1C2JA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2jA02
3Q3KA 4MPXA 4KKDA 3FZZA 1ELVA 1MUEB 1V2NT 4K1SA 3SU0A 2P8OC 2BVRH 3S9AA 4AYVB 1Q2WA 1H9HE 1B0EA 1MCTA 2D2DA 3VFEA 1OWDA 4NIWA 1GVKB 2ZQ2A 1PQ8A 4K8BA 1O31A 2ZGJA 1A2CH 5EG4A 1GBMA 1UTMA 1J17T 2O9QA 2AH4X 1O3BA 4RN6A 3KCGH 1C5RA 1O33A 4TPIZ 1BMMH 3BTWE 2JETC 2FZZA 2W5EA 1GBLA 3E6PH 4H4FA 1YCPK 1GJ5H 1V2OT 1UK4A 3K2UA 1ANDA 3ZZCA 2GCHF 4X8VH 1W0ZU 1SGYE 4BAOB 1P05A 1C5WB 3SI4H 2ZDVH 5C5NA 1HAVA 1VGCC 3T28A 5JBCS 1J16A 2KAIA 3RM0H 1A5HA 2ZU3A 4B1TA 4FUJA 3UWIA 3M35A 1QJ6B 5J4SA 5LGOA 2WV4A 1G3EA 2QAAA 4NA7A 3BG4C 1P0SH 2PTNA 4HZHA 4OGYA 3ZZDA 1BMNH 3SHCH 1O2ZA 2P8OB 1F5KU 1AWFH 4E06H 1FY5A 2QF0A 1AY6H 1TNKA 4I8HA 3MH5A 1AE5A 1TPSA 2ZDKA 4JCNA 2I6SA 2BDBA 2XYAA 4MLFB 3UNQA 1MAXA 2STBE 3A7XA 2EI6A 1YCPH 3MH7A 1YYY1 1UHBA 4BXSA 2HWLB 2A5IA 3A83A 2ZU4A 5FXLA 2BVXH 5DP5A 1LCYA 1DSUA 2Q6DA 1MKXK 2GX4A 4WVPE 1SG8B 4BAHB 2ZA5A 1V3XA 1K1OA 1QB6A 3PB1E 4K60A 4LK4A 1QURH 3IG6B 1XVMA 1O5FH 3AASA 4X1NU 4XBCA 1HB0B 3M5OA 1NRSH 1DX5M 1MZDA 3FVFB 2C8XB 2V6NA 1VGCB 1YPMH 3GY5A 1CA8B 3K6ZA 1IQKA 3CP7A 2ESTE 5LPRA 1JMOH 4CRCA 1NM6A 2P95A 4MG3A 3GYMA 4NFEA 1ZRKA 1TMBH 2C8WB 1TBRH 1PPCE 1ANBA 4WY3A 2WUBA 2PKSC 2TGDA 5E2PA 4O97A 5AHGH 5GJ4B 1HAOH 3T27A 2F9UA 3P8GA 1C1VH 2F9VA 1O5CB 3A89A 4ZH8A 2QYIA 4MNXA 3LGTA 3DFLA 1MKXH 3SU6A 3PLKA 4K3JA 1C5ZB 3BIUH 1WU1A 1GI7B 1GMHF 2G5NA 1BTZA 4OS7A 4X1QU 2A32A 1HAYB 2H2ZA 1Y8TA 1PPFE 2F9OA 2GCTC 1TONA 1DUEA 2VWNA 4MTBA 4ZXXH 3SU1A 2QXIA 4YT7H 2HPPH 3BTGE 1THRH 1QL9A 1O3KA 1C2DA 1FIWA 2OC8A 1FUJA 3NUMA 2ULLA 1SQTA 1L1JA 5A8YA 1GBFA 2G52A 3RXTA 1QRWA 2WPLS 3SNAA 1GCDA 3ITIA 4UFFH 2TGPZ 3RXSA 3ZZ3A 1AD8H 3HATH 1OYTH 1O2SA 5PTPA 5DGJA 1Y3UA 5TCCA 2PHBA 3KL6A 4B73A 3Q77A 2FLBH 2EEKA 2PKSB 2WYGA 2XRCA 5EPNA 4YLUA 1AKSB 5EW1H 1BBRE 5GWZA 1Y59T 2FOHA 1TX6A 3OY5U 1P04A 1UJ1A 1PPBH 2A45B 4FVBA 3NKKA 1DXPA 1SMFE 2TGTA 3SN8A 1GHVH 2GT7A 3RXMA 2A4QA 2FX6A 1OPHB 2G8TA 1L2EA 1XUJA 5GXPA 3E3TA 2ZGBH 2J9NA 1ELGA 4TYDA 1QY6A 3Q76A 1TMUH 4IC6A 1LTOA 2Z9LA 3GDUA 1RD3B 3RMLH 3TIUA 4A7IB 2Y81A 4NA8A 1A5IA 1LQDB 2PTCE 3E0PB 5GDSH 1VITH 2ZTYA 1AI8H 1MTUA 1QL8A 4MPVA 1JBUH 3UOUA 3VXFH 2GDDA 4JZFH 3F1SB 2Y7ZA 2BZAA 1BTWA 3SGBE 2G81E 4AX9H 2JKHA 1C1TA 3MFJA 2SFAA 1FY3A 1KXFA 1T8OA 2A7CA 3MO6A 2PV9B 3F9EA 2ZCLP 3KN2A 1UTPA 1P09A 1WTHD 4NIXA 1EP6A 2BD8A 3ZVDA 5IDKA 3B23B 4NSYA 2M5TA 2B5TB 4GAWA 3GCTG 3ZYEA 1SFIA 3LU9B 1E38B 1NFUA 1QRXA 1KLIH 4UFGH 1B0FA 1P03A 5GIBA 5DP8A 1UK2A 3OSYA 3M5MA 2O8WA 1XXDA 1EJMA 4BXWA 3ELAH 1P06A 1Z7KA 2B7DH 2A4RA 1ESTA 4LZ1H 4O9VA 2KAIB 4KGAA 3A7VA 1FI8A 4HTCH 2FESH 1AFQC 1EPTA 1K21H 1GI4A 1H8DH 1O2LA 1TNJA 1TLDA 3ATKA 4ASHA 1YGCH 5T6GA 3M3VA 1GI2A 1D6RA 2FYRA 2J94A 1WYKA 3H5CB 3W94A 1THSH 1K1IA 4A92A 1LKAA 2H5DA 1HPGA 2BLOA 1SOTA 7KMEH 1QA0A 2UUJB 3MU1A 2O8UA 5IYTA 1DWEH 2VJ1A 1QFKH 2ANMH 2BD2A 3QUMP 4NIYA 3SU4A 5E8EH 2A2XH 1Y3WA 2PKAB 1C2EA 3EA8A 1P9UA 1FY4A 1D4PB 1HIAA 4FUCA 3RLWH 3BTQE 1GCTC 4X0WU 3T2NA 1AVGH 1C2JA 4ZMAH 1CU1A 1A3EH 2STAE 2HPQH 3GCHC 1TPOA 1EJNA 5A09A 3E8LA 2BX3A 4FUHA 4ZKRU 3H7OA 2ZHWH 4WXIA 5T6FA 2TGAA 3UQOA 2CMYA 2SGPE 2W7SA 1PPZA 1W13U 4E05H 1OWEA 2Z9JA 3BG8A 1GI3A 1BUIA 3SORA 2B8OH 1C5PA 3F9FA 2VWMA 3RU4D 2BDHA 5FBEA 3ZVFA 1O3HA 4Y7AA 4DOQA 4Q80A 4WF8A 1WSSH 4XDEA 1FY8E 2BM2A 1O5EH 4WWYA 3AAVA 2FEQH 1TNHA 3BV9B 2SGEE 2ZTZA 3DA9B 1W2KH 1G3DA 5C2ZA 1MBQA 1BRCE 4OS2A 1IAUA 3SUGA 2AYWA 3BEIB 4CRDA 3AAUA 1C2HA 1DICA 3RXKA 3HGNA 5L2YH 2PR3A 1C2LA 1S0RA 5FX6A 1IQFA 3BTFE 4RKOB 3RMOH 3PYHA 4I8LA 3M5LA 1HJAC 4FUFA 1KDQA 3ZVBA 4J1YA 3R0FA 2Q6FA 5JB9S 3MMGA 1C1WH 3SV7A 1SGNE 1C1SA 3GCHB 1TGTA 1TNLA 1S85A 2ZHEH 1YCPM 2VWLA 2OBOA 3KQDA 1GMCF 3C27B 1WCZA 2CF9H 1FNIA 2ZPRA 1AE8H 3RXQA 1YKTA 1DDJA 1ZSLA 1EAWA 2IOTA 1SGCA 1UMAH 2J2UA 2ODPA 2VNTA 3QGNB 1K22H 3EA7A 1QBOA 3Q3XA 1O3OA 5LPFA 3T26A 2FOBA 1P2IA 1KXCA 5C5OA 1ELFA 1IHTH 1UK3A 2Z94A 1QJ7B 5C1UA 3S0NA 4GCHG 1V2RT 4MNWA 3RMMH 3D49H 1JIRA 2R3YA 4FUEA 1DOJA 1SLWB 3EE0B 4Y7BA 5DP7A 4JZIA 2OINA 3UFAA 2OP9A 2YOLA 3SHAH 1L4ZA 3PMHB 2BY6X 2CV3A 4TY7A 1ZOMA 1YC0A 4Q2KA 4X6PA 2YNBA 2FI3E 1TGCA 2P3UB 4Q7ZA 5L2ZH 1JRSA 3SJKA 1G32B 1O38A 1MQ5A 3SV6A 2BDYA 1Y5UT 1A46H 1BTUA 1L4DA 2QC2A 1V2ST 1BMLA 2FPZA 1LHCH 1TGSZ 2Y80A 5A0BA 1GI8B 5ETXA 3T62A 3A81A 1GDNA 1W0YH 1TE0A 3VB7A 3KHVA 4NG9H 3SZNA 2UUYA 3GCOA 4YO9A 2PLXA 2UWOA 4GSOA 5FPYA 3IWMA 1DLEA 2BMGB 4E7RG 3UREA 2AGEX 3UY9A 1NTPA 2WYJA 5EU8A 3LPRA 3SJIA 1UVTH 1AMHA 1BHXB 1C4U2 2GMTB 2QF3A 1BBRK 3MYWA 1P2OA 3K9XB 1IQNA 1MU8B 3A86A 1J14A 4ABDA 4I8JA 1YM0A 1K1JA 1MTVA 1TX7A 3RC4A 4BTIB 1RJXB 5A2MH 4R0IA 2XTTB 2FM2A 1F2SE 1HYLA 1T7CA 5E0GA 4ZROA 4D8NA 2A5AA 3LGYA 1MBMA 3BTDE 4Y0YE 9ESTA 3BTTE 2FXRA 4ISLA 5EQRA 1YPHC 3GCNA 4Y8YA 2BD3A 3RUOA 1D9IA 1O0DH 2QV1A 1TBQH 3MOCA 3PWBA 3TJNA 1BZXE 3NK8A 4JMYA 1GBIA 5C1YA 2F3CE 1PYTD 3MNXA 4ABGA 1OOKB 2V35A 1O3NA 3RC5A 5FBIA 1O32A 1OXGA 5AVDA 1P11E 2VVCA 4IMQA 1VZQH 1B7XB 5A0CA 3LGWA 4ZKSU 1XMNB 4ZHLU 1FONA 2CJIA 3QZQA 1BBRH 4QT8C 1XX9A 5C67A 3S7HB 1GL1A 1WBGB 