1FLEE

Crystal structure of elafin complexed with porcine pancreatic elastase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE
publication title Crystal structure of an elastase-specific inhibitor elafin complexed with porcine pancreatic elastase determined at 1.9 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (serine protease/inhibitor)
total genus 59
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 1996-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fleE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fleE01
1QB1A 1O2KA 4B2AA 1HIAA 2FOCA 1TYNA 2VU8E 1Y3XA 3K6YA 1AY6H 1XUHA 2XBYA 3V0XA 4IMQA 1QL7A 4JZ1A 3A89A 1RIWB 1ABIH 1C5OH 4NSVA 3ZZ7A 2QF0A 3MOCA 1FY5A 1XMNB 1O5EH 4I8GA 1K28D 4NA9H 4Y11E 3A80A 5LPRA 1C5RA 2BD4A 4LZ1H 1WQSA 1FN6A 3ITIA 3SUDA 1Z8IB 2G81E 2G8TA 2AMDA 2QXJA 1ZGVA 5A0CA 3MO3A 1TLDA 2ANKH 1LPKB 1HUTH 4MNXA 1P2JA 1FAKH 1P10A 4ZKOU 1EJAA 4TYDA 1EAXA 2TPIZ 5HXFA 1QA7A 1YPLH 1C2JA 1HB0B 2BVRH 2FPZA 3BIUH 2OD3B 2ZGJA 1C2DA 1IHTH 3PO1B 5I46H 3MTYA 3SO3A 3RXKA 1VGCC 1MQ5A 4Y10E 5DGJA 1UK4A 1C4V2 4BAOB 3RMNH 4BTIB 2WYJA 3SU4A 3ZZBA 5C1YA 3SZNA 1IQNA 2ILNA 2G51A 3E16B 3O8CA 1J17T 3BSQA 2Z9KA 2ANMH 3T25A 3QZQA 1LPZB 1WQVH 2C93B 3SI3H 8ESTE 1D3DB 1JXPA 3KQBA 5FXLA 1GBKA 2FZZA 1NS3A 1TONA 4KP0A 1YYY1 4UEHH 1A1RA 2PTCE 4AGJA 2BD2A 4IN2A 5DJ7A 5DP5A 4O97A 1GHZA 4AORA 3SV6A 2BY7X 4XBBA 3SU5A 5EOKA 4GLYA 1C5SA 4UONA 2PGBB 2A2QH 1S82A 4BAKB 1NRNH 3B8JA 3UQOA 2TBSA 1TNGA 2BDYA 2Q6FA 4BXSA 1SGDE 1QQUA 5EPNA 5FHTA 3QUMP 4FUFA 1ZPBA 3PMJA 3A84A 1HAGE 1PYTC 1DWBH 2FP7B 2UUYA 5PTPA 1GL1A 2TGPZ 4ISLA 2YNBA 2QY0B 3FANA 3ATLA 3ZZ5A 1BB0B 3VB4A 2O8MA 1T8LA 1ZGIA 4FU8A 1KXFA 3SHCH 3U98H 2HNTE 1V3XA 4HGCA 4ZH8A 1GDNA 1D3TB 1MTNC 1O3EA 1ANCA 1DITH 4MPWA 1RFNA 4JK6A 1KLJH 2OQUA 4RSPA 2H1UA 1FY4A 1YKTA 3LJOA 4AFZA 1OPHB 4IC5A 3ODDA 1DY9A 1A5GH 1T8OA 2FX6A 4LXBH 1EZSC 1L4DA 2PKAB 5T6FA 5L2ZH 3RXRA 1EAWA 1PQ5A 2JETC 4K3JA 4WH8A 4YLQH 1GBMA 1H9IE 1KXEA 3SNBA 2H9TH 2PR3A 3DD2H 1P01A 1GJAB 1SGEE 1DE7H 3FZDA 3RM2H 2WPLS 4D9RA 1FIZA 1AB9B 1IQMA 1PQ8A 6CHAC 2DUCA 2ZTYA 1SFIA 2EEKA 4Y0YE 3SV7A 2PKSC 3P8GA 2A45B 4Y79A 2RG3A 2HPPH 4MQAA 2FWWA 3BEIB 4I8HA 3SUFA 1C5XB 3W95A 1YPJH 1UTMA 1XX9A 1FLEE 1E37B 1IQFA 2ZFSA 1MAYA 1Y8TA 2PSXA 2AGGX 3SGQE 2JH6D 1YC0A 4X2XA 3SU2A 2WPMS 4JYUH 3MH7A 1TGNA 3GY7A 3I29A 3LH1A 3RXAA 3KIDU 2ODYB 4Y76A 1NZQH 4B75A 1SPJA 1K2I1 2VNTA 4YTAA 1DT2A 1LPGB 4Y7AA 2DE9A 5AFYH 2Q6GA 2VVCA 1THRH 2QAAA 1LMWB 1O5BB 1OWEA 1TFXA 4NFEA 3MU8A 2BDAA 1TPOA 1GI0A 4X0WU 2IPHA 1MAXA 1MBMA 1SGFA 2R0LA 2WPHS 2ZDVH 5LGOA 1EOLA 1HAVA 2OXSA 3STJA 2P94A 5C1UA 3UNSA 3V12A 4O3UA 4X6NA 2FOMB 2FDAA 4OS6A 2AFQB 1C2LA 1FPCH 2EC9H 1BTWA 2KAIA 4NWLA 2ZCKP 1M9UA 1DM4B 3PMAB 3PWBA 1FY3A 4X6OA 2BVSH 1X7AC 2RA3A 1A5HA 2J95A 1P9UA 1O2PA 2C90B 3PMBB 4XBDA 5DKMA 1YM0A 2VJ1A 4LOYH 1DANH 1O34A 1BDAA 2VIQA 1Y3YA 1EB1H 4WJG2 1ZMJA 5FBEA 1IOEA 2FOEA 3TNTA 1WU1A 4I31A 3BTME 3GY4A 1S84A 4TY7A 3QZRA 1AFQC 1OWDA 1GI6A 2Y5GA 1CBWB 3MH4A 5FAHA 1UTQA 1VCQA 1KLTA 2V35A 1WYKA 2ZU3A 1AVGH 3RXUA 1B5GH 3HGNA 1XKBC 2NU1E 1XKAC 4FU9A 2BD5A 1MTWA 1Z7KA 3TGIE 3BIVH 1W8BH 2GV7A 4WY3A 3TIUA 1V2UT 2FYRA 3BTTE 5CE1A 3GCHC 4X1PU 1CT4E 1TWXB 3M61U 3SJIA 2BHGA 2C3SA 1A0JA 2BDBA 1HAZB 1W3CA 1AVWA 1KLIH 4DVAU 4FUEA 1O2TA 5JBCS 2TGAA 1IHSH 1UVOA 3RXHA 4X6PA 2VINA 1TGCA 1F0UA 2GMTB 1O5DH 1WSSH 1P12E 4NG9H 1NFWA 3ZZDA 1H9HE 1CA0C 2Z9LA 1ETSH 1GBIA 1MKWH 2ZQ2A 2QGRA 1YGCH 1NPMA 2BLOA 1Y3WA 5K0HA 1ORFA 1U6QA 3IG6B 1GWAA 1BTXA 4AFUA 2PV9B 4RN6A 1S85A 3AAUA 4BTTB 3VGCC 3RLWH 1PJPA 2VWLA 1L1GA 5FPTA 1PFXC 3PLPA 2W26A 3P8NA 2Y80A 1GCTC 2HLCA 1ZJKA 2PW8H 4TPIZ 4WF8A 2BY5X 4DURA 1FAXA 3KQCA 4K8BA 1OP0A 1QL9A 1EZUC 3EDXB 1KSNA 2Z3CA 1C2EA 1HJAB 1S0QA 1SOTA 1MKXK 1TA6A 1EJMA 1AWFH 2Z9GA 3RXSA 4X1QU 3SN8A 1F0SA 1SLVB 1BMAA 1GI8B 1GBTA 2ZPQA 1C5PA 3P92A 4H6SB 1VITG 4RKOB 4ZMAH 1PPEE 4E7NA 1VITF 1QIXB 2J38A 3K6ZA 1EZQA 1F0TA 3V13A 1O31A 1TGSZ 4DY7B 4NIVA 2F9BH 4ABJA 2ULLA 3F68H 2FOFA 2CXVA 5JBBS 4ABIA 1UHBB 3FP6E 3PROA 2FLBH 2G00A 2GKVE 1ELEE 2ZGCA 1H4WA 2ASUB 2BY8X 4X1RU 1OS8A 5DK1A 2FEQH 4FVBA 3A85A 1O2ZA 2VIDA 3PWCA 2JH0D 3H7TA 5TJXA 1HCGA 1C4Y2 1ZJDA 1O5FH 4YOJA 1QNJA 1D6RA 4X1NU 4KTSA 1LTOA 1N6YA 3SQEE 1NU7B 2ZGHA 1O5AB 1TALA 2J2UA 1HAPH 1KDQB 4CRDA 1GVZA 1LQDB 2VGCC 1HBTH 1ELBA 2F9PA 3MNCA 2A4GA 3UR6A 3A86A 2D2DA 3VFEA 3GY6A 1F5KU 1UMAH 1FUJA 1P02A 1ETRH 1SLXB 1MTSA 3T2NA 1OWIA 1Y59T 1C5MD 2BQ6B 5CHAB 5B6OA 2BY9X 1K1OA 1O3OA 5AF9H 1C2KA 2ODPA 1AFEH 5FX6A 1N1LA 2FYQA 3NPSA 2STBE 3A8DA 4X2VA 2J92A 5EW1H 1PQ7A 3QLPH 1Q2WA 4F49A 5E2PA 3SU6A 2FXRA 1EB2A 5EXMA 1E35B 2SGPE 4ABBA 4BTUB 2OBOA 1PPGE 4TPYA 4OGYA 4JZDH 3UFAA 2ZHDA 3SNDA 1UK2A 3GDSA 3BEFB 2VIVA 1P3CA 4BAHB 2XC5A 2OP9A 4AX9H 1GJBB 1ARBA 1O2XA 1FZZA 2C8XB 4BOHA 4GPGA 3TVJB 3BTFE 4D9QA 4ZXYH 1LVYA 3TGJE 2FESH 1V2NT 1FXYA 1AKSB 3JZ2B 3KEEA 3ZVEA 2XC0A 1ID5H 3EA9A 3SV2H 2TGDA 3LIWA 2H5DA 3P8FA 4FUDA 2GZ9A 1C2FA 2UUJB 3GY8A 3A7ZA 1V2QT 2VWNA 1XUJA 1E34B 2ANWA 2A4QA 2Y7XA 3TH3H 3UUZA 4CH2B 3LOXA 2A0QB 2BY6X 3BTHE 1ABJH 3A8BA 4A7IB 5TCCA 