4PROA

Alpha-lytic protease complexed with pro region
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
198
structure length
198
Chain Sequence
b'ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Structure of alpha-lytic protease complexed with its pro region.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Serine protease
total genus 54
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4proA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4proA01
1ELAA 1LKBA 2IOTA 3GCHB 1O3EA 1OS8A 4ABBA 4JZFH 1C4Y2 2ZGXH 3KQDA 3S9BA 4VGCB 3F1SB 3LC3A 3FFGA 1WOFA 2BZAA 5EU8A 1LHEH 4CHAB 3UR9A 1JXPA 3EAJA 1ZGIA 3M7QA 5JDUB 2AGGX 4CRAA 1GBBA 1CU1A 5HM2A 1P9SA 4SGAE 4O03A 1LPZB 5HYOA 1O2TA 4X1QU 3UTUH 4H4FA 3LGUA 1BMAA 3SGQE 5G4BA 1OP0A 3B9FH 3E8LA 1HIAA 1EPTC 1ID5H 1O2YA 1GI2A 1V2MT 1HJAC 1C5XB 2HRVA 3ATMA 1Z1IA 4CRCA 2BMGB 2R9PA 1QGFA 1F5KU 1K1MA 3P8OA 3WY8A 3A8DA 4XSKU 1CT2E 1C2MA 1EZXC 4AORA 1HAZB 1MTVA 3F68H 4ZHMU 4XFQA 2G51A 1MCVA 1YPEH 2Y5FA 3LT3A 3PLPA 3UNQA 2A7CA 1EB2A 1SQTA 1RXPA 3V12A 1FY1A 1G2LA 2PKAB 2VB0A 4LOYH 1MAYA 4M7GA 1XUJA 1O3FA 2XBVA 3GY8A 1GHZA 2EEKA 2FP7B 3SU4A 4FU7A 1A3BH 3PLBA 2HGTH 2QN5T 2EA3A 3M36A 5T6GA 1E38B 3QO6A 4DGJA 3CENA 1P02A 1TNJA 1QIXB 1K2I1 3ZZ5A 1ZHPA 3MMGA 2BD4A 2Z3DA 2F9PA 3VPKA 3GOVB 1IQIA 1C1NA 3ZVCA 1P9UA 5BRRE 1UK4A 1P3CA 5GPIB 4BXWA 1DICA 1W3CA 4TYDA 4XOJA 4A5TS 1GBMA 2HVXA 4I31A 1MQ5A 1DWBH 2BVSH 2O8LA 5E8EH 4MG3A 1GMCG 5EW2H 4O9VA 1BB0B 1UK3A 1IQGA 3DFLA 1O5FH 2H5CA 3UNRA 2ZP0H 1GBDA 1FY8E 4FVBA 3RMNH 3A82A 5FHTA 1SHYA 2FO9A 1OOKB 1N1LA 4CBNA 3SU1A 3FP6E 5ETXA 7KMEH 5JB9S 3V7TA 1MKXH 5C2ZA 1ETRH 3FP8E 3VB4A 2BDIA 2FLRH 1UVOA 3BEFB 3T62A 1A7SA 4WMEA 1C2HA 1NPMA 1FAXA 5TJXA 3GY4A 1F0UA 3PWBA 2WYGA 1ZOMA 2P8OC 4K8BA 1SGIB 1ARCA 2GV7A 5IYTA 2FDAA 4ZXYH 1EX3A 5GJ4B 1YKTA 4GHQA 1O2HA 1TRNA 3BTHE 1CSOE 5DP3A 1ZYOA 2GCHF 1CT4E 1O2VA 3ZZ7A 1P11E 1ZHRA 5C1XA 1RRKA 4OS1A 3T25A 5L6NH 1SSXA 1QJ6B 2PWXA 1K1LA 2VINA 1E37B 4BNRA 1LMWB 1KXCA 1C2EA 1OWJA 2BD7A 1K1OA 4U01A 3UWJH 2GX4A 1BITA 2TGPZ 4A92A 1ZRBA 3OX7U 1O3OA 4BTTB 1BUIA 2BM2A 2XXLA 5FCKA 1UTOA 3JZ1B 2KAIA 4YLUA 3MO3A 1FJSA 1O36A 1GMDG 3CS7A 1ELDE 5DP5A 2OLGA 3SU5A 1PQAA 1SGEE 1TPSA 6GCHF 1G32B 4NIXA 1TNHA 4JZDH 1KXBA 1OWKA 2FM2A 2TGAA 1GI1A 2BQWB 4JK5A 1EATA 1VJ9U 1AE8H 2K1QA 4ISNA 1KDQA 1GHBG 1S6HA 3TLOA 5T3HA 3FVFB 1TNGA 4NSVA 4NWLA 3QTVH 1WU1A 4X1PU 4YOIA 1S6FA 4B76A 3K6YA 3DT0H 1NM6A 2V6NA 2QYIA 3A7XA 2R3YA 4DCDA 3SV9A 3SGBE 3SQEE 4DG4A 1KSNA 3F6UH 1V2UT 2ZPRA 3PV4A 3KN2A 2A2QH 3GY5A 