1DWBH 2I6QA 1HJ8A 4Y76A 1OP0A 4YOJA 4TWWA 3M37A 1ID5H 3MHWU 4CRFA 3NPSA 1W11U 1CGIE 1EQ9A 3PM3A 1Q31A 3SNDA 1CHOG 3SUDA 4A6LA 1NS3A 1UTKA 1GGDB 1C9PA 2OQ5A 3UPEA 2UUKB 2CGAA 2PFEA 4SGBE 1MAYA 4DY7B 3QLPH 3TPIZ 1BTYA 1DANH 1TGBA 2XC5A 3ZYDA 3GOVB 1O2KA 1C5UA 4O3UA 4GLYA 1C5TA 1MTNC 5F8ZA 4X1PU 1DY9A 2HNTC 5K0HA 4JZDH 3F9GA 1ESAA 1ABJH 2F9BH 1GVLA 2PGQB 1TPAE 5ESTE 1UVUH 4D7GA 1HAHH 4K5ZA 1CT0E 1JRTA 1SSXA 5AF9H 2ODYB 3GY2A 4Q7YA 4U30A 1OYQA 4MNYA 2FP7B 2NU1E 1FZZA 1THPB 2FLRH 1FJSA 2FOGA 1OX1A 3C1KA 4X6OA 3BTME 3FP7E 1H4WA 1HRTH 1H9IE 2ZEBA 1QR3E 1AN1E 3R3GB 4DG4A 3QN7A 1C9TA 2OC7A 1E37B 1YPKH 2ZECA 5FHTA 1L1GA 3RXHA 1AVWA 4GPGA 1VCWA 1FMGA 2ODQA 3F9HA 2P3TB 4F4OC 3KQBA 3FAOA 3S7KB 3A8CA 2HLCA 2GVFA 1EP5A 4DCDA 1QGFA 3QGJA 2C93B 1MH0A 2BHGA 2ZHDA 3RXVA 3N7OA 1MTNB 2FOCA 3FZDA 3S9BA 2FX4A 4KELA 5E0HA 3F6UH 3QZRA 2QGRA 3O8DA 1DPOA 1EXFA 4X8TH 2B9LA 1C1NA 5JBTA 2FTLE 4GUXA 2P16A 3TNTA 4DGJA 3U9AH 1C2MA 3A88A 1OS8A 2IPHA 1G3BA 2Z9GA 1G2LA 4ABIA 2ZFQH 1UTOA 1D3QB 1EAXA 2A4OA 3RM2H 1N8OC 2QXGA 4KTUA 1AVXA 3EQ0H 2BQWB 1UCYE 1TQ0B 2BD7A 1A4WH 1RGQA 1ZPCA 2H9TH 3B9FH 4ABAA 2BDIA 4UEHH 4B2CA 3HKJB 4ZAEA 3RU4T 2ZTXA 5E2OA 3SNBA 4WH8A 4YTAA 1IHSH 2ALPA 2XNIA 4JZ1A 1DFPA 3LKWA 3KQCA 3P8FA 1GBKA 4THNH 4MDSA 1YBWA 1NFWA 5EXNA 3LGIA 3A87A 1RTKA 1RFNA 2W26A 4E7NA 1V2WT 2BX4A 2AGIX 5JBAS 4INLA 1TFXA 2BXUH 4ABJA 1XUHA 2RA3A 3ATLA 2W7UA 2CN0H 2ZGCA 4IW4E 4FUIA 2ANWA 2SGDE 3QK1A 2Y7XA 1YF4A 2BY9X 2K1QA 2D8WA 3P8NA 1OKXA 2THFB 3TJUA 1QL7A 4INHA 4X6MA 5G4BA 2WUCA 4KTSA 5DO4H 2WPMS 2P94A 2LNCA 1YLDA 1TB6H 4H6SB 1N8OB 3FP8E 5DK1A 5BPEA 1EZQA 2ZI2H 1ORFA 1HFDA 2XCFA 1GJ7B 2J38A 3LOXA 1TRMA 4B2AA 1NPMA 3A85A 2H1UA 4ZHAA 2VU8E 1Z8JB 2JH0D 3GCTF 2OC1A 1VCQA 2IN2A 1C5QA 1SQOA 4AGJA 3BTHE 2BQ6B 5A0AE 2BDGA 3T25A 1QBNA 1FXYA 1DS2E 2RCEA 2ZCHP 4JYTA 4YESB 1T8MA 4BTUB 1KY9A 1PPHE 4NGAH 6ESTA 4DIIH 4JZEH 4NZLA 3PO1C 3UNSA 2ZCKP 3ODFA 3UR9A 2GTBA 4IBLH 1NRPH 1SGIB 2CF8H 4B76A 1T32A 1Q3XA 3M61U 3KQEA 1SGFG 3TU7H 3SV8A 4X8UH 1L0ZA 1A61H 3U8OH 3TH2H 4NIVA 1X7AC 3HK3B 4CH2B 1WQSA 1JWTA 4ESTE 4O3TA 1C5OH 1SC8U 2BOHB 4Y8XA 2HOBA 1AU8A 5DJ7A 3TH3H 5CHAC 3SNCA 2QCYA 3BEUA 4AN7A 2BLWA 2BY5X 3VGCB 4NFFA 1M9UA 2GV7A 9LPRA 4DJZB 3GICB 1EX3A 3BIVH 3MNBA 4CH8B 2OCVB 1XUIA 3RMNH 1VCPA 1J8AA 1HAXB 3RXUA 1O3DA 1BA8B 3MU0A 1O2TA 4WMEA 1O3GA 1CHGA 1KXDA 2V0BA 1EASA 4AFQA 2C8YB 4CR9A 1H8IH 2ZP0H 3VB6A 3PO1B 3VB3A 2ZGXH 3UQVA 3EYDA 1CGJE 1TNGA 1HAVB 3ZZ5A 1WUNH 3BF6H 2VWOA 3RXBA 1JIMA 1C1PA 1ZLRA 4DT7B 1S84A 3V3MA 1NT1A 3FANA 5HGGA 2TIOA 1ZHMA 1NY22 2ANYA 3ENSB 1EOLA 2RDLA 4RSPA 1P02A 5TJXA 5FPTA 2DUCA 2GT8A 5F03A 2VIQA 1CVWH 1MMJN 2BD9A 1ELEE 4MPWA 1BRBE 1P12E 2ZFPH 4J2YB 2A4GA 3A7YA 2JH5D 1OP2A 3KGPA 5CHAB 4X2VA 1SPJA 4XFQA 8KME2 3M7UA 1EOJA 3U98H 3GY6A 5FAHA 1HAIH 3UR6A 3A84A 4AYYB 3B8JA 3LGUA 1V2TT 1A3BH 4CBOA 1UHBB 5CMXH 1NFXA 2Y5GA 3ZZ7A 1O3CA 3TJOA 1HXFH 1CA0C 2B0FA 3STIA 1RIWC 1C2IA 4ISHH 1LHDH 1L1NA 3TITA 4FU8A 2ZF0H 3NWUA 3WY8A 3AVZA 1GBDA 2O8MA 5JB8S 1O3MA 1SLVB 1QJ1B 4TY6A 4Y0ZE 1LKBA 5L30H 3A80A 2BD4A 7GCHG 2ZHFH 4ISOA 1GG6C 1GWAA 2VINA 4ABBA 1P2JA 2G4TA 1O2UA 4K1TA 1BRUP 1GVZA 3AW1A 3VB5A 1S6FA 1UO6A 4D7FA 3EA9A 1ETTH 3I78A 3TK9A 1C5MD 1S6HA 1V2QT 3AW0A 1GI1A 1DWCH 3RXLA 2GKVE 2P3FH 3FP6E 2H6MA 3EDXB 4GCHF 3TNSA 3MU4A 7ESTE 2Q1JA 2WPKS 2LPRA 3LONA 4Y6DA 2ZDNA 2F83A 1BDAA 1D6WA 3UNRA 1SLXB 3HK6B 3ZV8A 2BD5A 2G4UA 1QQ4A 3P17H 1AB9C 2A1DB 4MVNA 5FPSA 4XBDA 4X2YA 3SGAE 1P3EA 5EPYA 2A5KA 1O3JA 4UD9H 5BRRE 1Z6EA 1GHAG 1ACBE 2XW9A 2ZIQH 3OU0A 2PWXA 1CA0B 1GBCA 1MTWA 1RIWB 3I77A 1GJAB 4LOYH 3MNSA 2Y82A 1RTLA 2R0LA 4MQAA 1TPPA 1F92A 3ATIA 1T31A 1O2OA 1LDTT 2RA0A 3MO3A 2DE9A 4CHAC 2UWLA 1D3TB 1O3IA 2J4IA 1W8BH 1ETRH 1GG6B 4AOQA 2BYAX 1NN6A 2FI4E 4O03A 3D23A 3SNEA 3V12A 5HM2A 1GI0A 3RU4E 1SL3A 1N1LA 4ABFA 1T8LA 5FX5A 3ZVGA 2O8LA 2Y5FA 3A7WA 1LMWB 3TLOA 3D65E 1UTQA 1F0TA 3VPKA 2WPJS 1A0JA 1IQGA 1G3CA 2UUFB 1G37A 3ZZ6A 3PTNA 2FDAA 4JK6A 1FPCH 3GY4A 1ESBA 2ZPQA 1UCYK 3RXDA 1QB9A 3E91A 4ZXYH 2QA9E 1BB0B 2GMTC 1GBHA 4OS6A 1MQ6A 2VVUA 3GYLB 2Z7FE 1A7SA 1AB9B 2P59A 1G2MA 3A8AA 3KEEA 4WMFA 2ZHQH 4LZ4B 4XE4A 1C4Y2 2BQ7B 3SJOA 2Z3CA 2XWAA 3PLPA 2J34A 1ZHPA 3TGIE 4OS5A 2A2QH 5T6DA 1BOQA 3LT3A 3VXEH 1O3AA 1W3CA 3I29A 1O39A 3DT0H 3JZ2B 2GZ9A 1W7GH 5FCRA 2VIVA 1WTGH 1GHYH 1QHRB 1O35A 1Z1JA 1SHHB 2ZFFH 4CHAB 1W10U 4I32A 2C3SA 3T5FH 5EXLA 1NRQH 3NZIA 3A8DA 1EPTC 1C5LH 1CO7E 2A7JA 3PV4A 3PMBB 2ZNKH 4X2XA 3LH3A 4R8TB 5TCAA 2GP9B 2YNAA 3SI3H 5JYIA 3L33A 1P57B 3DHKH 4HGCA 3ESTA 1PPEE 1UCYH 2Z6BD 2ZO3H 1GBTA 4RKJB 1N6XA 3Q3YA 2ZU1A 4WXVA 2BDAA 1PQ5A 1CHOF 2AMQA 4AZ2B 3ZZ4A 1A0LA 1C5VA 1LVOA 1O3LA 1GJDB 2Y5HA 1EAUA 1O34A 1GJ4H 1DITH 3PWCA 3LGVA 3U8TH 4DIHH 2J95A 1O2MA 1K9OE 1GGDC 4CRAA 4AFUA 3TGJE 1O2PA 1EZUC 5C1XA 3CENA 1GHBG 1UVOA 1AKSA 1NZQH 1K28D 1P9SA 1PPGE 4CRGA 2F9PA 1ARCA 4BANB 3SQEE 3RP2A 2AMDA 1QQUA 2XCNA 4ISNA 1EUFA 5F8XA 1C1RA 2ZDMA 3P70B 4AGKA 2FS9A 1G9IE 3E16B 1VJ9U 2WPHS 1RRKA 1P8VC 2AEIH 1EPTB 1HUTH 4TWYA 1DM4B 3ATMA 8LPRA 3PROA 2VGCC 