4NFFA

Human kallikrein-related peptidase 2 in complex with ppack
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
237
structure length
229
Chain Sequence
IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Kallikrein-2
publication title Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 229
sequence length 237
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nffA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nffA01
4ABEA 1K1NA 1O38A 1BMNH 3LT3A 4DVAU 5C1UA 1OWKA 3BTHE 6CHAC 3V12A 3QZQA 2ZCKP 2VGCB 4GUXA 4CR9A 1GI3A 1MU6B 1BHXF 4I32A 4FUIA 4IGDA 3FANA 2OTVA 4OS4A 3KCGH 1TPSA 3SNEA 2ALPA 4ABAA 3V7TA 2ZPSA 3KQCA 3LGIA 1OSSA 2ZECA 3CS0A 4IC6A 1K22H 3MHWU 3Q76A 4Q2KA 1QHRB 3IITA 2A7HA 4KTCA 1HYLA 2GCTB 1WQSA 1ZTJA 1P57B 3B8JA 2Z3CA 4CHAC 4KGAA 1BJUA 2P95A 3DA9B 4TPIZ 5JBAS 2A4QA 7GCHG 3N7OA 4GHQA 1VGCB 1YLDA 2FP7B 1O32A 1MKXK 1HDTH 3ZZBA 3VB7A 2F9OA 1GJ6A 2ANMH 3ZZ9A 2ZP0H 3NKKA 3O8CA 1AVGH 2C8XB 1NRSH 2GX4A 1ZZZA 2QYIA 3MYWA 1GHYH 1TX6A 4TWYA 3VEQB 1ELTA 2VIDA 1SQAA 1CSOE 2A4RA 3RXMA 1C4Y2 1FV9A 3A8CA 3BF6H 1SLWB 4NA7A 2FMJA 1TX8A 3FZZA 5C5NA 3M5OA 1Z8RA 5L30H 1ZMLA 3P95A 1FQ3A 1XUGA 2ZPRA 5JBBS 4AFSA 4HTCH 2CHAB 1XUHA 3EYDA 1DWBH 1HJ9A 1DPOA 3MH4A 2KAIB 1MD7A 1OS8A 1TBRH 3RXDA 1T8NA 3C27B 4I7YH 1DX5M 1NROH 1JRTA 1C1NA 1CA8B 3UUZA 1UCYE 1KLIH 1K28D 3STIA 4Q7XA 3RXFA 1W0YH 1O3CA 2GTBA 4UONA 1C5QA 1ARCA 1VCWA 1T8MA 1AE5A 1ESBA 3M7TA 3TGKE 4ISHH 3AASA 1P04A 4B73A 3H7TA 5E0HA 1GCTB 4K2YA 1GI5A 1ZRBA 2P8OC 1GBAA 4INHA 3RU4E 4X1PU 3MI4A 4YESB 3R3GB 4ZXYH 4AFUA 1TPOA 3ZZ7A 1SGEE 1YPHC 4LZ4B 4ZXXH 3KQBA 3A86A 5DKMA 3A89A 4X8VH 3TNTA 1YPMH 2VWLA 3HK3B 1W13U 3FP7E 4DIIH 1AUTC 4BNRA 3TH2H 2Y7XA 2BY9X 3T5FH 2XRCA 1T4UH 2Z94A 2CF9H 3ZVDA 4OS5A 1FXYA 3F9FA 1N8OC 5LPRA 1BCUH 3KGPA 3DFLA 3MH5A 1O5BB 3RXTA 5F8XA 1ABJH 4YOGA 1PPHE 1RJXB 1WOFA 1GL0E 3RMMH 1EXFA 4AYYB 1GHAF 1Z8GA 1IQFA 1X7AC 4IMZA 1GMDG 4LXBH 5EXLA 1GHZA 2LPRA 5SGAE 2TGDA 4WH8A 3ZZCA 3UR9A 3RDZA 5JYIA 1TBZH 1BOQA 1O3PB 5K0HA 2VWNA 1Y5AT 1LVOA 1FMGA 1GJ5H 1QQUA 4MQAA 4D7GA 3U98H 2BD2A 5DP3A 1IQEA 4AGKA 4BTTB 1O2TA 4X8UH 1P11E 1F92A 3SNDA 1WBGB 1GG6B 3U1JB 1V2NT 2A2XH 3RXSA 4YO9A 2A45B 2H6MA 1GL1A 3MU1A 2WINI 1P12E 1V2KT 1O3IA 2VU8E 3MU0A 3E0NB 2H2ZA 2ZU5A 2A0QB 1RTKA 5EPNA 1NU7B 1KYNA 1V2TT 3U69H 4E7RG 4R0IA 1G30B 3BTEE 3ITIA 2F9VA 4FUBA 1P10A 1P09A 1THSH 1WU1A 4D9QA 2Z9JA 1P2NA 3SV8A 2P93A 1N1LA 1S85A 1SGIB 2CXVA 2GMTB 5BRRE 3SU4A 3UNRA 1BITA 1QRZA 3E3TA 3FP8E 1GI9B 2EI6A 1TNIA 3A7ZA 2ZFRH 2O8TA 1WCZA 1YKTA 2PKSB 2ZA5A 2ZFTA 1QRWA 1EB1H 1RTFB 1GHXH 2TBSA 1WYKA 3KIDU 1WQVH 1C5NH 2A5IA 4WH6A 1HPGA 1C2GA 1OWHA 5AHGH 3LJJA 1IHTH 2VVCA 2NU3E 5A8XA 5GWZA 1GI4A 2XC4A 1PYTD 1ZJDA 3SNAA 1ZJKA 2ODQA 1S81A 3VB6A 1SL3A 1W11U 1AHTH 1O30A 4AG1A 3M7QA 2W7SA 4DURA 1EUFA 1MCTA 1O3GA 1S6FA 2FDAA 3M5NA 1A7SA 4BAQB 1EASA 1CGHA 3A87A 1LVMA 3MU5A 1TGCA 3SI3H 2CN0H 2EA3A 3D62A 3GY4A 1VR1H 1XUJA 2PW8H 2BTCE 4WF8A 1O2QA 3S9CA 3GCOA 5GPIB 1O2MA 1HIAB 2BLQA 3R0FA 3QLPH 2OC1A 2F9UA 1SFIA 2C8ZB 2XBXA 1EAXA 1T4VH 2FWWA 3RXPA 1O2ZA 1PJPA 1BUIA 3UREA 4SGAE 1IQJA 1S5SA 4JMYA 1O3EA 1FY3A 3RXQA 5CHAB 1NTPA 1GHAG 3M61U 1GJCB 3G01A 1ANCA 4I33A 4JZFH 1O3MA 4BOHA 1GI0A 1EPTC 2HOBA 5F03A 1HXEH 1UTLM 2BD8A 1E38B 3PTNA 3TK5A 1HGTH 3SU1A 4D9RA 1FY5A 4K5ZA 1C2IA 1GI2A 2ZFPH 4IMQA 4NFEA 4B2BA 2PUXB 3PWBA 2ZPQA 3QO6A 2FOHA 4MPVA 3ZVAA 1S82A 4U32A 1K1JA 1D4PB 1LPGB 4I31A 1DVAH 2VGCC 4GPGA 2BXTH 1NO9H 4JK5A 1A0HB 3A88A 3MH6A 4MNXA 2GV6A 3TIUA 1LDTT 1O5FH 1TGSZ 3BTDE 1DWCH 1C4V2 3KF2A 1ANDA 2R2MB 2STAE 1LHEH 1PPEE 2UUFB 1ZOMA 4I8KA 2YOLA 4JZEH 3B23B 2ZGCA 3SW2B 1QCPA 4MTBA 1TQ7B 1HLTH 1CGJE 5C1XA 1Y3UA 2VIWA 1BTWA 2ANYA 1GMCF 4Y0ZE 2HALA 4WXIA 3TITA 1GBEA 4ZHLU 2OC7A 1S6HA 1LCYA 4B1TA 3I78A 4IW4E 1NRNH 1TNHA 2ZHWH 4H42U 1GJ7B 3SJIA 4DW2U 1TGBA 1Y3WA 1V2RT 1FI8A 5J4SA 1VGCC 2ZFQH 1XXDA 4X6NA 3UOPA 1OWJA 1O2VA 3BG4B 9LPRA 2FIRH 4UFEH 1FY4A 3OX7U 1GGDB 3KN2A 1ETSH 2AGEX 1MKWK 4Y0YE 5DG6A 1A3EH 2J2UA 2BM2A 4FVDA 2QGRA 2VIOA 2Y6TA 5HXFA 3RMOH 1IQNA 1GJDB 3UPEA 1SGNE 4DIHH 4K1TA 3M3SA 1JIMA 1L1GA 2ZI2H 3D49H 3U9AH 3T29A 1RS0A 1Z6JH 1ESTA 2HPPH 1YPKH 1LHCH 1O3LA 2JH5D 3BSQA 2I6QA 1TOMH 2NWNA 3DFJA 9ESTA 2HNTF 3UNQA 4FUFA 1KSNA 1O5CB 3LGWA 1KY9A 4HGCA 2CHAC 2H5DA 3SV9A 1UCYH 1MTNB 4FU9A 3FAOA 4WWYA 4BAMB 1ETTH 3MU8A 1DITH 1MTVA 1FN8A 3PMAB 3UIRA 2QV1A 1RFNA 1SGFA 2XCNA 3STJA 3S9AA 1ANBA 1UJ1A 2AEIH 2TGAA 1C1VH 1KXFA 1GCTC 3PLBA 1D9IA 1CE5A 1Z1IA 1O3DA 4NZLA 4BXSA 3ZZAA 2Z3EA 3FVFB 1GMHF 2CV3A 5FPYA 2QY0B 3GDUA 3Q77A 1W3CA 1YPHE 3SBKA 1SHHB 1KXAA 3MO6A 1HAZB 1HAHH 1N6XA 2D26C 3TPIZ 4K60A 2ZC9H 4NCYA 1SGQE 4TWWA 4YOJA 1EX3A 1P0SH 1L1JA 1M9UA 1UHBB 1V2MT 2ZEBA 2ZDMA 4PROA 1O36A 4U30A 1SB1H 1LKBA 1DWEH 2BDCA 4BXWA 4Y8YA 1TQ0B 2FTLE 3M7UA 1JWTA 3TH4H 2WPIS 3GDSA 3GYMA 1SLVB 3KEEA 3LH3A 3SGBE 1GBMA 1SGFG 4ISLA 3UWIA 3F9GA 3SU3A 4AGJA 1WV7H 1Y3YA 1OPHB 2OLGA 2ZG0H 3RP2A 1VJ9U 5E2PA 2PGBB 1P2QA 1UVOA 2SGDE 3T62A 4FXGH 1QQ4A 4K8YA 2A2QH 3SGAE 4CRCA 2M5TA 1GCDA 1UTJA 3QK1A 2VH6A 1BIOA 2ZCHP 1ZHPA 1Z7KA 1ZPBA 2IJOB 3FFGA 