 4TPYA 2NU3E 4I86A 4ZMAH 2BB4A 4JYVH 1BMNH 1AHTH 3U28C 3FN8A 3MYWA 1TNKA 2Y80A 5KEDA 1P3EA 1CU1A 1LCYA 1XUFA 3VXEH 1EB1H 1O3IA 1OYQA 1RTLA 4DT7B 2QA9E 2ZGXH 4CH2B 2GCHF 2FESH 1DPOA 1N1LA 4E7RG 1ZTLA 8LPRA 1GGDC 1A3BH 2DE9A 1O5DH 1BITA 3PLKA 2QIQA 1E37B 2Z9GA 5HM2A 1KSNA 3GCTG 3TU7H 3SNCA 4DCDA 4ABBA 1HFDA 3OEED 1W13U 1DWEH 2GTBA 3UQVA 1P2KA 3SU3A 3V7TA 1C1QA 1EAIA 4BAKB 1TBZH 6GCHG 2VNTA 3DSPA 3C27B 3BEIB 1W0KD 2ZHQH 5J4SA 1ZSJA 1UTMA 5EODA 4U2WA 2BOKA 5H4IB 1ZZZA 1UCYE 4A1TA 2SNWA 1W7GH 2HNTF 2W7UA 5F53A 5EOKA 2Z6BD 2P59A 3A7ZA 3D23A 2LPRA 5JB8S 3MQKC 3PO1B 1O5BB 3U1IB 1MQ5A 3PM3A 1FPCH 4DURA 2GCTB 4X6OA 2V7QD 2TRMA 2ZA5A 4INHA 1O2IA 1QL9A 4WWYA 5HMAA 4Z6AH 1K1PA 3GY4A 1ELAA 1Z8RA 3TLOA 1GMHG 1O2KA 4NA9H 4F4OC 4VGCB 3P6ZB 1HXFH 3LC5A 1MD8A 1QL7A 2QGRA 3VB5A 3QUMP 2TIOA 4ZROA 5DP4A 2FODA 4DY7B 1OWIA 2V0BA 1NC6A 1QJ6B 1GHAG 1V2JT 5EPYA 1TWXB 3RXPA 1HAXB 2ALVA 4ACBA 3OAAD 3KYGA 2FOHA 3MWIU 1DSTA 2NU1E 4J2YB 3URDA 4AG1A 1GJ4H 1BJVA 1DWDH 2VIOA 2WINI 5EQSA 3BG4B 1ZRKA 2EC9H 2RDLA 3RXIA 1FIZA 1AE8H 1UK2A 5E0JA 2HLDD 2W6ID 2XTTB 1GG6C 2BMGB 3SNDA 2FI4E 5BRRE 1BRUP 1ARCA 3BTKE 2WPKS 2W7SA 3A87A 4A1VA 2QYIA 2R2WU 4YOJA 4ZKOU 1K0HA 3SZEA 4R0IA 3A89A 2RFKC 3HK3B 3KQEA 2QN5T 1EAXA 2WV9A 5C5NA 3K6ZA 1A0HB 1C4V2 1WSSH 3TH3H 1EPTA 4RT0A 1HB0B 4AGJA 5I25A 4X2YA 5DP7A 4CRBA 2CK3D 2QC2A 2B8OH 1SFIA 4P00A 2H9HA 2IJD1 1O5AB 3PO1C 1EQ9A 4QT8C 4ABEA 1ZSKA 1S6HA 3STIA 1LMWB 1ZHPA 1BMFD 1C2LA 2BOHB 2W26A 3LJJA 3BTFE 1WTHD 1QCPA 1W3CA 1BTWA 1LPGB 2B7DH 1W11U 1Y5BT 3LDXH 2WPDD 1O5GH 3RU4D 4LZ4B 3S7KB 1MMJN 1C5WB 1GI6A 3NWUA 1ESTA 2UWOA 1W7XH 3F68H 5FPTA 2VB0A 3PROA 3OTPA 2EI7A 3SUEA 1MTWA 1V2QT 3T62A 1SGQE 1Q3XA 4Y79A 5C0TA 5GWZA 1IQEA 5AFYH 2W5EA 3EGKH 1YPLH 5CDFE 4WJG2 4JMYA 1ELFA 2OC7A 1HGTH 3W94A 3BTQE 4UFFH 5DJ7A 1BB0B 2ZGCA 2GP9B 1TPAE 1FQ3A 4B76A 3MO9A 1ZHRA 4AGKA 6CHAC 1M9UA 3F3BA 5C94A 3UREA 5L6NH 1GBEA 4KGAA 3UWIA 3VEQB 3F0OA 4ABAA 2BXUH 4JK5A 5C17A 4OGXA 5HXFA 1O3EA 1C5YB 2BDGA 1S84A 4JZFH 1FXYA 4Q7YA 2O9QA 4IC6A 1O2RA 4K69A 5IK2D 3RUOA 4X6MA 2EEKA 3B9FH 1O2HA 2FOGA 5F8XA 1GL0E 1SLWB 1CHOF 1EATA 1SI5H 3K9XB 1MTSA 4F55A 3RXTA 1UTOA 2OINA 1A7SA 3HGPA 3KQCA 3RXUA 2HPPH 1TNGA 4JYTA 1RFNA 3I29A 1BCUH 1GBFA 2FO9A 1TX6A 3A8CA 3OX7U 2F4LA 1C1OA 3P8NA 1P2NA 3TGJE 1GBJA 1IQKA 5E2OA 5DGJA 3UUZA 1ANBA 4JCNA 