1FY1A

[r23s,f25e]hbp, a mutant of human heparin binding protein (cap37)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
225
structure length
225
Chain Sequence
IVGGRKARPRQFPFLASIQNQGSHECGGALIHARFVMTAASCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQQNLNDLMLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRGPDFFTRVALFRDWIDGVLNNPGPGPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antimicrobial protein
molecule keywords HEPARIN-BINDING PROTEIN
publication title Two mutants of human heparin binding protein (CAP37): toward the understanding of the nature of lipid A/LPS and BPTI binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 225
sequence length 225
ec nomenclature
pdb deposition date 2000-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy1A02
2G51A 3S69A 5A8XA 1SG8B 1TIOA 2A2XH 6GCHG 4DOQA 3ZV8A 3CP7A 1ELTA 1GMCF 2FOFA 2VIQA 4NSYA 1LO6A 3KHVA 3ATKA 1SI5H 1FY3A 2QXJA 1AGJA 1TRNA 4MPWA 5I25A 4Y6DA 2ZG0H 3ODFA 4JYTA 1A0HB 4WMFA 1Y8TA 4A5TS 5C20A 1BHXB 2PTNA 4FUFA 1T32A 3GCOA 3RXAA 1TOCB 3ZYDA 3PMAB 2J38A 1S82A 5C1UA 1ZTKA 4ABEA 1AY6H 1A5HA 1GG6C 3A7YA 4TY7A 5EQRA 2XBYA 4DG4A 5LPFA 2UUKB 3ZVDA 1A7SA 1UTMA 1F0UA 5A09A 1EAUA 1ZHRA 4K8BA 1IQIA 4X8SH 1ESBA 4FUBA 2Z3EA 1C5VA 2FZZA 1BTZA 1CO7E 3SU4A 1YYY1 4JMYA 1KLJH 1DWEH 1PPFE 1FQ3A 2R2WU 1HAVA 2QN5T 3RXLA 3UOUA 4X1PU 3RC4A 1GBDA 2HVXA 3OU0A 3P95A 5T3HA 4DY7B 3NUMA 4K69A 4NG9H 1FIWA 2ZQ2A 3PMHB 1UCYE 2AS9A 5GXPA 5E0GA 2THFB 2GZ8A 4FU8A 1HAOH 1HRTH 1P11E 2LNCA 2ZF0H 1FAKH 1TQ7B 1AIXH 1B0EA 1C1TA 3BEFB 1SC8U 3LGVA 4X2XA 1OYTH 2BZAA 2OC1A 2I6SA 1P12E 5EG4A 1C1RA 1SPJA 3TVJB 3EYDA 1TRYA 4YESB 1P8VC 2JH5D 2Y82A 3D65E 1TNLA 4ISHH 2ZU4A 3EDXB 2B0FA 2HWLB 2ZGXH 3TK6A 1RTFB 5DP8A 1E0FD 2OD3B 3A85A 3NK8A 1P2JA 3T28A 3M3TA 4MLFB 3AAUA 1RJXB 3SJ8A 4K1SA 2BD5A 4UE7H 3RDZA 1TMTH 3MI4A 5F8TA 1O2UA 1DWBH 1V2PT 3KQEA 5GCHG 2PUXB 3BTQE 2FX4A 1O2MA 2FOBA 1LPKB 3C1KA 4UFEH 2O8UA 3PV4A 2QY0B 1D3TB 4LXBH 4Q80A 1UTPA 4ZMAH 1ELVA 2W7SA 1GJCB 1G9IE 4RKJB 3M3SA 1MTNC 1A46H 1QA0A 1BTWA 2BY8X 1F0TA 2XWAA 4AGKA 1C1QA 1SGEE 4H4FA 1C5ZB 1EQ9A 2OBQA 2XC0A 4GSOA 4NA9H 1QA7A 2Y7XA 2BQ7B 3A87A 1IQGA 1C5MD 1OYQA 1Y5AT 1UCYK 1C5YB 1PFXC 3BTWE 1HJAB 1ETTH 3Q77A 1C2LA 1FDPA 1YPJH 3F9EA 2GGVB 2BDGA 3FANA 1HYLA 2ZECA 1QNJA 1F5LA 1TGSZ 3ZZCA 3SV7A 2FIRH 1MQ5A 1Z8RA 3H7OA 1GBAA 1NY22 1OX1A 1OSSA 2XRCA 3GCTF 1WCZA 3UFAA 1DWDH 1Z1IA 2FOEA 1GVKB 1O3IA 3RXFA 3NWUA 4GLYA 3A7TA 1SHYA 2NU2E 4OGXA 2FPZA 1KLIH 1CGIE 5JB8S 2CMYA 7GCHF 3VGCC 4DURA 4DIIH 1DSTA 2ZDLA 1GMHG 1BTUA 1MKXK 1HUTH 1ARBA 2A7CA 3EA7A 3RXSA 2ZHWH 1J15A 3SU2A 2AYWA 3MU4A 3S9AA 3UNQA 1P01A 1EPTC 5F8XA 1DM4B 2PKSB 1ZMJA 3MH6A 3T62A 3CENA 1HGTH 2ZGHA 4BANB 1EOJA 5C2ZA 2NU4E 1Z6JH 1MBMA 2BD4A 1GBCA 2A31A 5DP6A 1SGDE 1TNGA 5ETXA 1SQAA 2BHGA 1L4ZA 1NT1A 3GY5A 1C1OA 3B8JA 2Y5GA 2H2ZA 1SLVB 3V12A 1NN6A 2CGAA 3KIDU 1TBQH 1CT2E 3RXOA 3RXEA 1VCPA 5A0CA 4ABHA 1P09A 3HGNA 3KN2A 3M7QA 2Z7FE 2GT8A 1F7ZA 4H42U 2A7JA 2QIQA 2BDCA 1BBRE 1P57B 3RLYH 3E3TA 2Z6BD 5EW1H 4KTSA 1O0DH 3B9FH 1EJAA 1V2UT 3U98H 1AU8A 1O2PA 2O8TA 2HNTF 1SGYE 1AB9B 1ABIH 1BTHH 1GJBB 2ZTXA 1C2GA 4DVAU 1BTYA 1NRQH 2ALPA 4OS2A 1C4V2 5AFZH 1GI3A 2ZC9H 1KXFA 3HKJB 1JWTA 1TGNA 4NA7A 3HGPA 1TOMH 2A2QH 1CHGA 5DKMA 3LONA 1RTKA 3R0FA 1QL9A 1WV7H 2GCTB 1HV7A 2J9NA 3F6UH 3E6PH 1MTSA 3LGWA 1W7XH 4SGBE 1GBKA 5F8ZA 1VCQA 2Z9JA 3CS7A 2AGIX 1P04A 1AFQC 1GI7B 1DLKB 2W26A 1BITA 2AGEX 3M37A 3E16B 2Z9LA 1KXEA 3CS0A 1NESE 1MKWH 2PHBA 5JBTA 1Y3WA 1YBWA 4FUIA 4UFGH 5FHTA 2Q6DA 2HALA 1XXFA 2SFAA 5C67A 3K6YA 3M36A 1MQ6A 3BTME 1GHBF 3SO3A 3TGIE 2ZNKH 2HRVA 5T6FA 5EODA 4O97A 1UVPA 1SQOA 1IQNA 2H5CA 1K21H 4X1QU 2ODQA 2W7UA 1EZQA 1P3CA 1PPCE 1PJPA 4YLQH 3S7KB 1ANDA 1O2XA 2VGCB 4YLUA 1NFYA 5L6NH 3SUEA 1BJVA 1EUFA 2UWPA 1HAIH 3MH4A 1Z8IB 1EJMA 1BMNH 2P93A 1P9UA 3ATWA 3O8BA 3S9CA 3HK3B 2WV4A 1RIWB 4NA8A 1CGJE 1OWJA 2OC0A 3SQEE 3DUXH 2ZQ1A 3SJKA 2FOAA 1VITG 1D9IA 1TGTA 3MMGA 2Z94A 4NWLA 2FLRH 2F9OA 1KSNA 1WSSH 3Q3XA 1A3EH 5LGOA 4AFQA 3O8DA 4B2AA 2ZDAH 4D76A 4A1TA 5JBBS 1C1WH 5TCCA 4JZ1A 1QIXB 3M5NA 1CU1A 2TGTA 1DWCH 1N8OC 2ZFPH 1RS0A 3LKWA 1TX6A 1V2OT 2FP7B 1PPZA 1SSXA 4Y0ZE 5FPSA 1DXPA 3BF6H 1JMOH 3NXPA 2DE8A 1ZLRA 4K8YA 1L0ZA 1C2MA 2Y5FA 2ANWA 4MDSA 4MNYA 5IYTA 4IGDA 2CF8H 3PTNA 1UHBB 3LJJA 1QL7A 4IBLH 1NM6A 1WOFA 4JZDH 1O3BA 3VXFH 5K0HA 2J2UA 2A4RA 2F9VA 1TX8A 1PPEE 1BB0B 1S6HA 2V3OH 2ZDVH 1QL8A 2FODA 3SNDA 1AQ7A 1UTJA 2B8OH 2ZDMA 3BG4B 1CA0C 2Q6FA 1DE7H 1DFPA 1C2DA 4BTTB 3Q3YA 4VGCC 4X1NU 2YOLA 1HAGE 2ZDKA 4O3UA 2HGTH 2ZGJA 2XBVA 1FMGA 1W3CA 3QZRA 5LH8A 1AUJA 1ZMNA 2SNWA 1K1PA 1JBUH 2FO9A 6CHAC 5DP9A 1DXWA 2VIWA 3MH7A 4HFPB 1HAZB 1UTNA 1XUJA 1QJ7B 2YNBA 4MVNA 3D62A 3RXMA 4UDWH 2D26C 1LTOA 1Y3VA 1XUKA 2H9HA 4OS6A 3GOVB 4WMEA 2FEQH 3DFJA 1FUJA 2BDIA 1NFWA 3QLPH 2OP9A 3SGAE 1BIOA 1KLTA 5B6OA 3PWBA 4CR9A 2BD9A 1UTQA 3T25A 4B71A 2XYAA 3E0PB 5IDKA 2WINI 3SJOA 3F9FA 1TRMA 3A8CA 1TGCA 4ASHA 1UVSH 2GMTC 3VFEA 5A8ZA 1F2SE 1V2VT 2O8MA 1GJ5H 2DE9A 2ZCHP 1O3EA 3UOPA 1MUEB 1MU8B 8GCHF 2BDAA 1SGTA 4ABDA 4IMQA 1BHXF 1K1LA 3OX7U 1Q3XA 1FONA 2BXUH 2HOBA 1QBOA 2UWLA 