4NFFA

Human kallikrein-related peptidase 2 in complex with ppack
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
237
structure length
229
Chain Sequence
b'IVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kallikrein-2
publication title Structure-function analyses of human kallikrein-related peptidase 2 establish the 99-loop as master regulator of activity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 229
sequence length 237
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nffA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nffA01
3H7OA 2P59A 1BRCE 1E34B 2UWOA 3KQEA 1V3XA 1O2JA 3T25A 3NKKA 3MNSA 5C2ZA 2HNTE 1UCYE 4MQAA 1F5RA 2SGAA 1LKAA 3RLWH 2A7CA 1C5WB 3ATLA 1ARCA 2WUCA 2Z9GA 1QHRB 4YOJA 3ATIA 1O2SA 4MPWA 1AQ7A 6GCHG 2FZZA 3BTME 2AERH 3UWJH 1C5VA 5J4QA 3AW0A 1HRTH 1ZMLA 1EJAA 2C8YB 1QQUA 4ZKRU 1GJ5H 3BIUH 1NS3A 1HAXB 4CRAA 3GCHB 3GY8A 4ABEA 2H9TH 1QTFA 1SSXA 1C2LA 1P06A 2GMTB 1HCGA 5L6NH 3E91A 3RXTA 2PFEA 1CVWH 1N1LA 1TYNA 2ANKH 3TK9A 2VNTA 3TNSA 2PSYA 2ZQ1A 4B71A 1F7ZA 5DP4A 1SFQB 2FYRA 1AI8H 1WU1A 1EZQA 1ARBA 2ZWLH 2GD4B 1AUTC 4KTUA 1HAGE 1GI8B 2QXHA 4ISNA 1GGDB 2BM2A 3D62A 2W7UA 1TRYA 1GMCF 4BAOB 1GHAF 3BSQA 4WMEA 1OWHA 5FX6A 5GPIB 3E0NB 3QDZB 1LTOA 3SJ8A 1G30B 2A32A 1C4Y2 1AFQC 3GCTG 4H6TA 1MZAA 3UY9A 1EASA 4OS7A 2ZPSA 4VGCB 2Z7FE 5CHAC 8KME2 3B23B 1BRAA 5K7RA 2HVXA 2O8LA 1EXFA 1UTJA 5B6OA 5JYIA 3P70B 3DFLA 2ODYB 1UO6A 1V2WT 2FOAA 4NCYA 2W26A 3A7TA 5GDSH 1HUTH 1O3DA 1JRTA 3ODDA 1EKBB 1AVWA 2FWWA 2SGQE 2RG3A 2AMDA 3SU0A 2Z9IA 1LKBA 3URDA 2ULLA 1HBTH 2BTCE 4BOHA 1TBQH 1O5AB 3SJKA 4ESTE 3ZV9A 2OD3B 4TYDA 2P8OB 1V2RT 1UCYK 2AEIH 1IHSH 4YLUA 4MPXA 1ELEE 2VIVA 3RXPA 4Y0YE 3BV9B 1XXFA 2NU4E 1V2TT 1GL0E 1AVGH 4OS1A 3CENA 1PPZA 2PR3A 2ANMH 2H6MA 3JZ2B 2Y6TA 1P3EA 2F9BH 1ZJDA 3QGNB 2ALPA 1BUIA 1UVPA 2GDDA 1MCVA 2G8TA 4ZKOU 1C5NH 3U8RH 2QCYA 1BJUA 3QO6A 4I31A 4X8TH 1LVYA 3UQOA 5F8ZA 1AB9C 1QRXA 1Z7KA 5C1YA 4JYUH 1HV7A 1XUGA 1EP5A 3M5LA 3TH2H 1FJSA 1ZJKA 2DE9A 1Y5AT 4PROA 1T32A 1YBWA 1DWEH 2OC8A 1GVLA 1DOJA 1GHVH 1UTMA 3BTFE 1TNLA 1O5GH 2J9NA 4FXGH 3EA9A 2V3HH 4I8KA 1C1VH 1J9CH 1SLWB 2ZG0H 1ELBA 1AKSB 1W7GH 1EATA 1MCTA 3ZVAA 1GJDB 5DO4H 4O3UA 1QRWA 1XKBC 4Y76A 3PWCA 1PQAA 2HNTF 5DGJA 1V6DA 1VITG 5FAHA 1DLKB 3BN9A 2ZHDA 3H7TA 2O8UA 3AW1A 1AZZA 5T3HA 4OGXA 2PW8H 1SQAA 1C5RA 1OP8A 3T27A 4A1TA 4Y6DA 1DWBH 2CV3A 7KMEH 2BDBA 1W2KH 4OS4A 3EAJA 2FP7B 2RCEA 4XBCA 3VB7A 4WF8A 2VB0A 1K22H 2G51A 1C4V2 3GDSA 3FP7E 2BOKA 1DDJA 4AORA 1HLTH 1QA0A 1ETTH 1E38B 1SGFG 1O38A 1SPJA 3PLBA 1KXDA 1ELGA 1L2EA 1EZUC 1ZPZA 2PV9B 1V2KT 4X1PU 1HJAB 2XBWA 1SFIA 2Z9LA 1IQNA 1FY3A 1DY8A 3I29A 1HYLA 3VXEH 5EW2H 1AN1E 4K5ZA 3SZNA 2V35A 2VU8E 1MTNB 2SGFE 2Y5HA 3S0NA 2IN2A 3ESTA 1MTSA 1Z1IA 2GP9B 3MO9A 5FPTA 3U98H 1P2MA 1O3KA 3GCHC 3N7OA 3DFJA 2KAIA 1YPKH 2W3KA 3Q3YA 1AFEH 2GMTC 2PUXB 2CHAB 3AAUA 5FPSA 1RFNA 1UK2A 2OQ5A 3LC5A 2VGCB 2OINA 3BF6H 5EPNA 1ZHRA 3STJA 3UNQA 3QK1A 3P17H 1C5PA 2BQ7B 2ZHFH 4B1TA 5C1UA 2VH0A 2ZGCA 4AZ2B 2AYWA 4NIWA 3SU2A 3K6ZA 1Y3XA 1YPGH 1C5MD 5JBAS 1W7XH 1G32B 3MTYA 2FS9A 4AGKA 1V2NT 3GY4A 2G4TA 2HLCA 1TPOA 1GI7B 1ZLRA 4UDWH 1O2RA 3R0FA 1GGDC 5IYTA 3TLOA 1TBZH 2PTNA 2ZIQH 4IC6A 1AKSA 1Q31A 4O97A 3VPKA 3KL6A 3ELAH 3GYLB 4ISIH 3ZV8A 3R3GB 1RS0A 5EXNA 3ZZ6A 4VGCC 4A1XA 1BB0B 5F8XA 1P8VC 2O8TA 2ZCKP 3TGJE 3RXAA 4A5TS 3TU7H 2GX4A 1C5LH 3ZYEA 2YOLA 5AFZH 3GCOA 4AYVB 5EGMA 3RXKA 1IQEA 3OSYA 1KXAA 1SGCA 3RMOH 2WPIS 1UTKA 2P16A 4ABJA 2FOGA 2XC5A 5DP7A 1EB1H 2G4UA 2GT7A 1JXPA 1P03A 2XC0A 1P12E 4HZHA 3PMBB 4IGDA 3MH7A 4QT8C 2R0KA 1KLJH 4ISOA 1TGNA 4IN1A 1S0QA 5LPFA 1O39A 1FPCH 1UTNA 1C1SA 2JH0D 2O8WA 3SORA 2PKSB 3QTVH 4DW2U 4WMFA 4X1NU 1O33A 1SLXB 2GV6A 5JBTA 1CBWB 1VCQA 4YOIA 2CMYA 1SMFE 1OP2A 8GCHG 2FOHA 2F91A 1H1BA 2TIOA 1NFXA 1L4DA 1O2UA 2QIQA 5I46H 1C5QA 1ELTA 1SGQE 1GCTB 3LIWA 4Q7YA 3SGQE 4ABAA 3Q76A 1BHXF 1GJAB 4FU9A 3UQVA 3SNCA 5DP6A 1HB0B 1TNIA 5C5NA 2PKAB 3SU6A 4Q7ZA 1AGJA 1ZTJA 2BXTH 2Z9KA 1S82A 1A0LA 3KEEA 1EAUA 2V0BA 4IC5A 4NG9H 2Z3CA 1H8IH 2D8WA 5F6MA 1ZTKA 2OBOA 1ETRH 4JK6A 1KDQB 1L1NA 2A31A 1GMDF 1XVMA 5GCHG 1LVBA 3K2UA 1AU8A 1TGCA 1FV9A 3VGCB 3RP2A 4Q2KA 4HTCH 1CHOG 1T8MA 3SV2H 1UMAH 1H9IE 4TPYA 1DT2A 3SNEA 3UOPA 4WMDA 5PTPA 2JETB 4X6OA 3MU0A 2THFB 5BPEA 1GBMA 2M5TA 1CT4E 1P2NA 4IBLH 1GMHG 2Z9JA 1EJNA 1PPFE 1K21H 1TOCB 1YKTA 1O35A 1AO5A 3PWBA 1FY1A 3SJIA 5HGGA 5CE1A 3M5OA 2FPZA 2ZCLP 4DJZB 1SGEE 4H4FA 2BZAA 2BQ6B 2ODQA 4AFSA 1GJ9B 4K2YA 2ZGBH 4WXIA 2IPHA 3ZZCA 1O3OA 3P8OA 4NGAH 3V0XA 1GBCA 3QUMP 3S9CA 2ZDAH 1HJAC 1FXYA 3OX7U 1C4U2 2BMGB 3E3TA 3LGIA 5EXLA 2O8MA 1OWJA 3SU3A 1MTNC 1V2QT 3MU4A 1NU9A 1NM6A 2A2XH 4BXWA 3O8BA 3U1IB 1C5OH 3GICB 1OS8A 2QXGA 3MMGA 1F0RA 5GXPA 1F5LA 4MNYA 1UVUH 4FUFA 1E36B 1CU1A 1VCWA 3LJJA 1LHCH 2OLGA 1EOLA 1V2OT 1F5KU 2OCVB 1KTSB 2CHAC 4YZUA 3RXUA 2WPLS 2QXJA 4NZLA 2VGCC 1BZXE 5TCAA 5C1XA 4J1YA 4WXVA 3PMJA 1ZGVA 4AFZA 1EUFA 1T8OA 3RXOA 2FYQA 1E0FD 2FLBH 2BY5X 1K1NA 4AFQA 1KDQA 3QTOH 1KTTB 1GMCG 1SLUB 2TBSA 4HFPB 1Y59T 1EB2A 4K69A 1V2PT 4D7FA 3DA9B 3RXIA 1KY9A 3M61U 1GCDA 1FLEE 1XVOA 3RXGA 4ZMAH 