3M7UA 4Y71A 1CVWH 3P8OA 1BBRK 1TNJA 2ZC9H 2ZPRA 3U9AH 2GCTC 1UCYH 3QGNB 1F7ZA 1P2IA 1BJVA 2NWNA 1EPTB 3S69A 1UCYK 1EASA 3RC5A 1SC8U 3KN2A 1IQHA 1QJ7B 1B0FA 4K60A 4DJZB 4CR5A 1ELAA 1EATA 2Y7ZA 3PB1E 1UVSH 4MPUA 3RC4A 1RXPA 2ANYA 1AE8H 1YPKH 1RTFB 2ZECA 1C5ZB 3GISB 3E0PB 1BRAA 4UFDH 1SGRE 5DP8A 4FU7A 1N8OC 1WTGH 2FTMA 5ETXA 5AVDA 3GOVB 4I32A 4KELA 2P8OC 5I25A 3D23A 1CE5A 3S9AA 4D8NA 3ZYEA 5DO4H 3K65B 3F1SB 3N7OA 1Q3XA 1QBNA 4LK4A 1CQQA 2BDCA 2F9UA 4XBCA 5GWZA 1O2WA 4B74A 3RXBA 3UREA 3BTQE 4X6MA 4YOIA 1CT2E 3F9GA 1C9TA 2ZTZA 1UCYE 1LVBA 3S9BA 2CN0H 2WV5A 3RXDA 4JZFH 1PPFE 1KIGH 2FI4E 3A82A 1Z1IA 1O3GA 2AEIH 3I77A 2BTCE 1MH0A 2FO9A 1VJ9U 1ELGA 1SHYA 4A5TS 1C5LH 1XM1A 3ZV8A 5C20A 1UJ1A 4AG2A 1O3IA 3K2UA 4WMFA 3RXVA 2VIOA 3MU1A 1O2HA 3UWIA 1RD3B 4DW2U 1TOMH 2UUKB 5C5OA 4FUCA 2P95A 3SU0A 1O2GH 2ZA5A 1D3QB 4JMYA 1FDPA 1SQTA 1DUEA 4OGXA 4AOQA 1HV7A 3A88A 2A7CA 1O3HA 2F9NA 2HNTF 2F9VA 3LDXH 1EKBB 3M3SA 3V3MA 3RP2A 1QA0A 2AMPA 2H2ZA 2V0BA 2FX4A 2BMGB 3QO6A 2AS9A 6ESTA 2SGFE 2ALVA 4Q2KA 3ZZ6A 5DP6A 1P11E 4R8TB 2O8TA 1C5NH 1SLUB 3SJ9A 3KQEA 3W94A 1ZHPA 4CBNA 4CR9A 1H8IH 4WXVA 2ZU4A 2FS8A 3GDVA 5T6DA 3MH6A 1SBWA 1W13U 1GJDB 1AE5A 5DP4A 4YM9A 1UVTH 4IGDA 4FUJA 2BLVA 2VIWA 2GDEH 1DOJA 2ZPSA 4H6TA 1F2SE 2FOBA 2XCNA 2OTVA 1W0YH 1SGNE 2I6SA 5BPEA 2BLWA 1GBAA 4R0IA 4DIIH 5EU8A 1Y5UT 1OYTH 1Q31A 2QXHA 1ESAA 4A92A 4BNRA 1FV9A 4OS7A 3HATH 4NZLA 4CH8B 4D76A 1DLEA 3UNQA 1BA8B 1BTZA 1CA8B 1V2MT 3OYPA 1DXWA 2A2XH 1CO7E 1QTFA 3A7YA 3UWJH 1HXEH 2XW9A 3RXOA 4ISIH 3FAOA 3M35A 5C1XA 2R3UA 3PTNA 5T6GA 1H8DH 3GCNA 2A7HA 4Y0ZE 1GHWH 1GHVH 1NT1A 4E7RG 2FODA 3IITA 1SMFE 2BLQA 2HALA 3A7TA 2PUQH 2FI3E 1ZHMA 4K1TA 1KTTB 2D26C 1C1SA 4OS2A 2FM2A 4UFEH 1TX7A 3GICB 1NO9H 2OQ5A 2A31A 2I6QA 2ZF0H 4A1XA 1P2NA 2Y5HA 3TLOA 4Y7BA 4WMEA 3STIA 3Q00A 2ZFPH 1TX6A 3RC6A 1C1WH 2YOLA 3RLYH 2TGTA 4AN7A 5JDUB 3HPTB 1T8NA 1F0RA 1KY9A 4CRAA 2WUCA 3RM0H 3DA9B 1GHYH 1ESTA 1P9SA 4K8YA 3NZIA 1O3PB 4I33A 4K5ZA 1DLKB 1G30B 1WCZA 1VGCB 3D49H 1C1NA 1G37A 2OC7A 1AQ7A 1QB9A 3CS7A 4CRBA 2SGEE 2ZI2H 2Y81A 4JCNA 1W12U 4Q7YA 1GI2A 3AASA 3OY6U 1ELTA 1GBFA 7KMEH 2HVXA 1GGDC 1LHGH 1UHBA 2ZQ1A 4WMDA 1CBWC 4THNH 4CRFA 2XWBI 2ZP0H 3P17H 3Q3KA 1GL0E 3BTEE 2GVFA 1ZSKA 1ZRKA 1F5LA 3B23B 3ZVCA 1XVMA 3URCA 5JBAS 1XXDA 1L4ZA 4I8JA 2Q6DA 2NU0E 1HIAB 1TX8A 2VVVA 1A5IA 2ZDKA 2ZFFH 1KDQA 3SGBE 4ZROA 1T32A 4AFQA 2SNVA 1Y5AT 1OWJA 3QDZB 5SGAE 2J9NA 2BZAA 1EAIA 1SGPE 5EQRA 3ZVFA 1SOZA 3UR9A 5EXLA 2RCEA 1MUEB 2FI5E 2QA9E 4I7YH 4B76A 1W7XH 5AFZH 1MTNB 1UTLM 1C5UA 3KNXA 1DFPA 2PUXB 1K1LA 3AW1A 2D1JA 3LH3A 1GHAG 2FOHA 1AMHA 1GHAF 3NK8A 1BIOA 1P09A 1SGYE 1NFUA 1DICA 2BXUH 1ZLRA 1OKXA 1A7SA 3Q77A 2GP9B 1DY8A 2WV4A 2C8ZB 4J2YB 4DT7B 1BZXE 1NROH 3VB7A 1G32B 1TAWA 1SQOA 5EGMA 5FCRA 6CHAB 1O3CA 4O03A 1TRMA 3RXLA 1C2MA 3RU4T 2Y6TA 2ZU1A 4JZIA 2OCVB 2PKSB 2TRMA 2VWOA 4DGJA 4GHTA 1MTUA 4YOGA 2R2MB 3LKWA 3BF6H 5K7RA 1PPBH 1O3BA 5C5NA 1FNIA 5EXNA 4YZUA 1QRZA 3VXEH 1V2ST 2RDLA 3A8AA 1CT0E 1YLDA 4HI3A 1AO5A 3F9FA 1C5YB 4QT8C 2W5EA 2BDIA 3SI4H 4Y8ZA 5F03A 2DE8A 5AHGH 2CF9H 2FOAA 3UNRA 1EX3A 4Z6AH 1EPTA 2ALPA 3G01A 4YO9A 3ODFA 2BQ7B 2A4OA 4Q80A 3ZYDA 3CP7A 3F9EA 3T29A 1GBEA 1ZTKA 3TPIZ 1FY8E 1MKWK 1VCPA 4XDEA 3LJJA 5EODA 2R2WU 5GIBA 1IQIA 1K1MA 3HK6B 4Y8XA 2PFEA 3VB6A 2CHAC 3RXTA 1GBHA 3RXJA 4BANB 4HTCH 2YNAA 5A2MH 1ZHRA 1V2PT 1K1PA 1RS0A 3B9FH 5CHAC 4CHAC 5ESTE 3MU5A 1OSSA 1W2KH 1ZR0A 1S6FA 1UTJA 2ZTXA 1AZ8A 1CGIE 3VPKA 2XYAA 3A8CA 2H9HA 5EG4A 4AB8A 2VVUA 1GI1A 1SFQB 1FMGA 1VCWA 2SGDE 4NSYA 4ISOA 2XTTB 1BMMH 1NC6A 3P6ZB 4B2BA 2B5TB 2A5KA 3MFJA 2F91A 4ZKNU 1C4U2 1FN8A 1GI9B 4DOQA 1GI5A 4ASHA 2STAE 4GHQA 4DCDA 2WPKS 4H42U 1GDUA 4VGCB 5GXPA 1O2VA 1GJ6A 3BTDE 1MZAA 3LPRA 4CRCA 1ELVA 3LC3A 2W3KA 1AFQB 1TPSA 4J1YA 1P06A 3KQDA 1N6XA 1O32A 3MYWA 1TBZH 1IQKA 3A7XA 1S5SA 5HM2A 2W7UA 1EAUA 5JPMH 3ZZ9A 1AI8H 1L1JA 3ZVGA 5LPEA 5A0BA 1Z1JA 3DHKH 3DT0H 2PTNA 1YPHC 3GCHB 4MNYA 5EQQA 1RTKA 4UFGH 1O5CB 2UUFB 1HXFH 1EQ9A 2OINA 2ZFQH 1TNIA 1QGFA 5GJ4B 3O8RA 2PGQB 1O2LA 4KTCA 5IDKA 1ETTH 1QCPA 1UTKA 1C5WB 1PYTD 2IJOB 1EPTC 2J4IA 2JKHA 1V2VT 3VXFH 2SGQE 4ESTE 5EW2H 4U2WA 1TABE 1YPEH 1CA0B 4TWYA 1G2MA 1A0HB 3PTBA 2LPRA 3QTOH 1G36A 2XC4A 1IAUA 4INLA 1HAVB 1HGTH 1L2EA 4BXWA 1SGIB 1DUAA 1C1UH 3E8LA 4YLUA 1HDTH 3E6PH 3SHAH 1EXFA 2BD8A 1ZPZA 4A1VA 3VGCB 1BMLA 4YT6H 3Q3XA 1VZQH 2Z9JA 1FJSA 3M5MA 1XXFA 1ZSLA 1O37A 3U8RH 5C67A 3OX7U 3UPEA 1GCTB 1ACBE 1NFYA 1SG8B 1J9CH 3MHWU 1IQJA 3RU4D 1SR5C 3IWMA 3BG4B 2QCYA 4I8KA 3H7OA 3PYHA 2P16A 3ZVDA 4YESB 2FLRH 2GTBA 1ZTLA 2Z9IA 4X2WA 1D3PB 1AUTC 4A1TA 1YPMH 4FUBA 1ZPCA 3GDUA 3VB3A 2ZU2A 1GJ7B 1O2QA 1A4WH 1AN1E 1ZMNA 1LVOA 3R3GB 1LHDH 3T28A 2VIPA 4INHA 2OLGA 1QFKH 3FP7E 3S0NA 3S9CA 1VJAU 5A8XA 1GDQA 1DWCH 2OUAA 1SGFG 4GAWA 5L2YH 4ISNA 1H9LB 1G3CA 4B73A 1IQGA 1C5TA 3RXFA 1GJCB 3ZVBA 3ZZ8A 1A0LA 1QURH 3AVZA 1J8AA 1TNLA 4AB9A 1KXAA 3WY8A 1NU9A 3SUEA 1P8VC 1QQ4A 4LZ4B 5F8XA 1MCVA 1B0EA 1QJ6B 2OBQA 4BAMB 2CMYA 1A3BH 1HPGA 1MZDA 4GSOA 3TK6A 2BDGA 2QXIA 1G3DA 2BD9A 4AFSA 5LH8A 2Z6BD 1GPZA 1MU6B 2QIQA 1O39A 1RIWC 5FBIA 3TJVA 2B9LA 4HFPB 4AZ2B 