4CRAA 4XOJA 3PRBA 1TGBA 3MO6A 1DWCH 4XE4A 2YOLA 2PUQH 2GT8A 1GI3A 4ZXYH 3GCHB 1D3PB 1P0SH 2AYWA 3SHAH 1HJAB 2OQUA 3LGTA 1UVUH 1AUTC 1XXDA 2FDAA 2UUKB 1ZLRA 3P95A 2NWNA 1C1WH 5T3HA 3UOUA 2HLCA 3MH4A 3P8GA 2WYJA 1GMCG 2FI3E 2Z9KA 2D2DA 4ISIH 1O2PA 2IJOB 4LK4A 2AMDA 2ZFPH 7ESTE 1O37A 5SGAE 3AAVA 1JRTA 2Z3DA 2P8OC 3RXHA 1DSUA 3H7OA 1F5KU 3M37A 1TBRH 5DKMA 2L74A 2A4RA 1MZAA 2JDID 4OS5A 5DO4H 2VWMA 2PV9B 9LPRA 3HK6B 3E8LA 1YLNA 2CV3A 4Y8XA 3RM2H 1OP2A 1Z6JH 3SGQE 4MTBA 1SLXB 5JBTA 2D26C 2ZU1A 4MPWA 2FZZA 2HALA 3BIVH 3M5NA 5LH8A 3OTJE 3TGKE 2F3CE 1OKXA 2TPIZ 1DM4B 2OD3B 4TWYA 3T25A 3ZZ8A 4DG4A 1T8OA 1ZMLA 8GCHG 2BQWB 3PMJA 4WH6A 1KLTA 2M2AA 4Y11E 4R8TB 2BLQA 1GI2A 1YCPK 1K1JA 2ODYB 1GJAB 4YZUA 3SNEA 1O2YA 3F2GA 1JRSA 2AGIX 3UQOA 4WMDA 2ODQA 3E91A 1AFQB 3ELAH 2BXTH 1FONA 2STBE 3GCHC 4WY3A 1UTJA 1MAYA 2WSSD 1AE5A 2H9EH 1JBUH 1DLEA 1ZJDA 3U98H 1SB1H 4D7FA 1TGTA 1AGJA 1XMNB 3DUXH 2Z3EA 4Q7ZA 2ZQ1A 2HPQH 1V2LT 4B2CA 6LPRA 3KL6A 4K8YA 3M5OA 1UW7A 3U8TH 1ZPBA 4CH8B 2ZFRH 4I7YH 1J8AA 1EUFA 5FPYA 2STAE 5GIBA 3K65B 3A80A 3TH4H 1MZDA 1S0QA 2L6OA 1LHFH 2LNCA 1GBHA 5F6MA 2AMPA 1LQDB 4MNXA 1QFKH 1Z8IB 1FY4A 1KYNA 1HAVB 1EFRD 4Y8ZA 5TCAA 3NUMA 2Z3CA 4I8GA 1QRZA 3RDZA 1ANDA 2BD3A 3BEUA 3TITA 2XBWA 1DVAH 1MTNB 1IHSH 1P06A 3RXSA 4MNYA 2BY5X 3F2HA 3K2UA 4B71A 2H5DA 1SGRE 3SO3A 2WPLS 3LGVA 1P04A 1DE7H 1FI8A 1P57B 2M5TA 1DUAA 2ZO3H 5FX6A 2ZFFH 1NO9H 1SR5C 1V2KT 3S9AA 3STJA 2PSXA 2NU2E 2AH4X 1O38A 3GCOA 4Y10E 2WV5A 1V2TT 2BY8X 3ZVGA 1MUEB 1GBIA 3WWBA 3PMAB 1JWTA 3KN2A 2IOTA 3QGNB 2BDCA 1AN1E 2K8IA 2GZ9A 1CHGA 1H4WA 1S83A 1K2I1 3OY6U 2P3FH 4NFFA 5DK1A 3ATIA 1UTKA 1T4UH 4ISHH 1NFWA 3GY5A 2ILNA 3NXPA 1TFXA 1KY9A 3M7QA 1SOZA 3TJVA 3PLPA 2AEIH 1HNEE 1QR3E 1DX5M 2H9TH 1GI4A 1O3PB 1RS0A 1C9TA 3LJOA 1PPGE 2ANKH 3SYJA 1NS3A 4GVUA 1Z71A 2CF9H 4NWKA 1YBWA 1OWJA 4XDEA 1UHBB 3A8BA 2HVXA 2XW9A 1A5GH 3C1KA 1MH0A 3SJKA 3EA8A 1TGCA 1K1LA 3FP6E 3Q00A 1SQAA 1ZSLA 2GMTB 1S85A 1A3EH 4F49A 5B6LA 2PP6A 2AERH 2PLXA 5DSFA 4KELA 1UMAH 1XKBC 1KMHB 2RDEA 1EAUA 1ANCA 1G32B 3QTVH 1T4VH 4ZHAA 3ESTA 2PR3A 2Y5HA 1BIOA 5L30H 3ZZ6A 3Q77A 5DPAA 2A7JA 3V12A 1O2XA 3DD2H 2ZGHA 4CRDA 5PTPA 1GHVH 1KLJH 2A5AA 3DSOA 1SHHB 1BDAA 1W8BH 5T6FA 2YMSD 5EJZA 1LHGH 2A1DB 1O3NA 3MNSA 1SC8U 1O2OA 1KTSB 2QE7D 2ZEBA 3PB1E 5FCRA 3H09A 5EXMA 4A7IB 3RXQA 1P11E 3KEEA 4THNH 