3TK5A 1T4VH 1FPHH 1GPZA 1VITG 3PMAB 1LO6A 1MZAA 1O37A 1ZMNA 1MU6B 2OLGA 3L6PA 1NROH 2XC4A 3H7TA 1SFQB 1TOMH 1J15A 1GJ9B 4IC5A 3HPTB 5ABWA 1DE7H 2AMPA 2VH0A 3GDVA 1B5GH 2HRVA 1KXAA 4B71A 1Z8IB 2GV6A 1YP9A 3M36A 1RTFB 4X1RU 4B2BA 1SVPA 3NXPA 1GMDF 4WH6A 2OC0A 5JDUB 3CS7A 1FAKH 1TABE 3KIDU 3RXFA 3O8RA 1O2GH 2QXHA 3UUZA 2DE8A 1HIAB 2OD3B 1YPLH 2SGQE 4I7YH 1O3FA 1LHGH 6GCHG 2R0KA 1AUTC 1HBTH 1EB1H 2ZPSA 2SGAA 1FN8A 3KNXA 1IQHA 3O8BA 1ZTLA 1ARBA 1AWHB 4BNRA 1OWHA 1GJCB 7LPRA 3E1XB 1DUAA 1T8NA 2ZFTA 3MH4A 4YOIA 5JBBS 3TVJB 3E0NB 1DLKB 3MI4A 1A0HB 1Z8RA 4YZUA 1LQEA 2G00A 2Z3EA 1W12U 1GI5A 2TRMA 4JYUH 2HVXA 2V3OH 2ZC9H 1MTSA 5ESBA 2PW8H 4A1VA 2VGCB 1GDQA 1O2XA 1NESE 3OY6U 3UWJH 2EA3A 5A8ZA 3SV9A 1O2WA 5GCHG 3PMJA 2ZZUH 4DW2U 1TALA 2WINI 1HCGA 3S9CA 2FIRH 2QIQA 1O2IA 1TA2A 1GI6A 1KYNA 3QTOH 1LPGB 1MKWK 3G01A 4Y79A 1W14U 1KIGH 1K2I1 2VH6A 5L6NH 2NU2E 5GPIB 4UONA 2GGVB 1XUGA 1NRRH 8GCHF 3M7TA 1GMDG 4CREA 1QTFA 1TYNA 1IQIA 3OTJE 1KDQB 1HAPH 3A82A 3F68H 3K65B 1LPKB 1C1OA 3SU2A 1K1PA 5A8XA 3BSQA 4MNVA 3ODDA 4DURA 2RG3A 1ELCA 5HMAA 2JETB 4I33A 2PKAA 4K1EA 1E36B 1ZR0A 1NU9A 3ZVCA 5HM9A 1DXWA 4AFZA 1H1BA 3VEQB 1CE5A 4A1XA 1QNJA 1QIXB 2D26C 2JH6D 1O3PB 2ZU5A 3ZZAA 1QBVH 2NU0E 1TAWA 2OTVA 1OSSA 3DUXH 5I25A 1CQQA 2GCHG 4X1SU 1F0SA 1GBAA 2XWBI 1LVMA 5AFZH 4ZKOU 1Z8GA 1BT7A 1MKWH 4Y8ZA 1O2VA 3ATWA 4H42U 1PJPA 4YOGA 4IMZA 1VR1H 1S83A 3ZVEA 4I8KA 2FOFA 1ELDE 2D1JA 1WAYB 2ILNA 1ZZZA 1RS0A 3DFJA 3A7ZA 1IQEA 1P3CA 3BG4B 3MWIU 4OS1A 4LXBH 5E0JA 2BLQA 1F5RA 2WV5A 1T4UH 1INCA 1ELBA 4FXGH 2VIPA 3RXJA 1XUFA 1O5AB 1BTXA 1XKAC 1LPZB 2GDEH 1F0RA 4HFPB 1OWIA 1ZYOA 4I8GA 5SGAE 1ZGIA 2VIOA 5AFYH 4OGXA 1P10A 3TJVA 5H4IB 5EOKA 8GCHG 1K1MA 2XBWA 4K2YA 3W95A 1WV7H 4FUGA 4NZQA 1XUKA 3SV2H 3SW2B 2FO9A 5DPAA 2ZQ1A 4B75A 2FWWA 1EAIA 3VGCC 1TRYA 3TK6A 4CRBA 1ZRBA 3HKIB 1S0QA 1GBJA 3RXRA 2ZDLA 5DP9A 4XSKU 4FVDA 1V2JT 1K1NA 2SGFE 3SGQE 3QTVH 3MTYA 3RXEA 2PUQH 2AGGX 1BHXF 2BY8X 1ZHRA 1P01A 3SJ9A 2AERH 3LC3A 2GZ8A 2BLVA 5JPMH 2H5CA 5EW2H 1G36A 4ABEA 1HLTH 4PROA 3P95A 1E0FD 3BEFB 4NCYA 4FUDA 2FYQA 4NSVA 5DG6A 1AO5A 1NFYA 1FY1A 1IQMA 3U1JB 1OWJA 1YPEH 2PSYA 1XKBC 2QY0B 1O2JA 5EQQA 3RXPA 1ANCA 1TIOA 1TNIA 4A5TS 1Z1IA 3PLBA 4UE7H 1MCVA 1ZPBA 4UDWH 2OBQA 4SGAE 3D62A 1A5GH 1DWDH 1ANEA 2C90B 1EB2A 1SGFA 1XM1A 1S82A 2GCTB 3SOSA 1GBEA 1SOZA 2V3HH 3URDA 3GY7A 3SBKA 1PQ7A 1AZZA 1C2FA 3E90B 3K6YA 1GMHG 4U2WA 1TRNA 2BY7X 1C2KA 1ZGVA 4ISIH 4VGCC 3QX5H 1BCUH 3A7TA 1YPHE 1RXPA 1V6DA 5K7RA 2ZFSA 3A8BA 3LJOA 4BAQB 3BN9A 1A1RA 1Y5AT 4AORA 1EATA 4YT6H 3ZZ8A 3MU5A 5EQSA 2FOMB 1O30A 3IITA 3VB4A 1YPGH 1D3PB 4AB9A 2A0QB 2VIDA 3SUEA 2AIQA 2NU4E 2TBSA 2ZKSA 1C1UH 3P92A 1SBWA 2EI7A 5F8TA 1V2KT 7GCHF 4AG2A 1HAZB 3UIRA 4GHTA 1DSTA 1CBWC 2R2MB 1KTTB 4FUBA 4BTTB 1AZ8A 1O2HA 3GISB 2J92A 1C1MA 5HYOA 4WJG2 3T29A 5LH8A 1SB1H 1P2NA 1SGPE 4XOJA 2OUAA 4BAKB 4Z6AH 2QN5T 1E35B 2AIPA 3RXAA 4UFEH 3RXCA 2NU3E 2PGBB 2ALVA 2SNVA 2HGTH 1O2QA 1TX8A 4NA9H 4BOHA 1Z71A 3SU5A 2ZWLH 1OP8A 1HGTH 2UWPA 4YM9A 1CGHA 1J9CH 3DD2H 2WPIS 1NC6A 1Y5BT 3V7TA 1SLUB 4VGCB 2HNTE 1N6YA 4NWLA 1ETSH 1Y3YA 2BB4A 1AHTH 2Z9IA 1GHXH 1GHAF 1TQ7B 1FAXA 1JOUB 1F0UA 2BXTH 3LJJA 4JYVH 5C20A 1HDTH 5LPEA 3U1IB 1AQ7A 5B6OA 1P2MA 2XBXA 1TBZH 3OYPA 1NRNH 1DT2A 1GJ6A 3OX7U 4IN1A 3P6ZB 4ZKNU 1CBWB 4I31A 1DVAH 1WQVH 3LC5A 2BVSH 1C5XB 1SGEE 1O2RA 4AB8A 2R2WU 1V2MT 1PYTC 1U6QA 2C4FH 2HNTF 3M3TA 4ZUHA 4ABHA 1ZPZA 3MNCA 1TMTH 3NCLA 2VVVA 1BIOA 1CT4E 2NWNA 3JZ1B 4TPYA 1V2VT 3LDXH 1HV7A 1GDUA 1ELTA 1O2YA 3Q00A 3SUFA 5FCKA 4FU7A 2FMJA 1G30B 3V0XA 4D76A 5DP6A 3URCA 4D9RA 2R3UA 1BTPA 1BJUA 2C8ZB 1P2KA 3TGKE 1KXBA 3ZVAA 5T3HA 2F91A 1Z6JH 1UTJA 1WOFA 1KXEA 1AFQB 5I46H 4GHQA 4Y11E 1SHYA 1C5NH 2ZDAH 3MU8A 2FODA 1BQYA 3SO3A 5J4QA 4IGDA 4U01A 3RXGA 4Z0KA 2PUXB 2Y6TA 2FI5E 1QA7A 2BOKA 2BZ6H 2CHAC 4Q7XA 2BDCA 1O5BB 1SGRE 1KLTA 1GBBA 1TA6A 3EAJA 2SNWA 3GY8A 2R9PA 1CT2E 2OQUA 2ZG0H 3UOPA 1ZJKA 2VB0A 1W7XH 3M3SA 4ZHMU 3SU3A 2G51A 2EI8A 1O5GH 1E34B 4U32A 1IQLA 1H9LB 2TPIZ 3EGKH 2ZFRH 1MD7A 1SGTA 4OS4A 1O2NA 1FQ3A 3SJ8A 2HALA 1BMAA 2H9HA 3KF2A 2IJOB 1GCTB 1O5DH 1AGJA 2XC0A 1KSNA 3RLYH 4NWKA 4Y71A 3QDZB 1LVYA 2XXLA 1AFEH 1VJAU 1S81A 3FFGA 5DKMA 2FTMA 5HXFA 1FIZA 3GDSA 1D3DB 4YLQH 1O36A 1EKBB 2CXVA 4IS5A 2ZU2A 3CS0A 1UVPA 3U8RH 1UTNA 1GHBF 1XXFA 3BTEE 1GJBB 3MH6A 3LIWA 4D9QA 2FOEA 4AG1A 2Z3DA 1IQJA 2F9NA 1Y3VA 5EXMA 4INKA 1SGDE 2G55A 1XVOA 1YPJH 2G5VA 4CR5A 1IOEA 2FOAA 1FV9A 1S5SA 1QB1A 3GY3A 2CHAB 1HNEE 1SQAA 1BJVA 4IN2A 3UTUH 1AIXH 1FN6A 3RC6A 1ZTJA 2ANKH 4KP0A 3P8OA 1P2QA 3L3TA 5F6MA 3O8CA 5EODA 1EZSC 4M7GA 3M5NA 3RXOA 5C3NA 4CBNA 1KLJH 1LVBA 1C1QA 3QO6A 2QXJA 4Y10E 1O3EA 1VITF 1EJAA 4X8SH 2Q6GA 5CE1A 3PTBA 3ZV9A 1ABIH 6LPRA 1C2GA 1ZSJA 1GL0E 1HJAB 1BTHH 3RDZA 2W3KA 5EGMA 1LHFH 8ESTE 1ELAA 1DY8A 4K8YA 2ZGHA 2EC9H 1TOCB 1YLCA 3HGPA 6CHAC 4A1TA 1PFXC 1TGNA 4UFDH 1C5SA 2A7HA 2W3IA 2XBYA 2FS8A 1HXEH 2O8TA 3ZZBA 3LH1A 1HJ9A 2VIWA 4B74A 1C4V2 1CSOE 4GVUA 3STJA 3S69A 1V2PT 1ZMLA 1MD8A 2P93A 4MPUA 6GCHF 1GMCG 1HAGE 2GD4B 1JXPA 2AFQB 1ZJDA 4H6TA 3V13A 1FDPA 1C5YB 2PSXA 3M7QA 1ZTKA 4BAMB 1TWXB 1GJ8B 4AFSA 5DP4A 2H9EH 3QWCH 1F5LA 2OXSA 1QCPA 4HI3A 1ZSKA 1PQAA 1Y3XA 2A31A 1GHZA 1UVSH 1BRAA 1V2LT 4FU9A 5GCHF 3BTKE 1EZXC 1ZMJA 2Z9KA 4KTCA 2AS9A 1K1LA 1NU7B 1F7ZA 3TH4H 3U69H 1UTLM 1V2UT 2XBVA 4K69A 4XBBA 1NO9H 1FLEE 1GHWH 1SI5H 1LHEH 1SR5C 3RXIA 1GI9B 1OWKA 4X2WA 1SGQE 1BITA 5DP3A 1KTSB 4DVAU 6CHAB 3SQHE 2ASUB 2GZ7A 3ZZ9A 1AUJA 4WMDA 3MO9A 4F49A 2BTCE 4JK5A 1QRZA 4X6NA