1S81A 1VR1H 3AW0A 1FPHH 5C3NA 1DWDH 1GG6B 2VGCB 4MNVA 2AERH 4TWWA 3TJNA 3VEQB 2D8WA 5A09A 1NFXA 1NRRH 2R0KA 1BTUA 2OC8A 1QBVH 2K1QA 1P57B 1HJ9A 4MG3A 3UQVA 4KKDA 1J16A 4ZUHA 1O2NA 2QXGA 1NY22 3MNXA 4I8LA 1TGBA 4SGBE 3RMOH 1QRXA 4ABAA 1C1RA 3PLKA 1HNEE 2PKAA 4IC6A 1LKBA 1PQAA 2XCFA 1ZMLA 2GT7A 4AYYB 3M3VA 3URDA 1BMNH 2ZGBH 3GCTG 1SI5H 3ZZ3A 2GV6A 3GCTF 3PO1C 1AVXA 2PWXA 3KL6A 1KYNA 3MU0A 3OU0A 1ANDA 1OWHA 4K2YA 2BOHB 2VWMA 3PLBA 3SV9A 1TA2A 3V7TA 3EE0B 3SV8A 1OXGA 1P3EA 1K1JA 1TMBH 3U1IB 1OX1A 3MO6A 2FOGA 3GYMA 2UWLA 4A6LA 5GPIB 2ZEBA 3Q76A 4O3TA 3NWUA 2OC0A 1K21H 2VH6A 3K9XB 1THSH 2XBWA 2ZWLH 1EJNA 3TJOA 3HKIB 3F6UH 1G9IE 3NUMA 1C5VA 1G3EA 4Y8YA 1AD8H 2BD3A 1HAYB 2J94A 2Y5FA 2HRVA 3L3TA 1BUIA 1G3BA 3FP8E 3BEUA 7ESTE 4NIYA 2ZHEH 3A81A 2BYAX 3MNSA 3U8OH 1AWHB 2G52A 4UE7H 2QF3A 1AGJA 1V2JT 2P3TB 4YT7H 8GCHG 3SU3A 3M7TA 1C9PA 8GCHF 2EI6A 3L6PA 4BAQB 1EOJA 1C1QA 2BB4A 1Z8RA 1HFDA 5FPSA 5JB9S 2ZO3H 3E91A 2XXLA 5EPYA 1GJ8B 1N8OB 2GGVB 4M7GA 1CGJE 1UVUH 1B7XB 3TJUA 1YPGH 2P8OB 2Z7FE 4IMZA 1GBDA 4WH6A 1MD8A 4X8VH 4IS5A 1HAXB 1ANEA 3KCGH 2F9OA 3FFGA 1K9OE 1J15A 1YPHE 5F8TA 1IQEA 1QR3E 1EP5A 2B8OH 2ZG0H 3SNCA 3T62A 1GJ9B 1P05A 2PSYA 2SFAA 3KGPA 3A87A 1J14A 1AB9C 2HGTH 9ESTA 1ESBA 2ODQA 1A2CH 5HMAA 2VH0A 1UO6A 3ZZCA 3F9HA 4TY6A 1DDJA 3M5OA 1PPZA 1KXCA 2ESTE 4FUHA 4IBLH 1TNHA 1BT7A 2RA0A 2ZKSA 4AG1A 2AMQA 3TU7H 1C2GA 3PV4A 1NRQH 3H5CB 4U32A 1P2MA 2TIOA 3EA8A 5FX5A 4MLFB 1FONA 2CJIA 1BJUA 1GMDG 2G4TA 4NCYA 3S7KB 1O35A 3ESTA 1GMDF 3MWIU 1WTHD 1ZSJA 3PM3A 1TIOA 1GMHG 2QV1A 3PMHB 5ABWA 1GMHF 1ELDE 3T26A 3FVFB 1SB1H 1O33A 2P3FH 4ABHA 2BOKA 1GVKB 5L6NH 3OSYA 3NCLA 3RXEA 1HAIH 2R3YA 1O2MA 3ZVAA 1D4PB 3LGVA 2V6NA 2CV3A 1O2YA 1XVOA 1UTPA 3SUGA 1O30A 4NA7A 5FPYA 1OP2A 1P04A 5E0JA 1A46H 3LGIA 3SU1A 1TPPA 5HM9A 1O3LA 3UOPA 1FY1A 3ZZ4A 1V6DA 1LVMA 1QB6A 2AIQA 1BTYA 3RXIA 2ZHWH 3CS0A 1DVAH 4ZAEA 5CMXH 3TNSA 2GZ7A 1TB6H 3KHVA 3EAJA 1ELFA 1MD7A 2BM2A 1JRTA 3EA7A 2ZCHP 1UK3A 1UTOA 3UTUH 2G4UA 1OWKA 3A83A 1LHCH 4JYVH 4JK5A 1O3MA 3QX5H 2BZ6H 3ATWA 1WAYB 2W7SA 2ZDAH 2O9QA 2GCHG 2VB0A 1TQ0B 2A4RA 4PROA 1NN6A 2GCHF 1S0RA 4X8SH 3BG8A 3UIRA 1T8MA 2A32A 2NU2E 2EI7A 3ENSB 1GBBA 2EI8A 3SJKA 1MCTA 1W7GH 2A5AA 1TRYA 2GD4B 1FIWA 3GCOA 1C2HA 1CHOG 2ZDLA 1RTLA 1EUFA 1LQEA 1CHOF 1XUGA 1NM6A 5F6MA 4MDSA 4ZHAA 1YCPH 1OOKB 1SL3A 2Y82A 1JIRA 4WVPE 4D7GA 5H4IB 4AGKA 1YCPK 3QTVH 5DP3A 2SGAA 3A7VA 4D7FA 1ZTJA 1GI7B 2H9EH 1T4VH 1YCPM 1JMOH 1BTPA 4RKJB 3QN7A 5A0AE 2G55A 3ZZAA 1YF4A 3RXCA 1O3DA 1SGTA 3NXPA 3EGKH 5F8ZA 3HKJB 4XSKU 5DP9A 1S6HA 5J4QA 1P03A 1P2OA 2ZHFH 2BQWB 3TITA 4GVUA 6GCHG 3TGKE 2ZHQH 2GMTC 3NKKA 6GCHF 2QC2A 5LPFA 1GJ5H 3QGJA 5BRRE 3OY5U 1O2JA 2UWPA 4KGAA 1V2KT 4OS1A 2IN2A 2XBVA 4MPXA 4NGAH 5JYIA 2BDHA 2BX3A 1W14U 3M37A 1AIXH 1O3NA 3O8DA 1JOUB 1O38A 1GI3A 2A1DB 3LU9B 1A3EH 3SQHE 2F83A 5G4BA 2V3OH 3T5FH 4U30A 8LPRA 3VB5A 2JETB 1Z71A 3I78A 3RXQA 1V2RT 5EQSA 1HJAC 3HK3B 5FCKA 1NESE 1O3FA 4Q7ZA 1UTNA 1BRUP 3BV9B 2ZIQH 2Q1JA 3M3TA 1GHXH 1Z6EA 1QL8A 4X8TH 1BHXB 1O2UA 4AYVB 3BN9A 1IQLA 3RDZA 5GDSH 1CHGA 3BTKE 1QRWA 1AKSA 1K22H 1ZYOA 1DSTA 4U01A 4VGCC 3MMGA 1TMUH 2XBXA 3L33A 1KTSB 4MPVA 5HYOA 1E38B 1LCYA 1Y3VA 2P3UB 5T3HA 4IW4E 1GGDB 2W3IA 3SORA 1MTVA 1GHBG 1P0SH 1KXBA 2G5NA 1GHBF 2AH4X 1D9IA 1F92A 9LPRA 2AGIX 1GMCG 1Y5BT 1GBJA 1FQ3A 1O36A 4B71A 1HJ8A 1GMCF 2GT8A 4IN1A 1TQ7B 1SGQE 1RRKA 1BRCE 1WOFA 1EP6A 1C5QA 3P70B 4DIHH 2BD7A 4X1SU 2FMJA 1AZZA 1P2QA 5DPAA 3TH2H 3LC5A 1L1NA 1BHXF 4XE4A 1NRSH 2JH5D 3ELAH 3QWCH 3TK5A 2PHBA 3EYDA 1SVPA 3DUXH 4MTBA 1DPOA 1AU8A 2LNCA 4ISHH 1SLWB 2NU4E 3FZZA 3U1JB 1KXDA 1SHHB 1P2KA 2F3CE 3C27B 1HAOH 5A8YA 4HZHA 2XWAA 4INKA 2C4FH 1V2LT 1GJ4H 4UDWH 4E05H 2V3HH 1Z8GA 2ZCLP 4OS5A 4ZKSU 1Z6JH 4UFFH 1XUKA 5E8EH 2AYWA 3TK9A 2FTLE 1LDTT 3MU4A 1AHTH 1MKXH 2GZ8A 1EZXC 1C1MA 3BG4C 1H1BA 3RXMA 1A61H 3A7WA 1G2LA 1GCDA 3LGYA 7GCHG 4NIXA 7LPRA 1XUIA 7GCHF 2P59A 1HRTH 5HGGA 3SW2B 3AAVA 3Q3YA 4JZEH 1LO6A 1O3JA 2ZGXH 5TCAA 4NIWA 1TBQH 4ABFA 4ZKRU 2PLXA 3SBKA 3ATKA 4X8UH 3CENA 1C1TA 3GY3A 1S83A 1CSOE 1DSUA 3DFJA 3SJ8A 2ZDNA 3E3TA 1DXPA 3LGTA 3M7QA 4XOJA 1PPHE 1AUJA 3GY5A 4FUIA 1OYQA 2XRCA 3OTJE 1VITH 2C8YB 1YLCA 1ZRBA 2EA3A 1BITA 1BOQA 3BTWE 4X2YA 4Y6DA 1LHEH 5C2ZA 1RJXB 1DWEH 1W11U 2WUBA 1TOCB 1MBQA 4KTUA 3SJOA 1Y3UA 5ESBA 4NZQA 1C1VH 2CGAA 3RXPA 1V2TT 3P95A 1E0FD 2QYIA 1PPCE 1K1IA 2WPJS 2ZDMA 1ELCA 3RU4E 3BTGE 1O2SA 1GBLA 2FIRH 1O5GH 3LGWA 1GG6C 4K1SA 3MO9A 3SNAA 1SGCA 4WWYA 1F5RA 2O8LA 1LKAA 2HOBA 1C2IA 4H4FA 1JWTA 2CHAB 3EQ0H 3RMLH 1TRNA 3D62A 3S7HB 3UOUA 1TMTH 1O2RA 4XFQA 2KAIB 1ARCA 3R0FA 1C1OA 3UY9A 4UD9H 1TE0A 2B7DH 4CHAB 5JB8S 3GY2A 1BCUH 2NU3E 2SNWA 1V2WT 1WUNH 4ABEA 3MI4A 1NRPH 5IYTA 3RMMH 1GI4A 3U69H 2Z3EA 3MNBA 1MU8B 1E36B 1QY6A 4Q7XA 2BXTH 1THPB 1SQAA 4NFFA 3DFLA 1YP9A 3RXGA 1O0DH 1Z8JB 2H6MA 4CRGA 3JZ1B 1T31A 4ZXXH 1TNKA 3RUOA 5J4SA 2GX4A 4B1TA 2AGEX 1HLTH 1MMJN 1L0ZA 3TH4H 3ATMA 2HNTC 1C1PA 1TGTA 2AIPA 4Z0KA 4MVNA 1BQYA 1D6WA 1RGQA 2GDDA 5GCHG 1YBWA 2H5CA 5GCHF 2A7JA 1HYLA 2THFB 2G5VA 1INCA 4OS4A 4FUGA 1NTPA 1O2OA 3E90B 2BVXH 5DG6A 4ZHLU 4NWKA 4ABGA 