4PROA

Alpha-lytic protease complexed with pro region
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structure of alpha-lytic protease complexed with its pro region.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 54
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4proA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4proA01
4FUFA 2KAIB 1Y59T 1PPCE 4XDEA 1YF4A 1FY3A 4FVDA 4KTSA 3HK3B 1HJAC 2G8TA 2NWNA 1G3CA 1KXCA 4Y0ZE 1N6XA 2OBQA 3LC5A 1TMTH 3SU1A 4NIVA 1TNIA 2SNWA 6CHAB 3RU4E 1GWAA 1O34A 1OYQA 2ASUB 1H9IE 1TRYA 1TX8A 2XC5A 1ZRBA 1DM4B 1UCYK 2YNBA 4AGKA 1BTPA 2R0KA 1N8OC 4X2XA 1MZAA 1ZOMA 3BN9A 1NRNH 1TGNA 1GHYH 1HIAB 2VB0A 3NXPA 2SGEE 5G4BA 1TBZH 1RJXB 2UWLA 4Y7BA 3F1SB 3U8RH 2UWOA 3PO1C 1G2MA 2HPQH 2VIWA 2P16A 2I6SA 1O2MA 1UTOA 3RUOA 5CMXH 1GBEA 1PQ7A 1IQHA 1BCUH 4DY7B 2Z7FE 3TGJE 2FOHA 3RMLH 5DJ7A 1BTHH 3M36A 1BMAA 5GDSH 3QWCH 4Y10E 4A1TA 3GYMA 4I7YH 1EJMA 2ZU5A 1UHBA 1SOTA 4IC5A 5AHGH 4LZ1H 4MQAA 4UFGH 2WPJS 1V2ST 2BY5X 5L30H 4K8BA 1N6YA 4OS6A 3UREA 4MNXA 2ANWA 2A5IA 4SGAE 5A0BA 5I25A 1C2EA 3LGTA 4RSPA 3M37A 4OS7A 2FI3E 3A85A 1VJAU 3MU5A 3RLYH 1O3KA 3GCTF 4BOHA 1ORFA 3GCNA 1PPZA 4A6LA 1A1RA 1DLKB 2RA3A 2AFQB 3HPTB 3BIUH 3KIDU 2J94A 4Z6AH 4NA7A 1SGEE 5JBBS 2Y7ZA 3ATMA 1C5PA 1BHXB 1C9TA 3AVZA 1KY9A 2OC0A 2RA0A 1ABJH 3BTTE 1F5RA 1ETTH 1HJAB 2WPLS 1O5DH 2J4IA 1QJ6B 2OLGA 1DS2E 1ZPCA 3UWJH 5DP8A 1O5CB 1BUIA 1HFDA 5T6FA 3TNTA 4HGCA 1N8OB 1ZR0A 3NZIA 2Q6DA 4WH8A 5A0CA 2QV1A 4BANB 2V3HH 1C2JA 1P0SH 1T31A 1UHBB 1S84A 1JOUB 2ODYB 5EXNA 5F03A 2ZFPH 3PO1B 1AU8A 1GBIA 1V2UT 2BQWB 1GJ6A 1FONA 3JZ2B 2F9VA 2W3KA 3E91A 2BHGA 2ZCHP 1KXAA 1J8AA 4KTUA 1FN8A 3UUZA 1MTWA 1AZ8A 1JMOH 1Y8TA 4E06H 1VITH 1VCWA 1FAKH 3NWUA 3ZZ5A 4ASHA 4NIXA 1C5YB 2PTNA 2Y5HA 2ZGHA 1WYKA 2R3YA 3QLPH 1L4DA 3GCTG 4X6NA 2FS9A 4B2BA 3GY7A 3GY3A 2BY7X 4OGXA 3DD2H 1TGSZ 1DXPA 3OX7U 2K1QA 1MCVA 1O3EA 4FUCA 1O30A 1EPTC 2FTMA 3RXFA 1XXFA 3LU9B 2GVFA 3TH2H 1YLDA 1BRUP 1OWIA 1ZTLA 1DY8A 1O32A 3MU1A 1KXFA 1VGCB 1D3PB 1GHWH 3BTKE 1IQNA 3RXEA 1BT7A 1PPBH 4BAMB 2ZU3A 2TIOA 1C2HA 1TLDA 3TGIE 1TWXB 2GT7A 1MCTA 1F0RA 1EPTA 4F4OC 1SGYE 4Y71A 1GI4A 3S9AA 1NS3A 2BVSH 1W7XH 1GVZA 1GJ8B 3V7TA 3RXRA 3DT0H 1FIWA 1AN1E 2FOMB 3S0NA 4FUHA 2BDHA 4AGJA 1C5SA 1CO7E 1NU7B 1ZZZA 2LNCA 1QQ4A 2FP7B 2OXSA 4BTUB 2CV3A 1IQFA 3M61U 4K60A 4BAHB 1FN6A 1KDQA 5ETXA 1HLTH 1EZSC 3O8CA 4CRDA 3VB5A 4CRCA 1MD8A 1KXBA 3T25A 1TA2A 1DICA 3SNDA 5FAHA 1PPHE 5EODA 3UNQA 2XNIA 3BIVH 3VGCC 3IITA 4JZFH 2GD4B 2CJIA 2TGTA 5JBAS 2BB4A 4JK5A 1GGDB 3M7UA 1P04A 1HV7A 3Q3YA 2HNTF 3RU4T 3HGPA 2WUBA 4X8UH 4AN7A 1J9CH 1A2CH 2A31A 3DUXH 5C5NA 2OBOA 2PW8H 2FIRH 1TNGA 1AI8H 1EOLA 1SBWA 1QCPA 2AMPA 2FOFA 1O37A 5E0HA 5EGMA 2CF9H 2JETB 1QRWA 3OY6U 2OC7A 1NRQH 2YNAA 3EDXB 4ZROA 3BV9B 3UPEA 4AYVB 3C1KA 3M3VA 4X8TH 1EPTB 2WPHS 3Q00A 5EU8A 1XMNB 2Y5GA 4ABAA 5L2YH 1TE0A 1KTSB 1SGNE 2GCHF 1S6FA 1K28D 2VH6A 4K3JA 5FXLA 2G5NA 1GJAB 2EA3A 3LGIA 4D7FA 5JB8S 3TJNA 1OPHB 3ZZ8A 2A4QA 4CH2B 3A88A 2BVXH 5E0GA 3MO6A 3ZVBA 2EI7A 1MTVA 1KDQB 4IGDA 1O39A 1ZMLA 3U8OH 1E38B 1ETRH 2QN5T 1OP0A 2FOCA 5GPIB 4UONA 1J14A 4DVAU 1YP9A 2SGFE 1DPOA 3LKWA 2AGEX 1B0FA 4RKJB 1MAYA 1LHFH 4Y76A 4INLA 1DUEA 2ZPSA 1GBDA 4INKA 1MUEB 1GJ4H 3UWIA 4HTCH 1ABIH 1A46H 1FDPA 1CA8B 3MH4A 1PPEE 2P94A 1WCZA 1HJ9A 3RXVA 1O5GH 2PWXA 3MOCA 3MYWA 3SV9A 1DVAH 1QFKH 1W12U 3ENSB 5F8ZA 1P10A 2HRVA 3EAJA 2VH0A 1YPHC 2CHAB 4NFEA 4FUBA 3SGQE 2C90B 1H8IH 2NU3E 1ANDA 1D9IA 4NG9H 3IWMA 4TY6A 5CE1A 1E34B 1SLUB 2QYIA 2FEQH 4DOQA 1TPPA 1CU1A 2B9LA 3LGWA 3A7XA 2B5TB 1BHXF 1DUAA 3HKJB 4LK4A 1SSXA 3BEFB 5DP3A 3SJKA 1C5RA 1O2YA 1SGPE 1O2PA 1C4Y2 1GBLA 3URCA 1CT4E 2QGRA 2BDGA 3LIWA 1GI3A 2VWOA 1DWDH 3A81A 4TWWA 1K1PA 3U1IB 1GG6C 1E36B 2GCHG 5T6GA 3RXUA 1O2HA 3M5NA 2WPMS 3H7TA 1QQUA 3MWIU 1GHBF 3QK1A 3TLOA 3FAOA 1EAXA 4O03A 3W95A 1KLTA 1IQMA 3M5MA 3LJJA 3T26A 3RXKA 1G36A 2AGGX 1NESE 2J92A 2VIVA 4FUJA 3SZNA 4ESTE 1P2NA 1NN6A 2Z9GA 2BX4A 5ESBA 1ELFA 1T8NA 2XWBI 1OWDA 4JZIA 4ZXYH 2QXGA 1YPEH 1C5NH 3DFJA 4OGYA 1QURH 2A4OA 3PTBA 1P57B 2FESH 3ZYDA 5FBEA 1GJDB 1UK4A 1NM6A 4ABIA 1IQEA 4NA9H 1EZQA 2SGDE 3GDUA 3P70B 3QTOH 1P9UA 7KMEH 1GI1A 1DANH 1DY9A 2Z9JA 5FBIA 3STIA 1HXEH 3FFGA 4ABDA 2FOGA 1FMGA 5EW1H 3VB6A 1IQIA 5T3HA 1Z6JH 1MKXH 1AVWA 1SB1H 3OYPA 4K1SA 1TPSA 5TCAA 8GCHF 1BRAA 3PLBA 1XXDA 1DWBH 4D7GA 2ZA5A 1P2QA 2P3FH 5A8ZA 3QGNB 1HDTH 6GCHF 2FOAA 3GY8A 4NSVA 1EZUC 3G01A 4ZHMU 4X8VH 3TGKE 1VCPA 1Z1JA 5K0HA 4DIHH 1WAYB 1L2EA 5FPSA 4BAQB 1AE8H 2A32A 3S9BA 5DP9A 4R8TB 1XVMA 4ISIH 1GHBG 3U9AH 2O8MA 3I77A 1LVMA 3MI4A 1ELEE 4IS5A 1P2MA 4Y7AA 2OD3B 1C2LA 1EB1H 2PFEA 5FPYA 2FX6A 3P17H 4H42U 3TJUA 2F9UA 2OINA 1BDAA 1NO9H 4Q7YA 2FYRA 2G4TA 1BMNH 2VIQA 3LGUA 1BB0B 1EQ9A 2P8OC 4WXIA 1V2TT 1SFQB 4MNWA 1F7ZA 1UTMA 3K65B 1AE5A 3ZZ3A 1LHDH 1AGJA 3URDA 1B0EA 2H1UA 2TGDA 2D1JA 2ZGBH 4WMFA 4VGCC 5C1UA 2BD5A 2G55A 1D6WA 3PYHA 4JK6A 1O5AB 2GX4A 3SI3H 2A5AA 1PQ8A 2VWNA 1BITA 1NFYA 3MNCA 3HKIB 2J95A 4DT7B 4FU7A 4ABJA 3QZRA 1YPHE 1TALA 1PYTD 4QT8C 3SUFA 1TNLA 4X1SU 6CHAC 2IN2A 3FP6E 5K7RA 4FU9A 