3ITIA 2ANWA 5C1UA 4AYYB 3MH5A 4BAHB 3BIUH 5EJLA 4TYDA 1OXGA 3A82A 3MH6A 2Z94A 1THPB 3HKJB 1EP5A 1TLDA 2Q1JA 4NFEA 1F5RA 1HUTH 1AVWA 1QB6A 3A83A 3EA9A 3E3TA 3HKIB 3QGJA 3SU0A 2FOEA 1E36B 2FYQA 1C5UA 4ASUD 3MNXA 2ZU3A 2Q6FA 1E1RD 1MBMA 2V3HH 4CRGA 3RC4A 1Y3UA 1KXAA 3QDZB 1Y5UT 4K5ZA 3CS7A 1OSSA 1VCQA 1RTKA 2HNTE 1WYKA 1BUIA 5C2ZA 1QTFA 1XVOA 1IQMA 1YGCH 2GMTC 1CT2E 1DT2A 2ZFTA 1DLKB 3ZZ7A 3UTUH 2A2XH 2XWBI 3QLPH 1C5NH 3F9HA 4XD7D 1ZTKA 2C8XB 1GBKA 1EZUC 2ZDAH 1T8MA 1V2PT 3QZRA 2F9UA 3LGIA 3KHVA 3GYLB 3UNQA 5GDSH 3E0NB 1TGSZ 3U1JB 1FIWA 1GBDA 1UHBA 3A8DA 1XVMA 3LOXA 4IMQA 1IQJA 3MMGA 2ZU2A 3HGNA 4GUXA 2GVFA 1BHXF 4H6TA 1S81A 1C2EA 3SZNA 5F8TA 1YPHC 2D1JA 1V2UT 3ZZ9A 4FVDA 2FYRA 2CHAB 1YYY1 5LPRA 1P2MA 3SV6A 4IW4E 3TIUA 1O2WA 2VBCA 2G52A 3FVFB 2Y7XA 1Q31A 1SFQB 3F9GA 1NBMD 1L0ZA 1EXFA 3Q3YA 4ASHA 1GJBB 3N7DA 3P92A 5LPEA 4ISLA 3ZZBA 2V6NA 2VVUA 3DFLA 3JZ1B 1PYTC 3ZZAA 1FX0B 1D9IA 5EXLA 2FOBA 4M9FA 1NFXA 2GJGA 2PTCE 1PQAA 1ZMJA 1K22H 1NRQH 1TMTH 4X2VA 3L33A 3M7UA 4YLUA 1Y3YA 1SGFA 1AIXH 4D9QA 4WMEA 1TPOA 1TALA 1FJSA 1KLIH 4WH8A 3BG8A 3PYHA 3M35A 2G8TA 2C3SA 1D3DB 3RC5A 1W10U 1EPTB 2CMYA 1XUIA 2ZNKH 2VVCA 2HOBA 1E35B 4MG3A 1O34A 1O2GH 4NCYA 4Y7AA 1LHDH 4NZLA 3U8RH 4DOQA 2QXIA 2J97A 2TGTA 2P95A 1HAYB 1S0RA 1AFEH 2A45B 5B6OA 4Y6DA 1KXFA 2OCVB 1QHRB 2XC5A 5JB9S 5C1XA 3FZDA 2C8YB 3SQHE 1TOMH 1V2ST 2ZI2H 3BTTE 5C0UA 4E05H 1TMUH 1VJ9U 2CHAC 4IN2A 5AVDA 1PQ5A 2J5UA 1AU8A 5ESTE 1NTPA 1EKBB 2PUXB 4X2WA 3WY8A 1AWHB 2EY4C 2O8WA 1O5FH 2TGAA 1NM6A 4CBOA 1GBAA 1NESE 3DHKH 3M7TA 1GCTB 2WHXA 3RM0H 1IAUA 1QURH 1XM1A 1BTYA 1YPKH 5JDUB 1FUJA 2BDHA 2BDAA 2A5KA 1DICA 2BQ6B 1DS2E 2KZ4A 2LELA 2VINA 3CP7A 5LGOA 4X1PU 3S7HB 4YTAA 4UFDH 3BV9B 2FEQH 2WPIS 3A7WA 3AAUA 2C93B 1E1QD 3SV7A 5C3NA 4ZKSU 1QA7A 1UCYH 2OLGA 4FETA 4BTTB 1A5HA 1O3CA 1A46H 1W0ZU 2KAIA 5TCCA 1HAPH 1G3DA 1NRRH 3EE7A 4J1YA 3V13A 2FX4A 2W6JD 4WXVA 5JBAS 3SU2A 1CA0B 2ZPQA 1B5GH 3LH3A 1EPTC 5BPEA 2KCAA 2A4QA 4GHQA 4FUCA 3LKWA 3MU0A 3ZZ5A 5J4QA 1GJDB 1DITH 3N7EA 5GPIB 4DVAU 3Q3KA 2UWLA 2OC8A 1UK3A 2XC4A 1GMDG 1ANEA 2FOAA 3TGIE 4XBCA 1LKBA 4KP0A 2VGCB 4MNVA 1EZSC 2OUAA 4JZIA 1D6WA 4NWLA 1FY8E 2B5TB 1TX7A 5I46H 3SGBE 4HTCH 2R3YA 2XBXA 4O9VA 3QWCH 8KME2 1C5XB 3OY5U 1W0YH 1LHEH 2HNTC 1GHWH 3TNTA 4Y76A 1C5LH 2ZHWH 4TT3D 1KDQB 3S69A 4FUGA 3MU4A 1A0LA 1BBRK 4ZXXH 