1FLEE

Crystal structure of elafin complexed with porcine pancreatic elastase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (serine protease/inhibitor)
molecule keywords ELASTASE
publication title Crystal structure of an elastase-specific inhibitor elafin complexed with porcine pancreatic elastase determined at 1.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1996-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fleE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fleE01
2VVVA 1GHVH 4ZAEA 2ZFFH 5JB9S 2FLBH 1DLKB 2QN5T 2SGDE 3Q3KA 3MTYA 3OTJE 1AI8H 1DXPA 1QIXB 4X6NA 4D9QA 1BBRK 4GPGA 1FN8A 1ZJKA 1O5CB 2CN0H 5E0HA 1EAUA 1ZLRA 1LVMA 3IG6B 4KTSA 3ZZAA 1GMHF 1C1RA 1FAXA 3M35A 2XC4A 1XUFA 4OS6A 3A7YA 3LGIA 1DOJA 1YLDA 3R3GB 1OWEA 1Z1IA 1J17T 1GVKB 3NXPA 2D26C 3C1KA 4AYVB 4O9VA 4ABGA 1F5RA 1RRKA 1O3KA 2SGFE 5A0BA 1LVYA 1MTSA 3RXOA 3SV7A 1EB2A 3T5FH 1MTWA 1PQ7A 1O32A 4BAMB 1FI8A 2VWOA 3GYMA 2G8TA 1C5XB 3WY8A 1MCTA 1VCQA 1O2SA 1BMMH 1O2RA 2BOHB 2A7JA 4ZMAH 1QL8A 3FAOA 1G3CA 1BA8B 2TGTA 3E90B 1G37A 1HAIH 3BIUH 1C4V2 3VXFH 2BDHA 1OYQA 3DFLA 2F9OA 2HRVA 1SC8U 1P2KA 5J4SA 2FIRH 4CHAB 1C2HA 2FYRA 3UFAA 4BXWA 1OPHB 2A5IA 7LPRA 4Y8ZA 2VB0A 1IQLA 2AGIX 4NA9H 3TLOA 3LKWA 1O2TA 1HBTH 1L4ZA 1W2KH 2FTLE 2ZFPH 2W26A 3SU0A 1TALA 3BTEE 3RMMH 1UHBA 1WQSA 1A61H 4Y8XA 4Q7ZA 1IHSH 1UTLM 4Q80A 5C67A 3ZZ6A 3EGKH 1UVUH 2BDBA 3A81A 4X6PA 4RKOB 1SPJA 2GDEH 1D3PB 1NS3A 1YLCA 2G4UA 3S7KB 3O8RA 1FPCH 3TJUA 5AVDA 1P9SA 1QJ7B 1ZPBA 1K9OE 4R0IA 3SNAA 4NSVA 1TGBA 3RXEA 1MQ5A 3KNXA 3SNEA 2VH0A 4X6OA 1XXDA 1Y8TA 1W10U 1GJ5H 1L1NA 3U69H 2FPZA 3UWIA 1IQJA 3D23A 4X8TH 1O5BB 1TA2A 2F9UA 3SV8A 4BANB 3ZYEA 2GCHF 4AGJA 1QB6A 1T8NA 1RS0A 5T3HA 1KXDA 5EXLA 5HM9A 2ZIQH 1UK2A 1OWHA 1XKAC 5C5NA 1C5UA 2BVSH 2ANYA 4GAWA 1EOLA 1J9CH 2HNTE 3NPSA 5BPEA 1ANEA 1Z8IB 5E0GA 3E1XB 2XNIA 2OINA 3GY6A 3T28A 3U8TH 3GCTG 6ESTA 2SNVA 1HAPH 4O3TA 5LPEA 1CA8B 1ZHMA 4K8YA 1GCTC 3PM3A 5C1YA 1W3CA 2CGAA 2Z9JA 3ELAH 1SVPA 3W94A 3SUDA 1GBIA 1RD3B 3MOCA 3MU0A 2AEIH 1QGFA 3AW0A 3EA9A 1DY8A 4KKDA 4H42U 4GSOA 1V6DA 2XWBI 1UO6A 5PTPA 5CE1A 2ZU5A 3PMJA 5AFZH 1PPHE 4YM9A 1GBEA 1GHYH 1PPEE 1XX9A 1C5VA 3L6PA 3VB5A 1KSNA 4A1XA 5DP3A 1TGCA 1GI2A 1K1OA 1MBQA 2Z9GA 2I6QA 1ABIH 2G52A 2EC9H 1UTJA 4NCYA 4I8HA 1O2NA 4CRDA 1IQNA 4CRBA 1K1JA 2QIQA 1LCYA 1SGTA 4PROA 1TNIA 1VCPA 1W8BH 1NRSH 4B2AA 3ZZBA 1H4WA 3UIRA 2FM2A 1C9TA 1N8OC 1IQEA 1LDTT 2FS8A 1TRNA 1ELCA 2AIPA 2G55A 1O30A 1CE5A 1TBZH 2P93A 2ZDAH 1Z1JA 1PYTC 3RC6A 1GDNA 1H9HE 1B0FA 1XUKA 3VB7A 5FXLA 2ZGHA 5JBTA 1LQDB 2TPIZ 4D76A 1O5DH 1IQFA 4WWYA 3LGYA 5I25A 1OSSA 1YM0A 2BHGA 3UQVA 3PV4A 1GDQA 2D8WA 3BEFB 1OP0A 1EPTC 2UUYA 4RKJB 1EUFA 1LPKB 2PR3A 3PTBA 2Q6FA 2DUCA 2BVXH 2ZC9H 2C90B 3KEEA 1O3HA 3ODDA 1CQQA 3K2UA 1YPJH 3O8BA 1TA6A 3ZZ7A 1O2OA 2J2UA 2BD5A 1WOFA 1DITH 1JBUH 1YYY1 2ZG0H 1BTYA 1IHTH 4I32A 3RXVA 1T8OA 4E05H 1N1LA 1G3EA 4NFFA 1YCPK 2Y5FA 1O2XA 4SGAE 2QXIA 2ZECA 1QBOA 1BTPA 1Q3XA 1GBJA 2ZGJA 5A2MH 1RXPA 5L6NH 1NM6A 3A7VA 4I7YH 2F3CE 3KQEA 1ELEE 4IN1A 3Q76A 3G01A 1CBWC 3GY3A 3KQBA 8GCHF 4JK6A 2BZ6H 4UD9H 1WTHD 5LPFA 3RMLH 2CF8H 3SNBA 3RUOA 5EG4A 4AFZA 5DP9A 4IS5A 1GHAF 1B0EA 1TGNA 4FUGA 3EAJA 2B8OH 1ZTKA 2A1DB 3BEIB 3EA7A 1TNLA 4MPUA 4MPXA 3SN8A 1GBCA 3TNTA 2H9EH 4OS7A 1HAVB 1T7CA 2VIQA 1TPAE 1MKXK 5EW1H 1NT1A 2J4IA 3H7OA 3ATIA 2CMYA 2J94A 3IWMA 2ZQ2A 1P12E 3PMAB 1EOJA 1BITA 1AVWA 3SOSA 3UY9A 1FNIA 1GI0A 1Z6JH 3CP7A 2A2XH 2GCTB 1ANDA 1AZ8A 3D62A 1PFXC 1EAIA 1QJ1B 2Z3DA 2WPLS 3P6ZB 4CHAC 2PV9B 1C1TA 1JIMA 2QXGA 4X2VA 3GY8A 4LZ1H 3QLPH 2XTTB 4DGJA 1ELFA 2H9TH 3PB1E 9LPRA 3SORA 1C5PA 1F5LA 2HNTC 3HK6B 1YPEH 2AYWA 2GGVB 1Z8RA 1GMDF 1BTWA 2FS9A 2ZDNA 1KXEA 4I33A 1JRSA 3GCNA 4UEHH 3O8DA 5LH8A 2PLXA 5AF9H 1EZUC 1AY6H 1DX5M 2UUFB 1CT4E 1AFQB 2ODQA 2OC8A 3TH2H 2R0LA 3RXKA 6CHAB 5A8XA 5A09A 2WPKS 3UNRA 3H7TA 1PQ8A 1QRWA 2OC0A 3FVFB 4ZXXH 1QY6A 1RTLA 1QA7A 1ZZZA 2PWXA 3NCLA 4YOGA 3ZZ5A 4DVAU 1DS2E 1OOKB 1FXYA 1TQ0B 4NWKA 3SJOA 4GLYA 1P03A 1P2QA 2OTVA 4YLUA 5EXNA 1ZMNA 1K1NA 3LGWA 1O2IA 3K9XB 1MUEB 4VGCC 2NWNA 5JB8S 1V2JT 3FZDA 1C1QA 4NZQA 3FP8E 4A92A 2LNCA 1GHXH 4X8SH 1UCYH 4MNYA 4Z0KA 2DE9A 2WUCA 1C5SA 2UUJB 1Y3VA 1SB1H 4A5TS 5JPMH 1ELDE 1NESE 1GJ6A 3K6YA 4A7IB 1K1LA 3URDA 2W3IA 2FOFA 1CGJE 7KMEH 1DWCH 5ABWA 4JZEH 1C1MA 2ZP0H 1EJMA 3FANA 3RXPA 1LHGH 1D6WA 1LO6A 4X8VH 1P10A 1AO5A 2G81E 1DDJA 2GZ8A 1QCPA 3M3TA 1FUJA 4I8KA 1K2I1 5TJXA 1HXFH 2VIDA 2OUAA 4OS5A 5CHAB 1WCZA 4NIVA 3VPKA 1QR3E 4ZKOU 1EZXC 1S83A 1OP2A 3P8FA 4Q7YA 1AUTC 2YNAA 2BLVA 1MCVA 4K8BA 1TQ7B 2B9LA 2BQ6B 1HJ9A 1SLXB 1FV9A 1AE8H 2H5DA 3P70B 3VEQB 2TGAA 2FYQA 1V2PT 1OP8A 3MWIU 3MU8A 2BLWA 1O3OA 1UVPA 5EPYA 2VNTA 3PO1B 1HAVA 1RIWB 3GCOA 3OY6U 1FY3A 5FCKA 2AGEX 2IOTA 3TH3H 4AYYB 1IQGA 1HIAB 2WYJA 4MPWA 1LHCH 1A3EH 1AMHA 2BD8A 2ODPA 1LVBA 5JDUB 2GX4A 1MTUA 1QNJA 3KIDU 5E8EH 4AGKA 2A2QH 2GDDA 4SGBE 1GJ9B 1O31A 4AFQA 1UVTH 1EKBB 1JIRA 5L2YH 2J95A 2UWOA 4KTCA 3L3TA 1G2LA 2Z3EA 4CR9A 2GP9B 4B1TA 1LKBA 2P3TB 3UOUA 1BDAA 1A7SA 1AFEH 1GJBB 1P9UA 1SOTA 3HGNA 4A1VA 4K69A 2FODA 4YOJA 1C5YB 2QCYA 1O3NA 