4JZEH 1V2KT 1P2MA 1SGTA 2FX4A 1RTLA 1V2VT 1IAUA 1P8VC 4BAMB 2BDAA 4X8UH 5GCHF 1ZSKA 1QL8A 2V3HH 4WMDA 1CGJE 1O5GH 2VWLA 3KEEA 4B71A 1EPTA 2J92A 1BQYA 4I8KA 4X6PA 5F6MA 1HAPH 1PPHE 1NC6A 4X8TH 1C2IA 1G3EA 1EOLA 2BD2A 4CRDA 1WAYB 2ZECA 4NG9H 4D7FA 4ESTE 2A5KA 1TRMA 1FI8A 1K1PA 5AF9H 1GL0E 2ZPQA 1VGCB 3BTQE 4IMQA 1A0HB 1SFQB 3RXLA 3BTWE 2HLCA 1YPJH 1B0FA 3SNDA 3GDUA 4D7GA 2BY6X 4BANB 1C2FA 2CMYA 3STJA 2ZTYA 4KTCA 1O3LA 1C2LA 4K69A 1TMBH 1PPZA 3TGIE 2C8WB 4Y79A 2OUAA 3Q00A 1AN1E 1GGDB 3TH3H 1BJUA 1MCTA 5DP7A 3SHCH 2ZA5A 2H9EH 3ENSB 3M3TA 4RSPA 1FV9A 2DE9A 1WCZA 4BAKB 1V2JT 1NROH 2SNVA 1X7AC 1SGNE 1O2LA 4H6TA 2J38A 2AMDA 1EB1H 1O30A 3BTFE 4MPUA 1ZMNA 3PM3A 1TB6H 8KME2 2D26C 1U6QA 2RDLA 1A4WH 3MU4A 1CBWB 3FAOA 3ZYDA 3I77A 1AVGH 1D4PB 2Y7ZA 1NTPA 4NSYA 3SUFA 4A1VA 2PGQB 3NKKA 2FOCA 2BLVA 2F9OA 2GZ9A 2OBOA 4IC5A 2P95A 2C93B 1FXYA 1SLWB 1DLEA 2WPKS 3E0PB 2QC2A 4AG2A 8GCHF 1JWTA 2AMQA 3PO1C 2NU2E 2ZFSA 1O5CB 1HB0B 4A1TA 1YM0A 2ZCHP 2FI4E 1GHVH 3LH3A 2ODQA 3LIWA 2OC1A 3TH4H 4AYVB 1INCA 4X1NU 2O8WA 3LJOA 1P01A 2BD8A 3BEUA 4K1SA 5EXNA 5AFZH 2BOHB 1GHAG 3PTBA 1EJMA 2R2WU 1F0TA 5K7RA 5LPEA 1SG8B 4GSOA 3TJVA 3SI3H 3GY7A 5EODA 1GBIA 3OSYA 3G01A 3EQ0H 2A7JA 1YF4A 1UTKA 1P2KA 2ZDNA 4NZQA 1UTQA 1JBUH 1GBJA 1QHRB 4WY3A 2O8UA 4UFGH 1HJ9A 2C3SA 2PKAA 3FZZA 3SOSA 1C2GA 1AHTH 3A81A 3SQHE 5BPEA 4X2XA 3ZZAA 4WXIA 4I32A 1C4U2 1T31A 1C5VA 2CF8H 2W7UA 2BVRH 3P70B 2PTNA 1BJVA 3M35A 4KKDA 4ZROA 1PFXC 3EA7A 2STAE 1MTSA 1HAOH 2VGCB 2G81E 1HCGA 4Y76A 1G36A 1GI6A 1XMNB 3OU0A 1KIGH 5E2OA 1B0EA 1FZZA 3ODDA 5EG4A 1C1SA 1MKWK 3ZVFA 2AGIX 2FOFA 1AUJA 3GISB 2FS8A 1BMNH 3AW1A 3B23B 5CHAC 5I25A 1Y5BT 3QGJA 1C5UA 3U9AH 1Y5AT 2FWWA 1GVZA 4FUJA 1F5LA 1SC8U 1P2NA 1Z1JA 2ZWLH 1ZLRA 3MU8A 3D23A 3VB3A 1HFDA 1OYTH 3ZZDA 4UFEH 1K1IA 2B8OH 3KQCA 3MNCA 2BXUH 3BTDE 3SJKA 1G9IE 1EOJA 4F49A 4ZMAH 4B2CA 1EUFA 3PWCA 4X6NA 1CT0E 2EI8A 4ZHLU 1AUTC 2FOHA 4E06H 2W3IA 2BY9X 1O3AA 2Z9KA 5F8ZA 4LXBH 1ELVA 2CJIA 1YPMH 3ZZCA 1GI3A 3O8DA 5JPMH 5FCRA 5DJ7A 1Z8JB 2GCTC 3ZZ3A 3KIDU 2ULLA 3FANA 3M5OA 1O34A 1FY4A 3MNBA 3STIA 3SW2B 1ZR0A 2NU3E 4MNVA 3GCOA 1GI7B 1QURH 2ZFRH 4NGAH 1UMAH 2AIPA 3LGIA 1AE5A 1QB6A 4JZ1A 4Y10E 1V3XA 2O8TA 2ZGCA 3PYHA 4INKA 2J4IA 4WWYA 1BTPA 2A4GA 2WPLS 1J9CH 1V2OT 1C5ZB 1GMCF 3AASA 4YT6H 2FOEA 3RM2H 3A8BA 4B75A 3VB5A 1O3BA 1YCPM 4Q80A 1TA2A 3F9EA 3SORA 4ISIH 2Z7FE 3EYDA 3PMHB 1C2JA 4NA8A 5JBBS 5TCAA 1MQ6A 3ZZ9A 1E0FD 2EI7A 3RU4T 2BQ7B 3T2NA 1XM1A 1F0RA 2SNWA 1O2SA 3Q76A 3K6ZA 1F92A 2PLXA 2J9NA 3HK3B 2Z6BD 1MU8B 4JMYA 5DG6A 3HGPA 