2QA9E 1KLTA 4HFPB 2W5EA 2GZ8A 1MQ6A 3A7XA 2BQ7B 3T25A 3GCHC 1GDUA 1KLJH 1MQ5A 4XBDA 1O2RA 5HMAA 2W26A 1SGYE 4NA9H 4Z6AH 4ABBA 1L0ZA 2J94A 2BHGA 1GG6C 2DE9A 4VGCB 1O0DH 1VJAU 3A80A 3U8OH 1NU9A 1W2KH 2HGTH 1O2XA 3PV4A 4RKJB 1DXPA 1MH0A 1C2DA 1V2QT 4I8LA 5BPEA 5DJ7A 4X1QU 3HKIB 1PPCE 1EP6A 4WMEA 2ZWLH 1C1SA 1WAYB 2C8WB 1FAXA 2BDIA 4O3UA 1YCPH 3MWIU 2QF0A 1K1MA 3L3TA 4UFGH 4RSPA 2D8WA 2W3IA 5EU8A 3RMLH 1ZR0A 2OBOA 1LHFH 1ID5H 1EAWA 5JBCS 1O31A 1O2KA 1C2FA 3QX5H 4X2YA 3F6UH 1GVLA 3OTJE 2DE8A 2GMTC 3SV7A 1C2MA 2ZU1A 4YTAA 4X8TH 1P2KA 4INKA 1UTOA 1G3BA 3ZVCA 3MFJA 2R3UA 3K65B 2C90B 2H1UA 2PKSC 2ULLA 1OWEA 4MVNA 4CREA 1MTSA 2K1QA 1DT2A 1PYTC 4Q80A 1Z6EA 4I8JA 1FJSA 3RXVA 1ZGIA 1UHBA 2SNWA 5C20A 2RA0A 1TMBH 4Y8ZA 1D3QB 1AZZA 1N6YA 1DFPA 1O2NA 2J38A 2HPQH 4ISNA 3P70B 4NFFA 3GCTG 1DANH 3TNSA 2AH4X 3A8DA 1L4ZA 1Z8IB 1UTMA 3LGVA 2PWXA 1BHXB 2J4IA 2ZQ2A 1PPZA 3HPTB 4H6TA 1F7ZA 1XX9A 1TRMA 1FIZA 3V3MA 1UVPA 1CVWH 1TMUH 3A81A 4UDWH 3A7VA 1Z1JA 1FY8E 3PB1E 2AMPA 2QC2A 1AZ8A 2A7JA 5JDUB 1H4WA 3S0NA 5F8ZA 1UTPA 3L33A 4ZHAA 3LIWA 1A61H 2STBE 1C5TA 3T28A 1DLKB 3M36A 2CGAA 5IDKA 1INCA 2A1DB 3L6PA 1O37A 1P02A 1AD8H 4A6LA 3P8FA 2PLXA 3AAVA 1ZLRA 4O03A 3DUXH 5A0BA 2UWPA 2ZQ1A 1BZXE 4NWKA 1AIXH 1P03A 4ABHA 5AFYH 3OSYA 8GCHG 2D2DA 1GI7B 1TPAE 3RU4D 4WMFA 1V6DA 2ZFFH 4O97A 1DSUA 2BLVA 1WTGH 4E7NA 2ZDKA 2A7CA 2ODYB 1W14U 4B75A 1W7GH 2WPKS 1E36B 1DY8A 1KTTB 4YZUA 4LOYH 1MBMA 2FO9A 1ZSKA 4D76A 5CHAC 3SNBA 5EQSA 4NIVA 3ODDA 2AIQA 3RC4A 1Y3VA 1LQEA 1GI8B 1TGNA 2V0BA 3BTWE 5F8TA 1AKSB 3RXUA 5EOKA 4HZHA 5EXNA 3LJOA 2AERH 1UCYK 3A7TA 2HLCA 1AI8H 3F1SB 1GJBB 1DE7H 3M35A 1EPTA 4NIWA 3UNSA 1AFQC 3NZIA 3DHKH 2WPJS 3MH7A 1GBBA 1OX1A 3ZYDA 1XUKA 2FOGA 3ENSB 3GDVA 1ZPZA 2G5NA 1SHYA 1UMAH 3V13A 1BT7A 1XM1A 1QB9A 1TRNA 1NFUA 4FUJA 1CU1A 2OBQA 1D6RA 1QIXB 1C2KA 2A5AA 3CP7A 4CRGA 1QA0A 3GCNA 2JETC 2B5TB 2B8OH 3E16B 3MOCA 3C1KA 4KTUA 3MNCA 4A92A 1J8AA 1DOJA 1YM0A 1SGDE 7LPRA 1NT1A 1EZQA 3MTYA 2OQ5A 1JRSA 3IWMA 1E0FD 3BTKE 3LOXA 1D3DB 1VITH 4TYDA 5FPTA 2BD5A 3OU0A 1S0RA 3Q00A 1YGCH 3BG4C 1TE0A 3SUEA 1C5YB 1YPGH 4B71A 3S69A 2QAAA 5ESTE 1GGDC 3RM0H 4BAKB 3DT0H 5GCHF 1ARBA 1FAKH 1BQYA 3ZZDA 2FOCA 1QBVH 2C8YB 4OS2A 4XE4A 1UK3A 3GCHB 1HAPH 3TJVA 1CHGA 2P59A 1CHOF 4WY3A 4MNVA 6GCHF 2UWOA 1QBNA 1HB0B 1AQ7A 4JYUH 1EZUC 1GBCA 1EJNA 4OGXA 2XNIA 4RN6A 1ANEA 2HNTC 2J92A 1V2VT 1A3BH 2XTTB 3U8TH 1MTNC 3A85A 1H1BA 2FOEA 5TCCA 3PROA 4K1SA 1O2SA 3NK8A 3SUGA 1HAVB 3SORA 1THPB 4B2CA 1V3XA 4MPXA 1FZZA 3MMGA 2R9PA 4X1NU 3E1XB 1BTPA 3K2UA 3HGNA 1YBWA 2BQ6B 3E91A 2FOAA 2ZDNA 1TBQH 2XC0A 2WV5A 1O3NA 2KAIA 2BZ6H 4FU8A 4Z0KA 4JZDH 4K1EA 1WSSH 2NU4E 1H9HE 5F6MA 4X6PA 1LPZB 5L2ZH 1NN6A 3JZ2B 3RXOA 2BXUH 2A31A 3W95A 4YOIA 4AB9A 1WTHD 5DK1A 1UVUH 2G52A 1K1PA 1MBQA 3SU5A 3S9BA 4JCNA 4DOQA 3FP6E 2ZGJA 1G32B 1HNEE 3PO1B 1K1LA 4IBLH 5HM9A 1KIGH 3GY6A 4UFDH 1T31A 1AO5A 5DO4H 2BY8X 2IPHA 3M3TA 2WPLS 1EZSC 3URCA 1TB6H 1O5GH 1J16A 3SHAH 1J14A 2ZGXH 3VXFH 5B6OA 4LZ1H 1K9OE 2BY6X 1C5UA 2PTNA 1P9UA 2ESTE 4KKDA 3RLYH 3TGIE 2F9PA 1TRYA 2ZCLP 1HJAB 3DD2H 1C4U2 1ETRH 1TA6A 4X0WU 4B74A 1P2MA 2GDDA 1C1PA 1ELGA 1SGRE 1C9TA 1NM6A 3LGTA 1SOZA 5A0AE 4A1VA 3P8NA 1P3CA 4Y76A 1C5SA 1GJ4H 1SGPE 1FDPA 2FI3E 3TH3H 4AYVB 1CA0B 1SMFE 1TX7A 1Z71A 2BB4A 2PHBA 4XBBA 1SBWA 4GVUA 4TY7A 1BRUP 1ESAA 1G3CA 1QL9A 5EW2H 4VGCC 1C1MA 3A84A 5FHTA 1HUTH 3CENA 1O2OA 1ZHMA 3RXGA 3GY2A 4ZKOU 1ELAA 5HYOA 1BRCE 3RXAA 1QY6A 1ORFA 3RXJA 3AVZA 4ABFA 3LU9B 1JMOH 1XUIA 4AFQA 1XVOA 2BDAA 3E0PB 5I25A 1VITF 1Y8TA 1IHSH 1F0RA 1LHGH 1CT2E 4R8TB 1P05A 4NA8A 3BIUH 1NFYA 2HRVA 4X8SH 1ZTKA 5GCHG 4DCDA 4IN2A 1DY9A 3WY8A 1DS2E 2ZU3A 4YT7H 1Y3XA 1EJMA 2ZDAH 2FLRH 2I6SA 1O3OA 1CHOG 3MNXA 3SU0A 6GCHG 3MNBA 1AFQB 1MAXA 3M3VA 5DP4A 2FOFA 3A8BA 3SJ9A 1AE8H 2CJIA 4X6MA 4JYTA 3OYPA 1P3EA 2BD7A 3GOVB 4JZ1A 4DGJA 1O2HA 5ETXA 3F9HA 1O35A 2SGEE 3BEFB 2JETB 1C1QA 2Z9GA 2BDHA 1T8OA 3BIVH 3RXLA 4UE7H 1DUEA 1C5WB 3GY7A 4O3TA 1HBTH 1LHDH 1PQ7A 5LGOA 4OS7A 3NUMA 2BVRH 1KDQB 2TIOA 1L2EA 1RGQA 3EAJA 4H6SB 1F0UA 6LPRA 1G36A 3LH1A 2C3SA 1Y5BT 4OS6A 3PMJA 4XDEA 2QN5T 2P3UB 2FOBA 2H5CA 4XSKU 1LMWB 2XXLA 1GHVH 1K2I1 3LONA 4ZAEA 1BA8B 1O5EH 1SG8B 3FZDA 4CH8B 2AGGX 2CMYA 1NZQH 1YPLH 5K7RA 4MDSA 2ZU4A 2F3CE 1TWXB 1IQKA 3RLWH 3SO3A 1MTUA 1EZXC 3Q3XA 3F68H 1HIAA 3ATMA 2GZ9A 5LH8A 1AVXA 4ZMAH 1AN1E 1ELFA 1VZQH 4Q7ZA 5T6FA 4FVBA 5JB8S 1BMMH 1QA7A 1P9SA 1ZSLA 2AYWA 5GDSH 1C2HA 1DSTA 4CBOA 4A7IB 1TNKA 3KHVA 4U2WA 5A2MH 1C5OH 1A4WH 3UQOA 2A4OA 3PLPA 4D7FA 5ESBA 2XW9A 1A5HA 2SGQE 2BD9A 2G5VA 2HWLB 1EP5A 4E06H 2SGFE 4TY6A 1NFXA 5C67A 2FESH 4J1YA 2ILNA 4A5TS 4ABIA 1QR3E 3K6ZA 2UWLA 2VIVA 5AVDA 3M5LA 5A09A 1TPPA 1DUAA 3MNSA 5EQQA 1AMHA 1KXCA 1UVTH 1BB0B 5E8EH 1YLCA 1QJ6B 1ELVA 3SJOA 4SGBE 2B7DH 2PKAB 3BEUA 5FCKA 1C5RA 2OQUA 1DWDH 1V2PT 3LDXH 2BD3A 1G3EA 1B7XB 4J2YB 3PYHA 2Y81A 4CRDA 2ASUB 1SFQB 7GCHF 4GLYA 4I8GA 1VITG 4DG4A 1NPMA 5T3HA 1FLEE 7ESTE 4ESTE 1GWAA 2J95A 1EJAA 2SNVA 1AUJA 3QDZB 1XKBC 4WJG2 4WXVA 1O3FA 2NU2E 5E0JA 1QJ7B 1HAOH 3VB5A 1KDQA 1S0QA 5PTPA 1JBUH 1P06A 1C1RA 1LPKB 3BG8A 3TJNA 3F9EA 