1C2JA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2jA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2jA02
3M3VA 4GPGA 7GCHG 2J4IA 1VGCB 1LHCH 1EQ9A 2BDHA 1WUNH 1PPFE 3C1KA 2I6SA 2FOFA 2D8WA 1MBMA 1TQ7B 4BNRA 4PROA 3QTOH 2J95A 2ALVA 4MLFB 1O3AA 4DIIH 1IQFA 4CBNA 2BLWA 1CBWC 1CQQA 3WY8A 3GY2A 3RXQA 2P3TB 3RXVA 2YNBA 3UREA 5T6GA 2OTVA 1AUTC 2VVUA 1RTKA 4ABBA 1BTZA 1CHOF 1UTNA 3RXHA 4X8TH 3RU4E 4AORA 4MNYA 4TYDA 2EA3A 1KXCA 4YOGA 3CENA 2J92A 3A88A 2BOKA 1W0YH 2FDAA 2O8LA 2Z3EA 1O5DH 3PO1B 2QXIA 2FI4E 2FO9A 3MNSA 4X2VA 2LNCA 1PJPA 1S82A 3SV7A 4H4FA 2GV7A 2ZWLH 3ZVDA 3S69A 1O37A 1PQ7A 2EI7A 1TGCA 3TJVA 3VEQB 2F9NA 1EKBB 1AZZA 2RA0A 2ZCHP 1BITA 1O35A 1ZZZA 1GI0A 4OS1A 3EE0B 1O2PA 1QL7A 1IQEA 1PPHE 3SOSA 3EGKH 2GMTC 2BDYA 1FAKH 1ZJDA 4XBCA 2BXUH 1HGTH 3ITIA 1AWFH 4NGAH 3E91A 1TOMH 2FPZA 5FX6A 2GD4B 1EXFA 3ZVAA 1T7CA 1O2YA 4X2WA 2VWMA 2OXSA 1GGDC 2FMJA 4I8JA 1SBWA 1VCQA 1DVAH 2BOHB 1LVYA 1YGCH 5FX5A 4ABHA 3RU4D 3U8TH 2RDLA 3A7VA 2ZP0H 5DP7A 2IOTA 2B9LA 4ABAA 4DOQA 3KF2A 1GBFA 1ZOMA 1MD7A 1SR5C 1UO6A 2ZU2A 4I7YH 5E0GA 1DXPA 1RRKA 1THSH 2JH5D 3P8OA 3VPKA 3U1IB 3E0NB 4RKOB 3SBKA 1C5LH 1JOUB 1KXEA 1Z1IA 2ZDVH 1VITG 2F9UA 4KGAA 1DXWA 1TBQH 3SJIA 4Y0YE 1CT4E 2A45B 4JK6A 4UFGH 3N7OA 4X8UH 5IYTA 1O3IA 1V2OT 4JZ1A 1CSOE 2QCYA 3AAVA 1BIOA 2HNTF 3MNXA 1NFXA 3M7QA 1EZXC 1DLEA 2Y81A 4XDEA 2BY6X 5EODA 1LVOA 2QIQA 1GBMA 4XBBA 2FESH 1MCVA 3URDA 4OS5A 1LMWB 1XXDA 2VIWA 5T6DA 2BDIA 1O2OA 3SNDA 2WPHS 2GP9B 3CS0A 4UEHH 3OX7U 5JBAS 1V2WT 3SV9A 3LJOA 4ASHA 3ATIA 1GJ4H 1O5FH 3ZVEA 4DGJA 1SOZA 1C1SA 1S6HA 4IS5A 1MTWA 1SGFA 3K6ZA 1MTNC 2FODA 2R0KA 2G4UA 1AY6H 1HLTH 1ZRBA 4FUJA 4D76A 1GBDA 2FYRA 1PYTC 1P03A 1THRH 3A87A 5FBIA 1P2MA 3SV6A 1F5RA 1Y3YA 2R3YA 1ELBA 1S5SA 5GJ4B 2WYJA 1Y5BT 4ISNA 5JBCS 1H9HE 3ATWA 3TNTA 4IW4E 1GI6A 2ZDLA 1TGSZ 1OP8A 1E36B 3RXCA 1Z8RA 2XTTB 4OS2A 3ODFA 2B0FA 2KAIB 1C5QA 1GMDF 5LH8A 2ZFQH 3SU3A 5JYIA 4DW2U 4A7IB 1QGFA 2J2UA 1BJUA 2QA9E 1GI9B 3MTYA 3T27A 5F03A 1G3CA 1VR1H 4WH6A 2TGAA 5A09A 1TX7A 1O34A 1QQ4A 1TMBH 1HAHH 4K1SA 3NK8A 5GCHG 5SGAE 1O3NA 2RG3A 1J15A 1SPJA 2VVCA 2Q6GA 1GJCB 4ABEA 1O2HA 2B7DH 1YPHE 3GDVA 1YPJH 5TCAA 1HAGE 3EA8A 3NZIA 1F5KU 1HV7A 2SFAA 1GMDG 1LPGB 3LT3A 1XVMA 1KIGH 3JZ1B 1FI8A 1O32A 2W7SA 1TQ0B 1C1NA 2ZPRA 3F9GA 1YLCA 1W2KH 4DG4A 4IC5A 2OINA 4I31A 1GHBG 1W7XH 4I8KA 4OGYA 2Z7FE 3TGIE 1MZAA 3T2NA 1QR3E 4O3UA 3VXEH 1OWHA 1O36A 2ZTZA 1O31A 1P05A 1MU6B 1ELVA 1DDJA 4MQAA 2Z6BD 2EI6A 3QGJA 1EATA 1H1BA 5ESTE 1QB9A 1A3EH 1EB1H 2XWBI 4NSYA 4Q2KA 3NCLA 4J1YA 1V2JT 1V2LT 1C1MA 2UWPA 1IQKA 1UCYK 2ZFSA 4ZUHA 1SGFG 2ZFPH 2GZ9A 2WPIS 4NZQA 2G52A 3NXPA 1UVPA 1S84A 1QL9A 2C3SA 1DUEA 1P10A 2BD9A 5DO4H 1B7XB 5EPNA 5FHTA 4NWKA 1AWHB 4BAKB 3RXAA 1ZHRA 3E8LA 6ESTA 4XOJA 2O9QA 2GVFA 1FQ3A 1TPOA 3BTGE 1IQIA 1C5TA 1P57B 2STAE 3IG6B 1W7GH 2ZQ2A 1PQ5A 2BY8X 3FP6E 3BG4C 2VGCC 1NM6A 1J9CH 2TGPZ 4TPYA 3KQEA 3SNBA 1Y5UT 3QO6A 3AAUA 3MU8A 2GX4A 4I33A 2VWOA 2ZTXA 3T26A 1GCDA 3EDXB 1ABIH 1YCPM 4BXWA 1O2XA 3SNCA 3SGQE 5L2ZH 1G3BA 3RXUA 3ZZ4A 3BTQE 3SUEA 3A7TA 1BOQA 2H5DA 2QAAA 4NA8A 2BX4A 4LZ4B 3BTTE 2DE8A 2QXGA 3A7ZA 2VWNA 2BMGB 1HDTH 3SNAA 1SHHB 4Y8ZA 1SQOA 3RXIA 2AIQA 2W3KA 2G5NA 4YESB 1WQSA 5A0BA 1TE0A 5L2YH 4B1TA 2BD2A 4YZUA 1HAXB 2ZGHA 1BTPA 1O2MA 1Y5AT 3RXDA 3UQOA 3A80A 2G81E 2AMPA 3GCHB 4X6MA 1NN6A 2DE9A 4NFFA 2SNVA 1C2IA 3LC3A 3TK5A 1GG6C 4FVBA 1CT2E 1H8DH 1YPGH 2CHAB 4AYYB 1BBRH 1ZTKA 3MH6A 4WH8A 3KQDA 2VNTA 1RXPA 3Q3YA 1P2QA 1A0HB 3LH3A 1G32B 2HNTC 2O8UA 1UHBB 2VJ1A 1TNJA 1O3BA 4ISHH 4B73A 3ZZ5A 3DUXH 4OGXA 4GVUA 2Y6TA 1FJSA 2HLCA 4XFQA 3U8RH 4UFFH 4ABGA 1V2PT 3LGUA 3T28A 1O2KA 2HWLB 3MWIU 1F7ZA 4NIYA 1L4ZA 3SU6A 3QX5H 2WPMS 1NRSH 3UIRA 2FOAA 2GV6A 1SVPA 1TNLA 4ZROA 2AFQB 1BMMH 1ZPZA 2QXHA 3RXSA 2A7HA 2RA3A 2CGAA 1BA8B 1KXFA 1EPTB 2PTNA 1K1MA 4JYTA 4NG9H 3GY7A 1J17T 4MNXA 1UTPA 3UNRA 3K65B 1SGNE 2CV3A 4F4OC 5F8TA 4JZFH 1DICA 3NWUA 1KSNA 4WMDA 2BZAA 2OUAA 3I77A 1C1VH 2G5VA 2BD8A 2FZZA 3M5OA 4B2BA 2PGBB 1OWIA 1AD8H 2R9PA 1K21H 1K2I1 5EXNA 3U8OH 2SGFE 5C5NA 2QY0B 1P09A 1AE8H 1AIXH 4BXSA 5AFYH 5C1YA 4AB9A 1BHXB 2PTCE 4NA7A 1V2QT 3Q77A 3ZV8A 4MVNA 5C20A 3BTFE 1HPGA 1OKXA 3ODDA 4D7FA 2IJOB 2WINI 1GBCA 1ELEE 4UE7H 1TRNA 4K8BA 3AASA 4CRAA 1ESTA 4Y11E 3KQBA 4Y7BA 2BLOA 3RLWH 1LVMA 2P8OB 3F1SB 3RXFA 2QGRA 3BV9B 2F3CE 1GHAG 1EAUA 1CA8B 1K1IA 1GJ8B 1AE5A 1RTLA 1UCYH 1GBTA 4TY7A 1HJAB 4BANB 4DJZB 1MBQA 3SI3H 1IQGA 5EU8A 2H2ZA 3QN7A 1C5PA 3HGNA 1Y59T 1V2NT 2ZZUH 4ZKSU 1TRYA 1ELFA 2PW8H 3A8DA 1C1PA 1T32A 1FONA 3QZRA 5LPEA 3QTVH 4K8YA 2ODYB 1YM0A 2CMYA 4H6TA 4BTIB 1EAXA 1UTLM 1FN8A 3ENSB 1TX8A 2Y5HA 1NFYA 5JB9S 3A89A 3ZVBA 2Z9JA 3V12A 1G2MA 5CHAB 1VZQH 1AFQB 1PPZA 1L1GA 1GHAF 2W3IA 2ZEBA 4UFEH 1B0EA 3A8BA 3HPTB 5DP5A 4ZAEA 4DIHH 3MH7A 1QJ1B 4JCNA 5DP3A 5DP6A 4D9QA 1TA6A 4D7GA 1PPEE 4D9RA 2C4FH 1OWJA 1BRAA 3QK1A 1G9IE 5EQQA 4Z0KA 1IQNA 1SFIA 4XBDA 4AFUA 1CHOG 3OYPA 4Q7ZA 1ANCA 5DJ7A 2HOBA 5G4BA 1HAVB 1EPTC 1UCYE 2H1UA 1TGTA 4A92A 4JZIA 3H5CB 4HZHA 1DT2A 1YCPK 3F9EA 3RMMH 2H5CA 2NU1E 1ZGVA 3HATH 