3M36A 1V2OT 4CBOA 8KME2 1BBRH 5E0GA 2R9PA 1W0ZU 2B0FA 2ZFRH 5L30H 2XNIA 3KF2A 4FXGH 4F4OC 1ANBA 4B2CA 2FS9A 1ZZZA 3M5LA 2C8WB 1FI8A 4WXIA 2WINI 2HWLB 1TBRH 2ZFTA 4DG4A 1T7CA 2ZZUH 1DX5M 4ABDA 1W10U 3SNEA 5JBTA 5E2OA 4GUXA 4E06H 2OC1A 3D65E 3C1KA 3HGPA 1OP8A 1QBOA 2HPQH 1BRBE 3GYLB 1O2IA 3E0NB 1CGHA 4K1EA 1K1NA 3ZV9A 4JYTA 3MH5A 3LT3A 2J34A 4NA8A 2UWOA 5A8ZA 3M5NA 1GVLA 1DS2E 3E1XB 1CU1A 3T27A 2IOTA 1O3AA 2P93A 1BTHH 2ZNKH 1HAHH 3U8TH 4SGAE 4GCHG 1XUFA 1O3KA 3LONA 2Z94A 3SOSA 4GCHF 5DP7A 1LHFH 2WPIS 3ATIA 1JBUH 6LPRA 1JRSA 1SSXA 4K69A 1QJ1B 2WYGA 4O9VA 3O8BA 1GBCA 1WBGB 2CF8H 1QHRB 1BBRE 2BX4A 2Z3DA 2ZU5A 1UVPA 2QN5T 2O8UA 1WV7H 3LGUA 3SGAE 4ZHMU 2A5IA 1TPAE 4MNWA 4FVDA 5E0HA 1T4UH 4CREA 2M5TA 1MQ6A 3QK1A 1ZOMA 2O8WA 2GCTB 1JIMA
chains in the Genus database with same CATH superfamily
1QB1A 1O2KA 4B2AA 1HIAA 2FOCA 1TYNA 2VU8E 1Y3XA 3K6YA 1AY6H 1XUHA 2XBYA 3V0XA 4IMQA 1QL7A 4JZ1A 3A89A 1RIWB 1ABIH 5EJ1A 1C5OH 4NSVA 3ZZ7A 4AC9A 2QF0A 3MOCA 1FY5A 1XMNB 1O5EH 4I8GA 1K28D 4NA9H 4Y11E 3A80A 5LPRA 1C5RA 2BD4A 4LZ1H 1WQSA 1FN6A 3ITIA 3SUDA 1Z8IB 2G81E 2G8TA 2AMDA 2QXJA 1ZGVA 5A0CA 3MO3A 1TLDA 2ANKH 1LPKB 1HUTH 4MNXA 1P2JA 1FAKH 1P10A 4ASUD 5C17A 4ZKOU 1EJAA 4TYDA 1EAXA 2TPIZ 5HXFA 1QA7A 1YPLH 1C2JA 3PRBA 1HB0B 2BVRH 2FPZA 3BIUH 2OD3B 2ZGJA 1C2DA 1IHTH 3PO1B 5I46H 2M2AA 3MTYA 3SO3A 3RXKA 1VGCC 1MQ5A 4Y10E 5DGJA 1UK4A 1C4V2 3FN8A 4BAOB 3RMNH 4BTIB 2WYJA 3SU4A 3ZZBA 2F43B 5C1YA 3SZNA 1IQNA 2ILNA 2G51A 3E16B 3O8CA 1J17T 3BSQA 2Z9KA 2ANMH 3T25A 3QZQA 1LPZB 1WQVH 2C93B 2QF4A 3SI3H 8ESTE 1D3DB 1JXPA 3KQBA 5FXLA 1GBKA 2FZZA 1NS3A 1TONA 4KP0A 1YYY1 4UEHH 1A1RA 2PTCE 4AGJA 2BD2A 4IN2A 5DJ7A 5DP5A 4O97A 1GHZA 1SQRA 4AORA 3SV6A 2BY7X 4XBBA 3SU5A 5EOKA 4GLYA 1C5SA 4UONA 2PGBB 2A2QH 1S82A 4BAKB 1NRNH 3B8JA 3UQOA 2TBSA 1TNGA 2BDYA 2Q6FA 4FETA 4BXSA 1SGDE 1QQUA 5EPNA 5FHTA 4XRNA 3QUMP 4FUFA 1ZPBA 3PMJA 3A84A 1HAGE 1PYTC 1DWBH 2FP7B 2UUYA 5PTPA 1GL1A 2TGPZ 2IJD1 2JDID 2YNBA 2QY0B 3FANA 4ISLA 3ATLA 3ZZ5A 1BB0B 3VB4A 2O8MA 1T8LA 1ZGIA 4FU8A 1KXFA 3SHCH 3U98H 2HNTE 1V3XA 4HGCA 4ZH8A 1GDNA 1D3TB 1MTNC 1O3EA 1ANCA 1DITH 4MPWA 1RFNA 4JK6A 2JJ2D 1KLJH 3F0PA 2OQUA 4RSPA 2H1UA 1FY4A 1YKTA 5C94A 3LJOA 4AFZA 1OPHB 4IC5A 3ODDA 1DY9A 1A5GH 1T8OA 2FX6A 4LXBH 1EZSC 1L4DA 2PKAB 5T6FA 5L2ZH 2KCYA 3RXRA 1EAWA 1PQ5A 2JETC 4K3JA 4WH8A 4YLQH 1GBMA 1H9IE 1KXEA 3SNBA 2H9TH 2PR3A 3DD2H 1P01A 1GJAB 1SGEE 1DE7H 3FZDA 3RM2H 2WPLS 4D9RA 1FIZA 1K0HA 1AB9B 1IQMA 1PQ8A 6CHAC 2DUCA 2ZTYA 1SFIA 2EEKA 3KYGA 4Y0YE 3SV7A 2PKSC 3P8GA 2A45B 4Y79A 2RG3A 2HPPH 4MQAA 2FWWA 3BEIB 4I8HA 3SUFA 1C5XB 3W95A 1YPJH 1UTMA 1XX9A 1FLEE 1E37B 1IQFA 2ZFSA 1MAYA 1Y8TA 2PSXA 2AGGX 3SGQE 2JH6D 1YC0A 4X2XA 3MQKC 3SU2A 2WPMS 4JYUH 3MH7A 1TGNA 3GY7A 3I29A 3LH1A 3RXAA 3KIDU 2ODYB 4Y76A 1NZQH 4B75A 1SPJA 1K2I1 2VNTA 4YTAA 1DT2A 1LPGB 4Y7AA 2DE9A 5AFYH 2Q6GA 2VVCA 1THRH 2QAAA 1LMWB 1O5BB 1OWEA 1TFXA 4NFEA 3MU8A 2BDAA 4P02A 1TPOA 1GI0A 4X0WU 2IPHA 4TSFD 1MAXA 1MBMA 1SGFA 2R0LA 2WPHS 2ZDVH 5LGOA 1EOLA 1HAVA 2OXSA 3STJA 2P94A 5C1UA 3UNSA 3V12A 4O3UA 4X6NA 2YMSB 2FOMB 2FDAA 4OS6A 2AFQB 1C2LA 1FPCH 2EC9H 1BTWA 2KAIA 4NWLA 2ZCKP 3UB0A 1M9UA 1DM4B 3PMAB 1H8ED 3PWBA 1FY3A 4X6OA 2BVSH 1X7AC 2RA3A 1A5HA 2J95A 1P9UA 1O2PA 2C90B 3PMBB 4XBDA 5DKMA 1YM0A 4RT0A 2VJ1A 4LOYH 1DANH 1O34A 1BDAA 2VIQA 1Y3YA 1EB1H 4WJG2 1ZMJA 5FBEA 1BMFD 1IOEA 2FOEA 3TNTA 1WU1A 4I31A 3BTME 3GY4A 1S84A 4TY7A 3QZRA 1AFQC 1OWDA 1GI6A 2Y5GA 1CBWB 3MH4A 5FAHA 1UTQA 1VCQA 1KLTA 2V35A 1WYKA 2ZU3A 3DSPA 1AVGH 3GS9A 3RXUA 1B5GH 3HGNA 1XKBC 2NU1E 1XKAC 4FU9A 2BD5A 1MTWA 1Z7KA 3TGIE 3BIVH 1W8BH 2GV7A 4WY3A 3TIUA 1V2UT 2FYRA 3PRDA 3BTTE 5CE1A 3GCHC 4X1PU 1CT4E 1TWXB 3M61U 3SJIA 2BHGA 2C3SA 1A0JA 2BDBA 1HAZB 1W3CA 1W0KD 1AVWA 1KLIH 4DVAU 4FUEA 1O2TA 5JBCS 2TGAA 1IHSH 1UVOA 3RXHA 4X6PA 2VINA 1TGCA 1F0UA 2GMTB 1O5DH 1WSSH 1P12E 4NG9H 1NFWA 3ZZDA 1H9HE 1CA0C 2Z9LA 1ETSH 1GBIA 1MKWH 2ZQ2A 2QGRA 1YGCH 1NPMA 2BLOA 1Y3WA 5K0HA 1ORFA 1U6QA 3IG6B 1GWAA 1BTXA 4AFUA 2PV9B 4RN6A 1S85A 3AAUA 4BTTB 3VGCC 3RLWH 1PJPA 2VWLA 1L1GA 5FPTA 1PFXC 3PLPA 2W26A 3P8NA 2Y80A 1GCTC 2HLCA 1ZJKA 2PW8H 4TPIZ 4WF8A 2BY5X 4DURA 1FAXA 3KQCA 4K8BA 1OP0A 1QL9A 4ACBA 1MABB 1EZUC 3EDXB 1E1RD 1KSNA 2Z3CA 2KR7A 1C2EA 1HJAB 1S0QA 2J98B 2WSSD 1SOTA 1MKXK 1TA6A 1EJMA 1AWFH 4TT3D 2Z9GA 3RXSA 4X1QU 3SN8A 1F0SA 1SLVB 1BMAA 1GI8B 1GBTA 2ZPQA 1C5PA 3P92A 4H6SB 1VITG 4RKOB 4ZMAH 1PPEE 4E7NA 5EJLA 1VITF 1QIXB 2J38A 3K6ZA 1EZQA 1F0TA 3V13A 1O31A 1TGSZ 4DY7B 4NIVA 2F9BH 4ABJA 2ULLA 3F68H 2FOFA 2CXVA 5JBBS 4ABIA 1UHBB 3FP6E 3PROA 2FLBH 2G00A 2GKVE 1ELEE 2ZGCA 1H4WA 2ASUB 2BY8X 4X1RU 1OS8A 5DK1A 2FEQH 4FVBA 3A85A 1O2ZA 2VIDA 3PWCA 2JH0D 3H7TA 5TJXA 1HCGA 1C4Y2 1ZJDA 1O5FH 4YOJA 1QNJA 1D6RA 4X1NU 4KTSA 1LTOA 1N6YA 3SQEE 1NU7B 2ZGHA 1O5AB 1TALA 2J2UA 1HAPH 1KDQB 4CRDA 1GVZA 1LQDB 2VGCC 2W6ID 1HBTH 1ELBA 2F9PA 3MNCA 2A4GA 2WPDD 3UR6A 3A86A 2D2DA 3VFEA 3GY6A 1F5KU 1UMAH 2K8IA 2YMSD 1FUJA 1P02A 1ETRH 1SLXB 1MTSA 3T2NA 1OWIA 1Y59T 1C5MD 2BQ6B 5CHAB 5B6OA 2BY9X 1K1OA 2KCPA 1O3OA 5AF9H 1C2KA 2ODPA 1AFEH 5FX6A 1N1LA 2FYQA 3NPSA 