1FY1A

[r23s,f25e]hbp, a mutant of human heparin binding protein (cap37)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
225
structure length
225
Chain Sequence
IVGGRKARPRQFPFLASIQNQGSHECGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPARIN-BINDING PROTEIN
publication title Two mutants of human heparin binding protein (CAP37): toward the understanding of the nature of lipid A/LPS and BPTI binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Antimicrobial protein
total genus 46
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy1A02
3A7TA 1SLWB 3E0PB 1O2ZA 4MQAA 1O3BA 2IOTA 1GHWH 4MG3A 1MTVA 1K28D 1JBUH 4I8JA 1F92A 2A2XH 4K2YA 4UONA 3OSYA 5EG4A 4ZMAH 3TNSA 2BYAX 4WY3A 1VITG 4AGJA 1O5EH 4BNRA 2ULLA 1TABE 4AB9A 4HZHA 4A1TA 1GBHA 3GICB 3MU0A 3A88A 1D4PB 3ZZBA 1YPGH 1QBOA 2ZHDA 1DS2E 3L3TA 2FOHA 2A45B 4CRBA 1T31A 2SNWA 5K7RA 2BM2A 1QURH 2J9NA 4TPIZ 1LDTT 5F8XA 1AVXA 1BBRH 5DGJA 4ZAEA 1BUIA 1NRRH 1O2IA 1QCPA 1TYNA 3A83A 3FP8E 3Q3YA 2ZZUH 1EZSC 3EDXB 3VB7A 1C9PA 4GVUA 1ZPZA 2XW9A 1O3DA 1C1RA 1ZJKA 5EW1H 1BT7A 1MD8A 2FZZA 2BLVA 4IS5A 3BEFB 3BTDE 2P94A 2GMTC 4AGKA 4Z0KA 1VCPA 2P3TB 3HGNA 1FUJA 2BX4A 1XXDA 4D9QA 2BD4A 1QRZA 4GCHF 3RC4A 1Y8TA 1YCPH 2QXIA 1W0ZU 2Y80A 1LO6A 4O3TA 1S84A 1GJCB 1WQSA 2AMDA 1IQIA 2ZPQA 1GHXH 2H5CA 4I8KA 1MUEB 1LPGB 2Z6BD 1O2UA 4BAKB 2D2DA 3RXTA 1VITF 4DY7B 3ZZ8A 1C4Y2 1GJDB 2ZEBA 4AFQA 2UWLA 2ZI2H 5C2ZA 3RXHA 1G30B 1DM4B 2PUQH 5JB8S 1C5YB 1N1LA 1ZSJA 2W3IA 4UD9H 1QA7A 2BD7A 1V2KT 2A1DB 1KY9A 1CGHA 1OSSA 4JZDH 3GCNA 2LPRA 1QL9A 2NU4E 2HWLB 4BXSA 3GY2A 4KTSA 5EPNA 3PMJA 1UTMA 4H6TA 5FX5A 4TY7A 1W7XH 1GI6A 5JYIA 1TBQH 3UOUA 2FLRH 3EYDA 2XCNA 1AZZA 2IPHA 2HNTC 3RMOH 2ZNKH 1E0FD 4BOHA 1J16A 2QA9E 2ZC9H 3E90B 4J2YB 3QO6A 1C1QA 4Y71A 5A09A 1P8VC 3ATKA 5AHGH 1BZXE 1GI4A 1SGYE 1YP9A 1BHXB 4JYTA 5FCRA 5HM9A 1Q3XA 4FU9A 1FPCH 4GHQA 1LHFH 4B2AA 1D9IA 2G55A 3BIUH 1Z8JB 3RU4E 1RIWB 3SI3H 1O3KA 4CR9A 1O3MA 4KTCA 2XC4A 3GDUA 1E38B 1O3GA 2ZDAH 1KDQA 3N7OA 4ZHMU 1KXCA 1RS0A 1GG6B 3URDA 3A7WA 2RA0A 4ABJA 4OS5A 2ANKH 1C1UH 1RIWC 3M7QA 1HRTH 1NROH 3QWCH 3IITA 1B0FA 2NU0E 2B7DH 1CA0B 1A5IA 1YPJH 3FZZA 1QB1A 1GG6C 3A85A 2ZKSA 4YT7H 2FX4A 2FYRA 1KTSB 1ZMJA 5HYOA 2VIWA 1V2VT 1SLVB 5C1YA 3TJNA 2CF9H 1SFIA 3SV9A 3CP7A 1K9OE 4K1SA 1Y3WA 4B1TA 4R8TB 1G9IE 1CA0C 2OQUA 3P92A 5F8TA 4MNVA 1X7AC 1ZPBA 2B5TB 3NCLA 4F4OC 1ELVA 1EAXA 3GYLB 7GCHF 3RU4T 1ANCA 4MPVA 3T28A 4AFUA 3MI4A 4RKJB 1KLIH 1NTPA 3Q3XA 5E2PA 2GZ9A 1AWHB 2A7JA 3KIDU 1G3CA 2WPKS 4BAQB 1CE5A 4BANB 1MCTA 2A4OA 3DA9B 1O37A 4WH8A 1OP0A 3KN2A 1LKAA 3TJOA 3KF2A 1OWIA 3SUGA 4DJZB 1SGRE 3UUZA 4FUIA 3DD2H 1SLXB 4K1TA 1HB0B 4OS4A 3UR6A 2BTCE 1NFWA 1WOFA 1GCTC 1EAWA 1MKWK 3F1SB 1AUTC 1GHBF 3E8LA 5AVDA 2Y5GA 1RFNA 2ALPA 1OYTH 1TQ0B 2A5AA 1BRAA 1TGNA 3H7TA 4B75A 1NN6A 1EZXC 2OTVA 3QZQA 5TCCA 1MU8B 2CV3A 2ZP0H 1FN8A 1TX6A 2BDYA 3ZZ5A 1P12E 5E2OA 3HPTB 2ZFFH 1EZQA 1HAOH 1V3XA 4ISHH 4ZKRU 3ENSB 3S0NA 3IWMA 5FX6A 1XM1A 1UTQA 1HIAA 1DUEA 2PUXB 1MZDA 1SVPA 4K5ZA 2CN0H 2FS8A 1QR3E 3K65B 3FANA 4Z6AH 3MOCA 1V2OT 3UNSA 2BOKA 1Z8RA 4MNYA 4I33A 1DLKB 2BXTH 1P3EA 1VCQA 3SV6A 1QNJA 2PLXA 4B2CA 3U69H 1P57B 2VWNA 1RJXB 2ZGJA 3MU8A 3RMLH 4X8UH 4ABAA 1ANEA 1V2MT 2ILNA 2FOCA 5FPYA 1AUJA 2SGAA 3NKKA 2RCEA 1ELFA 2R2WU 3TH2H 1ETSH 1F0RA 4D76A 1O2KA 3T2NA 4CH2B 3R3GB 2VIPA 1EX3A 3E16B 1OWDA 1TIOA 1GBBA 2ODPA 4GPGA 4B74A 2A4RA 3PROA 1HFDA 2UUJB 5LPFA 2P95A 4KGAA 1KYNA 3ZVFA 2AMPA 1A61H 3SN8A 1C1TA 5IDKA 1SGFA 4O3UA 2GT8A 2SGQE 1OP2A 2ZFTA 5E0JA 1MTNB 1O38A 3ODFA 3UOPA 1GMHG 1LPZB 1O31A 1P3CA 3MFJA 1PQAA 2FO9A 2HALA 2PWXA 1SOTA 3GCOA 1FMGA 5A0AE 2BY9X 1OPHB 3V7TA 1AU8A 3SNCA 4PROA 4NWLA 3GCTG 1MTNC 1BRUP 3KNXA 5GXPA 1CT0E 3LONA 4YESB 3QLPH 1GL0E 4NIWA 1PPEE 4U30A 2VB0A 1GBKA 2P3FH 1GMCF 1KLTA 3SU0A 2FS9A 4XFQA 1F5KU 1O35A 1PPZA 1NU9A 5I46H 2WYJA 3O8RA 1QQUA 2HNTF 1Y3UA 3SU6A 7ESTE 1GHAG 5EXLA 2WUBA 4WXIA 1HJ9A 4ZUHA 3A8AA 2OQ5A 1BDAA 1TOMH 1P2QA 4Q80A 2BXUH 1MBMA 2C8YB 1CT4E 3RXFA 4ABFA 3S9CA 1CHOF 2LNCA 4FUFA 1GI1A 3VB4A 4NA8A 3A84A 1KDQB 1SOZA 1MAYA 1D6RA 3AAUA 1GWAA 1TRYA 3UREA 5DG6A 5FBEA 1B0EA 1FN6A 5K0HA 5EOKA 1YGCH 1SLUB 4AFSA 4DOQA 1GHZA 5F03A 2Y7XA 2YNAA 1O2VA 2AFQB 3GCTF 3OU0A 3LC3A 2XCFA 1D6WA 2ZDLA 1VGCB 4B76A 1ELEE 5DP7A 5FBIA 1CO7E 4BTTB 1NC6A 1HAPH 3M37A 1C5ZB 2XWAA 1LVYA 5JB9S 1H8DH 3Q76A 4WF8A 1WTHD 4A6LA 4DURA 3M7UA 2C93B 4Y79A 2ZHQH 1C5NH 1F0UA 2BDCA 1C2EA 5GCHF 4XBCA 3ATLA 4X0WU 2QXGA 1GJ8B 1SGQE 5B6OA 4MLFB 1UO6A 1G3BA 3RXDA 2ANWA 1ZJDA 2Z9GA 2Z9JA 1YLCA 4X6OA 1KSNA 3SUEA 3KQEA 2HOBA 3MNBA 1QIXB 4ABGA 3GCHB 4IN2A 3FFGA 2VWLA 2Y81A 2UUFB 1K1PA 2NWNA 3LDXH 2ZG0H 2ESTE 5EU8A 3GY4A 3SBKA 2FXRA 1Z8IB 2BDGA 2OC8A 1OYQA 2H5DA 3BEIB 2XBXA 2ZHFH 2C3SA 2ZGCA 1QB9A 4R0IA 1O3OA 1YPEH 1HXFH 3QDZB 1J17T 1YKTA 2RA3A 4NIYA 1O2OA 1ELAA 3TIUA 5HGGA 1DUAA 2WUCA 1KTTB 1ESBA 2VGCB 2A0QB 3EA7A 1TBZH 1P01A 8GCHG 3QN7A 3V3MA 2UUKB 3LGUA 1S81A 4HGCA 1E35B 4F49A 1OWJA 1HIAB 1YYY1 1ELGA 2I6SA 4UFGH 1TAWA 3A8DA 3JZ2B 2VGCC 4YT6H 2F9UA 3RXEA 4ZKNU 5A0CA 1SGNE 2G8TA 1A0LA 2H2ZA 3FAOA 3ODDA 2DUCA 3MU1A 3SV8A 1ID5H 2Y5FA 