4JK6A 1J17T 2J9NA 2CF8H 1CBWB 1MZDA 1PPGE 4MG3A 2XWAA 3MO9A 1TAWA 5HM2A 3RM2H 1UTKA 1D6WA 3SNCA 5I46H 2AGIX 3GY3A 1ZGVA 2Q6GA 1YPEH 2GD4B 1C5PA 2BOHB 3KL6A 3UOUA 2VIPA 3RU4T 3P6ZB 1OOKB 2JKHA 1S83A 2WUBA 1XUFA 2OD3B 1YP9A 2HNTE 3TLOA 1H9LB 3ZZ6A 1BTXA 5JBTA 2OUAA 4RKOB 4MLFB 1SR5C 1A0JA 4B2AA 5L2YH 1MD8A 2JH0D 3Q3KA 3HKJB 4IN1A 2A5KA 1TOCB 1O3KA 3BTGE 2BQWB 1SPJA 1FUJA 1GMCG 3I29A 2AS9A 1YF4A 1GJAB 2WYJA 4ZUHA 1Q3XA 3SJ8A 2XBVA 3EDXB 3QGNB 2XBYA 1CT0E 3K9XB 3P92A 1KXBA 4NIYA 1EAIA 5EODA 1ELDE 3SU2A 3UQVA 3U8RH 3T2NA 3HK6B 4A1XA 2JH6D 2QXJA 1ELCA 2FS8A 3TVJB 4NSYA 2FI5E 1C1UH 2BVSH 1BBRE 1OYQA 1EOJA 1P2IA 1OP2A 1UK2A 1OP0A 3PO1C 1ACBE 5GXPA 2BLOA 4FU7A 3A82A 3M5MA 1SQTA 1NS3A 1L4DA 4GHTA 4Q7YA 1RD3B 2PKAA 2P3TB 5FX5A 2G81E 1CGIE 1AFEH 1BMAA 3O8DA 4X6OA 1DDJA 1EATA 3QTOH 5FBEA 1E37B 1ZMNA 2H9EH 1HJAC 3B9FH 1BTUA 3EA8A 1TONA 2G00A 3TGJE 1TIOA 4CRBA 2O8UA 1H8IH 2A32A 2BOKA 1MCVA 1C5ZB 1C5LH 2LNCA 2VWOA 1ZMJA 1OWIA 1GVKB 1O2GH 1PPBH 1AB9C 2FYRA 3VPKA 4DJZB 2WV4A 5H4IB 1GBTA 1CA0C 1BJVA 1GMHG 1RXPA 1EB2A 2PSXA 2Q1JA 1KTSB 1C2JA 1QFKH 3ZVGA 2FM2A 4X1RU 2ZU2A 3PTBA 5FX6A 3QTVH 1LO6A 2ZTYA 1UK4A 1GHBF 1CQQA 3ZVBA 4CBNA 4YM9A 3SV6A 4UEHH 2FTMA 4NWLA 1UTQA 1IAUA 1IQHA 4WMDA 3P8GA 3LGYA 3P17H 4A1TA 3D65E 4H4FA 1BRBE 3TK6A 1KXEA 4GAWA 1HCGA 1AVWA 4QT8C 2BLWA 1HXFH 2PV9B 4JZIA 5E0GA 3KNXA 3LKWA 3A7WA 1TLDA 1A5IA 1NFWA 4XFQA 4KTSA 2QXHA 2ZF0H 1RIWB 1G2LA 4AX9H 2G4UA 5AF9H 3OY5U 3QWCH 4MPUA 3E90B 2FZZA 2HVXA 2FX6A 2ZZUH 2TGTA 3UTUH 2NU0E 1ZTLA 1O2PA 4ZH8A 4K3JA 1LKAA 4INLA 1SI5H 3GISB 3W94A 8KME2 3LC5A 3SV2H 4Y7AA 2OXSA 4KP0A 1W8BH 4XOJA 2BD4A 1J15A 2FLBH 2YNAA 2GDEH 5A8YA 2Q6DA 3H5CB 5EG4A 1K1OA 2VJ1A 1ZPCA 1PQ8A 1G3DA 1A1RA 1GPZA 2FOMB 2Y5HA 3ZV8A 5C2ZA 1DXWA 4X2WA 3NXPA 1O2YA 2ANWA 4FUCA 4MNWA 2ALVA 2R0KA 3TU7H 1OYTH 1Q31A 3JZ1B 2BDBA 2C93B 1UVSH 2THFB 1OWDA 3I77A 2V3OH 1SLUB 3TJOA 2OC8A 3BTFE 1OKXA 1LTOA 3VGCB 2G55A 3SUFA 2O9QA 1QRXA 1MMJN 5JB9S 1W12U 4IC5A 2FEQH 1JIRA 2RDLA 3SJKA 3GICB 3Q3YA 2NU1E 3QZRA 1T7CA 2RA3A 2BX3A 3SN8A 6ESTA 2F83A 2ZHEH 3EA9A 5TCAA 3ZZ8A 1O3HA 2Y5GA 2AFQB 1BDAA 4FUEA 3HGPA 1F0TA 4E05H 1MKWH 1VCPA 4KELA 3UY9A 2UUYA 1HAIH 1LVYA 2GCHF 2VINA 1EKBB 1J9CH 2BY5X 2R3YA 3ODFA 3RXRA 3VXEH 1O2IA 2D1JA 3TK9A 1ZSJA 3ZZ4A 3UWJH 1ELBA 5E2OA 3NCLA 4UFFH 1AY6H 1O5DH 1TMTH 2FI4E 4CR5A 2AMDA 4D8NA 2Q6FA 1UTNA 3EE0B 2EI8A 2BVXH 2H9TH 3KQDA 2FX4A 2SGPE 1QB1A 3GY8A 4WVPE 4Y8XA 2AMQA 2Z3DA 3U1IB 1HFDA 2EEKA 3RC5A 3CS7A 1H8DH 3T27A 4MNYA 2GT8A 1AKSA 1THRH 2R0LA 1G9IE 1V2JT 1BTYA 1P2OA 1IQLA 2DUCA 1CO7E 1GDQA 3T26A 4AORA 1YCPK 1E35B 1F5RA 1FPHH 2F91A 3ZVFA 1GHBG 1XKAC 1IQIA 1B0FA 1UO6A 1GBHA 2Z9LA 4Y11E 5FXLA 3LGUA 1PFXC 4CRFA 1AGJA 5J4QA 2XC5A 2FYQA 1O34A 2IOTA 2C4FH 1V2WT 2FS9A 1C1TA 1NC6A 2GKVE 2XBWA 2Z7FE 3E8LA 2BDYA 3AW0A 1DICA 2SGAA 4IS5A 2OP9A 4DT7B 5DGJA 1QGFA 4YLQH 1FN6A 1YCPM 2PFEA 1D3PB 4ISOA 2YNBA 3GY5A 1Z8JB 4AB8A 1D3TB 1RTLA 4CH2B 3EGKH 3MU4A 2ODPA 2G51A 3E6PH 4F4OC 5EW1H 6CHAB 1CBWC 1Y59T 1F0SA 2OINA 1CT4E 3VFEA 2J34A 2ZTXA 5GJ4B 3RUOA 1AB9B 1RRKA 1SVPA 1XVMA 4CRAA 1B5GH 2ZTZA 5EXMA 4ASHA 1FIWA 3K6YA 4ZKRU 2TRMA 2ZKSA 1TNLA 1H9IE 3ESTA 3BTQE 1GDNA 1O33A 4NG9H 1IOEA 4CHAB 3BTTE 1GVZA 2A4GA 4NGAH 3OY6U 1LVBA 1O3JA 2VIQA 1YYY1 3ZV9A 1T32A 1VCQA 1HAVA 1FPCH 1O3AA 1QJ1B 1MTWA 4OGYA 4ABGA 4BTIB 5C3NA 2PSYA 1IQMA 4NZQA 1V2OT 3EQ0H 2ZO3H 3RXIA 2G8TA 1AWFH 5DP8A 1O39A 1BBRH 2Z6BD 4AG2A 2UUKB 3SQEE 5HGGA 4BAHB 5FAHA 1AWHB 2G4TA 2GT7A 5FBIA 3QN7A 4GCHF 3SHCH 4AOQA 2ZDLA 3RXHA 2QCYA 2H9HA 2BY7X 1L1NA 2R2WU 3MO3A 7KMEH 3BEIB 1YC0A 1NRQH 1LQDB 1FY1A 2ZIQH 1DLEA 1BTHH 3SI4H 2QIQA 1GHWH 1PQ5A 3BTME 5JPMH 2GCHG 3ZZ5A 1U6QA 3O8BA 8ESTE 1GI1A 1NRPH 2W3KA 2XCFA 4MPWA 1TFXA 1V2UT 2VH0A 1F5LA 4U01A 1ELEE 2ZNKH 4AFZA 4JYVH 4YT6H 5L6NH 4K8BA 1Y5UT 1TNJA 3RXEA 2VB0A 2FODA 2O8WA 1HAYB 1QTFA 2BMGB 3HATH 3RXKA 3KQEA 4LK4A 5LPEA 1OP8A 3M37A 3SGQE 2PR3A 2P8OB 4ZROA 1BRAA 4ABDA 2TPIZ 3PM3A 2RG3A 1GBJA 2Y7ZA 2FPZA 3A8AA 1C5VA 1TYNA 2P16A 1QURH 5T6GA 5AFZH 2BYAX 1F2SE 2ZFSA 5A8ZA 3ATIA 4BAOB 2PUQH 4YLUA 2AIPA 3QUMP 2GV7A 3BV9B 3UFAA 1TABE 1B0EA 1GBDA 4BANB 2QF3A 2BDGA 1FONA 2GCTC 2Y80A 1GBFA 1GBIA 1MKXH 1N8OB 3AAUA 2Z9IA 2V35A 1C5MD 1O2JA 2F9BH 2P94A 3VB3A 2WPMS 3SZNA 1TNGA 1OXGA 5GIBA 1MAYA 2IN2A 4GSOA 4HI3A 1G37A 4FUGA 3SQHE 3PMBB 2OC0A 3UR6A 3LC3A 1SSXA 2P3FH 5CMXH 4Y79A 5LPFA 5C5OA 1A46H 1ABIH 3BN9A 4NIXA 5DP5A 1EAUA 1GI6A 1MUEB 1TALA 1QL8A 1TGTA 2Y82A 2XWBI 3IG6B 3AW1A 4ZHMU 1NRRH 1RIWC 4TPYA 1ZYOA 1HV7A 1JXPA 2ANKH 1C1WH 2XYAA 2Y5FA 8LPRA 2WPHS 3LPRA 1DM4B 2F9NA 2PGQB 3ZYEA 3A83A 1XXFA 3GCTF 3RC6A 2UUJB 1K21H 1XMNB 5CE1A 2QXGA 3ELAH 1ZRKA 2GGVB 1A5GH 1K1IA 5DP7A 3P8OA 3ZZ3A 1SC8U 1BTZA 2BZAA 3ZVEA 2O8LA 1Q2WA 3RXBA 1P2JA 4FUHA 1WUNH 4Y6DA 1PQAA 5FCRA 1P8VC 4Y10E 1A2CH 4F49A 1SLXB 2V3HH 1P01A 3PLKA 2GVFA 1TA2A 4BTUB 4K69A 3GYLB 2QXIA 3H7OA 2ZGHA 1GBKA 3PMHB 1NESE 2B0FA 5FPSA 2VNTA 1G2MA 3O8RA 1FNIA 1QNJA 1V2ST 3D23A 1O2WA 1SQOA 3PWCA 4XBCA 1W10U 2WUCA 3VGCC 2ZHQH 1BMLA 3S7HB 4B76A 4ZKNU 8GCHF 4GCHG 1GJ9B 3EA7A 2WYGA 1V2LT 2B9LA 5T6DA 5IYTA 1IQGA 2BX4A 1SOTA 2OCVB 2VWMA 1JOUB 1QBOA 2V6NA 1SGCA 4X2XA 1GBLA 4ZKSU 5EGMA 1C2LA 1W0ZU 4AZ2B 5EPYA 1EQ9A 5DP6A 1SGTA 2TGPZ 3A7YA 2ZHDA 3NPSA 1F5KU 4AN7A 4ABJA 4DY7B 2ZHFH 1QB6A 1AU8A 2FXRA 2VVUA 1NY22 2ZDVH 1GJ8B 3RXCA 1KXDA 3SUDA 3URDA 5DP9A 3ATWA 2PTCE 1C2EA 4THNH 2RCEA 2EI7A 2VVVA 3NWUA 1MZAA 1ZHRA 4O9VA 4Y71A 5DPAA 3ATKA 2EC9H 1A0LA 2GZ7A 1C1OA 3SU6A 4I8HA 3SOSA 3VB4A 5TJXA 4ISIH 4X2VA 1S84A 1C5XB 1W7XH 1HAXB 1HJ8A 2Z9KA 4OS1A 3S7KB 4X1SU 5G4BA 1MU8B 3V0XA 1YPJH 1BBRK 3ATLA 4Y7BA 4FUDA 5EQRA 2ZGBH 1O3BA 1HAGE 5A0CA 4UD9H 1T8LA 1E34B 3TJUA 1EOLA 1O2UA 1O5AB 1QL7A 5ABWA 2W7UA 2O8MA 3QGJA 3RMNH 2GP9B 1EPTB 5C1YA 2SFAA 1O2LA 1PPFE 1GMDF 1C9PA 4M7GA 1HRTH 4NSVA