chains in the Genus database with same CATH superfamily
3Q3KA 4MPXA 4KKDA 3FZZA 1ELVA 1MUEB 1V2NT 4K1SA 3SU0A 2P8OC 2BVRH 3S9AA 4AYVB 2AHME 1Q2WA 1H9HE 1B0EA 2F43B 1MCTA 2D2DA 3VFEA 1OWDA 4NIWA 1GVKB 2ZQ2A 1PQ8A 4K8BA 1O31A 2ZGJA 1A2CH 5EG4A 1GBMA 1UTMA 1J17T 2O9QA 2AH4X 1O3BA 4RN6A 3KCGH 1C5RA 1O33A 4TPIZ 1BMMH 3BTWE 2JETC 2FZZA 2W5EA 1GBLA 3E6PH 4H4FA 1YCPK 1GJ5H 1V2OT 1UK4A 3K2UA 1ANDA 3ZZCA 2GCHF 3MQKC 4X8VH 1W0ZU 1SGYE 4BAOB 1P05A 2WV9A 1C5WB 3SI4H 2ZDVH 5C5NA 1HAVA 3EE7A 1WDIA 1VGCC 3T28A 5JBCS 1J16A 2KAIA 3RM0H 1A5HA 2ZU3A 4B1TA 4FUJA 3UWIA 3M35A 1QJ6B 5J4SA 5LGOA 2WV4A 1G3EA 2QAAA 4NA7A 3BG4C 1P0SH 2PTNA 4HZHA 4OGYA 3ZZDA 1BMNH 3SHCH 1O2ZA 2P8OB 1F5KU 1AWFH 4E06H 1EFRD 1FY5A 2QF0A 1AY6H 1TNKA 4I8HA 3MH5A 1AE5A 1TPSA 2ZDKA 1W0JD 4JCNA 2I6SA 2BDBA 2XYAA 4MLFB 3UNQA 1MAXA 2STBE 3A7XA 4ASUD 2EI6A 1YCPH 3MH7A 1YYY1 1UHBA 4BXSA 2HWLB 2A5IA 3OTPA 3A83A 2ZU4A 5FXLA 2BVXH 5DP5A 4XRNA 1LCYA 2LELA 1DSUA 2Q6DA 1MKXK 2GX4A 4WVPE 1SG8B 4BAHB 2ZA5A 1V3XA 1K1OA 1QB6A 1SKYE 3PB1E 4K60A 4LK4A 1QURH 3IG6B 1XVMA 1O5FH 3AASA 1UW7A 4X1NU 4XBCA 1HB0B 3M5OA 1NRSH 1DX5M 1MZDA 3FVFB 2C8XB 2V6NA 1VGCB 1YPMH 3GY5A 1CA8B 3K6ZA 1IQKA 3CP7A 2ESTE 5LPRA 1JMOH 4CRCA 1NM6A 2P95A 4MG3A 3GYMA 4NFEA 1ZRKA 1TMBH 2C8WB 1TBRH 1PPCE 3PRDA 1ANBA 4WY3A 2WUBA 2PKSC 2TGDA 5E2PA 4O97A 5AHGH 5GJ4B 1HAOH 3T27A 2F9UA 3P8GA 1C1VH 2F9VA 1O5CB 3A89A 4ZH8A 2QYIA 4MNXA 3LGTA 3DFLA 1MKXH 3SU6A 3PLKA 4K3JA 1C5ZB 3BIUH 1WU1A 1GI7B 1GMHF 2G5NA 1BTZA 4OS7A 4X1QU 2A32A 3FKSD 1HAYB 2H2ZA 1Y8TA 1PPFE 2F9OA 2GCTC 1TONA 1DUEA 2VWNA 4MTBA 4ZXXH 2WZQA 3SU1A 2QXIA 4YT7H 2HPPH 3BTGE 1THRH 1QL9A 1O3KA 1C2DA 1YWUA 1FIWA 2OC8A 1FUJA 3NUMA 2ULLA 1SQTA 1L1JA 5A8YA 4Q63A 1GBFA 2G52A 3RXTA 1QRWA 2WPLS 3SNAA 1GCDA 3ITIA 4UFFH 2TGPZ 3RXSA 3ZZ3A 1AD8H 3HATH 1OYTH 1O2SA 5PTPA 5DGJA 1Y3UA 5TCCA 2PHBA 3KL6A 4B73A 3Q77A 2FLBH 2EEKA 2PKSB 2WYGA 2XRCA 5EPNA 4YLUA 1AKSB 5EW1H 1BBRE 5GWZA 1Y59T 2FOHA 1TX6A 3OY5U 1P04A 1UJ1A 1PPBH 2A45B 2IJD1 4FVBA 3N7EA 3NKKA 1DXPA 1SMFE 2TGTA 3SN8A 1GHVH 2GT7A 3RXMA 2A4QA 2FX6A 1OPHB 2G8TA 1L2EA 1XUJA 5GXPA 3E3TA 2ZGBH 2J9NA 1ELGA 4TYDA 4XD7D 1QY6A 3Q76A 1TMUH 4IC6A 1LTOA 2W6ID 2Z9LA 3SYJA 3GDUA 1RD3B 4Z1MD 3RMLH 3TIUA 4A7IB 2Y81A 4NA8A 1A5IA 1LQDB 2PTCE 3E0PB 5GDSH 1VITH 2ZTYA 1AI8H 1MTUA 1QL8A 4MPVA 1JBUH 3UOUA 3WWFA 3VXFH 2GDDA 4JZFH 3F1SB 2Y7ZA 2W6JD 2BZAA 5FL7D 1BTWA 3SGBE 2G81E 3DSPA 4AX9H 2JKHA 5DSFA 1C1TA 3MFJA 2SFAA 1FY3A 1KXFA 2XOKD 1T8OA 2A7CA 3MO6A 2PV9B 3F9EA 2ZCLP 3KN2A 1UTPA 1P09A 1WTHD 4NIXA 1EP6A 2BD8A 3ZVDA 5IDKA 3B23B 3PV5A 4NSYA 2M5TA 2B5TB 4GAWA 3GCTG 3ZYEA 2YMSD 1SFIA 3LU9B 1E38B 1NFUA 1QRXA 1KLIH 4F48B 4UFGH 1B0FA 1P03A 5GIBA 5DP8A 1UK2A 3OSYA 3M5MA 3OEHD 2O8WA 1XXDA 1EJMA 4BXWA 3ELAH 1P06A 1Z7KA 2B7DH 2A4RA 1ESTA 4LZ1H 4RI0A 4O9VA 2KAIB 4KGAA 3A7VA 1FI8A 4HTCH 2FESH 1E1QD 1AFQC 1EPTA 1K21H 5T1VA 1GI4A 1H8DH 1O2LA 1TNJA 1TLDA 3ATKA 4ASHA 1YGCH 5T6GA 3M3VA 1GI2A 1D6RA 2FYRA 2J94A 1WYKA 3H5CB 3W94A 1THSH 1K1IA 4A92A 1LKAA 2H5DA 1HPGA 2BLOA 2VBCA 1SOTA 7KMEH 1QA0A 2UUJB 3MU1A 2JJ1D 2O8UA 5IYTA 1DWEH 2VJ1A 1QFKH 2ANMH 2BD2A 3QUMP 4NIYA 3SU4A 5E8EH 3H09A 2A2XH 1Y3WA 2PKAB 1C2EA 3EA8A 1P9UA 1FY4A 1D4PB 1HIAA 4FUCA 3RLWH 3BTQE 1GCTC 4X0WU 3T2NA 1AVGH 1C2JA 4AC9A 4ACBA 4ZMAH 1CU1A 1A3EH 2STAE 2HPQH 3GCHC 1TPOA 1EJNA 5A09A 3OAAD 3E8LA 2BX3A 4FUHA 4ZKRU 3H7OA 2ZHWH 4WXIA 5T6FA 2TGAA 3UQOA 2CMYA 2SGPE 2W7SA 1PPZA 1W13U 4E05H 1OWEA 2Z9JA 4B6FA 3BG8A 1GI3A 1BUIA 3SORA 2B8OH 1C5PA 3F9FA 2VWMA 3RU4D 2BDHA 5FBEA 3ZVFA 1O3HA 4Y7AA 4DOQA 4Q80A 4WF8A 2WPDD 1WSSH 2KR7A 4XDEA 1FY8E 2BM2A 1O5EH 4WWYA 3AAVA 2FEQH 1TNHA 3BV9B 2SGEE 2ZTZA 3DA9B 2KCOA 1W2KH 1G3DA 2JDID 5C2ZA 1MBQA 1BRCE 4OS2A 1IAUA 3SUGA 2AYWA 4B6EA 3BEIB 4CRDA 4TSFD 3AAUA 1C2HA 1DICA 3RXKA 3HGNA 5L2YH 2PR3A 1C2LA 1S0RA 5FX6A 1IQFA 3BTFE 4RKOB 3RMOH 3PYHA 4I8LA 3M5LA 1HJAC 4FUFA 1KDQA 3ZVBA 4J1YA 3R0FA 2Q6FA 5JB9S 3MMGA 1C1WH 3SV7A 1SGNE 1C1SA 3GCHB 1TGTA 1TNLA 1S85A 5C0UA 2ZHEH 1YCPM 2VWLA 5KGOA 2OBOA 3KQDA 1GMCF 3C27B 1WCZA 3F2HA 2CF9H 1FNIA 2ZPRA 1AE8H 3RXQA 1YKTA 1DDJA 1ZSLA 1EAWA 2IOTA 1SGCA 1UMAH 2J2UA 2ODPA 2VNTA 3QGNB 1K22H 3EA7A 1QBOA 3SZEA 3Q3XA 1O3OA 5LPFA 3T26A 2FOBA 1P2IA 1KXCA 5C5OA 1ELFA 1IHTH 1UK3A 2Z94A 1QJ7B 2WSSD 5C1UA 3S0NA 4GCHG 1V2RT 4MNWA 2J98A 3RMMH 3D49H 1JIRA 2R3YA 4FUEA 1DOJA 1SLWB 2L74A 3EE0B 4Y7BA 5DP7A 4JZIA 2OINA 3UFAA 2OP9A 2YOLA 3SHAH 1L4ZA 3PMHB 5HIYA 2KCAA 4HG6A 2BY6X 2CV3A 4TY7A 1ZOMA 1YC0A 3KYGA 4Q2KA 4X6PA 2YNBA 2FI3E 1TGCA 2P3UB 4Q7ZA 5L2ZH 1JRSA 3SJKA 1G32B 1O38A 1MQ5A 3SV6A 2BDYA 1Y5UT 1A46H 