1BJUA 7KMEH 5FBIA 1JRSA 5L30H 1BCUH 3PMBB 1S85A 5AF9H 1KXBA 5JDUB 3A83A 2BDYA 1D3PB 3NCLA 4GCHF 2FLBH 4ZXXH 3W94A 1WAYB 1K22H 1WTHD 4ZHLU 2QYIA 3GICB 2R0KA 4Y10E 2NU0E 1GHZA 2F91A 1S84A 4AORA 1P2KA 3P8NA 3QTOH 3S9BA 1IQLA 1B5GH 4RN6A 1L1JA 1LHGH 4X8TH 4B75A 4KP0A 2R2MB 4CH2B 2KAIB 5DPAA 1CBWB 1LPGB 3Q00A 3FAOA 1H9LB 1H9IE 2RCEA 5E8EH 3BV9B 1PPBH 2A4QA 2PFEA 1ARCA 2QC2A 3UNSA 2GDEH 3LC3A 1O3LA 3M7TA 5PTPA 1RTLA 5GDSH 1HNEE 1TONA 1SMFE 1AVGH 4TWYA 1ELBA 1GI2A 3A80A 4NIVA 4U01A 3P70B 4AYVB 1T4UH 3BN9A 1AD8H 1UJ1A 2XBWA 3GYMA 2FYRA 1OWEA 1O5EH 4Y8XA 4AN7A 3AW1A 1PPHE 3UPEA 1KDQB 1SOZA 1AI8H 2P8OC 4INKA 1QBNA 4X6OA 4AYYB 1C9PA 1TQ0B 2LPRA 4AB8A 1T8OA 1IAUA 2ZTYA 4GHQA 4E05H 1O37A 2ZWLH 1P03A 1RRKA 2V35A 2NU1E 5BPEA 3HATH 3U9AH 3SGQE 2BLVA 2ZU5A 1EJNA 1UK2A 5CHAC 1GVZA 1GHWH 1GL1A 4HGCA 3H5CB 2J94A 3R3GB 2R0LA 4F49A 1IOEA 3QN7A 3A82A 1O2NA 2BY9X 2DUCA 1BMLA 3EE0B 1WTGH 4NIWA 1GDUA 3L6PA 1C2JA 3TJNA 3RU4D 3DHKH 4GPGA 1GI8B 3UR6A 4AZ2B 3RXQA 2BX4A 1HAHH 2BD8A 3EGKH 1ELCA 1BQYA 1YLDA 4NFFA 1O38A 4WVPE 4NIXA 1JIMA 5HGGA 2BD3A 4F4OC 2FI5E 2FS9A 1OWDA 1DS2E 4K5ZA 2GTBA 1BRAA 2STBE 1V2KT 2SGQE 3O8CA 3RXTA 2ESTE 1O2WA 2XC4A 3MTYA 2V0BA 1AKSB 1QB6A 1VGCB 1Z1JA 1C2HA 4J1YA 4X2YA 4IW4E 2Y6TA 2QXGA 3MNCA 3ZVEA 1GMDG 1LVBA 5HMAA 4D7FA 4FUDA 1YKTA 2GCHF 1BRUP 5EU8A 1QJ6B 1K28D 4O3TA 4CRBA 4FUCA 1KXAA 3GY3A 5C1XA 1D6RA 2AMPA 2ZKSA 4CRGA 1S83A 2Z9IA 1UHBA 4ZROA 3E1XB 2V6NA 3LH1A 1QY6A 1C5WB 4A1VA 1TMBH 3SHAH 5LPEA 3A8AA 2D1JA 1UVTH 2BD7A 2RA0A 3MNXA 4CH8B 1E34B 3SORA 4JK6A 1ELDE 1MCVA 1O34A 2ODPA 1ANBA 1VZQH 2VIDA 4MPVA 3UQOA 1EB2A 4ISIH 3URCA 4BTUB 3PTBA 4ABIA 1THRH 1HAPH 4ISLA 1TBZH 2O8LA 2H9EH 3BIVH 4Q2KA 2A4GA 1F5RA 2VWMA 4IC6A 3TK9A 4B2BA 1GJ8B 1QGFA 3DFLA 1YCPH 3ZVCA 1DSUA 3K9XB 3RLWH 3GDUA 4CRFA 1O36A 4ZHAA 4AFUA 1O2VA 1NU7B 3KQBA 3U8RH 3FZDA 4JZFH 1MTWA 3KQCA 2G52A 2YNAA 4YT7H 1OWIA 1ID5H 1YPLH 1GHXH 1XX9A 2ZFSA 2FOMB 1VR1H 8LPRA 1SB1H 2ANYA 1G30B 2OCVB 1V2LT 6GCHF 1TPSA 1ANCA 2QF0A 1O33A 4CREA 1GBJA 3AAVA 1VCWA 1H4WA 3K65B 2ZTZA 2XXLA 4WJG2 2UUFB 1W0YH 1NS3A 2BY5X 2PGQB 1TAWA 4NIYA 4H6SB 3SHCH 2PSYA 4LOYH 3GCHB 2EEKA 2GD4B 2F83A 3ZZDA 1O3PB 1GBFA 2QV1A 4KTUA 4ZAEA 1XUHA 1YM0A 1SGNE 3SUDA 1YPEH 3ZZAA 1AWFH 1LCYA 1ZHMA 4X1SU 3U8OH 1EB1H 5E2PA 1C4U2 4X6MA 5EOKA 5C5OA 4B2CA 2D8WA 3VEQB 3FVFB 1UVUH 4DT7B 4DJZB 1G2MA 3QK1A 4MNWA 1UK3A 1O5BB 2H6MA 2WUBA 1RFNA 1BTXA 2ALVA 3TNSA 1ELGA 2Q1JA 5C1YA 3ZZ7A 4K1EA 3Q76A 2G8TA 3PO1C 5FX5A 3P8GA 3RU4E 2ZGBH 2RA3A 3TNTA 1GI6A 3MU5A 1XUGA 1GI9B 1GHYH 4MPUA 2ZPRA 1GPZA 3MHWU 1TFXA 4NZLA 1HJAC 3AASA 3PLKA 1G3CA 4YT6H 1CSOE 2VJ1A 2W5EA 3MH5A 2BD2A 4CRCA 1O2YA 3M61U 4K3JA 5CE1A 1LQDB 1LHEH 2OBOA 2KAIA 1FY8E 1DVAH 1GDQA 1LMWB 2HNTE 2FYQA 4FUHA 3LH3A 2BLWA 1J9CH 4JCNA 1G32B 1KTTB 1GI0A 4AG2A 2AIQA 1P2IA 1RD3B 1IQMA 2IPHA 3P17H 3RXKA 1JRTA 2WYGA 4ZXYH 4Q7XA 5HM9A 1GJDB 5GCHF 1V6DA 2PW8H 2JH6D 5AVDA 1KDQA 1QBVH 1BA8B 3TH2H 1ORFA 3SV9A 1NC6A 1ACBE 2PKSC 1IHTH 1O2HA 2VVCA 1AN1E 2TBSA 3AVZA 4ZHMU 5E0JA 1LKBA 3PLBA 2EI7A 1GBBA 4X8VH 2OUAA 3TIUA 3L3TA 1SHHB 3OSYA 5DK1A 2BLQA 2A4OA 1OOKB 2RDLA 3GYLB 4B74A 4JYUH 2VIVA 5JBAS 1K1MA 5L2YH 1JOUB 1O39A 1W8BH 3DT0H 1ZHPA 1FZZA 1GBIA 1FN8A 3UREA 1QTFA 3SUGA 1T31A 4GVUA 1V2WT 3RXBA 3UTUH 2ZA5A 1L2EA 2P95A 5K7RA 3HK6B 4WMDA 3LGUA 1F0RA 4FUGA 3RMMH 3ZZ5A 3BG8A 4D9QA 1AB9C 3VB3A 4Y8ZA 5GJ4B 1ZSJA 1O5DH 1CT4E 3BEUA 2FI4E 3GY4A 4MNXA 3TPIZ 3SU3A 3SNBA 1C2EA 3FFGA 5EXMA 2QXIA 1TNKA 2ZU2A 4OS4A 2Z9GA 1KXDA 1LHFH 1G36A 2OINA 3SNCA 1KYNA 2BXTH 1EAXA 1SGFG 1AKSA 1BBRK 4K60A 3VB6A 2WPJS 3QDZB 1MD7A 2R9PA 1S81A 1FXYA 2AIPA 2C8ZB 4DGJA 1G3BA 1IQJA 2J4IA 1GMHF 1E38B 1LVYA 2XCFA 4BAMB 1UCYH 3RXVA 3FP7E 4YO9A 1MAXA 3D23A 3VPKA 1NRRH 4FUEA 4I32A 1O3FA 2BOHB 3BTTE 3A81A 1K1JA 4UD9H 1A5GH 3ZVBA 4Y79A 1MZDA 3JZ1B 3WY8A 3TLOA 1GGDB 2BY7X 4X0WU 3GISB 1GHAG 2AMQA 1IQHA 2ANMH 2VGCC 3BSQA 4SGAE 1IHSH 2G00A 1V2JT 2CF9H 1QB9A 4X2WA 4X8UH 1W11U 2O9QA 1VJAU 3MOCA 3FP6E 4FU7A 4MTBA 3MYWA 3BTGE 4ZH8A 1Z8GA 4BXSA 1HJ9A 3T26A 4FXGH 1ELFA 1DICA 1GJ4H 2HLCA 4KELA 4UEHH 4WH8A 2GV7A 1MKXH 4YTAA 2BB4A 3U1IB 1GJ6A 3ZZ9A 1LHDH 1WBGB 3KCGH 2OXSA 4U2WA 3E0NB 5AFYH 3SBKA 1X7AC 1MTVA 2A0QB 1EAWA 1DOJA 2A7HA 4TY6A 1P10A 1W14U 1UMAH 3PM3A 3NPSA 4CRAA 4DW2U 1C5TA 2NWNA 3A88A 4CR5A 1QJ1B 5HM2A 4INLA 1FIZA 1P9SA 2B5TB 1ZSKA 2XCNA 1S0QA 3GCNA 2PKAB 2TPIZ 1SFIA 3SZNA 2HNTC 2CV3A 5EQSA 2PWXA 1A1RA 1WQSA 2GT7A 1TNJA 1FN6A 1XUFA 1FY5A 3UQVA 2J92A 2UUJB 3QGNB 4YZUA 2BZ6H 1SVPA 1UTOA 3LT3A 4RSPA 1OP0A 1QB1A 1W10U 1FNIA 5FX6A 1MTUA 5EPYA 2OQUA 5DP7A 4LZ4B 4B73A 1LHCH 1DPOA 3G01A 3K6ZA 3GDSA 1SL3A 4MPXA 2PLXA 2VU8E 1AFEH 1MCTA 2AERH 2Y7ZA 3T2NA 1CHOG 1EP6A 3P8FA 2JETB 4J2YB 5FCRA 1PYTD 4Y76A 2A32A 4MNVA 1W12U 4JZIA 4Y7AA 4IC5A 5FXLA 1IQKA 2B9LA 1ANEA 1LKAA 1H8DH 2PGBB 4ZKOU 1DUEA 1DX5M 3SV6A 3TH3H 1YCPM 1FAXA 3C27B 2BYAX 3SJIA 1GMCG 2SGAA 2BQWB 1RXPA 3VB5A 3BG4C 4NCYA 5ESBA 2ZDNA 1BUIA 5DP3A 1UTKA 1XVMA 2CHAB 1WU1A 1GCTC 2P94A 1O2TA 5G4BA 1EZUC 1VITF 1ZRKA 1DDJA 5A2MH 1O3HA 4ABBA 1T7CA 2W3KA 2BVRH 4IS5A 2UWOA 3UUZA 4XE4A 4WXIA 3GY7A 1BT7A 4I7YH 9LPRA 2B7DH 3A7VA 5EGMA 5DG6A 