1TLDA 1TRNA 1BTUA 4THNH 3P8NA 3STIA 3ITIA 1EKBB 1O2SA 5FAHA 2WPLS 2EEKA 2GCTB 1GBFA 1D3TB 1QJ6B 1WUNH 1TRMA 1IQHA 2QCYA 1S83A 3MNXA 1J8AA 1SHHB 1FY3A 1GCDA 3R0FA 3TK6A 3M3VA 4DIHH 1O30A 3CS0A 3TH4H 2GCTC 2ZCKP 3MMGA 3PB1E 2Y82A 1AE5A 1AFQB 2A2QH 8GCHF 4IBLH 2SFAA 3JZ1B 4YTAA 2ZHEH 3PV4A 1J14A 1C5LH 3I77A 2R2MB 1GI5A 3T27A 1O33A 3A8CA 1FDPA 4TPYA 1AFQC 3AASA 1XVMA 2BHGA 2W5EA 1C2FA 3IG6B 5C1XA 3MO3A 3MO9A 2OP9A 1G3DA 1DXPA 1O2XA 1DX5M 2XNIA 5BRRE 1AMHA 2UWPA 3RXIA 1UTOA 3KGPA 1C5TA 4D9RA 3U8OH 1L4DA 1Q31A 1AZ8A 3K9XB 3MH5A 4A92A 1MZAA 1GJAB 1XX9A 3F6UH 2VINA 1Y5UT 1YPLH 1O32A 4ISLA 1TE0A 1E37B 1QFKH 3M7TA 3PM3A 1GBCA 1C1OA 3PTNA 1TGBA 3M5MA 1HJAB 1K21H 1MU6B 2PGBB 4OGXA 5AFYH 1F2SE 2PTCE 1IQLA 2PGQB 1FY4A 1A7SA 4FUBA 3LH3A 5FPTA 1TPAE 2CMYA 1XUGA 5C3NA 3OTJE 3LKWA 1HJAC 1MTUA 5EQSA 2J4IA 2ZU2A 4Y10E 3DFJA 1XVOA 1V2UT 4XSKU 4X1PU 2ZU1A 1ZRKA 2GMTB 3GYMA 4U2WA 3EA9A 4CH8B 1AD8H 1BTWA 3BEUA 2A5IA 3PWBA 4DW2U 2GGVB 1CHGA 1ZLRA 3ZVCA 3SJ8A 2QN5T 4AORA 1ZMNA 3RXVA 1IQFA 1S6HA 2FDAA 3S9AA 3PYHA 2PW8H 5DP3A 4IC5A 1A5GH 3VXFH 1HCGA 1JIMA 4DGJA 3S7HB 2BLWA 4I8HA 1SGIB 2SGEE 2Z7FE 3K2UA 1C4V2 2TGDA 1O2MA 1O3PB 1UVTH 2HLCA 4DCDA 1HJ8A 2GCHG 2H9TH 1UCYE 3SHAH 2BLOA 5T6GA 3CENA 4DVAU 5FCKA 3RMMH 3UWIA 2C4FH 1EZUC 1GI0A 3LIWA 1PFXC 1FY8E 5DO4H 1NS3A 1GJ5H 2OLGA 1DVAH 3SQHE 3ZVDA 5ETXA 4H6SB 3MH6A 1RRKA 2R3YA 2BDBA 1XKAC 3TJVA 1YC0A 1JXPA 2BVSH 3VEQB 1KIGH 3E91A 4JK5A 3BTTE 1V2PT 4NG9H 2QF3A 2J34A 1C5UA 1THSH 2CXVA 3L33A 1XUJA 3LGTA 1O3FA 2P93A 5HM2A 1EJAA 2TIOA 1BTYA 1JWTA 3QZRA 1GBIA 2H9EH 1V2WT 1QGFA 2V6NA 3Q77A 2ZIQH 1LQEA 2ZFSA 1UTJA 4CRFA 4ZKOU 3ZZ9A 2BLQA 1GDNA 1W8BH 1JOUB 1TA6A 2AGGX 3C27B 5GIBA 1HNEE 1MBQA 1FV9A 3M5OA 4X1RU 2DE9A 2H1UA 1ETTH 4ZKSU 4WJG2 4FUHA 1HAZB 1K1JA 1UJ1A 1G37A 1QA0A 1KXFA 1GBLA 1O5GH 2ZDKA 4ZHLU 1C2GA 4YLUA 1ORFA 2WV5A 1ANBA 3SOSA 4ABHA 1CGJE 3UNQA 1GI3A 4FU8A 1AE8H 3ZYEA 1BMAA 2GDEH 2ANYA 4CRAA 4X8VH 3RXGA 2ALVA 4HI3A 2VH6A 4AB8A 1SGFG 1UTKA 1J9CH 2ZQ1A 4LZ4B 1NFYA 4JZEH 3UY9A 3V0XA 2TBSA 1MH0A 1EOJA 2OC7A 1K1LA 1Z6EA 4VGCB 2ZFPH 1F0SA 1GJ9B 3MU5A 1AY6H 2GD4B 2UWOA 1D3PB 1K22H 1XUKA 1SQAA 1RTFB 4A5TS 4NA7A 1Y3VA 3K6ZA 1W2KH 2ZO3H 1E34B 3RU4D 3A80A 2ZU4A 3SI4H 1FY5A 2G4UA 5JBAS 1RXPA 1P10A 2JKHA 3LT3A 1V2RT 2ZTYA 1K1IA 1AFEH 1GCTB 1LHGH 4K8YA 4VGCC 1GMDG 1TGCA 1HAGE 1G3EA 2OC1A 5HMAA 4AG1A 1SBWA 1W0YH 2FOFA 4X6MA 4ZXXH 1GJ6A 1WBGB 1IQEA 2ODQA 4AG2A 4O97A 4ABEA 3FP7E 1A0JA 1V2JT 4RKOB 2FI3E 9ESTA 1D3DB 1WCZA 1QL7A 3P70B 3M5LA 4MNWA 1ARCA 1GJ4H 1AKSA 5EQRA 3P95A 1OWHA 1PJPA 1V2TT 2A32A 3PMHB 2J95A 2HPPH 3SZNA 2Y7ZA 3HGPA 4GLYA 3MNCA 1C5WB 5C20A 1UCYH 1MKXH 1QQ4A 1YPKH 3H5CB 5TJXA 2BB4A 1LCYA 1HAYB 3SJOA 3GDVA 4AZ2B 1TMUH 2O8TA 4WH6A 4X8TH 3PMBB 1PPBH 1SHYA 4H4FA 2PTNA 1O3HA 2QC2A 1V6DA 1ZMLA 3HK6B 2ZWLH 1SGPE 1P2JA 2F9VA 3EAJA 1OXGA 3O8CA 3F9HA 4INLA 5JPMH 3SUDA 1HAIH 5GWZA 1YF4A 5FXLA 4AX9H 1TNGA 1J15A 1OWEA 1W13U 4NSVA 1GHYH 5T3HA 3RXLA 3A89A 1OOKB 1SQTA 1Z8GA 1TPSA 1AWFH 4X6PA 5FHTA 1L1GA 2EI7A 2FMJA 1B5GH 1BJVA 3DUXH 4CHAB 3A7YA 1AGJA 1T8OA 1HAXB 3P8GA 1C2HA 4GHTA 4FUEA 1ZSLA 3A87A 6GCHG 2C8ZB 5GDSH 3SU2A 1OX1A 1VCWA 1P2IA 4FVBA 1ZPCA 4DG4A 4LOYH 1ZHRA 4ABBA 2F9PA 4CHAC 1JRSA 5C5NA 3D49H 2BQ7B 1EB2A 4JYVH 1P2OA 4O9VA 3BN9A 1AHTH 2J2UA 1O3EA 2FI4E 3FVFB 3UPEA 1QHRB 3A7ZA 5LGOA 1HDTH 1QTFA 1C9TA 1GJ7B 4MPXA 3GDSA 1BBRK 1O3NA 1JIRA 1QB6A 4FUDA 2P3UB 1GHVH 2PV9B 5L6NH 2O9QA 1DWDH 1H9HE 5IYTA 2Z3EA 3B8JA 2OXSA 6ESTA 1L4ZA 2R9PA 2FWWA 3SJ9A 1XUFA 2BQ6B 4I8LA 2WPJS 1AVGH 3RC5A 2B0FA 4XOJA 1DOJA 1SGEE 1FLEE 1YCPK 1YCPM 2FYQA 1O2PA 3ESTA 1AIXH 1O3JA 2B9LA 1EOLA 1TNHA 1P03A 3I29A 1CGIE 2BD8A 1B7XB 1ELTA 1LKBA 3F68H 4JZIA 2V3OH 4X8SH 3BTHE 1BTPA 1O3CA 2A4GA 1IAUA 5E0GA 1GL1A 2WPHS 5PTPA 3H7OA 1O2NA 1Z1JA 3OY6U 1MD7A 1ELDE 3P8FA 1UK4A 3RLWH 1BTZA 1P9SA 1VJAU 5TCAA 1A3EH 1GMHF 3RXCA 4NIVA 3U9AH 1M9UA 3M5NA 1HYLA 1PQ8A 3VB5A 2AH4X 1BHXF 4LXBH 3GY5A 2GTBA 1BQYA 1GVZA 1TBRH 1C2MA 2D26C 2BD3A 1UMAH 3STJA 1PQ7A 2G4TA 2PSYA 2WINI 2VJ1A 4K8BA 2V0BA 2ZFRH 1DSUA 3BIVH 3SUFA 1EUFA 4X1QU 2B8OH 3K6YA 4WWYA 1WQVH 1P09A 5EODA 3TPIZ 3UIRA 1FPHH 1T8NA 3SNBA 3TU7H 4TWYA 1PYTC 2ZGBH 4ASHA 4YOJA 1PQ5A 1GHAF 1SB1H 2ZDNA 2V35A 2G81E 2Z9IA 1S85A 1S0RA 3A82A 2P16A 3GY8A 4MTBA 2I6QA 2XTTB 3D23A 1T8LA 4U01A 3O8BA 2A4QA 7KMEH 4XBBA 3MU4A 2G51A 3ZV8A 4FUGA 5L2ZH 1F5LA 4D7GA 3ZVEA 2ZU5A 2O8LA 2W26A 3BTGE 4FUCA 3RMNH 3W95A 5A2MH 1TB6H 3G01A 2QV1A 4JYUH 1EPTA 4NZQA 4HFPB 2M5TA 1TNJA 2ZDMA 2UUYA 2PR3A 4FU7A 1S5SA 3OY5U 3DFLA 1O2JA 1SC8U 1AKSB 3KHVA 1SGCA 3VPKA 1DWBH 1GBMA 5G4BA 5DPAA 3T26A 1FXYA 1SGDE 1ZYOA 2WPIS 2VIVA 3KQCA 3LU9B 4CBOA 1ESAA 3AAVA 4TY6A 1T4VH 5LPRA 1FIWA 1MAXA 1INCA 3U1IB 2TRMA 2STAE 1THPB 1BA8B 3BTKE 3LOXA 2G00A 2FOBA 1TOCB 4JMYA 4B73A 4MPWA 1Q2WA 3HK3B 3T62A 3EE0B 1UTNA 2D1JA 4FXGH 3C1KA 3BTWE 3VXEH 2GVFA 2A7CA 3BTME 4X6NA 3U1JB 1TMBH 3SORA 2FPZA 1BTHH 1LVOA 4X1NU 2IN2A 1TGTA 4E05H 4NFEA 1SI5H 1FNIA 2FTLE 1S0QA 2GZ8A 4MVNA 2XC0A 4CBNA 4E7NA 1KXBA 1D3QB 3KL6A 4CRDA 5E0HA 1NFUA 5DP8A 1W11U 2ANMH 3QX5H 1GBDA 1DITH 1GI7B 1NRQH 3S69A 1ZTKA 2AMQA 