1SBWA 3ESTA 3F68H 3MMGA 1H9LB 2Z94A 4B73A 4U2WA 1GHZA 2PGQB 2BVRH 2V3OH 1BBRH 1SOZA 1PPZA 4Y0YE 1F2SE 2J34A 5EW2H 2GV6A 1Z7KA 3LH1A 2ESTE 4J1YA 1D3QB 1P2IA 1UHBB 3MO9A 1AHTH 1K1MA 1O2JA 3QGJA 3GOVB 1AGJA 3GDVA 1ZR0A 7GCHF 2BDCA 2C8XB 1C5OH 3QUMP 1GMCF 3S9AA 5J4QA 4JZDH 1SL3A 3RP2A 2WPHS 4ABEA 2ZTXA 1GI8B 4UONA 4ZH8A 1A5HA 3MFJA 2QAAA 3V12A 3F9GA 1IQKA 1W11U 3ZZ3A 1KDQB 1UTPA 1HJAB 4CR5A 2HWLB 2SGAA 3PWCA 4ZHAA 3QZQA 5FPSA 1O3LA 2K1QA 2UUKB 3HGPA 1O0DH 1FDPA 1MD8A 3JZ1B 4JYVH 4ZHMU 3DD2H 3PWBA 4ZKNU 1BJUA 1IQHA 3SHAH 3MNSA 2ZF0H 4CRGA 1UTQA 4LOYH 5FPYA 2FOMB 4Y7AA 3SI3H 4Y6DA 2A5KA 4TWWA 3RXJA 1D3DB 1AU8A 1KXCA 4FUBA 1C5MD 4UDWH 1O38A 1QQ4A 5T6DA 3JZ2B 4I8LA 2R0KA 5AHGH 1C1SA 1MMJN 1SR5C 3KCGH 4CH2B 2FOHA 3O8CA 2PGBB 3BTHE 2BX3A 4MNVA 4A6LA 3EE0B 3ENSB 3KQCA 1KY9A 3RDZA 4B76A 1NC6A 2BY6X 1C2LA 3A7WA 1DM4B 3KHVA 3EDXB 5JBCS 3A8AA 1F0SA 1LMWB 3F9EA 2ALVA 2XYAA 3MNCA 1K22H 1Q2WA 1GBFA 1BZXE 1O3IA 2GCTC 2I6SA 2P8OB 4ZXYH 5ESTE 3UWJH 4GHQA 1ZSKA 2SGPE 1NROH 1HIAA 2ZPRA 4ABAA 3U1JB 4XBBA 3M5LA 1IAUA 2FOGA 1V2QT 1Y5UT 5DPAA 2Z9IA 1LTOA 1SFQB 1FQ3A 3S7HB 1HAXB 4D8NA 4OS1A 1PYTD 1JWTA 1GBKA 2O8TA 2FOBA 1ELGA 1HAGE 3T2NA 1YPLH 1O3FA 1V2ST 3MO3A 4MQAA 4U30A 1F5KU 2Z6BD 3MHWU 3F6UH 4YT6H 1A5IA 3P8GA 6CHAC 1XUIA 1O3DA 1NO9H 3U8OH 1LKAA 3SQHE 1MTVA 3SGBE 3HKJB 1HAYB 2BX4A 1N6XA 2ZCKP 1Z8GA 4HI3A 1GVLA 2TBSA 2XWAA 1V2NT 1RJXB 1O5EH 1D9IA 1NZQH 1TMUH 3DHKH 3NZIA 5DP8A 1FPHH 3CS0A 3UQOA 3TK6A 4XFQA 1YPKH 1AB9B 2FTMA 1O2KA 2R3YA 4FUCA 1BB0B 4INHA 3TIUA 2ZTYA 2AMQA 2BD9A 3K65B 1KXAA 2F9NA 2RA0A 3BSQA 3QTOH 3ATWA 2CHAB 2Q6DA 3RXQA 1CA0B 1KDQA 3BIVH 5E2OA 4E06H 4DURA 2QYIA 3DA9B 2PKAB 3LJJA 2PHBA 4LK4A 4MPVA 4BTIB 2Z9KA 1J15A 1QURH 3AVZA 4MDSA 2ZFRH 4YT7H 4IGDA 2G5VA 1AUJA 2B7DH 4IC6A 1V2MT 4X2YA 2PUQH 1AIXH 1GBBA 2BTCE 1SGIB 1ZTLA 4MTBA 1ESBA 3D65E 1PQ5A 5F8ZA 4DIHH 1GG6C 1QJ6B 1MH0A 5CHAC 1O2GH 5EGMA 4GVUA 5FAHA 1VITH 3GICB 3VFEA 1GL0E 1H8IH 1TPSA 1SQAA 2Z3CA 2JKHA 4HFPB 1NU7B 3QX5H 2ANKH 3BTWE 1RFNA 3AW1A 4JMYA 3TGIE 1FY1A 4TPIZ 2O8LA 1RGQA 2HVXA 4IMZA 1TIOA 2CF9H 1CGHA 1GJ4H 4X6MA 3A8CA 1EASA 1SGDE 2A32A 3PROA 4X1SU 3ZZCA 1P57B 4GCHF 1GJ7B 4ABHA 2HGTH 5TCAA 5HM2A 2GCHG 3PYHA 5L2ZH 3ZZDA 1Y5AT 1QQUA 3NKKA 3RMNH 2ZHWH 2V3HH 4UFFH 1SLUB 1C2FA 1XKBC 3B23B 4AG2A 1T32A 4NGAH 2PFEA 3E6PH 1TLDA 2GV7A 2ZEBA 2PTNA 2Y5GA 4RN6A 2OBQA 3R0FA 2ZDVH 1ZGIA 3STJA 3SW2B 1GBHA 1ZOMA 3RMOH 2TRMA 2W7SA 4ZHLU 1ZSJA 3RU4E 1GHBF 1ZPZA 1F0TA 3SU5A 1JMOH 3VXEH 2P94A 2VGCB 1DANH 3RXMA 1O36A 2G51A 3LH3A 1EZQA 1S0RA 1DT2A 1TNKA 1S6HA 3UNSA 2C8ZB 1TMBH 1HFDA 1AWFH 2C8YB 1P11E 3A85A 1EATA 2XBWA 2ZGXH 1K21H 3UTUH 3I77A 2OCVB 3A83A 1G9IE 2R9PA 3EYDA 4Y11E 1BCUH 2XCNA 3BTTE 3MH7A 3A87A 4NFEA 1HRTH 1SMFE 1G30B 2Y5HA 1CT2E 1O39A 4NZLA 5C1XA 1MZAA 2XBYA 3M5OA 3S9CA 3QN7A 4DJZB 1HJAC 2VWMA 2R2WU 1SSXA 1XUJA 3RXDA 1HDTH 4MG3A 2H6MA 1V2KT 3ZZ4A 3UNQA 3VGCC 1AVGH 1G36A 2ZHEH 1A1RA 4WXVA 2Q6GA 1MKXH 1GVZA 1F92A 5HGGA 2VVCA 4DG4A 1O3AA 2PKAA 2BD3A 2ZPSA 1ANCA 2GD4B 3MU1A 3A88A 3V3MA 2BY8X 2ASUB 2JETB 2H2ZA 1O2UA 3MH4A 3C27B 1O3EA 4Y7BA 1YKTA 3B8JA 1KTSB 2G4TA 2M5TA 4JZIA 3RXAA 3LT3A 2WUBA 2QV1A 1KLJH 1OWIA 1WU1A 3W95A 1Y3XA 4AZ2B 2ZHFH 5FBEA 1VCWA 1Q31A 1Y5BT 2WYGA 4AG1A 1D4PB 2BQ7B 4D9RA 3SBKA 1MAYA 3OYPA 2RDLA 4WMDA 3TPIZ 1YPMH 1IQIA 4R8TB 1ELVA 1L1GA 3OU0A 3LDXH 4FVBA 4INLA 4FUHA 2P8OC 4NIXA 2NU1E 1JRTA 1FIWA 4FUEA 2BD2A 3V13A 1AVXA 2OC7A 3ZVAA 3D49H 1T4VH 1GBAA 3A80A 4Q7XA 1AN1E 1GI4A 1O3CA 1HNEE 3BTGE 4X8UH 7ESTE 1O34A 1CT0E 5GPIB 3OX7U 2THFB 4O3UA 1ELBA 3LU9B 2ZA5A 1XM1A 2QF3A 1UTKA 1WAYB 1TX8A 2ZI2H 2P59A 3ZVCA 8ESTE 1ESTA 4NWLA 5DGJA 4JZ1A 1C2JA 1GJAB 5GCHF 2BY9X 1BT7A 2GTBA 2PKSB 3TK9A 2C3SA 5EQSA 2A4QA 1P02A 1TGTA 1AZZA 4Y76A 3TH4H 1C2GA 1O2PA 4UE7H 4OS4A 1N6YA 1HB0B 1GHAG 3RXHA 3M36A 1G2MA 2BDGA 4FU8A 4WMFA 1GGDB 1ZMLA 1MQ6A 1P3EA 2BD4A 3LGTA 3ZV8A 1EZSC 1A0LA 3ZVFA 1XUGA 3VB6A 1SHYA 1ETTH 1Z8JB 4F49A 1GI3A 3AAUA 3ZVGA 5LGOA 1V2VT 2CHAC 1O2WA 1CA0C 3NUMA 1TX6A 4ABJA 2JH5D 1QBNA 5B6OA 5GXPA 2EI8A 1GI9B 3TK5A 5DP6A 3M3VA 2O8MA 4JCNA 5DO4H 1MBMA 2B0FA 1TE0A 3A89A 1WBGB 3OSYA 1F7ZA 1A3BH 4O97A 1XXFA 2A7HA 3RC5A 4CRCA 5A8YA 1CHOF 3ZZ8A 2BDYA 2GKVE 2ZCLP 2CXVA 4JK5A 1IQMA 3TNSA 1BUIA 1GMDG 5E0JA 3BF6H 4ABBA 3KQDA 1EAXA 1O3GA 1W7GH 4UFDH 3SJ8A 4WY3A 1UTNA 1G3DA 5FBIA 2PW8H 4X2WA 2WINI 1PPBH 4JZFH 3FP6E 2SFAA 1J16A 2JH0D 3MU4A 4ABFA 1P2OA 1UCYE 4MNWA 2ZDLA 3M7QA 1S85A 6GCHF 1FIZA 4AFUA 4NIYA 2AS9A 5BRRE 1NFXA 3EA8A 1JOUB 4NIWA 1E38B 3U9AH 1TB6H 1E34B 2QF0A 1SGRE 2P16A 3L33A 4AORA 5FX5A 1T31A 5ESBA 3P8OA 2UWLA 2SNWA 1C1UH 3SU1A 3U98H 5FPTA 3AASA 3VB3A 4D7FA 2GZ7A 2FDAA 1HJ8A 1SG8B 1DY9A 1DE7H 4FUIA 1CU1A 8KME2 2W7UA 1EP6A 3ATLA 2OD3B 2VWNA 1LHEH 2RCEA 4DIIH 2V0BA 3HPTB 2B5TB 2BLQA 4DT7B 2ZWLH 2STBE 1MD7A 1T8MA 1TAWA 4NSYA 1O3JA 2VGCC 1BTHH 1MZDA 1ZJDA 2VH6A 4NA8A 4WVPE 3CS7A 2QA9E 1L0ZA 1GHWH 1TOCB 3V7TA 2BD7A 1PJPA 1XVOA 1K28D 3QTVH 1O35A 4TPYA 5C5OA 4WXIA 1ID5H 2BY7X 1THRH 2R2MB 2A0QB 4OGYA 3LIWA 1HUTH 1TNGA 2FWWA 1BTXA 1TONA 1GBLA 1C5NH 1UCYK 4BTTB 2P95A 1HGTH 3AAVA 1VITF 1KTTB 