4ZKRU 1THPB 4CBNA 2ZCKP 3PROA 2FOCA 3TGKE 3MO9A 4JZEH 1YC0A 5J4SA 3BTKE 3L33A 2GKVE 1NO9H 3RMOH 1TPOA 1AE5A 2STAE 1HDTH 3P8OA 3LPRA 1ZJKA 1B0FA 3BTDE 2VIPA 1DT2A 1HCGA 1O2RA 2XW9A 3QWCH 1JIRA 2A45B 2ZFQH 4QT8C 4NSVA 5JPMH 1C5LH 1GL0E 1P02A 3ITIA 2SGEE 4TYDA 1EATA 1Y3XA 4Y11E 3KNXA 1SLXB 2ASUB 3RM2H 4X1RU 1C1PA 3HKIB 3LIWA 5J4QA 3RXIA 3VB7A 1O2LA 3UR9A 4Q7YA 3N7OA 1TX7A 1ZGVA 1K1IA 2ZO3H 3PMJA 2ZZUH 1C2KA 1P2MA 1SLUB 5A8YA 5E0HA 4Z6AH 8ESTE 2C90B 2FESH 1EP5A 1TWXB 1V2NT 1T8LA 1NROH 4AFZA 7ESTE 4K1TA 3B23B 3UWJH 2GVFA 5HXFA 1J8AA 2ZU1A 2F9PA 2BLOA 1P3EA 1GG6B 2WPHS 2C93B 2A5KA 3MU1A 4Y7BA 2ZCLP 2P59A 1QRZA 3FZZA 4LZ1H 1S6FA 1JXPA 2GP9B 4DCDA 3U69H 1ZTJA 2ODYB 1A0JA 1NRNH 1XKBC 1XUIA 2VH0A 4CHAC 2JKHA 3W95A 1KTSB 2BMGB 3V7TA 2H5DA 4AG1A 1H1BA 1ELEE 1HJ8A 1C2FA 1CBWC 3RXJA 1CA8B 3MNBA 3MNSA 5FCKA 1BMAA 1YPHE 1BDAA 1UK4A 1SGQE 2PUQH 1O2KA 3O8RA 4AOQA 3SV2H 3OY5U 4Z0KA 1MH0A 3LGIA 2OC7A 3QGJA 5FBEA 3LGTA 4B76A 3ZVGA 2TGDA 4E06H 3LOXA 2ANKH 1O3DA 3NZIA 3SU0A 3ZZBA 3M5LA 1XXDA 1BRBE 2ZU3A 4I8JA 2HPQH 4D8NA 1SGCA 2Z3DA 3STIA 8KME2 1ZYOA 1ZPZA 1D4PB 2Y80A 1TMUH 4KKDA 5H4IB 3SU1A 1AZ8A 3GCTG 2TRMA 4IMZA 1G2LA 5FPTA 2FX6A 1GI1A 2FS8A 1K9OE 1TBRH 2CXVA 1XM1A 2F9NA 3SU5A 1Z6EA 2BVXH 1O30A 1SQTA 1BRCE 1B7XB 3E91A 7GCHG 4I8KA 2FXRA 4Q7ZA 4AGJA 1ZJDA 1AHTH 3TITA 2CN0H 1T8MA 3BIUH 1UO6A 1C5NH 5AHGH 3UWIA 5DJ7A 1CVWH 1G37A 1GBEA 1QRXA 4WY3A 1A3BH 4ABAA 1N6YA 2VWOA 1E37B 5TJXA 3KQDA 4PROA 1ZPBA 2SGFE 1FPCH 3T27A 5LPRA 1QQUA 2QCYA 3BEIB 2EI8A 1TABE 3GY2A 1HXEH 1SLWB 2ZHEH 3S7HB 1C5QA 1J16A 1HBTH 2ZHFH 1MTNB 5F03A 1N1LA 1LVOA 3ODDA 1ZMLA 3SN8A 1O2OA 1GHVH 4XDEA 3A7WA 3GDVA 4UONA 1IQFA 1YPKH 1K2I1 2WYJA 2BDBA 3RXRA 1O3AA 1VGCC 2FI3E 2WPKS 1HXFH 1UVOA 2A1DB 2PKAA 3A86A 2W3IA 1O3NA 3ELAH 1C1VH 2FTMA 1C5XB 4XSKU 1UTLM 4JK5A 1MKWK 1TA6A 4R8TB 2ZPQA 5EXNA 1RGQA 2F9BH 3RMNH 1C5OH 1FY4A 4TPIZ 1AMHA 4FU9A 3SJ9A 1O5CB 1YGCH 3SI3H 1P2QA 3MWIU 1TPPA 1Q31A 1MAYA 2Z9KA 9ESTA 1BTPA 3A89A 3URDA 2BDHA 1ELAA 1NRSH 4HI3A 1NTPA 4M7GA 4ZKNU 1HB0B 2OTVA 1GI4A 3EA8A 1VITH 4NGAH 4WXVA 1L4DA 4BXWA 1MD8A 2VNTA 2R3UA 5I46H 1FPHH 1A5IA 1K1NA 2VIOA 3RXGA 1D3QB 1DITH 3VGCB 2IJOB 5DO4H 2IN2A 3F9HA 1EX3A 2G4TA 1EZSC 3BTEE 4OS5A 1DANH 1ESAA 1EZXC 2P3TB 3PO1B 1O5GH 3IITA 4ZUHA 3UNRA 1TNIA 1EPTB 2BQ6B 1YPMH 1C5SA 2QGRA 2ZFTA 1MZAA 1EKBB 3OY6U 1AVXA 2GZ7A 3U8TH 1GHBG 4INHA 1O3CA 1V2QT 1GBLA 1LVMA 1Z8JB 3ZZ4A 1WUNH 1AE8H 3BTFE 4U32A 3SQHE 2FWWA 4UFFH 2G55A 2WPLS 4OGYA 2PSXA 1Z7KA 3RUOA 2EC9H 4B1TA 1CT0E 1ZPCA 4NFEA 1YPHC 4X2VA 2ZP0H 3F68H 3PB1E 3ZZ8A 2Q6GA 1DLEA 2VH6A 2EA3A 1GMDF 3TH4H 4ABGA 1NFXA 1G3DA 4BOHA 3TK5A 5FPYA 1ETSH 3IWMA 2H1UA 4XOJA 3RMLH 1C1MA 1HPGA 1AUTC 4Y0YE 1LPZB 1PYTC 1THSH 1EXFA 1HIAB 2SGPE 3H7TA 4A7IB 3GCHC 1P06A 1ZTLA 1FJSA 3M3VA 2M5TA 2G5VA 2J34A 1A4WH 1TALA 1A2CH 2G5NA 2XTTB 1LDTT 2FTLE 2F3CE 2OQ5A 1LQEA 2V3HH 1HAXB 1O2GH 3TGJE 1OP2A 5GIBA 4FVBA 1NZQH 1WQVH 1AFQB 5DP5A 1O32A 2J95A 2SGDE 2Z3CA 3U1JB 2FOHA 2D2DA 1TGBA 3KL6A 2C8YB 3SV8A 4A6LA 2FMJA 1ZRBA 2G4UA 5FAHA 4ISOA 1TB6H 4ISNA 3A8DA 4FVDA 1O5FH 2PV9B 1HAYB 2UUYA 2BY6X 1FV9A 4TPYA 1FI8A 5C5NA 3SOSA 1QRWA 3KF2A 2GDDA 5JYIA 4JYVH 1SGIB 3ZVFA 1U6QA 3ZVAA 3ATMA 1NFUA 1K1OA 1PPGE 5EQQA 2G81E 3PWCA 5EW2H 4FUJA 1YP9A 1QHRB 3M5MA 3V0XA 2ZPSA 3ZZ6A 4X6NA 1SGFA 2FOGA 1V2RT 3RXUA 3K2UA 5EPNA 1A0LA 1PQAA 4THNH 2C8WB 1IQEA 1C4Y2 1CGHA 4E7NA 1L1NA 2O8WA 1PQ7A 2R3YA 3ATIA 3I77A 4HTCH 1ZSLA 1Y5BT 2K1QA 3ATLA 4K2YA 3GY8A 1C1SA 1OKXA 4D9RA 1S5SA 1Y5UT 1OPHB 5EXLA 2ZI2H 6ESTA 4RKOB 4Y8YA 2HPPH 2ZGCA 4I33A 2PTCE 1O3GA 4E7RG 2A5AA 2P3FH 1XVOA 4AB9A 4GUXA 1O2QA 3SU6A 3S0NA 1P05A 1N8OB 1GWAA 1C5UA 3OYPA 4I8HA 2A5IA 4XBDA 1VJ9U 1J17T 1SGPE 1TPAE 2Y81A 7LPRA 3RXHA 1FY1A 4A1XA 3P92A 1KIGH 1L1GA 2GCTC 1OXGA 3TJVA 2VWNA 1W13U 1BZXE 3PYHA 2BVSH 2XNIA 1W7GH 2XWBI 2VVVA 4MG3A 3I29A 1ZR0A 4TWWA 2ZHQH 1EAIA 1YPGH 3OTJE 4D7GA 1O2SA 1W0ZU 3M35A 2RG3A 8GCHG 3AW0A 3RXDA 6LPRA 3QTVH 3IG6B 1GVLA 1C1UH 1Y3YA 3FP8E 3SI4H 3LGYA 3MO3A 5SGAE 1D3DB 1C2IA 2QF3A 4I8LA 4LK4A 1GDNA 3E90B 5GPIB 1CA0B 1AVWA 1O3MA 2C3SA 3TJOA 3SGBE 1DUAA 5DP4A 4AFSA 4VGCB 3ZYEA 1HAVB 1AWHB 1SBWA 3QX5H 3M5OA 4H6TA 5HYOA 1O2ZA 3STJA 2OC8A 4ESTE 1W2KH 3F1SB 4GCHG 1DY9A 3UY9A 1NPMA 4WWYA 1OS8A 6CHAB 1RIWC 1P2NA 3TU7H 3NKKA 1OWHA 4BAOB 3KGPA 4WF8A 1HLTH 1N6XA 3VXEH 4O9VA 1MU6B 3F9GA 3RP2A 1H8IH 3GY6A 5JBCS 3E8LA 1F0SA 1TA2A 1FLEE 3RM0H 4O03A 5T6DA 1O5AB 1Q2WA 2GV6A 2P3UB 1T4VH 1EOLA 4UFDH 4AX9H 2XBXA 4YM9A 1C9TA 3ZZ3A 3EA9A 1O3KA 1QURH 1HFDA 1MBQA 2QA9E 2FM2A 2ZHDA 4XFQA 3QZQA 4MQAA 1F92A 5JB9S 4ABJA 1OP8A 2IOTA 1CQQA 1XMNB 4ZKSU 1BOQA 2WPIS 2VINA 5F6MA 1ABJH 1EASA 4YOIA 1O2IA 3A7ZA 1AO5A 1C5RA 4GAWA 2GMTB 2ZEBA 1GGDC 1O3OA 3QUMP 2I6QA 1DY8A 2FDAA 1KXCA 3MU0A 5A0BA 3P6ZB 2TGPZ 1GCTB 2F9UA 1SGRE 1Z71A 4CBOA 2WUCA 1C5PA 3SW2B 4BNRA 1Y3UA 1EPTA 2OLGA 3ENSB 2WPMS 1YLCA 1S0RA 2QXHA 2WV5A 4X6PA 3RXPA 1TYNA 1GBHA 1KY9A 1A61H 1P0SH 2EI6A 3D49H 5ABWA 5L2ZH 2QAAA 1V2MT 1QFKH 1GBMA 3V3MA 3EAJA 4I8GA 2C4FH 4YOJA 3T5FH 5C3NA 3SNAA 2VWLA 3RC5A 4ABFA 2PR3A 4R0IA 1QR3E 2AH4X 2GX4A 2BTCE 2H9TH 3SUFA 3A84A 1BMMH 1GBTA 5E2OA 4XBBA 4U30A 