3LT3A 5JDUB 2AGIX 3SGBE 1MU6B 4ISLA 1MD7A 5HM9A 1GI5A 3E1XB 4UE7H 2EC9H 1TABE 2F9UA 2ZHEH 1GHBF 1A3BH 2C90B 4GHQA 2BD7A 5T6GA 3VEQB 2BLVA 3HATH 2BVSH 4BANB 1VGCB 2BB4A 1AE8H 1O3MA 1EPTC 1FONA 3JZ1B 4JYVH 1EX3A 1ANEA 5LGOA 2ZI2H 7GCHG 1MUEB 2A4RA 3OY6U 2A5IA 3W95A 5L30H 3ZZ3A 3TNTA 3A83A 1DUAA 5E0JA 3A85A 3RM0H 2BD9A 2WV4A 1GHWH 1RIWC 2PKSC 4B2AA 4K3JA 1H9LB 2Y5GA 1CBWC 3UTUH 1P9SA 4GPGA 2BY8X 5ESTE 3PMAB 4JYTA 2TRMA 1F0UA 3SQHE 4Q7XA 1OP0A 2AMQA 5E0HA 3VB5A 1KXCA 1GCTC 2BXUH 2XYAA 3ZZ4A 1AHTH 3KNXA 3I77A 2BDGA 1A7SA 1HAPH 7LPRA 2PHBA 2UWLA 5TJXA 1UHBB 4NWLA 1EZXC 2FOCA 3P8NA 4GAWA 1O5DH 1TNHA 1ELAA 3T5FH 4ASHA 1QJ1B 1BTWA 1G3DA 4JZDH 1D6WA 2ZFPH 3BIVH 1C2FA 1ZMJA 3P6ZB 1OWKA 2FTMA 3FANA 1K28D 4FUGA 1BBRK 3RLYH 3VGCC 1A3EH 1HPGA 1WQVH 1Z71A 1FY8E 3PLKA 4NIXA 1ZZZA 3BEIB 2BD5A 1DVAH 2ZFTA 4MVNA 3A84A 1Y3YA 2VIDA 4YESB 2JETC 2Q1JA 1THPB 4XDEA 1ELFA 4KTSA 2F9NA 2OBQA 4Y8XA 2XBYA 2ZO3H 3RU4D 4Y71A 1D9IA 1TB6H 3LH1A 2HPQH 3A8CA 1ELDE 4X1SU 2Y82A 1MKWH 1C1QA 1S6FA 1MKXH 2BX3A 1VJ9U 2ZFRH 4DCDA 2ALVA 1LHEH 4U01A 5A0BA 1LHFH 1RD3B 2CGAA 2HOBA 3LKWA 3U8OH 1MAYA 4MNWA 3RU4T 2VH6A 1A2CH 3RXFA 1CO7E 1BTHH 3BTTE 3TIUA 1ZRKA 3SNBA 2BD2A 1O3JA 1QA7A 3DHKH 4XFQA 3VB4A 2D1JA 4UFDH 5E2OA 1N8OB 3W94A 1KXEA 2JKHA 1Y3UA 1O2XA 3E0PB 1C1TA 1MD8A 1DICA 1HAYB 2W5EA 3SUDA 4UFEH 4FVDA 2STBE 3A82A 2R9PA 3P92A 4Y11E 3RC6A 1DITH 1G3CA 2G81E 2RA0A 2K1QA 1CE5A 2VWOA 1ZSJA 1RTFB 3A86A 3M3SA 2JH6D 1AVXA 1TOMH 3SHAH 1MMJN 1O30A 3FFGA 1SGRE 1BTYA 4CRGA 1AD8H 2P3FH 3G01A 3ZVEA 1FY4A 3ZZ8A 2PUQH 2ZFFH 1C2IA 1Z6EA 2Z94A 1EOJA 5AF9H 1LPKB 1JBUH 2EEKA 2BHGA 1UHBA 1AWHB 3MI4A 1C5YB 5A8ZA 1V2JT 2ZGHA 4E06H 3IG6B 4TY7A 2QF0A 1PPHE 1UTQA 3O8RA 1TGSZ 2OP9A 2EA3A 4UD9H 1UJ1A 3AVZA 2D2DA 2H5CA 2J94A 1TNJA 5IDKA 1SGFA 2F3CE 1QL7A 2BDIA 3NZIA 3ZZBA 1LQEA 2UWPA 3NUMA 9LPRA 2GVFA 4I33A 2A45B 2VINA 3V7TA 3SU1A 5LH8A 4HGCA 2VVUA 3Q00A 3RU4E 1W0ZU 2KAIB 3ENSB 4MPVA 5FXLA 1VGCC 3RMNH 2QF3A 1BMMH 3IITA 5C5OA 2ZKSA 1ID5H 3OTJE 2FI5E 1QCPA 1YCPH 3F1SB 1W13U 4UFFH 1SOZA 3SNDA 4X2YA 2HALA 3EDXB 3SBKA 5E0GA 5A8YA 1CT0E 9ESTA 1O34A 4DOQA 3RXQA 1ESBA 1O5BB 4GCHG 2GTBA 1YLCA 1FDPA 4NSYA 1BIOA 2BYAX 1MZDA 1G9IE 2GCTB 1S84A 1KLIH 2FIRH 1NRNH 1C2MA 3F68H 4R0IA 1G2LA 4ABBA 1J16A 2ZTYA 1O2TA 1YGCH 2XW9A 1Q3XA 3RXJA 1QB9A 5F8TA 3MNXA 4WY3A 4FUCA 2GV7A 2I6SA 5LPEA 1PPGE 1GI6A 3TVJB 1GVZA 1E35B 2ZF0H 4B76A 3Q3XA 1C9PA 1GHZA 2RA3A 4Y8YA 1ZRBA 1TRNA 1W8BH 1JOUB 1JMOH 3S7KB 1DS2E 1AWFH 1QY6A 2GCHF 2YNAA 2ZU2A 4M7GA 2CF9H 2AIPA 1EAXA 6ESTA 1ZPBA 4ZKNU 2A1DB 1WSSH 3SV6A 1ZMNA 1AMHA 2Y5FA 1GJBB 4OS6A 1BMAA 3M37A 1W12U 3KCGH 1CA8B 4ZHAA 2V3OH 1A1RA 1O3IA 2PWXA 1O3AA 2FODA 2ZPRA 2H5DA 4YT6H 4U2WA 6GCHF 2GT8A 3QX5H 1O3GA 3UREA 3PTBA 1GI4A 3E90B 2BD3A 1J17T 1T7CA 4Y79A 1SHYA 2ESTE 3GDUA 2VIOA 3M5MA 1NO9H 1GDNA 1C5UA 1D6RA 1EAWA 4MDSA 3UR9A 1O5EH 4RKJB 2SNVA 1JRSA 1ELCA 2ZTXA 2O9QA 3BTGE 3RC5A 1YCPM 1YPLH 1BMLA 1XUIA 2UUJB 2VIQA 1Y3VA 4SGAE 4Q80A 1HJ9A 4D9RA 2FESH 1AUJA 2CF8H 1G2MA 1CA0B 3LPRA 2Z6BD 2AH4X 3UPEA 1ZPCA 1H9HE 1GBBA 2F9OA 2Z3EA 1QRZA 4BNRA 1A46H 1CGJE 1P2QA 1N8OC 3MO3A 3A89A 3GCNA 3SNAA 2GDEH 2AGEX 1SB1H 4B74A 5DKMA 1TPAE 3SO3A 3SU5A 1S85A 3EE0B 1GHXH 3TGIE 1RTLA 1NY22 3GCTF 2P3UB 4ZHMU 2WPMS 3IWMA 5T6FA 3BG8A 1XUFA 2XWBI 1WTHD 1HAHH 4A1VA 3MFJA 1O31A 4DIHH 1DLEA 3MH5A 1O3PB 2HWLB 2ZDVH 2SNWA 3KHVA 3S9BA 3ZVFA 4AYYB 1AE5A 1FIZA 1P0SH 2ZEBA 4ISHH 2ZGXH 1J15A 1NN6A 4AB8A 1GJ6A 2VWLA 2ODPA 3A8BA 1L4ZA 1C2DA 1GI0A 5DJ7A 1AY6H 2IJOB 4XE4A 4ZKSU 2P8OC 1GBFA 1NU7B 2W3IA 3EA8A 4UEHH 2BY7X 3PM3A 2D26C 1UTOA 1UTPA 3FP6E 4TWYA 4IMZA 3ZZ5A 2VJ1A 1P05A 4DY7B 2SGDE 4CRCA 2A4QA 1DM4B 1MU8B 2OTVA 3RDZA 1O2ZA 1UTLM 1TA2A 1QBNA 2A5KA 2Y80A 3MO6A 6LPRA 1FN6A 3D23A 3F9HA 4CR5A 1O3LA 4K1TA 4X8UH 1BTXA 5DK1A 1TPSA 5AFYH 1NRRH 1GBDA 3LGTA 1BA8B 1RGQA 2ZDNA 4B75A 1H8DH 3BEFB 3FZZA 1H4WA 3T62A 2FO9A 1BRBE 1ESAA 1C2KA 3VB6A 1C9TA 2QC2A 5EOKA 1Z8RA 3L3TA 1TX8A 3SJ9A 1ESTA 2NU3E 5SGAE 3SI3H 1GBAA 2ZQ2A 3T2NA 4LXBH 5EW1H 4X6NA 4RKOB 3UWIA 2ZP0H 2J92A 3F9EA 2A4GA 1AZ8A 1GG6B 2ZTZA 1GBJA 2ZU3A 1TGTA 1DE7H 1G3BA 1NESE 5FBEA 2FXRA 4X2XA 4CR9A 3RXBA 1VZQH 1TMTH 4GVUA 1SGYE 1NRSH 1O3FA 1MKWK 2BQWB 1GI2A 5JBBS 2W7SA 5C67A 1P02A 5L2YH 3QZQA 1MKXK 3GY3A 3M3TA 5FCKA 4O9VA 5J4SA 1E37B 3LJOA 4XBDA 4Y0ZE 3TJVA 1JIRA 1GJ4H 1YPJH 2LPRA 1EZSC 1YPMH 1MQ6A 1SQTA 2ZGJA 3SV8A 2C8XB 5E8EH 3RXSA 1WAYB 4E7NA 5FBIA 3LGYA 3S9AA 1ZGIA 1NRPH 1K1PA 2H1UA 2HPPH 4RN6A 1GI3A 2Q6GA 2ZU4A 1MBQA 4E05H 3RMLH 4IS5A 4D7GA 4Z6AH 1OYQA 1O2QA 1S83A 1ANDA 1D3DB 2QV1A 1DXWA 1N6XA 3KIDU 3ZYDA 3GY6A 2C3SA 1GBEA 4FUHA 4IN2A 2TPIZ 3BTDE 1QNJA 4YLQH 1Z8IB 5E2PA 1YYY1 4ZXYH 1GWAA 1CA0C 3PROA 2ZFSA 1V2ST 1HAZB 3M36A 1G37A 1XUHA 3B8JA 1LCYA 1NT1A 1P9UA 4O03A 4CH8B 3TK6A 4IMQA 4Y10E 1O2NA 1UVTH 1MTUA 4FUBA 4ZAEA 1O36A 1O2HA 5GWZA 8LPRA 1GHAG 1ANBA 2G5NA 1HIAA 2AFQB 1Z8GA 5EU8A 5TCCA 5CMXH 1T31A 1Z1JA 1OYTH 1OXGA 4K1SA 1GBTA 4F4OC 1DPOA 4CRDA 1GJ7B 4XBBA 1O3BA 1K9OE 1IHTH 1O2OA 1O3EA 3OY5U 1DWCH 2Z3DA 3E6PH 1C2HA 5L2ZH 4X2VA 2ASUB 1A61H 4JZIA 1YCPK 3PB1E 1QR3E 1VITH 3A7XA 1TX6A 1QBOA 