2HNTF 3DUXH 2FI3E 4ABDA 2BB4A 3ATKA 1CHGA 1TABE 2ILNA 1O2YA 3ZVDA 3KN2A 1O2VA 3A7ZA 3UR6A 4GHTA 1YCPM 3DT0H 4MVNA 1ETSH 1UTOA 2WPJS 1NRQH 2WPIS 1T8LA 1P04A 1FY8E 1NY22 1UMAH 1BTUA 1PQAA 1V3XA 3E8LA 2G00A 5DG6A 2A4RA 2BDAA 2ZFQH 2VJ1A 1TGSZ 4KP0A 4HTCH 2EI7A 4CRFA 1OX1A 3PLBA 1ABJH 4AX9H 3H5CB 1BRCE 1OKXA 2JH6D 1O2QA 1BBRE 1TNHA 1UTMA 3M7UA 3GISB 1ARCA 1ZRKA 1J8AA 1PPCE 2AIQA 4B2CA 1BOQA 1N8OB 2VWLA 4K1TA 3E3TA 2TIOA 2BOKA 1GI1A 2QXHA 1ZSLA 3FFGA 3NK8A 2C8WB 2V35A 3SUFA 3UUZA 4AB8A 1QRZA 4KELA 2ANMH 2BDIA 2KAIB 1QHRB 1C2MA 1DWBH 5F03A 1HAZB 3TJNA 3SNDA 1FY5A 2F9VA 3TGJE 2FOEA 5CMXH 1TPOA 1GL1A 1EJAA 3SUGA 1VZQH 4FXGH 2Y82A 7GCHG 1EB1H 1GMCG 1EPTB 1C2IA 1HPGA 3MYWA 2OC1A 3RXUA 3RU4T 1H8DH 1ZMJA 1D6RA 1GI7B 1S84A 3A7XA 3STIA 4XSKU 3P17H 3LGUA 1BMAA 3P8NA 2ZU3A 3SJIA 2ZHQH 1EXFA 3GY5A 4X1PU 1A0HB 1KIGH 1AQ7A 1CSOE 1MKWK 1KYNA 1C1WH 3BV9B 2VIPA 4OS2A 4BXSA 2XCFA 1XVMA 4H4FA 2ALPA 3HKIB 1FJSA 2IN2A 2YOLA 4Z6AH 1BQYA 1E0FD 1W7XH 5E2PA 2Y81A 2G5NA 1EJNA 2A45B 2PKSC 1V2LT 3MO6A 4BAOB 2ZNKH 1ZYOA 3LONA 3BTME 3T29A 4A1TA 3Q77A 1Y3WA 2XW9A 1Z71A 1CBWB 1F0UA 3SHCH 3CENA 3GY7A 2C93B 3Q00A 3MH6A 3T26A 3BN9A 1O3BA 4TWYA 2VIOA 4B75A 1GMHG 1HXEH 1AKSB 3UREA 1GBTA 1V2RT 4TY6A 3SU4A 1FONA 1GGDC 3OY5U 1ETRH 4IC5A 4TY7A 4U32A 3T27A 3BTQE 3MI4A 5GIBA 3RLYH 1AFQC 2OQ5A 1DLEA 1TRYA 2AH4X 1A5GH 2CV3A 3T25A 3KL6A 1TBRH 1HAHH 4XOJA 1SGCA 1P2JA 4ISHH 3F9FA 3U1IB 2F83A 5EODA 4ISOA 1C2KA 1HV7A 2LPRA 2W5EA 1L4DA 1DSUA 4CBOA 1MTNB 2FOCA 4WH8A 1OS8A 1SGFA 2FX6A 1V2OT 1BHXF 3TU7H 3Q3YA 1TMTH 3ITIA 3SGQE 5T6GA 1LPGB 3QK1A 2QXJA 1UVOA 5C1UA 2Y7ZA 2P3UB 4BAHB 1OYTH 1EAWA 3SU2A 1OXGA 1XUHA 1YPGH 4DY7B 1NFUA 4UFEH 1ELAA 1FAKH 1OWJA 4BAKB 3ODFA 4H6TA 2ZU4A 1MAXA 2O8UA 1BRAA 2OLGA 3GCHB 1NN6A 5JYIA 1C5WB 1QB9A 1KXFA 3HATH 5HXFA 4Y10E 1W0ZU 1S6FA 1LHDH 1O2MA 2KAIA 1B7XB 1HYLA 2FESH 5HMAA 1V2UT 2NU3E 2O8WA 1OWDA 3A82A 3SJKA 2IPHA 3GCTF 1BJVA 1FMGA 1P8VC 1TFXA 2F9PA 3M37A 1ESAA 2ZHDA 4Q2KA 3UOPA 3QO6A 5FHTA 1DWEH 1S81A 2F91A 2J38A 1TPPA 1C1NA 1EPTA 1VGCB 5GDSH 1MU8B 1ANBA 3URCA 1TWXB 3KF2A 2FI4E 4CRAA 3TJOA 2ZFSA 2AFQB 4DW2U 4CREA 5F6MA 4VGCB 1P05A 2ULLA 4FU7A 5EOKA 2DE8A 1A46H 2XBVA 3PO1C 3TGKE 1RIWC 1O2LA 1GWAA 3I78A 1GBDA 4K3JA 1VR1H 4MLFB 4GUXA 1CVWH 2ZCHP 4NG9H 5DJ7A 1QL7A 2OBOA 2FZZA 4YLQH 2HPPH 4CBNA 5L30H 1DFPA 1W0YH 5DP7A 4X1QU 4O03A 1DUEA 1P2MA 4H6SB 2AMPA 3B9FH 1WUNH 1UK4A 1GJ8B 3E0PB 2GVFA 4FUDA 4JYTA 1AE5A 1L2EA 2BZAA 1T4UH 1Z6EA 2H5CA 3RC4A 2XC5A 5A0CA 1V2WT 3BG4B 3SJ9A 3RXTA 1P0SH 1C5RA 1AKSA 1YCPH 1QTFA 3ZYDA 1NFWA 5H4IB 3GY2A 2ODYB 2STAE 4GCHG 1ELTA 1SI5H 1RTKA 2HPQH 1FN6A 5ETXA 2GT7A 3SU3A 3TITA 2ZTZA 1GBMA 4ZROA 4K2YA 4JYUH 2H9HA 1XMNB 1P01A 1KXBA 1VJ9U 1B5GH 4RSPA 1C5QA 1FLEE 1PPGE 1FY4A 2D1JA 3PMBB 1NRPH 3E16B 3M61U 2BYAX 1ORFA 1YGCH 1D3TB 1Y3YA 1GHBG 2UWPA 2ZKSA 2ZZUH 3RU4D 1WQVH 3SO3A 1KLIH 1THPB 4Y0ZE 4B2BA 1YC0A 4FUJA 1S0QA 2XC0A 1DICA 2FOAA 3QWCH 2V6NA 2C4FH 1E35B 2CJIA 5C3NA 4K60A 4K1EA 5EPNA 1CGIE 2ZU1A 1E36B 2FX4A 3KGPA 2HLCA 1C1VH 1DVAH 3ZV9A 5F8XA 3RXBA 1BHXB 3UPEA 1H9IE 3GDSA 4ESTE 1QA0A 2GMTB 5T6FA 1UK3A 3BEUA 1A4WH 4YZUA 4WJG2 5JBBS 1F0RA 2Z7FE 4WF8A 2AMDA 2BXTH 2RG3A 5IYTA 1P06A 3LJOA 4X1NU 1YF4A 1M9UA 4ZUHA 5FX6A 3PMHB 4TYDA 2AERH 1EP5A 2A7CA 3M5MA 4NA7A 4AFSA 3RXIA 2QY0B 1SLVB 5HYOA 4ABIA 4I31A 5C20A 1ARBA 1YP9A 4M7GA 2EI6A 3GDUA 3S69A 3E0NB 1DSTA 1C5LH 3SI4H 4QT8C 2XRCA 4E7RG 3S9BA 3GY4A 1O3MA 4J2YB 4X0WU 2QC2A 5EQRA 4KGAA 2H1UA 2FO9A 5AFYH 2XBXA 1JXPA 4X1RU 2ZPQA 2NU0E 3VB4A 1O5AB 1W13U 1WSSH 4LXBH 1BMNH 2ZDKA 5DKMA 3I29A 2BMGB 3M3SA 1O5GH 2OQUA 2TGDA 4DOQA 4WH6A 1TBQH 3LOXA 5I46H 3FZZA 8GCHG 4BAQB 1GI5A 1O3PB 3RXSA 4ISNA 4ZKRU 2AGGX 3FP7E 3MNBA 2RA3A 5GJ4B 3PLPA 4FVDA 5JBAS 1YPHE 2R3UA 3U8RH 5G4BA 4U01A 1P2NA 3BG8A 1BTZA 1QL9A 1SGQE 3A8DA 1UVSH 5LPRA 1E37B 1IOEA 2NU2E 1MTNC 5K0HA 2YNBA 1O37A 1C2DA 4AOQA 1AB9C 1NRNH 4YTAA 1AD8H 3RM0H 3A7TA 4AB9A 1C1OA 4XDEA 1S5SA 4AN7A 3BTKE 3RXCA 1LPZB 4FUFA 1FZZA 3MNXA 1UJ1A 2BY5X 1OWKA 5GWZA 2Y7XA 4HZHA 4ZKSU 3A84A 3ATMA 5GCHG 5FCRA 3UR9A 2FP7B 1O33A 2A5AA 4BOHA 1K1PA 1C5TA 3GCHC 4MNXA 4DCDA 1LHFH 2Q1JA 1TNJA 2SGQE 1SGFG 4B71A 2VINA 2FEQH 1WTGH 1Y59T 1TOMH 2WPMS 1C4U2 1ZHPA 2BQWB 1GCDA 1SQTA 3RLWH 4OGXA 2BLOA 1GDUA 2J92A 3TVJB 1ZPCA 1DXWA 1SFIA 3SV2H 1EX3A 3SUEA 1TYNA 1DUAA 2PUXB 1BRUP 1SGEE 3T62A 3IITA 1VGCC 2XXLA 3V0XA 4ISIH 1K1IA 1GJCB 2HALA 1BMLA 1GJDB 1NTPA 3EQ0H 4X2XA 2TGPZ 4Y79A 1S82A 1NRRH 3LC5A 1HCGA 2VIWA 2ZQ1A 4F4OC 2WV4A 1AWHB 1PPFE 3DFJA 1KLTA 4INKA 3ZZ9A 1CHOG 1G3BA 4YO9A 1LVOA 5EXMA 2VVUA 1TX7A 2QGRA 1W12U 2BM2A 2VU8E 3SQEE 2F9BH 2EA3A 1VJAU 2NU4E 1GI6A 1J14A 2SGEE 1THSH 2FLRH 2WV5A 2A4OA 3E91A 2J9NA 3SGAE 1O2HA 1ACBE 1DWDH 3QZRA 4BTUB 1A2CH 1Y3UA 3QGNB 1GG6B 3BG4C 2GT8A 1QRXA 1P09A 1TRMA 4D7GA 4FU9A 3SV6A 4HGCA 1L1JA 5DP5A 4CH8B 3BTDE 1C5ZB 5DP4A 1U6QA 1C2EA 1NPMA 6GCHG 1SGPE 4IW4E 1INCA 2PSYA 3SV9A 1EQ9A 1H1BA 2ZO3H 2FI5E 9ESTA 3A8BA 1GCTB 1YBWA 3A86A 1QB1A 2Y80A 4UFGH 4IMQA 2W3KA 4BNRA 1SGNE 5TCCA 4IN2A 1MU6B 3SU6A 1BIOA 2ZDMA 3BTFE 2PSXA 2OXSA 5K7RA 5EU8A 2A31A 3F9HA 2VIVA 1HAOH 2HOBA 2Z9LA 3M5NA 4I8JA 4ASHA 1ZRBA 1GPZA 5SGAE 2IJOB 1WV7H 3TJVA 3PTNA 4IBLH 4Y8YA 4B74A 5F8TA 4I8GA 2PTCE 3M7TA 2A4GA 1BRBE 1RTFB 4YESB 1SHHB 4K5ZA 3RXFA 1QFKH 2OP9A 1MKWH 1C9PA 2ZGCA 1G32B 3K6ZA 3LPRA 1ZGVA 3ZVBA 3LC3A 3RXGA 4ISLA 2Y6TA 4YOIA 1O2ZA 4XE4A 4WMEA 3SNCA 2JETC 3F1SB 4XBDA 4K1SA 3GYLB 3LGVA 4Y71A 5C2ZA 3S0NA 2D2DA 6LPRA 2BXUH 1NFYA 1LQEA 2FMJA 1VITG 2GMTC 3HK3B 5DK1A 1SGYE 1P3CA 1NU9A 3MU5A 3PLKA 3MH5A 5A8ZA 1SLWB 3P92A 1DPOA 1HLTH 5EQQA 2O9QA 3RXLA 1CO7E 4KTUA 3ZVEA 5IDKA 3N7OA 1YPHC 5A0AE 2FXRA 3Q3XA 3RXRA 1WYKA 1QBVH 2GZ9A 4E7NA 2ZFTA 3VGCB 1O5FH 4THNH 3QDZB 1A0JA 1C1PA 2ZU2A 1ZHRA 2EEKA 4LZ4B 1C4Y2 2P3FH 3NWUA 1X7AC 8LPRA 3RM2H 3SZNA 3P95A 4XBCA 2ZGBH 1V2TT 2ANWA 1ZTJA 1SQOA 1W14U