2STBE 1S6LA 2J5UA 3A8DA 2J92A 4X2VA 5EW1H 1PQ7A 3QLPH 1Q2WA 4F49A 5E2PA 3SU6A 2FXRA 1EB2A 5EXMA 1E35B 2SGPE 4ABBA 4BTUB 2OBOA 1PPGE 4TPYA 4OGYA 4JZDH 3UFAA 2ZHDA 3SNDA 1UK2A 3GDSA 3BEFB 2VIVA 1P3CA 4BAHB 2XC5A 2OP9A 4AX9H 1GJBB 1ARBA 1O2XA 1FZZA 2C8XB 4BOHA 4GPGA 3TVJB 3BTFE 4D9QA 4ZXYH 1LVYA 3TGJE 2FESH 1V2NT 1FXYA 1AKSB 3JZ2B 3KEEA 3ZVEA 2XC0A 1ID5H 3EA9A 3SV2H 2TGDA 3LIWA 2H5DA 3P8FA 4FUDA 2GZ9A 1C2FA 2UUJB 5FL7D 3GY8A 3A7ZA 1V2QT 2VWNA 1XUJA 1E34B 2ANWA 2A4QA 2Y7XA 3TH3H 3F3BA 3UUZA 4CH2B 3LOXA 2A0QB 2BY6X 3BTHE 2RFKC 1ABJH 3A8BA 4A7IB 5TCCA 3M7UA 4Y71A 1CVWH 4Q63A 3P8OA 1BBRK 1TNJA 2ZC9H 2ZPRA 3U9AH 2GCTC 1UCYH 3QGNB 1F7ZA 1P2IA 1BJVA 2NWNA 1EPTB 3S69A 1UCYK 3DSOA 1EASA 5GNDA 1SC8U 3KN2A 3RC5A 1IQHA 1QJ7B 1NBME 1B0FA 4K60A 4DJZB 4CR5A 5EIYA 1ELAA 1EATA 2Y7ZA 3PB1E 1UVSH 4MPUA 3RC4A 1RXPA 2ANYA 1AE8H 1YPKH 1UW7A 1RTFB 2ZECA 1C5ZB 3GISB 3E0PB 1BRAA 4UFDH 1SGRE 5DP8A 4FU7A 1N8OC 1WTGH 2FTMA 5ETXA 5AVDA 3GOVB 4I32A 4KELA 2P8OC 5I25A 4P00A 3D23A 1CE5A 3S9AA 4D8NA 3ZYEA 5DO4H 4RI0A 3K65B 3F1SB 3N7OA 1Q3XA 1QBNA 4LK4A 1CQQA 2BDCA 2F9UA 4XBCA 5GWZA 1O2WA 4B74A 3RXBA 3UREA 3BTQE 4X6MA 4YOIA 1CT2E 3F9GA 1C9TA 2ZTZA 1UCYE 1LVBA 3S9BA 2CN0H 2WV5A 3RXDA 3UAIC 4JZFH 1PPFE 1KIGH 2FI4E 3A82A 1Z1IA 1O3GA 2AEIH 3I77A 2BTCE 1MH0A 2FO9A 5F53A 1VJ9U 1ELGA 1SHYA 4A5TS 1C5LH 1XM1A 3ZV8A 5C20A 1COWD 1UJ1A 1E79D 4AG2A 1O3IA 3K2UA 3OAAD 4WMFA 3RXVA 2VIOA 3CNRA 3MU1A 5KGOA 1O2HA 3UWIA 1RD3B 4DW2U 1TOMH 2UUKB 5C5OA 4FUCA 1YLNA 2P95A 3SU0A 1O2GH 2ZA5A 1D3QB 4JMYA 1FDPA 1SQTA 1DUEA 4OGXA 4AOQA 1HV7A 3A88A 2A7CA 1O3HA 2F9NA 2IPQX 2GJGA 2HNTF 2F9VA 3LDXH 1EKBB 3M3SA 3V3MA 3RP2A 1QA0A 2AMPA 2H2ZA 2V0BA 2FX4A 2BMGB 3QO6A 2AS9A 6ESTA 2SGFE 2ALVA 4Q2KA 3ZZ6A 5DP6A 1P11E 4R8TB 2O8TA 1C5NH 1SLUB 3SJ9A 3KQEA 3W94A 1ZHPA 4CBNA 4CR9A 1H8IH 4WXVA 2ZU4A 2FS8A 3GDVA 5T6DA 3MH6A 1SBWA 1W13U 1GJDB 3N7EA 1AE5A 5DP4A 4YM9A 1UVTH 4IGDA 4FUJA 2BLVA 2VIWA 2GDEH 1DOJA 2ZPSA 4H6TA 1YY3A 1F2SE 2FOBA 2XCNA 2OTVA 1W0YH 1SGNE 2I6SA 5BPEA 2BLWA 1GBAA 5DN6D 4R0IA 4DIIH 5EU8A 1Y5UT 1OYTH 1Q31A 2QXHA 1ESAA 4A92A 4BNRA 1FV9A 4OS7A 3HATH 4NZLA 4CH8B 4D76A 1DLEA 3UNQA 1BA8B 1BTZA 1CA8B 1V2MT 1WDIA 3OYPA 5KECA 1DXWA 2A2XH 1CO7E 1QTFA 3A7YA 3UWJH 1HXEH 2XW9A 3RXOA 4ISIH 3FAOA 3M35A 5C1XA 2R3UA 3PTNA 5T6GA 1H8DH 3GCNA 2A7HA 4Y0ZE 1GHWH 1GHVH 1NT1A 4E7RG 2FODA 3IITA 1SMFE 2BLQA 2HALA 5IK2D 3A7TA 2PUQH 2FI3E 1ZHMA 4K1TA 1KTTB 2D26C 1C1SA 1KMHB 2FM2A 4OS2A 4UFEH 1TX7A 3GICB 1NO9H 2OQ5A 2A31A 2I6QA 2ZF0H 3DCLA 4A1XA 1P2NA 2Y5HA 3TLOA 4Y7BA 4WMEA 3STIA 3Q00A 2ZFPH 1TX6A 3RC6A 1C1WH 2YOLA 3RLYH 2TGTA 4AN7A 5JDUB 3HPTB 1T8NA 1F0RA 1KY9A 4CRAA 2WUCA 3RM0H 3H09A 3DA9B 1GHYH 1ESTA 1P9SA 4K8YA 3NZIA 1O3PB 4I33A 4K5ZA 1DLKB 1G30B 1WCZA 1VGCB 3D49H 1C1NA 1G37A 2OC7A 1AQ7A 1QB9A 3CS7A 4CRBA 2SGEE 2ZI2H 2Y81A 4JCNA 1W12U 5KEDA 2QE7D 4Q7YA 1GI2A 3AASA 3OY6U 1ELTA 1GBFA 7KMEH 2HVXA 1GGDC 1LHGH 1UHBA 2ZQ1A 4WMDA 1CBWC 4THNH 4CRFA 2XWBI 2ZP0H 3P17H 3Q3KA 1GL0E 3BTEE 2GVFA 1ZSKA 1ZRKA 3OFND 1F5LA 3B23B 3ZVCA 1XVMA 3URCA 5JBAS 1XXDA 1L4ZA 4I8JA 2Q6DA 2NU0E 1HIAB 1TX8A 2VVVA 1A5IA 2ZDKA 2ZFFH 1KDQA 3SGBE 4ZROA 1T32A 4AFQA 2SNVA 1Y5AT 1OWJA 3QDZB 5SGAE 2J9NA 2BZAA 1EAIA 1SGPE 3U28C 5EQRA 3ZVFA 1SOZA 3UR9A 5EXLA 2RCEA 1MUEB 2FI5E 2QA9E 4I7YH 4B76A 1W7XH 5AFZH 1MTNB 1UTLM 1C5UA 3KNXA 1DFPA 2PUXB 1K1LA 3AW1A 2D1JA 3LH3A 1GHAG 2FOHA 1AMHA 1GHAF 3NK8A 1BIOA 1P09A 1SGYE 1NFUA 1DICA 2BXUH 1ZLRA 1OKXA 1A7SA 3Q77A 2GP9B 1DY8A 2WV4A 2C8ZB 4J2YB 4DT7B 1BZXE 1NROH 3VB7A 3OEHD 1G32B 1TAWA 1SQOA 5EGMA 5FCRA 6CHAB 1O3CA 4O03A 1TRMA 3RXLA 1C2MA 3PV5A 2Y6TA 2ZU1A 3RU4T 4JZIA 2OCVB 2PKSB 2TRMA 2VWOA 4DGJA 4GHTA 1MTUA 4YOGA 2R2MB 3LKWA 3BF6H 5K7RA 1PPBH 1O3BA 5C5NA 1FNIA 5EXNA 3FKSD 4YZUA 1QRZA 3VXEH 1V2ST 2RDLA 3A8AA 1CT0E 1YLDA 4HI3A 1AO5A 3F9FA 1C5YB 4QT8C 2W5EA 2BDIA 3SI4H 4Y8ZA 5F03A 2DE8A 5AHGH 2CF9H 2FOAA 3UNRA 1EX3A 4Z6AH 1EPTA 2ALPA 3G01A 4YO9A 3ODFA 2BQ7B 2A4OA 4Q80A 3ZYDA 3CP7A 3F9EA 3T29A 1GBEA 1ZTKA 3TPIZ 1FY8E 1MKWK 1VCPA 4XDEA 3LJJA 5EODA 2R2WU 5CDFE 5GIBA 1IQIA 1K1MA 3HK6B 4Y8XA 2PFEA 3VB6A 2CHAC 2KM0A 3RXTA 2V7QD 1GBHA 3RXJA 4BANB 4HTCH 2YNAA 3KQ5A 5A2MH 4Z1MD 1ZHRA 1V2PT 1K1PA 1RS0A 3B9FH 5CHAC 4CHAC 5ESTE 3MU5A 1OSSA 1W2KH 1ZR0A 1S6FA 1UTJA 2EQNA 1AZ8A 1CGIE 2ZTXA 2XYAA 3VPKA 3A8CA 2H9HA 5EG4A 4AB8A 2VVUA 1GI1A 1SFQB 1FMGA 1VCWA 2SGDE 4NSYA 4ISOA 2XTTB 1BMMH 1NC6A 3P6ZB 4B2BA 2B5TB 2A5KA 2KCAA 3MFJA 2F91A 4ZKNU 1C4U2 1FN8A 1GI9B 4DOQA 1GI5A 4ASHA 2STAE 4GHQA 4DCDA 2WPKS 2KZ4A 4H42U 1GDUA 4VGCB 5GXPA 1O2VA 1GJ6A 3BTDE 1MZAA 3LPRA 4CRCA 3N7DA 1ELVA 3LC3A 2W3KA 1AFQB 1TPSA 4J1YA 1P06A 3DSGA 3KQDA 1N6XA 1O32A 3MYWA 1TBZH 1IQKA 3A7XA 1S5SA 5HM2A 2W7UA 1EAUA 5JPMH 3ZZ9A 1AI8H 1L1JA 3VG8A 3ZVGA 5LPEA 5A0BA 1Z1JA 2LP6A 3DHKH 3DT0H 2PTNA 1YPHC 3GCHB 4MNYA 5EQQA 1RTKA 4UFGH 1O5CB 2UUFB 1HXFH 1EQ9A 2OINA 2ZFQH 1TNIA 1QGFA 5GJ4B 3O8RA 2PGQB 1O2LA 4KTCA 5IDKA 1ETTH 1QCPA 1UTKA 1C5WB 1PYTD 2IJOB 1EPTC 2J4IA 2JKHA 1V2VT 3VXFH 2SGQE 4ESTE 5EW2H 3OEED 4U2WA 1TABE 1YPEH 3F2FA 1CA0B 4TWYA 1G2MA 1A0HB 3PTBA 2LPRA 3QTOH 1G36A 2XC4A 1IAUA 