2VWNA 1XM1A 2QXIA 4INHA 3SN8A 5BRRE 4NFEA 2C4FH 2BD8A 3S7HB 4A7IB 4FU8A 3T29A 3B9FH 1TBRH 3SV7A 2UUYA 1PYTD 4X6PA 8GCHF 3DUXH 2AIQA 3BTKE 3DD2H 3STIA 2BDHA 1KIGH 4K8YA 1P2KA 4KGAA 3A88A 5ESBA 3SGAE 5DG6A 4BXSA 4B2CA 3NWUA 3C27B 1NFWA 2VVVA 3LOXA 3S69A 3LONA 1V2UT 3ZVGA 3D49H 1O2YA 5DPAA 1TNGA 1SGPE 5HM2A 4WH6A 5GJ4B 1G36A 4JCNA 1PQ8A 1QFKH 2P94A 3TJNA 5GCHF 4AG2A 1FAKH 2FI3E 3OYPA 3E16B 1GI9B 3RXVA 4CH2B 4U30A 2GZ7A 2ANYA 4UFGH 1O37A 1Z8JB 2BVXH 2Y7ZA 2BZ6H 2ZC9H 4X8VH 2BD4A 1SG8B 4DG4A 1P09A 1YPHC 5EG4A 3LH3A 3SI4H 2QN5T 4ABFA 1GMHF 1PPBH 1WUNH 3HK3B 1GG6C 2TGTA 4I8GA 1XUJA 1C1MA 1TGBA 2VWMA 1A4WH 2R0LA 2GCHG 3FAOA 2Q6DA 1C1RA 2I6QA 3QGJA 1DANH 3RXEA 1GJ8B 3HKJB 1YPHE 2XC4A 2ZFQH 1UK4A 4ZROA 2WYGA 2WYJA 1FNIA 1O2MA 1GHYH 2QA9E 3BTEE 1P57B 1OSSA 1WYKA 1L1GA 4I8HA 3EGKH 3SUGA 1KSNA 1ZOMA 4NA7A 4AOQA 1PYTC 5FPYA 4YTAA 2BY9X 5JB8S 1TNKA 3RC4A 1YF4A 3EYDA 1THSH 3TGKE 1ZSLA 1D3TB 1O3HA 5G4BA 1OKXA 2XCNA 3HK6B 3LC3A 3MWIU 2DUCA 4Y7AA 3F9GA 4YOGA 3SV9A 1VR1H 1DFPA 3HKIB 2JH5D 4SGBE 1DSTA 2B0FA 4AG1A 1J14A 2J95A 5A09A 2P3TB 1C2EA 2ILNA 4YM9A 6CHAB 1V2MT 1NZQH 4AB9A 3F9FA 3A80A 3DT0H 3GOVB 2OQUA 1C5XB 2V6NA 4NA9H 1T8NA 2ANWA 4KTCA 2ZECA 2P93A 1T4VH 1BITA 3HPTB 4JMYA 5ABWA 1C5ZB 3V3MA 5JPMH 1ZSKA 1HAVA 1FAXA 3PO1B 4ZUHA 2XWAA 1C2GA 1W11U 1HFDA 2TGPZ 2XCFA 2A0QB 2FM2A 1SR5C 4WWYA 1VCPA 2FOFA 3SOSA 3SU4A 3U8TH 3ODFA 2BLOA 3URCA 1HDTH 4I32A 3LGWA 2XBVA 4TY6A 1OPHB 4JZFH 1NTPA 1BCUH 1CGHA 1UVSH 4FUDA 3TH3H 4BAKB 3MOCA 5A0AE 1C1UH 1BDAA 1SGDE 4X1QU 3UIRA 1TALA 1IQGA 3M5NA 3MNBA 3GDVA 1W3CA 2C8ZB 4NIVA 3KN2A 2HGTH 1EJMA 4Z0KA 5EPYA 3SQEE 2VIPA 5T6DA 1SGTA 1P11E 4KELA 5ETXA 4MG3A 4AX9H 1WTGH 1ETSH 3O8CA 2OC0A 3U69H 1O2VA 1WBGB 1A5HA 1TE0A 3U1JB 3MYWA 3QN7A 7GCHF 1D3PB 4INLA 5EODA 4NIYA 1OWIA 2PGQB 3A8AA 4DT7B 2PTCE 4BTUB 3HGPA 2BLWA 1FY5A 1CSOE 1O2KA 1K1JA 2J34A 1TX7A 2Y7XA 4XSKU 1PQ7A 3SUEA 1RTKA 3UFAA 1GVKB 4CRFA 1TRMA 1QL9A 4BAQB 1UVOA 1SOTA 4B2BA 4D9QA 1LHGH 1D4PB 1XUKA 2HRVA 4FUEA 3RUOA 1DXPA 1QGFA 1W14U 2NWNA 3MH6A 1MTWA 1S5SA 3T28A 2GKVE 2WUBA 4LZ4B 1B5GH 1FI8A 1M9UA 7ESTE 1V2VT 1C2JA 4FUJA 4KKDA 1QJ7B 4CRBA 3SHCH 3NXPA 2DE8A 1GMDG 2F9PA 4ABDA 1BT7A 5AVDA 2H2ZA 2A2QH 1SQOA 3L6PA 1THRH 4Y7BA 1S0RA 2B8OH 4CBNA 3KF2A 1IQLA 2C93B 1TIOA 1IQMA 3L33A 1V2LT 1FIWA 3NPSA 2GZ9A 4OS2A 4X1RU 1EP6A 2OXSA 3AAVA 1QL8A 5EQSA 3BTQE 2H9HA 2QGRA 4X6MA 3A81A 2XBXA 3RXLA 2B9LA 3KQDA 1NC6A 2ZZUH 4DVAU 1SC8U 1GBLA 1TPPA 2R3UA 1HXEH 2EI8A 1OWDA 1LHDH 3PTNA 4FUIA 3K9XB 3VB3A 1EQ9A 1BBRH 1P2JA 3PYHA 4NWKA 1OX1A 1BTPA 1BTZA 5I25A 1FMGA 4X8SH 5EXMA 4E7RG 3QWCH 1K1IA 1RJXB 3CS0A 4JZEH 4DIIH 4HI3A 2OC7A 3RXRA 3SJOA 2TGDA 2R3YA 2AGGX 3A7YA 4OGYA 1TONA 1O2PA 3LGVA 1NROH 4MNXA 4WJG2 4YT7H 3UR6A 2ZDLA 3P8GA 3RXHA 1SGNE 1BJVA 4BAHB 4OS5A 1ZHPA 1MBMA 3PLPA 1MTVA 1O32A 2FDAA 2Y81A 3CP7A 4Y8ZA 2BX4A 1C1NA 1J8AA 4NZQA 1P2OA 3H5CB 1K1OA 1BOQA 3E8LA 4TWWA 3QLPH 2ZNKH 1NRQH 1YC0A 6CHAC 2AS9A 3TJOA 3A87A 4DGJA 1C1WH 3TITA 2ZDKA 2FOEA 1P2IA 2PLXA 3NCLA 2SFAA 2OC1A 1O3NA 3BEUA 2FX6A 1QJ6B 2A7JA 4DURA 5A0CA 4K60A 2P95A 4ABHA 3PO1C 5DP8A 4R8TB 1K1MA 1TQ7B 2QY0B 1HNEE 1NFUA 2BOHB 3NK8A 4ZXXH 1QB1A 4CREA 1Y8TA 2G5VA 2RDLA 4A92A 1KYNA 1YP9A 3I78A 1O2GH 1L1JA 1FZZA 3ATKA 3BG4B 3RXDA 3C1KA 2BLQA 4I8JA 3M35A 3MU1A 1MAXA 1KXBA 2A4OA 2J38A 5EQQA 1Q2WA 1YLDA 4THNH 4WVPE 2R2WU 3UOUA 3ZVBA 4AN7A 1IQJA 3GY2A 5C20A 4LK4A 3M7UA 4TPIZ 1O0DH 1GHBG 1DX5M 5A8XA 2BDCA 2BDYA 3U9AH 3EA7A 1BQYA 2STAE 3RXMA 1EPTB 1HXFH 1W10U 3UNSA 1U6QA 1B0FA 1O5FH 2OUAA 1GI1A 5F03A 3PV4A 5DP3A 2UUFB 1G3EA 3ITIA 2PSXA 1BMNH 3CS7A 1UCYH 4O3TA 1WOFA 4GCHF 1LMWB 1A5GH 3MU8A 2XRCA 2G00A 1CHGA 4CHAB 3BTWE 1N6YA 4JK5A 1NPMA 1WCZA 1RIWB 4MTBA 2J4IA 3GY7A 3GY5A 2A5AA 2FTLE 3VXFH 2FX4A 3A7WA 1KXFA 1SL3A 2ZDMA 5HXFA 2GCTC 3AASA 4YO9A 3MNCA 4RSPA 1A5IA 1TQ0B 5JB9S 1F2SE 4JZ1A 1HIAB 1T4UH 1K2I1 1TMBH 1FQ3A 1VITF 1LQDB 2WPKS 1PPCE 2H9EH 3A8DA 3UNRA 1D3QB 5FCRA 1FPHH 2FS8A 4GLYA 3MU5A 4KP0A 1CT2E 2ZPQA 2CJIA 3TK5A 3ZVDA 1SGIB 3UUZA 2FOBA 4CBOA 1GDQA 1ACBE 1B7XB 8ESTE 3KQCA 1GDUA 1IQHA 1KLTA 3KGPA 4NA8A 1HAIH 5EQRA 4BAMB 1IQFA 2FOMB 2PGBB 2ZA5A 4FVBA 5DP9A 4J2YB 1ZTLA 2EI6A 2ZCHP 1IOEA 1IQKA 1DUEA 4BTIB 1EAIA 4GSOA 3K65B 5DP5A 1Y5BT 1CQQA 2VVCA 2IOTA 4MLFB 4BTTB 2TGAA 1CGIE 3RXCA 5C3NA 1SLVB 3Q3KA 4H6SB 1S81A 5H4IB 4D8NA 1UK3A 3ZZAA 1F92A 1QURH 2VIWA 4INKA 3LGUA 3ATWA 4UONA 4K1EA 1LPZB 4ZHLU 1TMUH 2CN0H 4LZ1H 1F0TA 3TPIZ 1IQIA 3BTHE 3GISB 1A0JA 1O2LA 5FX5A 2J2UA 1B0EA 1P04A 1EPTA 3F6UH 2UUKB 3LU9B 4B73A 2Q6FA 4X0WU 2QYIA 2XTTB 4LOYH 2QAAA 1O5CB 5GIBA 1W0YH 1TA6A 1ZHMA 2GGVB 3A7VA 2GZ8A 2NU0E 1L0ZA 4ABIA 2FLRH 3V13A 1ZR0A 3ZZDA 1HJ8A 4X2WA 1OWEA 3KQBA 5K0HA 1ABIH 2BY6X 3OU0A 3Q77A 1SVPA 4A6LA 1XX9A 3ATMA 3TJUA 1ELVA 4MNVA 3T26A 2XNIA 1FUJA 1AFQB 1WQSA 1ORFA 2ZHQH 3WY8A 2YNBA 2SGPE 4NSVA 5CHAB 4IW4E 1GBHA 2FEQH 2PKAA 3SUFA 2B7DH 3V12A 3MHWU 3ZZ7A 2BVRH 3SW2B 5LPRA 3M3VA 1YPEH 2XXLA 2EI7A 1BBRE 1INCA 2CXVA 2WPHS 1K1LA 2BDAA 4ABGA 1YM0A 4XOJA 4K8BA 4H42U 1P10A 1TAWA 1LO6A 2FMJA 1DY9A 1BRUP 1C1OA 1JWTA 2G52A 3QZRA 4U32A 4GHTA 1PPEE 3TH4H 2SGEE 1SI5H 