8GCHG 1V2OT 1CHOF 2CN0H 3SU6A 2OTVA 1O2UA 1UK3A 1BTZA 1YPLH 2GV7A 1DXWA 2ZGCA 3UNRA 2LPRA 5DP6A 1BTUA 1EATA 3SUDA 2A4GA 6GCHG 2Y81A 3SNEA 1AZZA 2BTCE 4U01A 1TGBA 4UFEH 1EP6A 1YCPH 2ZPQA 2Y82A 4TYDA 4TWYA 5JPMH 1DWCH 1QL8A 3S7KB 1MMJN 1F0TA 1WU1A 4WJG2 1SGFA 1CGHA 3F9HA 3VXEH 1MTNB 1HYLA 2UUFB 3BEUA 1BJUA 1NU9A 4BNRA 7GCHF 3K6YA 1HAYB 5BPEA 4NIYA 3AW0A 1C1RA 1ZPBA 4JCNA 2BLWA 2VJ1A 5EQRA 2ZDMA 3KL6A 4THNH 3KHVA 2WYJA 1OWHA 3E0PB 4JMYA 1OSSA 3TJOA 1C1OA 2BD2A 3M3TA 1FY1A 1O3NA 1GHXH 1V2VT 3QTVH 3MNXA 3SW2B 3RP2A 2P8OB 1O3PB 2XW9A 1AVGH 3PLPA 2GGVB 1F2SE 5C1YA 5HXFA 3RLWH 5H4IB 3GDVA 2O8UA 3K6ZA 4FUGA 4NFFA 3RXIA 1SGQE 4XSKU 1EAUA 5EXMA 3PV4A 1T8OA 3PWCA 4WMDA 4RN6A 1O3GA 2J34A 2WV4A 1CBWB 2BD3A 3MMGA 1HUTH 1WBGB 1HRTH 1UVSH 1XUIA 5E8EH 3RXOA 1AFQC 3ZYEA 1A61H 4M7GA 5AFYH 1VZQH 2XBXA 3A8BA 4ZXXH 4GCHF 3ZVDA 1F92A 1ZRKA 3I29A 2GP9B 2ZP0H 5DP4A 1MKXK 2FWWA 2PHBA 2ZDKA 2WV5A 3V13A 1P3EA 1ZGVA 5DP5A 2GMTC 4YTAA 5LPEA 1THPB 1GI0A 1ANEA 1UK2A 1BRCE 4XE4A 3R0FA 2BOKA 3SJ9A 1TNKA 1DOJA 1OS8A 3LH1A 2M5TA 3PTNA 1G30B 7GCHG 3E90B 2WINI 4IBLH 1ZSLA 3JZ1B 1HAIH 2GZ9A 2R3UA 2VINA 1ZHPA 1LHCH 2FX4A 1LVYA 4GHQA 4LOYH 3EA9A 4ZMAH 3UTUH 4DIIH 3SNBA 3RXDA 2BDCA 4UE7H 4BXWA 1QNJA 3SGAE 4FUIA 1BRBE 4UEHH 4X0WU 1SFIA 1DX5M 2C3SA 3Q76A 3SNCA 1V2RT 1LKAA 1XUFA 1TAWA 1BBRE 5A8XA 3M5OA 1MKWH 2HNTE 4J1YA 3SJIA 3VB3A 1V2JT 1GPZA 2BYAX 2AIPA 3FP8E 1PYTC 2ANMH 4MNYA 5GCHF 1JBUH 5LPFA 1GJ7B 2XYAA 2BM2A 5JBTA 2PUXB 4B73A 4JZ1A 1ELCA 1VGCC 2RG3A 1BMMH 3MU4A 2SGPE 2AERH 1C5UA 2ZNKH 1F5LA 2A0QB 1QB9A 4GCHG 1LMWB 1GJCB 3GOVB 5FX6A 4JYVH 1P03A 2EI8A 1X7AC 4NSYA 4NWKA 1AFQB 4FUDA 2C93B 3A7TA 3F9GA 2JKHA 3M7QA 4GPGA 3LONA 1Z8GA 1YPKH 3BF6H 1GHAF 4MPVA 2ZDVH 2GMTB 2ZHWH 1D4PB 4OS4A 1ELTA 1TRNA 3RXQA 4YT7H 4A1VA 1YCPK 1CGJE 3RMOH 4KP0A 5C67A 1ZPZA 1TPAE 2ODPA 1MAXA 1ZSKA 3A80A 3SNAA 1QL9A 3ZZ4A 5L2ZH 5DK1A 4Q7ZA 3U1JB 2FI4E 1TMUH 1GGDC 4A92A 1TOCB 1INCA 1YPJH 3SI4H 4NCYA 3MU0A 1YPMH 1AFEH 1V2PT 1GBTA 2VIOA 1P05A 1PPGE 5CHAC 1P11E 2JETC 5GCHG 2XTTB 2ZTYA 1TBQH 2ZGJA 3F68H 1CSOE 1QRXA 4ISLA 2BD7A 3RMMH 4D76A 3UY9A 1WTHD 2GT8A 1C1QA 1C1TA 2ZECA 1AHTH 1WQSA 1SGIB 4MG3A 2TPIZ 1GBJA 3GYLB 3ODFA 3PMAB 1EXFA 2OQ5A 3PB1E 4OS1A 4KKDA 3RDZA 4X2VA 1GI8B 1Y3UA 1K1LA 1C5MD 1UTJA 1AO5A 2ODQA 3U8TH 2WPIS 2QY0B 2BLQA 4YZUA 3SU2A 1SOZA 1E35B 2OQUA 4A5TS 5TCCA 1GMHF 2WUCA 2Z9KA 1VITF 3LPRA 1UMAH 1O31A 2QXIA 3N7OA 3ZZ6A 3RXBA 4XBDA 2ESTE 1RGQA 3I78A 1LHEH 3Q3XA 4B71A 1HPGA 1B5GH 1BA8B 1ETSH 2BY9X 4CR9A 2GZ7A 1SVPA 1W10U 1SGDE 5HM2A 2CHAC 1YYY1 2NU0E 2ZTXA 3MHWU 3UR6A 1TX7A 2UUKB 1EJAA 3IG6B 3ZVCA 1BOQA 3P8NA 1Z8IB 4CREA 4AFSA 4WMEA 4ISOA 3GCOA 2CF8H 2Z9LA 2ZI2H 2A5KA 4ISNA 3RM2H 4B1TA 5F8TA 1KSNA 4IC6A 4DJZB 3O8DA 1O0DH 2XBVA 2C8WB 4IW4E 5DGJA 1UVPA 1HNEE 2FYQA 4YOIA 4ZHAA 4CR5A 5CHAB 2ZFTA 1SGCA 1TX6A 3RXGA 1MKWK 2ALPA 4Y0YE 2W3IA 1FI8A 4CHAC 1TB6H 4AZ2B 3RC5A 1QA0A 4K69A 9LPRA 1GDUA 1C2KA 1OOKB 3SV6A 1YGCH 4NA8A 3UQVA 5E2OA 1SQTA 1IQLA 2BDYA 4O97A 1NT1A 3H5CB 2H2ZA 2V6NA 2BXUH 1NRSH 4H6SB 1S81A 3PLKA 3MH7A 4B74A 2BLOA 3E0NB 1GMHG 1VITG 3RU4D 4X1NU 2VGCC 1DLEA 1TRMA 2SFAA 4AORA 1HAZB 1P2IA 1ZTJA 1EJNA 4WVPE 3E6PH 2PTCE 2ZG0H 8LPRA 2Z3CA 2A45B 1K22H 2R2MB 1UJ1A 3TJVA 1EAIA 1XUJA 4IMZA 1FUJA 1RTKA 2UWPA 4U2WA 3ZZAA 4K1EA 1W8BH 1GDQA 2C4FH 3SU0A 1QHRB 2GCTB 1P2KA 1S82A 4ABFA 2HALA 5A0AE 2P3UB 1UTLM 1FIZA 1GJ5H 4Y8ZA 3QO6A 2W7UA 3U69H 2J9NA 1WQVH 1YPGH 1H4WA 2Z6BD 1F0SA 4BAKB 1RTLA 1O2LA 1O3MA 9ESTA 3ODDA 1HCGA 3EA8A 5FX5A 4CH8B 8ESTE 3OSYA 1YCPM 1QBOA 1C2IA 2DE9A 2FLBH 1GCTC 1NRRH 2VIDA 4I8KA 2Q6FA 1O2JA 3E16B 1SGFG 4HFPB 3VEQB 1E0FD 3M7TA 4X6OA 2YOLA 3SV2H 4AYYB 1BJVA 2GZ8A 4Q80A 4CHAB 1ZMNA 2JH6D 1O33A 3A8CA 3A87A 6LPRA 1KYNA 2O8LA 1O36A 2OCVB 1A5HA 4K2YA 1Z71A 4AB8A 2PSXA 1P06A 1IOEA 4I8LA 4B2CA 5GWZA 2A7CA 5C1XA 2BMGB 1NPMA 1Z7KA 2FPZA 1Y5AT 1FLEE 2A4RA 3GICB 1O2NA 2XWAA 2FI5E 5L6NH 4GLYA 2VGCB 1FV9A 5GIBA 1O3OA 1NTPA 1FY4A 1PQ5A 4X8SH 1W0YH 3A84A 1RIWC 1ELVA 1TQ0B 3Q3KA 2ZWLH 2R9PA 3SHCH 2F3CE 1C1WH 5EPNA 4YLUA 2HPPH 3KEEA 3ELAH 1O2TA 4BTIB 4H6TA 4B76A 3MFJA 1HXFH 1ESBA 1CVWH 3SV7A 1K1OA 1GBMA 1G3BA 5A2MH 3GY2A 1HAGE 3ZVEA 3QUMP 2AS9A 3ATIA 1A0LA 1SGTA 4TPYA 1IQJA 1C1NA 1EB2A 1TA6A 2OUAA 1BQYA 2BDIA 1LO6A 2ZHQH 1NFUA 1V2NT 1NROH 4NZQA 5GJ4B 1SQOA 1QJ1B 3BEIB 1KLJH 1G3EA 2B7DH 1O38A 3SQEE 1GBHA 1MTNC 2G4UA 2D8WA 1GCTB 4Y6DA 5AF9H 1SL3A 5LGOA 2Z9IA 1GJ9B 1GVKB 5T6DA 1QTFA 1C5WB 1SPJA 2Y80A 3VB4A 2FLRH 1KXDA 2PGBB 3CS0A 5TJXA 3ATLA 3M3SA 3A8AA 1TONA 3AAUA 3BG4B 4JYTA 4CRGA 2ZO3H 3E1XB 1XUKA 4NWLA 5B6OA 1AKSA 4I8GA 1O3HA 3T62A 1NFXA 2ZC9H 1DDJA 5LPRA 1ACBE 3RXTA 1ANBA 1W3CA 1DT2A 4D9RA 4I31A 4TPIZ 5GXPA 4Y11E 1F5KU 4X6MA 3TK9A 4DCDA 1OXGA 1P12E 3CP7A 2BDAA 3MO3A 2ANYA 1CHGA 2D26C 2ULLA 2QA9E 1RIWB 2Z94A 3ZZDA 4AB9A 3FANA 5EOKA 3T29A 3TITA 1CBWC 1ZJKA 3BTGE 4F49A 3C27B 1PJPA 1H9HE 3P6ZB 2BQ7B 4FVBA 2DE8A 1SGRE 2ZEBA 1D3QB 2HOBA 2ZCLP 4XOJA 3SOSA 1JXPA 1O5BB 1TABE 1WSSH 2Q6GA 1YBWA 2ILNA 5FCRA 1L1NA 3ZV9A 1V6DA 1D3DB 3ATKA 1O2IA 1T4UH 2AGIX 5EQSA 3STJA 1QGFA 3AASA 2NU2E 1RTFB 