2V3OH 5DP8A 3RDZA 3ODFA 2OQ5A 2QF3A 2G55A 4JYUH 1SLXB 1HJAB 3VXFH 1PPBH 1E35B 1FNIA 4Y0YE 4X2VA 1O2ZA 1SFIA 4X8VH 3E1XB 4KP0A 3T26A 2BD5A 1P03A 1C5RA 1O3MA 3MO9A 1SGCA 5A09A 3I29A 1LQDB 4ABEA 3RC6A 1FQ3A 4I8LA 1MTNB 2F9NA 1MKWH 1PPGE 3RXKA 1J14A 4IGDA 2ANKH 2UUKB 1KLTA 1SQAA 3IITA 2ZDMA 1PPFE 1XUIA 3ZVBA 1QL7A 3MH7A 2ZDAH 1WYKA 3GYMA 1DS2E 3VFEA 2FOBA 2PKSC 5FPTA 3ELAH 1NRPH 1BCUH 2Y81A 1WBGB 2UWPA 1UJ1A 1AB9B 1GMDF 1PPCE 4YT7H 1QR3E 2ZF0H 2QY0B 2F83A 3F9FA 5DPAA 5HM9A 3QWCH 3TIUA 1TQ0B 2ZKSA 3A80A 2ZQ1A 4MNYA 5JB8S 5EQSA 5EXLA 4B73A 1GHBF 4U2WA 5DP4A 1VCPA 1DWDH 2Z9JA 3BTGE 1BZXE 2G5NA 1VITG 3EDXB 2VIDA 2ODYB 3U1IB 4X6MA 1CVWH 4KELA 2CHAC 4ZAEA 6CHAC 1IQEA 1GBKA 4I8JA 1UO6A 4QT8C 5C1UA 1O2PA 3GCTG 1UHBA 2ZZUH 1HAHH 1XUHA 1GDNA 3S69A 1CGHA 4RKOB 1LQEA 1Z8RA 4R0IA 1QL9A 1IQHA 1BRBE 1UCYH 1O3GA 4X1SU 3ITIA 2IPHA 2A2XH 1M9UA 1GCTB 1OWHA 2A0QB 2FI5E 4ZKOU 5TCCA 1HBTH 2VIWA 3HK6B 1O2JA 4CH8B 1LVBA 1G3BA 1SI5H 3LJJA 3DHKH 4BAHB 1THRH 1V2TT 1AIXH 2C90B 1GBAA 1N6YA 1JMOH 5ESTE 1UVPA 2VWOA 3ZVGA 1Q2WA 2XNIA 2VIQA 2ALVA 1NN6A 1DWCH 4TWYA 1KXFA 1O2IA 1YPHE 5T6DA 4Y7AA 1EZQA 1O3PB 3LPRA 3PLKA 1P04A 4Z0KA 5HMAA 3UOPA 1O3IA 2BVXH 1AWHB 2HOBA 4GLYA 4K2YA 5PTPA 4YOGA 1LKAA 5EPYA 2G00A 3SNAA 4ASHA 4WVPE 3O8CA 2EI6A 1V2ST 2Y5GA 4ABHA 7LPRA 1O35A 2RA3A 1TGTA 5C3NA 4BTUB 3ESTA 3KGPA 3OYPA 1TMUH 2OD3B 4Y11E 2W26A 1V2WT 1Z8IB 3QGNB 2HALA 1PJPA 1AZZA 1O33A 3A7YA 2FOGA 2VH0A 3VXEH 3CP7A 1K1JA 4CHAC 1AKSA 3RXSA 4WH8A 8ESTE 3E91A 3LGYA 3LKWA 3VGCB 1EAXA 2AIQA 1DVAH 1ZGVA 2THFB 3SV7A 1LHGH 1SGFG 1JIMA 4ISLA 2FXRA 3CS0A 1EP6A 1BRCE 1ESBA 1DUAA 1WSSH 2FTMA 3BTME 1NFXA 1O2QA 4HTCH 1O2KA 2VVVA 5LH8A 3GY6A 4WMFA 2FPZA 1VZQH 3TITA 2XC4A 1O2XA 1C1MA 1TGSZ 4AB9A 1CHGA 3F9HA 3P8NA 5E2PA 1IQFA 3ATKA 1HUTH 1WUNH 1TNKA 2PSXA 5FXLA 4DIHH 2ILNA 1GHAF 5FX6A 4NCYA 2QGRA 1A5HA 1DY8A 3M37A 4Y8ZA 1XUFA 3M3VA 2C4FH 3P6ZB 2VNTA 1MUEB 1NRNH 1LVMA 2B9LA 5FPSA 5GWZA 4OGYA 2WYJA 4FUHA 1ETSH 2A4RA 2VH6A 2BX3A 1BA8B 1TX7A 1C5YB 3M61U 1PYTD 2SGEE 3SV2H 1T8OA 4XBDA 2FODA 1GHWH 4FUDA 3MYWA 1N8OB 2JH6D 1GWAA 1S83A 3Q3YA 1GJAB 1O3HA 1L1NA 1LDTT 1C9TA 1LPGB 2H5DA 4IS5A 4DVAU 1NRSH 1ETTH 1BRUP 3A8AA 2SGPE 1VJAU 1GBCA 3M5LA 3VB7A 2GP9B 1CGIE 3TVJB 2BDBA 1GI5A 2A4QA 1MH0A 2ODPA 4RN6A 3M7TA 5C20A 5A0CA 2ALPA 1EJNA 1RIWB 2DE8A 2R3UA 2VVCA 1EQ9A 2B7DH 4INHA 3RLWH 1QCPA 1BOQA 3V13A 1A1RA 2TIOA 2FESH 1K22H 1F0SA 1SGPE 1V2PT 2AGEX 2XWAA 2BLOA 4AOQA 2Z3CA 2B0FA 2SGFE 1QQ4A 3BEIB 3RC4A 1TPPA 2OC8A 3GCNA 2CN0H 4NIWA 4CRFA 2CGAA 3SNEA 1S81A 3R0FA 