2BD8A 1GBLA 2VVVA 4I8LA 4YM9A 4X8UH 5CE1A 3SN8A 2GCTC 1C2HA 1DOJA 3FP7E 2OC1A 1HAIH 4AFUA 4NSYA 1G3CA 4B2AA 1P3CA 4O3UA 3OSYA 2W3KA 1Y59T 4KKDA 2PWXA 4VGCC 2K0QA 2BLVA 4DT4A 1QRXA 3TK6A 1CA0C 4YESB 5FAHA 5G4BA 1CGHA 1P2IA 1GL1A 4BAMB 2ZQ2A 5A09A 5JYIA 1H9LB 1UO6A 4O03A 2FTLE 2ZGBH 2VJ1A 5E8EH 1HAHH 1NN6A 1DUEA 1XX9A 3SJIA 3ZVFA 4F48B 1B0FA 3V3MA 3BG4C 1RTFB 1A1RA 3GDVA 1GJ7B 3FKSD 3BTEE 1AQ7A 1QB9A 3RXVA 3VB7A 1AY6H 4Q7XA 1ZHMA 2OBQA 3VGCB 4E7NA 1TNJA 2Y5FA 1CBWB 3UIRA 3RP2A 2FOMB 2O8TA 2BLOA 1OX1A 5HIYA 2SNVA 3BSQA 2ZU4A 5AHGH 1NFYA 2VWLA 1PQ8A 1GHXH 2EA3A 1OPHB 3A7YA 2H6MA 3PV5A 1KXCA 2GKVE 2ZZUH 1IOEA 1P02A 2PSYA 7GCHG 3O8BA 3W95A 1UVTH 1G3BA 3SUDA 4H42U 3TJOA 2ZTXA 4INLA 2ZPSA 3GISB 3SQEE 2C90B 2GX4A 2B9LA 3D49H 1GI5A 3PTNA 5DP9A 2BVSH 1MKXH 3T28A 1WXRA 3QN7A 1VCPA 1V2MT 1KDQA 1BT7A 1A5IA 3MH7A 3QTOH 2GV7A 2H1UA 3EDXB 2ZCLP 3NRLA 3PV2A 2IPHA 1WBGB 1BBRH 1L4ZA 3T2NA 5F03A 2AS9A 2UUJB 4I31A 4B2BA 1KXDA 4KTUA 5IDKA 3ATWA 1LDTT 3SU1A 2PTNA 4FUFA 1LO6A 3VGCC 1EASA 3SUFA 3E0PB 1QY6A 1CBWC 3MU5A 2Q6GA 1HRTH 3U8OH 1LPKB 1EP6A 1P2QA 3UFAA 1SGFG 3SJOA 1A4WH 3RXCA 1NU9A 2J38A 2J2UA 4AG2A 2ZDNA 2GD4B 1JIMA 2ZTZA 4Q63A 2A5IA 4MQAA 4XFQA 4UEHH 2VWNA 3TJUA 1SL3A 3P17H 5TJXA 4BNRA 4MDSA 1QBVH 3SJ9A 1J17T 1XUKA 3QK1A 5DP8A 1C9PA 5T6GA 1RD3B 1GHYH 1QA0A 1VR1H 1GMHF 1Y8TA 1CQQA 2I6QA 2ALPA 2R0KA 4RI0A 1HV7A 3GY2A 4OS2A 2BD9A 2BZAA 2JJ2D 2G55A 3MO3A 5JBCS 5A0CA 2IPQX 2SGFE 1SQOA 2QXGA 1BRBE 5EJ1A 4O97A 3PMHB 1CO7E 1MCVA 3MNBA 2A0QB 1HJAC 2HVYB 4AFQA 4IC5A 4Y7BA 2ZDKA 2D8WA 3BEFB 5CMXH 1GHBG 2PKAA 1YPHE 1WQVH 1MAXA 3KNXA 2ZFSA 3ZVBA 4M7GA 2ZKSA 2LP6A 2XNDD 3MU1A 1NRPH 2FI5E 4GCHG 4X1QU 1PYTD 3BTWE 1LVOA 1TB6H 2BX4A 5A0BA 2XYAA 2F9BH 1C1PA 4GLYA 1D4PB 1G37A 1OWKA 4X2XA 3LU9B 4NG9H 1UTPA 3S9BA 3RXRA 3WW7A 5DP5A 4BAQB 1UJ1A 1XUHA 4YOIA 5FL7D 4A92A 3S0NA 3SOSA 1THSH 4AB9A 1YCPM 3MHWU 2HRVA 1YPGH 2ZTYA 3SNAA 1C1RA 1KXEA 2JJ1D 4GSOA 1N6YA 3A86A 1UTLM 4FOUC 2BVXH 3KIDU 3UR9A 1K1MA 1QQ4A 1T8NA 1N8OB 2BM2A 5HGGA 1GDQA 1AKSA 3A8AA 4DGJA 2ZP0H 1H8DH 1LQEA 2GZ8A 1AZZA 3FZZA 2Y7ZA 2EI6A 1GVZA 1VITG 1J15A 3OU0A 4AORA 1DXPA 1SGEE 4GAWA 4I8JA 4NZQA 2P3UB 3DT0H 3SBKA 2YNBA 4FVBA 1LVBA 1AFQC 4D9RA 5E2PA 1SMFE 5EG4A 2BD2A 1TMBH 4ABIA 2PHBA 4ABHA 2F91A 1TE0A 1NRSH 2O8LA 1SQRA 1EOLA 3LONA 1IQIA 2GCHG 3B8JA 1INCA 1O3FA 