2R0LA 3B8JA 1AKSB 2GKVE 1GVLA 1DWEH 1TPOA 3L33A 3ZZ9A 3KF2A 1CA0C 3ZVFA 2PGQB 3D65E 5FHTA 1RRKA 3S9CA 1QA7A 4GHTA 1WV7H 3A82A 5EQQA 2Z3DA 2FZZA 2STAE 4LZ4B 2BD8A 2D2DA 2BQ6B 4O3TA 3QDZB 5C20A 1O2SA 1KIGH 2P95A 3HATH 3QX5H 2J38A 1Z8JB 4XBCA 1K1MA 2ZQ1A 1C5LH 5F8XA 2O9QA 2VVUA 5ESTE 1Z8RA 4BAOB 1P09A 2H6MA 4BXSA 2EC9H 4MVNA 5EPYA 1GBCA 1O3AA 1BZXE 3LDXH 1AVXA 3ZZBA 2ZCKP 5FPTA 1EAWA 1GBBA 2Y6TA 1VCQA 1W7GH 3RC4A 1EP5A 4KELA 1O3DA 4R0IA 1BTXA 1TFXA 5EG4A 2SGQE 5HYOA 5IYTA 3RXAA 1OWKA 1S0QA 1T32A 1UVOA 2FM2A 3CS7A 4O3UA 1A3EH 1GJBB 1C1PA 3KQDA 4DGJA 3TNSA 5DP7A 1ZYOA 1GI9B 1CHOG 1JWTA 1UVTH 2XCNA 4Y8YA 3MTYA 1AMHA 2R2WU 3DFLA 2F9NA 4A1XA 1NC6A 5I46H 2CXVA 4GSOA 4MLFB 4UFFH 1Q2WA 1P3CA 1FY8E 4FXGH 2F83A 3NKKA 1HJ8A 1C1VH 1LPKB 3UOPA 2BOHB 2OC8A 1SQAA 3KN2A 3QGJA 2BY6X 2JH0D 1GMDF 1JRSA 1UVUH 2FODA 2H9TH 1A5GH 1CE5A 2C8YB 3CENA 5BRRE 1ZTKA 1JIMA 3MH5A 1WUNH 2ZHFH 1Q3XA 4I32A 1FXYA 1MQ5A 1TGTA 3GDSA 4AOQA 1IHSH 3EQ0H 1RFNA 1O3CA 1Y3VA 5ABWA 1CA0B 3OY5U 4RKOB 3RXMA 1SHHB 2PKSC 2ZIQH 1QB6A 1P2JA 3V12A 1WOFA 3EA7A 1GHVH 2FO9A 3B9FH 3FZDA 1Y3XA 1MQ6A 2F9BH 1THRH 1ZSJA 2A2QH 4FU8A 1QB1A 1QIXB 4J2YB 4X1PU 1T8LA 1V2KT 3QN7A 1DSUA 4ZKSU 1AUTC 1MU6B 1EUFA 2FMJA 2QF3A 2BZAA 2I6QA 1C9PA 2GTBA 4JZEH 3BTDE 1C2MA 1BTWA 1SI5H 1QL7A 1DE7H 2G00A 1IQKA 1AB9C 1GI7B 3EYDA 3A7ZA 1V3XA 3F6UH 3GY6A 3NUMA 1D6RA 1SLVB 2B8OH 5FCKA 3H7OA 1V2LT 3P8FA 1Y3YA 3LJOA 2AMDA 3QZQA 3BTME 5DG6A 2BDBA 1L1JA 2EEKA 3UOUA 1O2KA 8KME2 3A7VA 2GV6A 3VB7A 4CBOA 1AD8H 1GBAA 5LH8A 2XBWA 3MH6A 3PMHB 4GVUA 1AWFH 4E05H 3TU7H 1TGCA 1C1MA 4O9VA 4I33A 4K8YA 3AAVA 2OP9A 1WTGH 1C1SA 5C5OA 1GCDA 1O3JA 1GI6A 2EI6A 3P95A 3PWBA 3W94A 1GMDG 4NZLA 1ZHRA 2VNTA 4K5ZA 4A7IB 2AEIH 1K1IA 4ZKNU 1YLCA 2H5DA 1LKBA 1MTUA 3O8RA 2QF0A 1MTSA 1ZJDA 2BXTH 1T4VH 4E7NA 1MZDA 4ZH8A 4IN1A 1MU8B 5E0JA 1V2QT 1HAPH 2FTLE 2ALVA 3M35A 2PKSB 4ZUHA 4XBBA 1L4ZA 1HBTH 4WY3A 1O3BA 4I8JA 1C4V2 1VJ9U 2ZGXH 4ZKOU 2P3TB 3A86A 2G5VA 3A8DA 1L1GA 1TBRH 5AVDA 3KGPA 1EZXC 4Q2KA 4B75A 5JB9S 3SJ8A 3D23A 1BIOA 2AIQA 4Q7XA 3ZVGA 3SV8A 1NZQH 5IDKA 2PSYA 1AB9B 3RXSA 3BTHE 3MO9A 1H1BA 2HGTH 1FAXA 1TMBH 5JYIA 3RXCA 4CBNA 3BTEE 1QR3E 1Z6EA 1ZMJA 2RDLA 2O8TA 1XM1A 3BG8A 4PROA 1EOJA 3S7HB 1QRZA 1SR5C 3PM3A 1P8VC 4INHA 3EE0B 4U30A 4WWYA 1H8DH 3VFEA 1GHAG 1C2DA 1XUGA 1C1UH 4ABEA 1O2XA 1BTYA 3K9XB 2ZTZA 4GAWA 1O5FH 1F0UA 3GCHC 1TYNA 2QXHA 1BBRH 5A09A 1O2VA 1GI2A 3NPSA 1O3FA 3SQHE 2GCTC 1C5ZB 3VPKA 1YKTA 1K2I1 1LHGH 1HAVA 2HWLB 4JYUH 1ELBA 3BTWE 4MTBA 1QJ7B 1DFPA 4HI3A 4MPXA 3UNSA 4OS2A 3TH4H 1ELDE 4E7RG 1FQ3A 1GL1A 4Z0KA 3RXJA 1PFXC 3K2UA 3SO3A 3UIRA 3BTQE 3SUGA 1O35A 1RD3B 3LGYA 1FY5A 2IJOB 7ESTE 2XBYA 3UQOA 1FPCH 4CRBA 1LPZB 1HAOH 4B2AA 3KNXA 2AH4X 4YESB 2F9PA 3E8LA 2PR3A 3NCLA 1K21H 4KGAA 2GDEH 4OS5A 3E3TA 1C4U2 2W7SA 1J15A 3SORA 1LPGB 1O5EH 2VWLA 2C8ZB 5DO4H 1QY6A 1GBKA 2TRMA 1OYTH 3TH3H 2ZHEH 1G2LA 2DUCA 2W5EA 2FOBA 3DA9B 2THFB 1HGTH 4X2YA 1O2RA 2ANKH 5J4QA 4XFQA 1AUJA 4ABHA 3OU0A 1Q31A 1AY6H 1TIOA 2A1DB 2BZ6H 2QIQA 4MNVA 2ZFSA 1PPFE 1O2GH 3DHKH 2QC2A 1O3IA 2CMYA 4FUEA 2A7HA 3KQCA 1UTNA 1SG8B 1UCYE 1EKBB 1JRTA 1UTPA 1HAVB 2VIPA 2XRCA 3PMJA 1XX9A 1LCYA 2HVXA 5DKMA 1GI5A 2Z3EA 2BX3A 3TK6A 1AIXH 1C5QA 2A7JA 2ZDNA 3S69A 3GCHB 3T27A 4ABBA 4DW2U 2PV9B 3SGBE 2ZU1A 1QBNA 1S5SA 1XUHA 2HLCA 3MNBA 2FS8A 3L6PA 3ATWA 3A89A 1W0ZU 5J4SA 1C5VA 1UO6A 1OWJA 2IOTA 2STBE 2ZU4A 2A2XH 1O2ZA 4AFZA 1CT2E 2ZF0H 4NIWA 2IPHA 2P93A 2VU8E 3T2NA 2TGAA 6ESTA 4CRAA 1W13U 1ZGIA 1LVBA 1T8MA 2CGAA 1A7SA 5HGGA 2ZHDA 1ELAA 1HAXB 3LH3A 5SGAE 4WXVA 1BMLA 1O2OA 2BD9A 5DPAA 4X2WA 2WYGA 3TIUA 3VGCB 1MD7A 1OP8A 2XXLA 3V3MA 1MH0A 1T7CA 3UR9A 3RXPA 1GL0E 1EX3A 1NFWA 3BG4C 2O8WA 1SHYA 3B23B 3Q77A 4MPUA 2Y7XA 1XKAC 2XC0A 4ABGA 2VWMA 1N1LA 2ZU2A 1OKXA 4BTTB 1Y5UT 1SC8U 3LC3A 4WH6A 2NU4E 4AFUA 1VR1H 3P92A 4D9QA 1FPHH 3ESTA 1CGIE 3GISB 3KCGH 1S0RA 2BVRH 1ANCA 1GHZA 3MNSA 1CQQA 2UUYA 2RCEA 3LGVA 3P8OA 2C8XB 1TNJA 2BY8X 4HZHA 1FJSA 3D62A 7LPRA 1V2MT 3RMNH 2ZFRH 1GBFA 3RXLA 1BBRK 1S83A 3ITIA 3KQEA 2ZQ2A 4YO9A 5C3NA 3A7YA 4TY7A 3O8BA 1JIRA 3BTFE 1SLWB 1W14U 4Y8XA 1GDNA 4YOJA 1AWHB 4GUXA 2PKAA 1THSH 4KTCA 4WF8A 1ARCA 1G37A 4U32A 1E37B 1C2FA 4AG2A 2G52A 3LT3A 4K1TA 3M5LA 2ZFQH 4LXBH 1ZHMA 1ELGA 5EXLA 4DG4A 2QAAA 3ZV8A 1O2QA 4X6PA 3AW1A 3ZZCA 3HGNA 3FZZA 1O2WA 1KXEA 1FZZA 1A4WH 2XCFA 3F9FA 5AFZH 1UCYH 1W2KH 2F9OA 1TOMH 3A7WA 2VVCA 3RXHA 4ZKRU 3SU3A 1S6HA 4Y79A 1AQ7A 4CRFA 1OP2A 1MBQA 4NGAH 5HM9A 1L0ZA 3WY8A 1G32B 1YM0A 3EGKH 2ZPRA 3LOXA 1OWEA 3RM0H 3FP7E 1YC0A 2JH5D 3SJOA 3GY4A 4AG1A 5EW2H 2GDDA 2B0FA 3U98H 2W26A 1W11U 2ZFFH 1GG6B 1TQ7B 2ZDAH 3R3GB 1FNIA 1TNHA 2NU1E 1K9OE 1IAUA 3TVJB 3SHAH 3UFAA 1HAHH 1LQDB 2PLXA 1NRPH 2PKAB 3SBKA 4X1QU 4I8HA 4AX9H 1P9SA 3NK8A 4YOGA 1C5OH 1LQEA 2TGPZ 2FOEA 2TBSA 1IQGA 1B7XB 3A83A 1A5IA 1P2OA 1MBMA 1PQAA 3BSQA 1GMCF 2HNTC 4UDWH 4YT6H 2Y5FA 4ZAEA 4ZHLU 1XVOA 1ID5H 3SUEA 1SMFE 1M9UA 3T5FH 1OX1A 2VVVA 2V3OH 1C5TA 2H9EH 1Y3WA 3TK5A 1KLIH 1IHTH 4DURA 4YLQH 1KTTB 3P8GA 1D3TB 3KQBA 3PROA 4MPWA 1ZLRA 1A3BH 2FDAA 2KAIA 3VXFH 1CT0E 1J16A 1RXPA 1P02A 3SN8A 1K1NA 3RC6A 5F6MA 4MDSA 1O3LA 3GY5A 1LDTT 3SU5A 3V0XA 4IN2A 2SGAA 5E2PA 4AFQA 5C2ZA 2QCYA 3D49H 2FXRA 2BD4A 2UUJB 1DSTA 2SNVA 4X1RU 4IMQA 5PTPA 5A8YA 3T28A 2OC1A 5HMAA 1S85A 1EASA 3F9EA 3HK6B 1ARBA 1C2GA 2ZDLA 2ZZUH 2F91A 3PMBB 3ZZ7A 1Z1IA 2QXJA 1HIAA 4H4FA 4UFDH 3FVFB 1SLXB 4YM9A 1C5XB 1QBVH 2G81E 3TPIZ 1Y5BT 1UTQA 1XKBC 4ISHH 1A0JA 1P01A 4D8NA 1J17T 3OTJE 1ESAA 2Q1JA 1DITH 2AMQA 2P59A 4UD9H 2H5CA 2V35A 1UTKA 2AYWA 1NY22 1LTOA 4JZDH 2G51A 2V0BA 1G3DA 1GMCG 1A0HB 1HB0B 2XC4A 3MU8A 2J2UA 1K1JA 2PUQH 3SU4A 2BLVA 1G9IE 1H9LB 1ESTA 3ZVAA 3L3TA 5JDUB 1U6QA 2H9HA 1V2WT 2ZKSA 4SGBE 4VGCB 5JBCS 1RS0A 1LVOA 2WPKS