1XXDA 3M7TA 2G55A 2AMPA 1LDTT 2NU2E 3BG4C 1PFXC 4AFUA 2R2MB 1HAOH 1P01A 1TLDA 2F83A 1Y5UT 3ZVCA 1AIXH 5HYOA 2WINI 3RM2H 1O3CA 1C5TA 1RRKA 1A0HB 4I7YH 3HGNA 1WV7H 1LVOA 2B5TB 2NU1E 1O2WA 1RXPA 1GBKA 1GBIA 3PMHB 3D65E 1SHHB 1TFXA 3P95A 1AB9B 1GL1A 1O2IA 1NFYA 1X7AC 1C1PA 5FHTA 1BHXB 1HGTH 1LPGB 1MQ5A 3M7QA 1XKAC 1LVMA 1Z6JH 1QQ4A 4CHAC 1QB6A 4GUXA 4D76A 1Y3WA 1HAVB 2ZU5A 1BTUA 1OOKB 1QIXB 3LDXH 3ZZ9A 1C5SA 1ANCA 1VJAU 1ABJH 4AGJA 2FI4E 1XMNB 1DSUA 1SBWA 2LNCA 4F49A 4ZH8A 1IAUA 3P8FA 5A2MH 2WPJS 1CHOF 4FU7A 1TWXB 1GPZA 5AHGH 3GYMA 2ZHWH 3EQ0H 4MPUA 4WH8A 5JBCS 2F9VA 1ZYOA 3A7ZA 3K6YA 1F0SA 1QBVH 1T8LA 5HMAA 2C8WB 1DWDH 3MH4A 1MH0A 2HNTC 3RMMH 1GJCB 3O8DA 2WV5A 1P3CA 3VFEA 1FN8A 1JIMA 3FVFB 1PJPA 4I8LA 1S6HA 3FZDA 2A7HA 2ZU1A 3FP8E 1PQ5A 4NFFA
chains in the Genus database with same CATH superfamily
3H7OA 2P59A 1BRCE 1E34B 2UWOA 3KQEA 1V3XA 2KR7A 2KZ4A 1O2JA 3T25A 3NKKA 3MNSA 5C2ZA 1K0HA 2HNTE 1UCYE 2IJD1 1F5RA 4MQAA 2SGAA 1LKAA 3RLWH 2A7CA 1C5WB 3ATLA 1ARCA 2V3MA 2WUCA 2V7QD 1QHRB 2Z9GA 4YOJA 3ATIA 1O2SA 4MPWA 1AQ7A 6GCHG 2FZZA 3BTME 2AERH 3UWJH 1C5VA 5J4QA 3AW0A 3VG8A 1HRTH 1ZMLA 1EJAA 2C8YB 1QQUA 4ZKRU 1GJ5H 3BIUH 1NS3A 2XOKD 1HAXB 4CRAA 3GCHB 3GY8A 4ABEA 2H9TH 1QTFA 1SSXA 1C2LA 1P06A 2GMTB 1HCGA 5L6NH 3E91A 3RXTA 4DT4A 2PFEA 1CVWH 1N1LA 1TYNA 2ANKH 3TK9A 2VNTA 3TNSA 4YXWD 2IPQX 2PSYA 2ZQ1A 4B71A 1F7ZA 5DP4A 1SFQB 2FYRA 1AI8H 1WU1A 1EZQA 1ARBA 2ZWLH 2GD4B 1AUTC 4KTUA 1HAGE 1GI8B 2QXHA 5B6LA 4ISNA 1GGDB 5GNDA 2BM2A 3D62A 2W7UA 1TRYA 1GMCF 4BAOB 1GHAF 2EQNA 3BSQA 4WMEA 1OWHA 5FX6A 5GPIB 3E0NB 3QDZB 1LTOA 3SJ8A 1G30B 2A32A 1C4Y2 1AFQC 3GCTG 4H6TA 1MZAA 3UY9A 1EASA 4OS7A 2ZPSA 4VGCB 2Z7FE 3DSGA 5CHAC 8KME2 3B23B 1BRAA 4F55A 5K7RA 2HVXA 2O8LA 1EXFA 1UTJA 5B6OA 5JYIA 3P70B 3DFLA 2ODYB 1UO6A 1V2WT 2FOAA 4NCYA 2W26A 3A7TA 5GDSH 1HUTH 1O3DA 1JRTA 3ODDA 1EKBB 1AVWA 2FWWA 2SGQE 2RG3A 2AMDA 3SU0A 2Z9IA 1LKBA 1EFRD 3URDA 2ULLA 1SQRA 1HBTH 2BTCE 4BOHA 1TBQH 1O5AB 4Q63A 3SJKA 4ESTE 3ZV9A 2OD3B 4TYDA 2P8OB 1V2RT 1UCYK 2AEIH 1IHSH 4YLUA 4MPXA 1ELEE 2VIVA 3RXPA 4Y0YE 3BV9B 1XXFA 2NU4E 1V2TT 1GL0E 1AVGH 4OS1A 3CENA 1PPZA 2PR3A 2ANMH 2H6MA 3JZ2B 2Y6TA 1P3EA 2F9BH 1ZJDA 3QGNB 2ALPA 1BUIA 1UVPA 4TSFD 2GDDA 1MCVA 2G8TA 4ZKOU 1C5NH 2JDID 3U8RH 2QCYA 1BJUA 3QO6A 3DSOA 4I31A 4X8TH 1LVYA 3UQOA 5F8ZA 1AB9C 1QRXA 1Z7KA 5C1YA 4JYUH 1HV7A 1XUGA 1EP5A 3M5LA 3TH2H 1FJSA 1ZJKA 2DE9A 1Y5AT 4PROA 1T32A 1YBWA 1DWEH 2OC8A 1GVLA 1DOJA 1GHVH 1UTMA 3BTFE 1TNLA 1O5GH 2J9NA 4FXGH 3EA9A 2V3HH 4FETA 4I8KA 1C1VH 1J9CH 1SLWB 2ZG0H 1ELBA 1AKSB 1W7GH 1EATA 2KX4A 1W0JD 1MCTA 3ZVAA 1GJDB 5DO4H 4O3UA 1QRWA 1XKBC 4Y76A 3PWCA 1PQAA 2HNTF 5DGJA 1V6DA 1VITG 5FAHA 1DLKB 3BN9A 2ZHDA 3H7TA 2O8UA 3AW1A 1AZZA 5T3HA 4OGXA 2PW8H 1SQAA 1C5RA 1OP8A 3T27A 4A1TA 4Y6DA 1DWBH 2CV3A 7KMEH 2BDBA 2J97A 1W2KH 4OS4A 3EAJA 2LP6A 2FP7B 2RCEA 4XBCA 3VB7A 4WF8A 2VB0A 1K22H 2G51A 1C4V2 3GDSA 3FP7E 2BOKA 1DDJA 4AORA 1HLTH 1QA0A 1ETTH 1E38B 1SGFG 1O38A 1SPJA 3PLBA 2J5UA 1KXDA 1ELGA 1L2EA 1EZUC 1YWUA 1ZPZA 2PV9B 1V2KT 4X1PU 1HJAB 2XBWA 1SFIA 2Z9LA 1IQNA 2W6JD 1FY3A 1DY8A 3I29A 1HYLA 3VXEH 5EW2H 1AN1E 3PRDA 4K5ZA 3SZNA 2V35A 2VU8E 1MTNB 2SGFE 2Y5HA 5KEDA 3S0NA 2IN2A 3ESTA 1MTSA 1Z1IA 2GP9B 3MO9A 5FPTA 4RT0A 3U98H 1P2MA 1O3KA 3GCHC 3N7OA 3DFJA 2KAIA 1YPKH 2W3KA 3Q3YA 1AFEH 3OAAD 2GMTC 2PUXB 2CHAB 3AAUA 5FPSA 1RFNA 1UK2A 2OQ5A 2YMSB 3LC5A 2VGCB 3DCLA 2OINA 3BF6H 5EPNA 1ZHRA 3STJA 3UNQA 3QK1A 3P17H 1C5PA 2BQ7B 2ZHFH 4B1TA 5C1UA 2VH0A 2ZGCA 4AZ2B 2AYWA 4NIWA 3SU2A 3K6ZA 1Y3XA 1YPGH 1C5MD 5JBAS 1W7XH 1G32B 3MTYA 2FS9A 4AGKA 1V2NT 3GY4A 2G4TA 2HLCA 1TPOA 1GI7B 1ZLRA 4UDWH 1O2RA 3R0FA 1GGDC 5IYTA 3TLOA 1TBZH 2PTNA 2ZIQH 4IC6A 1AKSA 1Q31A 4O97A 3VPKA 3KL6A 3ELAH 4ACBA 3GYLB 2KCAA 4ISIH 3ZV8A 3R3GB 1RS0A 5EXNA 3ZZ6A 4VGCC 4A1XA 1BB0B 5F8XA 1P8VC 2O8TA 2ZCKP 3TGJE 3RXAA 4A5TS 3TU7H 2GX4A 1C5LH 3ZYEA 2YOLA 5AFZH 3GCOA 4AYVB 5C17A 5EGMA 3RXKA 1IQEA 3OSYA 1KXAA 1SGCA 2J98B 3RMOH 2WPIS 1UTKA 4ACAA 2P16A 4ABJA 2FOGA 2XC5A 5DP7A 1EB1H 2G4UA 2GT7A 1JXPA 1P03A 2XC0A 3PRBA 1P12E 4HZHA 3PMBB 4IGDA 4TT3D 3MH7A 4QT8C 2R0KA 1KLJH 4ISOA 1TGNA 4IN1A 1S0QA 5LPFA 1O39A 1FPCH 1UTNA 1C1SA 2JH0D 2O8WA 3SORA 2PKSB 3QTVH 4DW2U 4WMFA 4X1NU 1O33A 1SLXB 2GV6A 5JBTA 1CBWB 1VCQA 4YOIA 2CMYA 1SMFE 1OP2A 8GCHG 2FOHA 2F91A 1H1BA 2TIOA 1NFXA 1L4DA 1O2UA 2QIQA 5I46H 1C5QA 1ELTA 1SGQE 1GCTB 3LIWA 4Q7YA 3SGQE 4ABAA 3Q76A 1BHXF 1GJAB 4FU9A 3UQVA 3SNCA 5DP6A 1HB0B 1TNIA 5C5NA 2PKAB 3SU6A 4Q7ZA 1AGJA 1ZTJA 2BXTH 2Z9KA 1S82A 2RFKC 1A0LA 3FOAA 3DSPA 3KEEA 1EAUA 2V0BA 4IC5A 4NG9H 4HG6A 2Z3CA 1H8IH 2D8WA 5F6MA 1ZTKA 2OBOA 1ETRH 4JK6A 1KDQB 1NBMD 1L1NA 2A31A 1GMDF 1OHHD 1XVMA 5GCHG 1LVBA 3K2UA 1AU8A 1TGCA 1FV9A 2YMSD 2HLDD 3VGCB 3RP2A 4Q2KA 3OFND 4HTCH 1CHOG 1T8MA 3SV2H 1UMAH 1H9IE 4TPYA 1DT2A 3SNEA 3UOPA 4WMDA 5PTPA 2JETB 4X6OA 3MU0A 2THFB 5BPEA 1GBMA 2M5TA 1CT4E 1P2NA 4IBLH 1GMHG 2Z9JA 1EJNA 1PPFE 1K21H 1TOCB 1YKTA 1O35A 1AO5A 3PWBA 1FY1A 3SJIA 5HGGA 5CE1A 3M5OA 2FPZA 3AK5A 2ZCLP 4DJZB 4ZCNA 3UB0A 1SGEE 4H4FA 2BZAA 2BQ6B 2ODQA 3OEHD 4AFSA 1GJ9B 4K2YA 2ZGBH 4WXIA 2IPHA 