1O3OA 3LGUA 4BXSA 1ZMNA 1FV9A 1GJCB 1H8ED 1BTXA 3ZZDA 2W3IA 2BX3A 2VH0A 5A8YA 1HYLA 4YXWD 1LKAA 1C5RA 1S6FA 2G5VA 3F9EA 4X8SH 3TNSA 1UK4A 4ABJA 1E0FD 1ELTA 3KYFA 1TNHA 2B0FA 3MTYA 1SGIB 1OWDA 1MTNC 1O39A 3SV2H 1O2JA 1D3QB 1QRWA 3LPRA 1PJPA 4LOYH 4D76A 1N8OC 4Y71A 5K0HA 1A0JA 3UWJH 1TGNA 1A61H 1CGJE 1Z6EA 4K8BA 3SGAE 3T26A 2XNIA 1BOQA 2A32A 1L4DA 2G4TA 1TA6A 1AO5A 1TPSA 1L2EA 3S9CA 3SU6A 1L1GA 1CT0E 3UR6A 2BY7X 1X7AC 1G2MA 1O36A 1YF4A 2P94A 1G9IE 1MTVA 2BTCE 4XRNA 3L3TA 3EAJA 3A7XA 3NK8A 3ZVCA 1Z1IA 1QGFA 5HKKD 2JH0D 1GVLA 2R0LA 4CBNA 2VIVA 3V0XA 4Z1MD 1C5TA 1GMCF 1C4U2 1C1VH 1YM0A 3QO6A 5CHBA 2TGPZ 1QZ8A 4Q80A 3E16B 2PGQB 1F0UA 4ISNA 2AGEX 3EQ0H 4CR9A 1WUNH 1QJ1B 1DXWA 1G30B 2ZCKP 4RSPA 2SGDE 1MBQA 1WU1A 2DUCA 1GI8B 1SGDE 2CN0H 2A4GA 1KTTB 4P02A 1J16A 3OEHD 1GCDA 2JETB 1HIAB 2R3UA 3BTHE 3CS0A 1KIGH 5AFZH 4B75A 3ENSB 3ODFA 5ETXA 4X8VH 2NU0E 4GHTA 3M3TA 5DG6A 1C1NA 2Y6TA 2XOKD 2CJIA 1D3TB 1P9UA 1BTPA 2XBYA 2GZ7A 2ZDVH 2BD4A 1C5MD 1PPCE 1TYNA 4SGAE 2A4OA 7LPRA 1XXFA 2QY0B 3M5LA 1H9IE 3KGPA 3O8RA 1UCYK 4WXIA 1C1SA 2Z9LA 1CE5A 4Y8YA 1Z7KA 3FOAA 4B73A 5EXNA 6ESTA 5C5OA 1G3EA 1BHXB 1TRYA 1ZPCA 4ZUHA 4UDWH 2OP9A 3RLWH 5T6DA 2KAIB 1O2NA 3ODDA 4NIWA 1WCZA 1ZOMA 4ZHLU 1SHYA 2WPJS 1WV7H 3RMOH 3W1EA 2A7HA 2I6SA 2IN2A 2FP7B 1W2KH 5E0HA 2AGGX 1HAZB 1ARBA 4MPVA 1QIXB 1V3XA 3LIWA 3ATMA 3U9AH 3A84A 1RGQA 2XWAA 3AASA 1GHZA 2FLRH 1SOTA
chains in the Genus database with same CATH topology
1SGTA 3R3GB 2UUFB 5EGMA 1K1IA 4FU7A 4YT7H 5GCHF 3FAOA 1HAGE 4UFGH 1O3GA 3MU8A 1CT4E 4ZAEA 2BD5A 2A7CA 1V2WT 4HZHA 4LZ1H 1U6QA 3RC6A 2XXLA 3RXGA 1FN6A 2QV1A 1S82A 2BDYA 1K1NA 1O2ZA 1F0TA 5F8ZA 1CHOG 4AYVB 1Z8JB 1QB1A 1K28D 5FCKA 1LHCH 2ZU5A 2ZDMA 3ZVEA 2CF8H 3QZQA 3O8DA 4Q2KA 1TQ7B 2ESTE 4OS7A 2ZPRA 1TIOA 5A2MH 3SORA 4X8TH 2AMQA 1J9CH 1FMGA 5EW2H 1O2SA 5DP6A 1TNLA 1OP0A 2C8WB 2ZWLH 3RMNH 3EA7A 2GV6A 4NIVA 2FMJA 2VH6A 4MNWA 5FHTA 1HIAA 2ZF0H 3E90B 3BTME 3M3SA 3SJ8A 1JIRA 4HGCA 3GICB 4YT6H 2WUCA 3F1SB 3NCLA 4HI3A 1BQYA 2OC0A 1K1OA 1ZRBA 4OS1A 1GG6B 1MU8B 3AVZA 1FZZA 4ABGA 3ZYEA 2V35A 3VPKA 2F9VA 1Z8GA 3P8FA 4MVNA 1C5PA 4ABDA 1SGCA 1MKWH 4CRCA 4KTSA 2SGPE 3AW0A 1BRCE 4D7GA 4LXBH 2G51A 4XBBA 3GY7A 2JH6D 2BDIA 4DJZB 3IWMA 1O0DH 3LT3A 1SGYE 1DDJA 3O8CA 1SVPA 3GY3A 1IQFA 1AWFH 3TK5A 1T7CA 1THRH 2ZIQH 4ISOA 1EAWA 4INKA 1ID5H 3IG6B 