chains in the Genus database with same CATH superfamily
4ABEA 3UAIC 3FOAA 1K1NA 1O38A 1BMNH 3LT3A 4DVAU 2HLDD 5C1UA 1OWKA 3BTHE 6CHAC 3V12A 2QF5A 3GS9A 3QZQA 2ZCKP 2VGCB 2M2AA 4GUXA 4CR9A 1GI3A 1MU6B 1BHXF 4I32A 4FUIA 4IGDA 3FANA 2OTVA 4OS4A 3KCGH 1TPSA 3SNEA 2ALPA 4ABAA 3V7TA 2ZPSA 3KQCA 3LGIA 1OSSA 2ZECA 3CS0A 4IC6A 1K22H 3MHWU 3Q76A 4Q2KA 1QHRB 3IITA 2A7HA 4KTCA 1HYLA 2GCTB 1WQSA 1ZTJA 1P57B 3B8JA 2RFKC 2Z3CA 4CHAC 4KGAA 1BJUA 2P95A 3DA9B 4TPIZ 5JBAS 2A4QA 7GCHG 3N7OA 4GHQA 1VGCB 1YLDA 2FP7B 1O32A 1MKXK 1HDTH 3ZZBA 3VB7A 2F9OA 1GJ6A 2ANMH 3ZZ9A 2ZP0H 3NKKA 3O8CA 1AVGH 2C8XB 1NRSH 2GX4A 1ZZZA 2QYIA 3MYWA 1GHYH 1TX6A 2JIZD 4TWYA 3VEQB 1ELTA 2VIDA 1SQAA 1CSOE 2A4RA 2F4LA 3RXMA 1C4Y2 2IPQX 1FV9A 3A8CA 3BF6H 3N7DA 1SLWB 4NA7A 2FMJA 1TX8A 3FZZA 5C5NA 3M5OA 1Z8RA 5L30H 1ZMLA 3P95A 1FQ3A 1XUGA 2ZPRA 5JBBS 4AFSA 4HTCH 2CHAB 2WPDD 1XUHA 3EYDA 1DWBH 1HJ9A 1DPOA 3MH4A 2KAIB 1MD7A 1OS8A 1TBRH 3RXDA 1T8NA 3C27B 4I7YH 1QZ8A 1DX5M 1NROH 1JRTA 1C1NA 4HG6A 1CA8B 3UUZA 1UCYE 1KLIH 4Q4LA 1K28D 3STIA 4Q7XA 3RXFA 1W0YH 1O3CA 2GTBA 4UONA 1C5QA 1ARCA 1VCWA 1T8MA 1AE5A 1ESBA 1UW7A 2IJD1 3M7TA 3TGKE 2J97A 3AASA 4ISHH 1P04A 4B73A 3H7TA 5E0HA 1GCTB 4K2YA 1GI5A 1ZRBA 2P8OC 1GBAA 4INHA 3RU4E 4X1PU 3MI4A 4YESB 3R3GB 4ZXYH 4AFUA 1TPOA 3ZZ7A 1SGEE 1YPHC 4LZ4B 4ZXXH 3KQBA 3A86A 5DKMA 3A89A 4X8VH 3TNTA 1YPMH 2VWLA 3HK3B 1W13U 3FP7E 4DIIH 1AUTC 1E79D 4BNRA 1KMHB 3TH2H 2Y7XA 2BY9X 3T5FH 2XRCA 1T4UH 2Z94A 2CF9H 3ZVDA 4OS5A 1FXYA 3F9FA 1N8OC 5LPRA 1BCUH 3KGPA 3DFLA 3MH5A 1O5BB 3RXTA 5F8XA 1ABJH 4YOGA 1PPHE 1RJXB 1WOFA 1GL0E 3RMMH 1EXFA 4AYYB 3N99A 1GHAF 5T1VA 1Z8GA 1IQFA 1X7AC 4IMZA 1GMDG 4LXBH 5EXLA 1GHZA 2LPRA 5SGAE 3F0OA 2TGDA 4WH8A 3ZZCA 3UR9A 3RDZA 5JYIA 1TBZH 1BOQA 1O3PB 5K0HA 2VWNA 2WV9A 1Y5AT 1LVOA 1FMGA 1GJ5H 1QQUA 4MQAA 4D7GA 3U98H 5EJLA 2BD2A 5DP3A 1IQEA 4AGKA 2KZ4A 4BTTB 1O2TA 4X8UH 1P11E 1F92A 3SNDA 1WBGB 1GG6B 3U1JB 1V2NT 2L74A 2A2XH 3RXSA 4YO9A 2A45B 2H6MA 1GL1A 3MU1A 2WINI 1P12E 1V2KT 1O3IA 2VU8E 3MU0A 3ZIAD 3E0NB 2H2ZA 2ZU5A 2A0QB 1RTKA 5EPNA 1NU7B 2F43B 3EE7A 1KYNA 1V2TT 3SZEA 3U69H 2J98B 4E7RG 4R0IA 1G30B 3BTEE 3ITIA 2F9VA 4FUBA 1P10A 2V7QD 1P09A 1THSH 1WU1A 4D9QA 2Z9JA 1P2NA 3SV8A 2P93A 1N1LA 1S85A 1SGIB 2CXVA 2GMTB 5BRRE 3SU4A 3UNRA 1BITA 1QRZA 3E3TA 3FP8E 3WWBA 1GI9B 2EI6A 1TNIA 3A7ZA 2ZFRH 2O8TA 1WCZA 1YKTA 2PKSB 3DSOA 2ZA5A 2ZFTA 1QRWA 1EB1H 1RTFB 1GHXH 2TBSA 1WYKA 3KIDU 1WQVH 1C5NH 2A5IA 4WH6A 1HPGA 1C2GA 1OWHA 5AHGH 3LJJA 1IHTH 3F2HA 1E1RD 2VVCA 2NU3E 5A8XA 5GWZA 1GI4A 2XC4A 1PYTD 1ZJDA 3MQKC 3SNAA 1ZJKA 2ODQA 1S81A 3VB6A 1SL3A 1W11U 1AHTH 1O30A 4AG1A 2J5UA 3M7QA 2W7SA 4DURA 1EUFA 1MCTA 1O3GA 1S6FA 2FDAA 3M5NA 1A7SA 3U28C 5KEDA 4BAQB 1EASA 1CGHA 3A87A 1LVMA 3MU5A 1TGCA 3SI3H 2CN0H 2EA3A 3D62A 5KGOA 3GY4A 1VR1H 1XUJA 2PW8H 2BTCE 4WF8A 1O2QA 3S9CA 3GCOA 5GPIB 1O2MA 1HIAB 2BLQA 4B6EA 3R0FA 3QLPH 2OC1A 2F9UA 1SFIA 2C8ZB 2XBXA 1EAXA 1T4VH 2FWWA 3RXPA 1O2ZA 1PJPA 1BUIA 3UREA 4SGAE 1IQJA 1S5SA 4JMYA 1O3EA 1FY3A 3RXQA 5CHAB 3PRBA 1NTPA 2LP6A 1GHAG 3M61U 1GJCB 3G01A 1ANCA 4I33A 4JZFH 1O3MA 1FX0B 4BOHA 1GI0A 1EPTC 2HOBA 5F03A 1HXEH 1UTLM 2BD8A 1E38B 3PTNA 3TK5A 1HGTH 5CHBA 3SU1A 4D9RA 1FY5A 4K5ZA 1C2IA 1GI2A 2ZFPH 4IMQA 4NFEA 4B2BA 2PUXB 3PWBA 2ZPQA 3QO6A 2FOHA 4MPVA 3ZVAA 1S82A 4U32A 1K1JA 1D4PB 1LPGB 4I31A 1DVAH 2VGCC 4GPGA 2BXTH 1NO9H 4JK5A 1A0HB 3A88A 3MH6A 4MNXA 2GV6A 3TIUA 1LDTT 1O5FH 1TGSZ 3BTDE 1DWCH 1C4V2 3KF2A 1ANDA 2R2MB 2STAE 1LHEH 1PPEE 2UUFB 1ZOMA 4I8KA 2YOLA 4JZEH 3B23B 2ZGCA 3KQ5A 3SW2B 1QCPA 4MTBA 1TQ7B 1HLTH 3OE7D 1CGJE 5C1XA 1Y3UA 2VIWA 1BTWA 2ANYA 1GMCF 4Y0ZE 2HALA 4WXIA 3TITA 1GBEA 4ZHLU 2OC7A 1S6HA 1LCYA 4B1TA 3I78A 4IW4E 1NRNH 1TNHA 2ZHWH 4H42U 1GJ7B 3SJIA 4DW2U 1TGBA 1Y3WA 1V2RT 1FI8A 5EIYA 5J4SA 1VGCC 2ZFQH 2KM0A 1VKYA 1XXDA 4X6NA 3UOPA 1OWJA 1O2VA 3BG4B 1COWD 9LPRA 3FN8A 2FIRH 4UFEH 1FY4A 4XD7D 3OX7U 1GGDB 3KN2A 1ETSH 2AGEX 3WW7A 1MKWK 4Y0YE 5DG6A 1A3EH 2J2UA 2BM2A 4FVDA 2QGRA 2VIOA 2Y6TA 4Q63A 5HXFA 3RMOH 1IQNA 1GJDB 3UPEA 1SGNE 4TSFD 4DIHH 4DT4A 4K1TA 3M3SA 1JIMA 1L1GA 3AK5A 2ZI2H 5CDFE 3D49H 3U9AH 3T29A 1RS0A 1Z6JH 1ESTA 2HPPH 3NRLA 1YPKH 1LHCH 1O3LA 2JH5D 3BSQA 2I6QA 1TOMH 2NWNA 3DFJA 9ESTA 2HNTF 3UNQA 4FUFA 1KSNA 1O5CB 3LGWA 1KY9A 4HGCA 2CHAC 2H5DA 3SV9A 1UCYH 1MTNB 4FU9A 3FAOA 4WWYA 4BAMB 1ETTH 3MU8A 1DITH 1MTVA 1FN8A 4RI0A 3PMAB 3UIRA 2QV1A 1RFNA 