2CJIA 1QQ4A 1XKAC 3LDXH 4OS7A 2AFQB 1MMJN 3KEEA 1ZZZA 2ZIQH 3UIRA 4OS1A 1HIAA 2JETC 4BTIB 2AGGX 3ESTA 4BAKB 3M7UA 1V2TT 1ZOMA 2ZFRH 3ZV9A 1TNHA 1YF4A 2SNVA 2GZ9A 4NWKA 5ESTE 2TIOA 1G3EA 1ZGIA 4A92A 3DA9B 3MU8A 3HPTB 1J14A 1GJ7B 1GHAF 1Y59T 3JZ2B 5DGJA 2ILNA 1NRPH 1YCPK 1AZZA 2C8XB 4I31A 1E36B 1BBRH 4CRDA 2GCHG 1D6WA 1O31A 2P8OB 2BX3A 2CHAC 2TGAA 5TCAA 2P16A 2XC5A 5BRRE 3VB4A 4XBCA 1PQ5A 1H9HE 3T29A 3PLPA 3A7XA 4IN1A 4Y71A 3SNEA 5CHAB 1GI5A 1OWKA 4YOGA 5T6GA 1TE0A 3QO6A 4CHAB 1P2OA 2ULLA 3TJUA 5CMXH 1GJ9B 4GHTA 4BAQB 3V13A 3LC5A 3MFJA 1NU9A 1V3XA 4HZHA 1SR5C 3BTHE 3LJOA 4BAHB 1QCPA 1WYKA 2BM2A 5GWZA 1INCA 2VVUA 3DD2H 1O3JA 2Y5HA 3RU4T 1M9UA 1CE5A 1PQ8A 4KGAA 2NU3E 3A8BA 1GCDA 1O2JA 4WH6A 2ZFFH 3I78A 1E35B 1O35A 1ESTA 1TLDA 1GJAB 1SFQB 1T8NA 3LU9B 1F5KU 4KTCA 3EQ0H 2AEIH 2BOKA 4NZQA 1C1NA 1CHOF 1SOTA 2JH0D 4IN2A 4DIHH 1ETRH 3MO6A 1V2ST 2AMDA 2VB0A 3RXCA 3RC6A 3Q3KA 5A0AE
chains in the Genus database with same CATH superfamily
2G51A 3S69A 5A8XA 1SG8B 1TIOA 2A2XH 6GCHG 4DOQA 3ZV8A 3CP7A 1ELTA 1GMCF 2FOFA 2VIQA 4NSYA 1LO6A 3KHVA 3ATKA 1SI5H 1FY3A 2QXJA 1AGJA 1TRNA 4MPWA 5I25A 4Y6DA 2ZG0H 3ODFA 4JYTA 1A0HB 4WMFA 1Y8TA 1E79D 4A5TS 5C20A 1BHXB 2PTNA 4FUFA 1T32A 3GCOA 3RXAA 1TOCB 3ZYDA 3PMAB 2J38A 1S82A 5C1UA 1ZTKA 4ABEA 1AY6H 1A5HA 1GG6C 3A7YA 4TY7A 5EQRA 2XBYA 4DG4A 5LPFA 2UUKB 5HIZA 3ZVDA 1A7SA 1UTMA 1F0UA 5A09A 1EAUA 1ZHRA 4K8BA 1WDIA 1IQIA 4X8SH 1ESBA 4FUBA 2Z3EA 1NBME 1C5VA 2FZZA 1BTZA 1CO7E 3SU4A 1YYY1 4JMYA 1KLJH 1DWEH 1PPFE 1FQ3A 2R2WU 1HAVA 2QN5T 3RXLA 3UOUA 4X1PU 3RC4A 1GBDA 2HVXA 3OU0A 3P95A 5T3HA 4DY7B 3NUMA 3N7DA 4K69A 4NG9H 5KGOA 1FIWA 2ZQ2A 3PMHB 1UCYE 5F53A 2AS9A 5GXPA 5E0GA 2THFB 2GZ8A 4FU8A 1HAOH 1HRTH 4AC9A 1P11E 2LNCA 2ZF0H 1FAKH 1TQ7B 1AIXH 1B0EA 1C1TA 3BEFB 1SC8U 3LGVA 4X2XA 1OYTH 2BZAA 2OC1A 2I6SA 1P12E 3DSGA 5EG4A 1C1RA 1SPJA 3TVJB 3EYDA 1TRYA 4YESB 1P8VC 2JH5D 2Y82A 3D65E 1TNLA 4ISHH 2ZU4A 3EDXB 2B0FA 2HWLB 2ZGXH 3TK6A 1RTFB 5HIYA 5DP8A 1E0FD 2OD3B 3A85A 3NK8A 1P2JA 3T28A 3M3TA 4MLFB 3AAUA 1RJXB 3FN8A 3SJ8A 4K1SA 1OHHD 2BD5A 4UE7H 3RDZA 1TMTH 3MI4A 2IJD1 2L6OA 5F8TA 1O2UA 1DWBH 3WWBA 1V2PT 3KQEA 5GCHG 2PUXB 3BTQE 2FX4A 3EE7A 1O2MA 2FOBA 1LPKB 3C1KA 4UFEH 2KR7A 2OK5A 2O8UA 3PV4A 3GS9A 2QY0B 1D3TB 4LXBH 4Q80A 1UTPA 4ZMAH 1ELVA 2W7SA 1GJCB 1G9IE 4RKJB 3M3SA 1MTNC 1A46H 1QA0A 1BTWA 3SZEA 2BY8X 1F0TA 2XWAA 4AGKA 1C1QA 1SGEE 4H4FA 1C5ZB 1EQ9A 2OBQA 2XC0A 4GSOA 4ZHLU 4NA9H 1QA7A 2Y7XA 2BQ7B 3A87A 1IQGA 1C5MD 1OYQA 1Y5AT 1UCYK 1C5YB 1PFXC 3BTWE 1HJAB 1ETTH 3Q77A 1C2LA 1FDPA 1YPJH 3F9EA 2GGVB 3OFND 2BDGA 3FANA 1HYLA 2ZECA 1QNJA 1F5LA 1TGSZ 1W0JD 3SV7A 3ZZCA 3KQ5A 2FIRH 1MQ5A 1Z8RA 3H7OA 1GBAA 3UB0A 1NY22 1OX1A 1OSSA 2XRCA 3GCTF 1WCZA 3UFAA 1DWDH 1Z1IA 2FOEA 1GVKB 1O3IA 3RXFA 3NWUA 4GLYA 3A7TA 1SHYA 1QZ8A 2NU2E 4OGXA 2FPZA 1KLIH 1CGIE 5JB8S 2CMYA 7GCHF 1E1RD 3VGCC 4DURA 4DIIH 1DSTA 2J97A 2ZDLA 1GMHG 1BTUA 1MKXK 1HUTH 1ARBA 2A7CA 3EA7A 3RXSA 2ZHWH 1J15A 3SU2A 2AYWA 3MU4A 3S9AA 3UNQA 1P01A 2QF4A 1EPTC 5F8XA 1DM4B 2PKSB 1ZMJA 3MH6A 3T62A 3CENA 1HGTH 2ZGHA 1YY3A 4BANB 1EOJA 5C2ZA 2NU4E 1Z6JH 1MBMA 2BD4A 1GBCA 2A31A 5DP6A 1SGDE 1TNGA 5ETXA 1SQAA 4ACAA 2BHGA 1L4ZA 1NT1A 3GY5A 1C1OA 3B8JA 2Y5GA 2H2ZA 1SLVB 3V12A 1NN6A 2CGAA 3KIDU 1TBQH 1CT2E 3RXOA 3RXEA 1VCPA 5A0CA 4ABHA 1P09A 2YMSD 3HGNA 3KN2A 3M7QA 2Z7FE 2GT8A 1F7ZA 3PV5A 4H42U 2A7JA 2QIQA 2BDCA 1BBRE 1P57B 1K0HA 3RLYH 3E3TA 2Z6BD 5EW1H 5FL7D 4KTSA 1O0DH 3B9FH 1EJAA 1V2UT 3U98H 1AU8A 1O2PA 2O8TA 2HNTF 1SGYE 1AB9B 1ABIH 1BTHH 1GJBB 2ZTXA 1C2GA 4DVAU 1BTYA 1NRQH 2ALPA 4OS2A 1C4V2 2HVYB 5AFZH 1GI3A 2ZC9H 1KXFA 3HKJB 1JWTA 1TGNA 4NA7A 3HGPA 1TOMH 2A2QH 1CHGA 5DKMA 3LONA 1RTKA 3R0FA 1QL9A 1WV7H 2GCTB 1HV7A 2J9NA 3F6UH 3E6PH 1MTSA 3LGWA 1EFRD 1W7XH 4SGBE 1GBKA 5F8ZA 1VCQA 2Z9JA 3CS7A 2AGIX 1P04A 1AFQC 1GI7B 1DLKB 2W26A 1BITA 2AGEX 3M37A 3E16B 2Z9LA 1KXEA 3CS0A 1NESE 1MKWH 2PHBA 5JBTA 1Y3WA 1YBWA 4FUIA 4UFGH 5FHTA 2Q6DA 2HALA 1XXFA 2SFAA 5C67A 3K6YA 3M36A 1MQ6A 3BTME 1GHBF 3SO3A 3TGIE 2ZNKH 2HRVA 5T6FA 5EODA 4O97A 1UVPA 1SQOA 1IQNA 2H5CA 1K21H 4X1QU 2ODQA 2W7UA 1EZQA 1P3CA 1PPCE 1PJPA 4YLQH 3S7KB 1ANDA 1O2XA 2VGCB 4YLUA 1NFYA 5L6NH 3SUEA 1BJVA 1EUFA 2UWPA 1HAIH 3MH4A 1Z8IB 1EJMA 1BMNH 2P93A 1P9UA 3ATWA 3O8BA 3S9CA 3HK3B 2WV4A 1RIWB 4NA8A 1CGJE 1OWJA 2OC0A 3SQEE 3DUXH 2ZQ1A 3SJKA 2FOAA 1VITG 1D9IA 1TGTA 3MMGA 2Z94A 4NWLA 4FOUC 2FLRH 2F9OA 1KSNA 1WSSH 3Q3XA 1A3EH 5LGOA 4AFQA 3O8DA 4B2AA 2ZDAH 3U28C 4D76A 4A1TA 5JBBS 1C1WH 5TCCA 4JZ1A 1QIXB 3M5NA 1CU1A 2TGTA 1DWCH 1N8OC 2ZFPH 1RS0A 3LKWA 1TX6A 1V2OT 2FP7B 1PPZA 1SSXA 4Y0ZE 5FPSA 1DXPA 3BF6H 1JMOH 3NXPA 2DE8A 1ZLRA 4K8YA 1L0ZA 1C2MA 2Y5FA 2ANWA 4MDSA 4MNYA 5IYTA 4IGDA 2CF8H 3PTNA 1UHBB 3LJJA 3F3BA 1QL7A 4IBLH 1NM6A 1WOFA 1H8HD 4JZDH 1O3BA 3VXFH 5K0HA 2J2UA 2A4RA 2F9VA 1TX8A 1PPEE 1BB0B 1S6HA 2V3OH 2ZDVH 1QL8A 2FODA 3SNDA 1AQ7A 1UTJA 2B8OH 2ZDMA 3BG4B 1CA0C 2Q6FA 1DE7H 1DFPA 1C2DA 4BTTB 3Q3YA 4VGCC 4X1NU 2YOLA 1HAGE 2ZDKA 4O3UA 2HGTH 4TSFD 2ZGJA 2XBVA 1FMGA 1W3CA 3QZRA 5LH8A 1AUJA 1ZMNA 2SNWA 1K1PA 1JBUH 2FO9A 6CHAC 5DP9A 1DXWA 2VIWA 3MH7A 4HFPB 1HAZB 1UTNA 3KYFA 1XUJA 