1BTUA 5B6LA 1L4DA 2QC2A 1V2ST 1BMLA 2FPZA 1LHCH 1TGSZ 2Y80A 5A0BA 1GI8B 2KZ4A 5ETXA 4FOUC 3T62A 3A81A 4ZCNA 1GDNA 1W0YH 1TE0A 3VB7A 3KHVA 4NG9H 3SZNA 2UUYA 3GCOA 4YO9A 2PLXA 3F0PA 2UWOA 4GSOA 5FPYA 3IWMA 1DLEA 2BMGB 4E7RG 1NBME 3UREA 2AGEX 3UY9A 1NTPA 2WYJA 5EU8A 3LPRA 3SJIA 1UVTH 1AMHA 1BHXB 1C4U2 2GMTB 2QF3A 1BBRK 3MYWA 1P2OA 3K9XB 1IQNA 3ZIAD 1MU8B 3A86A 1J14A 4ABDA 4I8JA 1YM0A 1K1JA 1MTVA 1TX7A 3RC4A 4BTIB 1RJXB 5A2MH 4R0IA 2XTTB 2FM2A 1F2SE 1HYLA 3CNRA 1T7CA 5E0GA 4ZROA 4D8NA 2A5AA 3LGYA 1MBMA 3BTDE 4Y0YE 9ESTA 3BTTE 2FXRA 4ISLA 5EQRA 1YPHC 3GCNA 4Y8YA 1BMFD 2BD3A 3RUOA 1D9IA 1O0DH 2QV1A 1TBQH 3MOCA 3PWBA 3TJNA 1BZXE 3NK8A 4JMYA 1GBIA 5C1YA 2F3CE 1PYTD 3MNXA 4ABGA 2L6OA 1OOKB 2V35A 1O3NA 3RC5A 5FBIA 1O32A 1OXGA 5AVDA 1P11E 2VVCA 4IMQA 1VZQH 1B7XB 5A0CA 3LGWA 4ZKSU 1XMNB 4ZHLU 1FONA 4ACAA 2CJIA 3QZQA 1BBRH 4QT8C 1XX9A 5C67A 3S7HB 1GL1A 1WBGB 1DWBH 2I6QA 1HJ8A 4Y76A 1OP0A 4YOJA 4TWWA 3M37A 1ID5H 3MHWU 4CRFA 3NPSA 1W11U 1CGIE 1EQ9A 3PM3A 1Q31A 3SNDA 1CHOG 3SUDA 4A6LA 1NS3A 1UTKA 1GGDB 1C9PA 2OQ5A 3UPEA 2UUKB 2CGAA 2PFEA 4SGBE 1MAYA 4DY7B 3QLPH 3TPIZ 1BTYA 1DANH 1TGBA 2XC5A 3ZYDA 3GOVB 1O2KA 1C5UA 4O3UA 4GLYA 1C5TA 1MABB 1MTNC 5F8ZA 2LP6A 4X1PU 1DY9A 2HNTC 5K0HA 4JZDH 3F9GA 1ESAA 1ABJH 2F9BH 1GVLA 2PGQB 1TPAE 5ESTE 1UVUH 4D7GA 1HAHH 4K5ZA 1CT0E 1JRTA 1SSXA 5AF9H 2ODYB 3GY2A 4Q7YA 4U30A 1OYQA 4MNYA 2FP7B 2NU1E 1FZZA 1THPB 2FLRH 1FJSA 2FOGA 1OX1A 3C1KA 4X6OA 3BTME 3FP7E 1H4WA 1HRTH 1H9IE 2ZEBA 1QR3E 1AN1E 3R3GB 4DG4A 3QN7A 1C9TA 2OC7A 1E37B 1YPKH 2ZECA 3FN8A 5FHTA 1L1GA 3RXHA 5C17A 1AVWA 4GPGA 1VCWA 2GJGA 1FMGA 2ODQA 3F9HA 2P3TB 4F4OC 3KQBA 3FAOA 3S7KB 3A8CA 2HLCA 2GVFA 1EP5A 2XNDD 4DCDA 1QGFA 3QGJA 2C93B 1MH0A 2KCPA 2BHGA 2ZHDA 5GNDA 3RXVA 3N7OA 1MTNB 2FOCA 3FZDA 3S9BA 2FX4A 4KELA 5E0HA 3F6UH 3QZRA 2QGRA 3O8DA 1DPOA 1EXFA 4X8TH 4F55A 2B9LA 1C1NA 5JBTA 2FTLE 4GUXA 2P16A 3TNTA 4DGJA 3U9AH 1C2MA 3A88A 1OS8A 2IPHA 1G3BA 2Z9GA 1G2LA 4ABIA 2ZFQH 1UTOA 1D3QB 1EAXA 2A4OA 3RM2H 1H8ED 1N8OC 2QXGA 4KTUA 1AVXA 3EQ0H 2BQWB 1UCYE 1TQ0B 2BD7A 1A4WH 1RGQA 1ZPCA 2H9TH 3B9FH 4ABAA 2BDIA 4UEHH 4B2CA 3HKJB 4ZAEA 3RU4T 2YMSB 2ZTXA 5E2OA 3SNBA 4WH8A 4YTAA 1IHSH 2ALPA 2XNIA 4JZ1A 1DFPA 3LKWA 3KQCA 3P8FA 1GBKA 3PRBA 4THNH 4MDSA 1YBWA 1NFWA 5EXNA 3LGIA 3A87A 1RTKA 1RFNA 3UAIC 2W26A 4E7NA 1V2WT 1S6LA 2BX4A 3N99A 2AGIX 5JBAS 4INLA 1TFXA 2BXUH 5KEDA 4ABJA 1XUHA 2RA3A 3ATLA 4I86A 2W7UA 2CN0H 2ZGCA 4IW4E 4FUIA 2ANWA 2EQNA 2SGDE 3QK1A 2Y7XA 1YF4A 2BY9X 2K1QA 2D8WA 3P8NA 1OKXA 2THFB 3TJUA 1QL7A 4INHA 4X6MA 5G4BA 2QF4A 2WUCA 4KTSA 5DO4H 2WPMS 2P94A 2LNCA 1YLDA 1TB6H 4H6SB 1N8OB 3FP8E 5DK1A 5BPEA 1EZQA 2ZI2H 1ORFA 1HFDA 2XCFA 1GJ7B 2J38A 3LOXA 1TRMA 2V7QD 4B2AA 1NPMA 3A85A 1QZ8A 2H1UA 2F4LA 4ZHAA 2VU8E 1Z8JB 2JH0D 3DSOA 3GCTF 2OC1A 1VCQA 2IN2A 1C5QA 1SQOA 4AGJA 3BTHE 2BQ6B 5A0AE 2BDGA 3T25A 1QBNA 1FXYA 1DS2E 1OHHD 5KECA 2RCEA 2ZCHP 1K0HA 4JYTA 4YESB 1T8MA 3AK5A 4BTUB 1KY9A 2OK5A 1PPHE 4NGAH 6ESTA 4DIIH 4JZEH 4NZLA 3PO1C 3UNSA 2ZCKP 3ODFA 3UR9A 2GTBA 4IBLH 1NRPH 1SGIB 2CF8H 4B76A 1T32A 1Q3XA 3M61U 3KQEA 1SGFG 3TU7H 3SV8A 4X8UH 1L0ZA 1A61H 3U8OH 3TH2H 4NIVA 1X7AC 3HK3B 4CH2B 1WQSA 1JWTA 3F2GA 4O3TA 4ESTE 2CK3D 1C5OH 1SC8U 2BOHB 4Q4LA 4Y8XA 2HOBA 1AU8A 5DJ7A 3TH3H 5CHAC 3SNCA 2QCYA 3BEUA 4AN7A 2BLWA 2BY5X 3VGCB 4NFFA 1M9UA 2GV7A 9LPRA 4DJZB 3GICB 1EX3A 3BIVH 3MNBA 4CH8B 1KMHB 2OCVB 2V3MA 1XUIA 3RMNH 1VCPA 1J8AA 1HAXB 3RXUA 1O3DA 1BA8B 3MU0A 1O2TA 4WMEA 1O3GA 1CHGA 1KXDA 2V0BA 1EASA 4AFQA 2C8YB 4CR9A 1H8IH 2ZP0H 3VB6A 3PO1B 3VB3A 2ZGXH 3UQVA 3EYDA 1CGJE 1TNGA 1HAVB 3ZZ5A 1WUNH 3BF6H 2VWOA 3RXBA 1JIMA 1C1PA 1ZLRA 4DT7B 1S84A 3V3MA 1NT1A 3FANA 1YLNA 5HGGA 2TIOA 1ZHMA 1NY22 2ANYA 3ENSB 1EOLA 2RDLA 4RSPA 1P02A 5TJXA 5FPTA 2QF5A 2DUCA 2GT8A 5F03A 2VIQA 1CVWH 1MMJN 2BD9A 1ELEE 4MPWA 1BRBE 1P12E 2ZFPH 4J2YB 2A4GA 3A7YA 2JH5D 1OP2A 3KGPA 5CHAB 4X2VA 4YXWD 1SPJA 4XFQA 8KME2 3M7UA 1EOJA 3U98H 3GY6A 2PP6A 5FAHA 1HAIH 3UR6A 3A84A 4AYYB 3B8JA 3LGUA 1V2TT 1A3BH 4CBOA 1UHBB 5CMXH 1NFXA 2Y5GA 3DSGA 3ZZ7A 1O3CA 3TJOA 1HXFH 1CA0C 2B0FA 3STIA 1RIWC 1C2IA 4ISHH 1LHDH 1L1NA 3TITA 4FU8A 2ZF0H 3NWUA 3WY8A 3AVZA 1GBDA 2O8MA 5JB8S 1O3MA 1SLVB 1QJ1B 4TY6A 4Y0ZE 1LKBA 5L30H 3A80A 2BD4A 7GCHG 2ZHFH 4ISOA 1GG6C 1GWAA 2VINA 4ABBA 1P2JA 2G4TA 1O2UA 4K1TA 1BRUP 1GVZA 3AW1A 3VB5A 1S6FA 1UO6A 4D7FA 3EA9A 1ETTH 3I78A 3TK9A 1C5MD 1S6HA 1V2QT 3AW0A 1GI1A 1DWCH 3RXLA 2HVYB 2GKVE 2P3FH 3FP6E 2H6MA 3EDXB 4GCHF 3TNSA 3MU4A 7ESTE 2Q1JA 2WPKS 2LPRA 3OEED 3LONA 4Y6DA 2ZDNA 2F83A 1BDAA 1D6WA 3UNRA 1SLXB 3HK6B 3ZV8A 2BD5A 4OM9A 2G4UA 1QQ4A 3P17H 1AB9C 2A1DB 4MVNA 5FPSA 4XBDA 4X2YA 3SGAE 1P3EA 5EPYA 2A5KA 1O3JA 4UD9H 5BRRE 4DT4A 1Z6EA 1GHAG 1ACBE 2XW9A 2ZIQH 3OU0A 2PWXA 1CA0B 1GBCA 1MTWA 1RIWB 3I77A 1GJAB 4LOYH 3MNSA 2Y82A 1RTLA 2R0LA 4MQAA 1TPPA 1F92A 3ATIA 1T31A 1O2OA 1LDTT 2RA0A 3MO3A 2DE9A 4CHAC 2UWLA 1D3TB 1O3IA 2J4IA 1W8BH 4TT3D 3WW7A 1ETRH 1GG6B 4AOQA 2BYAX 1NN6A 2FI4E 4O03A 3D23A 3SNEA 3V12A 5HM2A 1GI0A 3RU4E 1SL3A 1N1LA 4ABFA 1T8LA 5FX5A 3ZVGA 2IPQX 