chains in the Genus database with same CATH superfamily
2VVVA 1GHVH 4ZAEA 2ZFFH 5JB9S 2FLBH 1DLKB 2QN5T 2SGDE 3Q3KA 3MTYA 3OTJE 1AI8H 1DXPA 1QIXB 2GJGA 4X6NA 4D9QA 1BBRK 4GPGA 1FN8A 1ZJKA 1O5CB 2CN0H 5E0HA 1EAUA 1ZLRA 1LVMA 3IG6B 4KTSA 3ZZAA 1GMHF 1C1RA 1FAXA 3M35A 2XC4A 1XUFA 4OS6A 3A7YA 3LGIA 1DOJA 1YLDA 3R3GB 1OWEA 1Z1IA 1J17T 1GVKB 3NXPA 2D26C 3C1KA 4AYVB 4O9VA 4ABGA 1F5RA 1RRKA 1O3KA 2SGFE 5A0BA 1LVYA 1MTSA 3RXOA 3SV7A 1EB2A 3T5FH 1MTWA 1PQ7A 1O32A 4BAMB 1FI8A 2VWOA 3GYMA 2G8TA 5T1VA 1C5XB 3WY8A 1MCTA 1VCQA 2JDID 1O2SA 1BMMH 1O2RA 2BOHB 2A7JA 4ZMAH 1QL8A 3FAOA 1G3CA 1BA8B 2TGTA 3E90B 1G37A 1HAIH 3BIUH 3F2FA 1C4V2 3VXFH 2BDHA 1OYQA 2M2AA 3DFLA 2F9OA 2HRVA 1SC8U 1P2KA 5J4SA 2FIRH 4CHAB 1C2HA 2FYRA 3UFAA 4BXWA 1OPHB 2A5IA 7LPRA 4Y8ZA 2VB0A 1IQLA 2AGIX 4NA9H 3TLOA 3LKWA 1O2TA 1HBTH 1L4ZA 1W2KH 2FTLE 2ZFPH 2W26A 3SU0A 1TALA 3BTEE 3RMMH 1UHBA 1WQSA 1A61H 4Y8XA 4Q7ZA 1IHSH 1UTLM 4Q80A 5C67A 3ZZ6A 3EGKH 1UVUH 2BDBA 3A81A 4X6PA 4RKOB 1SPJA 2GDEH 1D3PB 1NS3A 1YLCA 2G4UA 3S7KB 3O8RA 1FPCH 3TJUA 5AVDA 2LP6A 1P9SA 1QJ7B 1ZPBA 1K9OE 4R0IA 3SNAA 2V3MA 4NSVA 1TGBA 3RXEA 1MQ5A 3KNXA 3SNEA 2VH0A 4RI0A 2JJ2D 4X6OA 1XXDA 1Y8TA 1W10U 1GJ5H 1L1NA 3U69H 2FPZA 3UWIA 1IQJA 3D23A 4X8TH 1O5BB 1TA2A 2F9UA 5CDFE 3SV8A 4BANB 3ZYEA 2GCHF 4AGJA 1QB6A 1T8NA 1RS0A 5T3HA 1KXDA 5EXLA 5HM9A 2ZIQH 1UK2A 1OWHA 1XKAC 5C5NA 1C5UA 2BVSH 2ANYA 4GAWA 1EOLA 1J9CH 2HNTE 3NPSA 5BPEA 1ANEA 1Z8IB 5E0GA 3E1XB 2XNIA 2OINA 3GY6A 3T28A 3U8TH 3GCTG 6ESTA 2SNVA 1HAPH 4O3TA 2XOKD 5LPEA 1CA8B 1ZHMA 4K8YA 1GCTC 3PM3A 5C1YA 1W3CA 2CGAA 2Z9JA 3ELAH 1SVPA 3W94A 3SUDA 1GBIA 1RD3B 3MOCA 3MU0A 2AEIH 1QGFA 3AW0A 3EA9A 1DY8A 4KKDA 4H42U 4GSOA 1V6DA 5B6LA 2XWBI 1UO6A 5PTPA 5CE1A 2ZU5A 3PMJA 5AFZH 1PPHE 4YM9A 1GBEA 1GHYH 1PPEE 1XX9A 1C5VA 3L6PA 3VB5A 1KSNA 4A1XA 1FX0B 5DP3A 1TGCA 1GI2A 1K1OA 1MBQA 2Z9GA 2I6QA 1ABIH 2G52A 2EC9H 1UTJA 4NCYA 4I8HA 1O2NA 4CRDA 1IQNA 4CRBA 1K1JA 2QIQA 1LCYA 1SGTA 4PROA 1TNIA 1VCPA 1W8BH 1NRSH 4B2AA 3ZZBA 1H4WA 3UIRA 2FM2A 1C9TA 1N8OC 1IQEA 1LDTT 2FS8A 1TRNA 1ELCA 2AIPA 2G55A 1O30A 1E1QD 1CE5A 1TBZH 2P93A 1SKYE 2ZDAH 1Z1JA 1PYTC 3RC6A 1GDNA 1H9HE 1B0FA 1XUKA 3GS9A 3PRBA 3VB7A 5FXLA 2ZGHA 5JBTA 1H8ED 1LQDB 2TPIZ 4D76A 1O5DH 1IQFA 4WWYA 3LGYA 5I25A 1OSSA 2KR7A 3KQ5A 1YM0A 5C94A 2BHGA 3UQVA 3PV4A 1NBMD 1GDQA 2D8WA 3BEFB 1OP0A 1EPTC 2UUYA 4RKJB 1EUFA 1LPKB 2PR3A 3PTBA 2Q6FA 2DUCA 2BVXH 2ZC9H 2C90B 3KEEA 1O3HA 3DCLA 3ODDA 2KZ4A 1CQQA 3K2UA 1YPJH 3DSPA 1TA6A 3O8BA 1O2OA 3ZZ7A 2J2UA 2BD5A 1WOFA 1DITH 1JBUH 1YYY1 2ZG0H 1BTYA 1IHTH 4I32A 3RXVA 1T8OA 4E05H 1N1LA 1G3EA 4NFFA 1YCPK 2Y5FA 1O2XA 4SGAE 2QXIA 1BMFD 2ZECA 1QBOA 1BTPA 1Q3XA 1GBJA 2ZGJA 5A2MH 1RXPA 5L6NH 1NM6A 3A7VA 4I7YH 2F3CE 3KQEA 1ELEE 4IN1A 3Q76A 3G01A 3OTPA 1CBWC 3GY3A 3KQBA 8GCHF 4JK6A 2BZ6H 3F0PA 4UD9H 1WTHD 5LPFA 2F4LA 3RMLH 2CF8H 3SNBA 3RUOA 5EG4A 4AFZA 1MABB 5DP9A 2KCPA 4IS5A 1GHAF 1B0EA 1TGNA 3F0OA 4FUGA 3EAJA 2B8OH 1ZTKA 2A1DB 3BEIB 3EA7A 1TNLA 4MPUA 4MPXA 3SN8A 1GBCA 3TNTA 2H9EH 4OS7A 1HAVB 1T7CA 2VIQA 1TPAE 1MKXK 5EW1H 1NT1A 2J4IA 3H7OA 3ATIA 2CMYA 2J94A 3IWMA 2ZQ2A 1P12E 3PMAB 1EOJA 1BITA 1AVWA 3SOSA 3UY9A 1FNIA 1GI0A 1Z6JH 3CP7A 2A2XH 2GCTB 1ANDA 1AZ8A 3D62A 1PFXC 1EAIA 1QJ1B 2Z3DA 2WPLS 3P6ZB 4CHAC 2PV9B 1C1TA 1JIMA 2QXGA 4X2VA 3GY8A 4LZ1H 3QLPH 2XTTB 4DGJA 1ELFA 2H9TH 3PB1E 9LPRA 3SORA 1C5PA 1F5LA 2HNTC 3HK6B 1YPEH 2AYWA 2GGVB 1Z8RA 1GMDF 1BTWA 2FS9A 2ZDNA 1KXEA 4I33A 1JRSA 3GCNA 4UEHH 3O8DA 5LH8A 2PLXA 5AF9H 1EZUC 1AY6H 1DX5M 2UUFB 3SYJA 1CT4E 1AFQB 2ODQA 2OC8A 3TH2H 2R0LA 3RXKA 6CHAB 5A8XA 5A09A 1QZ8A 2WPKS 3H7TA 3UNRA 1PQ8A 1QRWA 2OC0A 3FVFB 4ZXXH 1QY6A 1RTLA 1QA7A 1ZZZA 2PWXA 3NCLA 4YOGA 3ZZ5A 4DVAU 1DS2E 1OOKB 1FXYA 1TQ0B 4NWKA 3SJOA 4GLYA 1P03A 2L6OA 1P2QA 2OTVA 4YLUA 5EXNA 2J97A 1ZMNA 1K1NA 3LGWA 1O2IA 3K9XB 1MUEB 4VGCC 2NWNA 5JB8S 1V2JT 3FZDA 1C1QA 4NZQA 3FP8E 4A92A 2LNCA 1GHXH 3KYFA 1UCYH 4MNYA 4X8SH 4Z0KA 2DE9A 2WUCA 1C5SA 2UUJB 1Y3VA 1SB1H 4A5TS 5JPMH 1ELDE 3FO8D 1NESE 1GJ6A 3K6YA 4A7IB 1K1LA 3URDA 2W3IA 2FOFA 1CGJE 7KMEH 1DWCH 2WZQA 4HG6A 5ABWA 4JZEH 1C1MA 2ZP0H 1EJMA 3FANA 3RXPA 1LHGH 1D6WA 3F3BA 1LO6A 4X8VH 3FKSD 1P10A 1AO5A 2G81E 1DDJA 2GZ8A 1QCPA 2WSSD 3M3TA 1FUJA 4I8KA 1K2I1 5TJXA 1HXFH 2VIDA 2OUAA 4Z1MD 4OS5A 5CHAB 1WCZA 4NIVA 3VPKA 1QR3E 4ZKOU 1EZXC 1S83A 1OP2A 3P8FA 4Q7YA 1AUTC 