3ZZCA 1O3OA 3P8OA 4NGAH 3V0XA 1GBCA 3QUMP 3S9CA 2ZDAH 1UW7A 1HJAC 1FXYA 3OX7U 1C4U2 2BMGB 3E3TA 3LGIA 5EXLA 2O8MA 1OWJA 5HKKD 3SU3A 1MTNC 1V2QT 3MU4A 1NU9A 1NM6A 3FKSD 2A2XH 4BXWA 3O8BA 3U1IB 1C5OH 3GICB 1OS8A 2WSSD 2QXGA 3MMGA 1F0RA 5GXPA 1F5LA 4MNYA 1UVUH 4FUFA 1E36B 1CU1A 1VCWA 3LJJA 1LHCH 2OLGA 1EOLA 1V2OT 1F5KU 2OCVB 1KTSB 2CHAC 4YZUA 3RXUA 2WPLS 2YMSC 2QXJA 4NZLA 2VGCC 1W0KD 1BZXE 5TCAA 5C1XA 4J1YA 4WXVA 3PMJA 1ZGVA 4AFZA 1EUFA 1T8OA 3RXOA 2FYQA 1E0FD 2FLBH 2BY5X 1K1NA 4AFQA 1NBME 1KDQA 3QTOH 2CK3D 1KTTB 1GMCG 1SLUB 2TBSA 4HFPB 1Y59T 4AC9A 1EB2A 4K69A 3F3BA 1V2PT 4D7FA 3DA9B 3RXIA 1KY9A 3M61U 4Z1MD 1GCDA 1FLEE 1XVOA 3RXGA 4ZMAH 3LT3A 5JDUB 2AGIX 3SGBE 1MU6B 4ISLA 1MD7A 5HM9A 1GI5A 3E1XB 4UE7H 2EC9H 1TABE 2F9UA 2ZHEH 1GHBF 1A3BH 1H8ED 2C90B 4GHQA 2BD7A 5T6GA 3VEQB 2BLVA 2QF4A 3HATH 2BVSH 4BANB 1VGCB 2BB4A 1AE8H 1WDIA 1O3MA 1EPTC 1FONA 3JZ1B 4JYVH 1EX3A 1ANEA 5LGOA 2ZI2H 7GCHG 1MUEB 2A4RA 3OY6U 2A5IA 3W95A 5L30H 3ZZ3A 4M9FA 3TNTA 3A83A 1DUAA 5E0JA 5F53A 1E1QD 3A85A 3RM0H 2BD9A 2WV4A 1GHWH 1RIWC 2PKSC 4B2AA 4K3JA 1H9LB 2Y5GA 1CBWC 3N99A 3UTUH 1P9SA 4GPGA 2BY8X 5ESTE 3PMAB 4JYTA 2TRMA 1F0UA 3SQHE 4Q7XA 1OP0A 2AMQA 5E0HA 3VB5A 1KXCA 1GCTC 2BXUH 2XYAA 3ZZ4A 1AHTH 3KNXA 3I77A 4OM9A 2BDGA 1A7SA 1HAPH 7LPRA 2PHBA 2UWLA 5TJXA 1UHBB 4NWLA 1EZXC 2FOCA 3P8NA 4GAWA 1O5DH 1TNHA 1ELAA 3T5FH 4ASHA 1QJ1B 1BTWA 1G3DA 4JZDH 1D6WA 2ZFPH 3BIVH 1C2FA 1ZMJA 3P6ZB 1OWKA 2FTMA 3FANA 5DN6D 1K28D 4FUGA 1BBRK 2AHME 3RLYH 3VGCC 1A3EH 1HPGA 4RI0A 1WQVH 1Z71A 1FY8E 3PLKA 4NIXA 1ZZZA 4P00A 3BEIB 2BD5A 1DVAH 2ZFTA 4MVNA 3A84A 1Y3YA 2VIDA 4YESB 2JETC 2Q1JA 1THPB 4XDEA 1ELFA 4KTSA 2F9NA 2OBQA 4Y8XA 2XBYA 2ZO3H 3RU4D 4Y71A 1D9IA 1TB6H 3LH1A 2HPQH 3A8CA 1ELDE 4X1SU 2Y82A 1MKWH 1C1QA 1S6LA 1S6FA 1MKXH 2BX3A 1VJ9U 2ZFRH 4DCDA 2ALVA 1LHEH 4U01A 5A0BA 1LHFH 1RD3B 2K0QA 2CGAA 2HOBA 3LKWA 3U8OH 1MAYA 4B6FA 5CDFE 4MNWA 3RU4T 2VH6A 1A2CH 3RXFA 1CO7E 1BTHH 3BTTE 3TIUA 1ZRKA 3SNBA 2BD2A 1O3JA 1QA7A 3DHKH 4XFQA 3VB4A 2D1JA 4UFDH 5E2OA 1N8OB 3W94A 1KXEA 2JKHA 1Y3UA 1O2XA 3E0PB 3KQ5A 1C1TA 1MD8A 1DICA 1HAYB 2W5EA 3SUDA 4UFEH 4FVDA 2STBE 3A82A 2R9PA 3P92A 4Y11E 3RC6A 1DITH 1G3CA 2XNDD 2G81E 2RA0A 2K1QA 1CE5A 2VWOA 1ZSJA 1RTFB 3A86A 3M3SA 2JH6D 1AVXA 1TOMH 3SHAH 1MMJN 1O30A 3FFGA 1SGRE 1BTYA 4CRGA 1AD8H 1KMHB 2P3FH 3G01A 1FY4A 3ZVEA 3ZZ8A 2PUQH 2ZFFH 1C2IA 1Z6EA 2Z94A 1EOJA 5AF9H 1LPKB 1JBUH 2EEKA 2BHGA 1UHBA 1AWHB 2JJ1D 3MI4A 1C5YB 5A8ZA 1V2JT 2ZGHA 4E06H 3IG6B 4TY7A 2QF0A 1PPHE 1UTQA 3O8RA 1TGSZ 2OP9A 2EA3A 4UD9H 1UJ1A 3AVZA 2D2DA 2H5CA 2J94A 1TNJA 5IDKA 1SGFA 2F3CE 1QL7A 2BDIA 5KECA 3NZIA 3ZZBA 1LQEA 2UWPA 3NUMA 9LPRA 2GVFA 4I33A 2A45B 2VINA 3V7TA 3SU1A 5LH8A 4HGCA 2VVUA 3Q00A 3RU4E 1W0ZU 2KAIB 3ENSB 4MPVA 5FXLA 1VGCC 3RMNH 2QF3A 1BMMH 3IITA 5C5OA 2ZKSA 1ID5H 3OTJE 2FI5E 1QCPA 1YCPH 3F1SB 1W13U 4UFFH 1SOZA 3CNRA 3SNDA 4X2YA 2HALA 3EDXB 3SBKA 5E0GA 5A8YA 1CT0E 9ESTA 1O34A 4DOQA 3RXQA 1ESBA 1MABB 1O5BB 4GCHG 2GTBA 1YLCA 1FDPA 4NSYA 1BIOA 2BYAX 5C0TA 1MZDA 1G9IE 2GCTB 4P02A 1S84A 1KLIH 2FIRH 1NRNH 1C2MA 3F68H 4R0IA 1G2LA 4ABBA 1J16A 2ZTYA 1O2TA 1YGCH 2XW9A 1Q3XA 3N7DA 3RXJA 1QB9A 5F8TA 3MNXA 4WY3A 4FUCA 2GV7A 2I6SA 5LPEA 1PPGE 1GI6A 3TVJB 1GVZA 3N7EA 1E35B 2ZF0H 4B76A 3Q3XA 1C9PA 1GHZA 2RA3A 4Y8YA 1ZRBA 1TRNA 1W8BH 1VKYA 1JOUB 1JMOH 3S7KB 1DS2E 1AWFH 1QY6A 2GCHF 2YNAA 2ZU2A 4M7GA 2CF9H 2AIPA 1EAXA 6ESTA 1ZPBA 4ZKNU 2A1DB 1WSSH 3H09A 3SV6A 1ZMNA 1AMHA 2Y5FA 1GJBB 4OS6A 5EJLA 1BMAA 3M37A 1W12U 3KCGH 1CA8B 4ZHAA 2V3OH 1A1RA 1O3IA 3F2FA 2PWXA 1O3AA 2FODA 2ZPRA 2H5DA 4YT6H 4U2WA 6GCHF 2GT8A 3QX5H 1O3GA 3UREA 3PTBA 1GI4A 3E90B 2BD3A 1J17T 1T7CA 4Y79A 1SHYA 2ESTE 3GDUA 2VIOA 3M5MA 1NO9H 3OE7D 1GDNA 2K8IA 1C5UA 1D6RA 1EAWA 4MDSA 3UR9A 1O5EH 4RKJB 2SNVA 1JRSA 1ELCA 2ZTXA 3PV2A 2O9QA 3BTGE 3RC5A 1YCPM 1YPLH 1BMLA 1XUIA 2UUJB 2VIQA 1Y3VA 4SGAE 4Q80A 1HJ9A 4D9RA 2FESH 1AUJA 2CF8H 1G2MA 1CA0B 3LPRA 2Z6BD 2AH4X 3UPEA 1ZPCA 1H9HE 1GBBA 2F9OA 2Z3EA 1QRZA 3MQKC 4BNRA 1A46H 1CGJE 1P2QA 1N8OC 3MO3A 3A89A 3GCNA 3SNAA 2GDEH 2AGEX 4XD7D 1SB1H 4B74A 5DKMA 1TPAE 3SO3A 3SU5A 1S85A 3EE0B 1GHXH 3TGIE 1RTLA 1NY22 3GCTF 2P3UB 4ZHMU 2WPMS 3IWMA 5T6FA 3BG8A 1XUFA 2XWBI 1WTHD 1HAHH 4A1VA 3MFJA 1O31A 4DIHH 3WWFA 1DLEA 4FOUC 3MH5A 1O3PB 2HWLB 2ZDVH 2SNWA 3KHVA 3S9BA 5T1VA 3ZVFA 4AYYB 1AE5A 1FIZA 1P0SH 2ZEBA 4ISHH 2ZGXH 1J15A 1NN6A 4AB8A 1GJ6A 2VWLA 2ODPA 2F43B 3A8BA 1L4ZA 1C2DA 1GI0A 5DJ7A 5DSFA 4B6EA 1AY6H 2IJOB 4XE4A 4ZKSU 2P8OC 1GBFA 1NU7B 2W3IA 3EA8A 4UEHH 2BY7X 3PM3A 2D26C 1UTOA 1UTPA 3FP6E 4TWYA 4IMZA 3ZZ5A 3WWBA 2VJ1A 1P05A 4DY7B 2SGDE 4CRCA 2A4QA 1DM4B 1MU8B 2OTVA 3RDZA 1O2ZA 1UTLM 1TA2A 1QBNA 2A5KA 2Y80A 3MO6A 6LPRA 1FN6A 3D23A 3F9HA 4CR5A 1O3LA 4K1TA 4X8UH 1BTXA 5DK1A 1TPSA 5AFYH 1NRRH 1GBDA 3LGTA 5EJ1A 1BA8B 1RGQA 2ZDNA 4B75A 1H8DH 3BEFB 3FZZA 1H4WA 3T62A 2FO9A 1BRBE 1ESAA 1C2KA 3VB6A 1C9TA 2QC2A 5EOKA 1Z8RA 3L3TA 1TX8A 3SJ9A 1ESTA 2NU3E 5SGAE 3SI3H 1GBAA 2ZQ2A 3T2NA 4LXBH 5EW1H 4X6NA 4RKOB 3UWIA 2ZP0H 2J92A 3F9EA 2A4GA 1AZ8A 1GG6B 2ZTZA 1GBJA 2ZU3A 1TGTA 1DE7H 1G3BA 1NESE 5FBEA 3ZIAD 3SZEA 4I86A 2FXRA 