chains in the Genus database with same CATH superfamily
4FUFA 2KAIB 1Y59T 1PPCE 4XDEA 1YF4A 1FY3A 4FVDA 4KTSA 4OM9A 3HK3B 1HJAC 2G8TA 2NWNA 1G3CA 1KXCA 4Y0ZE 1N6XA 2OBQA 3LC5A 5DSFA 1TMTH 3SU1A 4NIVA 1TNIA 2SNWA 6CHAB 3RU4E 1GWAA 1O34A 1OYQA 2ASUB 1H9IE 1TRYA 1TX8A 2XC5A 1ZRBA 1DM4B 1UCYK 2YNBA 4AGKA 1BTPA 2R0KA 1N8OC 2KCAA 4X2XA 1MZAA 1ZOMA 3BN9A 1NRNH 1TGNA 1GHYH 1HIAB 3DSOA 2VB0A 3NXPA 2SGEE 5G4BA 1TBZH 1RJXB 2UWLA 4Y7BA 3F1SB 3FOAA 3U8RH 2UWOA 3PO1C 1G2MA 2HPQH 2VIWA 2P16A 2I6SA 1O2MA 2PP6A 1UTOA 3RUOA 5CMXH 1GBEA 1PQ7A 1IQHA 1BCUH 4DY7B 2Z7FE 3TGJE 2FOHA 3RMLH 5DJ7A 1BTHH 3M36A 1BMAA 5GDSH 3QWCH 4Y10E 2OK5A 4A1TA 3GYMA 4I7YH 1EJMA 2ZU5A 1UHBA 1SOTA 4IC5A 5AHGH 4LZ1H 4MQAA 4UFGH 2WPJS 1V2ST 2BY5X 5L30H 4K8BA 1N6YA 4OS6A 5EJZA 3UREA 4MNXA 2ANWA 2A5IA 4SGAE 5A0BA 5I25A 1C2EA 3LGTA 4RSPA 3M37A 4OS7A 2FI3E 3A85A 1VJAU 3MU5A 3RLYH 1O3KA 3GCTF 4BOHA 1ORFA 3GCNA 1PPZA 4A6LA 1A1RA 1DLKB 2RA3A 2AFQB 2KCPA 3HPTB 3BIUH 3KIDU 2J94A 4Z6AH 4NA7A 1SGEE 5JBBS 2Y7ZA 3ATMA 1C5PA 1BHXB 1C9TA 3AVZA 1KY9A 2OC0A 2RA0A 1ABJH 3BTTE 1F5RA 1ETTH 1HJAB 2WPLS 1O5DH 2J4IA 1QJ6B 2OLGA 2RFKC 1DS2E 1ZPCA 3UWJH 5DP8A 1O5CB 1BUIA 1HFDA 2V3MA 5T6FA 4AC9A 3TNTA 4HGCA 1N8OB 1ZR0A 3NZIA 2Q6DA 4WH8A 5A0CA 2QV1A 4BANB 2V3HH 1C2JA 1P0SH 1T31A 1UHBB 1S84A 1JOUB 2ODYB 5EXNA 5F03A 2ZFPH 3PO1B 1AU8A 1GBIA 1V2UT 3SZEA 2BQWB 1GJ6A 1FONA 3JZ2B 2F9VA 2W3KA 3E91A 2BHGA 2ZCHP 1KXAA 1J8AA 4KTUA 1FN8A 1FX0B 3UUZA 1MTWA 1AZ8A 1JMOH 1Y8TA 4E06H 1VITH 1VCWA 1FAKH 3NWUA 3ZZ5A 4ASHA 4NIXA 1C5YB 2PTNA 3F2FA 2Y5HA 2ZGHA 1WYKA 2R3YA 3QLPH 1L4DA 3GCTG 3N7EA 4X6NA 2FS9A 4B2BA 3GY7A 3GY3A 2BY7X 4OGXA 3DD2H 1TGSZ 1DXPA 3OX7U 2K1QA 1MCVA 1O3EA 4FUCA 1O30A 1EPTC 2FTMA 3RXFA 1XXFA 3LU9B 2GVFA 3TH2H 2EQNA 5KGOA 1YLDA 1BRUP 1OWIA 1ZTLA 2IPQX 1DY8A 1O32A 3MU1A 1KXFA 1VGCB 1D3PB 1GHWH 3BTKE 3UB0A 1IQNA 3RXEA 1BT7A 1PPBH 4BAMB 2ZU3A 2TIOA 1C2HA 1TLDA 3TGIE 1TWXB 2GT7A 1MCTA 1F0RA 1EPTA 4F4OC 1SGYE 4Y71A 1GI4A 3S9AA 1NS3A 2BVSH 1W7XH 1GVZA 5C17A 1GJ8B 3V7TA 3RXRA 3DT0H 1FIWA 1AN1E 2FOMB 3S0NA 4FUHA 2BDHA 4AGJA 1C5SA 1CO7E 1NU7B 1WDIA 1ZZZA 2LNCA 1QQ4A 2FP7B 2OXSA 4BTUB 2CV3A 1IQFA 3M61U 4K60A 4BAHB 1FN6A 1KDQA 5ETXA 1HLTH 1EZSC 4B6EA 3O8CA 4CRDA 3VB5A 4CRCA 1MD8A 1KXBA 3T25A 1TA2A 2J97A 1DICA 3SNDA 4B6FA 5FAHA 1PPHE 5EODA 3UNQA 2XNIA 3BIVH 3VGCC 3IITA 4JZFH 2GD4B 2CJIA 2TGTA 5JBAS 2BB4A 4JK5A 1GGDB 3M7UA 1P04A 1HV7A 3Q3YA 2HNTF 3RU4T 3HGPA 2WUBA 4X8UH 4AN7A 1J9CH 1A2CH 2A31A 3DUXH 1E1QD 5C5NA 2OBOA 2PW8H 2FIRH 1TNGA 1AI8H 1EOLA 1SBWA 1QCPA 2AMPA 3KQ5A 2FOFA 1O37A 5E0HA 5EGMA 2CF9H 2JETB 1QRWA 3OY6U 3W1EA 2OC7A 1NRQH 2YNAA 3EDXB 4ZROA 3BV9B 5DN6D 3UPEA 4AYVB 2WZQA 3C1KA 3M3VA 4X8TH 1EPTB 2WPHS 3Q00A 5EU8A 1XMNB 2Y5GA 4ABAA 5L2YH 1TE0A 1KTSB 1SGNE 2GCHF 1S6FA 1K28D 2VH6A 4K3JA 5FXLA 2G5NA 1GJAB 2EA3A 3LGIA 4D7FA 5JB8S 3TJNA 1OPHB 3ZZ8A 2A4QA 4CH2B 3A88A 2BVXH 5E0GA 3MO6A 3ZVBA 2EI7A 1MTVA 1KDQB 4IGDA 1O39A 1ZMLA 3U8OH 1E38B 3UAIC 1ETRH 2QN5T 1OP0A 2FOCA 5GPIB 4UONA 1J14A 4DVAU 1YP9A 2SGFE 1DPOA 3LKWA 2AGEX 1B0FA 4RKJB 1MAYA 1LHFH 4Y76A 4INLA 1DUEA 2YMSD 2ZPSA 1GBDA 4INKA 1MUEB 1GJ4H 3UWIA 4HTCH 1ABIH 1A46H 1FDPA 1CA8B 3MH4A 1PPEE 2P94A 1WCZA 1HJ9A 4I86A 3RXVA 1O5GH 2PWXA 3MOCA 3MYWA 3SV9A 1DVAH 1QFKH 1W12U 3ENSB 5F8ZA 1P10A 2HRVA 3EAJA 2VH0A 1YPHC 2CHAB 4TSFD 4NFEA 4HG6A 4FUBA 3SGQE 2C90B 1H8IH 2NU3E 1ANDA 1D9IA 4NG9H 3IWMA 4TY6A 5CE1A 1E34B 1SLUB 2QYIA 2FEQH 5KECA 4DOQA 1TPPA 1CU1A 2B9LA 3LGWA 3A7XA 2LP6A 2B5TB 1BHXF 1DUAA 3HKJB 4LK4A 1SSXA 3BEFB 5DP3A 3SJKA 1C5RA 1O2YA 1SGPE 1O2PA 1C4Y2 1GBLA 3URCA 1CT4E 2QGRA 2BDGA 3LIWA 1GI3A 2VWOA 1DWDH 3A81A 4TWWA 1K1PA 3U1IB 1GG6C 1E36B 2GCHG 5T6GA 3RXUA 1O2HA 3M5NA 2WPMS 3H7TA 1QQUA 3MWIU 1GHBF 3QK1A 3TLOA 3FAOA 1EAXA 4O03A 3W95A 1KLTA 1IQMA 3M5MA 3PRBA 3LJJA 3T26A 3RXKA 1G36A 2AGGX 1VKYA 1NESE 2J92A 2VIVA 4FUJA 3SZNA 4ESTE 1P2NA 1NN6A 2Z9GA 2BX4A 1SQRA 5ESBA 1ELFA 1T8NA 2XWBI 1OWDA 4JZIA 4ZXYH 2QXGA 1YPEH 1C5NH 3DFJA 4OGYA 1QURH 2A4OA 3PTBA 1P57B 2FESH 3ZYDA 5FBEA 1GJDB 1UK4A 1NM6A 4ABIA 1IQEA 4NA9H 1EZQA 2SGDE 3AK5A 3PV5A 3GDUA 3P70B 3QTOH 1P9UA 7KMEH 1GI1A 1DANH 1DY9A 2Z9JA 5FBIA 3STIA 1HXEH 3FFGA 4ABDA 2FOGA 1FMGA 5EW1H 3VB6A 1IQIA 5T3HA 1Z6JH 1MKXH 1AVWA 1SB1H 3OYPA 4K1SA 1TPSA 5TCAA 8GCHF 1BRAA 3PLBA 1XXDA 1DWBH 4F55A 4D7GA 1H8ED 2ZA5A 1P2QA 2P3FH 5A8ZA 3KYGA 3QGNB 1W0JD 1HDTH 6GCHF 2FOAA 3GY8A 4NSVA 1EZUC 3G01A 4ZHMU 4X8VH 