1J14A 1EJMA 2BHGA 3EE0B 3F9FA 1ZGIA 5FBIA 3LC3A 4Y0ZE 2ZHEH 4BTUB 3E1XB 1TABE 4A5TS 1IHTH 4FUEA 3SHCH 4B74A 1O5EH 1ELBA 1FY1A 3ZVAA 1KXBA 1SQTA 2AIQA 4ESTE 4K1SA 5AF9H 2VU8E 3DFJA 1HDTH 3SV8A 1JOUB 1YPMH 4WMFA 3ZYDA 1ETTH 1VZQH 4BAOB 3TH2H 4IN1A 1IQLA 2UUYA 1MKXK 3F6UH 3G01A 1PPFE 1MCTA 2CGAA 1PFXC 3K6YA 2HWLB 3ZZ4A 6CHAB 1GCTC 1SGPE 4CRFA 3KQDA 4X0WU 1XUGA 1O3MA 2OXSA 3RMMH 2VIWA 1CSOE 1E34B 4FXGH 2XBVA 5FX5A 3RXFA 1FY3A 1RJXB 2ZFQH 3SW2B 1PPBH 1TNIA 3GCNA 1O3LA 2FXRA 1O32A 1TA2A 1C1MA 1VJAU 2FS8A 4I8HA 1QNJA 4OS6A 4D8NA 5GJ4B 1V2OT 3KCGH 3VXFH 1HJ8A 4Y0YE 1LTOA 1F7ZA 1QBOA 1F5LA 4X1NU 4ABFA 1GI0A 4AZ2B 1GJ6A 3SV9A 3UOPA 1C2KA 5CHAB 3N7OA 3P8OA 1O35A 1BA8B 3TJNA 2PFEA 3ZZ3A 1SG8B 2H5CA 1WQSA 1D6RA 4OGYA 2VWOA 1ELVA 1GWAA 1O30A 4AFSA 3PMBB 1ZTJA 3T5FH 1TONA 3RU4E 1NPMA 4U32A 1Y3WA 3HPTB 2VGCC 4Z0KA 2Q6DA 1NT1A 3PV4A 2UWPA 2VIQA 4BTIB 1WTGH 1EJNA 1FNIA 1HXEH 1SBWA 4I33A 1O2LA 2BD7A 2ZCHP 1P05A 1G2LA 1P03A 1UTNA 2G4UA 2O8MA 3T27A 2ZG0H 4FUBA 4JZDH 1GDUA 1ZGVA 1HCGA 1O2UA 4NA7A 4KTCA 1OOKB 2FIRH 2FTMA 1GBMA 3PWBA 1YP9A 4BANB 2ANMH 2F9NA 2P8OB 2PKAB 1OS8A 1H8IH 2G5NA 5EQQA 2XCFA 5C67A 3E6PH 1YC0A 2BY6X 4YO9A 4UD9H 2HGTH 1O2VA 2ZGJA 2V3OH 1EZQA 3NPSA 2WYGA 1P8VC 2R9PA 1HJ9A 1NRNH 2BVRH 4NIYA 2FM2A 2A2QH 2SFAA 3SU5A 5CHAC 3D62A 3B23B 1ACBE 2NU4E 5E0GA 1P10A 9ESTA 4TPIZ 1V2RT 1O3DA 4AOQA 1MU6B 1DWBH 3GCTF 4TY7A 2BY9X 2ZHFH 4MPXA 2WV4A 1BBRE 1TOCB 2RCEA 3SUGA 3ZZCA 4BXWA 6GCHF 3URCA 2RG3A 1UTQA 5C1YA 4O3TA 1AKSB 4NGAH 2Z9JA 1QQUA 1FAXA 1UVSH 4FU9A 1GJ5H 4I32A 2SGEE 3NZIA 4CR5A 2J92A 3M36A 4K2YA 1TBQH 2Z7FE 5L2YH 3UNSA 2AIPA 2GDDA 3GDSA 4FU8A 4CHAB 1DY8A 3BTGE 4A6LA 4NSVA 4JZEH 4H6SB 1O3AA 1EZXC 2ANYA 3GY6A 1FLEE 1Y3XA 1L1JA 1IQNA 1BRAA 3PTBA 8ESTE 2TBSA 1FAKH 2C8ZB 2WPHS 3D65E 2J9NA 3KQBA 3BN9A 5JBBS 3FFGA 1GPZA 2ASUB 4MLFB 4K1TA 1LPZB 3OYPA 2EI8A 1ZR0A 1HLTH 2G81E 4YOGA 2H2ZA 1GI7B 5GXPA 1C5SA 2J94A 5FBEA 1QL8A 1ETSH 2J34A 2QAAA 2SGAA 2ZHDA 4TY6A 1GHAF 3DA9B 1BZXE 1N6XA 1TQ0B 1LVMA 1SPJA 1PPHE 4ZH8A 1H1BA 5LPFA 4AX9H 1C2FA 1TPPA 4X6PA 1F0RA 2BYAX 4UFEH 1DANH 5HM9A 1ZYOA 1GMDF 5EQRA 1GBTA 1ZJKA 3EYDA 5ABWA 2FWWA 2YNAA 3PWCA 1O2MA 1QBNA 3A7TA 1C2JA 1YLCA 1ZPZA 4B1TA 1O33A 1SSXA 3M61U 2FPZA 4K3JA 1VCWA 4NA8A 5IYTA 3H5CB 4U30A 4A1XA 1Y5AT 1XKAC 4CHAC 2JKHA 1FY5A 2A31A 4TWWA 3CENA 2JH5D 4IS5A 2P3TB 