4X2XA 4CR9A 5CHBA 3RXBA 1VZQH 1TMTH 4GVUA 1SGYE 1NRSH 1O3FA 1MKWK 2BQWB 1GI2A 5JBBS 2W7SA 5C67A 1P02A 5L2YH 3QZQA 1MKXK 3GY3A 3M3TA 5FCKA 4O9VA 5J4SA 1E37B 5EIYA 3LJOA 4XBDA 4Y0ZE 3TJVA 1JIRA 1GJ4H 1YPJH 2LPRA 1EZSC 1YPMH 1MQ6A 1SQTA 2ZGJA 3SV8A 2C8XB 5E8EH 3RXSA 1WAYB 4E7NA 5FBIA 3LGYA 3S9AA 1ZGIA 1NRPH 1K1PA 2H1UA 2HPPH 4RN6A 1GI3A 2Q6GA 2ZU4A 1MBQA 4E05H 3RMLH 4IS5A 4D7GA 2EY4C 2KCYA 3GS9A 4Z6AH 1OYQA 1O2QA 1S83A 1ANDA 1D3DB 2QV1A 1DXWA 1N6XA 3KIDU 3ZYDA 3GY6A 2C3SA 1GBEA 4FUHA 4IN2A 2TPIZ 3BTDE 1QNJA 4YLQH 1Z8IB 5E2PA 1YYY1 4ZXYH 1GWAA 1CA0C 3PROA 2ZFSA 1V2ST 1HAZB 3M36A 1G37A 1XUHA 3B8JA 1LCYA 1NT1A 1P9UA 4O03A 2WZQA 4CH8B 3U28C 3TK6A 4IMQA 4Y10E 1O2NA 1UVTH 1MTUA 4FUBA 4ZAEA 1O36A 1O2HA 5GWZA 8LPRA 1GHAG 1ANBA 2G5NA 1HIAA 2AFQB 1Z8GA 5EU8A 5TCCA 5CMXH 1T31A 1Z1JA 1OYTH 1OXGA 4K1SA 1GBTA 4F4OC 1DPOA 4CRDA 3FN8A 1GJ7B 4XBBA 1O3BA 1K9OE 1IHTH 1O2OA 1QZ8A 1O3EA 3OY5U 1DWCH 2Z3DA 3E6PH 1C2HA 5L2ZH 4X2VA 2ASUB 1A61H 4JZIA 1YCPK 3PB1E 1QR3E 1VITH 3A7XA 1TX6A 1QBOA 2VWNA 1XM1A 2QXIA 1E79D 4INHA 3SN8A 5BRRE 4NFEA 2C4FH 2BD8A 3S7HB 4A7IB 2JJ2D 4FU8A 3T29A 3B9FH 1TBRH 3SV7A 2UUYA 1PYTD 4X6PA 8GCHF 3DUXH 2AIQA 3BTKE 3DD2H 1E1RD 3STIA 2BDHA 1KIGH 4K8YA 1P2KA 4KGAA 3A88A 5ESBA 3SGAE 5DG6A 4BXSA 4B2CA 3NWUA 3C27B 1NFWA 2VVVA 3LOXA 3S69A 3LONA 1V2UT 3ZVGA 3D49H 1O2YA 5DPAA 1TNGA 1SGPE 5HM2A 4WH6A 5GJ4B 1G36A 4JCNA 1PQ8A 1QFKH 2P94A 3TJNA 5GCHF 4AG2A 1FAKH 2FI3E 3OYPA 3E16B 1GI9B 3RXVA 4CH2B 3F2HA 4U30A 2GZ7A 2ANYA 4UFGH 1O37A 1Z8JB 2BVXH 2Y7ZA 2L74A 2BZ6H 2ZC9H 4X8VH 2BD4A 1SG8B 4DG4A 1P09A 1YPHC 5EG4A 3LH3A 3SI4H 2QN5T 4ABFA 1GMHF 1PPBH 1WUNH 3HK3B 1GG6C 2TGTA 4I8GA 1XUJA 1C1MA 1TGBA 2VWMA 2PP6A 5HIZA 1A4WH 2R0LA 2KCPA 2GCHG 3FAOA 2Q6DA 1C1RA 2I6QA 3QGJA 1DANH 2RDEA 3RXEA 1GJ8B 3HKJB 4Q4LA 1YPHE 2XC4A 2ZFQH 1UK4A 4ZROA 2WYGA 2WYJA 1FNIA 1O2MA 1GHYH 1H8HD 2QA9E 3BTEE 1P57B 1OSSA 1WYKA 1L1GA 4I8HA 3EGKH 3SUGA 1KSNA 1ZOMA 4NA7A 4AOQA 1PYTC 5FPYA 4YTAA 2BY9X 5JB8S 1TNKA 3RC4A 1YF4A 3EYDA 1THSH 3TGKE 1ZSLA 1D3TB 1O3HA 5G4BA 1OKXA 2XCNA 3HK6B 3LC3A 3MWIU 2DUCA 2WV9A 4Y7AA 3F9GA 4YOGA 3SV9A 1VR1H 1COWD 1DFPA 3HKIB 2JH5D 4SGBE 2KCOA 1DSTA 2B0FA 4AG1A 1J14A 2J95A 5A09A 2P3TB 1C2EA 2ILNA 4YM9A 6CHAB 1V2MT 1NZQH 4AB9A 3F9FA 3A80A 3DT0H 2GJGA 2OQUA 3GOVB 5C0UA 1C5XB 2V6NA 4NA9H 1T8NA 2ANWA 4KTCA 2ZECA 2P93A 1T4VH 1BITA 3HPTB 4JMYA 3OTPA 5ABWA 1C5ZB 3V3MA 5JPMH 1ZSKA 1HAVA 1FAXA 3PO1B 4ZUHA 2XWAA 1C2GA 1W11U 1HFDA 2QE7D 2TGPZ 2XCFA 2A0QB 2FM2A 1SR5C 4WWYA 1VCPA 2FOFA 3SOSA 3SU4A 3U8TH 3ODFA 2BLOA 3URCA 1HDTH 4I32A 3LGWA 2XBVA 4TY6A 1OPHB 1YLNA 4JZFH 1NTPA 1BCUH 1CGHA 1UVSH 4FUDA 3TH3H 1YY3A 3MOCA 4BAKB 5A0AE 1C1UH 1BDAA 1SGDE 4X1QU 3UIRA 1TALA 1IQGA 3M5NA 3MNBA 3GDVA 1W3CA 2C8ZB 4NIVA 3KN2A 2HGTH 1EJMA 4Z0KA 2F4LA 5EPYA 3SQEE 2VIPA 3FO8D 1SGTA 1P11E 4KELA 5T6DA 5ETXA 2HVYB 4MG3A 4AX9H 1WTGH 1ETSH 3O8CA 2OC0A 3U69H 1O2VA 1WBGB 1A5HA 1TE0A 3U1JB 3MYWA 3QN7A 7GCHF 1D3PB 4INLA 5EODA 4NIYA 1OWIA 2PGQB 3A8AA 4DT7B 2PTCE 4BTUB 3HGPA 2BLWA 1FY5A 1CSOE 1O2KA 1K1JA 5KGOA 2J34A 1TX7A 2Y7XA 4XSKU 1PQ7A 1SKYE 3SUEA 1RTKA 3UFAA 1GVKB 4CRFA 1TRMA 1QL9A 4BAQB 1UVOA 1SOTA 4B2BA 4D9QA 1LHGH 1D4PB 1XUKA 2HRVA 4FUEA 3RUOA 1DXPA 1QGFA 3EE7A 1W14U 2NWNA 3MH6A 1MTWA 1S5SA 3T28A 2GKVE 2WUBA 4LZ4B 1B5GH 1FI8A 1M9UA 7ESTE 1V2VT 1C2JA 4FUJA 4KKDA 1QJ7B 4CRBA 3SHCH 3NXPA 2DE8A 1GMDG 2F9PA 1WXRA 4ABDA 1BT7A 5AVDA 2H2ZA 2A2QH 1SQOA 3L6PA 1THRH 4F48B 4Y7BA 1S0RA 2B8OH 4CBNA 3KF2A 3SYJA 1IQLA 2C93B 1TIOA 1IQMA 3L33A 1V2LT 1FIWA 3NPSA 2GZ9A 3PV5A 4OS2A 4X1RU 1EP6A 2OXSA 3AAVA 1QL8A 5EQSA 3BTQE 2H9HA 2QGRA 4X6MA 3A81A 2XBXA 3RXLA 2B9LA 3KQDA 1NC6A 2ZZUH 4DVAU 1SC8U 1GBLA 1TPPA 2R3UA 1HXEH 2EI8A 1OWDA 1LHDH 3PTNA 4FUIA 3K9XB 3VB3A 1EQ9A 1BBRH 1P2JA 3PYHA 4NWKA 1OX1A 1BTPA 1BTZA 3OEED 5I25A 1FMGA 4X8SH 5EXMA 4E7RG 3QWCH 1K1IA 1RJXB 3CS0A 5HIYA 4JZEH 4DIIH 4HI3A 2OC7A 3RXRA 3SJOA 2LELA 2TGDA 2R3YA 2AGGX 3A7YA 4OGYA 1TONA 1O2PA 3LGVA 1NROH 4MNXA 4WJG2 4YT7H 3UR6A 2ZDLA 3P8GA 3RXHA 1SGNE 1BJVA 4BAHB 4OS5A 1ZHPA 5C94A 1MBMA 3PLPA 1MTVA 1O32A 2FDAA 2Y81A 3CP7A 4Y8ZA 2BX4A 1C1NA 1J8AA 4NZQA 1P2OA 3H5CB 1K1OA 1BOQA 3E8LA 4TWWA 3QLPH 2ZNKH 1NRQH 1YC0A 6CHAC 2AS9A 3TJOA 3A87A 4DGJA 1C1WH 3TITA 2ZDKA 2FOEA 1P2IA 2PLXA 3NCLA 2SFAA 2OC1A 1O3NA 3BEUA 2FX6A 1QJ6B 2A7JA 2WPDD 4DURA 5A0CA 4K60A 2P95A 4ABHA 3PO1C 5DP8A 4R8TB 1K1MA 1TQ7B 2QY0B 1HNEE 1NFUA 2BOHB 3NK8A 4ZXXH 1QB1A 4CREA 1Y8TA 2G5VA 2RDLA 4A92A 1KYNA 1YP9A 3NRLA 3I78A 1O2GH 1L1JA 4XRNA 1FZZA 3ATKA 3BG4B 3RXDA 3C1KA 2BLQA 4I8JA 3M35A 3MU1A 1MAXA 1KXBA 2A4OA 2J38A 5EQQA 1Q2WA 1YLDA 4THNH 4WVPE 2R2WU 3UOUA 3ZVBA 4AN7A 1IQJA 3GY2A 5C20A 4LK4A 3M7UA 4TPIZ 1O0DH 1GHBG 1DX5M 5A8XA 2BDCA 2BDYA 3U9AH 3EA7A 1BQYA 2STAE 3RXMA 1EPTB 1HXFH 1W10U 3UNSA 1U6QA 1B0FA 1O5FH 2OUAA 1GI1A 5F03A 3PV4A 5DP3A 2UUFB 1G3EA 3ITIA 2PSXA 2W6ID 1BMNH 3CS7A 1UCYH 4O3TA 1WOFA 3F0OA 4GCHF 1LMWB 1A5GH 3MU8A 2XRCA 2G00A 1CHGA 4CHAB 3BTWE 2M2AA 1N6YA 5IK2D 4JK5A 1NPMA 1WCZA 1RIWB 4MTBA 2J4IA 3GY7A 3GY5A 2A5AA 2FTLE 3VXFH 2FX4A 3A7WA 1KXFA 1SL3A 2ZDMA 5HXFA 2GCTC 3AASA 4YO9A 3MNCA 