3TGKE 1VCPA 1Z1JA 5K0HA 4DIHH 1WAYB 1L2EA 5FPSA 4BAQB 1AE8H 2A32A 5B6LA 3S9BA 5DP9A 4R8TB 1XVMA 4ISIH 1GHBG 3U9AH 2O8MA 3I77A 1LVMA 1YWUA 1ELEE 3MI4A 4IS5A 1P2MA 4Y7AA 2OD3B 1C2LA 1EB1H 2PFEA 5FPYA 2FX6A 3P17H 4H42U 3TJUA 2F9UA 2OINA 1BDAA 1NO9H 4Q7YA 2FYRA 2G4TA 4Q4LA 1BMNH 2KR7A 2VIQA 3LGUA 1BB0B 2YMSC 1EQ9A 2P8OC 4WXIA 1V2TT 1SFQB 4MNWA 1F7ZA 1UTMA 3K65B 1AE5A 3N7DA 3ZZ3A 1LHDH 1AGJA 3URDA 1B0EA 2H1UA 2TGDA 2D1JA 2ZGBH 4WMFA 4VGCC 5C1UA 2BD5A 2G55A 1D6WA 3PYHA 4JK6A 1O5AB 2GX4A 3SI3H 2A5AA 1PQ8A 2VWNA 1BITA 1NFYA 3MNCA 3HKIB 2J95A 4DT7B 4FU7A 4ABJA 3QZRA 1YPHE 1TALA 1PYTD 4QT8C 3SUFA 1TNLA 4X1SU 6CHAC 2IN2A 3FP6E 5K7RA 4FU9A 8GCHG 1V2OT 1CHOF 1YY3A 2CN0H 2QF5A 3SU6A 2OTVA 1O2UA 1UK3A 1BTZA 1YPLH 2GV7A 1DXWA 2KFWA 2ZGCA 5F53A 3UNRA 2LPRA 5DP6A 1BTUA 1EATA 3SUDA 2A4GA 6GCHG 2Y81A 3SNEA 1AZZA 2BTCE 4U01A 1TGBA 4UFEH 1EP6A 1YCPH 2ZPQA 2Y82A 4TYDA 4TWYA 3F2HA 5JPMH 1DWCH 1QL8A 3S7KB 1MMJN 1F0TA 1WU1A 2LELA 4WJG2 1SGFA 1CGHA 3F9HA 3VXEH 1MTNB 1HYLA 2UUFB 3BEUA 1BJUA 1NU9A 4BNRA 7GCHF 3K6YA 1HAYB 5BPEA 4NIYA 3AW0A 1C1RA 1ZPBA 4JCNA 2BLWA 5GNDA 2VJ1A 5EQRA 2ZDMA 3KL6A 4THNH 3KHVA 2WYJA 2L6OA 1OWHA 3E0PB 4JMYA 1OSSA 3TJOA 1C1OA 2BD2A 3M3TA 1FY1A 1O3NA 1GHXH 1V2VT 3QTVH 3MNXA 3SW2B 2YMSB 3RP2A 2P8OB 1O3PB 2XW9A 1AVGH 3PLPA 2GGVB 1F2SE 5C1YA 5HXFA 3RLWH 5H4IB 2KCOA 3GDVA 2O8UA 3K6ZA 4FUGA 4NFFA 3F2GA 3RXIA 1SGQE 4XSKU 1EAUA 5EXMA 3PV4A 1T8OA 3PWCA 4WMDA 4RN6A 1O3GA 2J34A 2WV4A 4Q63A 1CBWB 2BD3A 3MMGA 1HUTH 1WBGB 1HRTH 1UVSH 1XUIA 5E8EH 3RXOA 1AFQC 3ZYEA 1A61H 4M7GA 5AFYH 1VZQH 2XBXA 5HKKD 3A8BA 4ZXXH 1WXRA 4GCHF 3ZVDA 1F92A 1ZRKA 3I29A 2GP9B 2ZP0H 5DP4A 1MKXK 2FWWA 2PHBA 2ZDKA 2WV5A 3V13A 1P3EA 1ZGVA 5DP5A 2M2AA 2GMTC 3OTPA 4YTAA 5LPEA 1THPB 1GI0A 1ANEA 1UK2A 1BRCE 4XE4A 3R0FA 2BOKA 3SJ9A 1TNKA 1DOJA 1OS8A 3LH1A 2M5TA 3PTNA 1G30B 7GCHG 3E90B 2WINI 3FO8D 4IBLH 1ZSLA 3JZ1B 1HAIH 2GZ9A 2R3UA 2VINA 1ZHPA 1LHCH 2FX4A 1LVYA 4GHQA 4LOYH 3EA9A 4ZMAH 3NRLA 3UTUH 4DIIH 3SNBA 3RXDA 4M9FA 2BDCA 4UE7H 4BXWA 1QNJA 3SGAE 4FUIA 1BRBE 4UEHH 4X0WU 1SFIA 1DX5M 2C3SA 3Q76A 3SNCA 1V2RT 1LKAA 1XUFA 1TAWA 1BBRE 2VBCA 5A8XA 3M5OA 1MKWH 2HNTE 4J1YA 3SJIA 3VB3A 1V2JT 1GPZA 2BYAX 3EE7A 2AIPA 3FP8E 1PYTC 2ANMH 4MNYA 5GCHF 1JBUH 5LPFA 1GJ7B 2F43B 2XYAA 2BM2A 5JBTA 2PUXB 4P00A 4B73A 4JZ1A 1ELCA 1VGCC 2RG3A 1BMMH 3MU4A 2SGPE 2AERH 1C5UA 2ZNKH 1F5LA 2A0QB 1QB9A 1NBMD 4GCHG 1LMWB 1GJCB 3GOVB 5FX6A 4JYVH 1P03A 2EI8A 1X7AC 4NSYA 4NWKA 1AFQB 4FUDA 2C93B 3A7TA 3F9GA 2JKHA 3M7QA 3WWFA 4GPGA 3LONA 1Z8GA 1YPKH 3BF6H 1GHAF 4MPVA 2ZDVH 2JJ2D 4TT3D 2GMTB 2ZHWH 1D4PB 4OS4A 1ELTA 1TRNA 3RXQA 4YT7H 4A1VA 1YCPK 1CGJE 3RMOH 4KP0A 5C67A 1ZPZA 1TPAE 2ODPA 1MAXA 1ZSKA 3A80A 3SNAA 3FKSD 1QL9A 3ZZ4A 5L2ZH 5DK1A 4Q7ZA 3U1JB 2FI4E 1TMUH 1GGDC 4A92A 1TOCB 1INCA 1YPJH 3SI4H 4NCYA 3MU0A 1YPMH 1AFEH 1V2PT 1GBTA 4XD7D 2VIOA 1P05A 1PPGE 5CHAC 1P11E 2JETC 5GCHG 2XTTB 2ZTYA 1TBQH 2ZGJA 3F68H 1CSOE 1QRXA 4ISLA 2BD7A 3RMMH 4D76A 3UY9A 1WTHD 2GT8A 1C1QA 5C0UA 1C1TA 2ZECA 1AHTH 1WQSA 1SGIB 4MG3A 2TPIZ 1GBJA 3GYLB 3ODFA 3PMAB 1EXFA 2OQ5A 3PB1E 4OS1A 4KKDA 3RDZA 4X2VA 1GI8B 1Y3UA 1K1LA 1C5MD 1UTJA 1AO5A 2ODQA 3U8TH 2WPIS 2QY0B 2BLQA 4YZUA 3SU2A 1SOZA 1E35B 2OQUA 4A5TS 5TCCA 1GMHF 2WUCA 2Z9KA 1VITF 3LPRA 1UMAH 4Z1MD 1O31A 1QZ8A 2QXIA 3N7OA 3ZZ6A 4RI0A 4FETA 3RXBA 4XBDA 2ESTE 1RGQA 3I78A 1LHEH 3Q3XA 4FOUC 4B71A 1HPGA 1B5GH 1BA8B 1ETSH 2BY9X 4CR9A 2GZ7A 2KCYA 1SVPA 1W10U 1SGDE 5HM2A 2CHAC 1YYY1 2NU0E 2ZTXA 3MHWU 3UR6A 1TX7A 2UUKB 1EJAA 3IG6B 3ZVCA 1BOQA 3P8NA 1Z8IB 4CREA 4AFSA 4WMEA 4ISOA 3GCOA 2CF8H 2Z9LA 2ZI2H 2A5KA 4ISNA 2JJ1D 3RM2H 4B1TA 2EY4C 5F8TA 1KSNA 4IC6A 4DJZB 3O8DA 1O0DH 2XBVA 2C8WB 4IW4E 5DGJA 1UVPA 1HNEE 2FYQA 4YOIA 4ZHAA 4CR5A 5CHAB 2ZFTA 1SGCA 1TX6A 2HLDD 3RXGA 1MKWK 4F48B 2ALPA 4Y0YE 2W3IA 1FI8A 4CHAC 1TB6H 4AZ2B 3RC5A 1QA0A 4K69A 9LPRA 1GDUA 1C2KA 1OOKB 3SV6A 1YGCH 4NA8A 3UQVA 5E2OA 1SQTA 1IQLA 2BDYA 4O97A 1EFRD 1NT1A 3H5CB 2H2ZA 2V6NA 2BXUH 1NRSH 4H6SB 1S81A 3PLKA 3MH7A 4B74A 2BLOA 5EJ1A 3E0NB 1GMHG 1VITG 3RU4D 4X1NU 2VGCC 5C0TA 1DLEA 1TRMA 2SFAA 4AORA 1HAZB 1P2IA 1ZTJA 1EJNA 4WVPE 3E6PH 2PTCE 2ZG0H 8LPRA 2Z3CA 2A45B 1K22H 2R2MB 1UJ1A 2WV9A 3TJVA 1EAIA 1XUJA 4RT1A 4IMZA 1FUJA 1RTKA 2UWPA 4U2WA 2WSSD 3ZZAA 4K1EA 1W8BH 1GDQA 2C4FH 3SU0A 1QHRB 2GCTB 1P2KA 4ASUD 1S82A 4ABFA 2HALA 5A0AE 2K0QA 2KM0A 2P3UB 1UTLM 1FIZA 1GJ5H 4Y8ZA 3QO6A 2W7UA 3U69H 2J9NA 1WQVH 1YPGH 1H4WA 5EJLA 2Z6BD 1F0SA 4BAKB 1RTLA 1O2LA 3WWBA 1O3MA 9ESTA 3ODDA 1HCGA 3EA8A 5HIZA 5FX5A 3OEED 4CH8B 8ESTE 3OSYA 1YCPM 1QBOA 1C2IA 2DE9A 2FLBH 1GCTC 1NRRH 2VIDA 4I8KA 2Q6FA 1O2JA 3E16B 1SGFG 4HFPB 3VEQB 1E0FD 3M7TA 4X6OA 2YOLA 3SV2H 3OEHD 4AYYB 1BJVA 2GZ8A 4Q80A 4CHAB 1ZMNA 2JH6D 1O33A 3A8CA 3A87A 6LPRA 1KYNA 2O8LA 1O36A 2OCVB 1A5HA 4K2YA 1Z71A 4AB8A 2PSXA 1P06A 1IOEA 4I8LA 4B2CA 5GWZA 2A7CA 5C1XA 2BMGB 1NPMA 1Z7KA 2FPZA 1Y5AT 1SKYE 2JDID 1FLEE 2A4RA 3GICB 1O2NA 2XWAA 2FI5E 5L6NH 4GLYA 2VGCB 1FV9A 5GIBA 1O3OA 1NTPA 1FY4A 1PQ5A 3MQKC 3WW7A 4X8SH 1W0YH 3A84A 1RIWC 1ELVA 1TQ0B 3CNRA 3Q3KA 2ZWLH 2R9PA 3SHCH 2F3CE 