1QJ7B 2YNBA 4MVNA 3D62A 3RXMA 4UDWH 2D26C 1LTOA 1Y3VA 1XUKA 2H9HA 4OS6A 2PP6A 3GOVB 4WMEA 2FEQH 4M9FA 3DFJA 1FUJA 2BDIA 1NFWA 3QLPH 2KFWA 2OP9A 3SGAE 1BIOA 1KLTA 5B6OA 3PWBA 4CR9A 5HKKD 2BD9A 1UTQA 3T25A 4B71A 2XYAA 3E0PB 5IDKA 2WINI 3SJOA 4ACBA 3F9FA 1TRMA 3A8CA 1TGCA 4ASHA 1UVSH 2GMTC 3VFEA 5A8ZA 1F2SE 1V2VT 2O8MA 1GJ5H 2DE9A 2ZCHP 1O3EA 3UOPA 1MUEB 1MU8B 8GCHF 2BDAA 5EJZA 1SGTA 4ABDA 4IMQA 1BHXF 3OAAD 1K1LA 3OX7U 1Q3XA 1FONA 2BXUH 2HOBA 1QBOA 2UWLA 1BJUA 7KMEH 5FBIA 3ZIAD 5DN6D 1JRSA 3F0PA 5L30H 1BCUH 3PMBB 1S85A 5AF9H 1KXBA 5JDUB 3A83A 2BDYA 1D3PB 2V3MA 3NCLA 2FLBH 4GCHF 4ZXXH 1WAYB 1K22H 1WTHD 3W94A 2QYIA 3GICB 2R0KA 4Y10E 2NU0E 1GHZA 2F91A 1S84A 4AORA 1P2KA 3P8NA 3QTOH 3S9BA 1IQLA 1B5GH 4RN6A 2HLDD 1L1JA 1LHGH 4X8TH 4B75A 4KP0A 2R2MB 4CH2B 2KAIB 5DPAA 1CBWB 1LPGB 3Q00A 3FAOA 1H9LB 1H9IE 2RCEA 5E8EH 1H8ED 1PPBH 3BV9B 2A4QA 2PFEA 1ARCA 2QC2A 3UNSA 2GDEH 3LC3A 2AHME 1O3LA 3M7TA 3F2FA 5PTPA 1RTLA 5GDSH 1HNEE 1TONA 1SMFE 1AVGH 4TWYA 1ELBA 1GI2A 3A80A 4NIVA 4U01A 3P70B 4AYVB 1T4UH 3BN9A 1AD8H 1UJ1A 2XBWA 3GYMA 2FYRA 1OWEA 1O5EH 4Y8XA 4AN7A 3AW1A 1PPHE 3UPEA 1KDQB 1SOZA 1AI8H 2P8OC 4INKA 1QBNA 4X6OA 4AYYB 1C9PA 1TQ0B 2W6JD 2LPRA 4AB8A 1T8OA 1IAUA 2ZTYA 3PV2A 4GHQA 4E05H 1O37A 2ZWLH 1P03A 1RRKA 2V35A 2NU1E 5BPEA 3HATH 3U9AH 3SGQE 3KYGA 2BLVA 2ZU5A 1EJNA 1UK2A 5CHAC 1GVZA 1GHWH 1GL1A 2YMSC 4HGCA 3H5CB 1W0KD 2J94A 2XNDD 3R3GB 2R0LA 4F49A 1IOEA 3QN7A 3A82A 1O2NA 2BY9X 2DUCA 1BMLA 3EE0B 1WTGH 4NIWA 1GDUA 3L6PA 1C2JA 3TJNA 3RU4D 3DHKH 4GPGA 1GI8B 3UR6A 4AZ2B 3WW7A 3RXQA 2BX4A 1HAHH 2BD8A 3EGKH 1ELCA 1BQYA 1YLDA 4NFFA 1O38A 4WVPE 4NIXA 1JIMA 5HGGA 2BD3A 4F4OC 2FI5E 3FKSD 2FS9A 1OWDA 1DS2E 4K5ZA 2GTBA 2KCOA 1BRAA 2STBE 4RT0A 1V2KT 2SGQE 3O8CA 3RXTA 2ESTE 1O2WA 2XC4A 3MTYA 2V0BA 1AKSB 1QB6A 1VGCB 1Z1JA 3OE7D 1C2HA 5C17A 4J1YA 4X2YA 4IW4E 2Y6TA 2QXGA 3MNCA 3ZVEA 1GMDG 1LVBA 5HMAA 4D7FA 4FUDA 1YKTA 2GCHF 1BRUP 5EU8A 1QJ6B 1K28D 4O3TA 4CRBA 4FUCA 1KXAA 3GY3A 5C1XA 1D6RA 2AMPA 2ZKSA 4CRGA 1S83A 2Z9IA 1UHBA 4ZROA 3E1XB 2V6NA 3LH1A 1QY6A 1C5WB 4A1VA 1TMBH 3SHAH 5LPEA 3A8AA 2D1JA 1UVTH 3F2HA 2BD7A 2RA0A 3MNXA 3NRLA 4CH8B 1E34B 3SORA 4JK6A 2KCAA 1ELDE 1MCVA 1O34A 2ODPA 1ANBA 1VZQH 2VIDA 4MPVA 3UQOA 1EB2A 4ISIH 3URCA 4BTUB 3PTBA 4ABIA 1THRH 3VG8A 1HAPH 4ISLA 1TBZH 4B6EA 2O8LA 2H9EH 3BIVH 4Q2KA 2A4GA 1F5RA 2VWMA 2W6ID 4IC6A 3TK9A 4B2BA 1GJ8B 1QGFA 3DFLA 1YCPH 3ZVCA 1DSUA 3K9XB 3RLWH 3GDUA 3H09A 4CRFA 1O36A 4ZHAA 4AFUA 1O2VA 1NU7B 3KQBA 3U8RH 3FZDA 4JZFH 1MTWA 3KQCA 2G52A 2YNAA 4YT7H 1OWIA 1ID5H 1YPLH 1GHXH 1XX9A 2ZFSA 2FOMB 1VR1H 8LPRA 1SB1H 2ANYA 1G30B 2OCVB 1V2LT 6GCHF 1TPSA 1ANCA 2QF0A 1O33A 4CREA 1GBJA 3AAVA 1COWD 1VCWA 1H4WA 3K65B 2ZTZA 2XXLA 4WJG2 2UUFB 1W0YH 1NS3A 2BY5X 2PGQB 1TAWA 4NIYA 4H6SB 3SHCH 2PSYA 4LOYH 3GCHB 2EEKA 2GD4B 2F83A 3ZZDA 1O3PB 1GBFA 2QV1A 4KTUA 4ZAEA 1XUHA 1YM0A 1SGNE 3SUDA 1YPEH 3ZZAA 1AWFH 1LCYA 1ZHMA 4X1SU 3U8OH 1EB1H 5E2PA 1C4U2 2VBCA 4X6MA 5EOKA 5C5OA 4B2CA 2D8WA 3VEQB 3FVFB 1UVUH 4DT7B 4DJZB 1G2MA 3QK1A 4MNWA 1UK3A 1O5BB 2H6MA 2WUBA 1RFNA 1BTXA 2ALVA 3TNSA 1ELGA 2Q1JA 5C1YA 3ZZ7A 4K1EA 2WV9A 3Q76A 2G8TA 3PO1C 5FX5A 3P8GA 3RU4E 2ZGBH 2RA3A 3TNTA 1GI6A 3MU5A 1XUGA 1GI9B 5IK2D 1GHYH 4MPUA 2ZPRA 1GPZA 2WPDD 3MHWU 1TFXA 4NZLA 1HJAC 3AASA 3PLKA 1G3CA 4YT6H 1CSOE 2VJ1A 2W5EA 5KECA 3MH5A 4ASUD 2BD2A 4CRCA 1O2YA 3M61U 4K3JA 5CE1A 5EJLA 1LQDB 1LHEH 2OBOA 2RDEA 2KAIA 1FY8E 1DVAH 1GDQA 1LMWB 2HNTE 2FYQA 4FUHA 3LH3A 4RI0A 2BLWA 1J9CH 4JCNA 1G32B 1KTTB 1GI0A 4AG2A 2AIQA 1P2IA 1RD3B 1IQMA 2IPHA 2V7QD 3P17H 3RXKA 1JRTA 2WYGA 4ZXYH 4Q7XA 5HM9A 1GJDB 5GCHF 1V6DA 2PW8H 2JH6D 4XD7D 1YLNA 5CHBA 5AVDA 1KDQA 1QBVH 1BA8B 3TH2H 1ORFA 3SV9A 1NC6A 1ACBE 2PKSC 1IHTH 1O2HA 2VVCA 1AN1E 2TBSA 3AVZA 4ZHMU 5E0JA 1LKBA 3PLBA 2EI7A 2L74A 1GBBA 4X8VH 2OUAA 3TIUA 3L3TA 1SHHB 3OSYA 5DK1A 2BLQA 2A4OA 1OOKB 2RDLA 3GYLB 4B74A 4JYUH 2VIVA 5JBAS 1K1MA 5L2YH 1JOUB 1O39A 1W8BH 3DT0H 1ZHPA 1FZZA 3DSPA 1GBIA 1FN8A 3W1EA 2XOKD 3UREA 1QTFA 2K0QA 3SUGA 1T31A 4GVUA 1V2WT 3RXBA 3UTUH 2ZA5A 1L2EA 2P95A 5K7RA 3HK6B 4WMDA 3LGUA 1F0RA 4FUGA 3RMMH 3ZZ5A 3BG8A 4D9QA 1AB9C 3VB3A 4Y8ZA 5GJ4B 1ZSJA 1O5DH 1CT4E 3BEUA 2FI4E 3GY4A 4MNXA 3TPIZ 3SU3A 3SNBA 1C2EA 3FFGA 5EXMA 2QXIA 1SQRA 1TNKA 2ZU2A 4OS4A 2Z9GA 3MQKC 1KXDA 1LHFH 1G36A 2J98B 4P00A 2OINA 1UW7A 3SNCA 1KYNA 2BXTH 1EAXA 1SGFG 1AKSA 3F0OA 1BBRK 4K60A 3VB6A 2WPJS 3QDZB 3N7EA 1MD7A 2R9PA 1S81A 1FXYA 2AIPA 2JDID 2C8ZB 4DGJA 1G3BA 1IQJA 2J4IA 1GMHF 2F43B 1E38B 1LVYA 2XCFA 4BAMB 1UCYH 3RXVA 3FP7E 4YO9A 1MAXA 3D23A 1FX0B 3VPKA 1NRRH 2M2AA 4FUEA 4I32A 1VKYA 4FETA 2CK3D 4YXWD 1O3FA 2BOHB 3BTTE 3A81A 1K1JA 1BMFD 4UD9H 4F48B 1A5GH 3ZVBA 4Y79A 1MZDA 3JZ1B 2WZQA 3WY8A 3TLOA 1GGDB 2BY7X 4X0WU 3GISB 1GHAG 2AMQA 1IQHA 2ANMH 2VGCC 3BSQA 4SGAE 1IHSH 2G00A 1V2JT 2CF9H 1QB9A 4X2WA 4X8UH 1W11U 2O9QA 1VJAU 3MOCA 3FP6E 4FU7A 4MTBA 3MYWA 3BTGE 4ZH8A 1Z8GA 4BXSA 1HJ9A 3T26A 4FXGH 1ELFA 1DICA 1GJ4H 2HLCA 4KELA 4UEHH 4WH8A 2GV7A 1MKXH 4YTAA 2BB4A 3U1IB 1GJ6A 3ZZ9A 1LHDH 1WBGB 3KCGH 2OXSA 4U2WA 3E0NB 5AFYH 3SBKA 1X7AC 1MTVA 2A0QB 1EAWA 1DOJA 2A7HA 4TY6A 1P10A 1W14U 1UMAH 3PM3A 3NPSA 