4Y7AA 3PMJA 3UTUH 4BAQB 2C8ZB 2C8XB 1C1WH 4AN7A 6LPRA 3IWMA 1S81A 4JMYA 5EPYA 4Y6DA 5C1UA 4FUEA 1GBEA 1C2KA 4IMQA 5DK1A 2ZTYA 1GBJA 3P95A 4XE4A 2A0QB 3SHCH 1ELDE 1HYLA 4A1TA 1C2GA 1C9PA 2F9BH 4K1TA 3S0NA 4ESTE 1C1RA 5H4IB 3BTME 2Y80A 1SGYE 4NCYA 1ANEA 4Z6AH 3KGPA 3RXLA 4OS4A 4UD9H 4B76A 4WF8A 5ABWA 3TPIZ 1XVOA 2BVXH 2FEQH 1BMNH 1DITH 1LPZB 2OLGA 5DP9A 3GYLB 1WYKA 5FCRA 1AFQC 1TBZH 1QRWA 2C8WB 3L6PA 2O8TA 1ZHPA 1JBUH 4Q7XA 3QUMP 2BDCA 3SNEA 1P9SA 1GJBB 3BEFB 4U32A 1BTHH 1W3CA 4JZDH 1YPMH 1QBNA 2CN0H 1TX6A 1BCUH 4K1EA 1O38A 1P3EA 2A4RA 1FNIA 2GDEH 3P92A 5GCHF 2FWWA 4WXVA 3GY4A 1AB9C 2OC0A 5DP4A 3LOXA 1LO6A 3PWBA 3GY8A 2XBXA 3F6UH 2OCVB 2ULLA 4AFQA 2C8YB 2PHBA 2AGIX 1EJAA 1CBWB 2F91A 5AF9H 2FM2A 2G51A 2XW9A 1TABE 2GCTC 4KELA 3ZZ7A 3RXJA 2EEKA 1UTOA 1WSSH 3LJJA 1Q2WA 1BUIA 2ZU5A 1IHSH 1SFQB 3VFEA 3SU1A 4FU7A 1FAXA 3MMGA 8KME2 2WPLS 1QA7A 4YM9A 4IC6A 2F83A 3M7UA 2DUCA 5EQRA 1MTSA 1GI8B 2A5KA 4X8VH 2QV1A 2GZ7A 4LOYH 1BT7A 1XMNB 1IHTH 3TK6A 7ESTE 1YPKH 1MZDA 5C67A 5J4QA 4FUHA 1HXEH 3ZVGA 3A82A 1OP2A 1HCGA 5I25A 3UNQA 3OU0A 1CA0B 1YC0A 4WY3A 5DG6A 1AHTH 4MNVA 4BAMB 4FU9A 1TMTH 3U9AH 2JKHA 1BDAA 4GUXA 2HPPH 5EW1H 1WAYB 3NUMA 2ODQA 3SJ9A 3T5FH 4MG3A 1PQAA 4CH8B 1D4PB 3MFJA 8LPRA 2XBVA 1A61H 2FI5E 1L2EA 3SUDA 3GDSA 1DSUA 3M3TA 2AEIH 1T8NA 1F2SE 1C2MA 1QL8A 1W14U 3PMBB 3BEIB 1OYTH 1SQAA 1TRMA 4OS6A 5DP8A 1O5EH 1AO5A 2F9PA 5F8XA 4AG2A 4H42U 1HAZB 5DPAA 5GDSH 2VINA 3BTDE 4UONA 3EQ0H 1EPTA 4FXGH 4ZMAH 3RMLH 4CHAB 1IQLA 4Q7YA 1AKSA 4GCHG 1QRXA 1AN1E 3L3TA 2ZNKH 3M35A 5E0HA 3LH1A 3MH5A 2BQ7B 4CRFA 2XYAA 2ZA5A 4DT7B 4O97A 2D1JA 1TWXB 1LVBA 1O3HA 1Q3XA 2GGVB 4KP0A 5FCKA 2CXVA 4B71A 1Q31A 4QT8C 1GHBF 4A1VA 3S7KB 2BY7X 2W5EA 3OTJE 2PWXA 2FOEA 1O2LA 1WBGB 2Y5GA 3LGWA 4GAWA 2Z9KA 1HJAC 1Y3VA 2AH4X 4HGCA 1RJXB 1IOEA 4WWYA 1ZPBA 2VIOA 1CU1A 1FY5A 3K9XB 4F49A 2H9EH 3HK6B 1QHRB 4ISOA 2ZHEH 1FY8E 1MH0A 1TPPA 2ZPQA 3STJA 5I46H 3BG8A 1XXFA 1OPHB 4ABIA 3RMOH 4VGCC 1SMFE 2OBQA 2NU4E 1ZMNA 2EI8A 5K7RA 1BTUA 2ZQ1A 1HFDA 1GG6B 1A4WH 1ZMLA 3PLKA 1CVWH 1ZTJA 1UTJA 4MDSA 1O2TA 4JYUH 3MNCA 1SGCA 2Y7ZA 2GCHF 4ZKOU 2ILNA 3TGJE 1QRZA 1AKSB 3PYHA 3UNSA 2WV4A 2I6QA 3ELAH 1C1UH 1GBIA 8GCHG 1SI5H 1OOKB 2KAIA 5L30H 1O2NA 2QF3A 2Z3CA 1MQ5A 1EOLA 3H7TA 2AMQA 4FUIA 2SNWA 2UUJB 2BZ6H 3GCHC 2O8WA 1FPCH 5E2OA 1GPZA 4E06H 1T8MA 4ZXYH 1P2OA 4FUGA 3ATKA 1J8AA 2R2MB 2V3OH 1GWAA 3M5MA 3HKJB 4X8SH 3S9AA 2BDGA 3KIDU 2A5AA 3U1JB 1VITF 2OC1A 3PWCA 5DKMA 1NRQH 1HXFH 1YPEH 3RXEA 1KDQA 2OBOA 3U69H 1O3DA 2BVSH 1C5OH 4BTTB 1C5MD 1EJMA 1WTHD 3V0XA 3UQVA 1GBKA 1O2GH 1BHXF 1O3KA 3GY6A 1FY1A 4R8TB 1MTVA 4TY6A 3VB5A 2PUQH 2F9OA 3E3TA 1GJ6A 5ESBA 1DWDH 3UOUA 1IQHA 2PLXA 1W8BH 2FTLE 3LGIA 1HAYB 1O2VA 1JMOH 1F0SA 1C2EA 1DX5M 2HALA 1RTFB 1HUTH 3B9FH 4YTAA 3LKWA 2PSXA 1JXPA 3TU7H 2BB4A 2A5IA 2ZDNA 1P02A 1FY3A 1OXGA 1WU1A 4FUFA 3EA7A 3SGAE 2WV5A 1A5GH 1Z1JA 2QXJA 4UDWH 3E16B 1JIRA 1ZSJA 4LK4A 4X1SU 1UK2A 1PPBH 2HNTE 2UUKB 4K5ZA 3VB7A 4NA9H 3SO3A 4X1NU 1K1JA 2ZDAH 1AMHA 1JRSA 1VJ9U 1W10U 2GCTB 2ZHQH 3UFAA 3Q3XA 1JRTA 1QURH 1EAIA 1O2SA 5FPSA 1AVGH 2GDDA 4I32A 2ZHFH 3QDZB 3CP7A 2SGDE 2ZO3H 2XC4A 3SW2B 2PKAA 2BXTH 1ZJKA 1XM1A 3PLPA 4ZKRU 3PMAB 2TIOA 2BD7A 1YPLH 3UWIA 2HPQH 1L1JA 2BY9X 3ZVFA 1KLTA 3DHKH 5A8ZA 3RC4A 1K1LA 1OS8A 1SGRE 1EASA 1WTGH 3LIWA 1ELAA 1PFXC 2G4TA 2WPJS 4Y10E 1V6DA 1VITH 4AFSA 1P04A 1C2HA 2ZHWH 1YKTA 1KXAA 1TFXA 2O8MA 1F5LA 2GTBA 3C27B 1ANDA 4YOIA 1T31A 1MTUA 4X1PU 1C2FA 1H4WA 1DE7H 3GOVB 1SGDE 1RS0A 1S0RA 3RXMA 4A1XA 1DOJA 1K22H 3A86A 3T25A 4NWLA 1NT1A 1P2JA 1NROH 1WV7H 1YF4A 2LPRA 3A7XA 3SV8A 2FP7B 1GI3A 3D49H 1CGJE 5EXLA 1OWEA 1C2DA 2FX4A 4ABDA 2A7CA 1O2IA 2AGGX 3L33A 5LPRA 1DY9A 1V2TT 1Z8IB 2V35A 1Z8GA 2CHAC 1KLJH 2NU2E 1UTMA 2ZCKP 2XRCA 1ZHMA 3PV4A 1P0SH 3O8CA 1ZRKA 2SGPE 3RXPA 5BRRE 1QA0A 1KXDA 2XXLA 3RUOA 1F92A 3DT0H 2ZGCA 4CRBA 3LGTA 1NTPA 1EUFA 1O0DH 4I8LA 5A8XA 1GDQA 1ELCA 1AI8H 1FIWA 1TYNA 4SGBE 1XKAC 4I8HA 4BTUB 3LDXH 3PO1C 2XBYA 5E2PA 2ZGXH 1MD8A 3KEEA 3ZZAA 2PV9B 2GT7A 4X1RU 1XUFA 1UJ1A 1THPB 5FPTA 2H9HA 2BYAX 1O30A 4GCHF 2OQ5A 1BRUP 1LHDH 5PTPA 2PUXB 3FZDA 3FANA 1C5XB 4BAOB 1X7AC 3TH4H 5EOKA 5BPEA 2XC0A 2W26A 3HGPA 4Q80A 1AQ7A 1WCZA 2PR3A 1XX9A 4X2YA 5T3HA 4CRGA 2C93B 4JZEH 4TPIZ 4Y8XA 2A4QA 1LQDB 2B5TB 1YP9A 2YOLA 4KKDA 3PM3A 1GI7B 2BDBA 2SGEE 1GHXH 2FOHA 4FUCA 1GI5A 1FPHH 2AYWA 2VU8E 1TBRH 1XUHA 5ETXA 3A85A 4J2YB 1KY9A 1MMJN 3SQHE 2P8OC 3BTEE 1BZXE 1GHWH 1RD3B 4B2AA 3P8GA 3GCOA 2TPIZ 1RIWB 1DFPA 2Q6FA 1FMGA 2TGDA 8ESTE 3UOPA 4X6PA 1ZGIA 1A5HA 2GMTB 1J14A 3H7OA 3E1XB 1CGHA 4GSOA 2J38A 1BTWA 1C1TA 1D6RA 3VB6A 1KTSB 1QNJA 1GJDB 1TA2A 2Z9GA 4JK5A 3P70B 3W95A 3GCTF 1C9TA 1Z7KA 2VIQA 3ESTA 1WQVH 3QGNB 3SORA 2FS8A 1ID5H 3STIA 2BLVA 3B23B 4NIVA 1XKBC 3O8RA 2ZIQH 1ETRH 1LHFH 1OWKA 4NSVA 4FU8A 1EOJA 1EZSC 5C5OA 4UFDH 1H9LB 1N6XA 3KQCA 1LKBA 3UUZA 3M5LA 2Y7XA 1SLVB 2BQWB 3E0PB 1O5CB 4YT7H 4ZHLU 1QTFA 1V2VT 4Y76A 3LONA 1O3EA 1K1NA 1GCTB 2ZDMA 3ZV9A 3FP7E 4YLQH 4WMEA 7GCHF 5B6OA 3AVZA 1N8OC 1LTOA 1MKWK 3P8NA 4SGAE 3RM2H 8GCHF 2J9NA 4JYVH 