2O8LA 2Y5FA 3A7WA 1LMWB 3TLOA 3D65E 1UTQA 1F0TA 3DCLA 3VPKA 2WPJS 1A0JA 1IQGA 1G3CA 2UUFB 1E79D 1G37A 3ZZ6A 3PTNA 2FDAA 4JK6A 1FPCH 3GY4A 1ESBA 2ZPQA 1UCYK 3RXDA 1QB9A 1W0KD 3E91A 4ZXYH 2QA9E 2RFKC 1BB0B 2GMTC 1GBHA 4OS6A 1MQ6A 2VVUA 3OFND 3GYLB 2Z7FE 1A7SA 1AB9B 2P59A 1G2MA 3A8AA 3KEEA 4WMFA 2ZHQH 4LZ4B 4XE4A 1C4Y2 2BQ7B 3SJOA 2Z3CA 2XWAA 3PLPA 2J34A 1ZHPA 3TGIE 4OS5A 2A2QH 5T6DA 1BOQA 3LT3A 3VXEH 1O3AA 1W3CA 3I29A 1O39A 3DT0H 3JZ2B 1YY3A 2GZ9A 1W7GH 5FCRA 2VIVA 1WTGH 1GHYH 1QHRB 1O35A 1Z1JA 1SHHB 2ZFFH 4CHAB 1W10U 4I32A 2C3SA 3T5FH 5EXLA 5EIYA 1NRQH 3NZIA 3A8DA 1EPTC 1C5LH 1CO7E 2A7JA 3PV4A 3PMBB 2ZNKH 4X2XA 3LH3A 4R8TB 5TCAA 2GP9B 2YNAA 3SI3H 5JYIA 3L33A 1P57B 3DHKH 4HGCA 3ESTA 1PPEE 1UCYH 2Z6BD 2ZO3H 1GBTA 4RKJB 1N6XA 3Q3YA 2ZU1A 4WXVA 2BDAA 1PQ5A 1CHOF 2AMQA 4AZ2B 3ZZ4A 1A0LA 1C5VA 1LVOA 1O3LA 1GJDB 2Y5HA 1EAUA 1O34A 1GJ4H 1DITH 3PWCA 3LGVA 3U8TH 4DIHH 2J95A 1O2MA 1K9OE 1GGDC 4CRAA 4AFUA 3TGJE 1O2PA 1EZUC 5C1XA 3CENA 2J97A 1GHBG 1UVOA 1AKSA 1NZQH 1K28D 1P9SA 1PPGE 4CRGA 2F9PA 1ARCA 4BANB 3SQEE 3RP2A 2AMDA 1QQUA 2XCNA 4ISNA 1EUFA 2KM0A 5F8XA 1C1RA 2ZDMA 3P70B 4AGKA 2FS9A 1G9IE 1FX0B 3E16B 5C94A 1VJ9U 2WPHS 1RRKA 1P8VC 2AEIH 5EJLA 1EPTB 1HUTH 4TWYA 1DM4B 3ATMA 8LPRA 3PROA 2VGCC 3TK5A 1T4VH 1FPHH 1GPZA 1VITG 3PMAB 1LO6A 5C0TA 1MZAA 1O37A 1ZMNA 1MU6B 2OLGA 3L6PA 1NROH 2J5UA 2XC4A 3H7TA 1SFQB 1TOMH 1J15A 1GJ9B 4IC5A 3HPTB 5ABWA 1DE7H 2AMPA 2VH0A 3GDVA 1B5GH 1WXRA 2HRVA 1KXAA 4B71A 1Z8IB 2GV6A 1YP9A 3M36A 1RTFB 4X1RU 4B2BA 1SVPA 3NXPA 1GMDF 4WH6A 2OC0A 5JDUB 3CS7A 1FAKH 1TABE 3KIDU 3RXFA 3O8RA 1O2GH 2QXHA 3UUZA 2DE8A 1HIAB 2OD3B 1YPLH 2SGQE 4I7YH 1O3FA 1LHGH 6GCHG 2R0KA 1AUTC 1HBTH 1EB1H 2ZPSA 2SGAA 1FN8A 3KNXA 1IQHA 3F0OA 1ZTLA 3O8BA 1ARBA 1AWHB 4BNRA 1OWHA 1GJCB 7LPRA 3E1XB 1DUAA 1T8NA 2ZFTA 3MH4A 4YOIA 5JBBS 3TVJB 3E0NB 1DLKB 3MI4A 1A0HB 1Z8RA 4YZUA 1LQEA 2G00A 2Z3EA 1W12U 4M9FA 1GI5A 2TRMA 4JYUH 2HVXA 2V3OH 2ZC9H 1MTSA 5ESBA 2PW8H 4RT0A 4A1VA 2VGCB 1GDQA 5EJ1A 1O2XA 1NESE 3OY6U 3UWJH 2EA3A 5A8ZA 3SV9A 1O2WA 3FOAA 5GCHG 3PMJA 2ZZUH 4DW2U 1TALA 2WINI 1HCGA 3S9CA 2FIRH 5HIZA 2QIQA 1O2IA 1TA2A 1GI6A 1KYNA 3QTOH 1LPGB 2YMSC 1MKWK 3G01A 4Y79A 2KFWA 1W14U 1KIGH 1K2I1 2K8IA 2VH6A 5L6NH 2NU2E 5GPIB 4UONA 2GGVB 1XUGA 1NRRH 8GCHF 3M7TA 1GMDG 4CREA 1QTFA 1TYNA 1IQIA 3OTJE 1KDQB 1HAPH 3A82A 1VKYA 3F68H 3K65B 1LPKB 1C1OA 3SU2A 1K1PA 5A8XA 3BSQA 4MNVA 3ODDA 4DURA 2KCYA 1ELCA 2JIZD 2RG3A 2JETB 4I33A 5HMAA 2PKAA 4K1EA 1E36B 1ZR0A 1NU9A 3ZVCA 5HM9A 1DXWA 4AFZA 1H1BA 3VEQB 1CE5A 4A1XA 1QNJA 1QIXB 2D26C 2JH6D 1O3PB 2ZU5A 3ZZAA 1QBVH 2NU0E 1TAWA 2OTVA 1OSSA 3DUXH 5I25A 1CQQA 2GCHG 4X1SU 1F0SA 1GBAA 2XWBI 1LVMA 5AFZH 4ZKOU 1Z8GA 1BT7A 1MKWH 4Y8ZA 1O2VA 3ATWA 4H42U 1PJPA 4YOGA 4IMZA 1VR1H 1S83A 3ZVEA 4I8KA 2FOFA 1ELDE 2J98B 2D1JA 1WAYB 2ILNA 1ZZZA 1RS0A 3DFJA 3VG8A 3A7ZA 1IQEA 1P3CA 3BG4B 3MWIU 4OS1A 4LXBH 5E0JA 2BLQA 1F5RA 2WV5A 1T4UH 1INCA 1ELBA 5CDFE 4FXGH 2VIPA 3RXJA 1XUFA 1O5AB 2QE7D 1BTXA 1XKAC 1LPZB 2GDEH 1F0RA 4HFPB 1OWIA 1ZYOA 4I8GA 5SGAE 1ZGIA 2VIOA 5AFYH 4OGXA 1P10A 3U28C 3TJVA 5H4IB 5EOKA 8GCHG 1H8HD 1K1MA 2XBWA 4K2YA 3W95A 1WV7H 4FUGA 4NZQA 1XUKA 3SV2H 3SW2B 2FO9A 5DPAA 2ZQ1A 4B75A 2FWWA 1EAIA 3VGCC 1TRYA 3TK6A 4CRBA 1ZRBA 3HKIB 1S0QA 1GBJA 3RXRA 2ZDLA 5DP9A 4XSKU 4FVDA 1V2JT 1K1NA 2SGFE 3SGQE 3QTVH 3MTYA 3RXEA 2PUQH 2AGGX 1BHXF 2BY8X 1ZHRA 1P01A 3SJ9A 2AERH 3LC3A 2GZ8A 2BLVA 5JPMH 2H5CA 5EW2H 5F53A 1G36A 4ABEA 1HLTH 4PROA 3P95A 1E0FD 3BEFB 4NCYA 4FUDA 2FYQA 4NSVA 5DG6A 4RT1A 1AO5A 1NFYA 1FY1A 1IQMA 3U1JB 1OWJA 1YPEH 2PSYA 1XKBC 2QY0B 1O2JA 5EQQA 3RXPA 1ANCA 1TIOA 1TNIA 4A5TS 1Z1IA 3PLBA 4UE7H 1MCVA 1ZPBA 4UDWH 2OBQA 4SGAE 3D62A 1A5GH 1DWDH 1ANEA 2C90B 1EB2A 1SGFA 1XM1A 1S82A 2GCTB 3SOSA 1GBEA 1SOZA 2V3HH 3URDA 3GY7A 3SBKA 1PQ7A 1AZZA 1C2FA 3E90B 3K6YA 1GMHG 4U2WA 1TRNA 2BY7X 1C2KA 1ZGVA 4ISIH 4VGCC 3QX5H 1BCUH 2KX4A 3A7TA 1YPHE 5DN6D 1RXPA 1V6DA 5K7RA 3NRLA 2ZFSA 3A8BA 3LJOA 4BAQB 3BN9A 1A1RA 1Y5AT 4AORA 1EATA 4YT6H 3ZZ8A 3MU5A 5EQSA 2FOMB 1O30A 3IITA 3VB4A 1YPGH 1D3PB 4AB9A 2A0QB 2VIDA 3SUEA 2AIQA 2NU4E 3F2FA 2TBSA 2ZKSA 1C1UH 3P92A 1SBWA 2EI7A 5F8TA 1V2KT 7GCHF 4AG2A 1HAZB 3UIRA 4GHTA 1DSTA 1CBWC 2R2MB 1KTTB 4FUBA 4BTTB 1AZ8A 1O2HA 3GISB 2J92A 1C1MA 5HYOA 4WJG2 3T29A 5LH8A 1SB1H 1P2NA 1SGPE 4XOJA 2OUAA 4BAKB 4Z6AH 2QN5T 1E35B 2AIPA 3RXAA 4UFEH 3RXCA 2NU3E 2PGBB 2ALVA 2SNVA 2HGTH 1O2QA 1TX8A 4NA9H 4BOHA 1Z71A 3SU5A 2ZWLH 1OP8A 1HGTH 2UWPA 4YM9A 3PV2A 1CGHA 1J9CH 3DD2H 2WPIS 1NC6A 1Y5BT 3V7TA 1SLUB 4VGCB 2HNTE 1N6YA 2K0QA 4NWLA 1ETSH 1Y3YA 2BB4A 1AHTH 2Z9IA 1GHXH 1GHAF 1TQ7B 1FAXA 3KQ5A 5HKKD 1JOUB 1F0UA 2BXTH 3LJJA 3N7DA 4JYVH 5C20A 1HDTH 5LPEA 3U1IB 1AQ7A 5B6OA 1P2MA 2XBXA 1TBZH 3OYPA 1NRNH 1DT2A 1GJ6A 3OX7U 4IN1A 3P6ZB 4ZKNU 1CBWB 4I31A 1DVAH 1WQVH 3LC5A 2BVSH 1C5XB 1SGEE 1O2RA 4AB8A 2R2WU 1V2MT 1PYTC 1U6QA 2C4FH 2HNTF 3M3TA 4ZUHA 4ABHA 1ZPZA 3MNCA 1TMTH 3NCLA 2VVVA 1BIOA 1CT4E 2NWNA 3JZ1B 4TPYA 1V2VT 3LDXH 1HV7A 1GDUA 1ELTA 1O2YA 3Q00A 3SUFA 5FCKA 4FU7A 2FMJA 1G30B 3V0XA 4D76A 