2CXVA 3RXLA 2QF0A 2K1QA 3UPEA 3RXMA 1GI9B 3R0FA 1K9OE 2PKSB 2QXJA 4AFZA 3ZVDA 1CVWH 1T8LA 1B0EA 5HYOA 2XRCA 3TK9A 1AUJA 1C4Y2 1IQHA 2Y81A 4DIIH 3RXOA 5GCHG 4ZKRU 2OBOA 7KMEH 3KF2A 2BZ6H 1P09A 1V2NT 1E38B 3RU4T 3P70B 3RXDA 1FDPA 4RN6A 2VIDA 1C5ZB 1SLVB 1HPGA 3SU4A 2XCNA 3TVJB 3SNBA 3AW1A 3LGYA 4K60A 1GI1A 1S5SA 1F92A 2BLWA 2C4FH 1ABJH 1TAWA 3FP8E 4MPUA 1C5QA 2ZECA 3PLBA 1MQ6A 4CREA 1YPEH 2F83A 3A85A 1Q2WA 3I78A 1AZ8A 4U01A 3Q76A 3TPIZ 1GVKB 1HBTH 2J95A 1TRNA 1A2CH 1GBCA 1Z1JA 3RXEA 5K7RA 1AVGH 1PQ7A 2FX6A 3SI3H 1RIWB 3LGWA 2VIPA 1L1NA 1DFPA 4UE7H 2Z9IA 1CA8B 1BTUA 1V2VT 4YLQH 2RA3A 2Y5GA 1ELDE 4OS4A 1MTUA 1NFUA 3M5MA 7GCHF 3T29A 1EB2A 1ESAA 2OTVA 2PGBB 1AB9B 1AI8H 2PKSC 4H4FA 1YCPH 2ODPA 4XSKU 2TGDA 1UVOA 2ULLA 1P12E 1G36A 3FANA 1TRMA 1C1TA 1P9SA 1T32A 1YKTA 1JXPA 1Y3VA 3QX5H 5A0AE 4HFPB 1HAOH 4PROA 1H9HE 1C2GA 3MFJA 1NU7B 3MI4A 1VITH 1NZQH 1WOFA 2J4IA 3GDUA 1PPZA 2F9OA 4RKJB 1BJUA 3ZV8A 2GT7A 3SI4H 5EU8A 1O3BA 4NIXA 3UNRA 2P93A 3A81A 3LH1A 4ZKNU 2QF3A 2R2MB 4JK6A 4ZHMU 1B7XB 2QXHA 3RXBA 1BMMH 2FOCA 1GJ8B 1V6DA 3MNCA 3U69H 1ESBA 5C20A 1GBBA 1OWHA 1QJ7B 3RMLH 4JZ1A 3ATKA 1BTHH 1P2OA 5DP3A 4RKOB 1HAVA 3RXJA 2FS9A 2PW8H 1O3JA 4IMZA 1O2TA 1C2MA 1ELGA 4IGDA 5ESBA 1RIWC 5A8ZA 1OWEA 3GY8A 3H7TA 4JYUH 4FUJA 3L6PA 4SGBE 1T31A 4GPGA 1RRKA 4IBLH 1ELEE 4FUDA 1K21H 1P01A 5L2ZH 1ORFA 1AB9C 1RXPA 1FN8A 1IQGA 8GCHF 1MD7A 1ELCA 1GJ9B 2FLBH 4AB8A 3GYMA 2FOFA 5FXLA 3I77A 1P2JA 3RXAA 1VGCB 3UY9A 5EPNA 3ATLA 5EW1H 4WF8A 2O8UA 4DIHH 3NKKA 1W14U 1O31A 1MKWK 1O3HA 2ZC9H 4I8KA 1NROH 4FUIA 1C5VA 1WAYB 1TX8A 3VB4A 2BQ7B 3GOVB 4WVPE 4X6NA 1W12U 1O3KA 1AD8H 1UVPA 2GGVB 3VB3A 1AMHA 2AFQB 3A88A 1ABIH 1GHBF 1O5CB 1XUJA 4K1EA 1C1UH 2OQ5A 1BTZA 1GGDB 4X1SU 2WPMS 1DY9A 4GCHF 1OYTH 3IITA 3VFEA 2RA0A 4XBDA 4DW2U 2F9PA 1C5OH 1GDNA 1ETRH 3VB6A 1O2QA 2GDEH 4AN7A 3MOCA 1YPJH 1OP8A 4BOHA 2THFB 1EJAA 2DE8A 2G00A 1C2IA 2P16A 3RXKA 1NY22 4FUHA 1F2SE 3JZ2B 5FPSA 2JETC 3A7VA 3Q3XA 1F0SA 3BTDE 1YLDA 2QCYA 1BMLA 1LVYA 1SGNE 2WUBA 1EX3A 2BDBA 2ZDLA 4E06H 1EOJA 1CGIE 1PPEE 3HATH 5JPMH 1VGCC 1AVXA 1BMAA 1C2DA 4X1RU 2XC0A 1VITF 3ZV9A 2Y82A 1SLUB 3BF6H 1FPHH 4UONA 5A8XA 3RLYH 1JMOH 2SGQE 3M3VA 4TPYA 2NU3E 4ZMAH 2BB4A 4JYVH 1BMNH 1AHTH 3MYWA 1TNKA 2Y80A 1P3EA 1CU1A 1LCYA 1XUFA 3VXEH 1EB1H 1O3IA 1OYQA 1RTLA 4DT7B 2QA9E 2ZGXH 4CH2B 2GCHF 