1SG8B 2ZF0H 4GLYA 1MTNB 1KLIH 4THNH 1T4UH 4X6NA 1O3OA 1OSSA 2TBSA 2VIPA 1MQ6A 1O3PB 3FP8E 2J94A 3SU2A 2ODPA 3M37A 5CHAC 3MYWA 4HI3A 3UR6A 4Y8YA 2AERH 3F9HA 5JPMH 5AFZH 2PGQB 1HIAB 1G36A 1LHEH 1BTYA 1QBOA 1EZUC 3GYMA 2B8OH 1E34B 5HM2A 1CO7E 1E37B 1RGQA 2P3UB 1TONA 3DFJA 3MO9A 1FXYA 1L0ZA 2BD4A 2XCFA 1QB1A 2VB0A 2H9TH 1SGPE 3SU0A 3VB3A 1V2ST 3MO3A 3TH3H 2ZKSA 1G3EA 3K6YA 3RXRA 2EC9H 1GL1A 4O03A 3UWJH 1Z8JB 1W11U 3QWCH 7KMEH 1HAOH 1TLDA 2ANKH 1EAWA 1BJVA 3FFGA 1S0QA 1ARBA 2V3HH 2NU3E 1CE5A 1IQJA 4GHTA 2XWAA 4GHQA 1GMCG 2H6MA 1LDTT 4ZHMU 2FS9A 1O3GA 2ZU3A 3RXBA 3SUFA 1NU7B 1GDUA 1ZSLA 1TPAE 1O2WA 5F8ZA 3SZNA 2ZG0H 1HBTH 2UUFB 2Z9IA 4O3TA 1C2JA 4CR5A 2WUCA 3A84A 3BIVH 1PPCE 1YPHC 3HKIB 2ANYA 4MPXA 3BF6H 4X2XA 5IDKA 2FIRH 2ZU1A 4ISIH 2FI3E 4Y0ZE 4IMZA 5LPFA 2SGQE 3FZZA 3LU9B 1FN6A 1E38B 5JB8S 3PTNA 1SHYA 2FOGA 2FOMB 2TGTA 5TJXA 5EXMA 3M5NA 5E0JA 5TCCA 1O33A 1SLUB 3KN2A 1Z71A 2ESTE 1EB2A 2VH6A 3GY5A 5FXLA 2XBWA 2BDAA 5JBBS 1K28D 1QJ6B 3A8CA 1AB9B 3SQEE 1V2UT 2ALPA 2IPHA 4B74A 2Z3DA 3ZZ8A 2BVRH 3U98H 4LXBH 1GHYH 1H9IE 4AYVB 1YYY1 1VCPA 1XUKA 4OS7A 2ZI2H 1C1OA 2ZC9H 6CHAB 4R0IA 4E7RG 4H6SB 2R0LA 1K9OE 1C5VA 1AVWA 1ETSH 1SGIB 3VB4A 4YT6H 3I29A 3S7HB 5JBTA 1TNIA 3ATLA 2ZU4A 2CF8H 4K2YA 1TB6H 3LC5A 4MNWA 3GICB 2P94A 2Y5FA 5T6FA 4ZH8A 1NESE 1QCPA 1LQEA 2BD5A 1XUIA 1NZQH 4MPWA 5EGMA 1V3XA 1A0JA 3EA9A 1MKWH 4RN6A 3SJOA 1A0LA 1INCA 1HB0B 2Z9LA 1A46H 3E90B 1JIMA 1DS2E 1NS3A 1O2UA 3SV2H 3EYDA 3V13A 5GXPA 1SOTA 2BD3A 3TNSA 1ZPCA 1GI4A 2A1DB 3P8FA 2FOBA 3GCNA 4HFPB 3RC5A 3TIUA 1ZMJA 4B75A 1C4U2 3MNBA 2ZCLP 1SLWB 2WYGA 4AOQA 1Z6EA 1GL0E 1NO9H 4AG1A 3PLBA 1A2CH 4AFZA 2OC7A 1AZ8A 1ACBE 1GJ7B 1TOCB 1YCPH 1FDPA 2G55A 1C5RA 5L6NH 1ESBA 4TWWA 4MPVA 1DSTA 1ORFA 2TRMA 2A31A 3S9CA 3QZQA 1IAUA 1EP5A 3BEUA 4ZXXH 1SGTA 2JH6D 1N6YA 2ZFRH 1UHBA 2IN2A 4BAHB 3TLOA 2VWLA 1A5IA 2V0BA 1T8OA 3ATMA 2C90B 1AFEH 3MU0A 5FBEA 1CT0E 3VGCC 2BX3A 2OD3B 2ZFTA 1TPSA 2BQ6B 2UUYA 1BB0B 1P9UA 1C5SA 1C5ZB 1L4DA 2QF0A 1Y3WA 3BN9A 2ZGJA 4K60A 1W0ZU 3ZZ3A 1D3PB 1PPGE 1GCTC 1GBLA 4WMFA 1DWCH 3HK3B 2VVVA 1Z6JH 4MTBA 5E8EH 3RC6A 5C1XA 3A7WA 1HIAA 3K2UA 3RP2A 1C5UA 4DCDA 1G2LA 3I78A 3T62A 3SGBE 1ARCA 1NY22 1UTQA 1M9UA 1G3DA 1O39A 1O2RA 4FUBA 1PQ8A 1V2KT 1TAWA 1NFUA 4FVDA 4KTSA 2HRVA 4HTCH 2A7JA 3RLYH 1BTXA 1JWTA 1QB6A 1O2QA 2BTCE 1J16A 1QBVH 1G37A 2JETC 5GIBA 4ISLA 3URCA 1RFNA 1UVUH 1BBRE 3PROA 1C5WB 5FAHA 1ZYOA 1TALA 1B5GH 3M61U 2ZDKA 4KTUA 1GGDB 1UTKA 3D23A 2JH0D 2P16A 3BTHE 1O3CA 1Y3XA 4M7GA 1W13U 1NRRH 4AZ2B 1TGNA 4A5TS 1TGBA 4TWYA 3OSYA 1DY8A 1F0RA 1TNGA 1O2ZA 2ZPSA 1S85A 1KYNA 3IITA 1FUJA 1YBWA 4U2WA 4MPUA 3R3GB 3GY3A 3RXKA 3TITA 1NC6A 7LPRA 3MU4A 1OWDA 3BG4B 2BHGA 1D6WA 2OQUA 4IN2A 1FLEE 3BIUH 1GJAB 1C2LA 1GI1A 1GJ9B 4AX9H 5AHGH 1XUJA 2A2XH 5CMXH 4CR9A 5HMAA 3OY5U 1KDQB 1TMUH 2AS9A 2FLBH 1QQUA 1NRNH 5EG4A 4DY7B 2OP9A 1CHGA 1UMAH 3MO6A 2FLRH 3ZZBA 2BY5X 5A0AE 3GCTG 1UK4A 2Q6DA 3T29A 1AGJA 1DWEH 1S83A 1NFWA 2G00A 4WVPE 2XC5A 4NIXA 3P6ZB 2UWOA 2ASUB 3A81A 2JETB 4DURA 2ZECA 2FTMA 1MKXH 1D3DB 3RU4T 1AVXA 1C4V2 1PYTD 2A4GA 3PB1E 4CREA 1HAVA 1O5GH 1EP6A 1CA0C 3Q00A 1TNKA 4BOHA 1D3QB 3ZZ9A 1F0UA 2HGTH 4B2CA 2ZHDA 2GKVE 2W7UA 4YO9A 1V2RT 3E6PH 1MAXA 1V2MT 2VH0A 3BTKE 1GHVH 3MOCA 1UVTH 4X1QU 3TGKE 4WJG2 4I8GA 3ZZDA 3CS7A 5A2MH 2AIPA 6CHAC 2D2DA 2G8TA 2PKAB 1GVZA 1SGEE 5EQSA 1P2KA 1UVOA 1P2NA 3S9BA 1SB1H 3F68H 4YOJA 1SC8U 6GCHG 3P17H 5HXFA 1O3FA 1XUGA 1FIZA 1LCYA 5JDUB 2VIDA 1ANBA 4WXIA 3M3SA 1ZTLA 3D62A 4X0WU 4CHAC 1DLKB 1E35B 5HM9A 1K1OA 1LPKB 2P95A 1A3BH 1NPMA 3FVFB 3TH2H 1GVKB 1P06A 2BM2A 4Y71A 1BRBE 4U30A 4FUDA 1G30B 3MI4A 3R0FA 4D8NA 1VCWA 4Y79A 3SHAH 3Q3KA 1ELGA 3MU5A 3TJOA 4A6LA 1OP0A 5DGJA 1ABJH 4ABFA 1SSXA 2OC8A 1MAYA 2K1QA 2QC2A 4CBOA 2A32A 1FY4A 1ESAA 1P8VC 2P93A 1D3TB 4ZHAA 3AW1A 2Z94A 3BSQA 1TNHA 1GMHG 3UR9A 5F6MA 3RXTA 1C4Y2 2A2QH 3LGYA 1VJAU 4E05H 4YLUA 1O5AB 4XSKU 5GPIB 1HAIH 5EW2H 4VGCB 5J4SA 1O3LA 1DPOA 2ANMH 1SGQE 1HNEE 3KNXA 1C5YB 3Q76A 1KXBA 1A1RA 3QLPH 1HJ8A 2D26C 3KL6A 5LGOA 2QN5T 1D9IA 3LPRA 1GJ5H 1C5NH 2PSYA 1BMAA 2F9VA 5AVDA 1GBHA 2GZ8A 1ETTH 2A4OA 3ZVCA 3SU5A 3KCGH 3UPEA 1ZR0A 2WPKS 1S6FA 4E7NA 1E0FD 2V6NA 1GMHF 2VGCB 2J34A 1SL3A 1OYQA 5A8YA 4NZLA 4CH2B 9LPRA 6GCHF 1ZLRA 1T8LA 3PMHB 5CE1A 3TJNA 3G01A 4INLA 4CRCA 5FPYA 1W12U 3B8JA 2XCNA 1H8IH 9ESTA 3KHVA 2PKSB 3V3MA 3F9FA 4AGKA 1MKXK 3A7YA 4IBLH 2RCEA 2Y82A 3VGCB 4X6OA 3SUGA 1HAPH 1Y3UA 2GCHG 1DWBH 2ZFFH 1BBRK 4K69A 2THFB 1SQTA 1ELTA 2VIVA 3PTBA 1FV9A 5K0HA 1O5BB 3BTWE 3RXGA 1GBBA 2R2WU 2UWLA 1MUEB 2QYIA 2CF9H 4AB8A 1KTTB 3LGVA 2SGAA 2HVXA 2PFEA 5GWZA 2AGEX 3SI4H 4INHA 3M7TA 4LZ1H 2BLQA 4KTCA 1U6QA 4RSPA 4O9VA 2CJIA 1VGCC 3D65E 1O3MA 4IGDA 3SJ8A 1HJ9A 1P11E 1OX1A 1QY6A 3V7TA 1GDNA 3ZYDA 1RIWC 1P2IA 1UK3A 2FX6A 2GT8A 3TK9A 4ABJA 2P59A 3SJKA 1SLXB 1AU8A 1A7SA 1NRPH 4DVAU 1GMCF 1BQYA 1LKAA 2P3FH 1K1PA 1MCTA 1BRCE 3GISB 3UY9A 1EZQA 3ZYEA 1ZSKA 2FOCA 1O2JA 1GBAA 4NIWA 4IN1A 3M36A 2FXRA 2NU0E 5HGGA 3W94A 1GVLA 3RMNH 1UVSH 1P01A 1AUJA 2ZGBH 2AMDA 2STBE 1QIXB 3JZ2B 3DD2H 4ZKNU 3NPSA 2R3UA 1T4VH 4AGJA 1WOFA 1DUAA 1HRTH 1LHGH 3A83A 3O8DA 3OY6U 1N1LA 3NKKA 5HYOA 4NFEA 1Y8TA 2XNIA 3SU4A 1P12E 4CRDA 1O3JA 1C1QA 1BMLA 5C2ZA 2WUBA 3GDUA 2M5TA 1QJ7B 1IQMA 1FZZA 2Q1JA 2ANWA 3ZZCA 5C3NA 1YLDA 3A8AA 1F0TA 3RDZA 4U01A 3SN8A 2FYQA 3TVJB 3MH4A 1QFKH 3EAJA 1CGIE 1DM4B 1EJNA 3MU1A 5A0CA 4K3JA 1L1NA 3MHWU 1DANH 3VXFH 4INKA 1MU8B 1N8OB 3ZZ6A 1GHZA 2YNAA 4RKJB 3RM0H 2NWNA 3FAOA 1EX3A 3DA9B 1GI2A 1NU9A 3DFLA 2PKSC 1TIOA 3O8BA 3AW0A 3TJUA 1P3CA 1B0FA 3RXOA