1UCYK 4OS1A 5CMXH 1C5QA 4FVDA 4YM9A 1FJSA 1RTKA 5EPYA 2VVUA 1C4U2 1JRTA 4TYDA 2W7UA 2AYWA 4ZROA 1ZSKA 1C2IA 1O2LA 1ZHMA 1MKWH 5I25A 4DT7B 1IQGA 1OWKA 4X2WA 1O2TA 5LPEA 1N6YA 3E1XB 3BF6H 1HV7A 1IQKA 3KEEA 1WV7H 4AYVB 1O5CB 5LH8A 2STBE 4Q7YA 1P0SH 5ESBA 1WTGH 3L6PA 2SGPE 3GY3A 1LHEH 2VIDA 5JBCS 3UFAA 1P2NA 1C2LA 1PPHE 3OYPA 1FZZA 1GBAA 5EXMA 4RSPA 2IJOB 1IQJA 1DDJA 3M3SA 1FONA 2XBYA 4WMEA 9LPRA 2FOAA 1N8OC 3VB6A 3RXSA 4MNXA 4IGDA 2SGDE 2ZDVH 3UR9A 2JH5D 1XUIA 1P06A 2THFB 3SHCH 4CRGA 2VVVA 1AI8H 5DK1A 3SGAE 2QGRA 2JETB 4JZ1A 3RXPA 4NA9H 1F0TA 1L1JA 3ZZCA 1ABJH 8ESTE 3DHKH 4GCHG 1O5AB 1XMNB 4AOQA 2NU2E 3TK5A 2TGAA 5C67A 2BVXH 4IMZA 1C1SA 1GVKB 2JH0D 2W3KA 3RXOA 2JETC 3V13A 3VGCB 1TMTH 3RM0H 1Y5AT 2G52A 2ZTZA 3HKJB 1PYTD 2FTMA 3PO1B 1BJUA 4Y0ZE 1EP5A 2G5VA 3MWIU 4Q2KA 2TPIZ 4INKA 1NZQH 3VGCC 1BOQA 1F5RA 4SGBE 1C5VA 2F91A 1GJBB 1BMNH 1BIOA 4ISIH 1TX8A 3KQBA 5A0BA 1CSOE 5J4SA 1BCUH 1IHTH 3PO1C 2EC9H 5EGMA 2FOGA 1TALA 3RXRA 3QTOH 1S82A 4NGAH 3MO6A 1GDQA 2BDHA 2VVCA 1UVOA 1XKBC 3ATMA 1W10U 2PKAA 2R0KA 1TNKA 2A5KA 3SV7A 2Q6FA 1N6XA 4X2XA 1O34A 2ZU3A 2P8OB 5EW2H 1Y3XA 3RXKA 7LPRA 1NU7B 2C8WB 4ZHAA 4E7RG 4D8NA 3SV2H 4IW4E 1EASA 3QTVH 2PKSB 1KXAA 4I7YH 1O5FH 2P8OC 1CVWH 5JDUB 3LGVA 2ZA5A 5DP6A 5C5OA 1SSXA 1YPHE 5H4IB 1EPTB 4UEHH 5DKMA 3E6PH 2BD9A 4YO9A 3S9BA 4CREA 1P05A 2Z94A 3UQOA 1FIZA 1THRH 3D62A 3EGKH 2PKSC 3BV9B 1LQDB 2OC0A 1C5MD 3SW2B 1CU1A 2QXJA 3Q00A 3B9FH 1ZGIA 1RD3B 1PPCE 3T5FH 2EI8A 1EPTC 1EP6A 2BDAA 2GCHF 1V2ST 1SL3A 4HTCH 1HUTH 1HLTH 4I8GA 1DWCH 1BRCE 8LPRA 3TITA 2OINA 1C2KA 1WAYB 4I32A 1AO5A 1C1NA 2ZF0H 2ZGXH 3NWUA 3PWCA 4BTIB 3T25A 1WSSH 1P2MA 2KAIA 3RXJA 2BD2A 1LVMA 3ZZAA 2RG3A 2FLBH 4XBDA 4WMFA 3LJJA 4X1SU 7GCHG 2QYIA 2PHBA 2BDIA 2YNBA 1U6QA 2WYGA 4K1EA 1FAXA 2EI6A 3P6ZB 1FI8A 2ODYB 4U32A 5F6MA 2BVRH 5GJ4B 1DPOA 1C5OH 4MDSA 1GPZA 1UK2A 1C5XB 3A86A 3RXMA 4LK4A 1Y59T 4SGAE 1VITH 1S6FA 1YPMH 2O8MA 3SU5A 4QT8C 2J92A 2GZ7A 1NRNH 2BOHB 3ZVBA 2EA3A 1GBJA 2FI5E 3ZZDA 4Y6DA 3MNSA 2FESH 4MPUA 5CE1A 3ATWA 1YM0A 4GAWA 1T32A 1H9LB 1GHBG 2WV4A 6CHAB 2ZTXA 3ZZ6A 1WU1A 2XYAA 3ZVAA 2OD3B 3GY6A 1SFQB 2AEIH 1UHBA 5C1UA 3SJKA 1A5HA 3ATIA 2WPMS 6CHAC 1O2QA 2HRVA 1C1MA 3VFEA 5A8ZA 1TNLA 2FOEA 1K1NA 2PFEA 1DXWA 2GV6A 1CQQA 1LMWB 2QIQA 1ZHPA 3NXPA 4KP0A 3A8BA 2R3UA 1LHDH 2ZPSA 3MH7A 1P04A 4ZXYH 4Y8YA 3LH1A 1Y5BT 1L0ZA 1O2HA 1C5RA 3EA8A 3SU4A 1W3CA 2TGPZ 1P2KA 2Z3DA 2VNTA 4GUXA 4AFZA 3AW0A 3RXAA 1HAVA 1BITA 1RTLA 2HVXA 2VIOA 1GI9B 3SO3A 2ZQ2A 1DE7H 1GI8B 1DLEA 2V3HH 3A7VA 3LGWA 3RDZA 1EAUA 1JMOH 2NU3E 1GMDF 1OP8A 1DANH 2AGEX 2Q6DA 3SNAA 1ELCA 3A7XA 2ZECA 2NU1E 5L2YH 4WVPE 1W7GH 4NZLA 1C2JA 4XDEA 2CF8H 1SR5C 3BG8A 2VU8E 4NCYA 4ISOA 2XBVA 2QXHA 2BMGB 4GSOA 4OS6A 4Y0YE 1RGQA 1ARBA 2F83A 3RP2A 8KME2 2FOMB 1O39A 4OS2A 1QY6A 4WXVA 2QY0B 2F9NA 4BAHB 4OS7A 1O5DH 2HNTE 2OUAA 1W12U 5AF9H 1BMLA 1HGTH 4Y11E 5T6DA 1O2YA 1UTPA 1AQ7A 3LPRA 4YOIA 1K1OA 3VB3A 2SNVA 5T6FA 1L1NA 3UTUH 4K3JA 4B71A 1A3BH 1ZOMA 1QRWA 2GV7A 3NUMA 2QAAA 4A1VA 2PKAB 2Z3CA 1SMFE 1AVWA 1PPFE 1GMCG 2XBWA 1ZZZA 1KLJH 1TA2A 2OCVB 4I31A 2XWBI 3GISB 3RXQA 4O03A 2BZ6H 1GVLA 1HPGA 3SGBE 4IMQA 4K60A 3ZYDA 5F8ZA 1E36B 1UK3A 1TX7A 4INHA 2YOLA 1W14U 1O3IA 2C8XB 3CS7A 4K69A 2GP9B 1XUHA 3ZVGA 1BB0B 3QK1A 1BRBE 1XXFA 1SG8B 2D8WA 2PSXA 1O3AA 1CHOG 2GKVE 5L30H 6GCHF 1TONA 1HBTH 2K1QA 3RC6A 1TQ7B 2W7SA 1YLDA 3QGJA 4E06H 4IN1A 1O5BB 1A2CH 1DWEH 2HGTH 3ZV9A 1GI2A 2ZCHP 1C2DA 5ABWA 5JBTA 1NY22 1T8MA 1VJ9U 5A8YA 1NESE 2BZAA 5JBBS 1MTSA 3M61U 2FM2A 3RUOA 3UWJH 4X2YA 1TPPA 3T29A 2VWMA 5DP5A 3SGQE 2VWOA 1IQMA 2AIPA 3P8OA 4DIIH 2Q1JA 1BMMH 3GY7A 1KXEA 4NFFA 4NSYA 2KAIB 4JCNA 4XE4A 1Z1IA 2A7HA 1H9IE 1TNIA 3ZZ7A 3TGKE 1CT2E 1LHCH 1NRSH 5GCHG 1P11E 1ACBE 3BSQA 2BY7X 1K2I1 1Z7KA 3UNRA 1DY9A 1NM6A 1BTXA 2ZPRA 4UFFH 1P02A 1MCVA 2ZGHA 6LPRA 3TGJE 2BY6X 3P17H 2GT7A 1V2QT 1ZTLA 3QUMP 1L2EA 1ABIH 1AB9B 4AYYB 1KXDA 1QJ7B 2FEQH 1DT2A 4YZUA 4KTUA 1IOEA 4ISNA 1ZR0A 1UTLM 3OX7U 4UFEH 4Y7AA 5FPSA 4AN7A 2BD5A 4JZFH 2Q6GA 3TNTA 1G32B 1A46H 1ETRH 4A7IB 1AB9C 1C1VH 1SPJA 1ESTA 1NFXA 2FODA 2Z9KA 2GX4A 3NZIA 3SU1A 4YLQH 1MQ5A 1LVBA 1UHBB 1H4WA 4ZH8A 1K1MA 4LZ1H 2F9OA 1TGSZ 2J94A 2VIQA 1ANDA 3PLBA 5DP9A 1VGCC 2TGTA 5EXNA 4Q7ZA 3M36A 1YBWA 2GDDA 1TWXB 3SNEA 2RDLA 1V2LT 1VR1H 4RN6A 1Z6JH 1NO9H 3LC5A 4A1XA 2QF0A 3F9GA 1EJMA 1G2MA 2FIRH 4KELA 5HXFA 3AW1A 5ESTE 2SGFE 5CHAB 5EQQA 1EQ9A 3FZDA 3TGIE 5BPEA 3Q3KA 3U8RH 2ZCLP 1TPOA 3ZZ4A 4TWWA 4ABDA 1GBTA 2P59A 4FUJA 4Y8XA 4KKDA 4D7FA 2HPQH 1G2LA 1ZTJA 1BBRE 1EXFA 3RXUA 2O8UA 2BY5X 1UVUH 3MTYA 1NT1A 5CHAC 4BTUB 4X2VA 1IQNA 1DICA 1HAVB 3RXBA 2G5NA 5AFZH 4ESTE 3B23B 1WYKA 3GCHC 4JK6A 4OGYA 4ABIA 1DSTA 1QL8A 3URCA 3D65E 2CJIA 3F9EA 4Y76A 2F3CE 3TVJB 1SGTA 1H8IH 1IHSH 2F9BH 2XRCA 3TH3H 1O36A 1ELBA 3KCGH 2A31A 3BG4B 1Y3YA 3DT0H 4BXWA 4B2BA 1GBEA 5GPIB 4BAOB 3BTFE 1A1RA 1OS8A 3V12A 3WY8A 3M35A 1MTWA 1G36A 1CA8B 1C1WH 1O2WA 1UVSH 5DP4A 1EAIA 3RLYH 1FY1A 4NWKA 3I78A 2Y6TA 1MQ6A 2Y5HA 3SJIA 3U98H 4J1YA 3U8TH 3BG4C 2XC5A 3PLPA 2VH0A 3O8DA 1O3LA 1ZGVA 1OKXA 1P9UA 3A81A 1CBWB 2AS9A 2Z9LA 1MKXK 2BQWB 3MH4A 2O8WA 1YPHC 