4CRAA 4DW2U 1C5TA 2KCPA 2NWNA 3A88A 4CR5A 1QJ1B 5HM2A 4INLA 1FIZA 1P9SA 2B5TB 1ZSKA 2XCNA 1S0QA 3GCNA 1E1QD 2PKAB 2TPIZ 1SFIA 3SZNA 2HNTC 2CV3A 5EQSA 2PWXA 1A1RA 1WQSA 2GT7A 1TNJA 1FN6A 1XUFA 1FY5A 3UQVA 2J92A 2UUJB 3QGNB 4YZUA 2BZ6H 1SVPA 1UTOA 3LT3A 4RSPA 1OP0A 1QB1A 1W10U 1FNIA 5FX6A 1MTUA 5EPYA 2OQUA 5DP7A 4LZ4B 4B73A 1LHCH 1DPOA 3G01A 3K6ZA 3GDSA 1SL3A 4MPXA 2PLXA 2VU8E 1AFEH 1MCTA 2AERH 2Y7ZA 3T2NA 1CHOG 1EP6A 3P8FA 2JETB 4J2YB 3N99A 5FCRA 1PYTD 4Y76A 2A32A 4MNVA 1W12U 4JZIA 4Y7AA 4IC5A 5FXLA 1IQKA 2B9LA 1ANEA 1LKAA 1H8DH 2PGBB 4ZKOU 1DUEA 1DX5M 3SV6A 3TH3H 1YCPM 1FAXA 3C27B 2BYAX 3SJIA 1GMCG 2SGAA 2BQWB 1RXPA 3VB5A 3BG4C 4NCYA 5ESBA 2ZDNA 1BUIA 5DP3A 1UTKA 1XVMA 2CHAB 1WU1A 1GCTC 1O2TA 2P94A 5G4BA 1EZUC 1VITF 1ZRKA 1DDJA 5A2MH 1O3HA 4ABBA 1T7CA 2W3KA 4TT3D 2BVRH 4IS5A 4I86A 2UWOA 3UUZA 5T1VA 5CDFE 4XE4A 4WXIA 3GY7A 1BT7A 4I7YH 9LPRA 2B7DH 3A7VA 5EGMA 2LP6A 5DG6A 4ZKRU 1THPB 4CBNA 2ZCKP 3PROA 2FOCA 3TGKE 3MO9A 4JZEH 1YC0A 5J4SA 3BTKE 3L33A 2GKVE 1NO9H 3AK5A 3RMOH 1TPOA 1AE5A 2STAE 1HDTH 3P8OA 3LPRA 1ZJKA 1B0FA 3BTDE 2VIPA 1DT2A 1HCGA 1O2RA 2XW9A 3QWCH 4ZCNA 1JIRA 2A45B 2ZFQH 4QT8C 4NSVA 5JPMH 4DT4A 1C5LH 1GL0E 1P02A 3ITIA 2SGEE 4TYDA 1EATA 1Y3XA 4Y11E 3KNXA 3DSOA 1SLXB 2ASUB 3RM2H 4X1RU 1C1PA 3HKIB 3LIWA 5J4QA 3RXIA 3VB7A 1O2LA 3UR9A 4Q7YA 3N7OA 1TX7A 1ZGVA 1K1IA 2ZO3H 3PMJA 2ZZUH 1C2KA 1P2MA 1SLUB 5A8YA 5E0HA 4Z6AH 8ESTE 2QF5A 2C90B 2FESH 1EP5A 1TWXB 1V2NT 2YMSB 1T8LA 1NROH 4AFZA 7ESTE 4K1TA 3B23B 3UWJH 2GVFA 5HXFA 1J8AA 2ZU1A 2F9PA 2BLOA 1P3EA 1GG6B 2WPHS 2C93B 2A5KA 3MU1A 4Y7BA 2ZCLP 2P59A 1QRZA 3FZZA 4LZ1H 1S6FA 1JXPA 2GP9B 4DCDA 3U69H 1ZTJA 2ODYB 1A0JA 1NRNH 1XKBC 1XUIA 2VH0A 4CHAC 1S6LA 2JKHA 3W95A 1KTSB 2BMGB 3V7TA 2H5DA 4AG1A 1H1BA 1ELEE 1HJ8A 1C2FA 1CBWC 3RXJA 1CA8B 3MNBA 3MNSA 5FCKA 1BMAA 1YPHE 1BDAA 1UK4A 1SGQE 2PUQH 1O2KA 3O8RA 4AOQA 3SV2H 2KM0A 2J98A 3OY5U 4Z0KA 1MH0A 3LGIA 2OC7A 3QGJA 5FBEA 3LGTA 4B76A 3ZVGA 2TGDA 4E06H 3LOXA 1SKYE 2ANKH 1O3DA 3NZIA 3SU0A 3ZZBA 3M5LA 4RT1A 1XXDA 4Z1MD 1BRBE 2ZU3A 4I8JA 5EIYA 2HPQH 4D8NA 1SGCA 2Z3DA 3STIA 8KME2 1ZYOA 1ZPZA 1D4PB 2Y80A 1TMUH 4KKDA 5H4IB 3SU1A 1AZ8A 3GCTG 2TRMA 4IMZA 1G2LA 5FPTA 2FX6A 1GI1A 2FS8A 1K9OE 1TBRH 2CXVA 1XM1A 2F9NA 3SU5A 1Z6EA 2BVXH 1O30A 1SQTA 1BRCE 1B7XB 3E91A 7GCHG 3PRBA 5EJ1A 4I8KA 2FXRA 4Q7ZA 4AGJA 1ZJDA 1AHTH 3TITA 2CN0H 1T8MA 3BIUH 1UO6A 1C5NH 5AHGH 3UWIA 5DJ7A 1CVWH 2KX4A 1G37A 1GBEA 1QRXA 4WY3A 1A3BH 4ABAA 1N6YA 2VWOA 1E37B 5TJXA 3KQDA 4PROA 1ZPBA 2SGFE 1FPCH 3T27A 5LPRA 1QQUA 2QCYA 3BEIB 2EI8A 1TABE 3GY2A 1HXEH 1SLWB 2ZHEH 3OEED 3S7HB 1C5QA 1J16A 1HBTH 2ZHFH 1MTNB 5F03A 1N1LA 1LVOA 3ODDA 1ZMLA 3SN8A 1O2OA 3FOAA 1GHVH 4XDEA 3A7WA 3GDVA 4UONA 1IQFA 1YPKH 1K2I1 4Q63A 2WYJA 2BDBA 1KMHB 3RXRA 1O3AA 1VGCC 2FI3E 2WPKS 1HXFH 1UVOA 2A1DB 2PKAA 3A86A 2W3IA 1MABB 1O3NA 3ELAH 1C1VH 2FTMA 1C5XB 4XSKU 1UTLM 4JK5A 1MKWK 1TA6A 4R8TB 2ZPQA 5EXNA 1RGQA 2F9BH 3RMNH 1C5OH 1FY4A 4TPIZ 1AMHA 4FU9A 3SJ9A 1O5CB 1YGCH 3SI3H 1P2QA 3MWIU 1TPPA 1Q31A 1MAYA 2Z9KA 9ESTA 1BTPA 3A89A 3URDA 2BDHA 1ELAA 1NRSH 4HI3A 1NTPA 4M7GA 4ZKNU 1HB0B 2OTVA 1GI4A 3EA8A 1VITH 4NGAH 4WXVA 2KZ4A 1L4DA 4BXWA 1MD8A 2VNTA 2R3UA 5I46H 1FPHH 1A5IA 1K1NA 2VIOA 3RXGA 1D3QB 1DITH 3SYJA 2IJOB 3VGCB 5DO4H 2IN2A 3F9HA 1EX3A 2G4TA 1EZSC 2QE7D 3BTEE 4OS5A 1DANH 1ESAA 1EZXC 2P3TB 3PO1B 1O5GH 3IITA 4ZUHA 3UNRA 1TNIA 1EPTB 2BQ6B 1YPMH 1C5SA 2QGRA 2ZFTA 1MZAA 1EKBB 3OY6U 3WWFA 1AVXA 2GZ7A 3U8TH 1GHBG 4INHA 1O3CA 1V2QT 1GBLA 1LVMA 1Z8JB 3ZZ4A 1WUNH 1AE8H 3BTFE 4U32A 3SQHE 2FWWA 4UFFH 2G55A 2WPLS 4OGYA 2PSXA 1Z7KA 3RUOA 2EC9H 4B1TA 1CT0E 1ZPCA 4NFEA 1YPHC 4X2VA 2ZP0H 3F68H 3PB1E 3ZZ8A 2Q6GA 1DLEA 2VH6A 2EA3A 1GMDF 3TH4H 4ABGA 1NFXA 1G3DA 4BOHA 3TK5A 5FPYA 1ETSH 3IWMA 2H1UA 4XOJA 3RMLH 1C1MA 1HPGA 1AUTC 4Y0YE 1LPZB 1PYTC 1THSH 1EXFA 1HIAB 2SGPE 3H7TA 4A7IB 5B6LA 3GCHC 1P06A 1ZTLA 1FJSA 3M3VA 2M5TA 2G5VA 2J34A 1A4WH 1TALA 1A2CH 2G5NA 2XTTB 1LDTT 2FTLE 2F3CE 2OQ5A 1LQEA 2V3HH 1HAXB 1O2GH 3TGJE 1OP2A 5GIBA 4FVBA 1NZQH 1WQVH 1AFQB 5DP5A 1O32A 2J95A 2SGDE 2Z3CA 3U1JB 2FOHA 2D2DA 2WHXA 1TGBA 2IPQX 3KL6A 2C8YB 3SV8A 4A6LA 2FMJA 5C94A 1ZRBA 2G4UA 5FAHA 4ISOA 1TB6H 4ISNA 3A8DA 4FVDA 1O5FH 2PV9B 1HAYB 2UUYA 2BY6X 3CNRA 1FV9A 4TPYA 1FI8A 5C5NA 4HG6A 3SOSA 1QRWA 3KF2A 2GDDA 5JYIA 2LELA 4JYVH 1SGIB 3ZVFA 1U6QA 3ZVAA 3ATMA 1NFUA 1K1OA 1PPGE 5EQQA 2G81E 3PWCA 5EW2H 4FUJA 2F4LA 1YP9A 1QHRB 3M5MA 3V0XA 2ZPSA 3ZZ6A 4X6NA 1SGFA 2FOGA 2JIZD 1V2RT 3RXUA 3K2UA 5EPNA 1A0LA 1PQAA 4THNH 2C8WB 1IQEA 1C4Y2 1CGHA 4E7NA 1L1NA 2O8WA 1PQ7A 2R3YA 3ATIA 3I77A 4HTCH 1ZSLA 1Y5BT 2K1QA 3ATLA 4K2YA 3GY8A 1C1SA 1OKXA 4D9RA 1S5SA 1Y5UT 1OPHB 5EXLA 2ZI2H 1YWUA 6ESTA 4RKOB 4Y8YA 2HPPH 2ZGCA 4I33A 2PTCE 1O3GA 4E7RG 2A5AA 2P3FH 1XVOA 4AB9A 4GUXA 1O2QA 3SU6A 3S0NA 1P05A 1N8OB 1GWAA 1C5UA 3OYPA 4I8HA 2A5IA 4XBDA 1VJ9U 1J17T 1SGPE 1TPAE 2Y81A 7LPRA 3RXHA 1FY1A 4A1XA 3P92A 1KIGH 1L1GA 2GCTC 1OXGA 3F2GA 3TJVA 2VWNA 1W13U 3UAIC 1BZXE 3PYHA 2BVSH 2XNIA 1W7GH 2XWBI 2VVVA 4MG3A 3I29A 1ZR0A 4TWWA 4B6FA 2ZHQH 1EAIA 1YPGH 3OTJE 4D7GA 4XRNA 1O2SA 1W0ZU 3M35A 2RG3A 8GCHG 3AW0A 3RXDA 6LPRA 3DCLA 3QTVH 