2YNAA 2BLVA 1MCVA 4K8BA 1TQ7B 2B9LA 2BQ6B 1HJ9A 1SLXB 1FV9A 1AE8H 2H5DA 3P70B 3VEQB 2TGAA 2FYQA 1V2PT 1OP8A 4F48B 3MWIU 3MU8A 2BLWA 1O3OA 1UVPA 5EPYA 3OAAD 2VNTA 3PO1B 1HAVA 1RIWB 3GCOA 3OY6U 1FY3A 5FCKA 2AGEX 2IOTA 3TH3H 4AYYB 1IQGA 1HIAB 2WYJA 4MPWA 3SZEA 1LHCH 1A3EH 1AMHA 2BD8A 2ODPA 1LVBA 5JDUB 2GX4A 1MTUA 1QNJA 3OFND 3KIDU 5E8EH 4AGKA 2A2QH 2GDDA 4SGBE 1GJ9B 1O31A 4AFQA 1UVTH 1EKBB 1JIRA 5L2YH 2J95A 2UWOA 4KTCA 3L3TA 4FETA 1G2LA 2Z3EA 4CR9A 2GP9B 2QF4A 4B1TA 1LKBA 2P3TB 3UOUA 1BDAA 1A7SA 1AFEH 1GJBB 1P9UA 1SOTA 3HGNA 4A1VA 4K69A 2FODA 4YOJA 1C5YB 2QCYA 1O3NA 1SBWA 3ESTA 3F68H 3MMGA 1H9LB 2Z94A 4B73A 4U2WA 1GHZA 2PGQB 2BVRH 2V3OH 1BBRH 1SOZA 1PPZA 4Y0YE 1W0JD 1F2SE 2J34A 5EW2H 3ZIAD 2GV6A 1Z7KA 3LH1A 2ESTE 4J1YA 1D3QB 1P2IA 2KCYA 3PV5A 1UHBB 3MO9A 1AHTH 1K1MA 1O2JA 3QGJA 3GOVB 1AGJA 3GDVA 1ZR0A 7GCHF 2BDCA 2C8XB 1C5OH 3QUMP 1GMCF 3S9AA 5J4QA 2AHME 4JZDH 1SL3A 4Q4LA 2WPHS 3RP2A 4ABEA 2ZTXA 1GI8B 4UONA 4ZH8A 1A5HA 3MFJA 2QAAA 3V12A 3F9GA 1IQKA 1W11U 3ZZ3A 2QE7D 1KDQB 1UTPA 1HJAB 4CR5A 3N99A 2HWLB 2SGAA 3PWCA 4ZHAA 4Q63A 3QZQA 5FPSA 1O3LA 2K1QA 2UUKB 3HGPA 1O0DH 1FDPA 1MD8A 3F2HA 3JZ1B 4JYVH 4ZHMU 3DD2H 3PWBA 4ZKNU 1BJUA 1IQHA 3SHAH 4B6EA 3MNSA 2ZF0H 4CRGA 1UTQA 3H09A 4LOYH 5FPYA 3KYGA 2FOMB 4Y7AA 3SI3H 4ACAA 4Y6DA 2A5KA 4TWWA 3RXJA 3UB0A 1D3DB 1AU8A 1KXCA 4FUBA 1C5MD 4UDWH 1O38A 1QQ4A 5T6DA 3JZ2B 4I8LA 2R0KA 5AHGH 1C1SA 1MMJN 1SR5C 4XRNA 3KCGH 4CH2B 2FOHA 3O8CA 2PGBB 3BTHE 3N7DA 3VG8A 2BX3A 4TT3D 4MNVA 4A6LA 3EE0B 3ENSB 3KQCA 1KY9A 3RDZA 4B76A 1NC6A 2BY6X 1C2LA 3A7WA 1DM4B 3KHVA 3EDXB 3U28C 5JBCS 3A8AA 1F0SA 1LMWB 3F9EA 2ALVA 2XYAA 3MNCA 1K22H 1Q2WA 1GBFA 1BZXE 1O3IA 2GCTC 2I6SA 2P8OB 4ZXYH 5ESTE 3UWJH 4GHQA 1ZSKA 2SGPE 1NROH 1HIAA 2ZPRA 4ABAA 2LELA 3U1JB 4XBBA 3M5LA 1IAUA 2FOGA 1V2QT 1Y5UT 5DPAA 2Z9IA 1LTOA 1SFQB 1FQ3A 3S7HB 1HAXB 4D8NA 4OS1A 1PYTD 1JWTA 1GBKA 2O8TA 2FOBA 1ELGA 1HAGE 3T2NA 1YPLH 1O3FA 1V2ST 3MO3A 4MQAA 4U30A 1F5KU 2Z6BD 3MHWU 3F6UH 4YT6H 1A5IA 3P8GA 6CHAC 1XUIA 1O3DA 1NO9H 3U8OH 1LKAA 3SQHE 2VBCA 1MTVA 3SGBE 3HKJB 1HAYB 2BX4A 1N6XA 2ZCKP 1Z8GA 4HI3A 1GVLA 2TBSA 2XWAA 1V2NT 1RJXB 1O5EH 1D9IA 1NZQH 1TMUH 3DHKH 3NZIA 5DP8A 1FPHH 3CS0A 3UQOA 3TK6A 4XFQA 1YPKH 1AB9B 2FTMA 1O2KA 2R3YA 4FUCA 1BB0B 4INHA 3TIUA 2ZTYA 2AMQA 5C0TA 2BD9A 3K65B 1KXAA 2F9NA 2RA0A 3BSQA 3QTOH 3ATWA 2CHAB 2Q6DA 3RXQA 1CA0B 1KDQA 3BIVH 5E2OA 3N7EA 4E06H 2L74A 2QYIA 4DURA 3DA9B 2PKAB 3LJJA 2PHBA 4LK4A 4MPVA 4BTIB 2Z9KA 1J15A 1QURH 3AVZA 4MDSA 2KM0A 2ZFRH 4YT7H 4IGDA 2G5VA 1AUJA 2W6JD 2B7DH 4IC6A 1V2MT 4X2YA 2PUQH 1AIXH 1GBBA 4F55A 2BTCE 1SGIB 2JJ1D 1ZTLA 4MTBA 1ESBA 3D65E 1PQ5A 5F8ZA 4DIHH 1GG6C 1QJ6B 1MH0A 5CHAC 1O2GH 5EGMA 4GVUA 5FAHA 1VITH 3GICB 3VFEA 1GL0E 1H8IH 1TPSA 1SQAA 2Z3CA 2JKHA 4HFPB 1H8HD 1NU7B 3QX5H 3EE7A 2ANKH 5FL7D 3BTWE 1RFNA 3AW1A 4JMYA 3TGIE 5KGOA 1FY1A 4TSFD 4TPIZ 2O8LA 1RGQA 2HVXA 4IMZA 1TIOA 2CF9H 1CGHA 1GJ4H 5HIZA 4X6MA 3A8CA 1EASA 1SGDE 2A32A 3PROA 1UW7A 4X1SU 3ZZCA 1P57B 4GCHF 1GJ7B 3MQKC 4ABHA 2HGTH 1KMHB 5TCAA 5HM2A 2GCHG 3PYHA 5L2ZH 3ZZDA 1Y5AT 1QQUA 3NKKA 3RMNH 2ZHWH 2V3HH 4UFFH 1SLUB 1C2FA 1XKBC 3B23B 4AG2A 1T32A 4NGAH 2PFEA 3E6PH 1TLDA 2GV7A 2ZEBA 2PTNA 2Y5GA 4RN6A 2OBQA 3R0FA 2ZDVH 1ZGIA 3STJA 3SW2B 1GBHA 1ZOMA 3RMOH 3PRDA 2TRMA 2W7SA 4ZHLU 1ZSJA 3RU4E 1GHBF 1ZPZA 1F0TA 3SU5A 1JMOH 3VXEH 2P94A 2VGCB 1DANH 1YY3A 3RXMA 1O36A 2G51A 3LH3A 1EZQA 1S0RA 2WHXA 1DT2A 1TNKA 1S6HA 3UNSA 2C8ZB 1TMBH 1HFDA 1AWFH 3AK5A 2C8YB 1P11E 3A85A 1EATA 2XBWA 4YXWD 2ZGXH 3PV2A 2YMSB 2J98B 1K21H 3UTUH 3I77A 2OCVB 3A83A 1G9IE 2R9PA 3EYDA 4Y11E 1BCUH 2XCNA 3BTTE 3MH7A 3A87A 4NFEA 1HRTH 1SMFE 1G30B 2Y5HA 1CT2E 1O39A 4NZLA 5C1XA 1MZAA 2XBYA 3M5OA 3S9CA 3QN7A 4ACBA 4DJZB 1HJAC 2VWMA 2R2WU 1SSXA 1XUJA 3RXDA 1HDTH 4MG3A 2H6MA 1YLNA 1V2KT 3ZZ4A 3UNQA 3VGCC 1AVGH 1G36A 2ZHEH 1A1RA 4WXVA 2Q6GA 1MKXH 1GVZA 1F92A 5HGGA 2VVCA 4DG4A 1O3AA 2PKAA 2BD3A 2ZPSA 1ANCA 2GD4B 3MU1A 3A88A 3V3MA 2BY8X 2ASUB 2JETB 2H2ZA 1O2UA 3MH4A 3C27B 1O3EA 4Y7BA 1YKTA 3B8JA 1KTSB 2G4TA 2M5TA 4JZIA 3RXAA 3LT3A 2WUBA 2QV1A 1KLJH 1OWIA 1WU1A 3W95A 1Y3XA 4AZ2B 2ZHFH 5FBEA 1VCWA 1Q31A 1Y5BT 2WYGA 5CHBA 4AG1A 1D4PB 2BQ7B 4D9RA 3SBKA 1MAYA 3OYPA 2RDLA 4WMDA 3TPIZ 1YPMH 1IQIA 4R8TB 1ELVA 1L1GA 3OU0A 3LDXH 4FVBA 4INLA 4FUHA 2P8OC 4NIXA 2NU1E 1JRTA 1FIWA 4FUEA 2BD2A 3V13A 1AVXA 2OC7A 3ZVAA 3D49H 1T4VH 1GBAA 3A80A 4Q7XA 1AN1E 1GI4A 1O3CA 1HNEE 3BTGE 4X8UH 7ESTE 1O34A 1CT0E 5GPIB 3OX7U 2THFB 4O3UA 1ELBA 3LU9B 2ZA5A 1XM1A 2QF3A 1UTKA 1WAYB 1TX8A 2ZI2H 2P59A 3ZVCA 8ESTE 1ESTA 4NWLA 5DGJA 4JZ1A 1C2JA 1GJAB 5GCHF 2BY9X 1BT7A 2GTBA 2PKSB 3TK9A 2C3SA 5EQSA 2A4QA 1P02A 1TGTA 1AZZA 4Y76A 3TH4H 1C2GA 1O2PA 4UE7H 4OS4A 1N6YA 1HB0B 1GHAG 3RXHA 3M36A 1G2MA 2BDGA 4FU8A 4WMFA 4AC9A 2J98A 1GGDB 1ZMLA 1MQ6A 1P3EA 2BD4A 3LGTA 3ZV8A 1EZSC 1A0LA 3ZVFA 1COWD 1K0HA 1XUGA 3VB6A 1SHYA 1ETTH 5KECA 1Z8JB 4F49A 1GI3A 3AAUA 3ZVGA 5LGOA 3OEHD 3OEED 1V2VT 2CHAC 1O2WA 1CA0C 3NUMA 1TX6A 4ABJA 2JH5D 1QBNA 5B6OA 5GXPA 3DSGA 2EI8A 1GI9B 3TK5A 5DP6A 3M3VA 2O8MA 4JCNA 5DO4H 1MBMA 2B0FA 1TE0A 3A89A 1WBGB 3OSYA 1F7ZA 1A3BH 