3LGYA 3MHWU 4UFDH 3UQVA 2FX6A 2FP7B 1C5SA 1HAHH 2H9HA 3FP6E 3BTQE 2H6MA 1QJ1B 5DJ7A 1QBNA 1A0HB 1F7ZA 2DE8A 2C90B 1EB1H 3MYWA 3PTBA 4UE7H 1H1BA 1CBWC 2JH6D 3F9FA 3M3TA 1O2RA 1UVPA 2AGIX 3AVZA 3EQ0H 4CR5A 1DY8A 1DFPA 3RM2H 1QRXA 4Y8ZA 1FQ3A 1LPKB 4NIXA 3ZZ3A 3PMAB 1LTOA 2R0LA 2OBQA 4Y7BA 4WMDA 4IC6A 3ELAH 1AN1E 1T7CA 1GGDB 1PPGE 4UDWH 1VZQH 3QGNB 1N8OB 1C5PA 3TLOA 3NK8A 4M7GA 1QBVH 2ZHWH 2ASUB 1EJNA 2ZFQH 3TJUA 3SU3A 2OBOA 2CHAB 3NPSA 5A8XA 2BY8X 2XXLA 3LJOA 1GGDC 1V2NT 3HKIB 2AERH 3BTEE 3E3TA 3HATH 1Z71A 3E0NB 1T4UH 5J4QA 5E8EH 1FAKH 1O0DH 1O2GH 3W94A 3S7KB 4CRCA 3GOVB 5SGAE 1TFXA 4H42U 2CHAC 2CGAA 1HXEH 3PLKA 1A4WH 3TK9A 4YOGA 1GDUA 4BAMB 3LGIA 1NRPH 1EATA 2BX3A 1NPMA 1C1PA 4Q7XA 1MMJN 3SNDA 2AIQA 2J38A 3SQEE 3KQDA 1SQOA 1ZRBA
chains in the Genus database with same CATH superfamily
3A7TA 1SLWB 3E0PB 1O2ZA 4MQAA 1O3BA 2IOTA 1GHWH 4MG3A 1MTVA 1K28D 1JBUH 4I8JA 1F92A 2A2XH 4K2YA 4UONA 3OSYA 5EG4A 4ZMAH 3TNSA 2BYAX 4WY3A 3PV5A 1VITG 4AGJA 1O5EH 4BNRA 3F2HA 2ULLA 1TABE 4AB9A 4HZHA 1H8ED 4A1TA 1GBHA 3GICB 3MU0A 3A88A 1D4PB 3ZZBA 1YPGH 1QBOA 2ZHDA 1DS2E 3L3TA 2FOHA 2A45B 4CRBA 1T31A 2SNWA 5K7RA 2BM2A 1QURH 4M9FA 2J9NA 4TPIZ 1LDTT 4Q4LA 5F8XA 1AVXA 1BBRH 5DGJA 4ZAEA 1BUIA 1NRRH 1O2IA 1QCPA 1TYNA 3A83A 3FP8E 3Q3YA 2QE7D 2ZZUH 1EZSC 3EDXB 3VB7A 1C9PA 4GVUA 1ZPZA 2XW9A 3FO8D 1O3DA 1C1RA 1ZJKA 5EW1H 1BT7A 1MD8A 2FZZA 2BLVA 3N7EA 4IS5A 3BEFB 3BTDE 2P94A 2GMTC 4AGKA 4Z0KA 1VCPA 2P3TB 3HGNA 1FUJA 2BX4A 1XXDA 4D9QA 2BD4A 2EY4C 1QRZA 4GCHF 3RC4A 1Y8TA 1YCPH 2QXIA 1W0ZU 2Y80A 1LO6A 4O3TA 1S84A 1GJCB 1WQSA 2AMDA 2JIZD 1IQIA 2ZPQA 1GHXH 2H5CA 4I8KA 1MUEB 1LPGB 2Z6BD 1O2UA 4BAKB 2D2DA 3RXTA 4ZCNA 1VITF 4DY7B 1YWUA 2RFKC 3ZZ8A 1C4Y2 1GJDB 2ZEBA 4AFQA 2UWLA 2ZI2H 5C2ZA 3RXHA 1G30B 1DM4B 2PUQH 5JB8S 1C5YB 1N1LA 1ZSJA 1OHHD 2W3IA 4UD9H 1QA7A 2BD7A 1V2KT 2A1DB 1KY9A 1CGHA 4RT0A 5F53A 1OSSA 2EQNA 3GCNA 4JZDH 2LPRA 2V3MA 1QL9A 2NU4E 2WSSD 2HWLB 4BXSA 3GY2A 4KTSA 5EPNA 3AK5A 3PMJA 5CDFE 1UTMA 4H6TA 5FX5A 4TY7A 1W7XH 1GI6A 5JYIA 1TBQH 3UOUA 2FLRH 3EYDA 2XCNA 1AZZA 2IPHA 2HNTC 3RMOH 2ZNKH 1E0FD 4BOHA 1J16A 2QA9E 2ZC9H 3E90B 4J2YB 3QO6A 1C1QA 4Y71A 5A09A 1P8VC 3ATKA 5AHGH 1BZXE 1GI4A 1SGYE 1YP9A 1BHXB 4JYTA 2WHXA 5FCRA 5HM9A 3WW7A 1Q3XA 4FU9A 1FPCH 4GHQA 1LHFH 4B2AA 1D9IA 2G55A 3BIUH 1Z8JB 3RU4E 1RIWB 3SI3H 1O3KA 4CR9A 1O3MA 4KTCA 2XC4A 3GDUA 1E38B 1O3GA 2ZDAH 1KDQA 2L74A 3N7OA 4ZHMU 1KXCA 1RS0A 1GG6B 3URDA 3A7WA 2RA0A 4ABJA 3H09A 4OS5A 2ANKH 1C1UH 1RIWC 2KFWA 3M7QA 1HRTH 1NROH 3QWCH 3IITA 1B0FA 2NU0E 2B7DH 1CA0B 1A5IA 1YPJH 3FZZA 1QB1A 1GG6C 3A85A 2ZKSA 4YT7H 2FX4A 2FYRA 1KTSB 1ZMJA 5HYOA 2VIWA 1V2VT 1SLVB 5C1YA 3TJNA 2CF9H 1SFIA 3SV9A 3CP7A 1K9OE 4K1SA 1Y3WA 3FKSD 4B1TA 4R8TB 1G9IE 3SZEA 1CA0C 2OQUA 3P92A 5F8TA 4MNVA 1X7AC 1ZPBA 2B5TB 3NCLA 4F4OC 1ELVA 1EAXA 3GYLB 7GCHF 3RU4T 1ANCA 4MPVA 3T28A 4AFUA 3MI4A 4RKJB 1KLIH 1NTPA 3Q3XA 5E2PA 2GZ9A 1AWHB 2A7JA 3KIDU 1G3CA 2WPKS 4BAQB 1CE5A 4BANB 1MCTA 2A4OA 3DA9B 1O37A 4WH8A 1OP0A 3KN2A 1LKAA 3TJOA 3KF2A 1OWIA 3SUGA 4DJZB 1SGRE 3UUZA 4FUIA 2CK3D 3DD2H 1SLXB 4K1TA 1HB0B 4OS4A 3UR6A 2BTCE 1NFWA 1WOFA 1GCTC 3PRDA 1EAWA 1MKWK 3F1SB 1AUTC 1GHBF 3E8LA 5AVDA 2Y5GA 1RFNA 2ALPA 1W0JD 1OYTH 1TQ0B 2A5AA 1BRAA 1TGNA 3H7TA 4B75A 1NN6A 3F2FA 1EZXC 2OTVA 3QZQA 5TCCA 1MU8B 2CV3A 2ZP0H 1FN8A 1TX6A 2BDYA 3ZZ5A 1P12E 5E2OA 3HPTB 2ZFFH 1EZQA 1HAOH 1V3XA 4ISHH 4ZKRU 3ENSB 2JJ2D 3S0NA 3IWMA 3OFND 5FX6A 1XM1A 1UTQA 1HIAA 1DUEA 2PUXB 1MZDA 1SVPA 4K5ZA 2CN0H 2FS8A 1QR3E 3K65B 3FANA 4Z6AH 3MOCA 1V2OT 3UNSA 2BOKA 1Z8RA 4MNYA 4I33A 1DLKB 2BXTH 1P3EA 1VCQA 3SV6A 3DSOA 1QNJA 2PLXA 4B2CA 3U69H 1P57B 2W6JD 2VWNA 1RJXB 2ZGJA 3MU8A 3RMLH 4X8UH 4ABAA 1ANEA 1V2MT 4RI0A 4ACBA 2ILNA 2FOCA 5FPYA 1AUJA 2SGAA 3NKKA 2RCEA 1ELFA 2R2WU 3TH2H 1ETSH 1NBME 1F0RA 4D76A 1O2KA 3T2NA 4CH2B 3R3GB 2VIPA 4TT3D 1EX3A 3E16B 1OWDA 1TIOA 1GBBA 2ODPA 4GPGA 4B74A 2A4RA 3PROA 1HFDA 2UUJB 5LPFA 2P95A 4KGAA 1KYNA 3ZVFA 2AMPA 1A61H 3SN8A 1C1TA 5IDKA 1SGFA 4O3UA 2GT8A 2IJD1 2SGQE 1OP2A 4B6EA 2ZFTA 5E0JA 1MTNB 3DSGA 1O38A 3ODFA 3UOPA 1GMHG 1LPZB 1O31A 1P3CA 3MFJA 1PQAA 2FO9A 2HALA 2PWXA 1SOTA 3GCOA 1FMGA 5A0AE 2BY9X 1OPHB 3V7TA 3OE7D 1AU8A 3SNCA 4PROA 1NBMD 4NWLA 3GCTG 1MTNC 1BRUP 3KNXA 5GXPA 1CT0E 3LONA 4YESB 1S6LA 3QLPH 1GL0E 4NIWA 1PPEE 4U30A 2VB0A 1GBKA 2P3FH 1GMCF 1KLTA 3SU0A 2FS9A 4XFQA 1F5KU 1O35A 1PPZA 1NU9A 5I46H 2WYJA 3O8RA 1QQUA 2HNTF 1Y3UA 3SU6A 7ESTE 1GHAG 5EXLA 2WUBA 4WXIA 1HJ9A 4ZUHA 3A8AA 2OQ5A 4F55A 1BDAA 1TOMH 1P2QA 4Q80A 2BXUH 1VKYA 5HIZA 1MBMA 2C8YB 1CT4E 3RXFA 4ABFA 3S9CA 1CHOF 2LNCA 4FUFA 1GI1A 3VB4A 4NA8A 3A84A 1KDQB 1SOZA 1MAYA 1D6RA 3AAUA 1GWAA 1TRYA 3UREA 5DG6A 5FBEA 1B0EA 1FN6A 5K0HA 5EOKA 1YGCH 1SLUB 4AFSA 4DOQA 1GHZA 5F03A 2Y7XA 2YNAA 1O2VA 2AFQB 3GCTF 3OU0A 3LC3A 2XCFA 1D6WA 2ZDLA 1VGCB 4B76A 1SKYE 2LELA 1ELEE 5DP7A 5FBIA 1CO7E 4BTTB 1NC6A 1HAPH 3M37A 1C5ZB 2XWAA 1LVYA 5JB9S 1H8DH 3Q76A 4WF8A 1WTHD 4A6LA 4DURA 3M7UA 2C93B 4Y79A 3CNRA 2ZHQH 1C5NH 1F0UA 2BDCA 1C2EA 5GCHF 4XBCA 3ATLA 4X0WU 2QXGA 1GJ8B 1SGQE 5B6OA 4MLFB 1UO6A 1G3BA 3RXDA 2ANWA 1ZJDA 2Z9GA 