3N7OA 1MBQA 3U69H 1TWXB 3UWIA 1GG6B 2FIRH 2QA9E 1GJ4H 3V0XA 1FONA 2H2ZA 1C1RA 4BTIB 3PO1B 4K1EA 3T28A 5EXMA 1C1UH 2ESTE 4I33A 4Q2KA 4K5ZA 1CA0B 3EE0B 1F7ZA 3ZVEA 2OXSA 3U8RH 4ISOA 1JIRA 1FN6A 4J1YA 3UQVA 1V2QT 1NU7B 2QXJA 1D3DB 4WXVA 1AVWA 4CRGA 1BT7A 1IHTH 3MNXA 5J4QA 1MAXA 2TPIZ 3QZQA 1ZSJA 4BAOB 1C1TA 3UR6A 1UTNA 1F5RA 2ZQ2A 1O2UA 2J95A 3TGKE 1A46H 1ORFA 5A2MH 1EAWA 1VR1H 1S82A 4U32A 1O2RA 1YPKH 1QRWA 1H9LB 1W0YH 2ZC9H 1O3DA 3S9CA 1NRRH 1FY3A 4FU8A 1YC0A 2A5AA 3KQEA 2A31A 1SOZA 2BTCE 5A0AE 1O5EH 1SB1H 4H42U 2XBWA 1C5SA 4I7YH 2ZHFH 2WPMS 3KCGH 1BDAA 1MD7A 1QB9A 2ZI2H 2ANMH 3SU6A 1DDJA 2AYWA 5I46H 2BXTH 2YNBA 3HGNA 3LH1A 1Z71A 2GKVE 1HXFH 3TPIZ 2XC5A 3NK8A 1P09A 1XUKA 1C1OA 2Y80A 3PMBB 3LU9B 4XBCA 1HLTH 3OY5U 2VIOA 4I8GA 2D8WA 2ZGJA 1MTUA 4J2YB 4ZHAA 4CH2B 3K9XB 1MMJN 1EKBB 2XWBI 1HAVB 2C8ZB 3B8JA 1ANBA 1DT2A 1YYY1 1HIAB 3BN9A 2ZU2A 4IBLH 5L2YH 1S0QA 4MPVA 3MOCA 1TBRH 1CHOG 1B7XB 3RU4E 1AU8A 3SU2A 2RG3A 4D8NA 1BTUA 2F9VA 1V2LT 4DURA 3HPTB 2IN2A 5L30H 5CHAB 1IOEA 3SJ9A 4LZ4B 3KF2A 2BYAX 2F3CE 1A3EH 3RXRA 5FAHA 1DXWA 5AVDA 3E90B 4TPIZ 1LCYA 4GUXA 2VWMA 1TYNA 3ATLA 3GICB 4IC6A 1ABJH 4AFZA 5CMXH 4DT7B 2OCVB 1G30B 3OTJE 3E16B 1UTPA 1GMHG 2JETB 1V6DA 4MNWA 1O31A 2QV1A 1LO6A 4FUGA 1OSSA 3BG4B 3W94A 5DP9A 1DWEH 1D9IA 1BHXF 1GBLA 1K1NA 1TPOA 4D9QA 2JKHA 3A8CA 5ABWA 1HDTH 3LOXA 4NFEA 2F91A 5EGMA 1XXDA 1P06A 4INLA 3SJ8A 2Z9IA 3SUDA 1O2NA 1GGDC 5E0GA 2FEQH 1BMLA 1YCPK 2BY5X 3UQOA 4GPGA 3SV6A 3T27A 1XKBC 1O5BB 2HNTE 2XW9A 1VITF 2WUBA 1Z8GA 4MPXA 1AFQB 2XTTB 1MU6B 1H9HE 1LHDH 2XCFA 3PTNA 1NFUA 3ZYEA 2FTLE 4BOHA 1OPHB 3RXEA 1DSUA 1A5IA 4UFDH 3GCTF 3HKJB 3MU5A 4SGBE 3M5MA 1Y3XA 4RKJB 1HGTH 3K2UA 3SGAE 1ELCA 1GJBB 2PGBB 1BTYA 1LPKB 3D65E 3RXBA 1AMHA 3I78A 1NU9A 1XX9A 4UONA 1ANDA 1C5MD 3AAVA 3RXQA 3TJNA 1CQQA 1UTLM 5LPFA 1MD8A 4DW2U 2ZHQH 1QJ7B 2ZU1A 5DGJA 2PHBA 4OS5A 2PV9B 1QTFA 1IQLA 1IHSH 1E36B 2TGTA 5CE1A 1BBRK 1FIWA 2O8MA 2OC7A 2ZU5A 3ATIA 3RM0H 2ZHDA 4B1TA 1FAKH 1AGJA 1NY22 5F8TA 2QCYA 4MLFB 2P3UB 1KXDA 3AVZA 3LGTA 1FLEE 3KQBA 5DO4H 2ZNKH 2W5EA 1GHXH 2AERH 4E7RG 2FLBH 1D3PB 4YM9A 3ATWA 4DY7B 4JZIA 2ZDKA 1BBRE 2OTVA 3LGVA 3RMOH 3U8TH 2NU4E 4BAQB 1PYTC 1GVLA 2YOLA 1Q3XA 1QBVH 3KHVA 2ZDVH 3SO3A 4ZH8A 2PUXB 3SNBA 1KXEA 1DM4B 1W14U 2TGDA 4X2WA 1C1VH 5ESBA 4HGCA 1ZTKA 1BHXB 4BXSA 1BTHH 1GI8B 1TALA 1FDPA 4FUCA 3RU4D 2O9QA 1QNJA 1ZTJA 1W0ZU 3RC5A 2JH5D 1QA7A 4ZKSU 1TGCA 2H9TH 1QA0A 3O8BA 2VGCC 3QDZB 4I8HA 4K1TA 1BIOA 3SU0A 4MVNA 4MQAA 1VCWA 3ZV8A 2Q1JA 1IQJA 1G2MA 1IQKA 3Q3XA 1YGCH 1GJ7B 1H4WA 2G5VA 