4INLA 1HAVB 5EJZA 1HGTH 1L2EA 4BXWA 1SGIB 1DUAA 1C1UH 3E8LA 4YLUA 1HDTH 3E6PH 3SHAH 1EXFA 2BD8A 1ZPZA 4A1VA 3VGCB 1BMLA 4YT6H 3Q3XA 1VZQH 2Z9JA 1FJSA 3M5MA 1XXFA 1ZSLA 1O37A 3U8RH 5C67A 3OX7U 3UPEA 1GCTB 1ACBE 1NFYA 1SG8B 1J9CH 4M9FA 3MHWU 1IQJA 3RU4D 1SR5C 3IWMA 3BG4B 2QCYA 4I8KA 3H7OA 3PYHA 2LELA 2P16A 3ZVDA 4YESB 2FLRH 2GTBA 1ZTLA 2Z9IA 4X2WA 1D3PB 1AUTC 4A1TA 1YPMH 4FUBA 1ZPCA 3GDUA 3VB3A 3SYJA 2ZU2A 1GJ7B 1O2QA 1A4WH 1AN1E 1ZMNA 1LVOA 3R3GB 1LHDH 3T28A 2VIPA 4INHA 2OLGA 1QFKH 3FP7E 3S0NA 2WZQA 3S9CA 1VJAU 5A8XA 1GDQA 1DWCH 2OUAA 1SGFG 4GAWA 5L2YH 4ISNA 1H9LB 1G3CA 4B73A 1IQGA 1C5TA 3RXFA 1GJCB 3ZVBA 3ZZ8A 1A0LA 1QURH 2VBCA 3AVZA 1J8AA 3W1EA 1TNLA 4AB9A 1KXAA 3WY8A 1NU9A 3SUEA 1P8VC 1QQ4A 4LZ4B 5F8XA 1MCVA 1B0EA 1QJ6B 2OBQA 4BAMB 2CMYA 1A3BH 1HPGA 1MZDA 4GSOA 3TK6A 2BDGA 2QXIA 1G3DA 2BD9A 3N99A 4AFSA 5LH8A 2Z6BD 1GPZA 1MU6B 2QIQA 1O39A 1RIWC 5FBIA 3TJVA 2B9LA 4HFPB 4AZ2B 1S81A 1VR1H 3AW0A 1FPHH 5C3NA 1DWDH 1GG6B 2VGCB 4MNVA 2AERH 4TWWA 3TJNA 3VEQB 2D8WA 5A09A 1NFXA 1NRRH 4YXWD 2R0KA 1BTUA 2OC8A 1QBVH 5B6LA 2K1QA 1P57B 1HJ9A 4MG3A 3UQVA 4KKDA 1J16A 4ZUHA 1O2NA 2QXGA 1NY22 3MNXA 4I8LA 1TGBA 4SGBE 3RMOH 1QRXA 4ABAA 1C1RA 3PLKA 1HNEE 2PKAA 4IC6A 1LKBA 1PQAA 2XCFA 1ZMLA 2GT7A 4AYYB 3M3VA 3URDA 1BMNH 1NBMD 2ZGBH 3GCTG 5C0TA 1SI5H 3ZZ3A 1WXRA 2GV6A 3GCTF 3PO1C 1AVXA 2PWXA 2XOKD 3KL6A 1KYNA 2EY4C 3MU0A 3OU0A 1ANDA 1OWHA 4K2YA 2BOHB 2VWMA 3PLBA 2K0QA 3SV9A 1TA2A 3V7TA 3EE0B 2W6JD 3SV8A 1OXGA 1P3EA 1K1JA 4Q4LA 1TMBH 3U1IB 1OX1A 3MO6A 2FOGA 3GYMA 2UWLA 1YWUA 4A6LA 5GPIB 2ZEBA 3Q76A 4O3TA 2CK3D 3NWUA 2OC0A 1K21H 2VH6A 3K9XB 1THSH 2XBWA 2ZWLH 1EJNA 3TJOA 3HKIB 3F6UH 3WWFA 1G9IE 3F2GA 1EFRD 3NUMA 1C5VA 1G3EA 4Y8YA 1AD8H 2BD3A 1HAYB 2J94A 2Y5FA 2HRVA 1W0JD 1VKYA 1BUIA 3L3TA 1G3BA 3FP8E 3BEUA 7ESTE 4NIYA 2ZHEH 3A81A 2BYAX 1SKYE 3MNSA 3U8OH 1AWHB 3OTPA 2G52A 4UE7H 2QF3A 1AGJA 1V2JT 2P3TB 4YT7H 8GCHG 2WV9A 3SU3A 3M7TA 1C9PA 8GCHF 2EI6A 3L6PA 4BAQB 1EOJA 1C1QA 4B6EA 2BB4A 1Z8RA 1HFDA 5FPSA 5JB9S 2ZO3H 3E91A 2XXLA 5EPYA 1GJ8B 1N8OB 2GGVB 4M7GA 1CGJE 1UVUH 1B7XB 3TJUA 1YPGH 2P8OB 2Z7FE 4IMZA 1GBDA 4WH6A 1MD8A 4X8VH 4IS5A 1HAXB 1ANEA 3KCGH 2F9OA 3FFGA 1K9OE 1J15A 1YPHE 5F8TA 1IQEA 4XD7D 1QR3E 1EP5A 2B8OH 2ZG0H 3SNCA 3T62A 1GJ9B 1P05A 2PSYA 2SFAA 3KGPA 3A87A 1J14A 2V3MA 1AB9C 2HGTH 9ESTA 1ESBA 2ODQA 1A2CH 5HMAA 2VH0A 1UO6A 3ZZCA 3F9HA 4TY6A 1DDJA 3M5OA 1PPZA 1KXCA 2ESTE 4FUHA 4IBLH 1TNHA 1BT7A 2RA0A 2ZKSA 4AG1A 2AMQA 3TU7H 1C2GA 3PV4A 1NRQH 3H5CB 4U32A 1P2MA 2TIOA 3EA8A 5FX5A 4MLFB 1FONA 2CJIA 1BJUA 1GMDG 2G4TA 4NCYA 4RT1A 1O35A 3ESTA 1GMDF 3MWIU 3S7KB 1WTHD 1ZSJA 3PM3A 1TIOA 1GMHG 2QV1A 5HIZA 3PMHB 5ABWA 1GMHF 1ELDE 3T26A 3FVFB 1SB1H 1O33A 2P3FH 4ABHA 2BOKA 1GVKB 5L6NH 3OSYA 3NCLA 3RXEA 1HAIH 2R3YA 1O2MA 3ZVAA 5HIYA 1D4PB 3LGVA 2V6NA 2CV3A 1O2YA 1XVOA 1UTPA 3SUGA 1O30A 4NA7A 5FPYA 3OE7D 1OP2A 1P04A 1QZ8A 1A46H 2L74A 3LGIA 5E0JA 3SU1A 1TPPA 5HM9A 1O3LA 3UOPA 1FY1A 3ZZ4A 1V6DA 2QF5A 1LVMA 1QB6A 2AIQA 1BTYA 3RXIA 2YMSC 2ZHWH 3CS0A 1DVAH 4ZAEA 5CMXH 3TNSA 2GZ7A 1TB6H 3KHVA 3EAJA 1ELFA 1MD7A 2BM2A 1JRTA 3EA7A 2ZCHP 3EE7A 1UK3A 1UTOA 3UTUH 2G4UA 2J98A 1OWKA 3A83A 1LHCH 4JYVH 4JK5A 1O3MA 3QX5H 2BZ6H 3ATWA 1WAYB 2W7SA 3PV2A 2ZDAH 2O9QA 2GCHG 2VB0A 1TQ0B 2A4RA 4PROA 1NN6A 2GCHF 1S0RA 4X8SH 3BG8A 3UIRA 1T8MA 2A32A 2NU2E 2EI7A 3ENSB 3WWBA 1GBBA 2EI8A 3SJKA 1MCTA 1W7GH 2A5AA 1TRYA 2GD4B 1FIWA 3GCOA 1C2HA 1CHOG 2ZDLA 1RTLA 1EUFA 1LQEA 1CHOF 1XUGA 1NM6A 5F6MA 4MDSA 4ZHAA 1YCPH 1OOKB 1SL3A 2Y82A 1JIRA 4WVPE 4D7GA 5H4IB 4AGKA 1YCPK 3QTVH 5DP3A 2SGAA 3A7VA 4D7FA 1ZTJA 1GI7B 2H9EH 2HVYB 1T4VH 1YCPM 1JMOH 1BTPA 4RKJB 3QN7A 5A0AE 2G55A 3ZZAA 1YF4A 3RXCA 1O3DA 1SGTA 3NXPA 3EGKH 5F8ZA 2F4LA 3HKJB 4XSKU 5DP9A 1S6HA 5J4QA 1P03A 1P2OA 2ZHFH 2BQWB 3TITA 4GVUA 6GCHG 3TGKE 2ZHQH 2GMTC 3NKKA 6GCHF 2QC2A 5LPFA 1GJ5H 3QGJA 5BRRE 3OY5U 1O2JA 2UWPA 4KGAA 1V2KT 4OS1A 2IN2A 2XBVA 4MPXA 4NGAH 5JYIA 2BDHA 2BX3A 1W14U 3M37A 1AIXH 1O3NA 3O8DA 1JOUB 1O38A 1GI3A 2A1DB 3LU9B 1A3EH 3SQHE 2F83A 5G4BA 2V3OH 3T5FH 4U30A 8LPRA 3VB5A 2JETB 1Z71A 3I78A 3RXQA 1V2RT 5EQSA 1HJAC 3HK3B 5FCKA 1NESE 1O3FA 4Q7ZA 1UTNA 1BRUP 3BV9B 2ZIQH 5CHBA 2Q1JA 2KX4A 2HLDD 3M3TA 1GHXH 1Z6EA 1QL8A 3AK5A 4X8TH 1BHXB 1O2UA 4AYVB 3BN9A 1IQLA 3RDZA 5GDSH 1CHGA 2JJ1D 3BTKE 1QRWA 1AKSA 1K22H 1ZYOA 3WW7A 1DSTA 4U01A 4VGCC 3MMGA 1TMUH 2XBXA 3L33A 1KTSB 1E1QD 4MPVA 5HYOA 1E38B 1LCYA 1Y3VA 2P3UB 5T3HA 4IW4E 1GGDB 2W3IA 3SORA 1MTVA 1GHBG 2RDEA 2AHME 1P0SH 1KXBA 2G5NA 2L6OA 1GHBF 2AH4X 1D9IA 1F92A 9LPRA 2AGIX 1GMCG 1Y5BT 1GBJA 2WHXA 1FQ3A 1O36A 4B71A 1HJ8A 1GMCF 2GT8A 4IN1A 3ZIAD 1TQ7B 1SGQE 1RRKA 1BRCE 3FO8D 1WOFA 1EP6A 1C5QA 3P70B 4DIHH 2BD7A 4X1SU 2FMJA 1AZZA 1P2QA 5DPAA 3TH2H 3LC5A 5T1VA 1L1NA 1BHXF 4XE4A 1NRSH 4F55A 2JH5D 3ELAH 3QWCH 3TK5A 2PHBA 4F48B 3EYDA 4ACAA 4ZCNA 1SVPA 3DUXH 4MTBA 1DPOA 1AU8A 2LNCA 4ISHH 1SLWB 2NU4E 3FZZA 3U1JB 1KXDA 4B6FA 1SHHB 1P2KA 2F3CE 3C27B 1HAOH 5A8YA 4HZHA 2XWAA 4INKA 2C4FH 1V2LT 1GJ4H 4UDWH 4E05H 2V3HH 1Z8GA 2ZCLP 4OS5A 4ZKSU 1Z6JH 4UFFH 1XUKA 5E8EH 2AYWA 3TK9A 2FTLE 1LDTT 3MU4A 1AHTH 1MKXH 2GZ8A 