5DP6A 3WWBA 3URCA 4D9RA 2R3UA 1BTPA 1BJUA 2C8ZB 1P2KA 3TGKE 1KXBA 3ZVAA 5T3HA 2F91A 1Z6JH 1UTJA 1WOFA 1KXEA 1AFQB 5I46H 4GHQA 4Y11E 1SHYA 1C5NH 2ZDAH 3MU8A 2FODA 1BQYA 3SO3A 5J4QA 4IGDA 4U01A 3RXGA 4Z0KA 2PUXB 2Y6TA 2FI5E 1E1RD 1QA7A 2BOKA 2BZ6H 2CHAC 4Q7XA 2BDCA 5CHBA 1O5BB 1SGRE 1KLTA 1GBBA 1TA6A 3EAJA 2SNWA 3GY8A 2R9PA 1CT2E 2OQUA 2ZG0H 3UOPA 1ZJKA 5IK2D 2VB0A 1W7XH 3M3SA 5EJZA 4ZHMU 3SU3A 2G51A 2EI8A 1O5GH 3OE7D 3W1EA 1E34B 4U32A 1IQLA 1H9LB 2TPIZ 3EGKH 2ZFRH 1MD7A 1SGTA 4OS4A 1O2NA 1FQ3A 3SJ8A 2HALA 1BMAA 2H9HA 3KF2A 2IJOB 1GCTB 1O5DH 1AGJA 2XC0A 1KSNA 3RLYH 4NWKA 4Y71A 3QDZB 1LVYA 2XXLA 1AFEH 1VJAU 1S81A 3FFGA 1COWD 5DKMA 2FTMA 2WHXA 4P00A 5HXFA 1FIZA 3GS9A 3GDSA 1D3DB 4YLQH 2JJ2D 1O36A 1EKBB 2CXVA 4IS5A 2ZU2A 3CS0A 1UVPA 3U8RH 1UTNA 1GHBF 1XXFA 3BTEE 1GJBB 3MH6A 3LIWA 4D9QA 2FOEA 4AG1A 2Z3DA 1IQJA 2F9NA 1Y3VA 5EXMA 4INKA 1SGDE 2G55A 1XVOA 1YPJH 2G5VA 4CR5A 1IOEA 2FOAA 1FV9A 1S5SA 1QB1A 3GY3A 2CHAB 1HNEE 1SQAA 1BJVA 1NBMD 4IN2A 3UTUH 1AIXH 1FN6A 3RC6A 1ZTJA 2ANKH 4KP0A 3P8OA 1P2QA 3L3TA 5F6MA 3O8CA 5EODA 1EZSC 4M7GA 3M5NA 3RXOA 5C3NA 4CBNA 1KLJH 3UB0A 1LVBA 1C1QA 3QO6A 2QXJA 4Y10E 1O3EA 1VITF 1EJAA 4X8SH 2Q6GA 5CE1A 3PTBA 2M2AA 3ZV9A 1ABIH 6LPRA 1C2GA 1ZSJA 1GL0E 1HJAB 1BTHH 3RDZA 2W3KA 5EGMA 1LHFH 8ESTE 1ELAA 1DY8A 4K8YA 2ZGHA 2EC9H 1TOCB 1YLCA 3HGPA 6CHAC 4A1TA 1PFXC 1TGNA 4UFDH 1C5SA 2A7HA 2W3IA 2XBYA 2FS8A 1HXEH 2O8TA 3ZZBA 4FETA 3LH1A 1HJ9A 2VIWA 4B74A 1C4V2 1CSOE 4GVUA 3STJA 3S69A 1V2PT 1ZMLA 1MD8A 2P93A 4MPUA 6GCHF 1GMCG 1HAGE 3KYFA 2GD4B 1JXPA 2AFQB 1ZJDA 4H6TA 3V13A 1FDPA 1C5YB 2PSXA 3M7QA 1ZTKA 4BAMB 1TWXB 1GJ8B 4AFSA 5DP4A 2H9EH 4P02A 3QWCH 1F5LA 2OXSA 1QCPA 4HI3A 1ZSKA 1PQAA 1Y3XA 2RDEA 3FO8D 1SQRA 2A31A 2EY4C 1GHZA 1UVSH 1BRAA 1V2LT 4FU9A 3F3BA 3BTKE 5GCHF 1EZXC 1ZMJA 2Z9KA 4KTCA 2AS9A 1K1LA 1NU7B 1F7ZA 3TH4H 3U69H 1UTLM 1V2UT 2XBVA 4K69A 4XBBA 1NO9H 1FLEE 1GHWH 1SI5H 1LHEH 1SR5C 3RXIA 1GI9B 1OWKA 2HLDD 1SGQE 4X2WA 1BITA 5DP3A 1KTSB 4DVAU 6CHAB 3SQHE 2ASUB 2GZ7A 3ZZ9A 1AUJA 4WMDA 3MO9A 4F49A 2BTCE 4JK5A 1QRZA 4X6NA
chains in the Genus database with same CATH topology
3Q3KA 4MPXA 4KKDA 3FZZA 1ELVA 1MUEB 1V2NT 4K1SA 3SU0A 2P8OC 2BVRH 3S9AA 4AYVB 1Q2WA 1H9HE 1B0EA 1MCTA 2D2DA 3VFEA 1OWDA 4NIWA 1GVKB 2ZQ2A 1PQ8A 4K8BA 1O31A 2ZGJA 1A2CH 5EG4A 1GBMA 1UTMA 1J17T 2O9QA 2AH4X 1O3BA 4RN6A 3KCGH 1C5RA 1O33A 4TPIZ 1BMMH 3BTWE 2JETC 2FZZA 2W5EA 1GBLA 3E6PH 4H4FA 1YCPK 1GJ5H 1V2OT 1UK4A 3K2UA 1ANDA 3ZZCA 2GCHF 4X8VH 1W0ZU 1SGYE 4BAOB 1P05A 1C5WB 3SI4H 2ZDVH 5C5NA 1HAVA 1VGCC 3T28A 5JBCS 1J16A 2KAIA 3RM0H 1A5HA 2ZU3A 4B1TA 4FUJA 3UWIA 3M35A 1QJ6B 5J4SA 5LGOA 2WV4A 1G3EA 2QAAA 4NA7A 3BG4C 1P0SH 2PTNA 4HZHA 4OGYA 3ZZDA 1BMNH 3SHCH 1O2ZA 2P8OB 1F5KU 1AWFH 4E06H 1FY5A 2QF0A 1AY6H 1TNKA 4I8HA 3MH5A 1AE5A 1TPSA 2ZDKA 4JCNA 2I6SA 2BDBA 2XYAA 4MLFB 3UNQA 1MAXA 2STBE 3A7XA 2EI6A 1YCPH 3MH7A 1YYY1 1UHBA 4BXSA 2HWLB 2A5IA 3A83A 2ZU4A 5FXLA 2BVXH 5DP5A 1LCYA 1DSUA 2Q6DA 1MKXK 2GX4A 4WVPE 1SG8B 4BAHB 2ZA5A 1V3XA 1K1OA 1QB6A 3PB1E 4K60A 4LK4A 1QURH 3IG6B 1XVMA 1O5FH 3AASA 4X1NU 4XBCA 1HB0B 3M5OA 1NRSH 1DX5M 1MZDA 3FVFB 2C8XB 2V6NA 1VGCB 1YPMH 3GY5A 1CA8B 3K6ZA 1IQKA 3CP7A 2ESTE 5LPRA 1JMOH 4CRCA 1NM6A 2P95A 4MG3A 3GYMA 4NFEA 1ZRKA 1TMBH 2C8WB 1TBRH 1PPCE 1ANBA 4WY3A 2WUBA 2PKSC 2TGDA 5E2PA 4O97A 5AHGH 5GJ4B 1HAOH 3T27A 2F9UA 3P8GA 1C1VH 2F9VA 1O5CB 3A89A 4ZH8A 2QYIA 4MNXA 3LGTA 3DFLA 1MKXH 3SU6A 3PLKA 4K3JA 1C5ZB 3BIUH 1WU1A 1GI7B 1GMHF 2G5NA 1BTZA 4OS7A 4X1QU 2A32A 1HAYB 2H2ZA 1Y8TA 1PPFE 2F9OA 2GCTC 1TONA 1DUEA 2VWNA 4MTBA 4ZXXH 3SU1A 2QXIA 4YT7H 2HPPH 3BTGE 1THRH 1QL9A 1O3KA 1C2DA 1FIWA 2OC8A 1FUJA 3NUMA 2ULLA 1SQTA 1L1JA 5A8YA 1GBFA 2G52A 3RXTA 1QRWA 2WPLS 3SNAA 1GCDA 3ITIA 4UFFH 2TGPZ 3RXSA 3ZZ3A 1AD8H 3HATH 1OYTH 1O2SA 5PTPA 5DGJA 1Y3UA 5TCCA 2PHBA 3KL6A 4B73A 3Q77A 2FLBH 2EEKA 2PKSB 2WYGA 2XRCA 5EPNA 4YLUA 1AKSB 5EW1H 1BBRE 5GWZA 1Y59T 2FOHA 1TX6A 3OY5U 1P04A 1UJ1A 1PPBH 2A45B 4FVBA 3NKKA 1DXPA 1SMFE 2TGTA 3SN8A 1GHVH 2GT7A 3RXMA 2A4QA 2FX6A 1OPHB 2G8TA 1L2EA 1XUJA 5GXPA 3E3TA 2ZGBH 2J9NA 1ELGA 4TYDA 1QY6A 3Q76A 1TMUH 4IC6A 1LTOA 2Z9LA 3GDUA 1RD3B 3RMLH 3TIUA 4A7IB 2Y81A 4NA8A 1A5IA 1LQDB 2PTCE 3E0PB 5GDSH 1VITH 2ZTYA 1AI8H 1MTUA 1QL8A 4MPVA 1JBUH 3UOUA 3VXFH 2GDDA 4JZFH 3F1SB 2Y7ZA 2BZAA 1BTWA 3SGBE 2G81E 4AX9H 2JKHA 1C1TA 3MFJA 2SFAA 1FY3A 1KXFA 1T8OA 2A7CA 3MO6A 2PV9B 3F9EA 2ZCLP 3KN2A 1UTPA 1P09A 1WTHD 4NIXA 1EP6A 2BD8A 3ZVDA 5IDKA 3B23B 4NSYA 2M5TA 2B5TB 4GAWA 3GCTG 3ZYEA 1SFIA 3LU9B 1E38B 1NFUA 1QRXA 1KLIH 4UFGH 1B0FA 1P03A 5GIBA 5DP8A 1UK2A 3OSYA 3M5MA 2O8WA 1XXDA 1EJMA 4BXWA 3ELAH 1P06A 1Z7KA 2B7DH 2A4RA 1ESTA 4LZ1H 4O9VA 2KAIB 4KGAA 3A7VA 1FI8A 4HTCH 2FESH 1AFQC 1EPTA 1K21H 1GI4A 1H8DH 1O2LA 1TNJA 1TLDA 3ATKA 4ASHA 1YGCH 5T6GA 3M3VA 1GI2A 1D6RA 2FYRA 2J94A 1WYKA 3H5CB 3W94A 1THSH 1K1IA 4A92A 1LKAA 2H5DA 1HPGA 2BLOA 1SOTA 7KMEH 1QA0A 2UUJB 3MU1A 2O8UA 5IYTA 1DWEH 2VJ1A 1QFKH 2ANMH 2BD2A 3QUMP 4NIYA 3SU4A 5E8EH 2A2XH 1Y3WA 2PKAB 1C2EA 3EA8A 1P9UA 1FY4A 1D4PB 1HIAA 4FUCA 