2G8TA 4UDWH 1TBZH 1T4VH 1AZ8A 2ZU3A 1GJDB 2BDYA 6CHAB 2Z9GA 1TABE 2ZFTA 1ACBE 1Y3YA 2QF0A 1XUGA 4MNXA 3RXIA 1YPHC 1O2WA 4IN1A 1EPTB 2ZGHA 4ABDA 1DX5M 1P2OA 3BV9B 3NCLA 4UFFH 1T8MA 3ZZ8A 1D3QB 4X1RU 1C5QA 1O0DH 2V0BA 3IG6B 4AFUA 2XCNA 2Y6TA 3P95A 1ARBA 2ZCLP 1E34B 1P3EA 5C5NA 1A61H 2J34A 4TPYA 1C2KA 5FBIA 1W13U 3MI4A 3QLPH 2WPHS 1YPLH 4CR5A 2HPPH 3NZIA 1TOCB 2QXGA 1C5NH 3K65B 1C1WH 4ABAA 4YO9A 1HPGA 2LPRA 4PROA 4UE7H 5C5OA 1BTXA 1SGYE 1SLUB 2G52A 2VIPA 3AW0A 3BIUH 5IDKA 1GI0A 1HAIH 3D49H 4AGJA 1BMMH 3GDSA 3A86A 2VU8E 3VB6A 1GBHA 4NA7A 1P2QA 2JH0D 1CA8B 1HYLA 5DK1A 1AWFH 1GBFA 1A0LA 1KXAA 2NU1E 3S9AA 3RXGA 9ESTA 2A7HA 1D6RA 2GMTC 1MKXK 3RXPA 2GT7A 2VWNA 1HRTH 3RXDA 3RXFA 5AFYH 2WV4A 3NUMA 2FMJA 5E0HA 9LPRA 1DPOA 2WUCA 1SLVB 1O5DH 1HAGE 3TK6A 1GDQA 4CREA 1RFNA 4XBBA 1PQ7A 1LHFH 5HXFA 4X2YA 1KLIH 3MH4A 4JYTA 3SUGA 1KTSB 4AGKA 1GBEA 1P0SH 2WPIS 4GAWA 3QN7A 2WINI 1ABIH 1D6WA 2ZCKP 2UWOA 3E0NB 4B2AA 1JRSA 1Y3WA 1OX1A 3SJOA 3UIRA 8LPRA 1TGNA 2VVUA 2GZ8A 1DY9A 1J15A 1LVYA 2VJ1A 2C8YB 1HAVA 2GVFA 4NIYA 3SN8A 1TONA 2HNTF 1QY6A 5F03A 1IQNA 1RTKA 3MH5A 5F8XA 3RUOA 1P12E 1GJCB 1ZPBA 1Z7KA 2P8OB 1SGDE 3PROA 3RLYH 5EQQA 3H5CB 3BTTE 5L2ZH 2A5IA 2AEIH 4Z6AH 1QBNA 4KTUA 2G4TA 2Z9LA 1OP2A 1MTNC 4F4OC 1C5PA 1TA6A 1ZJKA 3UPEA 1HNEE 1TFXA 5GIBA 1O39A 4ABFA 1T8LA 2Q6DA 4LK4A 4Y8XA 7GCHG 1FPCH 1MZDA 1PQ5A 1TGBA 1UK2A 1P2JA 2G4UA 1ZSLA 5A8XA 1ZPCA 1A0JA 1AB9C 1XVOA 3GDVA 1GJ6A 1K9OE 3GCHC 3GY3A 3E3TA 1ZMLA 2OINA 4NZLA 5FX5A 1SHHB 4OS4A 1YP9A 2BD3A 1HV7A 1L4ZA 4VGCC 4O3TA 1UVTH 2ZFPH 5LGOA 1K28D 2XYAA 4AFSA 2P59A 2RA0A 4ZUHA 1V2RT 4HZHA 1Z6JH 4ABGA 1FUJA 3OY6U 3VEQB 1ANEA 3LONA 1DLKB 1TIOA 1NZQH 3DFJA 1L1JA 1WTGH 2QAAA 1J17T 4XDEA 1ZHMA 1CHOF 2AS9A 1MTWA 1P10A 1ZMJA 1THSH 3RMMH 2TBSA 3SBKA 4AN7A 4ISHH 2Q6FA 3A89A 1WQSA 1GCTC 1UVUH 4JCNA 3O8RA 5EPNA 2ZHWH 2ZIQH 3W95A 1XVMA 3GYLB 1DFPA 2UUFB 2BQ6B 3FP7E 1KLJH 3RP2A 4MPWA 2UUJB 3RXAA 3A87A 1GMHF 4Y6DA 3TJOA 1O3KA 4Q7YA 3M3SA 1C4V2 2Z94A 4OS2A 5A8YA 1BRAA 3RXTA 1GHYH 2DUCA 1QFKH 3DA9B 3M5NA 3RXVA 2ZG0H 3RXHA 1C9PA 2BHGA 3P17H 2Y5HA 2BDGA 3UREA 3PB1E 1TX8A 1FIZA 3LGWA 3ZVDA 4GCHG 4ABJA 1L4DA 1H8IH 2Q6GA 2Y7XA 3TGJE 2PR3A 1O3NA 1ELEE 2GT8A 1MBMA 2PFEA 1CO7E 4A7IB 1AO5A 1RD3B 4YESB 1TNIA 3EA8A 1GJ9B 1L0ZA 2Y82A 5JBCS 1DOJA 4B2BA 1O2GH 1AY6H 1TPAE 4Q7XA 3A88A 2AMPA 3DUXH 1YLCA 1GJ5H 1ZTLA 2GDDA 1TMTH 1W10U 3KNXA 3MWIU 1FPHH 4DIIH 3BTKE 4D9RA 3VGCC 1DITH 1DSTA 1OYQA 4WH6A 1J8AA 2VIVA 4WJG2 3GY2A 3S0NA 3QX5H 4D76A 2SGAA 1O32A 3L6PA 2ZEBA 1BTZA 3L33A 3S7KB 1SVPA 