1C1WH 5EPNA 4YLUA 2HPPH 3KEEA 3ELAH 1O2TA 4BTIB 4H6TA 4B76A 3MFJA 1HXFH 1ESBA 1CVWH 3SV7A 1K1OA 1GBMA 1G3BA 2KZ4A 5A2MH 3GY2A 1HAGE 3ZVEA 3QUMP 2AS9A 3ATIA 1A0LA 1SGTA 4TPYA 1IQJA 1C1NA 1EB2A 1TA6A 2OUAA 1BQYA 2BDIA 1BMFD 1LO6A 2ZHQH 1NFUA 1V2NT 1NROH 4NZQA 5GJ4B 1SQOA 1QJ1B 3BEIB 1KLJH 1G3EA 2B7DH 1O38A 3SQEE 1GBHA 1MTNC 2G4UA 2D8WA 1GCTB 4Y6DA 5AF9H 1SL3A 5LGOA 2Z9IA 1GJ9B 1GVKB 5T6DA 5T1VA 1QTFA 1C5WB 1SPJA 2Y80A 3VB4A 2FLRH 1KXDA 2PGBB 3CS0A 5CHBA 3ATLA 3M3SA 3A8AA 5TJXA 1TONA 3AAUA 3BG4B 4JYTA 4CRGA 2ZO3H 3E1XB 1XUKA 4NWLA 5B6OA 1AKSA 4I8GA 1O3HA 3T62A 1NFXA 2ZC9H 1DDJA 5LPRA 1ACBE 3RXTA 1ANBA 1W3CA 1DT2A 4D9RA 4I31A 4TPIZ 5GXPA 4RT0A 4Y11E 1F5KU 4X6MA 2WPDD 3TK9A 4DCDA 1OXGA 1P12E 3CP7A 2BDAA 3MO3A 2ANYA 1CHGA 2D26C 2ULLA 2QA9E 1RIWB 2Z94A 3ZZDA 4AB9A 3FANA 5EOKA 3T29A 3TITA 1CBWC 1ZJKA 3BTGE 4F49A 3C27B 1PJPA 1H9HE 3P6ZB 2BQ7B 4FVBA 2DE8A 1SGRE 2ZEBA 1D3QB 2HOBA 2ZCLP 5IK2D 4XOJA 3SOSA 1JXPA 1O5BB 1TABE 1WSSH 2Q6GA 1YBWA 2ILNA 5FCRA 1L1NA 3ZV9A 1V6DA 1D3DB 3ATKA 1O2IA 1T4UH 2AGIX 5EQSA 3STJA 1QGFA 3AASA 2NU2E 1RTFB 2R0LA 3B8JA 1AKSB 2GKVE 1GVLA 1DWEH 3DSGA 1TPOA 3L33A 3ZZ9A 3KF2A 1CA0C 3ZVFA 2PGQB 3D65E 5FHTA 1RRKA 3S9CA 1QA7A 4GHTA 1WV7H 3A82A 1KMHB 5EQQA 2WHXA 2Z3DA 3H09A 2FZZA 2STAE 4LZ4B 2BD8A 2D2DA 2BQ6B 4O3TA 3QDZB 5C20A 1O2SA 1KIGH 2P95A 3HATH 3QX5H 2J38A 1Z8JB 4XBCA 1K1MA 2ZQ1A 1C5LH 5F8XA 2O9QA 2VVUA 5ESTE 1Z8RA 4BAOB 1P09A 2H6MA 4BXSA 2EC9H 4MVNA 5EPYA 1GBCA 1O3AA 1BZXE 3LDXH 1AVXA 3ZZBA 2ZCKP 5FPTA 1EAWA 1GBBA 2Y6TA 1VCQA 1W7GH 3RC4A 1EP5A 4KELA 1O3DA 4R0IA 1BTXA 1TFXA 5EG4A 2SGQE 5HYOA 5IYTA 3RXAA 1OWKA 1S0QA 1T32A 1UVOA 2FM2A 3CS7A 4O3UA 1A3EH 1GJBB 1C1PA 3KQDA 4DGJA 3TNSA 5DP7A 1ZYOA 1GI9B 1CHOG 1JWTA 1UVTH 2XCNA 4Y8YA 3MTYA 1AMHA 2R2WU 3OFND 3DFLA 2F9NA 4A1XA 1NC6A 5I46H 5FL7D 2CXVA 4GSOA 4MLFB 4UFFH 1Q2WA 1P3CA 1FY8E 4FXGH 2F83A 3NKKA 1HJ8A 1C1VH 1LPKB 3UOPA 2BOHB 2OC8A 1SQAA 3KN2A 3QGJA 2BY6X 2J5UA 2JH0D 1GMDF 1JRSA 1UVUH 1H8HD 3OE7D 2FODA 2H9TH 2GJGA 1A5GH 1CE5A 2C8YB 3CENA 5BRRE 1ZTKA 1JIMA 3MH5A 1WUNH 2ZHFH 1Q3XA 4I32A 1FXYA 1MQ5A 1TGTA 3GDSA 4AOQA 1IHSH 3EQ0H 1RFNA 1O3CA 1Y3VA 5ABWA 1CA0B 3OY5U 4RKOB 3RXMA 1SHHB 2PKSC 2ZIQH 1QB6A 1P2JA 3V12A 1WOFA 3EA7A 1GHVH 2FO9A 3B9FH 3FZDA 1Y3XA 1MQ6A 2F9BH 1THRH 1ZSJA 2A2QH 4FU8A 1QB1A 1QIXB 4J2YB 4X1PU 1T8LA 1V2KT 3QN7A 1DSUA 4ZKSU 1AUTC 1MU6B 1EUFA 2FMJA 2QF3A 2BZAA 2I6QA 3SYJA 1C9PA 2GTBA 4JZEH 3BTDE 1C2MA 1BTWA 1SI5H 1QL7A 1DE7H 2G00A 1IQKA 1AB9C 1GI7B 3EYDA 3A7ZA 1V3XA 3F6UH 3GY6A 3NUMA 1D6RA 1SLVB 2B8OH 5FCKA 3H7OA 1V2LT 3P8FA 1Y3YA 3LJOA 2AMDA 3QZQA 3BTME 5DG6A 2BDBA 1L1JA 2EEKA 3UOUA 1O2KA 8KME2 3A7VA 2GV6A 3VB7A 4CBOA 1AD8H 1GBAA 5LH8A 2XBWA 3MH6A 3PMHB 4GVUA 1AWFH 4E05H 3TU7H 1TGCA 1C1MA 4O9VA 4I33A 4K8YA 3AAVA 2OP9A 1WTGH 1C1SA 5C5OA 2XOKD 1GCDA 1O3JA 1GI6A 2EI6A 3P95A 3PWBA 3W94A 1GMDG 4NZLA 1ZHRA 2VNTA 4K5ZA 4A7IB 2AEIH 1K1IA 4ZKNU 1YLCA 2H5DA 1LKBA 1MTUA 3O8RA 2QF0A 1MTSA 1ZJDA 2BXTH 1K0HA 1T4VH 4E7NA 2J98A 1MZDA 4ZH8A 4IN1A 1MU8B 5E0JA 1V2QT 1HAPH 2FTLE 2ALVA 3M35A 2PKSB 4ZUHA 4XBBA 1L4ZA 1HBTH 4WY3A 1O3BA 4I8JA 1C4V2 1VJ9U 2ZGXH 2QF4A 4ZKOU 2P3TB 3A86A 2G5VA 1S6LA 3A8DA 1L1GA 1TBRH 5AVDA 3KGPA 1EZXC 4Q2KA 4B75A 5JB9S 3SJ8A 3D23A 1BIOA 2AIQA 4Q7XA 3U28C 3ZVGA 3SV8A 3F3BA 1NZQH 5IDKA 2PSYA 1AB9B 3RXSA 3BTHE 3MO9A 1H1BA 2HGTH 1FAXA 1TMBH 5JYIA 3FN8A 3RXCA 4CBNA 3BTEE 1QR3E 1Z6EA 1ZMJA 2RDLA 2O8TA 1XM1A 3DCLA 3BG8A 4PROA 1EOJA 3S7HB 1QRZA 1SR5C 3PM3A 2IJD1 4ACBA 1P8VC 2J98B 4INHA 3EE0B 4U30A 4WWYA 1H8DH 3VFEA 1GHAG 1C2DA 1XUGA 1C1UH 4ABEA 1O2XA 1BTYA 3K9XB 2ZTZA 4GAWA 1O5FH 1F0UA 3GCHC 1TYNA 2QXHA 1BBRH 5A09A 1O2VA 2CK3D 1GI2A 2W6JD 3NPSA 1O3FA 3SQHE 2GCTC 1C5ZB 3VPKA 1YKTA 1K2I1 1LHGH 1HAVA 2HWLB 4JYUH 1ELBA 3BTWE 4MTBA 1QJ7B 1DFPA 4HI3A 4MPXA 3UNSA 4OS2A 3TH4H 1ELDE 2L74A 4E7RG 1FQ3A 1GL1A 4Z0KA 3RXJA 1PFXC 3K2UA 3SO3A 3UIRA 3BTQE 3SUGA 1O35A 1RD3B 3LGYA 1FY5A 2IJOB 7ESTE 2XBYA 3UQOA 1FPCH 4YXWD 4CRBA 1LPZB 1HAOH 4B2AA 3KNXA 2AH4X 4YESB 2F9PA 3E8LA 2PR3A 3NCLA 1K21H 4KGAA 2GDEH 4OS5A 3E3TA 1C4U2 2W7SA 1J15A 3SORA 1LPGB 1O5EH 2F4LA 2C8ZB 2VWLA 1QY6A 1GBKA 5DO4H 2TRMA 1OYTH 3TH3H 2ZHEH 1G2LA 2DUCA 2W5EA 2FOBA 2XNDD 3DA9B 5EIYA 2THFB 1HGTH 4X2YA 1O2RA 2ANKH 5J4QA 4XFQA 1AUJA 4ABHA 3OU0A 1Q31A 1AY6H 1TIOA 2A1DB 2BZ6H 2QIQA 4MNVA 2ZFSA 1PPFE 1O2GH 3DHKH 2QC2A 1O3IA 2W6ID 2CMYA 4FUEA 2A7HA 3KQCA 1UTNA 1SG8B 1UCYE 1EKBB 1JRTA 1UTPA 1HAVB 2VIPA 2XRCA 3PMJA 1XX9A 1LCYA 2HVXA 5DKMA 1GI5A 2Z3EA 2BX3A 3TK6A 1AIXH 1C5QA 2A7JA 2ZDNA 3S69A 3GCHB 3T27A 4ABBA 4DW2U 2PV9B 3SGBE 1UW7A 2ZU1A 1QBNA 1S5SA 1XUHA 2HLCA 3MNBA 2FS8A 3L6PA 3ZIAD 3ATWA 3F0OA 3A89A 1W0ZU 5J4SA 1C5VA 1UO6A 1OWJA 2IOTA 2STBE 2ZU4A 2A2XH 1O2ZA 4AFZA 1CT2E 2ZF0H 4NIWA 2IPHA 2KX4A 2P93A 1E79D 2VU8E 3T2NA 2TGAA 6ESTA 4CRAA 1W13U 1ZGIA 1LVBA 1T8MA 5KEDA 2CGAA 1A7SA 5HGGA 2ZHDA 1ELAA 1HAXB 3LH3A 5SGAE 4WXVA 1BMLA 1O2OA 2BD9A 5DPAA 4X2WA 2WYGA 3TIUA 3VGCB 1MD7A 1OP8A 2XXLA 3V3MA 1MH0A 1T7CA 3UR9A 3RXPA 1GL0E 1EX3A 1NFWA 3BG4C 2O8WA 1SHYA 3B23B 3Q77A 4MPUA 2Y7XA 1XKAC 2XC0A 4ABGA 