4O97A 1XXFA 2A7HA 3RC5A 4CRCA 5A8YA 1CHOF 3ZZ8A 2BDYA 2GKVE 2ZCLP 2CXVA 4JK5A 4M9FA 1IQMA 3TNSA 1BUIA 1GMDG 5E0JA 3BF6H 4ABBA 2EY4C 3KQDA 1EAXA 1O3GA 1W7GH 4UFDH 3SJ8A 4WY3A 1UTNA 1G3DA 5FBIA 2PW8H 4X2WA 2WINI 1PPBH 4JZFH 3FP6E 2SFAA 1J16A 2JH0D 3MU4A 4ABFA 4RT0A 5IK2D 1P2OA 1UCYE 4MNWA 2ZDLA 3M7QA 1S85A 6GCHF 1FIZA 4AFUA 4NIYA 2AS9A 5BRRE 1NFXA 3EA8A 1JOUB 4NIWA 1E38B 3U9AH 1TB6H 1E34B 2QF0A 1SGRE 2P16A 3L33A 4AORA 5EJZA 5FX5A 1T31A 5ESBA 3P8OA 2UWLA 2SNWA 1C1UH 3SU1A 2CK3D 3U98H 5FPTA 3AASA 3VB3A 4D7FA 2GZ7A 2FDAA 1HJ8A 1SG8B 1DY9A 1DE7H 4FUIA 1CU1A 8KME2 2W7UA 1EP6A 3ATLA 2OD3B 2VWNA 1LHEH 2RCEA 4DIIH 2V0BA 3HPTB 2B5TB 2BLQA 4DT7B 2ZWLH 2STBE 1MD7A 1T8MA 1TAWA 4NSYA 1O3JA 2VGCC 1BTHH 1MZDA 1ZJDA 2VH6A 4NA8A 4WVPE 3CS7A 2QA9E 1L0ZA 1GHWH 1TOCB 3V7TA 2BD7A 1PJPA 5EJLA 1XVOA 5DN6D 3FOAA 1K28D 3QTVH 1O35A 4TPYA 5C5OA 4WXIA 1ID5H 2BY7X 1THRH 2R2MB 2A0QB 4OGYA 3LIWA 1HUTH 2YMSC 1TNGA 2FWWA 1BTXA 1TONA 1GBLA 1C5NH 2HVYB 1UCYK 4BTTB 2P95A 1HGTH 3AAVA 1VITF 1KTTB 2HNTF 1SQRA 2FI3E 3DUXH 4ABDA 2BB4A 3ATKA 1CHGA 1TABE 2ILNA 1O2YA 3ZVDA 3KN2A 1O2VA 3A7ZA 3UR6A 4GHTA 1YCPM 3DT0H 4MVNA 1ETSH 1UTOA 2WPJS 4ZCNA 1NRQH 2WPIS 1T8LA 1P04A 1FY8E 1NY22 1UMAH 1BTUA 1PQAA 1V3XA 3E8LA 2G00A 5DG6A 2A4RA 2BDAA 2ZFQH 2VJ1A 1TGSZ 4KP0A 4HTCH 2EI7A 4CRFA 1OX1A 3PLBA 1ABJH 4AX9H 3H5CB 1BRCE 1OKXA 2JH6D 1O2QA 1BBRE 1TNHA 1UTMA 3M7UA 3GISB 1ARCA 1ZRKA 1J8AA 1PPCE 2AIQA 4B2CA 3OE7D 1BOQA 1N8OB 2VWLA 4K1TA 3E3TA 2TIOA 2BOKA 1GI1A 2QXHA 1ZSLA 3FFGA 3NK8A 2C8WB 2V35A 3SUFA 3UUZA 4AB8A 1QRZA 4KELA 2ANMH 2BDIA 2KAIB 1QHRB 1C2MA 1DWBH 5F03A 1HAZB 3TJNA 3SNDA 1FY5A 2F9VA 3TGJE 2FOEA 5CMXH 1TPOA 1GL1A 1EJAA 3SUGA 1VZQH 4FXGH 2Y82A 7GCHG 1EB1H 1GMCG 1EPTB 1C2IA 1HPGA 3MYWA 2OC1A 3RXUA 3RU4T 1H8DH 1ZMJA 1S6LA 1D6RA 1GI7B 1S84A 3A7XA 3STIA 4XSKU 3P17H 3LGUA 1BMAA 3P8NA 2ZU3A 3SJIA 5F53A 2ZHQH 1EXFA 3GY5A 4X1PU 1A0HB 1KIGH 1AQ7A 1WDIA 1CSOE 1MKWK 1KYNA 1C1WH 3BV9B 2VIPA 4OS2A 4BXSA 2XCFA 1XVMA 4H4FA 1OHHD 2ALPA 3HKIB 1FJSA 2IN2A 2YOLA 4Z6AH 1BQYA 1E0FD 1W7XH 5E2PA 2Y81A 2G5NA 1EJNA 2A45B 2PKSC 1V2LT 3MO6A 4BAOB 2ZNKH 4P00A 1ZYOA 3LONA 3CNRA 3BTME 3T29A 4A1TA 3Q77A 1Y3WA 2XW9A 1Z71A 1CBWB 1F0UA 3SHCH 3CENA 3GY7A 2C93B 3Q00A 3MH6A 3T26A 3BN9A 1O3BA 4TWYA 2VIOA 4B75A 1GMHG 1HXEH 1AKSB 3UREA 1GBTA 1V2RT 4TY6A 4FOUC 3DSOA 3WWFA 3SU4A 1FONA 1GGDC 3OY5U 1ETRH 4IC5A 4TY7A 4U32A 3T27A 3BTQE 3MI4A 5DSFA 5GIBA 3RLYH 1AFQC 2OQ5A 1DLEA 1TRYA 5HKKD 2AH4X 1A5GH 1E1RD 2CV3A 3T25A 3KL6A 1TBRH 1HAHH 4XOJA 1SGCA 1P2JA 3W1EA 4ISHH 3F9FA 3U1IB 2F83A 5EODA 4ISOA 1C2KA 1HV7A 2LPRA 2W5EA 1L4DA 1DSUA 4CBOA 1MTNB 2FOCA 4WH8A 1EFRD 1OS8A 1SGFA 2FX6A 1V2OT 1BHXF 3TU7H 3Q3YA 1TMTH 3ITIA 3SGQE 5T6GA 1LPGB 3QK1A 2QXJA 1UVOA 5C1UA 2Y7ZA 2P3UB 4BAHB 1OYTH 1EAWA 3SU2A 1OXGA 1XUHA 1YPGH 3F2GA 4DY7B 1NFUA 4UFEH 1ELAA 1FAKH 1OWJA 4BAKB 3ODFA 4H6TA 2ZU4A 1MAXA 2O8UA 1BRAA 2OLGA 3GCHB 1NN6A 5JYIA 1C5WB 1QB9A 1KXFA 3HATH 5HXFA 4Y10E 1W0ZU 1S6FA 1LHDH 1O2MA 2KAIA 5C0UA 1B7XB 1HYLA 2FESH 5HMAA 1V2UT 2NU3E 2O8WA 1OWDA 3A82A 3SJKA 2IPHA 3GCTF 1BJVA 1FMGA 1P8VC 1TFXA 2F9PA 3M37A 2KFWA 1ESAA 2ZHDA 4Q2KA 3UOPA 3QO6A 5FHTA 1DWEH 1S81A 2F91A 2J38A 1TPPA 1C1NA 1EPTA 1VGCB 5GDSH 1MU8B 1ANBA 3URCA 1TWXB 3KF2A 2FI4E 4CRAA 3TJOA 2ZFSA 2AFQB 4DW2U 4CREA 5F6MA 4VGCB 1P05A 2ULLA 4FU7A 5EOKA 2DE8A 1A46H 2XBVA 3PO1C 3TGKE 1RIWC 1O2LA 1GWAA 3I78A 1GBDA 4K3JA 1VR1H 4MLFB 4GUXA 1CVWH 2ZCHP 4NG9H 5DJ7A 1QL7A 2OBOA 2FZZA 4YLQH 2HPPH 4CBNA 5L30H 2RFKC 1DFPA 1W0YH 5DP7A 4X1QU 4O03A 1DUEA 1E79D 1P2MA 4H6SB 2AMPA 3B9FH 1WUNH 1UK4A 2QF5A 1GJ8B 3E0PB 2GVFA 4FUDA 4JYTA 1AE5A 1L2EA 2BZAA 1T4UH 1Z6EA 2H5CA 3RC4A 2XC5A 5A0CA 1V2WT 3BG4B 3SJ9A 3RXTA 1P0SH 1C5RA 1AKSA 1YCPH 1QTFA 3ZYDA 1NFWA 5H4IB 3GY2A 2ODYB 2HLDD 2STAE 4GCHG 1ELTA 1SI5H 1RTKA 2HPQH 1FN6A 3NRLA 5ETXA 2GT7A 3SU3A 3TITA 2ZTZA 1GBMA 4ZROA 4B6FA 1NBME 4K2YA 4JYUH 2H9HA 1XMNB 1P01A 1KXBA 1VJ9U 1B5GH 4RSPA 1C5QA 1FLEE 1PPGE 1FY4A 2D1JA 3PMBB 1NRPH 3E16B 3M61U 2BYAX 1ORFA 1YGCH 1D3TB 1Y3YA 1GHBG 2UWPA 2ZKSA 2ZZUH 3RU4D 1WQVH 3SO3A 1KLIH 1THPB 4Y0ZE 4B2BA 1YC0A 4FUJA 1S0QA 2XC0A 1DICA 2FOAA 3QWCH 2V6NA 2C4FH 1E35B 2CJIA 3WW7A 4K60A 5C3NA 4K1EA 5EPNA 1CGIE 2ZU1A 1E36B 5C17A 2FX4A 3KGPA 2HLCA 1C1VH 1DVAH 3ZV9A 5F8XA 2KCAA 3RXBA 1BHXB 3UPEA 1H9IE 3GDSA 4ESTE 1QA0A 2GMTB 2WV9A 5T6FA 1UK3A 3BEUA 1A4WH 4YZUA 4WJG2 5JBBS 1F0RA 2Z7FE 2RDEA 4WF8A 2AMDA 2BXTH 2RG3A 5IYTA 1P06A 3LJOA 4X1NU 1YF4A 2F43B 1M9UA 4ZUHA 5FX6A 3PMHB 4TYDA 2AERH 1EP5A 2A7CA 3M5MA 3WWBA 4NA7A 4AFSA 3RXIA 2QY0B 1SLVB 5HYOA 4ABIA 4I31A 5C20A 1ARBA 1YP9A 4M7GA 2EI6A 3GDUA 3S69A 2W6ID 3E0NB 1DSTA 1C5LH 3SI4H 4QT8C 2XRCA 4E7RG 2IPQX 3S9BA 3GY4A 1O3MA 4J2YB 4X0WU 2QC2A 5EQRA 4KGAA 2H1UA 2FO9A 5AFYH 2XBXA 1JXPA 2K0QA 4X1RU 2ZPQA 2NU0E 3VB4A 1O5AB 1W13U 1WSSH 4LXBH 1BMNH 2ZDKA 5DKMA 2YMSD 3I29A 5EIYA 2BMGB 3M3SA 5GNDA 1O5GH 2OQUA 2TGDA 4DOQA 4WH6A 1TBQH 3LOXA 5I46H 3FZZA 8GCHG 4BAQB 1GI5A 1O3PB 3RXSA 4ASUD 4ISNA 4ZKRU 2AGGX 3FP7E 3MNBA 2RA3A 5GJ4B 3PLPA 4FVDA 5JBAS 1YPHE 2R3UA 3U8RH 5G4BA 4U01A 1P2NA 3BG8A 1BTZA 1QL9A 1SGQE 