2CXVA 1ZRKA 2TRMA 3EA9A 4FUIA 1LHCH 2ZFQH 1SL3A 2GD4B 3TK5A 5A8ZA 1B5GH 1NS3A 1Y5UT 5C67A 4X8SH 3UY9A 1QB1A 1W7XH 4YTAA 2BLWA 1AD8H 4ZXXH 3SZNA 1ELBA 2EC9H 5K0HA 2FYRA 3SHAH 1HJ8A 1Q31A 3C27B 4Y0ZE 1XXFA 4Y71A 4YLQH 1Z6EA 3ZVAA 1TOMH 3BF6H 3RXCA 1G37A 4TY6A 3SNCA 2BDCA 2HNTC 5B6OA 2A45B 4AZ2B 2IJOB 5JBTA 2CV3A 2QXIA 1FN8A 1EAUA 2PSYA 1RGQA 1HXEH 3MU0A 3C1KA 1SQOA 3MO6A 4MDSA 2OQUA 1J16A 1W8BH 1VITH 1TRYA 1WTHD 1EJAA 1N8OC 1SR5C 2FX6A 1UTMA 3MNSA 3SV8A 1S84A 1Y8TA 3Q3KA 2BDHA 1Y59T 4B74A 2SGDE 2P3TB 4O3UA 4K60A 2HPQH 2ANWA 4AG1A 2HWLB 1T4UH 2GDEH 3EGKH 1KYNA 2NU0E 3H7OA 3IWMA 1RIWC 1AQ7A 1G3CA 5FPYA 3DD2H 1SMFE 4NWKA 1GDUA 3SJIA 1ELGA 1FMGA 4UEHH 1LVOA 3U8OH 1UVSH 5DKMA 1P05A 1UHBB 1C1PA 1C5LH 1LTOA 3U98H 1RJXB 2ZGBH 2QXHA 2ZO3H 1H8DH 1GVKB 1O38A 1PPEE 4CBOA 4LZ1H 2CF9H 2I6QA 2Z3EA 4OS7A 4U30A 3RXMA 2FS9A 1S0RA 6LPRA 1QRZA 4THNH 3BIVH 3E6PH 1GG6C 3LDXH 4AFQA 1A5GH 1O3JA 3TNTA 2H9HA 1EAIA 2AFQB 1SGFA 3TK9A 2GZ7A 4FUBA 3SI4H 3P8FA 1O2MA 1ESAA 1S5SA 1T8NA 2BOKA 2P3FH 3JZ2B 3Q77A 2ZTXA 2V35A 1SOTA 1UTJA 1CA0C 2R0KA 4MTBA 2AH4X 1NRQH 2ASUB 2H1UA 2BD9A 3TNSA 2BY8X 2LNCA 3NPSA 4KGAA 1VGCC 1QJ1B 4ZKRU 4IW4E 3R3GB 5GXPA 4K3JA 5JBAS 2P16A 4R8TB 3TH2H 1C5OH 2A1DB 3P92A 1SGQE 3PMAB 3MU1A 1ELTA 4A6LA 1EZUC 1AI8H 1O3CA 2GCHG 1O37A 2ANYA 3QTOH 3SUEA 5EQRA 1N6XA 2NWNA 2FOMB 2GCTB 1F2SE 1OWDA 1SPJA 3A7VA 1L2EA 2BLQA 4XE4A 2P94A 1Y3VA 1C2DA 2WV5A 1W2KH 3U1JB 3A85A 2FZZA 2ZPSA 5EW1H 4WF8A 2PUQH 4OS6A 1JOUB 1P57B 3BG8A 1BTWA 1AKSB 2SGQE 2C8XB 6GCHG 2FI3E 4DJZB 1YLDA 1D3TB 3RXUA 1CBWC 1T7CA 3A7WA 2FOAA 3P8GA 2W3KA 3QZRA 2XBYA 2A4OA 1KY9A 2ZFFH 1WV7H 2F9BH 4TWWA 2ZDLA 1W7GH 2F9UA 1NO9H 3HKIB 3QUMP 1XKAC 2D1JA 4A1XA 2PW8H 1O5AB 4O97A 1ESTA 3A7TA 1RS0A 1KTTB 3URCA 1PQ8A 1T32A 4CRBA 4AYYB 2OP9A 4NA9H 1JRTA 1H9IE 2FYQA 3T5FH 2R2MB 5AHGH 1TNLA 2GTBA 4ZKNU 5GCHG 3ZV9A 1OWIA 1TBQH 3M7UA 5EOKA 1FY5A 1RTFB 4UD9H 1SGRE 3UUZA 4Y7BA 4E05H 4FUEA 4YZUA 2ZTZA 1C5TA 4FUFA 3TU7H 1S85A 5GDSH 3UNSA 3A83A 1QRXA 3PMJA 4AX9H 2BB4A 3UOUA 1SBWA 2JETC 2WPJS 2J94A 1TX6A 5FBEA 4IMZA 7GCHF 5J4SA 1ZZZA 2XBXA 4X6OA 1NFYA 4K8YA 3MH6A 2KAIB 2I6SA 3BG4C 3S7HB 2XRCA 2R0LA 3A84A 4FVDA 1ANCA 2PKSB 4IN2A 1YPGH 1IQMA 3ZZ6A 3TJUA 1H1BA 3KL6A 3QK1A 1W12U 2D2DA 2BZ6H 1KDQB 2OBQA 3A7ZA 2J2UA 3LC5A 5DP6A 3ZZBA 4GHTA 3URDA 1EASA 1ZPZA 1DXPA 2SFAA 1OXGA 1THPB 1GI4A 2B5TB 2BY7X 4ABIA 3MTYA 4JYVH 1UCYK 1EP5A 1GI9B 1AFQC 1QBOA 1OWEA 1DE7H 3AAUA 1C5WB 2GMTB 2BX4A 1TAWA 1GJ8B 3NWUA 2YNAA 2P93A 1VCQA 4FXGH 1OP8A 2CHAB 4HI3A 1TE0A 2H6MA 3RMLH 1DUEA 3D62A 