3IG6B 1GVLA 1C1UH 1Y3YA 3FP8E 3SI4H 3LGYA 3MO3A 5SGAE 1D3DB 5DSFA 1C2IA 2QF3A 4I8LA 4LK4A 1GDNA 3E90B 5GPIB 1CA0B 1AVWA 1O3MA 2C3SA 3TJOA 3SGBE 1DUAA 5DP4A 4AFSA 4VGCB 3ZYEA 1HAVB 1AWHB 1SBWA 3QX5H 3M5OA 4H6TA 5HYOA 1O2ZA 3STJA 2OC8A 4ESTE 5C0TA 1W2KH 3F1SB 4GCHG 1DY9A 3UY9A 2J5UA 1NPMA 4WWYA 1OS8A 6CHAB 1RIWC 4P02A 1P2NA 3TU7H 4Q4LA 3NKKA 1OWHA 4BAOB 3KGPA 4WF8A 1HLTH 1N6XA 3VXEH 4O9VA 1MU6B 3F9GA 3RP2A 1H8IH 3GY6A 5JBCS 3E8LA 1F0SA 1TA2A 1FLEE 3RM0H 4O03A 4F55A 5T6DA 2JJ2D 1O5AB 1Q2WA 2GV6A 2P3UB 1T4VH 1EOLA 4UFDH 4AX9H 2XBXA 4YM9A 1C9TA 3ZZ3A 1WXRA 3EA9A 1O3KA 1QURH 1HFDA 1MBQA 2QA9E 2FM2A 2ZHDA 4XFQA 3QZQA 4MQAA 1F92A 5JB9S 4ABJA 1OP8A 2IOTA 1CQQA 1XMNB 4ZKSU 1BOQA 2WPIS 2VINA 5F6MA 1ABJH 2EQNA 1EASA 4YOIA 1O2IA 3A7ZA 1AO5A 1C5RA 4GAWA 2GMTB 2ZEBA 1GGDC 1O3OA 3QUMP 2I6QA 3OTPA 1DY8A 2K8IA 2FDAA 1KXCA 3MU0A 5A0BA 3P6ZB 2EY4C 2TGPZ 1GCTB 2F9UA 1SGRE 1Z71A 4CBOA 2WUCA 1C5PA 3SW2B 4BNRA 1Y3UA 1EPTA 2OLGA 3ENSB 2WPMS 1YLCA 1S0RA 2QXHA 2WV5A 4X6PA 3RXPA 1TYNA 5C0UA 2WSSD 1GBHA 1KY9A 1A61H 1P0SH 2EI6A 3D49H 5ABWA 5L2ZH 2QAAA 1V2MT 1NBMD 1QFKH 3OEHD 1GBMA 3V3MA 3EAJA 4I8GA 2C4FH 4YOJA 3T5FH 5C3NA 3SNAA 2VWLA 3RC5A 4ABFA 2PR3A 4R0IA 1QR3E 2AH4X 2GX4A 2BTCE 2H9TH 3SUFA 3A84A 1BMMH 1GBTA 5E2OA 4XBBA 4U30A 2CJIA 1QQ4A 1XKAC 3LDXH 4OS7A 2AFQB 1MMJN 3KEEA 1ZZZA 2ZIQH 3UIRA 4OS1A 1HIAA 2JETC 4BTIB 2AGGX 3ESTA 4BAKB 3M7UA 1V2TT 1ZOMA 2ZFRH 3ZV9A 1TNHA 2KCYA 1YF4A 2SNVA 2GZ9A 4NWKA 5ESTE 2TIOA 1G3EA 1ZGIA 4A92A 3DA9B 3MU8A 3HPTB 1J14A 1GJ7B 1GHAF 1Y59T 3JZ2B 5DGJA 2ILNA 1NRPH 1YCPK 1AZZA 2C8XB 4I31A 1E36B 1BBRH 4CRDA 2GCHG 1D6WA 2GJGA 1O31A 2P8OB 2BX3A 5KEDA 2CHAC 3PRDA 2TGAA 5TCAA 2P16A 2XC5A 5BRRE 3VB4A 4XBCA 1PQ5A 1H9HE 3T29A 3PLPA 3A7XA 4IN1A 4Y71A 3SNEA 5CHAB 1GI5A 1OWKA 4YOGA 5T6GA 1TE0A 3QO6A 4CHAB 1P2OA 2ULLA 3TJUA 5CMXH 1GJ9B 4GHTA 4BAQB 3V13A 3LC5A 2JJ1D 3MFJA 1NU9A 1V3XA 2RFKC 4HZHA 1SR5C 3BTHE 3LJOA 4BAHB 1QCPA 1WYKA 2BM2A 5GWZA 1INCA 2VVUA 3DD2H 3FO8D 1O3JA 2Y5HA 3RU4T 1M9UA 1CE5A 1PQ8A 4KGAA 2NU3E 3A8BA 1GCDA 1O2JA 4WH6A 2ZFFH 3I78A 1E35B 1O35A 1ESTA 1TLDA 1GJAB 1SFQB 1T8NA 3LU9B 1F5KU 4KTCA 3EQ0H 4OM9A 2AEIH 2BOKA 4NZQA 1C1NA 1CHOF 1SOTA 2JH0D 4IN2A 4DIHH 1ETRH 3MO6A 1V2ST 2AMDA 2VB0A 5GNDA 3RXCA 3RC6A 3Q3KA 5A0AE
chains in the Genus database with same CATH topology
2G51A 3S69A 5A8XA 1SG8B 1TIOA 2A2XH 6GCHG 4DOQA 3ZV8A 3CP7A 1ELTA 1GMCF 2FOFA 2VIQA 4NSYA 1LO6A 3KHVA 3ATKA 1SI5H 1FY3A 2QXJA 1AGJA 1TRNA 4MPWA 5I25A 4Y6DA 2ZG0H 3ODFA 4JYTA 1A0HB 4WMFA 1Y8TA 4A5TS 5C20A 1BHXB 2PTNA 4FUFA 1T32A 3GCOA 3RXAA 1TOCB 3ZYDA 3PMAB 2J38A 1S82A 5C1UA 1ZTKA 4ABEA 1AY6H 1A5HA 1GG6C 3A7YA 4TY7A 5EQRA 2XBYA 4DG4A 5LPFA 2UUKB 3ZVDA 1A7SA 1UTMA 1F0UA 5A09A 1EAUA 1ZHRA 4K8BA 1IQIA 4X8SH 1ESBA 4FUBA 2Z3EA 1C5VA 2FZZA 1BTZA 1CO7E 3SU4A 1YYY1 4JMYA 1KLJH 1DWEH 1PPFE 1FQ3A 2R2WU 1HAVA 2QN5T 3RXLA 3UOUA 4X1PU 3RC4A 1GBDA 2HVXA 3OU0A 3P95A 5T3HA 4DY7B 3NUMA 4K69A 4NG9H 1FIWA 2ZQ2A 3PMHB 1UCYE 2AS9A 5GXPA 5E0GA 2THFB 2GZ8A 4FU8A 1HAOH 1HRTH 1P11E 2LNCA 2ZF0H 1FAKH 1TQ7B 1AIXH 1B0EA 1C1TA 3BEFB 1SC8U 3LGVA 4X2XA 1OYTH 2BZAA 2OC1A 2I6SA 1P12E 5EG4A 1C1RA 1SPJA 3TVJB 3EYDA 1TRYA 4YESB 1P8VC 2JH5D 2Y82A 3D65E 1TNLA 4ISHH 2ZU4A 3EDXB 2B0FA 2HWLB 2ZGXH 3TK6A 1RTFB 5DP8A 1E0FD 2OD3B 3A85A 3NK8A 1P2JA 3T28A 3M3TA 4MLFB 3AAUA 1RJXB 3SJ8A 4K1SA 2BD5A 4UE7H 3RDZA 1TMTH 3MI4A 5F8TA 1O2UA 1DWBH 1V2PT 3KQEA 5GCHG 2PUXB 3BTQE 2FX4A 1O2MA 2FOBA 1LPKB 3C1KA 4UFEH 2O8UA 3PV4A 2QY0B 1D3TB 4LXBH 4Q80A 1UTPA 4ZMAH 1ELVA 2W7SA 1GJCB 1G9IE 4RKJB 3M3SA 1MTNC 1A46H 1QA0A 1BTWA 2BY8X 1F0TA 2XWAA 4AGKA 1C1QA 1SGEE 4H4FA 1C5ZB 1EQ9A 2OBQA 2XC0A 4GSOA 4NA9H 1QA7A 2Y7XA 2BQ7B 3A87A 1IQGA 1C5MD 1OYQA 1Y5AT 1UCYK 1C5YB 1PFXC 3BTWE 1HJAB 1ETTH 3Q77A 1C2LA 1FDPA 1YPJH 3F9EA 2GGVB 2BDGA 3FANA 1HYLA 2ZECA 1QNJA 1F5LA 1TGSZ 3ZZCA 3SV7A 2FIRH 1MQ5A 1Z8RA 3H7OA 1GBAA 1NY22 1OX1A 1OSSA 2XRCA 3GCTF 1WCZA 3UFAA 1DWDH 1Z1IA 2FOEA 1GVKB 1O3IA 3RXFA 3NWUA 4GLYA 3A7TA 1SHYA 2NU2E 4OGXA 2FPZA 1KLIH 1CGIE 5JB8S 2CMYA 7GCHF 3VGCC 4DURA 4DIIH 1DSTA 2ZDLA 1GMHG 1BTUA 1MKXK 1HUTH 1ARBA 2A7CA 3EA7A 3RXSA 2ZHWH 1J15A 3SU2A 2AYWA 3MU4A 3S9AA 3UNQA 1P01A 1EPTC 5F8XA 1DM4B 2PKSB 1ZMJA 3MH6A 3T62A 3CENA 1HGTH 2ZGHA 4BANB 1EOJA 5C2ZA 2NU4E 1Z6JH 1MBMA 2BD4A 1GBCA 2A31A 5DP6A 1SGDE 1TNGA 5ETXA 1SQAA 2BHGA 1L4ZA 1NT1A 3GY5A 1C1OA 3B8JA 2Y5GA 2H2ZA 1SLVB 3V12A 1NN6A 2CGAA 3KIDU 1TBQH 1CT2E 3RXOA 3RXEA 1VCPA 5A0CA 4ABHA 1P09A 3HGNA 3KN2A 3M7QA 2Z7FE 2GT8A 1F7ZA 4H42U 2A7JA 2QIQA 2BDCA 1BBRE 1P57B 3RLYH 3E3TA 2Z6BD 5EW1H 4KTSA 1O0DH 3B9FH 1EJAA 1V2UT 3U98H 1AU8A 1O2PA 2O8TA 2HNTF 1SGYE 1AB9B 1ABIH 1BTHH 1GJBB 2ZTXA 1C2GA 4DVAU 1BTYA 1NRQH 2ALPA 4OS2A 1C4V2 5AFZH 1GI3A 2ZC9H 1KXFA 3HKJB 1JWTA 1TGNA 4NA7A 3HGPA 1TOMH 2A2QH 1CHGA 5DKMA 3LONA 1RTKA 3R0FA 1QL9A 1WV7H 2GCTB 1HV7A 2J9NA 3F6UH 3E6PH 1MTSA 3LGWA 1W7XH 4SGBE 1GBKA 5F8ZA 1VCQA 2Z9JA 3CS7A 2AGIX 1P04A 1AFQC 1GI7B 1DLKB 2W26A 1BITA 2AGEX 3M37A 3E16B 2Z9LA 1KXEA 3CS0A 1NESE 1MKWH 2PHBA 5JBTA 1Y3WA 1YBWA 4FUIA 4UFGH 5FHTA 2Q6DA 2HALA 1XXFA 2SFAA 5C67A 3K6YA 3M36A 1MQ6A 3BTME 1GHBF 3SO3A 3TGIE 2ZNKH 