chains in the Genus database with same CATH superfamily
3M3VA 4GPGA 7GCHG 2J4IA 1VGCB 1LHCH 1EQ9A 5C0TA 2BDHA 1WUNH 1PPFE 3C1KA 5CDFE 2I6SA 2FOFA 2D8WA 1MBMA 1TQ7B 4BNRA 4PROA 3QTOH 2J95A 2ALVA 4MLFB 1O3AA 4DIIH 1IQFA 4CBNA 2BLWA 1CBWC 1CQQA 3WY8A 3GY2A 3RXQA 2P3TB 3RXVA 2YNBA 3UREA 3NRLA 5T6GA 2OTVA 1AUTC 2VVUA 1RTKA 4ABBA 1BTZA 1CHOF 1UTNA 3RXHA 4X8TH 3RU4E 4AORA 4MNYA 4TYDA 2EA3A 1KXCA 4YOGA 3CENA 2J92A 3A88A 2BOKA 1W0YH 2FDAA 2O8LA 2Z3EA 1O5DH 3PO1B 2QXIA 2FI4E 2FO9A 3MNSA 4X2VA 2LNCA 1PJPA 1S82A 3SV7A 4H4FA 2GV7A 2ZWLH 3ZVDA 3S69A 1O37A 1PQ7A 2EI7A 1TGCA 3F2FA 3TJVA 3VEQB 2F9NA 1EKBB 1AZZA 2RA0A 2ZCHP 1BITA 1O35A 5HKKD 1ZZZA 1GI0A 4OS1A 3EE0B 4M9FA 1O2PA 1QL7A 1IQEA 1PPHE 3PV2A 3EGKH 2GMTC 3SOSA 2BDYA 2WPDD 1FAKH 1ZJDA 3N7EA 4XBCA 2BXUH 1HGTH 3ITIA 1AWFH 2V3MA 4NGAH 3E91A 1TOMH 2F4LA 2FPZA 2GD4B 3OEED 5FX6A 1EXFA 3ZVAA 1T7CA 1O2YA 4X2WA 2VWMA 2OXSA 1GGDC 2FMJA 4I8JA 1SBWA 1VCQA 1DVAH 2BOHB 1LVYA 1YGCH 5FX5A 4ABHA 3RU4D 3U8TH 2RDLA 3A7VA 2ZP0H 4XRNA 5DP7A 2IOTA 2B9LA 4ABAA 4DOQA 4FETA 3KF2A 1GBFA 1ZOMA 1MD7A 1SR5C 1UO6A 2ZU2A 4I7YH 5E0GA 1DXPA 1RRKA 1THSH 2JH5D 3P8OA 2JIZD 3DSOA 3VPKA 3U1IB 3E0NB 4RKOB 3SBKA 1C5LH 1JOUB 1KXEA 1Z1IA 2ZDVH 1VITG 1MABB 2F9UA 4KGAA 1DXWA 1TBQH 3SJIA 4Y0YE 1CT4E 2A45B 4JK6A 4UFGH 3N7OA 4X8UH 5IYTA 1O3IA 1V2OT 3OTPA 4JZ1A 1CSOE 2QCYA 3AAVA 1BIOA 2HNTF 3MNXA 1NFXA 3M7QA 1EZXC 1DLEA 2Y81A 4XDEA 2BY6X 5EODA 1LVOA 1OHHD 2QIQA 1GBMA 4XBBA 2FESH 1MCVA 3URDA 4OS5A 1LMWB 1XXDA 2VIWA 5T6DA 2BDIA 1O2OA 1W0JD 4B6EA 3SNDA 2WPHS 2GP9B 3CS0A 4UEHH 3OX7U 5JBAS 1V2WT 3SV9A 3LJOA 4ASHA 3ATIA 1GJ4H 1O5FH 3ZVEA 4DGJA 1SOZA 1C1SA 1S6HA 4IS5A 2LP6A 1MTWA 1SGFA 3K6ZA 1MTNC 2FODA 2R0KA 2G4UA 1AY6H 1HLTH 1ZRBA 4FUJA 4D76A 1GBDA 2FYRA 1PYTC 1P03A 1THRH 3A87A 5FBIA 1P2MA 3SV6A 1F5RA 1Y3YA 5EJZA 2R3YA 1ELBA 1S5SA 5GJ4B 2WYJA 1Y5BT 4ISNA 5JBCS 1H9HE 3ATWA 3TNTA 4IW4E 1GI6A 2ZDLA 3N99A 1TGSZ 1OP8A 1E36B 3RXCA 1Z8RA 1W0KD 2XTTB 4OS2A 3ODFA 5C17A 2B0FA 2KAIB 1C5QA 1GMDF 5LH8A 2ZFQH 3SU3A 5JYIA 4DW2U 4A7IB 1QGFA 2J2UA 1BJUA 2QA9E 1GI9B 3MTYA 3T27A 5F03A 1G3CA 1VR1H 4WH6A 2TGAA 5A09A 1TX7A 1O34A 1QQ4A 1TMBH 1HAHH 4K1SA 3NK8A 5GCHG 5SGAE 1O3NA 2RG3A 1J15A 1SPJA 2VVCA 2Q6GA 1GJCB 4ABEA 1O2HA 2B7DH 1YPHE 3GDVA 1YPJH 5TCAA 1HAGE 3EA8A 3NZIA 1F5KU 1HV7A 2SFAA 1GMDG 1LPGB 3LT3A 1XVMA 1KIGH 3JZ1B 1FI8A 1O32A 2W7SA 1TQ0B 1C1NA 2ZPRA 3F9GA 1YLCA 1W2KH 4DG4A 4IC5A 2OINA 2KCOA 4I31A 1GHBG 1W7XH 4I8KA 4OGYA 2Z7FE 3TGIE 1MZAA 3T2NA 1QR3E 4O3UA 3VXEH 1OWHA 4B6FA 1O36A 2ZTZA 1O31A 1P05A 1MU6B 1ELVA 1DDJA 4MQAA 2Z6BD 2EI6A 3QGJA 1EATA 1H1BA 5ESTE 1QB9A 5HIYA 1A3EH 1EB1H 2XWBI 4NSYA 3ZIAD 4Q2KA 3NCLA 4J1YA 2J5UA 1V2JT 1V2LT 1C1MA 2UWPA 1IQKA 1UCYK 2ZFSA 4ZUHA 1SGFG 2ZFPH 2GZ9A 2WPIS 4NZQA 2G52A 3NXPA 1UVPA 1S84A 1QL9A 2C3SA 1DUEA 1P10A 2BD9A 5DO4H 1B7XB 5EPNA 5FHTA 4NWKA 1AWHB 4BAKB 3RXAA 1ZHRA 3E8LA 6ESTA 4XOJA 2O9QA 2KCAA 2GVFA 1FQ3A 1TPOA 3BTGE 1IQIA 1C5TA 1P57B 2STAE 3IG6B 1W7GH 2ZQ2A 1PQ5A 2BY8X 3FP6E 3BG4C 2VGCC 1NM6A 1J9CH 2TGPZ 4TPYA 3KQEA 3SNBA 1Y5UT 3QO6A 3AAUA 3MU8A 2GX4A 4I33A 2VWOA 2ZTXA 3T26A 1GCDA 3EDXB 1ABIH 1YCPM 4BXWA 1O2XA 3SNCA 3SGQE 5L2ZH 1G3BA 3RXUA 3ZZ4A 3BTQE 3SUEA 3A7TA 1BOQA 1QZ8A 2H5DA 2QAAA 4NA8A 2BX4A 4LZ4B 3BTTE 2DE8A 2QXGA 3A7ZA 2VWNA 2BMGB 1HDTH 3SNAA 3F2GA 1SHHB 4Y8ZA 1SQOA 3RXIA 2AIQA 2W3KA 2G5NA 4YESB 1WQSA 5A0BA 1TE0A 5L2YH 4B1TA 1EFRD 2BD2A 4YZUA 1HAXB 2ZGHA 1BTPA 1S6LA 4ZCNA 1O2MA 1Y5AT 3RXDA 3UQOA 2GJGA 3A80A 2G81E 2AMPA 3GCHB 4X6MA 1NN6A 2DE9A 4NFFA 2SNVA 1C2IA 3LC3A 3TK5A 1GG6C 4FVBA 1CT2E 1H8DH 1YPGH 2CHAB 4AYYB 1BBRH 1ZTKA 3MH6A 4WH8A 3KQDA 2VNTA 1RXPA 3Q3YA 1P2QA 1A0HB 3LH3A 1G32B 2HNTC 2O8UA 1UHBB 2VJ1A 1TNJA 2WZQA 1O3BA 4ISHH 4B73A 3ZZ5A 3DUXH 4OGXA 3AK5A 4GVUA 2Y6TA 1FJSA 2HLCA 4XFQA 3U8RH 4UFFH 2YMSC 1V2PT 4ABGA 3LGUA 3T28A 1O2KA 2HWLB 3MWIU 1F7ZA 4NIYA 1L4ZA 3SU6A 3QX5H 2WPMS 1NRSH 3UIRA 2FOAA 2GV6A 1SVPA 1TNLA 4ZROA 2AFQB 1BMMH 1ZPZA 2QXHA 3RXSA 2A7HA 2RA3A 5FL7D 2CGAA 1NBMD 1BA8B 1KXFA 1EPTB 2PTNA 1K1MA 4JYTA 4NG9H 3GY7A 1J17T 4MNXA 1UTPA 3UNRA 3K65B 1SGNE 2CV3A 4F4OC 5F8TA 4JZFH 1H8ED 1DICA 3NWUA 1KSNA 4WMDA 2BZAA 4OM9A 2OUAA 1KMHB 3I77A 1C1VH 2G5VA 2BD8A 2FZZA 3M5OA 4B2BA 2PGBB 1OWIA 1AD8H 2R9PA 1K21H 1K2I1 5EXNA 3U8OH 2SGFE 3OE7D 5C5NA 2QY0B 1P09A 1AE8H 1AIXH 4BXSA 5AFYH 1SQRA 5C1YA 4AB9A 1BHXB 2PTCE 4NA7A 1V2QT 3Q77A 3ZV8A 4MVNA 5C20A 3BTFE 1HPGA 1OKXA 3ODDA 3W1EA 4D7FA 2IJOB 2WINI 1GBCA 1ELEE 4UE7H 1TRNA 4K8BA 3AASA 4CRAA 1ESTA 4Y11E 3KQBA 4Y7BA 2BLOA 3RLWH 1LVMA 2P8OB 3F1SB 3RXFA 2QGRA 