1SGFA 2XCNA 3STJA 3S9AA 1ANBA 1UJ1A 2AEIH 2TGAA 1C1VH 1KXFA 1GCTC 3PLBA 1D9IA 1CE5A 1Z1IA 1O3DA 4NZLA 4BXSA 2KCPA 3ZZAA 2Z3EA 3FVFB 1GMHF 2CV3A 5FPYA 2QY0B 3GDUA 3Q77A 1W3CA 1YPHE 3SBKA 1SHHB 1KXAA 3MO6A 1HAZB 1HAHH 1N6XA 2D26C 3TPIZ 4K60A 2ZC9H 4NCYA 1SGQE 4TWWA 4YOJA 1EX3A 1P0SH 1L1JA 1M9UA 1UHBB 1V2MT 2ZEBA 2ZDMA 3H09A 4PROA 1O36A 4U30A 1SB1H 1LKBA 1DWEH 2BDCA 4BXWA 4Y8YA 1TQ0B 2FTLE 3M7UA 1JWTA 3TH4H 2WPIS 3GDSA 3GYMA 1SLVB 3KEEA 3LH3A 3SGBE 1GBMA 1SGFG 4ISLA 3UWIA 3F9GA 3SU3A 4AGJA 1WV7H 3KYFA 1Y3YA 1OPHB 2OLGA 2ZG0H 3RP2A 1VJ9U 5E2PA 2PGBB 1P2QA 1UVOA 2SGDE 3T62A 4FXGH 1QQ4A 4K8YA 2A2QH 3SGAE 4CRCA 2M5TA 1GCDA 1UTJA 3QK1A 2VH6A 1BIOA 2ZCHP 1ZHPA 1Z7KA 1ZPBA 2IJOB 3FFGA 2QA9E 1KLTA 4HFPB 2W5EA 2GZ8A 1MQ6A 3A7XA 2BQ7B 3T25A 3GCHC 1GDUA 1KLJH 1MQ5A 4XBDA 1O2RA 5HMAA 2JJ1D 3KYGA 2W26A 1NBMD 1SGYE 4NA9H 4Z6AH 4ABBA 1L0ZA 2J94A 2BHGA 1GG6C 2DE9A 4VGCB 1O0DH 1VJAU 3A80A 3U8OH 1NU9A 1W2KH 2HGTH 1O2XA 3PV4A 4RKJB 1DXPA 1MH0A 1C2DA 1V2QT 4I8LA 5BPEA 5DJ7A 4X1QU 3HKIB 1PPCE 1EP6A 4WMEA 2ZWLH 1C1SA 1WAYB 2C8WB 1FAXA 2KR7A 2BDIA 4O3UA 2QF4A 1YCPH 3MWIU 2QF0A 1K1MA 3L3TA 4UFGH 4RSPA 2D8WA 2W3IA 5EU8A 3RMLH 1ZR0A 2OBOA 1LHFH 1ID5H 1EAWA 5JBCS 2KCYA 1O31A 3PV2A 1O2KA 1C2FA 3QX5H 4X2YA 3F6UH 1GVLA 3OTJE 2DE8A 2GMTC 3SV7A 1C2MA 2ZU1A 4YTAA 4X8TH 1P2KA 4INKA 1UTOA 1G3BA 3ZVCA 3MFJA 2R3UA 3K65B 2C90B 2H1UA 2PKSC 2ULLA 1OWEA 4MVNA 4CREA 1MTSA 2K1QA 1DT2A 1PYTC 4Q80A 1Z6EA 4I8JA 1FJSA 3RXVA 1ZGIA 1UHBA 2SNWA 5C20A 2RA0A 1TMBH 4Y8ZA 1D3QB 1AZZA 1N6YA 1DFPA 1O2NA 2J38A 2HPQH 4ISNA 3P70B 4NFFA 3GCTG 1DANH 3TNSA 2AH4X 3A8DA 1L4ZA 1Z8IB 1UTMA 3LGVA 2LELA 2PWXA 1BHXB 2J4IA 2ZQ2A 4RT1A 1PPZA 3HPTB 4H6TA 1F7ZA 1XX9A 1TRMA 4P00A 1FIZA 3V3MA 1UVPA 1CVWH 1TMUH 3A81A 2W6ID 4UDWH 3A7VA 3F2GA 1Z1JA 1FY8E 3PB1E 2AMPA 2QC2A 1AZ8A 2A7JA 2EQNA 1H4WA 5JDUB 3S0NA 4AC9A 3FKSD 5F8ZA 1UTPA 3L33A 4ZHAA 3LIWA 1A61H 2STBE 1C5TA 3T28A 1DLKB 3M36A 2CGAA 5IDKA 1INCA 2A1DB 3L6PA 1O37A 1P02A 1AD8H 2RDEA 4A6LA 3P8FA 2PLXA 3AAVA 1ZLRA 4O03A 3DUXH 5A0BA 1MABB 2UWPA 2ZQ1A 1BZXE 4NWKA 1AIXH 1P03A 4ABHA 5AFYH 3OSYA 8GCHG 2D2DA 1GI7B 1TPAE 3RU4D 4WMFA 1V6DA 2ZFFH 3F2FA 4O97A 1DSUA 2BLVA 1WTGH 4E7NA 2ZDKA 2A7CA 2ODYB 1W14U 4B75A 1W7GH 2WPKS 1E36B 1DY8A 1KTTB 4YZUA 3UB0A 4LOYH 1MBMA 2FO9A 1ZSKA 4D76A 5CHAC 3SNBA 5EQSA 4NIVA 3ODDA 2AIQA 3RC4A 1Y3VA 1LQEA 1GI8B 1TGNA 2V0BA 3BTWE 5F8TA 1AKSB 3RXUA 5EOKA 4HZHA 5EXNA 3LJOA 2AERH 1UCYK 3A7TA 2HLCA 1AI8H 3F1SB 1GJBB 1DE7H 3M35A 1EPTA 4NIWA 3UNSA 1AFQC 3NZIA 2V3MA 3DHKH 2WPJS 3MH7A 1GBBA 1OX1A 3ZYDA 1XUKA 2FOGA 3ENSB 3GDVA 1ZPZA 2G5NA 1SHYA 1UMAH 3V13A 1BT7A 1XM1A 1QB9A 1TRNA 1NFUA 4FUJA 1CU1A 2OBQA 1D6RA 1QIXB 1C2KA 2A5AA 3CP7A 4CRGA 1QA0A 3GCNA 2JETC 2B5TB 2B8OH 3E16B 3MOCA 3C1KA 4KTUA 3MNCA 4A92A 1J8AA 1DOJA 2WSSD 1YM0A 1SGDE 7LPRA 1NT1A 1EZQA 3MTYA 2OQ5A 1JRSA 3IWMA 1E0FD 3BTKE 1K0HA 3LOXA 1D3DB 1VITH 4TYDA 5FPTA 2BD5A 3OU0A 1S0RA 3Q00A 1YGCH 3BG4C 1TE0A 3SUEA 1C5YB 1YPGH 4B71A 3S69A 2QAAA 5ESTE 1GGDC 3RM0H 2XNDD 3DT0H 4BAKB 4YXWD 5GCHF 1ARBA 1FAKH 1BQYA 3DSGA 3ZZDA 2FOCA 1QBVH 2C8YB 4OS2A 4XE4A 1UK3A 3GCHB 1HAPH 3TJVA 1CHGA 2P59A 1CHOF 4WY3A 4MNVA 6GCHF 2UWOA 1QBNA 1HB0B 1AQ7A 4JYUH 2JDID 1EZUC 1GBCA 1EJNA 4OGXA 2XNIA 4RN6A 1ANEA 2HNTC 2J92A 1V2VT 1A3BH 2XTTB 3U8TH 1MTNC 3A85A 1H1BA 2FOEA 5TCCA 3PROA 4K1SA 1O2SA 3NK8A 3SUGA 1HAVB 3SORA 1THPB 4B2CA 1V3XA 4MPXA 1FZZA 3MMGA 2VBCA 2R9PA 4X1NU 3E1XB 1BTPA 3K2UA 3HGNA 1YBWA 2BQ6B 3E91A 2FOAA 2ZDNA 1TBQH 2XC0A 2WV5A 1O3NA 2KAIA 2BZ6H 4FU8A 4Z0KA 4JZDH 4K1EA 1WSSH 2NU4E 1H9HE 5F6MA 4X6PA 1LPZB 5L2ZH 1NN6A 3JZ2B 3RXOA 2BXUH 2A31A 3W95A 4YOIA 4AB9A 2JJ2D 1WTHD 5DK1A 1UVUH 2G52A 1K1PA 1MBQA 3SU5A 3S9BA 4JCNA 4DOQA 3FP6E 4OM9A 2ZGJA 1G32B 1HNEE 3PO1B 1K1LA 4IBLH 5HM9A 1KIGH 3GY6A 4UFDH 1T31A 1AO5A 5DO4H 2BY8X 2IPHA 3M3TA 2WPLS 1EZSC 3URCA 1TB6H 1O5GH 1J16A 2L6OA 1J14A 2ZGXH 3SHAH 3VXFH 5B6OA 4LZ1H 1K9OE 2BY6X 1C5UA 2PTNA 1P9UA 2ESTE 2W6JD 4KKDA 1YLNA 3RLYH 2F9PA 3TGIE 1TRYA 2ZCLP 1HJAB 3DD2H 1C4U2 1ETRH 1TA6A 4X0WU 4B74A 1P2MA 2GDDA 1C1PA 1ELGA 1SGRE 1C9TA 1NM6A 3LGTA 1SOZA 5A0AE 4A1VA 3P8NA 1P3CA 5EJ1A 4Y76A 1C5SA 1GJ4H 1SGPE 1FDPA 2FI3E 3TH3H 4AYVB 2K8IA 1CA0B 1SMFE 1TX7A 5KECA 1Z71A 2BB4A 1SQRA 2PHBA 4XBBA 1SBWA 4GVUA 4TY7A 1BRUP 1ESAA 1G3CA 1QL9A 5EW2H 4VGCC 1C1MA 3A84A 5FHTA 1HUTH 3CENA 1O2OA 1ZHMA 3RXGA 3GY2A 4ZKOU 1ELAA 3DCLA 5HYOA 1BRCE 3RXAA 1QY6A 1ORFA 3RXJA 3AVZA 4ABFA 3LU9B 3OAAD 1JMOH 1XUIA 4AFQA 1XVOA 2BDAA 3E0PB 5I25A 2WZQA 1VITF 1Y8TA 1IHSH 1F0RA 1LHGH 1CT2E 4R8TB 1P05A 4NA8A 4FOUC 3BIUH 1NFYA 2HRVA 4X8SH 1ZTKA 2J98A 5GCHG 4DCDA 4IN2A 1DY9A 3WY8A 1DS2E 2ZU3A 4YT7H 1Y3XA 1EJMA 2ZDAH 2FLRH 2I6SA 1O3OA 2KCAA 1CHOG 2AHME 3MNXA 3SU0A 6GCHG 3MNBA 1AFQB 1MAXA 5HIYA 3M3VA 5DP4A 2FOFA 5F53A 3A8BA 3SJ9A 1AE8H 2CJIA 4X6MA 4JYTA 3OYPA 1P3EA 2BD7A 3GOVB 4JZ1A 4DGJA 1O2HA 5ETXA 3F9HA 1O35A 2SGEE 3BEFB 2JETB 1C1QA 2Z9GA 2BDHA 1T8OA 3BIVH 3RXLA 4UE7H 2KFWA 1DUEA 1C5WB 3GY7A 4O3TA 1HBTH 1LHDH 1PQ7A 5LGOA 4OS7A 3NUMA 2BVRH 1KDQB 2TIOA 1L2EA 1RGQA 3EAJA 4H6SB 1F0UA 6LPRA 1G36A 3LH1A 2C3SA 