3A8DA 1UVSH 5LPRA 1E37B 1IOEA 2NU2E 1MTNC 5K0HA 2YNBA 1O37A 1C2DA 4AOQA 1AB9C 1NRNH 4YTAA 1AD8H 3RM0H 3A7TA 4AB9A 1C1OA 4XDEA 1S5SA 4AN7A 3BTKE 3RXCA 1LPZB 4FUFA 1FZZA 3MNXA 1UJ1A 5EJ1A 2BY5X 1OWKA 2EQNA 5GWZA 2Y7XA 4HZHA 4ZKSU 3A84A 3ATMA 5GCHG 5FCRA 3UR9A 2FP7B 1O33A 2A5AA 4BOHA 1K1PA 1C5TA 3GCHC 2OK5A 4MNXA 4DCDA 1LHFH 2Q1JA 1TNJA 2SGQE 1SGFG 4B71A 2VINA 2FEQH 1WTGH 1Y59T 1TOMH 2WPMS 1C4U2 1ZHPA 2BQWB 1GCDA 1SQTA 3RLWH 4OGXA 2BLOA 1GDUA 2J92A 3TVJB 1ZPCA 1DXWA 1SFIA 3SV2H 1EX3A 3SUEA 1TYNA 4P02A 1DUAA 2PUXB 1BRUP 4DT4A 1SGEE 1VKYA 3T62A 3IITA 1VGCC 2XXLA 3V0XA 4ISIH 1K1IA 1GJCB 2HALA 1BMLA 4OM9A 1GJDB 1NTPA 3EQ0H 2J5UA 4X2XA 2KCOA 2TGPZ 4Y79A 1S82A 1NRRH 2IJD1 3LC5A 1HCGA 2VIWA 2ZQ1A 3FN8A 4F4OC 2WV4A 1AWHB 1PPFE 2JIZD 3DFJA 4I86A 5KEDA 1KLTA 4INKA 2V7QD 3ZZ9A 1CHOG 1G3BA 2K8IA 4YO9A 1LVOA 5EXMA 2VVUA 1TX7A 2QGRA 1W12U 2BM2A 2KX4A 2VU8E 3SQEE 2F9BH 2EA3A 1VJAU 2NU4E 1GI6A 1J14A 2SGEE 1THSH 2FLRH 2WV5A 2A4OA 3E91A 2J9NA 3SGAE 1O2HA 1ACBE 1DWDH 3QZRA 4BTUB 1A2CH 1Y3UA 3QGNB 1GG6B 3BG4C 2GT8A 1QRXA 1P09A 1TRMA 4D7GA 4FU9A 3SV6A 4HGCA 1L1JA 5DP5A 4CH8B 3BTDE 1C5ZB 5DP4A 1U6QA 1C2EA 1NPMA 2XNDD 1SGPE 6GCHG 4IW4E 1INCA 2PSYA 3SV9A 1EQ9A 1H1BA 2ZO3H 2FI5E 9ESTA 3A8BA 1GCTB 1YBWA 3A86A 1QB1A 2Y80A 4UFGH 4IMQA 2W3KA 4BNRA 1SGNE 5TCCA 4IN2A 1MU6B 3SU6A 1BIOA 2ZDMA 3BTFE 2PSXA 2OXSA 5K7RA 5EU8A 2A31A 3F9HA 4XD7D 2VIVA 1HAOH 1W0KD 2HOBA 2Z9LA 3M5NA 4I8JA 4ASHA 1ZRBA 1GPZA 5SGAE 2IJOB 1WV7H 3TJVA 3PTNA 4IBLH 4Y8YA 4B74A 5F8TA 3UAIC 4I8GA 2PTCE 3M7TA 2A4GA 1BRBE 1RTFB 4YESB 1SHHB 4K5ZA 3RXFA 1QFKH 2OP9A 5HIYA 1MKWH 1C9PA 2ZGCA 1G32B 2PP6A 3K6ZA 3LPRA 1ZGVA 3ZVBA 3LC3A 3RXGA 4ISLA 2Y6TA 4YOIA 1O2ZA 4XE4A 4WMEA 3SNCA 2JETC 3F1SB 4XBDA 4K1SA 3GYLB 3LGVA 4Y71A 5C2ZA 3S0NA 2D2DA 6LPRA 2BXUH 1NFYA 1LQEA 2FMJA 1VITG 1WXRA 2GMTC 3HK3B 5DK1A 1SGYE 1P3CA 1NU9A 3MU5A 3PLKA 3MH5A 5A8ZA 1SLWB 3P92A 1DPOA 1HLTH 5EQQA 2O9QA 3RXLA 1CO7E 4KTUA 3ZVEA 5IDKA 3N7OA 1YPHC 5A0AE 2FXRA 1YWUA 3Q3XA 3RXRA 1WYKA 1QBVH 2GZ9A 4E7NA 2ZFTA 3VGCB 1O5FH 4THNH 3QDZB 2WPDD 4RT1A 1A0JA 1C1PA 2ZU2A 1ZHRA 2EEKA 4LZ4B 1C4Y2 2P3FH 3NWUA 1X7AC 8LPRA 3RM2H 3SZNA 3P95A 4XBCA 2ZGBH 1V2TT 2ANWA 1ZTJA 1SQOA 1W14U
chains in the Genus database with same CATH topology
2VVVA 1GHVH 4ZAEA 2ZFFH 5JB9S 2FLBH 1DLKB 2QN5T 2SGDE 3Q3KA 3MTYA 3OTJE 1AI8H 1DXPA 1QIXB 4X6NA 4D9QA 1BBRK 4GPGA 1FN8A 1ZJKA 1O5CB 2CN0H 5E0HA 1EAUA 1ZLRA 1LVMA 3IG6B 4KTSA 3ZZAA 1GMHF 1C1RA 1FAXA 3M35A 2XC4A 1XUFA 4OS6A 3A7YA 3LGIA 1DOJA 1YLDA 3R3GB 1OWEA 1Z1IA 1J17T 1GVKB 3NXPA 2D26C 3C1KA 4AYVB 4O9VA 4ABGA 1F5RA 1RRKA 1O3KA 2SGFE 5A0BA 1LVYA 1MTSA 3RXOA 3SV7A 1EB2A 3T5FH 1MTWA 1PQ7A 1O32A 4BAMB 1FI8A 2VWOA 3GYMA 2G8TA 1C5XB 3WY8A 1MCTA 1VCQA 1O2SA 1BMMH 1O2RA 2BOHB 2A7JA 4ZMAH 1QL8A 3FAOA 1G3CA 1BA8B 2TGTA 3E90B 1G37A 1HAIH 3BIUH 1C4V2 3VXFH 2BDHA 1OYQA 3DFLA 2F9OA 2HRVA 1SC8U 1P2KA 5J4SA 2FIRH 4CHAB 1C2HA 2FYRA 3UFAA 4BXWA 1OPHB 2A5IA 7LPRA 4Y8ZA 2VB0A 1IQLA 2AGIX 4NA9H 3TLOA 3LKWA 1O2TA 1HBTH 1L4ZA 1W2KH 2FTLE 2ZFPH 2W26A 3SU0A 1TALA 3BTEE 3RMMH 1UHBA 1WQSA 1A61H 4Y8XA 4Q7ZA 1IHSH 1UTLM 4Q80A 5C67A 3ZZ6A 3EGKH 1UVUH 2BDBA 3A81A 4X6PA 4RKOB 1SPJA 2GDEH 1D3PB 1NS3A 1YLCA 2G4UA 3S7KB 3O8RA 1FPCH 3TJUA 5AVDA 1P9SA 1QJ7B 1ZPBA 1K9OE 4R0IA 3SNAA 4NSVA 1TGBA 3RXEA 1MQ5A 3KNXA 3SNEA 2VH0A 4X6OA 1XXDA 1Y8TA 1W10U 1GJ5H 1L1NA 3U69H 2FPZA 3UWIA 1IQJA 3D23A 4X8TH 1O5BB 1TA2A 2F9UA 3SV8A 4BANB 3ZYEA 2GCHF 4AGJA 1QB6A 1T8NA 1RS0A 5T3HA 1KXDA 5EXLA 5HM9A 2ZIQH 1UK2A 1OWHA 1XKAC 5C5NA 1C5UA 2BVSH 2ANYA 4GAWA 1EOLA 1J9CH 2HNTE 3NPSA 5BPEA 1ANEA 1Z8IB 5E0GA 3E1XB 2XNIA 2OINA 3GY6A 3T28A 3U8TH 3GCTG 6ESTA 2SNVA 1HAPH 4O3TA 5LPEA 1CA8B 1ZHMA 4K8YA 1GCTC 3PM3A 5C1YA 1W3CA 2CGAA 2Z9JA 3ELAH 1SVPA 3W94A 3SUDA 1GBIA 1RD3B 3MOCA 3MU0A 2AEIH 1QGFA 3AW0A 3EA9A 1DY8A 4KKDA 4H42U 4GSOA 1V6DA 2XWBI 1UO6A 5PTPA 5CE1A 2ZU5A 3PMJA 5AFZH 1PPHE 4YM9A 1GBEA 1GHYH 1PPEE 1XX9A 1C5VA 3L6PA 3VB5A 1KSNA 4A1XA 5DP3A 1TGCA 1GI2A 1K1OA 1MBQA 2Z9GA 2I6QA 1ABIH 2G52A 2EC9H 1UTJA 4NCYA 4I8HA 1O2NA 4CRDA 1IQNA 4CRBA 1K1JA 2QIQA 1LCYA 1SGTA 4PROA 1TNIA 1VCPA 1W8BH 1NRSH 4B2AA 3ZZBA 1H4WA 3UIRA 2FM2A 1C9TA 1N8OC 1IQEA 1LDTT 2FS8A 1TRNA 1ELCA 2AIPA 2G55A 1O30A 1CE5A 1TBZH 2P93A 2ZDAH 1Z1JA 1PYTC 3RC6A 1GDNA 1H9HE 1B0FA 1XUKA 3VB7A 5FXLA 2ZGHA 5JBTA 1LQDB 2TPIZ 4D76A 1O5DH 1IQFA 4WWYA 3LGYA 5I25A 1OSSA 1YM0A 2BHGA 3UQVA 3PV4A 1GDQA 2D8WA 3BEFB 1OP0A 1EPTC 2UUYA 4RKJB 1EUFA 1LPKB 2PR3A 3PTBA 2Q6FA 2DUCA 2BVXH 2ZC9H 2C90B 3KEEA 1O3HA 3ODDA 1CQQA 3K2UA 1YPJH 3O8BA 1TA6A 3ZZ7A 1O2OA 2J2UA 2BD5A 1WOFA 1DITH 1JBUH 1YYY1 2ZG0H 1BTYA 1IHTH 4I32A 3RXVA 1T8OA 4E05H 1N1LA 1G3EA 4NFFA 1YCPK 2Y5FA 1O2XA 4SGAE 2QXIA 2ZECA 1QBOA 1BTPA 1Q3XA 1GBJA 2ZGJA 5A2MH 1RXPA 5L6NH 1NM6A 3A7VA 4I7YH 2F3CE 3KQEA 1ELEE 4IN1A 3Q76A 3G01A 1CBWC 3GY3A 3KQBA 8GCHF 4JK6A 2BZ6H 4UD9H 1WTHD 5LPFA 3RMLH 2CF8H 3SNBA 3RUOA 5EG4A 4AFZA 5DP9A 4IS5A 1GHAF 1B0EA 1TGNA 4FUGA 3EAJA 2B8OH 1ZTKA 2A1DB 3BEIB 3EA7A 1TNLA 4MPUA 4MPXA 3SN8A 1GBCA 3TNTA 2H9EH 4OS7A 1HAVB 1T7CA 2VIQA 1TPAE 1MKXK 5EW1H 1NT1A 2J4IA 3H7OA 