4RSPA 1A5IA 1TQ0B 5JB9S 1F2SE 2VBCA 4JZ1A 1HIAB 1T4UH 1K2I1 1TMBH 1FQ3A 1VITF 1LQDB 2WPKS 1PPCE 3UAIC 2H9EH 3A8DA 3UNRA 1D3QB 3KYGA 5FCRA 1FPHH 1FX0B 2FS8A 4GLYA 3MU5A 4KP0A 1CT2E 2ZPQA 2CJIA 3TK5A 3ZVDA 1SGIB 3UUZA 2FOBA 4CBOA 1GDQA 1ACBE 1B7XB 8ESTE 3KQCA 1GDUA 1IQHA 1KLTA 3KGPA 4NA8A 1HAIH 5EQRA 4BAMB 1IQFA 2FOMB 2PGBB 2ZA5A 4FVBA 5DP9A 4J2YB 1ZTLA 2EI6A 2ZCHP 1IOEA 1IQKA 1DUEA 4BTIB 1EAIA 4GSOA 3K65B 5DP5A 1Y5BT 1CQQA 2VVCA 2IOTA 4MLFB 4BTTB 2TGAA 5FL7D 1CGIE 3RXCA 5C3NA 1SLVB 3Q3KA 4H6SB 1S81A 5H4IB 4D8NA 1UK3A 3ZZAA 1F92A 1QURH 2VIWA 4INKA 3LGUA 3ATWA 2QF5A 3KYFA 4UONA 4K1EA 1LPZB 4ZHLU 1TMUH 2CN0H 4LZ1H 1F0TA 3TPIZ 1IQIA 3BTHE 3GISB 1A0JA 1O2LA 5FX5A 2J2UA 2J98A 1B0EA 1P04A 1EPTA 2L6OA 3F6UH 2UUKB 3LU9B 4B73A 2Q6FA 4X0WU 2QYIA 2XTTB 4LOYH 2QAAA 1BMFD 1O5CB 5GIBA 1W0YH 1TA6A 1ZHMA 2GGVB 3A7VA 2GZ8A 2KM0A 2NU0E 1L0ZA 3F0PA 4ABIA 2FLRH 3V13A 1ZR0A 3ZZDA 1HJ8A 4X2WA 1OWEA 3KQBA 5K0HA 1ABIH 2BY6X 3OU0A 3Q77A 1SVPA 4A6LA 1XX9A 3ATMA 3TJUA 1ELVA 4MNVA 3T26A 2XNIA 1FUJA 1AFQB 1WQSA 1ORFA 2ZHQH 3WY8A 2YNBA 2SGPE 4NSVA 5CHAB 4IW4E 1GBHA 2FEQH 2PKAA 3SUFA 2B7DH 4RT1A 3V12A 2WHXA 3MHWU 3ZZ7A 4ASUD 2BVRH 3SW2B 5LPRA 3M3VA 1YPEH 2KFWA 2XXLA 2EI7A 5EJZA 1BBRE 1INCA 2CXVA 2WPHS 1K1LA 2BDAA 4ABGA 1YM0A 4XOJA 4K8BA 4H42U 1P10A 1TAWA 1LO6A 2FMJA 1DY9A 1BRUP 1C1OA 1JWTA 2G52A 3QZRA 4U32A 4GHTA 1PPEE 3TH4H 2SGEE 1SI5H 1XXDA 3M7TA 2G55A 2AMPA 1LDTT 2NU2E 3BG4C 1PFXC 4AFUA 2R2MB 1HAOH 1P01A 3W1EA 1TLDA 2F83A 1Y5UT 3ZVCA 1AIXH 5HYOA 2WINI 3RM2H 1O3CA 1C5TA 1RRKA 1A0HB 4I7YH 3HGNA 1WV7H 1LVOA 2B5TB 2NU1E 1O2WA 1RXPA 1GBKA 1GBIA 3PMHB 3D65E 3WW7A 1SHHB 1TFXA 3P95A 1AB9B 1GL1A 1O2IA 1NFYA 1X7AC 1C1PA 5FHTA 1BHXB 1HGTH 1LPGB 1MQ5A 3M7QA 1XKAC 1LVMA 1Z6JH 3F2GA 1QQ4A 4CHAC 1QB6A 4GUXA 4D76A 1Y3WA 1HAVB 2ZU5A 1BTUA 1OOKB 1QIXB 3LDXH 3ZZ9A 1C5SA 1ANCA 1VJAU 1ABJH 4AGJA 2FI4E 1XMNB 1DSUA 1SBWA 2LNCA 4F49A 4ZH8A 1IAUA 3P8FA 5A2MH 2WPJS 1CHOF 2JIZD 4FU7A 1TWXB 1GPZA 5AHGH 3GYMA 2ZHWH 3EQ0H 4MPUA 4WH8A 5JBCS 2F9VA 1ZYOA 3A7ZA 3K6YA 1F0SA 1QBVH 1T8LA 5HMAA 2C8WB 1DWDH 3MH4A 1MH0A 2HNTC 3RMMH 1GJCB 3O8DA 2WV5A 1P3CA 3VFEA 1FN8A 1JIMA 2OK5A 3FVFB 1PJPA 4I8LA 1S6HA 3FZDA 2A7HA 2ZU1A 3FP8E 1PQ5A 4NFFA
chains in the Genus database with same CATH topology
3H7OA 2P59A 1BRCE 1E34B 2UWOA 3KQEA 1V3XA 1O2JA 3T25A 3NKKA 3MNSA 5C2ZA 2HNTE 1UCYE 4MQAA 1F5RA 2SGAA 1LKAA 3RLWH 2A7CA 1C5WB 3ATLA 1ARCA 2WUCA 2Z9GA 1QHRB 4YOJA 3ATIA 1O2SA 4MPWA 1AQ7A 6GCHG 2FZZA 3BTME 2AERH 3UWJH 1C5VA 5J4QA 3AW0A 1HRTH 1ZMLA 1EJAA 2C8YB 1QQUA 4ZKRU 1GJ5H 3BIUH 1NS3A 1HAXB 4CRAA 3GCHB 3GY8A 4ABEA 2H9TH 1QTFA 1SSXA 1C2LA 1P06A 2GMTB 1HCGA 5L6NH 3E91A 3RXTA 2PFEA 1CVWH 1N1LA 1TYNA 2ANKH 3TK9A 2VNTA 3TNSA 2PSYA 2ZQ1A 4B71A 1F7ZA 5DP4A 1SFQB 2FYRA 1AI8H 1WU1A 1EZQA 1ARBA 2ZWLH 2GD4B 1AUTC 4KTUA 1HAGE 1GI8B 2QXHA 4ISNA 1GGDB 2BM2A 3D62A 2W7UA 1TRYA 1GMCF 4BAOB 1GHAF 3BSQA 4WMEA 1OWHA 5FX6A 5GPIB 3E0NB 3QDZB 1LTOA 3SJ8A 1G30B 2A32A 1C4Y2 1AFQC 3GCTG 4H6TA 1MZAA 3UY9A 1EASA 4OS7A 2ZPSA 4VGCB 2Z7FE 5CHAC 8KME2 3B23B 1BRAA 5K7RA 2HVXA 2O8LA 1EXFA 1UTJA 5B6OA 5JYIA 3P70B 3DFLA 2ODYB 1UO6A 1V2WT 2FOAA 4NCYA 2W26A 3A7TA 5GDSH 1HUTH 1O3DA 1JRTA 3ODDA 1EKBB 1AVWA 2FWWA 2SGQE 2RG3A 2AMDA 3SU0A 2Z9IA 1LKBA 3URDA 2ULLA 1HBTH 2BTCE 4BOHA 1TBQH 1O5AB 3SJKA 4ESTE 3ZV9A 2OD3B 4TYDA 2P8OB 1V2RT 1UCYK 2AEIH 1IHSH 4YLUA 4MPXA 1ELEE 2VIVA 3RXPA 4Y0YE 3BV9B 1XXFA 2NU4E 1V2TT 1GL0E 1AVGH 4OS1A 3CENA 1PPZA 2PR3A 2ANMH 2H6MA 3JZ2B 2Y6TA 1P3EA 2F9BH 1ZJDA 3QGNB 2ALPA 1BUIA 1UVPA 2GDDA 1MCVA 2G8TA 4ZKOU 1C5NH 3U8RH 2QCYA 1BJUA 3QO6A 4I31A 4X8TH 1LVYA 3UQOA 5F8ZA 1AB9C 1QRXA 1Z7KA 5C1YA 4JYUH 1HV7A 1XUGA 1EP5A 3M5LA 3TH2H 1FJSA 1ZJKA 2DE9A 1Y5AT 4PROA 1T32A 1YBWA 1DWEH 2OC8A 1GVLA 1DOJA 1GHVH 1UTMA 3BTFE 1TNLA 1O5GH 2J9NA 4FXGH 3EA9A 2V3HH 4I8KA 1C1VH 1J9CH 1SLWB 2ZG0H 1ELBA 1AKSB 1W7GH 1EATA 1MCTA 3ZVAA 1GJDB 5DO4H 4O3UA 1QRWA 1XKBC 4Y76A 3PWCA 1PQAA 2HNTF 5DGJA 1V6DA 1VITG 5FAHA 1DLKB 3BN9A 2ZHDA 3H7TA 2O8UA 3AW1A 1AZZA 5T3HA 4OGXA 2PW8H 1SQAA 1C5RA 1OP8A 3T27A 4A1TA 4Y6DA 1DWBH 2CV3A 7KMEH 2BDBA 1W2KH 4OS4A 3EAJA 2FP7B 2RCEA 4XBCA 3VB7A 4WF8A 2VB0A 1K22H 2G51A 1C4V2 3GDSA 3FP7E 2BOKA 1DDJA 4AORA 1HLTH 1QA0A 1ETTH 1E38B 1SGFG 1O38A 1SPJA 3PLBA 1KXDA 1ELGA 1L2EA 1EZUC 1ZPZA 2PV9B 1V2KT 4X1PU 1HJAB 2XBWA 1SFIA 2Z9LA 1IQNA 1FY3A 1DY8A 3I29A 1HYLA 3VXEH 5EW2H 1AN1E 4K5ZA 3SZNA 2V35A 2VU8E 1MTNB 2SGFE 2Y5HA 3S0NA 2IN2A 3ESTA 1MTSA 1Z1IA 2GP9B 3MO9A 5FPTA 3U98H 1P2MA 1O3KA 3GCHC 3N7OA 3DFJA 2KAIA 1YPKH 2W3KA 3Q3YA 1AFEH 2GMTC 2PUXB 2CHAB 3AAUA 5FPSA 1RFNA 1UK2A 2OQ5A 3LC5A 2VGCB 2OINA 3BF6H 5EPNA 1ZHRA 3STJA 3UNQA 3QK1A 3P17H 1C5PA 2BQ7B 2ZHFH 4B1TA 5C1UA 2VH0A 2ZGCA 4AZ2B 2AYWA 4NIWA 3SU2A 3K6ZA 1Y3XA 1YPGH 1C5MD 5JBAS 1W7XH 1G32B 3MTYA 2FS9A 4AGKA 1V2NT 3GY4A 2G4TA 2HLCA 1TPOA 1GI7B 1ZLRA 4UDWH 1O2RA 3R0FA 1GGDC 5IYTA 3TLOA 1TBZH 2PTNA 2ZIQH 4IC6A 1AKSA 1Q31A 4O97A 3VPKA 3KL6A 3ELAH 3GYLB 4ISIH 3ZV8A 3R3GB 1RS0A 5EXNA 3ZZ6A 4VGCC 4A1XA 1BB0B 5F8XA 1P8VC 2O8TA 2ZCKP 3TGJE 3RXAA 4A5TS 3TU7H 2GX4A 1C5LH 3ZYEA 2YOLA 5AFZH 3GCOA 4AYVB 