2VWMA 4XRNA 1N1LA 2ZU2A 1OKXA 4BTTB 1Y5UT 1SC8U 3LC3A 4WH6A 2NU4E 4AFUA 1VR1H 3P92A 4D9QA 4P02A 1FPHH 3ESTA 1CGIE 3GISB 3KCGH 1S0RA 2BVRH 1ANCA 1GHZA 3MNSA 1CQQA 2UUYA 2RCEA 3LGVA 3P8OA 2C8XB 1TNJA 2BY8X 4HZHA 1FJSA 3D62A 7LPRA 1V2MT 3OAAD 3RMNH 2ZFRH 1GBFA 3RXLA 1BBRK 1S83A 3ITIA 3KQEA 3VG8A 2ZQ2A 4YO9A 5C3NA 3A7YA 4TY7A 3O8BA 1JIRA 3BTFE 1SLWB 1W14U 4Y8XA 1GDNA 4YOJA 1YLNA 1AWHB 4GUXA 2PKAA 4ZCNA 1THSH 4KTCA 4WF8A 1ARCA 1G37A 4U32A 1E37B 1C2FA 4AG2A 2G52A 3LT3A 4K1TA 3M5LA 2ZFQH 4LXBH 1ZHMA 1ELGA 5EXLA 4DG4A 2QAAA 3ZV8A 1O2QA 4X6PA 3AW1A 3ZZCA 3HGNA 3FZZA 1O2WA 1KXEA 1FZZA 1A4WH 1NBME 2XCFA 3F9FA 5AFZH 1UCYH 1W2KH 2F9OA 1COWD 1TOMH 3A7WA 2VVCA 3RXHA 4ZKRU 2K8IA 3SU3A 1S6HA 4Y79A 1AQ7A 4CRFA 1OP2A 1MBQA 4NGAH 5HM9A 1L0ZA 5C94A 3WY8A 1G32B 1YM0A 3EGKH 2ZPRA 3LOXA 1OWEA 5CDFE 3RM0H 3FP7E 1YC0A 2JH5D 3SJOA 3GY4A 2AHME 4AG1A 5EW2H 2GDDA 2B0FA 3U98H 2W26A 1W11U 2ZFFH 1GG6B 1TQ7B 2ZDAH 3PRDA 3PV2A 3R3GB 1FNIA 1TNHA 2QE7D 2NU1E 1K9OE 1OHHD 1IAUA 3TVJB 3SHAH 3UFAA 1HAHH 4DT4A 1LQDB 2PLXA 1NRPH 2PKAB 3SBKA 4X1QU 4I8HA 4AX9H 1P9SA 3NK8A 4YOGA 1C5OH 1LQEA 2TGPZ 2FOEA 2TBSA 1IQGA 1B7XB 3A83A 1A5IA 1P2OA 1MBMA 1PQAA 3BSQA 1GMCF 2HNTC 4UDWH 4YT6H 2Y5FA 3F0PA 4ZAEA 4ZHLU 1XVOA 1ID5H 2JIZD 3SUEA 1SMFE 1M9UA 3T5FH 1OX1A 2VVVA 2V3OH 2HVYB 1C5TA 4ACAA 2H9EH 1Y3WA 3TK5A 1KLIH 1IHTH 4DURA 4YLQH 3KYFA 1KTTB 3P8GA 1D3TB 3KQBA 3PROA 4MPWA 1ZLRA 1A3BH 2FDAA 3N99A 2KAIA 3VXFH 1CT0E 1J16A 1RXPA 1P02A 1MABB 3SN8A 1K1NA 3RC6A 5F6MA 1W0KD 4MDSA 1O3LA 3GY5A 1LDTT 3SU5A 3V0XA 2RDEA 4IN2A 2SGAA 5E2PA 4AFQA 5C2ZA 2QCYA 3D49H 2FXRA 2BD4A 2UUJB 1DSTA 2SNVA 4X1RU 4IMQA 3GS9A 5PTPA 5A8YA 3T28A 2OC1A 5HMAA 1S85A 1EASA 3F9EA 3HK6B 1ARBA 1C2GA 2ZDLA 2ZZUH 2F91A 3PMBB 3ZZ7A 1Z1IA 2QXJA 1HIAA 4H4FA 4UFDH 3FVFB 1SLXB 4YM9A 1C5XB 1QBVH 2G81E 5HIYA 3TPIZ 1Y5BT 1UTQA 1XKBC 4ISHH 1A0JA 1P01A 4D8NA 1J17T 3OTJE 1ESAA 2Q1JA 1DITH 2AMQA 2P59A 4UD9H 2H5CA 2V7QD 2V35A 1UTKA 2AYWA 1NY22 1LTOA 4JZDH 2G51A 2V0BA 1G3DA 1GMCG 1A0HB 1HB0B 2XC4A 3MU8A 2J2UA 1K1JA 2PUQH 3SU4A 2BLVA 1G9IE 1H9LB 1ESTA 3ZVAA 3L3TA 5JDUB 3DSPA 1U6QA 2H9HA 1V2WT 2ZKSA 4SGBE 4VGCB 5JBCS 1E1RD 1RS0A 1LVOA 2WPKS
chains in the Genus database with same CATH topology
4FUFA 2KAIB 1Y59T 1PPCE 4XDEA 1YF4A 1FY3A 4FVDA 4KTSA 3HK3B 1HJAC 2G8TA 2NWNA 1G3CA 1KXCA 4Y0ZE 1N6XA 2OBQA 3LC5A 1TMTH 3SU1A 4NIVA 1TNIA 2SNWA 6CHAB 3RU4E 1GWAA 1O34A 1OYQA 2ASUB 1H9IE 1TRYA 1TX8A 2XC5A 1ZRBA 1DM4B 1UCYK 2YNBA 4AGKA 1BTPA 2R0KA 1N8OC 4X2XA 1MZAA 1ZOMA 3BN9A 1NRNH 1TGNA 1GHYH 1HIAB 2VB0A 3NXPA 2SGEE 5G4BA 1TBZH 1RJXB 2UWLA 4Y7BA 3F1SB 3U8RH 2UWOA 3PO1C 1G2MA 2HPQH 2VIWA 2P16A 2I6SA 1O2MA 1UTOA 3RUOA 5CMXH 1GBEA 1PQ7A 1IQHA 1BCUH 4DY7B 2Z7FE 3TGJE 2FOHA 3RMLH 5DJ7A 1BTHH 3M36A 1BMAA 5GDSH 3QWCH 4Y10E 4A1TA 3GYMA 4I7YH 1EJMA 2ZU5A 1UHBA 1SOTA 4IC5A 5AHGH 4LZ1H 4MQAA 4UFGH 2WPJS 1V2ST 2BY5X 5L30H 4K8BA 1N6YA 4OS6A 3UREA 4MNXA 2ANWA 2A5IA 4SGAE 5A0BA 5I25A 1C2EA 3LGTA 4RSPA 3M37A 4OS7A 2FI3E 3A85A 1VJAU 3MU5A 3RLYH 1O3KA 3GCTF 4BOHA 1ORFA 3GCNA 1PPZA 4A6LA 1A1RA 1DLKB 2RA3A 2AFQB 3HPTB 3BIUH 3KIDU 2J94A 4Z6AH 4NA7A 1SGEE 5JBBS 2Y7ZA 3ATMA 1C5PA 1BHXB 1C9TA 3AVZA 1KY9A 2OC0A 2RA0A 1ABJH 3BTTE 1F5RA 1ETTH 1HJAB 2WPLS 1O5DH 2J4IA 1QJ6B 2OLGA 1DS2E 1ZPCA 3UWJH 5DP8A 1O5CB 1BUIA 1HFDA 5T6FA 3TNTA 4HGCA 1N8OB 1ZR0A 3NZIA 2Q6DA 4WH8A 5A0CA 2QV1A 4BANB 2V3HH 1C2JA 1P0SH 1T31A 1UHBB 1S84A 1JOUB 2ODYB 5EXNA 5F03A 2ZFPH 3PO1B 1AU8A 1GBIA 1V2UT 2BQWB 1GJ6A 1FONA 3JZ2B 2F9VA 2W3KA 3E91A 2BHGA 2ZCHP 1KXAA 1J8AA 4KTUA 1FN8A 3UUZA 1MTWA 1AZ8A 1JMOH 1Y8TA 4E06H 1VITH 1VCWA 1FAKH 3NWUA 3ZZ5A 4ASHA 4NIXA 1C5YB 2PTNA 2Y5HA 2ZGHA 1WYKA 2R3YA 3QLPH 1L4DA 3GCTG 4X6NA 2FS9A 4B2BA 3GY7A 3GY3A 2BY7X 4OGXA 3DD2H 1TGSZ 1DXPA 3OX7U 2K1QA 1MCVA 1O3EA 4FUCA 1O30A 1EPTC 2FTMA 3RXFA 1XXFA 3LU9B 2GVFA 3TH2H 1YLDA 1BRUP 1OWIA 1ZTLA 1DY8A 1O32A 3MU1A 1KXFA 1VGCB 1D3PB 1GHWH 3BTKE 1IQNA 3RXEA 1BT7A 1PPBH 4BAMB 2ZU3A 2TIOA 1C2HA 1TLDA 3TGIE 1TWXB 2GT7A 1MCTA 1F0RA 1EPTA 4F4OC 1SGYE 4Y71A 1GI4A 3S9AA 1NS3A 2BVSH 1W7XH 1GVZA 1GJ8B 3V7TA 3RXRA 3DT0H 1FIWA 1AN1E 2FOMB 3S0NA 4FUHA 2BDHA 4AGJA 1C5SA 1CO7E 1NU7B 1ZZZA 2LNCA 1QQ4A 2FP7B 2OXSA 4BTUB 2CV3A 1IQFA 3M61U 4K60A 4BAHB 1FN6A 1KDQA 5ETXA 1HLTH 1EZSC 3O8CA 4CRDA 3VB5A 4CRCA 1MD8A 1KXBA 3T25A 1TA2A 1DICA 3SNDA 5FAHA 1PPHE 5EODA 3UNQA 2XNIA 3BIVH 3VGCC 3IITA 4JZFH 2GD4B 2CJIA 2TGTA 5JBAS 2BB4A 4JK5A 1GGDB 3M7UA 1P04A 1HV7A 3Q3YA 2HNTF 3RU4T 3HGPA 2WUBA 4X8UH 4AN7A 1J9CH 1A2CH 2A31A 3DUXH 5C5NA 2OBOA 2PW8H 2FIRH 1TNGA 1AI8H 1EOLA 1SBWA 1QCPA 2AMPA 2FOFA 1O37A 5E0HA 5EGMA 2CF9H 2JETB 1QRWA 3OY6U 2OC7A 1NRQH 2YNAA 3EDXB 4ZROA 3BV9B 3UPEA 4AYVB 3C1KA 3M3VA 4X8TH 1EPTB 2WPHS 3Q00A 5EU8A 1XMNB 2Y5GA 4ABAA 5L2YH 1TE0A 1KTSB 1SGNE 2GCHF 1S6FA 1K28D 2VH6A 4K3JA 5FXLA 2G5NA 1GJAB 2EA3A 3LGIA 4D7FA 5JB8S 3TJNA 1OPHB 3ZZ8A 2A4QA 4CH2B 3A88A 2BVXH 5E0GA 3MO6A 3ZVBA 2EI7A 1MTVA 1KDQB 4IGDA 1O39A 1ZMLA 3U8OH 1E38B 1ETRH 2QN5T 1OP0A 2FOCA 5GPIB 4UONA 1J14A 4DVAU 1YP9A 2SGFE 1DPOA 3LKWA 2AGEX 1B0FA 4RKJB 1MAYA 1LHFH 4Y76A 4INLA 