1EZXC 1C1MA 3BG4C 2OK5A 1H1BA 3RXMA 1A61H 3A7WA 1G2LA 1GCDA 3LGYA 7GCHG 4NIXA 7LPRA 1XUIA 7GCHF 2P59A 1HRTH 5HGGA 3SW2B 3AAVA 3Q3YA 3F2HA 4JZEH 1LO6A 1O3JA 2ZGXH 5TCAA 4NIWA 1TBQH 4ABFA 4I86A 4ZKRU 2PLXA 5C0UA 3SBKA 3ATKA 4X8UH 3CENA 1C1TA 3GY3A 1S83A 1CSOE 1DSUA 3DFJA 3SJ8A 2KFWA 2ZDNA 3E3TA 1DXPA 3LGTA 3M7QA 4XOJA 1PPHE 1AUJA 3GY5A 4FUIA 1OYQA 2XRCA 3OTJE 1VITH 2C8YB 3SZEA 1YLCA 1ZRBA 2EA3A 1BITA 1BOQA 3BTWE 4X2YA 4Y6DA 1LHEH 5C2ZA 1RJXB 1DWEH 1W11U 2WUBA 1TOCB 1MBQA 4KTUA 3SJOA 1Y3UA 5ESBA 4NZQA 1C1VH 2CGAA 3RXPA 1V2TT 3P95A 1E0FD 4HG6A 2QYIA 1PPCE 1K1IA 2WPJS 2ZDMA 1ELCA 3RU4E 3BTGE 1O2SA 1GBLA 2FIRH 1O5GH 3LGWA 1GG6C 4K1SA 3MO9A 3SNAA 1SGCA 4WWYA 1F5RA 2O8LA 1LKAA 2HOBA 3F0OA 1C2IA 4H4FA 1JWTA 2CHAB 3EQ0H 3RMLH 1TRNA 3D62A 3S7HB 3UOUA 1TMTH 1O2RA 4XFQA 2KAIB 1ARCA 3R0FA 1C1OA 3UY9A 5HKKD 4UD9H 1TE0A 2B7DH 4CHAB 5JB8S 3GY2A 1BCUH 2NU3E 2SNWA 1V2WT 1WUNH 2JIZD 4ABEA 3MI4A 1NRPH 5IYTA 3RMMH 1GI4A 3U69H 2Z3EA 3MNBA 1MU8B 1E36B 1QY6A 4Q7XA 2BXTH 1THPB 1SQAA 4NFFA 3DFLA 1YP9A 3RXGA 1O0DH 1Z8JB 2H6MA 4CRGA 3JZ1B 1T31A 4ZXXH 1TNKA 3RUOA 5J4SA 2GX4A 4B1TA 2AGEX 1HLTH 1MMJN 1L0ZA 3TH4H 3ATMA 2HNTC 1C1PA 1TGTA 2AIPA 4Z0KA 4MVNA 1BQYA 1D6WA 1RGQA 2GDDA 5GCHG 1YBWA 2H5CA 5GCHF 2A7JA 1HYLA 2THFB 2G5VA 1INCA 4OS4A 4FUGA 1NTPA 1O2OA 3E90B 1OHHD 2BVXH 5DG6A 4ZHLU 4NWKA 4OM9A 4ABGA 3M36A 1V2OT 4CBOA 8KME2 1BBRH 3KYFA 5E0GA 2R9PA 5DSFA 1W0ZU 2KCOA 2PP6A 2B0FA 2ZFRH 5L30H 2XNIA 3KF2A 4FXGH 4F4OC 1ANBA 4B2CA 2FS9A 1ZZZA 3M5LA 2C8WB 1FI8A 4WXIA 2WINI 2HWLB 1TBRH 2ZFTA 4DG4A 1T7CA 2ZZUH 1DX5M 4ABDA 1W10U 3SNEA 5JBTA 5E2OA 4GUXA 4E06H 2OC1A 2XNDD 3D65E 3C1KA 3HGPA 1OP8A 1QBOA 2HPQH 1BRBE 3GYLB 1O2IA 3E0NB 1CGHA 4K1EA 1K1NA 3ZV9A 4JYTA 2J97A 3MH5A 3LT3A 2J34A 4NA8A 2UWOA 5A8ZA 3M5NA 1GVLA 1DS2E 3E1XB 1CU1A 3T27A 2IOTA 1FX0B 1O3AA 2P93A 1BTHH 2ZNKH 4FOUC 1HAHH 3U8TH 4SGAE 4GCHG 1XUFA 1O3KA 3LONA 2Z94A 3SOSA 4GCHF 5DP7A 1LHFH 1H8HD 2WPIS 3ATIA 1JBUH 6LPRA 1JRSA 1SSXA 4K69A 1QJ1B 2WYGA 4DT4A 4O9VA 3O8BA 1GBCA 3FOAA 1WBGB 2CF8H 1QHRB 1BBRE 2BX4A 2Z3DA 2ZU5A 1UVPA 2QN5T 2O8UA 1WV7H 3LGUA 3SGAE 4ZHMU 2A5IA 1TPAE 4MNWA 4FVDA 5E0HA 1T4UH 3NRLA 4CREA 2M5TA 1MQ6A 3QK1A 1ZOMA 2O8WA 2GCTB 1JIMA
chains in the Genus database with same CATH topology
1QB1A 1O2KA 4B2AA 1HIAA 2FOCA 1TYNA 2VU8E 1Y3XA 3K6YA 1AY6H 1XUHA 2XBYA 3V0XA 4IMQA 1QL7A 4JZ1A 3A89A 1RIWB 1ABIH 1C5OH 4NSVA 3ZZ7A 2QF0A 3MOCA 1FY5A 1XMNB 1O5EH 4I8GA 1K28D 4NA9H 4Y11E 3A80A 5LPRA 1C5RA 2BD4A 4LZ1H 1WQSA 1FN6A 3ITIA 3SUDA 1Z8IB 2G81E 2G8TA 2AMDA 2QXJA 1ZGVA 5A0CA 3MO3A 1TLDA 2ANKH 1LPKB 1HUTH 4MNXA 1P2JA 1FAKH 1P10A 4ZKOU 1EJAA 4TYDA 1EAXA 2TPIZ 5HXFA 1QA7A 1YPLH 1C2JA 1HB0B 2BVRH 2FPZA 3BIUH 2OD3B 2ZGJA 1C2DA 1IHTH 3PO1B 5I46H 3MTYA 3SO3A 3RXKA 1VGCC 1MQ5A 4Y10E 5DGJA 1UK4A 1C4V2 4BAOB 3RMNH 4BTIB 2WYJA 3SU4A 3ZZBA 5C1YA 3SZNA 1IQNA 2ILNA 2G51A 3E16B 3O8CA 1J17T 3BSQA 2Z9KA 2ANMH 3T25A 3QZQA 1LPZB 1WQVH 2C93B 3SI3H 8ESTE 1D3DB 1JXPA 3KQBA 5FXLA 1GBKA 2FZZA 1NS3A 1TONA 4KP0A 1YYY1 4UEHH 1A1RA 2PTCE 4AGJA 2BD2A 4IN2A 5DJ7A 5DP5A 4O97A 1GHZA 4AORA 3SV6A 2BY7X 4XBBA 3SU5A 5EOKA 4GLYA 1C5SA 4UONA 2PGBB 2A2QH 1S82A 4BAKB 1NRNH 3B8JA 3UQOA 2TBSA 1TNGA 2BDYA 2Q6FA 4BXSA 1SGDE 1QQUA 5EPNA 5FHTA 3QUMP 4FUFA 1ZPBA 3PMJA 3A84A 1HAGE 1PYTC 1DWBH 2FP7B 2UUYA 5PTPA 1GL1A 2TGPZ 4ISLA 2YNBA 2QY0B 3FANA 3ATLA 3ZZ5A 1BB0B 3VB4A 2O8MA 1T8LA 1ZGIA 4FU8A 1KXFA 3SHCH 3U98H 2HNTE 1V3XA 4HGCA 4ZH8A 1GDNA 1D3TB 1MTNC 1O3EA 1ANCA 1DITH 4MPWA 1RFNA 4JK6A 1KLJH 2OQUA 4RSPA 2H1UA 1FY4A 1YKTA 3LJOA 4AFZA 1OPHB 4IC5A 3ODDA 1DY9A 1A5GH 1T8OA 2FX6A 4LXBH 1EZSC 1L4DA 2PKAB 5T6FA 5L2ZH 3RXRA 1EAWA 1PQ5A 2JETC 4K3JA 4WH8A 4YLQH 1GBMA 1H9IE 1KXEA 3SNBA 2H9TH 2PR3A 3DD2H 1P01A 1GJAB 1SGEE 1DE7H 3FZDA 3RM2H 2WPLS 4D9RA 1FIZA 1AB9B 1IQMA 1PQ8A 6CHAC 2DUCA 2ZTYA 1SFIA 2EEKA 4Y0YE 3SV7A 2PKSC 3P8GA 2A45B 4Y79A 2RG3A 2HPPH 4MQAA 2FWWA 3BEIB 4I8HA 3SUFA 1C5XB 3W95A 1YPJH 1UTMA 1XX9A 1FLEE 1E37B 1IQFA 2ZFSA 1MAYA 1Y8TA 2PSXA 2AGGX 3SGQE 2JH6D 1YC0A 4X2XA 3SU2A 2WPMS 4JYUH 3MH7A 1TGNA 3GY7A 3I29A 3LH1A 3RXAA 3KIDU 2ODYB 4Y76A 1NZQH 4B75A 1SPJA 1K2I1 2VNTA 4YTAA 1DT2A 1LPGB 4Y7AA 2DE9A 5AFYH 2Q6GA 2VVCA 1THRH 2QAAA 1LMWB 1O5BB 1OWEA 1TFXA 4NFEA 3MU8A 2BDAA 1TPOA 1GI0A 4X0WU 2IPHA 1MAXA 1MBMA 1SGFA 2R0LA 2WPHS 2ZDVH 5LGOA 1EOLA 1HAVA 2OXSA 3STJA 2P94A 5C1UA 3UNSA 3V12A 4O3UA 4X6NA 2FOMB 2FDAA 4OS6A 2AFQB 1C2LA 1FPCH 2EC9H 1BTWA 2KAIA 4NWLA 2ZCKP 1M9UA 1DM4B 3PMAB 3PWBA 1FY3A 4X6OA 2BVSH 1X7AC 2RA3A 1A5HA 2J95A 1P9UA 1O2PA 2C90B 3PMBB 4XBDA 5DKMA 1YM0A 2VJ1A 4LOYH 1DANH 1O34A 1BDAA 2VIQA 1Y3YA 1EB1H 4WJG2 1ZMJA 5FBEA 1IOEA 2FOEA 3TNTA 1WU1A 4I31A 3BTME 3GY4A 1S84A 4TY7A 3QZRA 1AFQC 1OWDA 1GI6A 2Y5GA 1CBWB 3MH4A 5FAHA 1UTQA 1VCQA 1KLTA 2V35A 1WYKA 2ZU3A 1AVGH 3RXUA 1B5GH 3HGNA 1XKBC 2NU1E 1XKAC 4FU9A 2BD5A 1MTWA 1Z7KA 3TGIE 3BIVH 1W8BH 2GV7A 4WY3A 3TIUA 1V2UT 2FYRA 3BTTE 5CE1A 3GCHC 4X1PU 1CT4E 1TWXB 3M61U 3SJIA 2BHGA 2C3SA 1A0JA 2BDBA 1HAZB 1W3CA 1AVWA 1KLIH 4DVAU 4FUEA 1O2TA 5JBCS 2TGAA 1IHSH 1UVOA 3RXHA 4X6PA 2VINA 1TGCA 1F0UA 2GMTB 1O5DH 1WSSH 