2Z9JA 1YLCA 2JDID 1KSNA 4X6OA 3SUEA 3KQEA 2HOBA 3MNBA 1QIXB 4ABGA 3GCHB 4IN2A 3FFGA 2VWLA 2Y81A 2UUFB 1E1QD 1K1PA 2NWNA 2ZG0H 2ESTE 3LDXH 3GY4A 5EU8A 5HKKD 3SBKA 2FXRA 2F43B 1Z8IB 2BDGA 2OC8A 1OYQA 2H5DA 3BEIB 2XBXA 2ZHFH 2C3SA 2ZGCA 1QB9A 4R0IA 1O3OA 1YPEH 1HXFH 3QDZB 1J17T 1YKTA 2RA3A 4NIYA 1O2OA 1ELAA 3TIUA 5HGGA 1DUAA 2WUCA 1KTTB 1ESBA 1W0KD 2VGCB 2A0QB 3EA7A 1TBZH 1P01A 8GCHG 3QN7A 3V3MA 2UUKB 3LGUA 1S81A 4HGCA 1E35B 4F49A 1OWJA 1HIAB 1YYY1 1ELGA 2I6SA 4UFGH 1TAWA 3A8DA 3JZ2B 2VGCC 4YT6H 2F9UA 3FN8A 3RXEA 3EE7A 4ZKNU 5A0CA 1SGNE 2G8TA 1A0LA 2H2ZA 3FAOA 2YMSC 3ODDA 2DUCA 3MU1A 3SV8A 1ID5H 2Y5FA 1TLDA 1TRNA 1BTUA 4THNH 3P8NA 3STIA 3ITIA 1EKBB 1O2SA 5FAHA 2WPLS 2EEKA 2GCTB 1GBFA 1D3TB 1QJ6B 1WUNH 1TRMA 1IQHA 2QCYA 1S83A 3MNXA 1J8AA 1SHHB 1FY3A 1GCDA 3R0FA 3TK6A 3M3VA 4DIHH 1O30A 3CS0A 3TH4H 2GCTC 2ZCKP 3MMGA 3PB1E 2Y82A 1AE5A 1AFQB 2A2QH 8GCHF 4IBLH 2SFAA 3JZ1B 4YTAA 2ZHEH 3PV4A 1J14A 1C5LH 3I77A 3WWBA 2R2MB 1GI5A 3T27A 4AC9A 1O33A 3A8CA 1FDPA 4TPYA 2XNDD 1BMFD 1AFQC 3AASA 1XVMA 2BHGA 2W5EA 1C2FA 3IG6B 5C1XA 3MO3A 3MO9A 2OP9A 1G3DA 1DXPA 1O2XA 1DX5M 2XNIA 5BRRE 1AMHA 2UWPA 3RXIA 1UTOA 3KGPA 1C5TA 4D9RA 3U8OH 1L4DA 1Q31A 1AZ8A 3K9XB 3MH5A 4A92A 1MZAA 1GJAB 1XX9A 3F6UH 2VINA 1Y5UT 1YPLH 1O32A 4ISLA 1TE0A 1E37B 1QFKH 3M7TA 3PM3A 1GBCA 1C1OA 3PTNA 1TGBA 3M5MA 1HJAB 1K21H 1MU6B 2PGBB 4OGXA 5AFYH 1F2SE 3DCLA 2PTCE 1IQLA 2PGQB 1FY4A 1A7SA 4FUBA 3LH3A 4XD7D 5FPTA 1TPAE 2CMYA 1XUGA 2KCOA 5C3NA 4P02A 3OTJE 3LKWA 1HJAC 1MTUA 5EQSA 2J4IA 2ZU2A 4Y10E 3DFJA 1XVOA 1V2UT 4XSKU 4X1PU 2ZU1A 1ZRKA 2GMTB 2IPQX 3GYMA 4U2WA 3EA9A 4CH8B 1AD8H 1BTWA 3BEUA 5CHBA 2KCAA 2A5IA 3PWBA 4DW2U 2GGVB 1CHGA 1ZLRA 3ZVCA 3SJ8A 2QN5T 4AORA 1ZMNA 4TSFD 3RXVA 1WDIA 1IQFA 1S6HA 2FDAA 3S9AA 3PYHA 2PW8H 5DP3A 4IC5A 1A5GH 3VXFH 1HCGA 1JIMA 4DGJA 3S7HB 2BLWA 4I8HA 1SGIB 2SGEE 2Z7FE 3K2UA 1C4V2 2TGDA 1O2MA 1O3PB 1UVTH 2HLCA 4DCDA 1HJ8A 2GCHG 2H9TH 1UCYE 3SHAH 2BLOA 5T6GA 3CENA 4DVAU 5FCKA 3RMMH 3UWIA 2C4FH 1EZUC 1GI0A 3LIWA 3U28C 2WPDD 1PFXC 2KX4A 1FY8E 5DO4H 2RDEA 1NS3A 1GJ5H 2OLGA 3OEED 2KZ4A 1DVAH 3SQHE 3ZVDA 5ETXA 4H6SB 3MH6A 1RRKA 2R3YA 2BDBA 1YLNA 1XKAC 3TJVA 1YC0A 1JXPA 2BVSH 3VEQB 1KIGH 3E91A 4JK5A 3F2GA 3BTTE 1V2PT 4NG9H 2QF3A 2J34A 1C5UA 1THSH 2CXVA 3L33A 1XUJA 3LGTA 1O3FA 2P93A 5HM2A 1EJAA 4F48B 2TIOA 1BTYA 1JWTA 3QZRA 1GBIA 2H9EH 1V2WT 1QGFA 2V6NA 3Q77A 2ZIQH 1LQEA 2ZFSA 1UTJA 4CRFA 2YMSD 4ZKOU 5C0TA 3ZZ9A 2BLQA 1GDNA 1W8BH 1JOUB 1TA6A 2AGGX 3C27B 5GIBA 1HNEE 1MBQA 1FV9A 3M5OA 4X1RU 2DE9A 2H1UA 3ZIAD 1ETTH 4ZKSU 4WJG2 2L6OA 4FUHA 1HAZB 1K1JA 1UJ1A 1G37A 1QA0A 1KXFA 1GBLA 1O5GH 2ZDKA 4ZHLU 1C2GA 4YLUA 1ORFA 2WV5A 1ANBA 3SOSA 4FOUC 1CGJE 4ABHA 3UNQA 1GI3A 4FU8A 1AE8H 3ZYEA 1BMAA 2GDEH 2ANYA 4CRAA 4X8VH 3RXGA 2ALVA 4HI3A 2VH6A 4AB8A 1SGFG 1UTKA 1J9CH 2ZQ1A 4LZ4B 1NFYA 4JZEH 3UY9A 3V0XA 2TBSA 1MH0A 1EOJA 2OC7A 1K1LA 1Z6EA 4VGCB 2ZFPH 1F0SA 1GJ9B 2J97A 1AY6H 3MU5A 2GD4B 2UWOA 1D3PB 1K22H 1XUKA 1SQAA 1RTFB 4A5TS 4NA7A 1Y3VA 3K6ZA 4YXWD 1W2KH 2ZO3H 1E34B 3RU4D 3A80A 2ZU4A 3SI4H 1FY5A 2G4UA 5JBAS 1RXPA 1P10A 2JKHA 3LT3A 1V2RT 1EFRD 2ZTYA 1K1IA 1AFEH 1GCTB 1LHGH 4K8YA 4VGCC 1GMDG 1TGCA 1HAGE 1G3EA 2OC1A 5HMAA 4AG1A 1SBWA 1W0YH 2FOFA 4X6MA 4ZXXH 1GJ6A 1WBGB 1IQEA 2ODQA 4AG2A 4O97A 4ABEA 3FP7E 1A0JA 1V2JT 4RKOB 2FI3E 9ESTA 1D3DB 1WCZA 1QL7A 3P70B 3M5LA 4MNWA 1ARCA 1GJ4H 1QZ8A 1AKSA 5EQRA 3P95A 1OWHA 1PJPA 1V2TT 2A32A 3PMHB 2J95A 3W1EA 2HPPH 3SZNA 2Y7ZA 3HGPA 4GLYA 3MNCA 1C5WB 5C20A 1UCYH 1MKXH 1QQ4A 1YPKH 3H5CB 5TJXA 2BB4A 1LCYA 1HAYB 3SJOA 3GDVA 4AZ2B 1TMUH 2O8TA 4WH6A 4X8TH 3PMBB 1PPBH 1SHYA 4H4FA 2PTNA 1O3HA 2QC2A 1V6DA 1ZMLA 3HK6B 2ZWLH 1SGPE 1P2JA 2F9VA 3EAJA 1OXGA 3O8CA 3F9HA 4INLA 5JPMH 3SUDA 1HAIH 5T1VA 5GWZA 1YF4A 5FXLA 4AX9H 1TNGA 1J15A 1OWEA 1W13U 4NSVA 1GHYH 5T3HA 3RXLA 3A89A 1OOKB 1SQTA 1Z8GA 1TPSA 1AWFH 4X6PA 5FHTA 1L1GA 2EI7A 2FMJA 1B5GH 1BJVA 3DUXH 4CHAB 3A7YA 1AGJA 1T8OA 1HAXB 3P8GA 1C2HA 1H8HD 4GHTA 4FUEA 1ZSLA 3A87A 6GCHG 2C8ZB 5GDSH 3SU2A 1OX1A 1VCWA 1P2IA 4FVBA 1ZPCA 4DG4A 4LOYH 1ZHRA 4ABBA 2F9PA 4CHAC 1JRSA 5C5NA 3D49H 4Z1MD 2BQ7B 1EB2A 4JYVH 1P2OA 4O9VA 3BN9A 1AHTH 2J2UA 1O3EA 2FI4E 3FVFB 3UPEA 1UW7A 1QHRB 3A7ZA 5LGOA 1HDTH 1QTFA 1C9TA 1GJ7B 4MPXA 3GDSA 1BBRK 1O3NA 1JIRA 1QB6A 4FUDA 2P3UB 1GHVH 3DSPA 2PV9B 5L6NH 2O9QA 1DWDH 1H9HE 3SYJA 5IYTA 2Z3EA 3B8JA 2OXSA 6ESTA 1L4ZA 2R9PA 2FWWA 3SJ9A 1XUFA 2BQ6B 3GS9A 4I8LA 2WPJS 1AVGH 3RC5A 5EJ1A 2B0FA 4XOJA 1DOJA 1SGEE 1FLEE 1YCPK 1YCPM 2FYQA 1O2PA 3ESTA 1AIXH 5KGOA 1O3JA 2B9LA 1EOLA 1TNHA 1P03A 3I29A 1CGIE 2BD8A 5DN6D 1B7XB 3N99A 1ELTA 1LKBA 3F68H 4JZIA 2V3OH 4X8SH 3BTHE 1BTPA 1O3CA 2A4GA 1IAUA 5E0GA 1GL1A 2WPHS 5PTPA 3H7OA 1O2NA 1Z1JA 3OY6U 1MD7A 1ELDE 3P8FA 1UK4A 3RLWH 1BTZA 1P9SA 1VJAU 5TCAA 1A3EH 1GMHF 3RXCA 4NIVA 3U9AH 1M9UA 3M5NA 1HYLA 1PQ8A 3VB5A 2AH4X 1BHXF 4B6FA 4LXBH 3GY5A 2GTBA 1BQYA 1GVZA 1TBRH 1C2MA 2D26C 2BD3A 1UMAH 3STJA 1PQ7A 2G4TA 2PSYA 2WINI 2VJ1A 4K8BA 2V0BA 2ZFRH 1DSUA 3BIVH 3SUFA 1EUFA 4X1QU 2B8OH 3K6YA 4WWYA 1WQVH 1P09A 5EODA 3TPIZ 3UIRA 1FPHH 1T8NA 3SNBA 3TU7H 4TWYA 1PYTC 2ZGBH 4ASHA 4YOJA 