3RLWH 3BTQE 1GCTC 4X0WU 3T2NA 1AVGH 1C2JA 4ZMAH 1CU1A 1A3EH 2STAE 2HPQH 3GCHC 1TPOA 1EJNA 5A09A 3E8LA 2BX3A 4FUHA 4ZKRU 3H7OA 2ZHWH 4WXIA 5T6FA 2TGAA 3UQOA 2CMYA 2SGPE 2W7SA 1PPZA 1W13U 4E05H 1OWEA 2Z9JA 3BG8A 1GI3A 1BUIA 3SORA 2B8OH 1C5PA 3F9FA 2VWMA 3RU4D 2BDHA 5FBEA 3ZVFA 1O3HA 4Y7AA 4DOQA 4Q80A 4WF8A 1WSSH 4XDEA 1FY8E 2BM2A 1O5EH 4WWYA 3AAVA 2FEQH 1TNHA 3BV9B 2SGEE 2ZTZA 3DA9B 1W2KH 1G3DA 5C2ZA 1MBQA 1BRCE 4OS2A 1IAUA 3SUGA 2AYWA 3BEIB 4CRDA 3AAUA 1C2HA 1DICA 3RXKA 3HGNA 5L2YH 2PR3A 1C2LA 1S0RA 5FX6A 1IQFA 3BTFE 4RKOB 3RMOH 3PYHA 4I8LA 3M5LA 1HJAC 4FUFA 1KDQA 3ZVBA 4J1YA 3R0FA 2Q6FA 5JB9S 3MMGA 1C1WH 3SV7A 1SGNE 1C1SA 3GCHB 1TGTA 1TNLA 1S85A 2ZHEH 1YCPM 2VWLA 2OBOA 3KQDA 1GMCF 3C27B 1WCZA 2CF9H 1FNIA 2ZPRA 1AE8H 3RXQA 1YKTA 1DDJA 1ZSLA 1EAWA 2IOTA 1SGCA 1UMAH 2J2UA 2ODPA 2VNTA 3QGNB 1K22H 3EA7A 1QBOA 3Q3XA 1O3OA 5LPFA 3T26A 2FOBA 1P2IA 1KXCA 5C5OA 1ELFA 1IHTH 1UK3A 2Z94A 1QJ7B 5C1UA 3S0NA 4GCHG 1V2RT 4MNWA 3RMMH 3D49H 1JIRA 2R3YA 4FUEA 1DOJA 1SLWB 3EE0B 4Y7BA 5DP7A 4JZIA 2OINA 3UFAA 2OP9A 2YOLA 3SHAH 1L4ZA 3PMHB 2BY6X 2CV3A 4TY7A 1ZOMA 1YC0A 4Q2KA 4X6PA 2YNBA 2FI3E 1TGCA 2P3UB 4Q7ZA 5L2ZH 1JRSA 3SJKA 1G32B 1O38A 1MQ5A 3SV6A 2BDYA 1Y5UT 1A46H 1BTUA 1L4DA 2QC2A 1V2ST 1BMLA 2FPZA 1LHCH 1TGSZ 2Y80A 5A0BA 1GI8B 5ETXA 3T62A 3A81A 1GDNA 1W0YH 1TE0A 3VB7A 3KHVA 4NG9H 3SZNA 2UUYA 3GCOA 4YO9A 2PLXA 2UWOA 4GSOA 5FPYA 3IWMA 1DLEA 2BMGB 4E7RG 3UREA 2AGEX 3UY9A 1NTPA 2WYJA 5EU8A 3LPRA 3SJIA 1UVTH 1AMHA 1BHXB 1C4U2 2GMTB 2QF3A 1BBRK 3MYWA 1P2OA 3K9XB 1IQNA 1MU8B 3A86A 1J14A 4ABDA 4I8JA 1YM0A 1K1JA 1MTVA 1TX7A 3RC4A 4BTIB 1RJXB 5A2MH 4R0IA 2XTTB 2FM2A 1F2SE 1HYLA 1T7CA 5E0GA 4ZROA 4D8NA 2A5AA 3LGYA 1MBMA 3BTDE 4Y0YE 9ESTA 3BTTE 2FXRA 4ISLA 5EQRA 1YPHC 3GCNA 4Y8YA 2BD3A 3RUOA 1D9IA 1O0DH 2QV1A 1TBQH 3MOCA 3PWBA 3TJNA 1BZXE 3NK8A 4JMYA 1GBIA 5C1YA 2F3CE 1PYTD 3MNXA 4ABGA 1OOKB 2V35A 1O3NA 3RC5A 5FBIA 1O32A 1OXGA 5AVDA 1P11E 2VVCA 4IMQA 1VZQH 1B7XB 5A0CA 3LGWA 4ZKSU 1XMNB 4ZHLU 1FONA 2CJIA 3QZQA 1BBRH 4QT8C 1XX9A 5C67A 3S7HB 1GL1A 1WBGB 1DWBH 2I6QA 1HJ8A 4Y76A 1OP0A 4YOJA 4TWWA 3M37A 1ID5H 3MHWU 4CRFA 3NPSA 1W11U 1CGIE 1EQ9A 3PM3A 1Q31A 3SNDA 1CHOG 3SUDA 4A6LA 1NS3A 1UTKA 1GGDB 1C9PA 2OQ5A 3UPEA 2UUKB 2CGAA 2PFEA 4SGBE 1MAYA 4DY7B 3QLPH 3TPIZ 1BTYA 1DANH 1TGBA 2XC5A 3ZYDA 3GOVB 1O2KA 1C5UA 4O3UA 4GLYA 1C5TA 1MTNC 5F8ZA 4X1PU 1DY9A 2HNTC 5K0HA 4JZDH 3F9GA 1ESAA 1ABJH 2F9BH 1GVLA 2PGQB 1TPAE 5ESTE 1UVUH 4D7GA 1HAHH 4K5ZA 1CT0E 1JRTA 1SSXA 5AF9H 2ODYB 3GY2A 4Q7YA 4U30A 1OYQA 4MNYA 2FP7B 2NU1E 1FZZA 1THPB 2FLRH 1FJSA 2FOGA 1OX1A 3C1KA 4X6OA 3BTME 3FP7E 1H4WA 1HRTH 1H9IE 2ZEBA 1QR3E 1AN1E 3R3GB 4DG4A 3QN7A 1C9TA 2OC7A 1E37B 1YPKH 2ZECA 5FHTA 1L1GA 3RXHA 1AVWA 4GPGA 1VCWA 1FMGA 2ODQA 3F9HA 2P3TB 4F4OC 3KQBA 3FAOA 3S7KB 3A8CA 2HLCA 2GVFA 1EP5A 4DCDA 1QGFA 3QGJA 2C93B 1MH0A 2BHGA 2ZHDA 3RXVA 3N7OA 1MTNB 2FOCA 3FZDA 3S9BA 2FX4A 4KELA 5E0HA 3F6UH 3QZRA 2QGRA 3O8DA 1DPOA 1EXFA 4X8TH 2B9LA 1C1NA 5JBTA 2FTLE 4GUXA 2P16A 3TNTA 4DGJA 3U9AH 1C2MA 3A88A 1OS8A 2IPHA 1G3BA 2Z9GA 1G2LA 4ABIA 2ZFQH 1UTOA 1D3QB 1EAXA 2A4OA 3RM2H 1N8OC 2QXGA 4KTUA 1AVXA 3EQ0H 2BQWB 1UCYE 1TQ0B 2BD7A 1A4WH 1RGQA 1ZPCA 2H9TH 3B9FH 4ABAA 2BDIA 4UEHH 4B2CA 3HKJB 4ZAEA 3RU4T 2ZTXA 5E2OA 3SNBA 4WH8A 4YTAA 1IHSH 2ALPA 2XNIA 4JZ1A 1DFPA 3LKWA 3KQCA 3P8FA 1GBKA 4THNH 4MDSA 1YBWA 1NFWA 5EXNA 3LGIA 3A87A 1RTKA 1RFNA 2W26A 4E7NA 1V2WT 2BX4A 2AGIX 5JBAS 4INLA 1TFXA 2BXUH 4ABJA 1XUHA 2RA3A 3ATLA 2W7UA 2CN0H 2ZGCA 4IW4E 4FUIA 2ANWA 2SGDE 3QK1A 2Y7XA 1YF4A 2BY9X 2K1QA 2D8WA 3P8NA 1OKXA 2THFB 3TJUA 1QL7A 4INHA 4X6MA 5G4BA 2WUCA 4KTSA 5DO4H 2WPMS 2P94A 2LNCA 1YLDA 1TB6H 4H6SB 1N8OB 3FP8E 5DK1A 5BPEA 1EZQA 2ZI2H 1ORFA 1HFDA 2XCFA 1GJ7B 2J38A 3LOXA 1TRMA 4B2AA 1NPMA 3A85A 2H1UA 4ZHAA 2VU8E 1Z8JB 2JH0D 3GCTF 2OC1A 1VCQA 2IN2A 1C5QA 1SQOA 4AGJA 3BTHE 2BQ6B 5A0AE 2BDGA 3T25A 1QBNA 1FXYA 1DS2E 2RCEA 2ZCHP 4JYTA 4YESB 1T8MA 4BTUB 1KY9A 1PPHE 4NGAH 6ESTA 4DIIH 4JZEH 4NZLA 3PO1C 3UNSA 2ZCKP 3ODFA 3UR9A 2GTBA 4IBLH 1NRPH 1SGIB 2CF8H 4B76A 1T32A 1Q3XA 3M61U 3KQEA 1SGFG 3TU7H 3SV8A 4X8UH 1L0ZA 1A61H 3U8OH 3TH2H 4NIVA 1X7AC 3HK3B 4CH2B 1WQSA 1JWTA 4ESTE 4O3TA 1C5OH 1SC8U 2BOHB 4Y8XA 2HOBA 1AU8A 5DJ7A 3TH3H 5CHAC 3SNCA 2QCYA 3BEUA 4AN7A 2BLWA 2BY5X 3VGCB 4NFFA 1M9UA 2GV7A 9LPRA 4DJZB 3GICB 1EX3A 3BIVH 3MNBA 4CH8B 2OCVB 1XUIA 3RMNH 1VCPA 1J8AA 1HAXB 3RXUA 1O3DA 1BA8B 3MU0A 1O2TA 4WMEA 1O3GA 1CHGA 1KXDA 2V0BA 1EASA 4AFQA 2C8YB 4CR9A 1H8IH 2ZP0H 3VB6A 3PO1B 3VB3A 2ZGXH 3UQVA 3EYDA 1CGJE 1TNGA 1HAVB 3ZZ5A 1WUNH 3BF6H 2VWOA 3RXBA 1JIMA 1C1PA 1ZLRA 4DT7B 1S84A 3V3MA 1NT1A 3FANA 5HGGA 2TIOA 1ZHMA 1NY22 2ANYA 3ENSB 1EOLA 2RDLA 4RSPA 1P02A 5TJXA 5FPTA 2DUCA 2GT8A 5F03A 2VIQA 1CVWH 1MMJN 2BD9A 1ELEE 4MPWA 1BRBE 1P12E 2ZFPH 4J2YB 2A4GA 3A7YA 2JH5D 1OP2A 3KGPA 5CHAB 4X2VA 1SPJA 4XFQA 8KME2 3M7UA 1EOJA 3U98H 3GY6A 5FAHA 1HAIH 3UR6A 3A84A 4AYYB 3B8JA 3LGUA 1V2TT 1A3BH 4CBOA 1UHBB 5CMXH 1NFXA 2Y5GA 3ZZ7A 1O3CA 3TJOA 1HXFH 1CA0C 2B0FA 3STIA 1RIWC 1C2IA 4ISHH 1LHDH 1L1NA 3TITA