5HGGA 1GPZA 5C1YA 5SGAE 1UCYE 4AB8A 3FZDA 1ZJDA 2RCEA 2ZU4A 4NIVA 1YCPH 1NFWA 4YOJA 1K21H 1EXFA 1P2IA 3BTEE 4GVUA 3HATH 1W11U 1L1GA 1YBWA 1DANH 4TY7A 3MFJA 6ESTA 3MHWU 5JYIA 4Y8YA 4E7NA 2M5TA 8GCHG 3RXOA 5A0BA 1Y3UA 3RXJA 4KTSA 3BSQA 1TQ7B 1NESE 5E0JA 2W7SA 1WQVH 4FU9A 1HAXB 1HAYB 2XC0A 1CE5A 4HFPB 2GGVB 2ZHEH 4H6SB 2A32A 1O2OA 2UUYA 1QQUA 1AFEH 4X0WU 2OC0A 1A2CH 2UWLA 3L3TA 4JK6A 5T6FA 1OKXA 1GL1A 4CR9A 2GV6A 1G3DA 4OGXA 3UFAA 4DOQA 3H7TA 3ZZ4A 1GBTA 1GCDA 1C1QA 4GCHF 3NXPA 3SU3A 1EZSC 3V3MA 4NFFA 3F9GA 1AVXA 1TLDA 1BBRH 2PTCE 4Q7ZA 5LPRA 2STBE 3T29A 1V2NT 1NT1A 7ESTE 1MZAA 1ELFA 5H4IB 2QIQA
chains in the Genus database with same CATH superfamily
1ELAA 1LKBA 2IOTA 3GCHB 1O3EA 1OS8A 4ABBA 4JZFH 1C4Y2 3KYGA 2ZGXH 3KQDA 3S9BA 2J98A 3FN8A 4VGCB 3F1SB 3LC3A 3FFGA 1WOFA 2BZAA 5EU8A 1LHEH 4CHAB 3UR9A 1JXPA 3EAJA 1ZGIA 3M7QA 2WSSD 5JDUB 2AGGX 4CRAA 1GBBA 1CU1A 5HM2A 1P9SA 4SGAE 4O03A 1LPZB 5HYOA 1O2TA 4X1QU 3UTUH 4H4FA 3LGUA 1BMAA 3SGQE 3UAIC 4ACBA 5C0UA 5G4BA 1OP0A 3B9FH 3E8LA 1HIAA 1EPTC 1ID5H 1O2YA 1GI2A 1V2MT 1HJAC 1C5XB 2HRVA 3ATMA 1Z1IA 2J97A 4CRCA 2BMGB 2R9PA 1QGFA 1F5KU 1K1MA 3P8OA 3WY8A 3A8DA 4XSKU 1CT2E 2W6ID 2YMSC 1C2MA 1EZXC 4AORA 1HAZB 1MTVA 3F68H 4ZHMU 4XFQA 2G51A 1MCVA 1YPEH 2Y5FA 3LT3A 3PLPA 3UNQA 2A7CA 1EB2A 1SQTA 5KECA 1RXPA 3V12A 1FY1A 1G2LA 2PKAB 2VB0A 4LOYH 1MAYA 4M7GA 1XUJA 1O3FA 2XBVA 3GY8A 1GHZA 2EEKA 2FP7B 3N99A 3SU4A 4FU7A 1A3BH 3PLBA 2HGTH 2QN5T 2EA3A 3M36A 5T6GA 1E38B 3QO6A 4DGJA 3CENA 1P02A 1TNJA 1QIXB 1K2I1 3ZZ5A 1ZHPA 3MMGA 2BD4A 2Z3DA 2F9PA 3VPKA 3GOVB 1IQIA 1C1NA 3ZVCA 1P9UA 5BRRE 1UK4A 1P3CA 5GPIB 4BXWA 1W0KD 1DICA 1W3CA 4TYDA 4XOJA 4A5TS 1E1RD 1GBMA 3PRDA 2HVXA 4I31A 1MQ5A 1K0HA 1DWBH 2BVSH 2O8LA 1E79D 5E8EH 4MG3A 1GMCG 5EW2H 4O9VA 1BB0B 1UK3A 2QE7D 1IQGA 3DFLA 1O5FH 2H5CA 3UNRA 2ZP0H 1GBDA 3F2FA 1FY8E 4FVBA 3RMNH 3UB0A 3A82A 5FHTA 1SHYA 2FO9A 1OOKB 1N1LA 4CBNA 3SU1A 3FP6E 5ETXA 7KMEH 5JB9S 3V7TA 1MKXH 5C2ZA 1ETRH 3FP8E 3VB4A 3GS9A 2VBCA 4FETA 2BDIA 2FLRH 1UVOA 3BEFB 3T62A 1A7SA 4WMEA 1C2HA 1NPMA 1FAXA 5TJXA 3GY4A 1F0UA 3PWBA 2WYGA 1ZOMA 2P8OC 4K8BA 1SGIB 1ARCA 2GV7A 5IYTA 2FDAA 4ZXYH 1EX3A 5GJ4B 1YKTA 4GHQA 1O2HA 1TRNA 3BTHE 1CSOE 5DP3A 1ZYOA 2GCHF 1CT4E 1O2VA 3ZZ7A 1P11E 1ZHRA 5C1XA 1RRKA 4OS1A 3T25A 5L6NH 1SSXA 1QJ6B 2PWXA 1K1LA 2VINA 1E37B 4BNRA 1LMWB 1KXCA 1C2EA 1OWJA 1VKYA 2BD7A 2WV9A 1K1OA 4RT0A 4U01A 3UWJH 2GX4A 1BITA 5EIYA 2TGPZ 4A92A 1ZRBA 3OX7U 1O3OA 4BTTB 1BUIA 2BM2A 2XXLA 5FCKA 1UTOA 3JZ1B 2KAIA 4YLUA 3MO3A 1FJSA 1O36A 1GMDG 3CS7A 1ELDE 