3BV9B 2F3CE 1GHAG 1EAUA 1CA8B 1K1IA 2JJ2D 1GJ8B 1AE5A 1RTLA 1UCYH 1GBTA 4TY7A 1HJAB 4BANB 4DJZB 1MBQA 3SI3H 1IQGA 5EU8A 2H2ZA 3QN7A 1C5PA 2JDID 3HGNA 1Y59T 1V2NT 2ZZUH 4ZKSU 1TRYA 1ELFA 2PW8H 3A8DA 1C1PA 1T32A 1FONA 3QZRA 4RI0A 5LPEA 3QTVH 4K8YA 2ODYB 1YM0A 2CMYA 4H6TA 4BTIB 1EAXA 1UTLM 1FN8A 3KYFA 3ENSB 1TX8A 2Y5HA 1NFYA 5JB9S 3A89A 3ZVBA 2Z9JA 3V12A 1G2MA 5CHAB 1VZQH 1AFQB 1PPZA 1L1GA 1GHAF 2W3IA 2ZEBA 4UFEH 1B0EA 3A8BA 3HPTB 5DP5A 4ZAEA 4DIHH 3MH7A 1QJ1B 4JCNA 5DP3A 5DP6A 4RT1A 4D9QA 1TA6A 4D7GA 1PPEE 4D9RA 2C4FH 1OWJA 1BRAA 3QK1A 1G9IE 5EQQA 4Z0KA 1IQNA 1SFIA 4XBDA 4AFUA 1CHOG 3OYPA 4Q7ZA 1E1QD 1ANCA 5DJ7A 2HOBA 5G4BA 1HAVB 1EPTC 1UCYE 2H1UA 5EIYA 1TGTA 4A92A 4JZIA 3H5CB 4HZHA 2VBCA 1DT2A 1YCPK 3F9EA 3RMMH 2H5CA 2NU1E 1ZGVA 3HATH 4Y7AA 3PMJA 3UTUH 4BAQB 2C8ZB 2C8XB 1C1WH 4AN7A 6LPRA 3IWMA 1S81A 3PV5A 4JMYA 5EPYA 4Y6DA 5C1UA 4FUEA 1GBEA 1C2KA 4IMQA 5DK1A 2ZTYA 1GBJA 3P95A 1YWUA 4XE4A 2A0QB 3SHCH 1ELDE 1HYLA 4A1TA 1C2GA 1C9PA 2F9BH 5F53A 4K1TA 3S0NA 4ESTE 1C1RA 5H4IB 3BTME 2Y80A 1SGYE 4NCYA 3VG8A 1ANEA 4Z6AH 3KGPA 3RXLA 4OS4A 1WDIA 4Q4LA 4UD9H 4B76A 4WF8A 5ABWA 3TPIZ 1XVOA 2BVXH 2FEQH 1BMNH 1DITH 1LPZB 2OLGA 5DP9A 3GYLB 1WYKA 5FCRA 1AFQC 1TBZH 4TT3D 1QRWA 2C8WB 3L6PA 1NBME 2J97A 2O8TA 4YXWD 1ZHPA 1JBUH 4Q7XA 2W6ID 2BDCA 2QF4A 3QUMP 1P9SA 3SNEA 1GJBB 3BEFB 4U32A 1BTHH 1W3CA 4JZDH 1YPMH 1QBNA 2CN0H 1TX6A 1BCUH 4K1EA 1O38A 3U28C 1P3EA 2A4RA 1FNIA 3SZEA 2GDEH 3P92A 5GCHF 2FWWA 4WXVA 3GY4A 1AB9C 2OC0A 5DP4A 2KR7A 3SYJA 3LOXA 1LO6A 3PWBA 3GY8A 2XBXA 3F6UH 2OCVB 2ULLA 4AFQA 2C8YB 2PHBA 2AGIX 1EJAA 1CBWB 2F91A 5AF9H 2FM2A 2G51A 2XW9A 1TABE 3PRDA 2GCTC 4KELA 3ZZ7A 3RXJA 2EEKA 1UTOA 1WSSH 3LJJA 2RDEA 5CHBA 1Q2WA 1BUIA 2ZU5A 1IHSH 1SFQB 3VFEA 3SU1A 4FU7A 1FAXA 3MMGA 8KME2 2WPLS 1QA7A 4YM9A 3OFND 4IC6A 2F83A 3FN8A 3M7UA 2DUCA 1YY3A 5EQRA 1MTSA 1GI8B 2A5KA 4X8VH 2QV1A 2GZ7A 4LOYH 1BT7A 1XMNB 1IHTH 1E79D 3TK6A 7ESTE 1YPKH 1MZDA 5C67A 5J4QA 4FUHA 1HXEH 3ZVGA 3A82A 1OP2A 2EQNA 1HCGA 5I25A 3F0OA 3UNQA 3OU0A 1CA0B 1YC0A 4WY3A 5DG6A 1AHTH 4MNVA 4BAMB 4FU9A 1TMTH 3U9AH 2JKHA 1BDAA 4GUXA 2HPPH 5EW1H 1WAYB 3NUMA 2ODQA 2KM0A 3SJ9A 3T5FH 4MG3A 1PQAA 4CH8B 1D4PB 3MFJA 8LPRA 2XBVA 1A61H 2FI5E 1L2EA 3SUDA 3GDSA 1DSUA 3M3TA 2AEIH 1T8NA 1F2SE 1C2MA 1QL8A 1W14U 3PMBB 3BEIB 1OYTH 1SQAA 1TRMA 4OS6A 5DP8A 1O5EH 1AO5A 2F9PA 5F8XA 4AG2A 2J98A 4H42U 1HAZB 5DPAA 5GDSH 2VINA 3BTDE 4UONA 3EQ0H 1EPTA 4FXGH 2V7QD 4ZMAH 3RMLH 4CHAB 1IQLA 4Q7YA 3F3BA 1AKSA 4GCHG 1QRXA 1AN1E 3L3TA 2ZNKH 3M35A 5E0HA 3LH1A 3MH5A 2BQ7B 4CRFA 2XYAA 2ZA5A 4DT7B 4O97A 2D1JA 1TWXB 1LVBA 1O3HA 1Q3XA 2GGVB 4KP0A 4RT0A 5FCKA 2CXVA 4B71A 1Q31A 3WW7A 4QT8C 1GHBF 4A1VA 3S7KB 2BY7X 2W5EA 3OTJE 2PWXA 2FOEA 1O2LA 1WBGB 2Y5GA 3LGWA 4GAWA 2Z9KA 1HJAC 1Y3VA 2WHXA 2AH4X 4HGCA 5DSFA 4ASUD 1RJXB 1IOEA 4WWYA 1ZPBA 2VIOA 1CU1A 1FY5A 3K9XB 4F49A 2H9EH 3HK6B 1QHRB 4ISOA 2ZHEH 1FY8E 1MH0A 1TPPA 2ZPQA 3STJA 5I46H 3BG8A 1XXFA 1OPHB 4ABIA 3DSGA 2PP6A 4VGCC 3RMOH 1SMFE 2OBQA 2NU4E 1ZMNA 1K0HA 2EI8A 5K7RA 1BTUA 2ZQ1A 1HFDA 1GG6B 1A4WH 1ZMLA 3PLKA 1CVWH 1ZTJA 1UTJA 4MDSA 1O2TA 4JYUH 3MNCA 1SGCA 2Y7ZA 2GCHF 4ZKOU 2ILNA 3TGJE 1QRZA 1AKSB 3PYHA 3UNSA 2I6QA 2WV4A 3ELAH 1C1UH 1GBIA 8GCHG 1SI5H 1OOKB 2KAIA 5L30H 1O2NA 2QF3A 2Z3CA 1MQ5A 1EOLA 3H7TA 2AMQA 4FUIA 2SNWA 2UUJB 2BZ6H 3GCHC 2O8WA 1FPCH 2W6JD 5E2OA 1GPZA 5KGOA 2L6OA 4E06H 1T8MA 4ZXYH 1P2OA 4FUGA 3ATKA 1J8AA 2R2MB 2V3OH 1GWAA 3M5MA 3HKJB 4X8SH 3S9AA 2BDGA 3KIDU 2A5AA 3U1JB 1VITF 2OC1A 3PWCA 5DKMA 1NRQH 1HXFH 1YPEH 3RXEA 1KDQA 2OBOA 3U69H 1O3DA 2BVSH 1C5OH 4BTTB 1C5MD 1EJMA 1WTHD 3V0XA 3UQVA 1GBKA 1O2GH 2YMSD 1BHXF 1O3KA 3GY6A 1FY1A 4R8TB 1MTVA 4TY6A 3VB5A 2PUQH 2F9OA 3E3TA 3FKSD 1GJ6A 5ESBA 1DWDH 3UOUA 1IQHA 2PLXA 1W8BH 2FTLE 3LGIA 1HAYB 1O2VA 1JMOH 1F0SA 1C2EA 1DX5M 2HALA 1RTFB 1HUTH 3B9FH 4YTAA 3LKWA 2PSXA 1JXPA 3TU7H 2BB4A 2A5IA 2ZDNA 1P02A 1FY3A 1OXGA 1WU1A 4FUFA 3EA7A 3SGAE 2WV5A 1A5GH 1Z1JA 2QXJA 4UDWH 3E16B 1JIRA 1ZSJA 4LK4A 4X1SU 1UK2A 1PPBH 2HNTE 2UUKB 1BMFD 4K5ZA 3VB7A 4NA9H 3SO3A 4X1NU 1K1JA 2ZDAH 1AMHA 1JRSA 1VJ9U 1W10U 2GCTB 2ZHQH 2XOKD 3UFAA 3Q3XA 1JRTA 1QURH 1EAIA 1O2SA 5FPSA 1AVGH 2GDDA 4I32A 2ZHFH 3QDZB 3CP7A 2SGDE 2ZO3H 2XC4A 3SW2B 2PKAA 2BXTH 2XNDD 1ZJKA 1XM1A 3PLPA 4ZKRU 3PMAB 2TIOA 2BD7A 1YPLH 2IJD1 3UWIA 2HPQH 1L1JA 2BY9X 3ZVFA 2KCYA 1KLTA 2M2AA 2KFWA 3DHKH 5T1VA 5A8ZA 3RC4A 1K1LA 1OS8A 1SGRE 1EASA 1WTGH 3LIWA 1ELAA 1PFXC 2G4TA 2WPJS 4Y10E 1V6DA 1VITH 4AFSA 1P04A 1C2HA 2ZHWH 1YKTA 1KXAA 1TFXA 2O8MA 1F5LA 2GTBA 3C27B 1ANDA 4YOIA 1T31A 1MTUA 4X1PU 1C2FA 1H4WA 1DE7H 3GOVB 1SGDE 1RS0A 1S0RA 3RXMA 4A1XA 1DOJA 1K22H 3A86A 3T25A 2QE7D 4NWLA 1NT1A 1P2JA 1NROH 1WV7H 3F0PA 1YF4A 2LPRA 3A7XA 3SV8A 2FP7B 1GI3A 3D49H 1CGJE 5EXLA 1OWEA 1H8HD 1C2DA 2FX4A 4ABDA 2A7CA 1O2IA 2AGGX 3L33A 5LPRA 1DY9A 1V2TT 1Z8IB 2V35A 1Z8GA 2CHAC 1KLJH 2NU2E 1UTMA 1VKYA 2ZCKP 2XRCA 1ZHMA 3PV4A 1P0SH 3O8CA 1ZRKA 2SGPE 3RXPA 5BRRE 1QA0A 1KXDA 2J98B 2XXLA 2K8IA 3RUOA 1F92A 3DT0H 2ZGCA 4CRBA 3LGTA 1NTPA 1EUFA 4P02A 1O0DH 4ACAA 4I8LA 5A8XA 