5EGMA 3RXKA 1IQEA 3OSYA 1KXAA 1SGCA 3RMOH 2WPIS 1UTKA 2P16A 4ABJA 2FOGA 2XC5A 5DP7A 1EB1H 2G4UA 2GT7A 1JXPA 1P03A 2XC0A 1P12E 4HZHA 3PMBB 4IGDA 3MH7A 4QT8C 2R0KA 1KLJH 4ISOA 1TGNA 4IN1A 1S0QA 5LPFA 1O39A 1FPCH 1UTNA 1C1SA 2JH0D 2O8WA 3SORA 2PKSB 3QTVH 4DW2U 4WMFA 4X1NU 1O33A 1SLXB 2GV6A 5JBTA 1CBWB 1VCQA 4YOIA 2CMYA 1SMFE 1OP2A 8GCHG 2FOHA 2F91A 1H1BA 2TIOA 1NFXA 1L4DA 1O2UA 2QIQA 5I46H 1C5QA 1ELTA 1SGQE 1GCTB 3LIWA 4Q7YA 3SGQE 4ABAA 3Q76A 1BHXF 1GJAB 4FU9A 3UQVA 3SNCA 5DP6A 1HB0B 1TNIA 5C5NA 2PKAB 3SU6A 4Q7ZA 1AGJA 1ZTJA 2BXTH 2Z9KA 1S82A 1A0LA 3KEEA 1EAUA 2V0BA 4IC5A 4NG9H 2Z3CA 1H8IH 2D8WA 5F6MA 1ZTKA 2OBOA 1ETRH 4JK6A 1KDQB 1L1NA 2A31A 1GMDF 1XVMA 5GCHG 1LVBA 3K2UA 1AU8A 1TGCA 1FV9A 3VGCB 3RP2A 4Q2KA 4HTCH 1CHOG 1T8MA 3SV2H 1UMAH 1H9IE 4TPYA 1DT2A 3SNEA 3UOPA 4WMDA 5PTPA 2JETB 4X6OA 3MU0A 2THFB 5BPEA 1GBMA 2M5TA 1CT4E 1P2NA 4IBLH 1GMHG 2Z9JA 1EJNA 1PPFE 1K21H 1TOCB 1YKTA 1O35A 1AO5A 3PWBA 1FY1A 3SJIA 5HGGA 5CE1A 3M5OA 2FPZA 2ZCLP 4DJZB 1SGEE 4H4FA 2BZAA 2BQ6B 2ODQA 4AFSA 1GJ9B 4K2YA 2ZGBH 4WXIA 2IPHA 3ZZCA 1O3OA 3P8OA 4NGAH 3V0XA 1GBCA 3QUMP 3S9CA 2ZDAH 1HJAC 1FXYA 3OX7U 1C4U2 2BMGB 3E3TA 3LGIA 5EXLA 2O8MA 1OWJA 3SU3A 1MTNC 1V2QT 3MU4A 1NU9A 1NM6A 2A2XH 4BXWA 3O8BA 3U1IB 1C5OH 3GICB 1OS8A 2QXGA 3MMGA 1F0RA 5GXPA 1F5LA 4MNYA 1UVUH 4FUFA 1E36B 1CU1A 1VCWA 3LJJA 1LHCH 2OLGA 1EOLA 1V2OT 1F5KU 2OCVB 1KTSB 2CHAC 4YZUA 3RXUA 2WPLS 2QXJA 4NZLA 2VGCC 1BZXE 5TCAA 5C1XA 4J1YA 4WXVA 3PMJA 1ZGVA 4AFZA 1EUFA 1T8OA 3RXOA 2FYQA 1E0FD 2FLBH 2BY5X 1K1NA 4AFQA 1KDQA 3QTOH 1KTTB 1GMCG 1SLUB 2TBSA 4HFPB 1Y59T 1EB2A 4K69A 1V2PT 4D7FA 3DA9B 3RXIA 1KY9A 3M61U 1GCDA 1FLEE 1XVOA 3RXGA 4ZMAH 3LT3A 5JDUB 2AGIX 3SGBE 1MU6B 4ISLA 1MD7A 5HM9A 1GI5A 3E1XB 4UE7H 2EC9H 1TABE 2F9UA 2ZHEH 1GHBF 1A3BH 2C90B 4GHQA 2BD7A 5T6GA 3VEQB 2BLVA 3HATH 2BVSH 4BANB 1VGCB 2BB4A 1AE8H 1O3MA 1EPTC 1FONA 3JZ1B 4JYVH 1EX3A 1ANEA 5LGOA 2ZI2H 7GCHG 1MUEB 2A4RA 3OY6U 2A5IA 3W95A 5L30H 3ZZ3A 3TNTA 3A83A 1DUAA 5E0JA 3A85A 3RM0H 2BD9A 2WV4A 1GHWH 1RIWC 2PKSC 4B2AA 4K3JA 1H9LB 2Y5GA 1CBWC 3UTUH 1P9SA 4GPGA 2BY8X 5ESTE 3PMAB 4JYTA 2TRMA 1F0UA 3SQHE 4Q7XA 1OP0A 2AMQA 5E0HA 3VB5A 1KXCA 1GCTC 2BXUH 2XYAA 3ZZ4A 1AHTH 3KNXA 3I77A 2BDGA 1A7SA 1HAPH 7LPRA 2PHBA 2UWLA 5TJXA 1UHBB 4NWLA 1EZXC 2FOCA 3P8NA 4GAWA 1O5DH 1TNHA 1ELAA 3T5FH 4ASHA 1QJ1B 1BTWA 1G3DA 4JZDH 1D6WA 2ZFPH 3BIVH 1C2FA 1ZMJA 3P6ZB 1OWKA 2FTMA 3FANA 1K28D 4FUGA 1BBRK 3RLYH 3VGCC 1A3EH 1HPGA 1WQVH 1Z71A 1FY8E 3PLKA 4NIXA 1ZZZA 3BEIB 2BD5A 1DVAH 2ZFTA 4MVNA 3A84A 1Y3YA 2VIDA 4YESB 2JETC 2Q1JA 1THPB 4XDEA 1ELFA 4KTSA 2F9NA 2OBQA 4Y8XA 2XBYA 2ZO3H 3RU4D 4Y71A 1D9IA 1TB6H 3LH1A 2HPQH 3A8CA 1ELDE 4X1SU 2Y82A 1MKWH 1C1QA 1S6FA 1MKXH 2BX3A 1VJ9U 2ZFRH 4DCDA 2ALVA 1LHEH 4U01A 5A0BA 1LHFH 1RD3B 2CGAA 2HOBA 3LKWA 3U8OH 1MAYA 4MNWA 3RU4T 2VH6A 1A2CH 3RXFA 1CO7E 1BTHH 3BTTE 3TIUA 1ZRKA 3SNBA 2BD2A 1O3JA 1QA7A 3DHKH 4XFQA 3VB4A 2D1JA 4UFDH 5E2OA 1N8OB 3W94A 1KXEA 2JKHA 1Y3UA 1O2XA 3E0PB 1C1TA 1MD8A 1DICA 1HAYB 2W5EA 3SUDA 4UFEH 4FVDA 2STBE 3A82A 2R9PA 3P92A 4Y11E 3RC6A 1DITH 1G3CA 2G81E 2RA0A 2K1QA 1CE5A 2VWOA 1ZSJA 1RTFB 3A86A 3M3SA 2JH6D 1AVXA 1TOMH 3SHAH 1MMJN 1O30A 3FFGA 1SGRE 1BTYA 4CRGA 1AD8H 2P3FH 3G01A 3ZVEA 1FY4A 3ZZ8A 2PUQH 2ZFFH 1C2IA 1Z6EA 2Z94A 1EOJA 5AF9H 1LPKB 1JBUH 2EEKA 2BHGA 1UHBA 1AWHB 3MI4A 1C5YB 5A8ZA 1V2JT 2ZGHA 4E06H 3IG6B 4TY7A 2QF0A 1PPHE 1UTQA 3O8RA 1TGSZ 2OP9A 2EA3A 4UD9H 1UJ1A 3AVZA 2D2DA 2H5CA 2J94A 1TNJA 5IDKA 1SGFA 2F3CE 1QL7A 2BDIA 3NZIA 3ZZBA 1LQEA 2UWPA 3NUMA 9LPRA 2GVFA 4I33A 2A45B 2VINA 3V7TA 3SU1A 5LH8A 4HGCA 2VVUA 3Q00A 3RU4E 1W0ZU 2KAIB 3ENSB 4MPVA 5FXLA 1VGCC 3RMNH 2QF3A 1BMMH 3IITA 5C5OA 2ZKSA 1ID5H 3OTJE 2FI5E 1QCPA 1YCPH 3F1SB 1W13U 4UFFH 1SOZA 3SNDA 4X2YA 2HALA 3EDXB 3SBKA 5E0GA 5A8YA 1CT0E 9ESTA 1O34A 4DOQA 3RXQA 1ESBA 1O5BB 4GCHG 2GTBA 1YLCA 1FDPA 4NSYA 1BIOA 2BYAX 1MZDA 1G9IE 2GCTB 1S84A 1KLIH 2FIRH 1NRNH 1C2MA 3F68H 4R0IA 1G2LA 4ABBA 1J16A 2ZTYA 1O2TA 1YGCH 2XW9A 1Q3XA 3RXJA 1QB9A 5F8TA 3MNXA 4WY3A 4FUCA 2GV7A 2I6SA 5LPEA 1PPGE 1GI6A 3TVJB 1GVZA 1E35B 2ZF0H 4B76A 3Q3XA 1C9PA 1GHZA 2RA3A 4Y8YA 1ZRBA 1TRNA 1W8BH 1JOUB 1JMOH 3S7KB 1DS2E 1AWFH 1QY6A 2GCHF 2YNAA 2ZU2A 4M7GA 2CF9H 2AIPA 1EAXA 6ESTA 1ZPBA 4ZKNU 2A1DB 1WSSH 3SV6A 1ZMNA 1AMHA 2Y5FA 1GJBB 4OS6A 1BMAA 3M37A 1W12U 3KCGH 1CA8B 4ZHAA 2V3OH 1A1RA 1O3IA 2PWXA 1O3AA 2FODA 2ZPRA 2H5DA 4YT6H 4U2WA 6GCHF 2GT8A 3QX5H 1O3GA 3UREA 3PTBA 1GI4A 3E90B 2BD3A 1J17T 1T7CA 4Y79A 1SHYA 2ESTE 3GDUA 2VIOA 3M5MA 1NO9H 1GDNA 1C5UA 1D6RA 1EAWA 4MDSA 3UR9A 1O5EH 4RKJB 2SNVA 1JRSA 1ELCA 2ZTXA 2O9QA 3BTGE 3RC5A 1YCPM 1YPLH 1BMLA 1XUIA 2UUJB 2VIQA 1Y3VA 4SGAE 4Q80A 1HJ9A 4D9RA 2FESH 1AUJA 2CF8H 1G2MA 1CA0B 3LPRA 2Z6BD 2AH4X 3UPEA 1ZPCA 1H9HE 1GBBA 2F9OA 2Z3EA 1QRZA 4BNRA 1A46H 1CGJE 1P2QA 1N8OC 3MO3A 3A89A 3GCNA 3SNAA 2GDEH 2AGEX 1SB1H 4B74A 5DKMA 1TPAE 3SO3A 3SU5A 1S85A 3EE0B 1GHXH 3TGIE 1RTLA 1NY22 3GCTF 2P3UB 4ZHMU 2WPMS 3IWMA 5T6FA 3BG8A 1XUFA 2XWBI 1WTHD 1HAHH 4A1VA 3MFJA 1O31A 4DIHH 1DLEA 3MH5A 1O3PB 2HWLB 2ZDVH 2SNWA 3KHVA 3S9BA 3ZVFA 4AYYB 1AE5A 1FIZA 1P0SH 2ZEBA