1PQ5A 1GHAF 1SB1H 2ZDNA 2V35A 5B6LA 2G81E 2Z9IA 1S85A 1S0RA 3A82A 2P16A 1FX0B 2QF5A 3GY8A 4MTBA 2I6QA 2XTTB 3D23A 1T8LA 4U01A 3O8BA 2A4QA 7KMEH 4XBBA 3MU4A 3N7DA 2G51A 3ZV8A 2M2AA 4FUGA 5L2ZH 1F5LA 4D7GA 3ZVEA 2ZU5A 2O8LA 2W26A 3BTGE 4FUCA 3RMNH 3W95A 5A2MH 1TB6H 3G01A 2QV1A 4JYUH 1EPTA 4NZQA 4HFPB 2M5TA 1TNJA 2ZDMA 2UUYA 2PR3A 4FU7A 1S5SA 3OY5U 3DFLA 1O2JA 1SC8U 1AKSB 3KHVA 1SGCA 3VPKA 1DWBH 1GBMA 3KYGA 5G4BA 5DPAA 3T26A 1FXYA 1SGDE 1ZYOA 2WPIS 2VIVA 3KQCA 3LU9B 1E1RD 4CBOA 1ESAA 3AAVA 4TY6A 1T4VH 5LPRA 1FIWA 1MAXA 5KEDA 1INCA 3U1IB 2TRMA 2STAE 1THPB 1BA8B 2HVYB 3BTKE 2YMSB 2G00A 3LOXA 2FOBA 1TOCB 4JMYA 4B73A 4MPWA 1Q2WA 3HK3B 3T62A 3EE0B 1UTNA 2D1JA 4FXGH 3C1KA 3BTWE 3VXEH 2GVFA 2KM0A 2A7CA 3BTME 2J98A 4X6NA 3U1JB 1TMBH 3F0OA 3SORA 2FPZA 1COWD 1BTHH 1LVOA 4X1NU 2IN2A 1TGTA 2GJGA 4NFEA 4E05H 1SI5H 1FNIA 2FTLE 1S0QA 2GZ8A 4MVNA 5C0UA 3KQ5A 2XC0A 3F3BA 4CBNA 4E7NA 1KXBA 1D3QB 3KL6A 2XOKD 4CRDA 5E0HA 1NFUA 5DP8A 4FETA 1W11U 2ANMH 3QX5H 1GBDA 1DITH 1GI7B 1NRQH 3S69A 1ZTKA 2AMQA 1UCYK 4OS1A 5CMXH 1C5QA 4FVDA 4YM9A 1FJSA 1RTKA 5EPYA 2VVUA 2JJ1D 1C4U2 1JRTA 4TYDA 2W7UA 2AYWA 4ZROA 1ZSKA 2KCPA 1C2IA 1O2LA 1ZHMA 1MKWH 5I25A 4DT7B 1IQGA 1OWKA 4X2WA 1O2TA 5LPEA 1MABB 4HG6A 1N6YA 3E1XB 3BF6H 1HV7A 1IQKA 5C17A 3KEEA 1WV7H 4AYVB 1O5CB 3UAIC 5LH8A 2STBE 4Q7YA 1P0SH 5ESBA 1WTGH 3L6PA 2SGPE 3GY3A 5DSFA 3PRBA 1LHEH 2VIDA 5JBCS 3UFAA 1P2NA 1C2LA 1PPHE 3OYPA 1FZZA 1GBAA 5EXMA 4RSPA 2IJOB 1IQJA 1DDJA 3M3SA 1FONA 2XBYA 4WMEA 9LPRA 2FOAA 1N8OC 3VB6A 3RXSA 4MNXA 4IGDA 2SGDE 5FL7D 2ZDVH 3UR9A 2JH5D 1XUIA 1P06A 2THFB 3SHCH 3OTPA 4CRGA 2VVVA 1AI8H 5DK1A 3SGAE 2QGRA 2JETB 4JZ1A 3RXPA 4NA9H 1F0TA 1L1JA 3ZZCA 1ABJH 8ESTE 3DHKH 4GCHG 1O5AB 1XMNB 4AOQA 2NU2E 3TK5A 2TGAA 5C67A 2BVXH 4IMZA 1C1SA 1GVKB 2JH0D 2W3KA 3RXOA 2JETC 3V13A 3VGCB 1TMTH 3RM0H 1Y5AT 2G52A 2ZTZA 3UB0A 3HKJB 1PYTD 2FTMA 3PO1B 1BJUA 4Y0ZE 1EP5A 4XRNA 2G5VA 3MWIU 4Q2KA 2TPIZ 4INKA 1NZQH 3VGCC 1BOQA 1F5RA 4SGBE 1C5VA 2F91A 1GJBB 1BMNH 1BIOA 4ISIH 1TX8A 3KQBA 5A0BA 1CSOE 5J4SA 1BCUH 1IHTH 3PO1C 2EC9H 5EGMA 2FOGA 1TALA 3RXRA 3QTOH 1S82A 4NGAH 3MO6A 1GDQA 2BDHA 2VVCA 1UVOA 1XKBC 3ATMA 1W10U 2PKAA 2R0KA 1TNKA 2A5KA 3SV7A 2Q6FA 1N6XA 4X2XA 1O34A 2ZU3A 2P8OB 5EW2H 1Y3XA 1WXRA 3RXKA 7LPRA 1NU7B 2WZQA 2C8WB 4ZHAA 4E7RG 4D8NA 3SV2H 4IW4E 1EASA 3QTVH 2PKSB 1KXAA 4I7YH 1O5FH 2P8OC 1CVWH 5IK2D 5JDUB 3LGVA 2ZA5A 2VBCA 5DP6A 5C5OA 1SSXA 1YPHE 5H4IB 1EPTB 4UEHH 5DKMA 3E6PH 4Q63A 2BD9A 4YO9A 3S9BA 4CREA 1P05A 2Z94A 3UQOA 1FIZA 1THRH 3D62A 3EGKH 2PKSC 3BV9B 1LQDB 2OC0A 1C5MD 3SW2B 2LP6A 1CU1A 2QXJA 3Q00A 3B9FH 1ZGIA 5HIYA 1RD3B 1PPCE 3T5FH 2EI8A 1EPTC 1EP6A 2BDAA 2GCHF 1V2ST 1SL3A 4HTCH 2KCYA 1HUTH 1HLTH 4I8GA 1DWCH 1BRCE 8LPRA 3TITA 2OINA 1C2KA 1WAYB 4I32A 1AO5A 1C1NA 2ZF0H 2ZGXH 3NWUA 3PWCA 4BTIB 3T25A 1WSSH 1P2MA 2J98B 2KAIA 2BD2A 1LVMA 3RXJA 3ZZAA 2RG3A 2FLBH 4XBDA 4WMFA 3LJJA 4X1SU 7GCHG 2QYIA 2PHBA 2BDIA 2YNBA 5C94A 1U6QA 2WYGA 4K1EA 1FAXA 2EI6A 3P6ZB 1FI8A 2ODYB 4U32A 5F6MA 2OK5A 2BVRH 5GJ4B 1DPOA 1C5OH 4MDSA 1GPZA 1UK2A 1C5XB 3A86A 3RXMA 4LK4A 1Y59T 4SGAE 1VITH 1S6FA 1YPMH 2O8MA 3SU5A 1E79D 4QT8C 2J92A 2GZ7A 1NRNH 2BOHB 3ZVBA 2EA3A 1GBJA 2FI5E 2QF4A 3ZZDA 4Y6DA 3MNSA 2FESH 4MPUA 5CE1A 3ATWA 1YM0A 4GAWA 1T32A 1H9LB 1GHBG 2WV4A 6CHAB 2ZTXA 3ZZ6A 1WU1A 2XYAA 3ZVAA 2OD3B 3GY6A 1SFQB 2AEIH 1UHBA 5C1UA 3SJKA 1A5HA 3ATIA 2WPMS 6CHAC 1O2QA 2HRVA 1C1MA 3VFEA 5A8ZA 1TNLA 2FOEA 4ACAA 1K1NA 2PFEA 2AHME 2GV6A 1DXWA 1CQQA 1LMWB 2QIQA 1ZHPA 3NXPA 2HLDD 4KP0A 3A8BA 2R3UA 1LHDH 5EJZA 2ZPSA 3MH7A 1P04A 4ZXYH 4Y8YA 3LH1A 1Y5BT 1L0ZA 4P00A 1O2HA 1C5RA 3EA8A 3SU4A 1W3CA 5EIYA 2TGPZ 1P2KA 2Z3DA 4RT1A 2VNTA 4GUXA 4AFZA 3AW0A 3RXAA 1HAVA 1BITA 1RTLA 2HVXA 2VIOA 1GI9B 3SO3A 2ZQ2A 1DE7H 1GI8B 1DLEA 4OM9A 2V3HH 3A7VA 3LGWA 3RDZA 1EAUA 1JMOH 2NU3E 4ASUD 1GMDF 1OP8A 1DANH 2AGEX 2Q6DA 3SNAA 1ELCA 3A7XA 2ZECA 2NU1E 5L2YH 4WVPE 1W7GH 2V7QD 4NZLA 1C2JA 4XDEA 2CF8H 1SR5C 3BG8A 2VU8E 4NCYA 4ISOA 2XBVA 2QXHA 2BMGB 4I86A 4GSOA 4OS6A 4Y0YE 1RGQA 1ARBA 2F83A 2K8IA 3RP2A 8KME2 2FOMB 1O39A 4OS2A 1QY6A 4WXVA 2QY0B 2F9NA 4BAHB 4OS7A 1O5DH 2HNTE 2OUAA 1W12U 5AF9H 1BMLA 5KECA 1HGTH 3F0PA 4Y11E 5T6DA 1O2YA 1UTPA 1AQ7A 3LPRA 4YOIA 1K1OA 3VB3A 2SNVA 5T6FA 1L1NA 3UTUH 4K3JA 4B71A 1A3BH 1ZOMA 1QRWA 2GV7A 3NRLA 3NUMA 2QAAA 4A1VA 2PKAB 3KYFA 2Z3CA 1SMFE 1AVWA 3PV2A 1PPFE 1GMCG 2XBWA 1ZZZA 1KLJH 1TA2A 2OCVB 4I31A 2XWBI 3GISB 3RXQA 4O03A 2BZ6H 1GVLA 1HPGA 3SGBE 4IMQA 4K60A 3ZYDA 5F8ZA 1E36B 1UK3A 1TX7A 4INHA 2YOLA 1W14U 1O3IA 2C8XB 3CS7A 4K69A 2GP9B 1XUHA 3ZVGA 1BB0B 3QK1A 3VG8A 1BRBE 1XXFA 1SG8B 2D8WA 2PSXA 1O3AA 1CHOG 2GKVE 5L30H 6GCHF 1TONA 1HBTH 2K1QA 3RC6A 1TQ7B 2W7SA 1YLDA 3QGJA 4E06H 4IN1A 1O5BB 1A2CH 1DWEH 2HGTH 3ZV9A 1GI2A 2ZCHP 1C2DA 5ABWA 5JBTA 1NY22 1T8MA 1VJ9U 5A8YA 1NESE 2BZAA 5JBBS 1MTSA 3M61U 2FM2A 3RUOA 3UWJH 4X2YA 1TPPA 3T29A 1K0HA 2VWMA 5DP5A 3SGQE 2VWOA 1IQMA 2AIPA 3P8OA 4DIIH 2Q1JA 1BMMH 3GY7A 1KXEA 4NFFA 4NSYA 2KAIB 4JCNA 4XE4A 1Z1IA 2A7HA 1H9IE 1TNIA 3ZZ7A 3TGKE 1CT2E 1LHCH 1NRSH 5GCHG 1P11E 1ACBE 3BSQA 2BY7X 1K2I1 1Z7KA 3UNRA 1DY9A 1NM6A 1BTXA 