3ATIA 2CMYA 2J94A 3IWMA 2ZQ2A 1P12E 3PMAB 1EOJA 1BITA 1AVWA 3SOSA 3UY9A 1FNIA 1GI0A 1Z6JH 3CP7A 2A2XH 2GCTB 1ANDA 1AZ8A 3D62A 1PFXC 1EAIA 1QJ1B 2Z3DA 2WPLS 3P6ZB 4CHAC 2PV9B 1C1TA 1JIMA 2QXGA 4X2VA 3GY8A 4LZ1H 3QLPH 2XTTB 4DGJA 1ELFA 2H9TH 3PB1E 9LPRA 3SORA 1C5PA 1F5LA 2HNTC 3HK6B 1YPEH 2AYWA 2GGVB 1Z8RA 1GMDF 1BTWA 2FS9A 2ZDNA 1KXEA 4I33A 1JRSA 3GCNA 4UEHH 3O8DA 5LH8A 2PLXA 5AF9H 1EZUC 1AY6H 1DX5M 2UUFB 1CT4E 1AFQB 2ODQA 2OC8A 3TH2H 2R0LA 3RXKA 6CHAB 5A8XA 5A09A 2WPKS 3UNRA 3H7TA 1PQ8A 1QRWA 2OC0A 3FVFB 4ZXXH 1QY6A 1RTLA 1QA7A 1ZZZA 2PWXA 3NCLA 4YOGA 3ZZ5A 4DVAU 1DS2E 1OOKB 1FXYA 1TQ0B 4NWKA 3SJOA 4GLYA 1P03A 1P2QA 2OTVA 4YLUA 5EXNA 1ZMNA 1K1NA 3LGWA 1O2IA 3K9XB 1MUEB 4VGCC 2NWNA 5JB8S 1V2JT 3FZDA 1C1QA 4NZQA 3FP8E 4A92A 2LNCA 1GHXH 4X8SH 1UCYH 4MNYA 4Z0KA 2DE9A 2WUCA 1C5SA 2UUJB 1Y3VA 1SB1H 4A5TS 5JPMH 1ELDE 1NESE 1GJ6A 3K6YA 4A7IB 1K1LA 3URDA 2W3IA 2FOFA 1CGJE 7KMEH 1DWCH 5ABWA 4JZEH 1C1MA 2ZP0H 1EJMA 3FANA 3RXPA 1LHGH 1D6WA 1LO6A 4X8VH 1P10A 1AO5A 2G81E 1DDJA 2GZ8A 1QCPA 3M3TA 1FUJA 4I8KA 1K2I1 5TJXA 1HXFH 2VIDA 2OUAA 4OS5A 5CHAB 1WCZA 4NIVA 3VPKA 1QR3E 4ZKOU 1EZXC 1S83A 1OP2A 3P8FA 4Q7YA 1AUTC 2YNAA 2BLVA 1MCVA 4K8BA 1TQ7B 2B9LA 2BQ6B 1HJ9A 1SLXB 1FV9A 1AE8H 2H5DA 3P70B 3VEQB 2TGAA 2FYQA 1V2PT 1OP8A 3MWIU 3MU8A 2BLWA 1O3OA 1UVPA 5EPYA 2VNTA 3PO1B 1HAVA 1RIWB 3GCOA 3OY6U 1FY3A 5FCKA 2AGEX 2IOTA 3TH3H 4AYYB 1IQGA 1HIAB 2WYJA 4MPWA 1LHCH 1A3EH 1AMHA 2BD8A 2ODPA 1LVBA 5JDUB 2GX4A 1MTUA 1QNJA 3KIDU 5E8EH 4AGKA 2A2QH 2GDDA 4SGBE 1GJ9B 1O31A 4AFQA 1UVTH 1EKBB 1JIRA 5L2YH 2J95A 2UWOA 4KTCA 3L3TA 1G2LA 2Z3EA 4CR9A 2GP9B 4B1TA 1LKBA 2P3TB 3UOUA 1BDAA 1A7SA 1AFEH 1GJBB 1P9UA 1SOTA 3HGNA 4A1VA 4K69A 2FODA 4YOJA 1C5YB 2QCYA 1O3NA 1SBWA 3ESTA 3F68H 3MMGA 1H9LB 2Z94A 4B73A 4U2WA 1GHZA 2PGQB 2BVRH 2V3OH 1BBRH 1SOZA 1PPZA 4Y0YE 1F2SE 2J34A 5EW2H 2GV6A 1Z7KA 3LH1A 2ESTE 4J1YA 1D3QB 1P2IA 1UHBB 3MO9A 1AHTH 1K1MA 1O2JA 3QGJA 3GOVB 1AGJA 3GDVA 1ZR0A 7GCHF 2BDCA 2C8XB 1C5OH 3QUMP 1GMCF 3S9AA 5J4QA 4JZDH 1SL3A 3RP2A 2WPHS 4ABEA 2ZTXA 1GI8B 4UONA 4ZH8A 1A5HA 3MFJA 2QAAA 3V12A 3F9GA 1IQKA 1W11U 3ZZ3A 1KDQB 1UTPA 1HJAB 4CR5A 2HWLB 2SGAA 3PWCA 4ZHAA 3QZQA 5FPSA 1O3LA 2K1QA 2UUKB 3HGPA 1O0DH 1FDPA 1MD8A 3JZ1B 4JYVH 4ZHMU 3DD2H 3PWBA 4ZKNU 1BJUA 1IQHA 3SHAH 3MNSA 2ZF0H 4CRGA 1UTQA 4LOYH 5FPYA 2FOMB 4Y7AA 3SI3H 4Y6DA 2A5KA 4TWWA 3RXJA 1D3DB 1AU8A 1KXCA 4FUBA 1C5MD 4UDWH 1O38A 1QQ4A 5T6DA 3JZ2B 4I8LA 2R0KA 5AHGH 1C1SA 1MMJN 1SR5C 3KCGH 4CH2B 2FOHA 3O8CA 2PGBB 3BTHE 2BX3A 4MNVA 4A6LA 3EE0B 3ENSB 3KQCA 1KY9A 3RDZA 4B76A 1NC6A 2BY6X 1C2LA 3A7WA 1DM4B 3KHVA 3EDXB 5JBCS 3A8AA 1F0SA 1LMWB 3F9EA 2ALVA 2XYAA 3MNCA 1K22H 1Q2WA 1GBFA 1BZXE 1O3IA 2GCTC 2I6SA 2P8OB 4ZXYH 5ESTE 3UWJH 4GHQA 1ZSKA 2SGPE 1NROH 1HIAA 2ZPRA 4ABAA 3U1JB 4XBBA 3M5LA 1IAUA 2FOGA 1V2QT 1Y5UT 5DPAA 2Z9IA 1LTOA 1SFQB 1FQ3A 3S7HB 1HAXB 4D8NA 4OS1A 1PYTD 1JWTA 1GBKA 2O8TA 2FOBA 1ELGA 1HAGE 3T2NA 1YPLH 1O3FA 1V2ST 3MO3A 4MQAA 4U30A 1F5KU 2Z6BD 3MHWU 3F6UH 4YT6H 1A5IA 3P8GA 6CHAC 1XUIA 1O3DA 1NO9H 3U8OH 1LKAA 3SQHE 1MTVA 3SGBE 3HKJB 1HAYB 2BX4A 1N6XA 2ZCKP 1Z8GA 4HI3A 1GVLA 2TBSA 2XWAA 1V2NT 1RJXB 1O5EH 1D9IA 1NZQH 1TMUH 3DHKH 3NZIA 5DP8A 1FPHH 3CS0A 3UQOA 3TK6A 4XFQA 1YPKH 1AB9B 2FTMA 1O2KA 2R3YA 4FUCA 1BB0B 4INHA 3TIUA 2ZTYA 2AMQA 2BD9A 3K65B 1KXAA 2F9NA 2RA0A 3BSQA 3QTOH 3ATWA 2CHAB 2Q6DA 3RXQA 1CA0B 1KDQA 3BIVH 5E2OA 4E06H 4DURA 2QYIA 3DA9B 2PKAB 3LJJA 2PHBA 4LK4A 4MPVA 4BTIB 2Z9KA 1J15A 1QURH 3AVZA 4MDSA 2ZFRH 4YT7H 4IGDA 2G5VA 1AUJA 2B7DH 4IC6A 1V2MT 4X2YA 2PUQH 1AIXH 1GBBA 2BTCE 1SGIB 1ZTLA 4MTBA 1ESBA 3D65E 1PQ5A 5F8ZA 4DIHH 1GG6C 1QJ6B 1MH0A 5CHAC 1O2GH 5EGMA 4GVUA 5FAHA 1VITH 3GICB 3VFEA 1GL0E 1H8IH 1TPSA 1SQAA 2Z3CA 2JKHA 4HFPB 1NU7B 3QX5H 2ANKH 3BTWE 1RFNA 3AW1A 4JMYA 3TGIE 1FY1A 4TPIZ 2O8LA 1RGQA 2HVXA 4IMZA 1TIOA 2CF9H 1CGHA 1GJ4H 4X6MA 3A8CA 1EASA 1SGDE 2A32A 3PROA 4X1SU 3ZZCA 1P57B 4GCHF 1GJ7B 4ABHA 2HGTH 5TCAA 5HM2A 2GCHG 3PYHA 5L2ZH 3ZZDA 1Y5AT 1QQUA 3NKKA 3RMNH 2ZHWH 2V3HH 4UFFH 1SLUB 1C2FA 1XKBC 3B23B 4AG2A 1T32A 4NGAH 2PFEA 3E6PH 1TLDA 2GV7A 2ZEBA 2PTNA 2Y5GA 4RN6A 2OBQA 3R0FA 2ZDVH 1ZGIA 3STJA 3SW2B 1GBHA 1ZOMA 3RMOH 2TRMA 2W7SA 4ZHLU 1ZSJA 3RU4E 1GHBF 1ZPZA 1F0TA 3SU5A 1JMOH 3VXEH 2P94A 2VGCB 1DANH 3RXMA 1O36A 2G51A 3LH3A 1EZQA 1S0RA 1DT2A 1TNKA 1S6HA 3UNSA 2C8ZB 1TMBH 1HFDA 1AWFH 2C8YB 1P11E 3A85A 1EATA 2XBWA 2ZGXH 1K21H 3UTUH 3I77A 2OCVB 3A83A 1G9IE 2R9PA 3EYDA 4Y11E 1BCUH 2XCNA 3BTTE 3MH7A 3A87A 4NFEA 1HRTH 1SMFE 1G30B 2Y5HA 1CT2E 1O39A 4NZLA 5C1XA 1MZAA 2XBYA 3M5OA 3S9CA 3QN7A 4DJZB 1HJAC 2VWMA 2R2WU 1SSXA 1XUJA 3RXDA 1HDTH 4MG3A 2H6MA 1V2KT 3ZZ4A 3UNQA 3VGCC 1AVGH 1G36A 2ZHEH 1A1RA 4WXVA 2Q6GA 1MKXH 1GVZA 1F92A 5HGGA 2VVCA 4DG4A 1O3AA 2PKAA 2BD3A 2ZPSA 1ANCA 2GD4B 3MU1A 3A88A 3V3MA 2BY8X 2ASUB 2JETB 2H2ZA 1O2UA 3MH4A 3C27B 1O3EA 4Y7BA 1YKTA 3B8JA 1KTSB 2G4TA 2M5TA 4JZIA 3RXAA 3LT3A 2WUBA 2QV1A 1KLJH 1OWIA 1WU1A 3W95A 1Y3XA 4AZ2B 2ZHFH 5FBEA 1VCWA 1Q31A 1Y5BT 2WYGA 4AG1A 1D4PB 2BQ7B 4D9RA 3SBKA 1MAYA 3OYPA 2RDLA 4WMDA 3TPIZ 1YPMH 1IQIA 4R8TB 1ELVA 1L1GA 3OU0A 3LDXH 4FVBA