1GDQA 1ELCA 1AI8H 1FIWA 1TYNA 4SGBE 1XKAC 4I8HA 4BTUB 3LDXH 3PO1C 2XBYA 5E2PA 2ZGXH 1MD8A 3KEEA 3ZZAA 2PV9B 2GT7A 4X1RU 1XUFA 1UJ1A 1THPB 5FPTA 2WSSD 2H9HA 2BYAX 1O30A 2CK3D 2OQ5A 4GCHF 1BRUP 1LHDH 5PTPA 2PUXB 3FZDA 3MQKC 3FANA 1C5XB 4BAOB 1X7AC 3TH4H 4F48B 5EOKA 5BPEA 2XC0A 2W26A 3HGPA 1YLNA 1AQ7A 4Q80A 1WCZA 2PR3A 2RFKC 1XX9A 4X2YA 5T3HA 4CRGA 2C93B 4JZEH 4TPIZ 4Y8XA 2A4QA 1LQDB 2B5TB 1YP9A 2KZ4A 2YOLA 4KKDA 3PM3A 1GI7B 2BDBA 2SGEE 1GHXH 2FOHA 4FUCA 1GI5A 1FPHH 2AYWA 2VU8E 1TBRH 1XUHA 5ETXA 3A85A 4J2YB 1KY9A 1MMJN 3SQHE 4Q63A 2P8OC 3BTEE 1BZXE 1GHWH 1RD3B 4B2AA 3P8GA 3GCOA 2TPIZ 1RIWB 1DFPA 2Q6FA 1FMGA 2TGDA 8ESTE 3UOPA 4X6PA 1ZGIA 1A5HA 2GMTB 1J14A 4ACBA 3H7OA 3E1XB 1CGHA 4GSOA 2J38A 1BTWA 1C1TA 1D6RA 3VB6A 1KTSB 1QNJA 1GJDB 1TA2A 2JJ1D 2Z9GA 4JK5A 3P70B 3W95A 3GCTF 1C9TA 1Z7KA 2VIQA 3ESTA 1WQVH 3QGNB 3SORA 2FS8A 1ID5H 3STIA 2BLVA 2K0QA 3B23B 4NIVA 1XKBC 3O8RA 2ZIQH 1ETRH 1LHFH 3WWBA 1OWKA 4NSVA 4FU8A 1EOJA 1EZSC 5C5OA 4UFDH 1H9LB 1N6XA 3KQCA 1LKBA 3UUZA 3M5LA 2Y7XA 1SLVB 2BQWB 3E0PB 1O5CB 4YT7H 4ZHLU 1QTFA 1V2VT 4Y76A 3LONA 1O3EA 1K1NA 1GCTB 2ZDMA 3ZV9A 3FP7E 4YLQH 4WMEA 7GCHF 5B6OA 3AVZA 1N8OC 1LTOA 1MKWK 3P8NA 4SGAE 3RM2H 8GCHF 2J9NA 4JYVH 1SG8B 2ZF0H 4GLYA 1MTNB 1KLIH 4THNH 1T4UH 4X6NA 1O3OA 1OSSA 2TBSA 2VIPA 1MQ6A 1O3PB 3FP8E 2J94A 3SU2A 2ODPA 3GS9A 3M37A 5CHAC 3MYWA 5KECA 4HI3A 3UR6A 4Y8YA 2AERH 3F9HA 5JPMH 5AFZH 2PGQB 1HIAB 1G36A 1LHEH 1BTYA 1QBOA 1EZUC 3GYMA 2B8OH 1E34B 5HM2A 1CO7E 1E37B 1RGQA 2P3UB 1TONA 3DFJA 3MO9A 1FXYA 1L0ZA 2BD4A 2XCFA 1QB1A 2VB0A 2H9TH 1SGPE 3SU0A 3VB3A 1V2ST 3MO3A 3TH3H 2ZKSA 1G3EA 3K6YA 3RXRA 2EC9H 1GL1A 1WXRA 4O03A 3UWJH 1Z8JB 1W11U 3QWCH 7KMEH 1HAOH 1TLDA 2ANKH 1EAWA 1BJVA 3FFGA 1S0QA 1ARBA 2V3HH 2NU3E 1CE5A 1IQJA 4GHTA 2XWAA 4GHQA 1GMCG 2H6MA 1LDTT 4ZHMU 2FS9A 1O3GA 2ZU3A 3RXBA 3SUFA 1NU7B 1GDUA 1ZSLA 1TPAE 1O2WA 5F8ZA 3SZNA 2ZG0H 1HBTH 2UUFB 2Z9IA 4O3TA 1C2JA 4CR5A 2WUCA 3A84A 3BIVH 1PPCE 3H09A 1YPHC 5B6LA 3HKIB 2ANYA 4MPXA 3CNRA 3BF6H 4X2XA 5IDKA 2FIRH 2ZU1A 4ISIH 3PRBA 2FI3E 4Y0ZE 4IMZA 5LPFA 2SGQE 3FZZA 5EJ1A 3LU9B 1FN6A 1E38B 5JB8S 3PTNA 1SHYA 2FOGA 2FOMB 2TGTA 5TJXA 5EXMA 3M5NA 5E0JA 5TCCA 1O33A 1SLUB 3KN2A 1Z71A 2ESTE 1EB2A 2VH6A 3GY5A 5FXLA 2XBWA 2BDAA 5JBBS 1K28D 1QJ6B 3A8CA 1AB9B 3KQ5A 3SQEE 1V2UT 2ALPA 2IPHA 4B74A 2Z3DA 3ZZ8A 2BVRH 3U98H 2WV9A 4LXBH 1GHYH 1H9IE 4AYVB 1YYY1 1VCPA 1XUKA 4OS7A 2ZI2H 1C1OA 2ZC9H 4DT4A 6CHAB 4R0IA 4E7RG 4H6SB 2R0LA 1K9OE 1C5VA 1AVWA 1ETSH 1SGIB 2OK5A 3VB4A 4YT6H 3I29A 3S7HB 5JBTA 1TNIA 3ATLA 2ZU4A 2CF8H 4K2YA 1TB6H 3LC5A 5C0UA 4MNWA 3GICB 2P94A 2Y5FA 5T6FA 3EE7A 1NESE 1QCPA 1LQEA 2BD5A 4ZH8A 1XUIA 1NZQH 5HIZA 4MPWA 5EGMA 1V3XA 2F43B 1A0JA 3EA9A 1MKWH 4RN6A 3SJOA 1A0LA 1INCA 1HB0B 2Z9LA 1A46H 3E90B 1JIMA 1DS2E 1NS3A 1O2UA 3SV2H 3EYDA 3V13A 5GXPA 1SOTA 2BD3A 3TNSA 1ZPCA 1GI4A 2A1DB 3P8FA 2FOBA 1SKYE 3GCNA 4HFPB 3RC5A 3TIUA 1ZMJA 4B75A 1C4U2 3MNBA 2ZCLP 1SLWB 2WYGA 4AOQA 1Z6EA 1GL0E 1NO9H 4AG1A 3PLBA 1A2CH 4AFZA 2OC7A 1AZ8A 3DSPA 1ACBE 1GJ7B 1TOCB 1YCPH 1FDPA 2G55A 1C5RA 5L6NH 1ESBA 4TWWA 4MPVA 1DSTA 1ORFA 2TRMA 2A31A 3S9CA 3QZQA 1IAUA 1EP5A 3BEUA 4ZXXH 1SGTA 2JH6D 1N6YA 2ZFRH 1UHBA 2IN2A 4BAHB 3TLOA 2VWLA 1A5IA 2V0BA 1T8OA 3ATMA 2C90B 1AFEH 3MU0A 5FBEA 1CT0E 3VGCC 2BX3A 2OD3B 2ZFTA 1TPSA 2BQ6B 2UUYA 1BB0B 1P9UA 1C5SA 1C5ZB 1L4DA 2QF0A 1Y3WA 3BN9A 2ZGJA 4K60A 1W0ZU 3ZZ3A 1D3PB 1PPGE 1GCTC 1GBLA 4WMFA 1DWCH 3HK3B 2VVVA 1Z6JH 4MTBA 5E8EH 3RC6A 5C1XA 3A7WA 1HIAA 3K2UA 3RP2A 1C5UA 4DCDA 1G2LA 3I78A 3T62A 3SGBE 1ARCA 1NY22 1UTQA 1M9UA 1G3DA 1O39A 1O2RA 4FUBA 1PQ8A 2L74A 1V2KT 1TAWA 1NFUA 4FVDA 4KTSA 2HRVA 4HTCH 2A7JA 3RLYH 1BTXA 1JWTA 1QB6A 1O2QA 2BTCE 1J16A 3OEHD 3FO8D 1QBVH 1G37A 2JETC 5GIBA 4ISLA 3URCA 1RFNA 1UVUH 1BBRE 3PROA 1C5WB 5FAHA 1ZYOA 1TALA 1B5GH 3M61U 2ZDKA 4KTUA 1GGDB 1UTKA 3D23A 2EY4C 2JH0D 2P16A 3BTHE 1O3CA 1Y3XA 4M7GA 1W13U 1NRRH 4AZ2B 1TGNA 4A5TS 1TGBA 4TWYA 3OSYA 1DY8A 1F0RA 1TNGA 1O2ZA 2ZPSA 1S85A 1KYNA 3IITA 1FUJA 1YBWA 4U2WA 4MPUA 3R3GB 3GY3A 3RXKA 3TITA 1NC6A 7LPRA 3MU4A 1OWDA 4Z1MD 3BG4B 2BHGA 1D6WA 2OQUA 4IN2A 1FLEE 3BIUH 1GJAB 1C2LA 1GI1A 1GJ9B 4AX9H 5AHGH 1XUJA 2A2XH 5CMXH 4CR9A 5HMAA 3OY5U 1KDQB 4HG6A 1TMUH 2AS9A 2FLBH 1QQUA 1NRNH 5EG4A 4DY7B 2OP9A 1CHGA 1UMAH 3MO6A 2FLRH 3ZZBA 2BY5X 5A0AE 4F55A 3GCTG 4TSFD 1UK4A 2Q6DA 3T29A 1AGJA 1DWEH 1S83A 1NFWA 3F2HA 2G00A 4WVPE 2XC5A 4NIXA 3P6ZB 2UWOA 2ASUB 3A81A 2JETB 4DURA 2ZECA 2FTMA 1MKXH 1D3DB 3RU4T 1AVXA 1C4V2 1PYTD 2A4GA 3PB1E 4CREA 1HAVA 1O5GH 1EP6A 1CA0C 3Q00A 1TNKA 4BOHA 1D3QB 3ZZ9A 4I86A 1F0UA 2HGTH 4B2CA 2ZHDA 2GKVE 2W7UA 4YO9A 1V2RT 3E6PH 1MAXA 1V2MT 2VH0A 3BTKE 1GHVH 3MOCA 1UVTH 4X1QU 3TGKE 4WJG2 4I8GA 3ZZDA 3CS7A 5A2MH 2AIPA 6CHAC 3N7DA 2D2DA 2G8TA 2PKAB 1GVZA 1SGEE 5EQSA 1P2KA 1UVOA 1P2NA 3S9BA 1SB1H 2KCPA 3F68H 4YOJA 1SC8U 6GCHG 3P17H 3FOAA 5HXFA 1O3FA 1XUGA 4XD7D 1FIZA 1LCYA 5JDUB 2VIDA 1ANBA 4WXIA 2KX4A 3M3SA 1ZTLA 3D62A 4X0WU 4CHAC 1COWD 2YMSB 1DLKB 1E35B 5HM9A 1K1OA 1LPKB 2P95A 1A3BH 1NPMA 3FVFB 3TH2H 1GVKB 1P06A 2BM2A 4Y71A 