1DUEA 2ZPSA 1GBDA 4INKA 1MUEB 1GJ4H 3UWIA 4HTCH 1ABIH 1A46H 1FDPA 1CA8B 3MH4A 1PPEE 2P94A 1WCZA 1HJ9A 3RXVA 1O5GH 2PWXA 3MOCA 3MYWA 3SV9A 1DVAH 1QFKH 1W12U 3ENSB 5F8ZA 1P10A 2HRVA 3EAJA 2VH0A 1YPHC 2CHAB 4NFEA 4FUBA 3SGQE 2C90B 1H8IH 2NU3E 1ANDA 1D9IA 4NG9H 3IWMA 4TY6A 5CE1A 1E34B 1SLUB 2QYIA 2FEQH 4DOQA 1TPPA 1CU1A 2B9LA 3LGWA 3A7XA 2B5TB 1BHXF 1DUAA 3HKJB 4LK4A 1SSXA 3BEFB 5DP3A 3SJKA 1C5RA 1O2YA 1SGPE 1O2PA 1C4Y2 1GBLA 3URCA 1CT4E 2QGRA 2BDGA 3LIWA 1GI3A 2VWOA 1DWDH 3A81A 4TWWA 1K1PA 3U1IB 1GG6C 1E36B 2GCHG 5T6GA 3RXUA 1O2HA 3M5NA 2WPMS 3H7TA 1QQUA 3MWIU 1GHBF 3QK1A 3TLOA 3FAOA 1EAXA 4O03A 3W95A 1KLTA 1IQMA 3M5MA 3LJJA 3T26A 3RXKA 1G36A 2AGGX 1NESE 2J92A 2VIVA 4FUJA 3SZNA 4ESTE 1P2NA 1NN6A 2Z9GA 2BX4A 5ESBA 1ELFA 1T8NA 2XWBI 1OWDA 4JZIA 4ZXYH 2QXGA 1YPEH 1C5NH 3DFJA 4OGYA 1QURH 2A4OA 3PTBA 1P57B 2FESH 3ZYDA 5FBEA 1GJDB 1UK4A 1NM6A 4ABIA 1IQEA 4NA9H 1EZQA 2SGDE 3GDUA 3P70B 3QTOH 1P9UA 7KMEH 1GI1A 1DANH 1DY9A 2Z9JA 5FBIA 3STIA 1HXEH 3FFGA 4ABDA 2FOGA 1FMGA 5EW1H 3VB6A 1IQIA 5T3HA 1Z6JH 1MKXH 1AVWA 1SB1H 3OYPA 4K1SA 1TPSA 5TCAA 8GCHF 1BRAA 3PLBA 1XXDA 1DWBH 4D7GA 2ZA5A 1P2QA 2P3FH 5A8ZA 3QGNB 1HDTH 6GCHF 2FOAA 3GY8A 4NSVA 1EZUC 3G01A 4ZHMU 4X8VH 3TGKE 1VCPA 1Z1JA 5K0HA 4DIHH 1WAYB 1L2EA 5FPSA 4BAQB 1AE8H 2A32A 3S9BA 5DP9A 4R8TB 1XVMA 4ISIH 1GHBG 3U9AH 2O8MA 3I77A 1LVMA 3MI4A 1ELEE 4IS5A 1P2MA 4Y7AA 2OD3B 1C2LA 1EB1H 2PFEA 5FPYA 2FX6A 3P17H 4H42U 3TJUA 2F9UA 2OINA 1BDAA 1NO9H 4Q7YA 2FYRA 2G4TA 1BMNH 2VIQA 3LGUA 1BB0B 1EQ9A 2P8OC 4WXIA 1V2TT 1SFQB 4MNWA 1F7ZA 1UTMA 3K65B 1AE5A 3ZZ3A 1LHDH 1AGJA 3URDA 1B0EA 2H1UA 2TGDA 2D1JA 2ZGBH 4WMFA 4VGCC 5C1UA 2BD5A 2G55A 1D6WA 3PYHA 4JK6A 1O5AB 2GX4A 3SI3H 2A5AA 1PQ8A 2VWNA 1BITA 1NFYA 3MNCA 3HKIB 2J95A 4DT7B 4FU7A 4ABJA 3QZRA 1YPHE 1TALA 1PYTD 4QT8C 3SUFA 1TNLA 4X1SU 6CHAC 2IN2A 3FP6E 5K7RA 4FU9A 8GCHG 1V2OT 1CHOF 2CN0H 3SU6A 2OTVA 1O2UA 1UK3A 1BTZA 1YPLH 2GV7A 1DXWA 2ZGCA 3UNRA 2LPRA 5DP6A 1BTUA 1EATA 3SUDA 2A4GA 6GCHG 2Y81A 3SNEA 1AZZA 2BTCE 4U01A 1TGBA 4UFEH 1EP6A 1YCPH 2ZPQA 2Y82A 4TYDA 4TWYA 5JPMH 1DWCH 1QL8A 3S7KB 1MMJN 1F0TA 1WU1A 4WJG2 1SGFA 1CGHA 3F9HA 3VXEH 1MTNB 1HYLA 2UUFB 3BEUA 1BJUA 1NU9A 4BNRA 7GCHF 3K6YA 1HAYB 5BPEA 4NIYA 3AW0A 1C1RA 1ZPBA 4JCNA 2BLWA 2VJ1A 5EQRA 2ZDMA 3KL6A 4THNH 3KHVA 2WYJA 1OWHA 3E0PB 4JMYA 1OSSA 3TJOA 1C1OA 2BD2A 3M3TA 1FY1A 1O3NA 1GHXH 1V2VT 3QTVH 3MNXA 3SW2B 3RP2A 2P8OB 1O3PB 2XW9A 1AVGH 3PLPA 2GGVB 1F2SE 5C1YA 5HXFA 3RLWH 5H4IB 3GDVA 2O8UA 3K6ZA 4FUGA 4NFFA 3RXIA 1SGQE 4XSKU 1EAUA 5EXMA 3PV4A 1T8OA 3PWCA 4WMDA 4RN6A 1O3GA 2J34A 2WV4A 1CBWB 2BD3A 3MMGA 1HUTH 1WBGB 1HRTH 1UVSH 1XUIA 5E8EH 3RXOA 1AFQC 3ZYEA 1A61H 4M7GA 5AFYH 1VZQH 2XBXA 3A8BA 4ZXXH 4GCHF 3ZVDA 1F92A 1ZRKA 3I29A 2GP9B 2ZP0H 5DP4A 1MKXK 2FWWA 2PHBA 2ZDKA 2WV5A 3V13A 1P3EA 1ZGVA 5DP5A 2GMTC 4YTAA 5LPEA 1THPB 1GI0A 1ANEA 1UK2A 1BRCE 4XE4A 3R0FA 2BOKA 3SJ9A 1TNKA 1DOJA 1OS8A 3LH1A 2M5TA 3PTNA 1G30B 7GCHG 3E90B 2WINI 4IBLH 1ZSLA 3JZ1B 1HAIH 2GZ9A 2R3UA 2VINA 1ZHPA 1LHCH 2FX4A 1LVYA 4GHQA 4LOYH 3EA9A 4ZMAH 3UTUH 4DIIH 3SNBA 3RXDA 2BDCA 4UE7H 4BXWA 1QNJA 3SGAE 4FUIA 1BRBE 4UEHH 4X0WU 1SFIA 1DX5M 2C3SA 3Q76A 3SNCA 1V2RT 1LKAA 1XUFA 1TAWA 1BBRE 5A8XA 3M5OA 1MKWH 2HNTE 4J1YA 3SJIA 3VB3A 1V2JT 1GPZA 2BYAX 2AIPA 3FP8E 1PYTC 2ANMH 4MNYA 5GCHF 1JBUH 5LPFA 1GJ7B 2XYAA 2BM2A 5JBTA 2PUXB 4B73A 4JZ1A 1ELCA 1VGCC 2RG3A 1BMMH 3MU4A 2SGPE 2AERH 1C5UA 2ZNKH 1F5LA 2A0QB 1QB9A 4GCHG 1LMWB 1GJCB 3GOVB 5FX6A 4JYVH 1P03A 2EI8A 1X7AC 4NSYA 4NWKA 1AFQB 4FUDA 2C93B 3A7TA 3F9GA 2JKHA 3M7QA 4GPGA 3LONA 1Z8GA 1YPKH 3BF6H 1GHAF 4MPVA 2ZDVH 2GMTB 2ZHWH 1D4PB 4OS4A 1ELTA 1TRNA 3RXQA 4YT7H 4A1VA 1YCPK 1CGJE 3RMOH 4KP0A 5C67A 1ZPZA 1TPAE 2ODPA 1MAXA 1ZSKA 3A80A 3SNAA 1QL9A 3ZZ4A 5L2ZH 5DK1A 4Q7ZA 3U1JB 2FI4E 1TMUH 1GGDC 4A92A 1TOCB 1INCA 1YPJH 3SI4H 4NCYA 3MU0A 1YPMH 1AFEH 1V2PT 1GBTA 2VIOA 1P05A 1PPGE 5CHAC 1P11E 2JETC 5GCHG 2XTTB 2ZTYA 1TBQH 2ZGJA 3F68H 1CSOE 1QRXA 4ISLA 2BD7A 3RMMH 4D76A 3UY9A 1WTHD 2GT8A 1C1QA 1C1TA 2ZECA 1AHTH 1WQSA 1SGIB 4MG3A 2TPIZ 1GBJA 3GYLB 3ODFA 3PMAB 1EXFA 2OQ5A 3PB1E 4OS1A 4KKDA 3RDZA 4X2VA 1GI8B 1Y3UA 1K1LA 1C5MD 1UTJA 1AO5A 2ODQA 3U8TH 2WPIS 2QY0B 2BLQA 4YZUA 3SU2A 1SOZA 1E35B 2OQUA 4A5TS 5TCCA 1GMHF 2WUCA 2Z9KA 1VITF 3LPRA 1UMAH 1O31A 2QXIA 3N7OA 3ZZ6A 3RXBA 4XBDA 2ESTE 1RGQA 3I78A 1LHEH 3Q3XA 4B71A 1HPGA 1B5GH 1BA8B 1ETSH 2BY9X 4CR9A 2GZ7A 1SVPA 1W10U 1SGDE 5HM2A 2CHAC 1YYY1 2NU0E 2ZTXA 3MHWU 3UR6A 1TX7A 2UUKB 1EJAA 3IG6B 3ZVCA 1BOQA 3P8NA 1Z8IB 4CREA 4AFSA 4WMEA 4ISOA 3GCOA 2CF8H 2Z9LA 2ZI2H 2A5KA 4ISNA 3RM2H 4B1TA 5F8TA 1KSNA 4IC6A 4DJZB 3O8DA 1O0DH 2XBVA 2C8WB 4IW4E 5DGJA 1UVPA 1HNEE 2FYQA 4YOIA 4ZHAA 4CR5A 5CHAB 2ZFTA 1SGCA 1TX6A 3RXGA 1MKWK 2ALPA 4Y0YE 2W3IA 1FI8A 4CHAC 1TB6H 4AZ2B 3RC5A 1QA0A 4K69A 9LPRA 1GDUA 1C2KA 1OOKB 3SV6A 1YGCH 4NA8A 3UQVA 5E2OA 1SQTA 1IQLA 2BDYA 4O97A 1NT1A 3H5CB 2H2ZA 2V6NA 2BXUH 1NRSH 4H6SB 1S81A 3PLKA 3MH7A 4B74A 2BLOA 3E0NB 1GMHG 1VITG 3RU4D 4X1NU 2VGCC 1DLEA 1TRMA 2SFAA 4AORA 1HAZB 1P2IA 1ZTJA 1EJNA 4WVPE 3E6PH 2PTCE 2ZG0H 8LPRA 2Z3CA