5GNDA 2ZPRA 4UFFH 1P02A 1MCVA 2ZGHA 6LPRA 2K0QA 3TGJE 2BY6X 3P17H 2GT7A 1V2QT 1ZTLA 3QUMP 1L2EA 1ABIH 1AB9B 4AYYB 1KXDA 1QJ7B 2FEQH 1DT2A 4YZUA 4KTUA 1IOEA 4ISNA 1ZR0A 1UTLM 3OX7U 4UFEH 4Y7AA 5FPSA 4AN7A 2BD5A 4JZFH 2Q6GA 3TNTA 1G32B 1A46H 1ETRH 4A7IB 1AB9C 1C1VH 1SPJA 1ESTA 1NFXA 2FODA 2Z9KA 2GX4A 3WWFA 3NZIA 3SU1A 4YLQH 1MQ5A 1LVBA 1UHBB 1H4WA 4ZH8A 1K1MA 4LZ1H 2F9OA 1TGSZ 2J94A 2VIQA 1ANDA 3PLBA 5DP9A 1VGCC 2TGTA 5EXNA 4Q7ZA 3M36A 1YBWA 2GDDA 1TWXB 3SNEA 2RDLA 1V2LT 1VR1H 4RN6A 1Z6JH 1NO9H 3LC5A 4A1XA 2QF0A 3F9GA 1EJMA 1G2MA 2FIRH 4KELA 5HXFA 3AW1A 5ESTE 2SGFE 5CHAB 2KR7A 5EQQA 3FOAA 1EQ9A 3FZDA 3OAAD 5BPEA 3TGIE 3Q3KA 3U8RH 2ZCLP 1TPOA 3ZZ4A 4TWWA 4ABDA 1GBTA 2P59A 4FUJA 4Y8XA 4KKDA 4D7FA 2HPQH 1YY3A 1G2LA 1ZTJA 1BBRE 1EXFA 3RXUA 2O8UA 2BY5X 1UVUH 3MTYA 1NT1A 5CHAC 4BTUB 4X2VA 1IQNA 1DICA 2F4LA 1HAVB 3RXBA 2G5NA 5AFZH 4ESTE 3B23B 1WYKA 3GCHC 4JK6A 4OGYA 4ABIA 1DSTA 1QL8A 3URCA 3D65E 2CJIA 3F9EA 4Y76A 2F3CE 3TVJB 1SGTA 1H8IH 5EJLA 1IHSH 2F9BH 2XRCA 3TH3H 1O36A 1ELBA 3KCGH 2A31A 3BG4B 1Y3YA 3DT0H 2W6ID 4BXWA 4B2BA 1GBEA 5GPIB 4BAOB 3BTFE 1A1RA 2WV9A 1OS8A 3V12A 3WY8A 3M35A 1MTWA 1G36A 1CA8B 1C1WH 1O2WA 2PP6A 1UVSH 5DP4A 1EAIA 3RLYH 1FY1A 4NWKA 3I78A 2Y6TA 1MQ6A 2Y5HA 3SJIA 3U98H 4J1YA 3U8TH 3BG4C 2XC5A 3PLPA 2VH0A 3O8DA 1O3LA 1ZGVA 1OKXA 1P9UA 3A81A 1CBWB 2AS9A 2Z9LA 1MKXK 2BQWB 3MH4A 2J5UA 2O8WA 1YPHC 3LGYA 3MHWU 1SQRA 4UFDH 3UQVA 3OEHD 2FX6A 2FP7B 1C5SA 1HAHH 2H9HA 3FP6E 3BTQE 2H6MA 1QJ1B 5DJ7A 1QBNA 1A0HB 1F7ZA 2DE8A 2C90B 1EB1H 3MYWA 3PTBA 4UE7H 1H1BA 1CBWC 2JH6D 3F9FA 3M3TA 1O2RA 1UVPA 2AGIX 3AVZA 3EQ0H 4CR5A 1DY8A 1DFPA 3RM2H 1QRXA 4Y8ZA 1FQ3A 1LPKB 4NIXA 3ZZ3A 3PMAB 1LTOA 2R0LA 2OBQA 1KMHB 4Y7BA 4WMDA 4IC6A 3ELAH 1AN1E 1T7CA 1GGDB 1PPGE 4UDWH 1VZQH 3QGNB 1N8OB 1C5PA 3TLOA 3MQKC 3NK8A 4M7GA 1QBVH 2ZHWH 2ASUB 1EJNA 4DT4A 2ZFQH 3TJUA 3SU3A 2OBOA 2CHAB 3NPSA 5A8XA 2BY8X 2XXLA 3LJOA 1GGDC 1V2NT 3HKIB 2AERH 3BTEE 3E3TA 3HATH 1Z71A 3E0NB 1T4UH 5J4QA 5E8EH 1FAKH 1O0DH 1O2GH 3W94A 3S7KB 4CRCA 3GOVB 5SGAE 1TFXA 4H42U 2CHAC 2CGAA 1HXEH 3PLKA 1A4WH 3TK9A 4YOGA 1GDUA 4BAMB 3LGIA 1NRPH 1EATA 2BX3A 1NPMA 1C1PA 4Q7XA 1MMJN 3SNDA 2AIQA 2J38A 3SQEE 3KQDA 1SQOA 1ZRBA
chains in the Genus database with same CATH topology
3A7TA 1SLWB 3E0PB 1O2ZA 4MQAA 1O3BA 2IOTA 1GHWH 4MG3A 1MTVA 1K28D 1JBUH 4I8JA 1F92A 2A2XH 4K2YA 4UONA 3OSYA 5EG4A 4ZMAH 3TNSA 2BYAX 4WY3A 1VITG 4AGJA 1O5EH 4BNRA 2ULLA 1TABE 4AB9A 4HZHA 4A1TA 1GBHA 3GICB 3MU0A 3A88A 1D4PB 3ZZBA 1YPGH 1QBOA 2ZHDA 1DS2E 3L3TA 2FOHA 2A45B 4CRBA 1T31A 2SNWA 5K7RA 2BM2A 1QURH 2J9NA 4TPIZ 1LDTT 5F8XA 1AVXA 1BBRH 5DGJA 4ZAEA 1BUIA 1NRRH 1O2IA 1QCPA 1TYNA 3A83A 3FP8E 3Q3YA 2ZZUH 1EZSC 3EDXB 3VB7A 1C9PA 4GVUA 1ZPZA 2XW9A 1O3DA 1C1RA 1ZJKA 5EW1H 1BT7A 1MD8A 2FZZA 2BLVA 4IS5A 3BEFB 3BTDE 2P94A 2GMTC 4AGKA 4Z0KA 1VCPA 2P3TB 3HGNA 1FUJA 2BX4A 1XXDA 4D9QA 2BD4A 1QRZA 4GCHF 3RC4A 1Y8TA 1YCPH 2QXIA 1W0ZU 2Y80A 1LO6A 4O3TA 1S84A 1GJCB 1WQSA 2AMDA 1IQIA 2ZPQA 1GHXH 2H5CA 4I8KA 1MUEB 1LPGB 2Z6BD 1O2UA 4BAKB 2D2DA 3RXTA 1VITF 4DY7B 3ZZ8A 1C4Y2 1GJDB 2ZEBA 4AFQA 2UWLA 2ZI2H 5C2ZA 3RXHA 1G30B 1DM4B 2PUQH 5JB8S 1C5YB 1N1LA 1ZSJA 2W3IA 4UD9H 1QA7A 2BD7A 1V2KT 2A1DB 1KY9A 1CGHA 1OSSA 4JZDH 3GCNA 2LPRA 1QL9A 2NU4E 2HWLB 4BXSA 3GY2A 4KTSA 5EPNA 3PMJA 1UTMA 4H6TA 5FX5A 4TY7A 1W7XH 1GI6A 5JYIA 1TBQH 3UOUA 2FLRH 3EYDA 2XCNA 1AZZA 2IPHA 2HNTC 3RMOH 2ZNKH 1E0FD 4BOHA 1J16A 2QA9E 2ZC9H 3E90B 4J2YB 3QO6A 1C1QA 4Y71A 5A09A 1P8VC 3ATKA 5AHGH 1BZXE 1GI4A 1SGYE 1YP9A 1BHXB 4JYTA 5FCRA 5HM9A 1Q3XA 4FU9A 1FPCH 4GHQA 1LHFH 4B2AA 1D9IA 2G55A 3BIUH 1Z8JB 3RU4E 1RIWB 3SI3H 1O3KA 4CR9A 1O3MA 4KTCA 2XC4A 3GDUA 1E38B 1O3GA 2ZDAH 1KDQA 3N7OA 4ZHMU 1KXCA 1RS0A 1GG6B 3URDA 3A7WA 2RA0A 4ABJA 4OS5A 2ANKH 1C1UH 1RIWC 3M7QA 1HRTH 1NROH 3QWCH 3IITA 1B0FA 2NU0E 2B7DH 1CA0B 1A5IA 1YPJH 3FZZA 1QB1A 1GG6C 3A85A 2ZKSA 4YT7H 2FX4A 2FYRA 1KTSB 1ZMJA 5HYOA 2VIWA 1V2VT 1SLVB 5C1YA 3TJNA 2CF9H 1SFIA 3SV9A 3CP7A 1K9OE 4K1SA 1Y3WA 4B1TA 4R8TB 1G9IE 1CA0C 2OQUA 3P92A 5F8TA 4MNVA 1X7AC 1ZPBA 2B5TB 3NCLA 4F4OC 1ELVA 1EAXA 3GYLB 7GCHF 3RU4T 1ANCA 4MPVA 3T28A 4AFUA 3MI4A 4RKJB 1KLIH 1NTPA 3Q3XA 5E2PA 2GZ9A 1AWHB 2A7JA 3KIDU 1G3CA 2WPKS 4BAQB 1CE5A 4BANB 1MCTA 2A4OA 3DA9B 1O37A 4WH8A 1OP0A 3KN2A 1LKAA 3TJOA 3KF2A 1OWIA 3SUGA 4DJZB 1SGRE 3UUZA 4FUIA 3DD2H 1SLXB 4K1TA 1HB0B 4OS4A 3UR6A 2BTCE 1NFWA 1WOFA 1GCTC 1EAWA 1MKWK 3F1SB 1AUTC 1GHBF 3E8LA 5AVDA 2Y5GA 1RFNA 2ALPA 1OYTH 1TQ0B 2A5AA 1BRAA 1TGNA 3H7TA 4B75A 1NN6A 1EZXC 2OTVA 3QZQA 5TCCA 1MU8B 2CV3A 2ZP0H 1FN8A 1TX6A 2BDYA 3ZZ5A 1P12E 5E2OA 3HPTB 2ZFFH 1EZQA 1HAOH 1V3XA 4ISHH 4ZKRU 3ENSB 3S0NA 3IWMA 5FX6A 1XM1A 1UTQA 1HIAA 1DUEA 2PUXB 1MZDA 1SVPA 4K5ZA 2CN0H 2FS8A 1QR3E 3K65B 3FANA 4Z6AH 3MOCA 1V2OT 3UNSA 2BOKA 1Z8RA 4MNYA 4I33A 1DLKB 2BXTH 1P3EA 1VCQA 3SV6A 1QNJA 2PLXA 4B2CA 3U69H 1P57B 2VWNA 1RJXB 2ZGJA 3MU8A 3RMLH 4X8UH 4ABAA 1ANEA 1V2MT 2ILNA 2FOCA 5FPYA 1AUJA 2SGAA 3NKKA 2RCEA 1ELFA 2R2WU 3TH2H 1ETSH 1F0RA 4D76A 1O2KA 3T2NA 4CH2B 3R3GB 2VIPA 1EX3A 3E16B 1OWDA 1TIOA 1GBBA 2ODPA 4GPGA 4B74A 2A4RA 3PROA 1HFDA 2UUJB 