1P12E 4NG9H 1NFWA 3ZZDA 1H9HE 1CA0C 2Z9LA 1ETSH 1GBIA 1MKWH 2ZQ2A 2QGRA 1YGCH 1NPMA 2BLOA 1Y3WA 5K0HA 1ORFA 1U6QA 3IG6B 1GWAA 1BTXA 4AFUA 2PV9B 4RN6A 1S85A 3AAUA 4BTTB 3VGCC 3RLWH 1PJPA 2VWLA 1L1GA 5FPTA 1PFXC 3PLPA 2W26A 3P8NA 2Y80A 1GCTC 2HLCA 1ZJKA 2PW8H 4TPIZ 4WF8A 2BY5X 4DURA 1FAXA 3KQCA 4K8BA 1OP0A 1QL9A 1EZUC 3EDXB 1KSNA 2Z3CA 1C2EA 1HJAB 1S0QA 1SOTA 1MKXK 1TA6A 1EJMA 1AWFH 2Z9GA 3RXSA 4X1QU 3SN8A 1F0SA 1SLVB 1BMAA 1GI8B 1GBTA 2ZPQA 1C5PA 3P92A 4H6SB 1VITG 4RKOB 4ZMAH 1PPEE 4E7NA 1VITF 1QIXB 2J38A 3K6ZA 1EZQA 1F0TA 3V13A 1O31A 1TGSZ 4DY7B 4NIVA 2F9BH 4ABJA 2ULLA 3F68H 2FOFA 2CXVA 5JBBS 4ABIA 1UHBB 3FP6E 3PROA 2FLBH 2G00A 2GKVE 1ELEE 2ZGCA 1H4WA 2ASUB 2BY8X 4X1RU 1OS8A 5DK1A 2FEQH 4FVBA 3A85A 1O2ZA 2VIDA 3PWCA 2JH0D 3H7TA 5TJXA 1HCGA 1C4Y2 1ZJDA 1O5FH 4YOJA 1QNJA 1D6RA 4X1NU 4KTSA 1LTOA 1N6YA 3SQEE 1NU7B 2ZGHA 1O5AB 1TALA 2J2UA 1HAPH 1KDQB 4CRDA 1GVZA 1LQDB 2VGCC 1HBTH 1ELBA 2F9PA 3MNCA 2A4GA 3UR6A 3A86A 2D2DA 3VFEA 3GY6A 1F5KU 1UMAH 1FUJA 1P02A 1ETRH 1SLXB 1MTSA 3T2NA 1OWIA 1Y59T 1C5MD 2BQ6B 5CHAB 5B6OA 2BY9X 1K1OA 1O3OA 5AF9H 1C2KA 2ODPA 1AFEH 5FX6A 1N1LA 2FYQA 3NPSA 2STBE 3A8DA 4X2VA 2J92A 5EW1H 1PQ7A 3QLPH 1Q2WA 4F49A 5E2PA 3SU6A 2FXRA 1EB2A 5EXMA 1E35B 2SGPE 4ABBA 4BTUB 2OBOA 1PPGE 4TPYA 4OGYA 4JZDH 3UFAA 2ZHDA 3SNDA 1UK2A 3GDSA 3BEFB 2VIVA 1P3CA 4BAHB 2XC5A 2OP9A 4AX9H 1GJBB 1ARBA 1O2XA 1FZZA 2C8XB 4BOHA 4GPGA 3TVJB 3BTFE 4D9QA 4ZXYH 1LVYA 3TGJE 2FESH 1V2NT 1FXYA 1AKSB 3JZ2B 3KEEA 3ZVEA 2XC0A 1ID5H 3EA9A 3SV2H 2TGDA 3LIWA 2H5DA 3P8FA 4FUDA 2GZ9A 1C2FA 2UUJB 3GY8A 3A7ZA 1V2QT 2VWNA 1XUJA 1E34B 2ANWA 2A4QA 2Y7XA 3TH3H 3UUZA 4CH2B 3LOXA 2A0QB 2BY6X 3BTHE 1ABJH 3A8BA 4A7IB 5TCCA 3M7UA 4Y71A 1CVWH 3P8OA 1BBRK 1TNJA 2ZC9H 2ZPRA 3U9AH 2GCTC 1UCYH 3QGNB 1F7ZA 1P2IA 1BJVA 2NWNA 1EPTB 3S69A 1UCYK 1EASA 3RC5A 1SC8U 3KN2A 1IQHA 1QJ7B 1B0FA 4K60A 4DJZB 4CR5A 1ELAA 1EATA 2Y7ZA 3PB1E 1UVSH 4MPUA 3RC4A 1RXPA 2ANYA 1AE8H 1YPKH 1RTFB 2ZECA 1C5ZB 3GISB 3E0PB 1BRAA 4UFDH 1SGRE 5DP8A 4FU7A 1N8OC 1WTGH 2FTMA 5ETXA 5AVDA 3GOVB 4I32A 4KELA 2P8OC 5I25A 3D23A 1CE5A 3S9AA 4D8NA 3ZYEA 5DO4H 3K65B 3F1SB 3N7OA 1Q3XA 1QBNA 4LK4A 1CQQA 2BDCA 2F9UA 4XBCA 5GWZA 1O2WA 4B74A 3RXBA 3UREA 3BTQE 4X6MA 4YOIA 1CT2E 3F9GA 1C9TA 2ZTZA 1UCYE 1LVBA 3S9BA 2CN0H 2WV5A 3RXDA 4JZFH 1PPFE 1KIGH 2FI4E 3A82A 1Z1IA 1O3GA 2AEIH 3I77A 2BTCE 1MH0A 2FO9A 1VJ9U 1ELGA 1SHYA 4A5TS 1C5LH 1XM1A 3ZV8A 5C20A 1UJ1A 4AG2A 1O3IA 3K2UA 4WMFA 3RXVA 2VIOA 3MU1A 1O2HA 3UWIA 1RD3B 4DW2U 1TOMH 2UUKB 5C5OA 4FUCA 2P95A 3SU0A 1O2GH 2ZA5A 1D3QB 4JMYA 1FDPA 1SQTA 1DUEA 4OGXA 4AOQA 1HV7A 3A88A 2A7CA 1O3HA 2F9NA 2HNTF 2F9VA 3LDXH 1EKBB 3M3SA 3V3MA 3RP2A 1QA0A 2AMPA 2H2ZA 2V0BA 2FX4A 2BMGB 3QO6A 2AS9A 6ESTA 2SGFE 2ALVA 4Q2KA 3ZZ6A 5DP6A 1P11E 4R8TB 2O8TA 1C5NH 1SLUB 3SJ9A 3KQEA 3W94A 1ZHPA 4CBNA 4CR9A 1H8IH 4WXVA 2ZU4A 2FS8A 3GDVA 5T6DA 3MH6A 1SBWA 1W13U 1GJDB 1AE5A 5DP4A 4YM9A 1UVTH 4IGDA 4FUJA 2BLVA 2VIWA 2GDEH 1DOJA 2ZPSA 4H6TA 1F2SE 2FOBA 2XCNA 2OTVA 1W0YH 1SGNE 2I6SA 5BPEA 2BLWA 1GBAA 4R0IA 4DIIH 5EU8A 1Y5UT 1OYTH 1Q31A 2QXHA 1ESAA 4A92A 4BNRA 1FV9A 4OS7A 3HATH 4NZLA 4CH8B 4D76A 1DLEA 3UNQA 1BA8B 1BTZA 1CA8B 1V2MT 3OYPA 1DXWA 2A2XH 1CO7E 1QTFA 3A7YA 3UWJH 1HXEH 2XW9A 3RXOA 4ISIH 3FAOA 3M35A 5C1XA 2R3UA 3PTNA 5T6GA 1H8DH 3GCNA 2A7HA 4Y0ZE 1GHWH 1GHVH 1NT1A 4E7RG 2FODA 3IITA 1SMFE 2BLQA 2HALA 3A7TA 2PUQH 2FI3E 1ZHMA 4K1TA 1KTTB 2D26C 1C1SA 4OS2A 2FM2A 4UFEH 1TX7A 3GICB 1NO9H 2OQ5A 2A31A 2I6QA 2ZF0H 4A1XA 1P2NA 2Y5HA 3TLOA 4Y7BA 4WMEA 3STIA 3Q00A 2ZFPH 1TX6A 3RC6A 1C1WH 2YOLA 3RLYH 2TGTA 4AN7A 5JDUB 3HPTB 1T8NA 1F0RA 1KY9A 4CRAA 2WUCA 3RM0H 3DA9B 1GHYH 1ESTA 1P9SA 4K8YA 3NZIA 1O3PB 4I33A 4K5ZA 1DLKB 1G30B 1WCZA 1VGCB 3D49H 1C1NA 1G37A 2OC7A 1AQ7A 1QB9A 3CS7A 4CRBA 2SGEE 2ZI2H 2Y81A 4JCNA 1W12U 4Q7YA 1GI2A 3AASA 3OY6U 1ELTA 1GBFA 7KMEH 2HVXA 1GGDC 1LHGH 1UHBA 2ZQ1A 4WMDA 1CBWC 4THNH 4CRFA 2XWBI 2ZP0H 3P17H 3Q3KA 1GL0E 3BTEE 2GVFA 1ZSKA 1ZRKA 1F5LA 3B23B 3ZVCA 1XVMA 3URCA 5JBAS 1XXDA 1L4ZA 4I8JA 2Q6DA 2NU0E 1HIAB 1TX8A 2VVVA 1A5IA 2ZDKA 2ZFFH 1KDQA 3SGBE 4ZROA 1T32A 4AFQA 2SNVA 1Y5AT 1OWJA 3QDZB 5SGAE 2J9NA 2BZAA 1EAIA 1SGPE 5EQRA 3ZVFA 1SOZA 3UR9A 5EXLA 2RCEA 1MUEB 2FI5E 2QA9E 4I7YH 4B76A 1W7XH 5AFZH 1MTNB 1UTLM 1C5UA 3KNXA 1DFPA 2PUXB 1K1LA 3AW1A 2D1JA 3LH3A 1GHAG 2FOHA 1AMHA 1GHAF 3NK8A 1BIOA 1P09A 1SGYE 1NFUA 1DICA 2BXUH 1ZLRA 1OKXA 1A7SA 3Q77A 2GP9B 1DY8A 2WV4A 2C8ZB 4J2YB 4DT7B 1BZXE 1NROH 3VB7A 1G32B 1TAWA 1SQOA 5EGMA 5FCRA 6CHAB 1O3CA 4O03A 1TRMA 3RXLA 1C2MA 3RU4T 2Y6TA 2ZU1A 4JZIA 2OCVB 2PKSB 2TRMA 2VWOA 4DGJA 4GHTA 1MTUA 4YOGA 2R2MB 3LKWA 3BF6H 5K7RA 1PPBH 1O3BA 5C5NA 1FNIA 5EXNA 4YZUA 1QRZA 3VXEH 1V2ST 2RDLA 3A8AA 1CT0E 1YLDA 4HI3A 1AO5A 3F9FA 1C5YB 4QT8C 2W5EA 2BDIA 3SI4H 4Y8ZA 5F03A 2DE8A 5AHGH 2CF9H 2FOAA 3UNRA 1EX3A 4Z6AH 1EPTA 2ALPA 3G01A 4YO9A 3ODFA 2BQ7B 2A4OA 4Q80A 3ZYDA 3CP7A 3F9EA 3T29A 1GBEA 1ZTKA 3TPIZ 1FY8E 1MKWK 1VCPA 4XDEA 3LJJA 5EODA 2R2WU 5GIBA 1IQIA 1K1MA 3HK6B 4Y8XA 2PFEA 3VB6A 2CHAC 3RXTA 1GBHA 3RXJA 4BANB 4HTCH 2YNAA 5A2MH 1ZHRA 1V2PT 1K1PA 1RS0A 3B9FH 5CHAC 4CHAC 5ESTE