1BRBE 4U30A 4FUDA 1G30B 3MI4A 3R0FA 3OAAD 4D8NA 1VCWA 4Y79A 3SHAH 3Q3KA 1ELGA 3MU5A 3TJOA 4A6LA 1OP0A 2AHME 5DGJA 1ABJH 4ABFA 1SSXA 2OC8A 1MAYA 2K1QA 2QC2A 4CBOA 2A32A 1FY4A 1ESAA 1P8VC 2P93A 4P00A 1D3TB 4ZHAA 3AW1A 2Z94A 2HLDD 3BSQA 1TNHA 1GMHG 3UR9A 3WWFA 3RXTA 5F6MA 1C4Y2 2A2QH 5DN6D 3LGYA 1VJAU 4E05H 4YLUA 1O5AB 4XSKU 5GPIB 1HAIH 5EW2H 4VGCB 5J4SA 1O3LA 1DPOA 2ANMH 1SGQE 4FOUC 1HNEE 3KNXA 1C5YB 3Q76A 1KXBA 1A1RA 3QLPH 1HJ8A 2D26C 3KL6A 5LGOA 2QN5T 1D9IA 3LPRA 1GJ5H 1C5NH 2PSYA 1BMAA 2F9VA 5AVDA 1GBHA 2GZ8A 1ETTH 2A4OA 3ZVCA 2IPQX 3SU5A 3KCGH 3UPEA 1ZR0A 2WPKS 1S6FA 4E7NA 1E0FD 2V6NA 1GMHF 2VGCB 2J34A 1SL3A 1OYQA 5A8YA 4NZLA 4CH2B 9LPRA 6GCHF 1ZLRA 1T8LA 3PMHB 5C94A 3KYGA 3TJNA 5CE1A 3G01A 4INLA 4CRCA 5FPYA 1W12U 3B8JA 2XCNA 1H8IH 9ESTA 3KHVA 2PKSB 3V3MA 3F9FA 4AGKA 1MKXK 5GNDA 3A7YA 4IBLH 2RCEA 2Y82A 3VGCB 4X6OA 3SUGA 1HAPH 1Y3UA 2GCHG 1DWBH 2ZFFH 1BBRK 4K69A 2THFB 1SQTA 1ELTA 2VIVA 3PTBA 1FV9A 5K0HA 1O5BB 3BTWE 3RXGA 1GBBA 2R2WU 2UWLA 1MUEB 2QYIA 2CF9H 4AB8A 1KTTB 3LGVA 2SGAA 2HVXA 2PFEA 5GWZA 2AGEX 3SI4H 4INHA 3M7TA 4LZ1H 2BLQA 4KTCA 2LELA 1U6QA 4RSPA 4O9VA 2CJIA 1VGCC 3D65E 1O3MA 4IGDA 3SJ8A 1HJ9A 1P11E 1OX1A 1QY6A 3V7TA 1GDNA 3ZYDA 1RIWC 1P2IA 1UK3A 2FX6A 2GT8A 3TK9A 4ABJA 2P59A 1E1RD 3SJKA 1SLXB 1AU8A 1A7SA 1NRPH 4DVAU 1GMCF 5EJLA 1BQYA 1LKAA 2P3FH 1K1PA 1MCTA 1BRCE 3GISB 3UY9A 1FX0B 1EZQA 3ZYEA 5IK2D 1ZSKA 2FOCA 1O2JA 1GBAA 2QF5A 4NIWA 4IN1A 3M36A 2FXRA 1UW7A 2NU0E 5HGGA 3W94A 1GVLA 3RMNH 1UVSH 1P01A 1AUJA 2ZGBH 2AMDA 5KEDA 4AC9A 2STBE 1QIXB 3JZ2B 3DD2H 4ZKNU 3NPSA 2R3UA 1T4VH 4AGJA 1WOFA 1DUAA 1HRTH 3UAIC 1LHGH 3A83A 3DCLA 3O8DA 3OY6U 1N1LA 2HVYB 3NKKA 5HYOA 4NFEA 1Y8TA 2XNIA 3SU4A 1P12E 4CRDA 1O3JA 1C1QA 3UB0A 1BMLA 5C2ZA 2WUBA 3GDUA 2M5TA 1QJ7B 1IQMA 1FZZA 2Q1JA 2ANWA 3ZZCA 5C3NA 1YLDA 3A8AA 1F0TA 3RDZA 4U01A 3SN8A 2FYQA 3TVJB 3MH4A 1QFKH 3EAJA 1CGIE 1DM4B 1EJNA 3MU1A 5A0CA 4K3JA 1L1NA 3MHWU 1DANH 3VXFH 4INKA 1MU8B 1N8OB 3ZZ6A 1GHZA 2YNAA 4RKJB 3RM0H 2NWNA 3FAOA 1EX3A 3DA9B 1GI2A 1NU9A 3DFLA 2PKSC 1TIOA 3O8BA 3AW0A 3TJUA 1P3CA 1B0FA 3RXOA
chains in the Genus database with same CATH topology
3M3VA 4GPGA 7GCHG 2J4IA 1VGCB 1LHCH 1EQ9A 2BDHA 1WUNH 1PPFE 3C1KA 2I6SA 2FOFA 2D8WA 1MBMA 1TQ7B 4BNRA 4PROA 3QTOH 2J95A 2ALVA 4MLFB 1O3AA 4DIIH 1IQFA 4CBNA 2BLWA 1CBWC 1CQQA 3WY8A 3GY2A 3RXQA 2P3TB 3RXVA 2YNBA 3UREA 5T6GA 2OTVA 1AUTC 2VVUA 1RTKA 4ABBA 1BTZA 1CHOF 1UTNA 3RXHA 4X8TH 3RU4E 4AORA 4MNYA 4TYDA 2EA3A 1KXCA 4YOGA 3CENA 2J92A 3A88A 2BOKA 1W0YH 2FDAA 2O8LA 2Z3EA 1O5DH 3PO1B 2QXIA 2FI4E 2FO9A 3MNSA 4X2VA 2LNCA 1PJPA 1S82A 3SV7A 4H4FA 2GV7A 2ZWLH 3ZVDA 3S69A 1O37A 1PQ7A 2EI7A 1TGCA 3TJVA 3VEQB 2F9NA 1EKBB 1AZZA 2RA0A 2ZCHP 1BITA 1O35A 1ZZZA 1GI0A 4OS1A 3EE0B 1O2PA 1QL7A 1IQEA 1PPHE 3SOSA 3EGKH 2GMTC 2BDYA 1FAKH 1ZJDA 4XBCA 2BXUH 1HGTH 3ITIA 1AWFH 4NGAH 3E91A 1TOMH 2FPZA 5FX6A 2GD4B 1EXFA 3ZVAA 1T7CA 1O2YA 4X2WA 2VWMA 2OXSA 1GGDC 2FMJA 4I8JA 1SBWA 1VCQA 1DVAH 2BOHB 1LVYA 1YGCH 5FX5A 4ABHA 3RU4D 3U8TH 2RDLA 3A7VA 2ZP0H 5DP7A 2IOTA 2B9LA 4ABAA 4DOQA 3KF2A 1GBFA 1ZOMA 1MD7A 1SR5C 1UO6A 2ZU2A 4I7YH 5E0GA 1DXPA 1RRKA 1THSH 2JH5D 3P8OA 3VPKA 3U1IB 3E0NB 4RKOB 3SBKA 1C5LH 1JOUB 1KXEA 1Z1IA 2ZDVH 1VITG 2F9UA 4KGAA 1DXWA 1TBQH 3SJIA 4Y0YE 1CT4E 2A45B 4JK6A 4UFGH 3N7OA 4X8UH 5IYTA 1O3IA 1V2OT 4JZ1A 1CSOE 2QCYA 3AAVA 1BIOA 2HNTF 3MNXA 1NFXA 3M7QA 1EZXC 1DLEA 2Y81A 4XDEA 2BY6X 5EODA 1LVOA 2QIQA 1GBMA 4XBBA 2FESH 1MCVA 3URDA 4OS5A 1LMWB 1XXDA 2VIWA 5T6DA 2BDIA 1O2OA 3SNDA 2WPHS 2GP9B 3CS0A 4UEHH 3OX7U 5JBAS 1V2WT 3SV9A 3LJOA 4ASHA 3ATIA 1GJ4H 1O5FH 3ZVEA 4DGJA 1SOZA 1C1SA 1S6HA 4IS5A 1MTWA 1SGFA 3K6ZA 1MTNC 2FODA 2R0KA 2G4UA 1AY6H 1HLTH 1ZRBA 4FUJA 4D76A 1GBDA 2FYRA 1PYTC 1P03A 1THRH 3A87A 5FBIA 1P2MA 3SV6A 1F5RA 1Y3YA 2R3YA 1ELBA 1S5SA 5GJ4B 2WYJA 1Y5BT 4ISNA 5JBCS 1H9HE 3ATWA 3TNTA 4IW4E 1GI6A 2ZDLA 1TGSZ 1OP8A 1E36B 3RXCA 1Z8RA 2XTTB 4OS2A 3ODFA 2B0FA 2KAIB 1C5QA 1GMDF 5LH8A 2ZFQH 3SU3A 5JYIA 4DW2U 4A7IB 1QGFA 2J2UA 1BJUA 2QA9E 1GI9B 3MTYA 3T27A 5F03A 1G3CA 1VR1H 4WH6A 2TGAA 5A09A 1TX7A 1O34A 1QQ4A 1TMBH 1HAHH 4K1SA 3NK8A 5GCHG 5SGAE 1O3NA 2RG3A 1J15A 1SPJA 2VVCA 2Q6GA 1GJCB 4ABEA 1O2HA 2B7DH 1YPHE 3GDVA 1YPJH 5TCAA 1HAGE 3EA8A 3NZIA 1F5KU 1HV7A 2SFAA 1GMDG 1LPGB 3LT3A 1XVMA 1KIGH 3JZ1B 1FI8A 1O32A 2W7SA 1TQ0B 1C1NA 2ZPRA 3F9GA 1YLCA 1W2KH 4DG4A 4IC5A 2OINA 4I31A 1GHBG 1W7XH 4I8KA 4OGYA 2Z7FE 3TGIE 1MZAA 3T2NA 1QR3E 4O3UA 3VXEH 1OWHA 1O36A 2ZTZA 1O31A 1P05A 1MU6B 1ELVA 1DDJA 4MQAA 2Z6BD 2EI6A 3QGJA 1EATA 1H1BA 5ESTE 1QB9A 1A3EH 1EB1H 2XWBI 4NSYA 4Q2KA 3NCLA 4J1YA 1V2JT 1V2LT 1C1MA 2UWPA 1IQKA 1UCYK 2ZFSA 4ZUHA 1SGFG 2ZFPH 2GZ9A 2WPIS 4NZQA 2G52A 3NXPA 1UVPA 1S84A 1QL9A 2C3SA 1DUEA 1P10A 2BD9A 5DO4H 1B7XB 5EPNA 5FHTA 4NWKA 1AWHB 4BAKB 3RXAA 1ZHRA 3E8LA 6ESTA 4XOJA 2O9QA 2GVFA 1FQ3A 1TPOA 3BTGE 1IQIA 1C5TA 1P57B 2STAE 3IG6B 1W7GH 2ZQ2A 1PQ5A 2BY8X 3FP6E 3BG4C 2VGCC 1NM6A 1J9CH 2TGPZ 4TPYA 3KQEA 3SNBA 1Y5UT 3QO6A 3AAUA 3MU8A 2GX4A 4I33A 2VWOA 2ZTXA 3T26A 1GCDA 3EDXB 1ABIH 1YCPM 4BXWA 1O2XA 3SNCA 