1Y5BT 1W0KD 4OS6A 3PMJA 5GNDA 4XDEA 2QN5T 2FOBA 2H5CA 2P3UB 4XSKU 1LMWB 2XXLA 1GHVH 1K2I1 3LONA 4ZAEA 1BA8B 1O5EH 1SG8B 3FZDA 4CH8B 2AGGX 5IK2D 2CMYA 1NZQH 1YPLH 5K7RA 4MDSA 2ZU4A 2F3CE 1WXRA 1TWXB 1IQKA 3RLWH 3SO3A 1MTUA 1EZXC 3Q3XA 3F68H 1HIAA 3ATMA 2GZ9A 5LH8A 1AVXA 4ZMAH 1AN1E 1ELFA 1VZQH 4Q7ZA 5T6FA 4FVBA 5JB8S 1BMMH 1QA7A 1P9SA 1ZSLA 2AYWA 5GDSH 1C2HA 1DSTA 4CBOA 4A7IB 1TNKA 3KHVA 4U2WA 5A2MH 1C5OH 1A4WH 3UQOA 3F0PA 2A4OA 3PLPA 4D7FA 2GJGA 5ESBA 2XW9A 1A5HA 2SGQE 2BD9A 2G5VA 2HWLB 1EP5A 4E06H 2SGFE 4TY6A 1NFXA 5C67A 2FESH 4J1YA 2ILNA 4A5TS 4ABIA 1QR3E 3K6ZA 2UWLA 3VG8A 2VIVA 5AVDA 3M5LA 5A09A 1TPPA 1DUAA 3MNSA 5EQQA 1AMHA 1KXCA 1UVTH 1BB0B 5E8EH 1YLCA 1QJ6B 1ELVA 3SJOA 4SGBE 2B7DH 2PKAB 3BEUA 5FCKA 1C5RA 2OQUA 5B6LA 4B6FA 1DWDH 1V2PT 3LDXH 2BD3A 1G3EA 1B7XB 4J2YB 3PYHA 2Y81A 4CRDA 2ASUB 1SFQB 7GCHF 4GLYA 4I8GA 4XRNA 1VITG 4DG4A 1NPMA 5T3HA 1FLEE 7ESTE 4ESTE 1GWAA 2J95A 1EJAA 2SNVA 1AUJA 3QDZB 1XKBC 4WJG2 4WXVA 1O3FA 2NU2E 5E0JA 1QJ7B 1HAOH 3VB5A 1KDQA 1S0QA 5PTPA 1JBUH 1P06A 1C1RA 1LPKB 3BG8A 3TJNA 3F9EA 4JK6A 1J17T 2J9NA 1H8ED 2CF8H 1CBWB 1MZDA 1PPGE 4P02A 4MG3A 2XWAA 3MO9A 1TAWA 5HM2A 3RM2H 1UTKA 1D6WA 3SNCA 5I46H 2AGIX 3GY3A 1ZGVA 2Q6GA 1YPEH 2GD4B 1C5PA 2BOHB 3KL6A 3UOUA 2VIPA 3RU4T 3P6ZB 1OOKB 2JKHA 1S83A 2WUBA 1XUFA 2OD3B 1YP9A 2HNTE 3TLOA 1H9LB 3ZZ6A 1BTXA 5JBTA 2OUAA 4RKOB 4MLFB 1SR5C 1A0JA 4B2AA 5L2YH 1MD8A 2JH0D 3Q3KA 3HKJB 4IN1A 2A5KA 1TOCB 1O3KA 3BTGE 2BQWB 1SPJA 1FUJA 1GMCG 3I29A 2AS9A 1YF4A 1GJAB 2WYJA 4ZUHA 2K0QA 1WDIA 1Q3XA 2KCOA 3OFND 3SJ8A 2XBVA 3EDXB 3QGNB 2XBYA 1CT0E 3K9XB 3P92A 1KXBA 4NIYA 1EAIA 5EODA 1ELDE 3SU2A 3UQVA 3U8RH 3T2NA 3HK6B 4FETA 4A1XA 2JH6D 2QXJA 1ELCA 2FS8A 3TVJB 4NSYA 2FI5E 1C1UH 2BVSH 1BBRE 1OYQA 5DN6D 1EOJA 1P2IA 1OP2A 1UK2A 1OP0A 3PO1C 1ACBE 5GXPA 2BLOA 4FU7A 3A82A 3M5MA 1SQTA 1NS3A 1L4DA 4GHTA 4Q7YA 1RD3B 2PKAA 2P3TB 5FX5A 2G81E 1CGIE 1AFEH 1BMAA 3O8DA 4X6OA 1DDJA 1EATA 3QTOH 5FBEA 1E37B 1ZMNA 2H9EH 1HJAC 1NBME 3B9FH 1BTUA 3EA8A 1TONA 2G00A 2QE7D 3TGJE 1TIOA 4CRBA 2O8UA 1H8IH 2A32A 2BOKA 1MCVA 1C5ZB 1C5LH 2LNCA 2VWOA 1ZMJA 1OWIA 1GVKB 1O2GH 1PPBH 1AB9C 2FYRA 3VPKA 4DJZB 2WV4A 5H4IB 1GBTA 1CA0C 3OEED 1BJVA 1GMHG 1RXPA 1EB2A 2PSXA 2Q1JA 1KTSB 1C2JA 1QFKH 3ZVGA 2FM2A 4X1RU 2ZU2A 3PTBA 5FX6A 3QTVH 1LO6A 2ZTYA 1UK4A 1GHBF 1CQQA 3ZVBA 4CBNA 4YM9A 3SV6A 4UEHH 2FTMA 4NWLA 1UTQA 1IAUA 1IQHA 4WMDA 3P8GA 3LGYA 3P17H 4A1TA 3D65E 5HIZA 4H4FA 1BRBE 3TK6A 1KXEA 4GAWA 1HCGA 1AVWA 4QT8C 2BLWA 1HXFH 2PV9B 5C17A 4JZIA 5E0GA 3KNXA 3LKWA 3A7WA 1TLDA 1A5IA 1NFWA 4XFQA 4KTSA 2QXHA 2ZF0H 2WHXA 1RIWB 1G2LA 4AX9H 2G4UA 5AF9H 3OY5U 3QWCH 4MPUA 2YMSB 3E90B 2FZZA 2HVXA 2FX6A 2ZZUH 2TGTA 3UTUH 2NU0E 1ZTLA 1O2PA 4ZH8A 4K3JA 1LKAA 4INLA 1SI5H 3GISB 3W94A 8KME2 3LC5A 3SV2H 4Y7AA 5FL7D 2OXSA 4KP0A 1W8BH 4XOJA 3N7EA 2BD4A 2YMSD 1J15A 2FLBH 2YNAA 2GDEH 5A8YA 2Q6DA 3H5CB 5EG4A 1K1OA 2VJ1A 1ZPCA 1PQ8A 1G3DA 1A1RA 1GPZA 2FOMB 2Y5HA 3ZV8A 5C2ZA 1DXWA 4X2WA 3NXPA 1O2YA 2ANWA 4FUCA 4MNWA 2ALVA 2R0KA 3TU7H 1OYTH 1Q31A 3JZ1B 2BDBA 2C93B 1UVSH 2THFB 1OWDA 3I77A 2V3OH 1SLUB 3TJOA 2OC8A 3BTFE 1OKXA 1LTOA 3FO8D 2G55A 3VGCB 3SUFA 2O9QA 1QRXA 1MMJN 5JB9S 1W12U 4IC5A 2FEQH 1JIRA 2RDLA 3SJKA 3GICB 3Q3YA 2NU1E 3QZRA 1T7CA 2RA3A 2BX3A 3SN8A 6ESTA 2F83A 2ZHEH 3EA9A 5TCAA 3ZZ8A 1O3HA 2Y5GA 1YY3A 2AFQB 1BDAA 4FUEA 3HGPA 1F0TA 4E05H 1MKWH 1OHHD 1VCPA 4KELA 3UY9A 2UUYA 1HAIH 2PP6A 1LVYA 2GCHF 2VINA 1EKBB 1J9CH 1S6LA 2BY5X 2R3YA 2EY4C 3ODFA 3RXRA 3VXEH 1O2IA 2D1JA 3TK9A 1ZSJA 3ZZ4A 3UWJH 1ELBA 5E2OA 3NCLA 4UFFH 1AY6H 1O5DH 1TMTH 2FI4E 4CR5A 2AMDA 4D8NA 3OTPA 2Q6FA 1UTNA 3EE0B 2EI8A 2BVXH 2H9TH 3KQDA 2FX4A 2SGPE 1QB1A 3GY8A 4WVPE 4Y8XA 2AMQA 2Z3DA 3U1IB 1HFDA 2EEKA 3RC5A 3CS7A 1H8DH 3T27A 2KX4A 4MNYA 2GT8A 1AKSA 1THRH 2R0LA 1G9IE 1V2JT 1BTYA 1P2OA 1IQLA 2DUCA 1CO7E 4RT0A 1GDQA 3T26A 4AORA 1YCPK 1E35B 1F5RA 1FPHH 2F91A 4ACBA 3ZVFA 1GHBG 1XKAC 1IQIA 1B0FA 1UO6A 1GBHA 2Z9LA 4Y11E 5FXLA 3LGUA 1PFXC 4CRFA 1AGJA 5J4QA 2XC5A 2FYQA 1O34A 2IOTA 2C4FH 1V2WT 2FS9A 1C1TA 1NC6A 2GKVE 2XBWA 2Z7FE 3E8LA 2BDYA 3AW0A 1DICA 2SGAA 4IS5A 2OP9A 4DT7B 5DGJA 1QGFA 4YLQH 1FN6A 1YCPM 2PFEA 3PV5A 1D3PB 4ISOA 2YNBA 3GY5A 1Z8JB 4AB8A 1D3TB 1RTLA 4CH2B 3EGKH 3MU4A 2ODPA 2G51A 3E6PH 3F3BA 4F4OC 5EW1H 6CHAB 1CBWC 1Y59T 1F0SA 2OINA 1CT4E 3VFEA 2J34A 2ZTXA 5GJ4B 3RUOA 1AB9B 1E1QD 1RRKA 1SVPA 1XVMA 5EJZA 4CRAA 2HVYB 1B5GH 2ZTZA 5EXMA 4ASHA 1FIWA 3K6YA 4ZKRU 2TRMA 2ZKSA 1TNLA 1H9IE 3ESTA 3BTQE 1GDNA 1O33A 3WWFA 4NG9H 1IOEA 4CHAB 3BTTE 1GVZA 2A4GA 4NGAH 3OY6U 1LVBA 1O3JA 2VIQA 1YYY1 3ZV9A 1T32A 1VCQA 1HAVA 1FPCH 1O3AA 1QJ1B 1MTWA 4OGYA 4ABGA 4BTIB 5C3NA 2PSYA 1IQMA 4NZQA 1V2OT 3EQ0H 2ZO3H 3RXIA 2G8TA 1AWFH 5DP8A 1O39A 1BBRH 2Z6BD 4AG2A 2UUKB 3SQEE 5HGGA 4BAHB 5FAHA 1AWHB 2G4TA 2GT7A 5FBIA 3QN7A 4GCHF 3SHCH 4AOQA 2ZDLA 3RXHA 5C0UA 2QCYA 2H9HA 2BY7X 1L1NA 2R2WU 3MO3A 2OK5A 7KMEH 3BEIB 1YC0A 1NRQH 1LQDB 1FY1A 2ZIQH 1DLEA 1BTHH 3SI4H 2QIQA 1GHWH 1PQ5A 3BTME 5JPMH 2CK3D 2GCHG 3ZZ5A 1U6QA 3O8BA 8ESTE 1EFRD 1GI1A 1NRPH 2W3KA 2XCFA 4MPWA 1TFXA 1V2UT 2VH0A 1F5LA 4U01A 1ELEE 2ZNKH 