2HRVA 5T6FA 5EODA 4O97A 1UVPA 1SQOA 1IQNA 2H5CA 1K21H 4X1QU 2ODQA 2W7UA 1EZQA 1P3CA 1PPCE 1PJPA 4YLQH 3S7KB 1ANDA 1O2XA 2VGCB 4YLUA 1NFYA 5L6NH 3SUEA 1BJVA 1EUFA 2UWPA 1HAIH 3MH4A 1Z8IB 1EJMA 1BMNH 2P93A 1P9UA 3ATWA 3O8BA 3S9CA 3HK3B 2WV4A 1RIWB 4NA8A 1CGJE 1OWJA 2OC0A 3SQEE 3DUXH 2ZQ1A 3SJKA 2FOAA 1VITG 1D9IA 1TGTA 3MMGA 2Z94A 4NWLA 2FLRH 2F9OA 1KSNA 1WSSH 3Q3XA 1A3EH 5LGOA 4AFQA 3O8DA 4B2AA 2ZDAH 4D76A 4A1TA 5JBBS 1C1WH 5TCCA 4JZ1A 1QIXB 3M5NA 1CU1A 2TGTA 1DWCH 1N8OC 2ZFPH 1RS0A 3LKWA 1TX6A 1V2OT 2FP7B 1PPZA 1SSXA 4Y0ZE 5FPSA 1DXPA 3BF6H 1JMOH 3NXPA 2DE8A 1ZLRA 4K8YA 1L0ZA 1C2MA 2Y5FA 2ANWA 4MDSA 4MNYA 5IYTA 4IGDA 2CF8H 3PTNA 1UHBB 3LJJA 1QL7A 4IBLH 1NM6A 1WOFA 4JZDH 1O3BA 3VXFH 5K0HA 2J2UA 2A4RA 2F9VA 1TX8A 1PPEE 1BB0B 1S6HA 2V3OH 2ZDVH 1QL8A 2FODA 3SNDA 1AQ7A 1UTJA 2B8OH 2ZDMA 3BG4B 1CA0C 2Q6FA 1DE7H 1DFPA 1C2DA 4BTTB 3Q3YA 4VGCC 4X1NU 2YOLA 1HAGE 2ZDKA 4O3UA 2HGTH 2ZGJA 2XBVA 1FMGA 1W3CA 3QZRA 5LH8A 1AUJA 1ZMNA 2SNWA 1K1PA 1JBUH 2FO9A 6CHAC 5DP9A 1DXWA 2VIWA 3MH7A 4HFPB 1HAZB 1UTNA 1XUJA 1QJ7B 2YNBA 4MVNA 3D62A 3RXMA 4UDWH 2D26C 1LTOA 1Y3VA 1XUKA 2H9HA 4OS6A 3GOVB 4WMEA 2FEQH 3DFJA 1FUJA 2BDIA 1NFWA 3QLPH 2OP9A 3SGAE 1BIOA 1KLTA 5B6OA 3PWBA 4CR9A 2BD9A 1UTQA 3T25A 4B71A 2XYAA 3E0PB 5IDKA 2WINI 3SJOA 3F9FA 1TRMA 3A8CA 1TGCA 4ASHA 1UVSH 2GMTC 3VFEA 5A8ZA 1F2SE 1V2VT 2O8MA 1GJ5H 2DE9A 2ZCHP 1O3EA 3UOPA 1MUEB 1MU8B 8GCHF 2BDAA 1SGTA 4ABDA 4IMQA 1BHXF 1K1LA 3OX7U 1Q3XA 1FONA 2BXUH 2HOBA 1QBOA 2UWLA 1BJUA 7KMEH 5FBIA 1JRSA 5L30H 1BCUH 3PMBB 1S85A 5AF9H 1KXBA 5JDUB 3A83A 2BDYA 1D3PB 3NCLA 4GCHF 2FLBH 4ZXXH 3W94A 1WAYB 1K22H 1WTHD 4ZHLU 2QYIA 3GICB 2R0KA 4Y10E 2NU0E 1GHZA 2F91A 1S84A 4AORA 1P2KA 3P8NA 3QTOH 3S9BA 1IQLA 1B5GH 4RN6A 1L1JA 1LHGH 4X8TH 4B75A 4KP0A 2R2MB 4CH2B 2KAIB 5DPAA 1CBWB 1LPGB 3Q00A 3FAOA 1H9LB 1H9IE 2RCEA 5E8EH 3BV9B 1PPBH 2A4QA 2PFEA 1ARCA 2QC2A 3UNSA 2GDEH 3LC3A 1O3LA 3M7TA 5PTPA 1RTLA 5GDSH 1HNEE 1TONA 1SMFE 1AVGH 4TWYA 1ELBA 1GI2A 3A80A 4NIVA 4U01A 3P70B 4AYVB 1T4UH 3BN9A 1AD8H 1UJ1A 2XBWA 3GYMA 2FYRA 1OWEA 1O5EH 4Y8XA 4AN7A 3AW1A 1PPHE 3UPEA 1KDQB 1SOZA 1AI8H 2P8OC 4INKA 1QBNA 4X6OA 4AYYB 1C9PA 1TQ0B 2LPRA 4AB8A 1T8OA 1IAUA 2ZTYA 4GHQA 4E05H 1O37A 2ZWLH 1P03A 1RRKA 2V35A 2NU1E 5BPEA 3HATH 3U9AH 3SGQE 2BLVA 2ZU5A 1EJNA 1UK2A 5CHAC 1GVZA 1GHWH 1GL1A 4HGCA 3H5CB 2J94A 3R3GB 2R0LA 4F49A 1IOEA 3QN7A 3A82A 1O2NA 2BY9X 2DUCA 1BMLA 3EE0B 1WTGH 4NIWA 1GDUA 3L6PA 1C2JA 3TJNA 3RU4D 3DHKH 4GPGA 1GI8B 3UR6A 4AZ2B 3RXQA 2BX4A 1HAHH 2BD8A 3EGKH 1ELCA 1BQYA 1YLDA 4NFFA 1O38A 4WVPE 4NIXA 1JIMA 5HGGA 2BD3A 4F4OC 2FI5E 2FS9A 1OWDA 1DS2E 4K5ZA 2GTBA 1BRAA 2STBE 1V2KT 2SGQE 3O8CA 3RXTA 2ESTE 1O2WA 2XC4A 3MTYA 2V0BA 1AKSB 1QB6A 1VGCB 1Z1JA 1C2HA 4J1YA 4X2YA 4IW4E 2Y6TA 2QXGA 3MNCA 3ZVEA 1GMDG 1LVBA 5HMAA 4D7FA 4FUDA 1YKTA 2GCHF 1BRUP 5EU8A 1QJ6B 1K28D 4O3TA 4CRBA 4FUCA 1KXAA 3GY3A 5C1XA 1D6RA 2AMPA 2ZKSA 4CRGA 1S83A 2Z9IA 1UHBA 4ZROA 3E1XB 2V6NA 3LH1A 1QY6A 1C5WB 4A1VA 1TMBH 3SHAH 5LPEA 3A8AA 2D1JA 1UVTH 2BD7A 2RA0A 3MNXA 4CH8B 1E34B 3SORA 4JK6A 1ELDE 1MCVA 1O34A 2ODPA 1ANBA 1VZQH 2VIDA 4MPVA 3UQOA 1EB2A 4ISIH 3URCA 4BTUB 3PTBA 4ABIA 1THRH 1HAPH 4ISLA 1TBZH 2O8LA 2H9EH 3BIVH 4Q2KA 2A4GA 1F5RA 2VWMA 4IC6A 3TK9A 4B2BA 1GJ8B 1QGFA 3DFLA 1YCPH 3ZVCA 1DSUA 3K9XB 3RLWH 3GDUA 4CRFA 1O36A 4ZHAA 4AFUA 1O2VA 1NU7B 3KQBA 3U8RH 3FZDA 4JZFH 1MTWA 3KQCA 2G52A 2YNAA 4YT7H 1OWIA 1ID5H 1YPLH 1GHXH 1XX9A 2ZFSA 2FOMB 1VR1H 8LPRA 1SB1H 2ANYA 1G30B 2OCVB 1V2LT 6GCHF 1TPSA 1ANCA 2QF0A 1O33A 4CREA 1GBJA 3AAVA 1VCWA 1H4WA 3K65B 2ZTZA 2XXLA 4WJG2 2UUFB 1W0YH 1NS3A 2BY5X 2PGQB 1TAWA 4NIYA 4H6SB 3SHCH 2PSYA 4LOYH 3GCHB 2EEKA 2GD4B 2F83A 3ZZDA 1O3PB 1GBFA 2QV1A 4KTUA 4ZAEA 1XUHA 1YM0A 1SGNE 3SUDA 1YPEH 3ZZAA 1AWFH 1LCYA 1ZHMA 4X1SU 3U8OH 1EB1H 5E2PA 1C4U2 4X6MA 5EOKA 5C5OA 4B2CA 2D8WA 3VEQB 3FVFB 1UVUH 4DT7B 4DJZB 1G2MA 3QK1A 4MNWA 1UK3A 1O5BB 2H6MA 2WUBA 1RFNA 1BTXA 2ALVA 3TNSA 1ELGA 2Q1JA 5C1YA 3ZZ7A 4K1EA 3Q76A 2G8TA 3PO1C 5FX5A 3P8GA 3RU4E 2ZGBH 2RA3A 3TNTA 1GI6A 3MU5A 1XUGA 1GI9B 1GHYH 4MPUA 2ZPRA 1GPZA 3MHWU 1TFXA 4NZLA 1HJAC 3AASA 3PLKA 1G3CA 4YT6H 1CSOE 2VJ1A 2W5EA 3MH5A 2BD2A 4CRCA 1O2YA 3M61U 4K3JA 5CE1A 1LQDB 1LHEH 2OBOA 2KAIA 1FY8E 1DVAH 1GDQA 1LMWB 2HNTE 2FYQA 4FUHA 3LH3A 2BLWA 1J9CH 4JCNA 1G32B 1KTTB 1GI0A 4AG2A 2AIQA 1P2IA 1RD3B 1IQMA 2IPHA 3P17H 3RXKA 1JRTA 2WYGA 4ZXYH 4Q7XA 5HM9A 1GJDB 5GCHF 1V6DA 2PW8H 2JH6D 5AVDA 1KDQA 1QBVH 1BA8B 3TH2H 1ORFA 3SV9A 1NC6A 1ACBE 2PKSC 1IHTH 1O2HA 2VVCA 1AN1E 2TBSA 3AVZA 4ZHMU 5E0JA 1LKBA 3PLBA 2EI7A 1GBBA 4X8VH 2OUAA 3TIUA 3L3TA 1SHHB 3OSYA 5DK1A 2BLQA 2A4OA 1OOKB 2RDLA 3GYLB 4B74A 4JYUH 2VIVA 5JBAS 1K1MA 5L2YH 1JOUB 1O39A 1W8BH 3DT0H 1ZHPA 1FZZA 1GBIA 1FN8A 3UREA 1QTFA 3SUGA 1T31A 4GVUA 1V2WT 3RXBA 3UTUH 2ZA5A 1L2EA 2P95A 5K7RA 3HK6B 4WMDA 3LGUA 1F0RA 4FUGA 3RMMH 3ZZ5A 3BG8A 4D9QA 1AB9C 3VB3A 4Y8ZA 5GJ4B 1ZSJA 1O5DH 1CT4E 3BEUA 2FI4E 3GY4A 4MNXA 3TPIZ 3SU3A 3SNBA 1C2EA 3FFGA 5EXMA 2QXIA 1TNKA 2ZU2A 4OS4A 2Z9GA 1KXDA 1LHFH 1G36A 2OINA 3SNCA 1KYNA 2BXTH 1EAXA 1SGFG 1AKSA 1BBRK 4K60A 3VB6A 2WPJS 3QDZB 1MD7A 2R9PA 1S81A 1FXYA 2AIPA 2C8ZB 4DGJA