3SGQE 5L2ZH 1G3BA 3RXUA 3ZZ4A 3BTQE 3SUEA 3A7TA 1BOQA 2H5DA 2QAAA 4NA8A 2BX4A 4LZ4B 3BTTE 2DE8A 2QXGA 3A7ZA 2VWNA 2BMGB 1HDTH 3SNAA 1SHHB 4Y8ZA 1SQOA 3RXIA 2AIQA 2W3KA 2G5NA 4YESB 1WQSA 5A0BA 1TE0A 5L2YH 4B1TA 2BD2A 4YZUA 1HAXB 2ZGHA 1BTPA 1O2MA 1Y5AT 3RXDA 3UQOA 3A80A 2G81E 2AMPA 3GCHB 4X6MA 1NN6A 2DE9A 4NFFA 2SNVA 1C2IA 3LC3A 3TK5A 1GG6C 4FVBA 1CT2E 1H8DH 1YPGH 2CHAB 4AYYB 1BBRH 1ZTKA 3MH6A 4WH8A 3KQDA 2VNTA 1RXPA 3Q3YA 1P2QA 1A0HB 3LH3A 1G32B 2HNTC 2O8UA 1UHBB 2VJ1A 1TNJA 1O3BA 4ISHH 4B73A 3ZZ5A 3DUXH 4OGXA 4GVUA 2Y6TA 1FJSA 2HLCA 4XFQA 3U8RH 4UFFH 4ABGA 1V2PT 3LGUA 3T28A 1O2KA 2HWLB 3MWIU 1F7ZA 4NIYA 1L4ZA 3SU6A 3QX5H 2WPMS 1NRSH 3UIRA 2FOAA 2GV6A 1SVPA 1TNLA 4ZROA 2AFQB 1BMMH 1ZPZA 2QXHA 3RXSA 2A7HA 2RA3A 2CGAA 1BA8B 1KXFA 1EPTB 2PTNA 1K1MA 4JYTA 4NG9H 3GY7A 1J17T 4MNXA 1UTPA 3UNRA 3K65B 1SGNE 2CV3A 4F4OC 5F8TA 4JZFH 1DICA 3NWUA 1KSNA 4WMDA 2BZAA 2OUAA 3I77A 1C1VH 2G5VA 2BD8A 2FZZA 3M5OA 4B2BA 2PGBB 1OWIA 1AD8H 2R9PA 1K21H 1K2I1 5EXNA 3U8OH 2SGFE 5C5NA 2QY0B 1P09A 1AE8H 1AIXH 4BXSA 5AFYH 5C1YA 4AB9A 1BHXB 2PTCE 4NA7A 1V2QT 3Q77A 3ZV8A 4MVNA 5C20A 3BTFE 1HPGA 1OKXA 3ODDA 4D7FA 2IJOB 2WINI 1GBCA 1ELEE 4UE7H 1TRNA 4K8BA 3AASA 4CRAA 1ESTA 4Y11E 3KQBA 4Y7BA 2BLOA 3RLWH 1LVMA 2P8OB 3F1SB 3RXFA 2QGRA 3BV9B 2F3CE 1GHAG 1EAUA 1CA8B 1K1IA 1GJ8B 1AE5A 1RTLA 1UCYH 1GBTA 4TY7A 1HJAB 4BANB 4DJZB 1MBQA 3SI3H 1IQGA 5EU8A 2H2ZA 3QN7A 1C5PA 3HGNA 1Y59T 1V2NT 2ZZUH 4ZKSU 1TRYA 1ELFA 2PW8H 3A8DA 1C1PA 1T32A 1FONA 3QZRA 5LPEA 3QTVH 4K8YA 2ODYB 1YM0A 2CMYA 4H6TA 4BTIB 1EAXA 1UTLM 1FN8A 3ENSB 1TX8A 2Y5HA 1NFYA 5JB9S 3A89A 3ZVBA 2Z9JA 3V12A 1G2MA 5CHAB 1VZQH 1AFQB 1PPZA 1L1GA 1GHAF 2W3IA 2ZEBA 4UFEH 1B0EA 3A8BA 3HPTB 5DP5A 4ZAEA 4DIHH 3MH7A 1QJ1B 4JCNA 5DP3A 5DP6A 4D9QA 1TA6A 4D7GA 1PPEE 4D9RA 2C4FH 1OWJA 1BRAA 3QK1A 1G9IE 5EQQA 4Z0KA 1IQNA 1SFIA 4XBDA 4AFUA 1CHOG 3OYPA 4Q7ZA 1ANCA 5DJ7A 2HOBA 5G4BA 1HAVB 1EPTC 1UCYE 2H1UA 1TGTA 4A92A 4JZIA 3H5CB 4HZHA 1DT2A 1YCPK 3F9EA 3RMMH 2H5CA 2NU1E 1ZGVA 3HATH 4Y7AA 3PMJA 3UTUH 4BAQB 2C8ZB 2C8XB 1C1WH 4AN7A 6LPRA 3IWMA 1S81A 4JMYA 5EPYA 4Y6DA 5C1UA 4FUEA 1GBEA 1C2KA 4IMQA 5DK1A 2ZTYA 1GBJA 3P95A 4XE4A 2A0QB 3SHCH 1ELDE 1HYLA 4A1TA 1C2GA 1C9PA 2F9BH 4K1TA 3S0NA 4ESTE 1C1RA 5H4IB 3BTME 2Y80A 1SGYE 4NCYA 1ANEA 4Z6AH 3KGPA 3RXLA 4OS4A 4UD9H 4B76A 4WF8A 5ABWA 3TPIZ 1XVOA 2BVXH 2FEQH 1BMNH 1DITH 1LPZB 2OLGA 5DP9A 3GYLB 1WYKA 5FCRA 1AFQC 1TBZH 1QRWA 2C8WB 3L6PA 2O8TA 1ZHPA 1JBUH 4Q7XA 3QUMP 2BDCA 3SNEA 1P9SA 1GJBB 3BEFB 4U32A 1BTHH 1W3CA 4JZDH 1YPMH 1QBNA 2CN0H 1TX6A 1BCUH 4K1EA 1O38A 1P3EA 2A4RA 1FNIA 2GDEH 3P92A 5GCHF 2FWWA 4WXVA 3GY4A 1AB9C 2OC0A 5DP4A 3LOXA 1LO6A 3PWBA 3GY8A 2XBXA 3F6UH 2OCVB 2ULLA 4AFQA 2C8YB 2PHBA 2AGIX 1EJAA 1CBWB 2F91A 5AF9H 2FM2A 2G51A 2XW9A 1TABE 2GCTC 4KELA 3ZZ7A 3RXJA 2EEKA 1UTOA 1WSSH 3LJJA 1Q2WA 1BUIA 2ZU5A 1IHSH 1SFQB 3VFEA 3SU1A 4FU7A 1FAXA 3MMGA 8KME2 2WPLS 1QA7A 4YM9A 4IC6A 2F83A 3M7UA 2DUCA 5EQRA 1MTSA 1GI8B 2A5KA 4X8VH 2QV1A 2GZ7A 4LOYH 1BT7A 1XMNB 1IHTH 3TK6A 7ESTE 1YPKH 1MZDA 5C67A 5J4QA 4FUHA 1HXEH 3ZVGA 3A82A 1OP2A 1HCGA 5I25A 3UNQA 3OU0A 1CA0B 1YC0A 4WY3A 5DG6A 1AHTH 4MNVA 4BAMB 4FU9A 1TMTH 3U9AH 2JKHA 1BDAA 4GUXA 2HPPH 5EW1H 1WAYB 3NUMA 2ODQA 3SJ9A 3T5FH 4MG3A 1PQAA 4CH8B 1D4PB 3MFJA 8LPRA 2XBVA 1A61H 2FI5E 1L2EA 3SUDA 3GDSA 1DSUA 3M3TA 2AEIH 1T8NA 1F2SE 1C2MA 1QL8A 1W14U 3PMBB 3BEIB 1OYTH 1SQAA 1TRMA 4OS6A 5DP8A 1O5EH 1AO5A 2F9PA 5F8XA 4AG2A 4H42U 1HAZB 5DPAA 5GDSH 2VINA 3BTDE 4UONA 3EQ0H 1EPTA 4FXGH 4ZMAH 3RMLH 4CHAB 1IQLA 4Q7YA 1AKSA 4GCHG 1QRXA 1AN1E 3L3TA 2ZNKH 3M35A 5E0HA 3LH1A 3MH5A 2BQ7B 4CRFA 2XYAA 2ZA5A 4DT7B 4O97A 2D1JA 1TWXB 1LVBA 1O3HA 1Q3XA 2GGVB 4KP0A 5FCKA 2CXVA 4B71A 1Q31A 4QT8C 1GHBF 4A1VA 3S7KB 2BY7X 2W5EA 3OTJE 2PWXA 2FOEA 1O2LA 1WBGB 2Y5GA 3LGWA 4GAWA 2Z9KA 1HJAC 1Y3VA 2AH4X 4HGCA 1RJXB 1IOEA 4WWYA 1ZPBA 2VIOA 1CU1A 1FY5A 3K9XB 4F49A 2H9EH 3HK6B 1QHRB 4ISOA 2ZHEH 1FY8E 1MH0A 1TPPA 2ZPQA 3STJA 5I46H 3BG8A 1XXFA 1OPHB 4ABIA 3RMOH 4VGCC 1SMFE 2OBQA 2NU4E 1ZMNA 2EI8A 5K7RA 1BTUA 2ZQ1A 1HFDA 1GG6B 1A4WH 1ZMLA 3PLKA 1CVWH 1ZTJA 1UTJA 4MDSA 1O2TA 4JYUH 3MNCA 1SGCA 2Y7ZA 2GCHF 4ZKOU 2ILNA 3TGJE 1QRZA 1AKSB 3PYHA 3UNSA 2WV4A 2I6QA 3ELAH 1C1UH 1GBIA 8GCHG 1SI5H 1OOKB 2KAIA 5L30H 1O2NA 2QF3A 2Z3CA 1MQ5A 1EOLA 3H7TA 2AMQA 4FUIA 2SNWA 2UUJB 2BZ6H 3GCHC 2O8WA 1FPCH 5E2OA 1GPZA 4E06H 1T8MA 4ZXYH 1P2OA 4FUGA 3ATKA 1J8AA 2R2MB 2V3OH 1GWAA 3M5MA 3HKJB 4X8SH 3S9AA 2BDGA 3KIDU 2A5AA 3U1JB 1VITF 2OC1A 3PWCA 5DKMA 1NRQH 1HXFH 1YPEH 3RXEA 1KDQA 2OBOA 3U69H 1O3DA 2BVSH 1C5OH 4BTTB 1C5MD 1EJMA 1WTHD 3V0XA 3UQVA 1GBKA 1O2GH 1BHXF 1O3KA 3GY6A 1FY1A 4R8TB 1MTVA 4TY6A 3VB5A 2PUQH 2F9OA 3E3TA 1GJ6A 5ESBA 1DWDH 3UOUA 1IQHA 2PLXA 1W8BH 2FTLE 3LGIA 1HAYB 1O2VA 1JMOH 1F0SA 1C2EA 1DX5M 2HALA 1RTFB 1HUTH 3B9FH 4YTAA 3LKWA 2PSXA 1JXPA 3TU7H 2BB4A 2A5IA 2ZDNA 1P02A 1FY3A 1OXGA 1WU1A 4FUFA 3EA7A 3SGAE 2WV5A 1A5GH 1Z1JA 2QXJA 4UDWH 3E16B 1JIRA 1ZSJA 4LK4A 4X1SU 1UK2A 1PPBH 2HNTE 2UUKB 4K5ZA 3VB7A 4NA9H 3SO3A 4X1NU 1K1JA 2ZDAH 1AMHA 1JRSA 1VJ9U