4AFZA 4JYVH 4YT6H 4I86A 5L6NH 4K8BA 1Y5UT 1TNJA 3RXEA 2VB0A 2FODA 2O8WA 1HAYB 1QTFA 2BMGB 3HATH 3RXKA 3KQEA 4LK4A 5LPEA 1OP8A 3M37A 3SGQE 2PR3A 4ASUD 2P8OB 4ZROA 1BRAA 4ABDA 2TPIZ 3PM3A 2RG3A 1GBJA 2Y7ZA 2FPZA 3A8AA 1C5VA 1TYNA 2P16A 1QURH 5T6GA 5AFZH 2BYAX 1F2SE 2ZFSA 5A8ZA 3ATIA 4BAOB 2PUQH 4YLUA 2AIPA 3QUMP 2XOKD 2GV7A 3BV9B 1SKYE 3UFAA 1TABE 1B0EA 1GBDA 4BANB 2QF3A 2BDGA 1FONA 2GCTC 2Y80A 1GBFA 1GBIA 1MKXH 1N8OB 3AAUA 2Z9IA 2V35A 1C5MD 1O2JA 2F9BH 2P94A 3VB3A 2WPMS 3SZNA 1TNGA 1OXGA 5GIBA 1MAYA 2IN2A 4GSOA 4HI3A 1G37A 4FUGA 3SQHE 3PMBB 4F48B 2OC0A 3UR6A 3LC3A 1SSXA 2P3FH 5CMXH 4Y79A 5LPFA 5C5OA 1A46H 1ABIH 3BN9A 4NIXA 5DP5A 1EAUA 1GI6A 1MUEB 4Z1MD 1TALA 1QL8A 1TGTA 2Y82A 2XWBI 3IG6B 1W0JD 3AW1A 4ZHMU 1NRRH 1RIWC 4TPYA 2YMSC 1ZYOA 1HV7A 1JXPA 2ANKH 1C1WH 2XYAA 2Y5FA 8LPRA 1YWUA 2WPHS 3LPRA 1DM4B 2F9NA 2PGQB 3ZYEA 3A83A 1XXFA 3GCTF 3RC6A 2UUJB 1K21H 1XMNB 5CE1A 2QXGA 3ELAH 1ZRKA 2GGVB 1A5GH 1K1IA 5DP7A 3P8OA 3ZZ3A 1SC8U 1BTZA 2BZAA 3ZVEA 2O8LA 1Q2WA 3RXBA 1P2JA 4FUHA 1WUNH 4Y6DA 1PQAA 5FCRA 1P8VC 4Y10E 1A2CH 1BMFD 4F49A 1SLXB 2V3HH 1P01A 3PLKA 2GVFA 1TA2A 4BTUB 4K69A 3GYLB 2QXIA 3H7OA 2ZGHA 1GBKA 5C94A 3PMHB 1NESE 5C0TA 2B0FA 5FPSA 2VNTA 1G2MA 3O8RA 1FNIA 1QNJA 1V2ST 3D23A 1O2WA 1SQOA 3PWCA 4XBCA 1W10U 2WUCA 3VGCC 2ZHQH 1BMLA 3S7HB 4B76A 4ZKNU 8GCHF 4GCHG 1GJ9B 3EA7A 2WYGA 1V2LT 2B9LA 5T6DA 5IYTA 1IQGA 2BX4A 3SYJA 4F55A 1SOTA 2OCVB 2VWMA 1JOUB 4TT3D 1QBOA 2V6NA 1SGCA 4X2XA 1GBLA 4ZKSU 5EGMA 1C2LA 1W0ZU 4AZ2B 5EPYA 1EQ9A 5DP6A 1SGTA 2TGPZ 3A7YA 3PRDA 2ZHDA 3NPSA 1F5KU 4AN7A 4ABJA 4DY7B 2ZHFH 1QB6A 1AU8A 2FXRA 2VVUA 1NY22 2ZDVH 1GJ8B 3RXCA 1KXDA 3W1EA 3SUDA 3URDA 5DP9A 3ATWA 2PTCE 1C2EA 4THNH 2RCEA 2EI7A 2VVVA 3NWUA 1MZAA 1ZHRA 4O9VA 4Y71A 5DPAA 5DSFA 3ATKA 2EC9H 1A0LA 2GZ7A 1C1OA 3SU6A 4I8HA 3SOSA 3VB4A 5TJXA 4ISIH 1H8HD 4X2VA 1S84A 1C5XB 1W7XH 1HAXB 1HJ8A 2Z9KA 4OS1A 3S7KB 4X1SU 5G4BA 3DSPA 4ACAA 1MU8B 3V0XA 1YPJH 1BBRK 3ATLA 4Y7BA 4FUDA 5EQRA 2ZGBH 5HKKD 1O3BA 1HAGE 4M9FA 5A0CA 4UD9H 1T8LA 1E34B 3TJUA 4ZCNA 1EOLA 1O2UA 1O5AB 1QL7A 3CNRA 5ABWA 2W7UA 2O8MA 3QGJA 3RMNH 2GP9B 1EPTB 5C1YA 2SFAA 3OEHD 1O2LA 1PPFE 1GMDF 1C9PA 4M7GA 1HRTH 4NSVA
chains in the Genus database with same CATH topology
4ABEA 1K1NA 1O38A 1BMNH 3LT3A 4DVAU 5C1UA 1OWKA 3BTHE 6CHAC 3V12A 3QZQA 2ZCKP 2VGCB 4GUXA 4CR9A 1GI3A 1MU6B 1BHXF 4I32A 4FUIA 4IGDA 3FANA 2OTVA 4OS4A 3KCGH 1TPSA 3SNEA 2ALPA 4ABAA 3V7TA 2ZPSA 3KQCA 3LGIA 1OSSA 2ZECA 3CS0A 4IC6A 1K22H 3MHWU 3Q76A 4Q2KA 1QHRB 3IITA 2A7HA 4KTCA 1HYLA 2GCTB 1WQSA 1ZTJA 1P57B 3B8JA 2Z3CA 4CHAC 4KGAA 1BJUA 2P95A 3DA9B 4TPIZ 5JBAS 2A4QA 7GCHG 3N7OA 4GHQA 1VGCB 1YLDA 2FP7B 1O32A 1MKXK 1HDTH 3ZZBA 3VB7A 2F9OA 1GJ6A 2ANMH 3ZZ9A 2ZP0H 3NKKA 3O8CA 1AVGH 2C8XB 1NRSH 2GX4A 1ZZZA 2QYIA 3MYWA 1GHYH 1TX6A 4TWYA 3VEQB 1ELTA 2VIDA 1SQAA 1CSOE 2A4RA 3RXMA 1C4Y2 1FV9A 3A8CA 3BF6H 1SLWB 4NA7A 2FMJA 1TX8A 3FZZA 5C5NA 3M5OA 1Z8RA 5L30H 1ZMLA 3P95A 1FQ3A 1XUGA 2ZPRA 5JBBS 4AFSA 4HTCH 2CHAB 1XUHA 3EYDA 1DWBH 1HJ9A 1DPOA 3MH4A 2KAIB 1MD7A 1OS8A 1TBRH 3RXDA 1T8NA 3C27B 4I7YH 1DX5M 1NROH 1JRTA 1C1NA 1CA8B 3UUZA 1UCYE 1KLIH 1K28D 3STIA 4Q7XA 3RXFA 1W0YH 1O3CA 2GTBA 4UONA 1C5QA 1ARCA 1VCWA 1T8MA 1AE5A 1ESBA 3M7TA 3TGKE 4ISHH 3AASA 1P04A 4B73A 3H7TA 5E0HA 1GCTB 4K2YA 1GI5A 1ZRBA 2P8OC 1GBAA 4INHA 3RU4E 4X1PU 3MI4A 4YESB 3R3GB 4ZXYH 4AFUA 1TPOA 3ZZ7A 1SGEE 1YPHC 4LZ4B 4ZXXH 3KQBA 3A86A 5DKMA 3A89A 4X8VH 3TNTA 1YPMH 2VWLA 3HK3B 1W13U 3FP7E 4DIIH 1AUTC 4BNRA 3TH2H 2Y7XA 2BY9X 3T5FH 2XRCA 1T4UH 2Z94A 2CF9H 3ZVDA 4OS5A 1FXYA 3F9FA 1N8OC 5LPRA 1BCUH 3KGPA 3DFLA 3MH5A 1O5BB 3RXTA 5F8XA 1ABJH 4YOGA 1PPHE 1RJXB 1WOFA 1GL0E 3RMMH 1EXFA 4AYYB 1GHAF 1Z8GA 1IQFA 1X7AC 4IMZA 1GMDG 4LXBH 5EXLA 1GHZA 2LPRA 5SGAE 2TGDA 4WH8A 3ZZCA 3UR9A 3RDZA 5JYIA 1TBZH 1BOQA 1O3PB 5K0HA 2VWNA 1Y5AT 1LVOA 1FMGA 1GJ5H 1QQUA 4MQAA 4D7GA 3U98H 2BD2A 5DP3A 1IQEA 4AGKA 4BTTB 1O2TA 4X8UH 1P11E 1F92A 3SNDA 1WBGB 1GG6B 3U1JB 1V2NT 2A2XH 3RXSA 4YO9A 2A45B 2H6MA 1GL1A 3MU1A 2WINI 1P12E 1V2KT 1O3IA 2VU8E 3MU0A 3E0NB 2H2ZA 2ZU5A 2A0QB 1RTKA 5EPNA 1NU7B 1KYNA 1V2TT 3U69H 4E7RG 4R0IA 1G30B 3BTEE 3ITIA 2F9VA 4FUBA 1P10A 1P09A 1THSH 1WU1A 4D9QA 2Z9JA 1P2NA 3SV8A 2P93A 1N1LA 1S85A 1SGIB 2CXVA 2GMTB 5BRRE 3SU4A 3UNRA 1BITA 1QRZA 3E3TA 3FP8E 1GI9B 2EI6A 1TNIA 3A7ZA 2ZFRH 2O8TA 1WCZA 1YKTA 2PKSB 2ZA5A 2ZFTA 1QRWA 1EB1H 1RTFB 1GHXH 2TBSA 1WYKA 3KIDU 1WQVH 1C5NH 2A5IA 4WH6A 1HPGA 1C2GA 1OWHA 5AHGH 3LJJA 1IHTH 2VVCA 2NU3E 5A8XA 5GWZA 1GI4A 2XC4A 1PYTD 1ZJDA 3SNAA 1ZJKA 2ODQA 1S81A 3VB6A 1SL3A 1W11U 1AHTH 1O30A 4AG1A 3M7QA 2W7SA 4DURA 1EUFA 1MCTA 1O3GA 1S6FA 2FDAA 3M5NA 1A7SA 4BAQB 1EASA 1CGHA 3A87A 1LVMA 3MU5A 1TGCA 3SI3H 2CN0H 2EA3A 3D62A 3GY4A 1VR1H 1XUJA 2PW8H 2BTCE 4WF8A 1O2QA 3S9CA 3GCOA 5GPIB 1O2MA 1HIAB 2BLQA 3R0FA 3QLPH 2OC1A 2F9UA 1SFIA 2C8ZB 2XBXA 1EAXA 1T4VH 2FWWA 3RXPA 1O2ZA 1PJPA 1BUIA 3UREA 4SGAE 1IQJA 1S5SA 4JMYA 1O3EA 1FY3A 3RXQA 5CHAB 1NTPA 1GHAG 3M61U 1GJCB 3G01A 1ANCA 4I33A 4JZFH 1O3MA 4BOHA 1GI0A 1EPTC 2HOBA 5F03A 1HXEH 1UTLM 2BD8A 1E38B 3PTNA 3TK5A 1HGTH 3SU1A 