5LPFA 2P95A 4KGAA 1KYNA 3ZVFA 2AMPA 1A61H 3SN8A 1C1TA 5IDKA 1SGFA 4O3UA 2GT8A 2SGQE 1OP2A 2ZFTA 5E0JA 1MTNB 1O38A 3ODFA 3UOPA 1GMHG 1LPZB 1O31A 1P3CA 3MFJA 1PQAA 2FO9A 2HALA 2PWXA 1SOTA 3GCOA 1FMGA 5A0AE 2BY9X 1OPHB 3V7TA 1AU8A 3SNCA 4PROA 4NWLA 3GCTG 1MTNC 1BRUP 3KNXA 5GXPA 1CT0E 3LONA 4YESB 3QLPH 1GL0E 4NIWA 1PPEE 4U30A 2VB0A 1GBKA 2P3FH 1GMCF 1KLTA 3SU0A 2FS9A 4XFQA 1F5KU 1O35A 1PPZA 1NU9A 5I46H 2WYJA 3O8RA 1QQUA 2HNTF 1Y3UA 3SU6A 7ESTE 1GHAG 5EXLA 2WUBA 4WXIA 1HJ9A 4ZUHA 3A8AA 2OQ5A 1BDAA 1TOMH 1P2QA 4Q80A 2BXUH 1MBMA 2C8YB 1CT4E 3RXFA 4ABFA 3S9CA 1CHOF 2LNCA 4FUFA 1GI1A 3VB4A 4NA8A 3A84A 1KDQB 1SOZA 1MAYA 1D6RA 3AAUA 1GWAA 1TRYA 3UREA 5DG6A 5FBEA 1B0EA 1FN6A 5K0HA 5EOKA 1YGCH 1SLUB 4AFSA 4DOQA 1GHZA 5F03A 2Y7XA 2YNAA 1O2VA 2AFQB 3GCTF 3OU0A 3LC3A 2XCFA 1D6WA 2ZDLA 1VGCB 4B76A 1ELEE 5DP7A 5FBIA 1CO7E 4BTTB 1NC6A 1HAPH 3M37A 1C5ZB 2XWAA 1LVYA 5JB9S 1H8DH 3Q76A 4WF8A 1WTHD 4A6LA 4DURA 3M7UA 2C93B 4Y79A 2ZHQH 1C5NH 1F0UA 2BDCA 1C2EA 5GCHF 4XBCA 3ATLA 4X0WU 2QXGA 1GJ8B 1SGQE 5B6OA 4MLFB 1UO6A 1G3BA 3RXDA 2ANWA 1ZJDA 2Z9GA 2Z9JA 1YLCA 4X6OA 1KSNA 3SUEA 3KQEA 2HOBA 3MNBA 1QIXB 4ABGA 3GCHB 4IN2A 3FFGA 2VWLA 2Y81A 2UUFB 1K1PA 2NWNA 3LDXH 2ZG0H 2ESTE 5EU8A 3GY4A 3SBKA 2FXRA 1Z8IB 2BDGA 2OC8A 1OYQA 2H5DA 3BEIB 2XBXA 2ZHFH 2C3SA 2ZGCA 1QB9A 4R0IA 1O3OA 1YPEH 1HXFH 3QDZB 1J17T 1YKTA 2RA3A 4NIYA 1O2OA 1ELAA 3TIUA 5HGGA 1DUAA 2WUCA 1KTTB 1ESBA 2VGCB 2A0QB 3EA7A 1TBZH 1P01A 8GCHG 3QN7A 3V3MA 2UUKB 3LGUA 1S81A 4HGCA 1E35B 4F49A 1OWJA 1HIAB 1YYY1 1ELGA 2I6SA 4UFGH 1TAWA 3A8DA 3JZ2B 2VGCC 4YT6H 2F9UA 3RXEA 4ZKNU 5A0CA 1SGNE 2G8TA 1A0LA 2H2ZA 3FAOA 3ODDA 2DUCA 3MU1A 3SV8A 1ID5H 2Y5FA 1TLDA 1TRNA 1BTUA 4THNH 3P8NA 3STIA 3ITIA 1EKBB 1O2SA 5FAHA 2WPLS 2EEKA 2GCTB 1GBFA 1D3TB 1QJ6B 1WUNH 1TRMA 1IQHA 2QCYA 1S83A 3MNXA 1J8AA 1SHHB 1FY3A 1GCDA 3R0FA 3TK6A 3M3VA 4DIHH 1O30A 3CS0A 3TH4H 2GCTC 2ZCKP 3MMGA 3PB1E 2Y82A 1AE5A 1AFQB 2A2QH 8GCHF 4IBLH 2SFAA 3JZ1B 4YTAA 2ZHEH 3PV4A 1J14A 1C5LH 3I77A 2R2MB 1GI5A 3T27A 1O33A 3A8CA 1FDPA 4TPYA 1AFQC 3AASA 1XVMA 2BHGA 2W5EA 1C2FA 3IG6B 5C1XA 3MO3A 3MO9A 2OP9A 1G3DA 1DXPA 1O2XA 1DX5M 2XNIA 5BRRE 1AMHA 2UWPA 3RXIA 1UTOA 3KGPA 1C5TA 4D9RA 3U8OH 1L4DA 1Q31A 1AZ8A 3K9XB 3MH5A 4A92A 1MZAA 1GJAB 1XX9A 3F6UH 2VINA 1Y5UT 1YPLH 1O32A 4ISLA 1TE0A 1E37B 1QFKH 3M7TA 3PM3A 1GBCA 1C1OA 3PTNA 1TGBA 3M5MA 1HJAB 1K21H 1MU6B 2PGBB 4OGXA 5AFYH 1F2SE 2PTCE 1IQLA 2PGQB 1FY4A 1A7SA 4FUBA 3LH3A 5FPTA 1TPAE 2CMYA 1XUGA 5C3NA 3OTJE 3LKWA 1HJAC 1MTUA 5EQSA 2J4IA 2ZU2A 4Y10E 3DFJA 1XVOA 1V2UT 4XSKU 4X1PU 2ZU1A 1ZRKA 2GMTB 3GYMA 4U2WA 3EA9A 4CH8B 1AD8H 1BTWA 3BEUA 2A5IA 3PWBA 4DW2U 2GGVB 1CHGA 1ZLRA 3ZVCA 3SJ8A 2QN5T 4AORA 1ZMNA 3RXVA 1IQFA 1S6HA 2FDAA 3S9AA 3PYHA 2PW8H 5DP3A 4IC5A 1A5GH 3VXFH 1HCGA 1JIMA 4DGJA 3S7HB 2BLWA 4I8HA 1SGIB 2SGEE 2Z7FE 3K2UA 1C4V2 2TGDA 1O2MA 1O3PB 1UVTH 2HLCA 4DCDA 1HJ8A 2GCHG 2H9TH 1UCYE 3SHAH 2BLOA 5T6GA 3CENA 4DVAU 5FCKA 3RMMH 3UWIA 2C4FH 1EZUC 1GI0A 3LIWA 1PFXC 1FY8E 5DO4H 1NS3A 1GJ5H 2OLGA 1DVAH 3SQHE 3ZVDA 5ETXA 4H6SB 3MH6A 1RRKA 2R3YA 2BDBA 1XKAC 3TJVA 1YC0A 1JXPA 2BVSH 3VEQB 1KIGH 3E91A 4JK5A 3BTTE 1V2PT 4NG9H 2QF3A 2J34A 1C5UA 1THSH 2CXVA 3L33A 1XUJA 3LGTA 1O3FA 2P93A 5HM2A 1EJAA 2TIOA 1BTYA 1JWTA 3QZRA 1GBIA 2H9EH 1V2WT 1QGFA 2V6NA 3Q77A 2ZIQH 1LQEA 2ZFSA 1UTJA 4CRFA 4ZKOU 3ZZ9A 2BLQA 1GDNA 1W8BH 1JOUB 1TA6A 2AGGX 3C27B 5GIBA 1HNEE 1MBQA 1FV9A 3M5OA 4X1RU 2DE9A 2H1UA 1ETTH 4ZKSU 4WJG2 4FUHA 1HAZB 1K1JA 1UJ1A 1G37A 1QA0A 1KXFA 1GBLA 1O5GH 2ZDKA 4ZHLU 1C2GA 4YLUA 1ORFA 2WV5A 1ANBA 3SOSA 4ABHA 1CGJE 3UNQA 1GI3A 4FU8A 1AE8H 3ZYEA 1BMAA 2GDEH 2ANYA 4CRAA 4X8VH 3RXGA 2ALVA 4HI3A 2VH6A 4AB8A 1SGFG 1UTKA 1J9CH 2ZQ1A 4LZ4B 1NFYA 4JZEH 3UY9A 3V0XA 2TBSA 1MH0A 1EOJA 2OC7A 1K1LA 1Z6EA 4VGCB 2ZFPH 1F0SA 1GJ9B 3MU5A 1AY6H 2GD4B 2UWOA 1D3PB 1K22H 1XUKA 1SQAA 1RTFB 4A5TS 4NA7A 1Y3VA 3K6ZA 1W2KH 2ZO3H 1E34B 3RU4D 3A80A 2ZU4A 3SI4H 1FY5A 2G4UA 5JBAS 1RXPA 1P10A 2JKHA 3LT3A 1V2RT 2ZTYA 1K1IA 1AFEH 1GCTB 1LHGH 4K8YA 4VGCC 1GMDG 1TGCA 1HAGE 1G3EA 2OC1A 5HMAA 4AG1A 1SBWA 1W0YH 2FOFA 4X6MA 4ZXXH 1GJ6A 1WBGB 1IQEA 2ODQA 4AG2A 4O97A 4ABEA 3FP7E 1A0JA 1V2JT 4RKOB 2FI3E 9ESTA 1D3DB 1WCZA 1QL7A 3P70B 3M5LA 4MNWA 1ARCA 1GJ4H 1AKSA 5EQRA 3P95A 1OWHA 1PJPA 1V2TT 2A32A 3PMHB 2J95A 2HPPH 3SZNA 2Y7ZA 3HGPA 4GLYA 3MNCA 1C5WB 5C20A 1UCYH 1MKXH 1QQ4A 1YPKH 3H5CB 5TJXA 2BB4A 1LCYA 1HAYB 3SJOA 3GDVA 4AZ2B 1TMUH 2O8TA 4WH6A 4X8TH 3PMBB 1PPBH 1SHYA 4H4FA 2PTNA 1O3HA 2QC2A 1V6DA 1ZMLA 3HK6B 2ZWLH 1SGPE 1P2JA 2F9VA 3EAJA 1OXGA 3O8CA 3F9HA 4INLA 5JPMH 3SUDA 1HAIH 5GWZA 1YF4A 5FXLA 4AX9H 1TNGA 1J15A 1OWEA 1W13U 4NSVA 1GHYH 5T3HA 3RXLA 3A89A 1OOKB 1SQTA 1Z8GA 1TPSA 1AWFH 4X6PA 5FHTA 1L1GA 2EI7A 2FMJA 1B5GH 1BJVA 3DUXH 4CHAB 3A7YA 1AGJA 1T8OA 1HAXB 3P8GA 1C2HA 4GHTA 4FUEA 1ZSLA 3A87A 6GCHG 2C8ZB 5GDSH 3SU2A 1OX1A 1VCWA 1P2IA 4FVBA 1ZPCA 4DG4A 4LOYH 1ZHRA 4ABBA 2F9PA 4CHAC 1JRSA 5C5NA 3D49H 2BQ7B 1EB2A 4JYVH 1P2OA 4O9VA 3BN9A 1AHTH 2J2UA 1O3EA 2FI4E 3FVFB 3UPEA 1QHRB 3A7ZA 5LGOA 1HDTH 1QTFA 1C9TA 1GJ7B 4MPXA 3GDSA 1BBRK 1O3NA 1JIRA 1QB6A 4FUDA 2P3UB 1GHVH