2FESH 1DPOA 1N1LA 4E7RG 1ZTLA 8LPRA 1GGDC 1A3BH 2DE9A 1O5DH 1BITA 3PLKA 2QIQA 1E37B 2Z9GA 5HM2A 1KSNA 3GCTG 3TU7H 3SNCA 4DCDA 4ABBA 1HFDA 1W13U 1DWEH 2GTBA 3UQVA 1P2KA 3SU3A 3V7TA 1C1QA 1EAIA 4BAKB 1TBZH 6GCHG 2VNTA 3C27B 3BEIB 2ZHQH 5J4SA 1ZSJA 1UTMA 5EODA 4U2WA 2BOKA 5H4IB 1ZZZA 1UCYE 4A1TA 2SNWA 1W7GH 2HNTF 2W7UA 5EOKA 2Z6BD 2P59A 3A7ZA 3D23A 2LPRA 5JB8S 3PO1B 1O5BB 3U1IB 1MQ5A 3PM3A 1FPCH 4DURA 2GCTB 4X6OA 2TRMA 2ZA5A 4INHA 1O2IA 1QL9A 4WWYA 5HMAA 4Z6AH 1K1PA 3GY4A 1ELAA 1Z8RA 3TLOA 1GMHG 1O2KA 4NA9H 4F4OC 4VGCB 3P6ZB 1HXFH 3LC5A 1MD8A 1QL7A 2QGRA 3VB5A 3QUMP 2TIOA 4ZROA 5DP4A 2FODA 4DY7B 1OWIA 2V0BA 1NC6A 1QJ6B 1GHAG 1V2JT 5EPYA 1TWXB 3RXPA 1HAXB 2ALVA 2FOHA 3MWIU 1DSTA 2NU1E 4J2YB 3URDA 4AG1A 1GJ4H 1BJVA 1DWDH 2VIOA 2WINI 5EQSA 3BG4B 1ZRKA 2EC9H 2RDLA 3RXIA 1FIZA 1AE8H 1UK2A 5E0JA 2XTTB 1GG6C 2BMGB 3SNDA 2FI4E 5BRRE 1BRUP 1ARCA 3BTKE 2WPKS 2W7SA 3A87A 4A1VA 2QYIA 2R2WU 4YOJA 4ZKOU 4R0IA 3A89A 3HK3B 3KQEA 2QN5T 1EAXA 5C5NA 3K6ZA 1A0HB 1C4V2 1WSSH 3TH3H 1EPTA 1HB0B 4AGJA 5I25A 4X2YA 5DP7A 4CRBA 2QC2A 2B8OH 1SFIA 2H9HA 1O5AB 3PO1C 1EQ9A 4QT8C 4ABEA 1ZSKA 1S6HA 3STIA 1LMWB 1ZHPA 1C2LA 2BOHB 2W26A 3LJJA 3BTFE 1WTHD 1QCPA 1W3CA 1BTWA 1LPGB 2B7DH 1W11U 1Y5BT 3LDXH 3RU4D 1O5GH 4LZ4B 3S7KB 1MMJN 1C5WB 1GI6A 3NWUA 1ESTA 2UWOA 1W7XH 3F68H 5FPTA 2VB0A 3PROA 2EI7A 3SUEA 1MTWA 1V2QT 3T62A 1SGQE 1Q3XA 4Y79A 5GWZA 1IQEA 5AFYH 2W5EA 3EGKH 1YPLH 4WJG2 4JMYA 1ELFA 2OC7A 1HGTH 3W94A 3BTQE 4UFFH 5DJ7A 1BB0B 2ZGCA 2GP9B 1TPAE 1FQ3A 4B76A 3MO9A 1ZHRA 4AGKA 6CHAC 1M9UA 3UREA 5L6NH 1GBEA 4KGAA 3UWIA 3VEQB 4ABAA 2BXUH 4JK5A 4OGXA 5HXFA 1O3EA 1C5YB 2BDGA 1S84A 4JZFH 1FXYA 4Q7YA 2O9QA 4IC6A 1O2RA 4K69A 3RUOA 4X6MA 2EEKA 3B9FH 1O2HA 2FOGA 5F8XA 1GL0E 1SLWB 1CHOF 1EATA 1SI5H 3K9XB 1MTSA 3RXTA 1UTOA 2OINA 1A7SA 3HGPA 3KQCA 3RXUA 2HPPH 1TNGA 4JYTA 1RFNA 3I29A 1BCUH 1GBFA 2FO9A 1TX6A 3A8CA 3OX7U 1C1OA 3P8NA 1P2NA 3TGJE 1GBJA 1IQKA 5E2OA 5DGJA 3UUZA 1ANBA 4JCNA 4CRAA 4XOJA 1TGBA 3MO6A 1DWCH 4XE4A 2YOLA 2PUQH 2GT8A 1GI3A 4ZXYH 3GCHB 1D3PB 1P0SH 2AYWA 3SHAH 1HJAB 2OQUA 3LGTA 1UVUH 1AUTC 1XXDA 2FDAA 2UUKB 1ZLRA 3P95A 2NWNA 1C1WH 5T3HA 3UOUA 2HLCA 3MH4A 3P8GA 2WYJA 1GMCG 2FI3E 2Z9KA 2D2DA 4ISIH 1O2PA 2IJOB 4LK4A 2AMDA 2ZFPH 7ESTE 1O37A 5SGAE 3AAVA 1JRTA 2Z3DA 2P8OC 3RXHA 1DSUA 3H7OA 1F5KU 3M37A 1TBRH 5DKMA 2A4RA 1MZAA