4D9RA 1FY5A 4K5ZA 1C2IA 1GI2A 2ZFPH 4IMQA 4NFEA 4B2BA 2PUXB 3PWBA 2ZPQA 3QO6A 2FOHA 4MPVA 3ZVAA 1S82A 4U32A 1K1JA 1D4PB 1LPGB 4I31A 1DVAH 2VGCC 4GPGA 2BXTH 1NO9H 4JK5A 1A0HB 3A88A 3MH6A 4MNXA 2GV6A 3TIUA 1LDTT 1O5FH 1TGSZ 3BTDE 1DWCH 1C4V2 3KF2A 1ANDA 2R2MB 2STAE 1LHEH 1PPEE 2UUFB 1ZOMA 4I8KA 2YOLA 4JZEH 3B23B 2ZGCA 3SW2B 1QCPA 4MTBA 1TQ7B 1HLTH 1CGJE 5C1XA 1Y3UA 2VIWA 1BTWA 2ANYA 1GMCF 4Y0ZE 2HALA 4WXIA 3TITA 1GBEA 4ZHLU 2OC7A 1S6HA 1LCYA 4B1TA 3I78A 4IW4E 1NRNH 1TNHA 2ZHWH 4H42U 1GJ7B 3SJIA 4DW2U 1TGBA 1Y3WA 1V2RT 1FI8A 5J4SA 1VGCC 2ZFQH 1XXDA 4X6NA 3UOPA 1OWJA 1O2VA 3BG4B 9LPRA 2FIRH 4UFEH 1FY4A 3OX7U 1GGDB 3KN2A 1ETSH 2AGEX 1MKWK 4Y0YE 5DG6A 1A3EH 2J2UA 2BM2A 4FVDA 2QGRA 2VIOA 2Y6TA 5HXFA 3RMOH 1IQNA 1GJDB 3UPEA 1SGNE 4DIHH 4K1TA 3M3SA 1JIMA 1L1GA 2ZI2H 3D49H 3U9AH 3T29A 1RS0A 1Z6JH 1ESTA 2HPPH 1YPKH 1LHCH 1O3LA 2JH5D 3BSQA 2I6QA 1TOMH 2NWNA 3DFJA 9ESTA 2HNTF 3UNQA 4FUFA 1KSNA 1O5CB 3LGWA 1KY9A 4HGCA 2CHAC 2H5DA 3SV9A 1UCYH 1MTNB 4FU9A 3FAOA 4WWYA 4BAMB 1ETTH 3MU8A 1DITH 1MTVA 1FN8A 3PMAB 3UIRA 2QV1A 1RFNA 1SGFA 2XCNA 3STJA 3S9AA 1ANBA 1UJ1A 2AEIH 2TGAA 1C1VH 1KXFA 1GCTC 3PLBA 1D9IA 1CE5A 1Z1IA 1O3DA 4NZLA 4BXSA 3ZZAA 2Z3EA 3FVFB 1GMHF 2CV3A 5FPYA 2QY0B 3GDUA 3Q77A 1W3CA 1YPHE 3SBKA 1SHHB 1KXAA 3MO6A 1HAZB 1HAHH 1N6XA 2D26C 3TPIZ 4K60A 2ZC9H 4NCYA 1SGQE 4TWWA 4YOJA 1EX3A 1P0SH 1L1JA 1M9UA 1UHBB 1V2MT 2ZEBA 2ZDMA 4PROA 1O36A 4U30A 1SB1H 1LKBA 1DWEH 2BDCA 4BXWA 4Y8YA 1TQ0B 2FTLE 3M7UA 1JWTA 3TH4H 2WPIS 3GDSA 3GYMA 1SLVB 3KEEA 3LH3A 3SGBE 1GBMA 1SGFG 4ISLA 3UWIA 3F9GA 3SU3A 4AGJA 1WV7H 1Y3YA 1OPHB 2OLGA 2ZG0H 3RP2A 1VJ9U 5E2PA 2PGBB 1P2QA 1UVOA 2SGDE 3T62A 4FXGH 1QQ4A 4K8YA 2A2QH 3SGAE 4CRCA 2M5TA 1GCDA 1UTJA 3QK1A 2VH6A 1BIOA 2ZCHP 1ZHPA 1Z7KA 1ZPBA 2IJOB 3FFGA 2QA9E 1KLTA 4HFPB 2W5EA 2GZ8A 1MQ6A 3A7XA 2BQ7B 3T25A 3GCHC 1GDUA 1KLJH 1MQ5A 4XBDA 1O2RA 5HMAA 2W26A 1SGYE 4NA9H 4Z6AH 4ABBA 1L0ZA 2J94A 2BHGA 1GG6C 2DE9A 4VGCB 1O0DH 1VJAU 3A80A 3U8OH 1NU9A 1W2KH 2HGTH 1O2XA 3PV4A 4RKJB 1DXPA 1MH0A 1C2DA 1V2QT 4I8LA 5BPEA 5DJ7A 4X1QU 3HKIB 1PPCE 1EP6A 4WMEA 2ZWLH 1C1SA 1WAYB 2C8WB 1FAXA 2BDIA 4O3UA 1YCPH 3MWIU 2QF0A 1K1MA 3L3TA 4UFGH 4RSPA 2D8WA 2W3IA 5EU8A 3RMLH 1ZR0A 2OBOA 1LHFH 1ID5H 1EAWA 5JBCS 1O31A 1O2KA 1C2FA 3QX5H 4X2YA 3F6UH 1GVLA 3OTJE 2DE8A 2GMTC 3SV7A 1C2MA 2ZU1A 4YTAA 4X8TH 1P2KA 4INKA 1UTOA 1G3BA 3ZVCA 3MFJA 2R3UA 3K65B 2C90B 2H1UA 2PKSC 2ULLA 1OWEA 4MVNA 4CREA 1MTSA 2K1QA 1DT2A 1PYTC 4Q80A 1Z6EA 4I8JA 1FJSA 3RXVA 1ZGIA 1UHBA 2SNWA 5C20A 2RA0A 1TMBH 4Y8ZA 1D3QB 1AZZA 1N6YA 1DFPA 1O2NA 2J38A 2HPQH 4ISNA 3P70B 4NFFA 3GCTG 1DANH 3TNSA 2AH4X 3A8DA 1L4ZA 1Z8IB 1UTMA 3LGVA 2PWXA 1BHXB 2J4IA 2ZQ2A 1PPZA 3HPTB 4H6TA 1F7ZA 1XX9A 1TRMA 1FIZA 3V3MA 1UVPA 1CVWH 1TMUH 3A81A 4UDWH 3A7VA 1Z1JA 1FY8E 3PB1E 2AMPA 2QC2A 1AZ8A 2A7JA 5JDUB 1H4WA 3S0NA 5F8ZA 1UTPA 3L33A 4ZHAA 3LIWA 1A61H 2STBE 1C5TA 3T28A 1DLKB 3M36A 2CGAA 5IDKA 1INCA 2A1DB 3L6PA 1O37A 1P02A 1AD8H 4A6LA 3P8FA 2PLXA 3AAVA 1ZLRA 4O03A 3DUXH 5A0BA 2UWPA 2ZQ1A 1BZXE 4NWKA 1AIXH 1P03A 4ABHA 5AFYH 3OSYA 8GCHG 2D2DA 1GI7B 1TPAE 3RU4D 4WMFA 1V6DA 2ZFFH 4O97A 1DSUA 2BLVA 1WTGH 4E7NA 2ZDKA 2A7CA 2ODYB 1W14U 4B75A 1W7GH 2WPKS 1E36B 1DY8A 1KTTB 4YZUA 4LOYH 1MBMA 2FO9A 1ZSKA 4D76A 5CHAC 3SNBA 5EQSA 4NIVA 3ODDA 2AIQA 3RC4A 1Y3VA 1LQEA 1GI8B 1TGNA 2V0BA 3BTWE 5F8TA 1AKSB 3RXUA 5EOKA 4HZHA 5EXNA 3LJOA 2AERH 1UCYK 3A7TA 2HLCA 1AI8H 3F1SB 1GJBB 1DE7H 3M35A 1EPTA 4NIWA 3UNSA 1AFQC 3NZIA 3DHKH 2WPJS 3MH7A 1GBBA 1OX1A 3ZYDA 1XUKA 2FOGA 3ENSB 3GDVA 1ZPZA 2G5NA 1SHYA 1UMAH 3V13A 1BT7A 1XM1A 1QB9A 1TRNA 1NFUA 4FUJA 1CU1A 2OBQA 1D6RA 1QIXB 1C2KA 2A5AA 3CP7A 4CRGA 1QA0A 3GCNA 2JETC 2B5TB 2B8OH 3E16B 3MOCA 3C1KA 4KTUA 3MNCA 4A92A 1J8AA 1DOJA 1YM0A 1SGDE 7LPRA 1NT1A 1EZQA 3MTYA 2OQ5A 1JRSA 3IWMA 1E0FD 3BTKE 3LOXA 1D3DB 1VITH 4TYDA 5FPTA 2BD5A 3OU0A 1S0RA 3Q00A 1YGCH 3BG4C 1TE0A 3SUEA 1C5YB 1YPGH 4B71A 3S69A 2QAAA 5ESTE 1GGDC 3RM0H 4BAKB 3DT0H 5GCHF 1ARBA 1FAKH 1BQYA 3ZZDA 2FOCA 1QBVH 2C8YB 4OS2A 4XE4A 1UK3A 3GCHB 1HAPH 3TJVA 1CHGA 2P59A 1CHOF 4WY3A 4MNVA 6GCHF 2UWOA 1QBNA 1HB0B 1AQ7A 4JYUH 1EZUC 1GBCA 1EJNA 4OGXA 2XNIA 4RN6A 1ANEA 2HNTC 2J92A 1V2VT 1A3BH 2XTTB 3U8TH 1MTNC 3A85A 1H1BA 2FOEA 5TCCA 3PROA 4K1SA 1O2SA 3NK8A 3SUGA 1HAVB 3SORA 1THPB 4B2CA 1V3XA 4MPXA 1FZZA 3MMGA 2R9PA 4X1NU 3E1XB 1BTPA 3K2UA 3HGNA 1YBWA 2BQ6B 3E91A 2FOAA 2ZDNA 1TBQH 2XC0A 2WV5A 1O3NA 2KAIA 2BZ6H 4FU8A 4Z0KA 4JZDH 4K1EA 1WSSH 2NU4E 1H9HE 5F6MA 4X6PA 1LPZB 5L2ZH 1NN6A 3JZ2B 3RXOA 2BXUH 2A31A 3W95A 4YOIA 4AB9A 1WTHD 5DK1A 1UVUH 2G52A 1K1PA 1MBQA 3SU5A 3S9BA 4JCNA 4DOQA 3FP6E 2ZGJA 1G32B 1HNEE 3PO1B 1K1LA 4IBLH 5HM9A 1KIGH 3GY6A 4UFDH 1T31A 1AO5A 5DO4H 2BY8X 2IPHA 3M3TA 2WPLS 1EZSC 3URCA 1TB6H 1O5GH 1J16A 3SHAH 1J14A 2ZGXH 3VXFH 5B6OA 4LZ1H 1K9OE 2BY6X 1C5UA 2PTNA 1P9UA 2ESTE 4KKDA 3RLYH 3TGIE 2F9PA 1TRYA 2ZCLP 1HJAB 3DD2H 1C4U2 1ETRH 1TA6A 4X0WU 4B74A 1P2MA 2GDDA 1C1PA 1ELGA 1SGRE 1C9TA 1NM6A 3LGTA 1SOZA 5A0AE 4A1VA 3P8NA 1P3CA 4Y76A 1C5SA 1GJ4H 1SGPE 1FDPA 2FI3E 3TH3H 4AYVB 1CA0B 1SMFE 1TX7A 1Z71A 2BB4A 2PHBA 4XBBA 1SBWA