5DP5A 2OLGA 3SU5A 1PQAA 1SGEE 1TPSA 6GCHF 1G32B 4NIXA 1TNHA 4JZDH 1KXBA 1OWKA 2FM2A 2TGAA 1GI1A 2BQWB 4JK5A 1SKYE 1EATA 1VJ9U 1AE8H 2K1QA 4ISNA 1KDQA 1GHBG 1S6HA 3TLOA 5T3HA 3FVFB 1TNGA 4NSVA 4NWLA 3QTVH 1WU1A 4X1PU 4YOIA 1S6FA 4B76A 3K6YA 3DT0H 1NM6A 2V6NA 2QYIA 3A7XA 2R3YA 4DCDA 3SV9A 3SGBE 3SQEE 4DG4A 1KSNA 4AC9A 3F6UH 1V2UT 2ZPRA 3PV4A 3KN2A 2A2QH 2EQNA 3GY5A 4JZEH 1V2KT 1P2MA 1SGTA 2FX4A 1RTLA 1V2VT 1IAUA 1P8VC 4BAMB 2BDAA 4X8UH 5GCHF 1ZSKA 1QL8A 2V3HH 4WMDA 1CGJE 1O5GH 2VWLA 3KEEA 4B71A 1EPTA 2J92A 1BQYA 4I8KA 4X6PA 5F6MA 1HAPH 1PPHE 1NC6A 4X8TH 1C2IA 1G3EA 1EOLA 2BD2A 4CRDA 1WAYB 2ZECA 4NG9H 4D7FA 4ESTE 1OHHD 2A5KA 1TRMA 1FI8A 1K1PA 5AF9H 1GL0E 2ZPQA 1VGCB 3BTQE 4IMQA 1A0HB 1SFQB 3RXLA 3BTWE 3F0OA 2HLCA 1YPJH 1B0FA 3SNDA 3GDUA 4D7GA 2BY6X 4BANB 1C2FA 2WZQA 1H8HD 2CMYA 2ZTYA 3STJA 4KTCA 1O3LA 1C2LA 4K69A 1TMBH 1PPZA 3KYFA 5CDFE 3TGIE 2C8WB 4Y79A 2OUAA 3Q00A 1AN1E 1GGDB 3TH3H 1BJUA 1MCTA 5DP7A 1S6LA 3SHCH 2ZA5A 2H9EH 3ENSB 3M3TA 4RSPA 2V3MA 1FV9A 2DE9A 1WCZA 4BAKB 1V2JT 1NROH 2SNVA 1X7AC 1SGNE 1O2LA 4H6TA 2J38A 2AMDA 1EB1H 1O30A 3BTFE 4MPUA 1ZMNA 2QF4A 3PM3A 1TB6H 8KME2 2D26C 1U6QA 2RDLA 1A4WH 3MU4A 1CBWB 3FAOA 3ZYDA 3I77A 1AVGH 1D4PB 2Y7ZA 1NTPA 4NSYA 3SUFA 4A1VA 2PGQB 3NKKA 2FOCA 3OTPA 2BLVA 2F9OA 2GZ9A 2OBOA 4IC5A 2P95A 2C93B 1FXYA 1SLWB 1DLEA 2WPKS 3E0PB 2QC2A 4AG2A 8GCHF 1JWTA 2AMQA 3PO1C 2NU2E 2ZFSA 1O5CB 1HB0B 4A1TA 1YM0A 2ZCHP 2FI4E 1GHVH 2QF5A 3LH3A 2ODQA 3LIWA 2OC1A 3TH4H 4AYVB 1INCA 4X1NU 2O8WA 3LJOA 1P01A 2BD8A 3BEUA 4K1SA 5HIZA 5EXNA 5AFZH 2BOHB 5HKKD 1GHAG 3PTBA 1EJMA 2R2WU 1F0TA 5K7RA 5LPEA 1SG8B 4GSOA 3TJVA 3SI3H 3GY7A 5EODA 3OFND 1GBIA 3OSYA 3G01A 2KCYA 3EQ0H 2A7JA 1YF4A 1UTKA 1P2KA 2ZDNA 3DSOA 4NZQA 1UTQA 1JBUH 1UW7A 1GBJA 1QHRB 4WY3A 2O8UA 4UFGH 1HJ9A 2C3SA 2PKAA 3FZZA 3SOSA 1C2GA 1AHTH 3A81A 3FKSD 3SQHE 2W6JD 5BPEA 4X2XA 4RT1A 3ZZAA 4WXIA 4I32A 1C4U2 2LELA 1T31A 4ASUD 1C5VA 2CF8H 2W7UA 2BVRH 3P70B 2PTNA 1BJVA 3M35A 4KKDA 4ZROA 1PFXC 3EA7A 2STAE 1MTSA 1HAOH 2VGCB 2G81E 1HCGA 4Y76A 1G36A 1GI6A 1XMNB 3OU0A 1KIGH 5E2OA 1B0EA 1FZZA 3ODDA 5EG4A 1C1SA 1MKWK 3ZVFA 2AGIX 2FOFA 1AUJA 3GISB 2FS8A 1BMNH 3AW1A 3B23B 5CHAC 5I25A 1Y5BT 3QGJA 1C5UA 3U9AH 1Y5AT 2FWWA 1GVZA 4FUJA 1F5LA 4F55A 1SC8U 1P2NA 3WW7A 1Z1JA 2ZWLH 1ZLRA 3MU8A 3D23A 3VB3A 1HFDA 1OYTH 3ZZDA 4UFEH 1K1IA 2B8OH 3KQCA 3MNCA 2BXUH 3BTDE 3SJKA 1G9IE 1EOJA 4F49A 4ZMAH 4B2CA 1EUFA 3PWCA 4X6NA 1CT0E 2EI8A 4ZHLU 1AUTC 2FOHA 4E06H 2W3IA 2BY9X 1O3AA 2Z9KA 5F8ZA 4LXBH 1ELVA 2CJIA 1YPMH 3ZZCA 1GI3A 3O8DA 5JPMH 5FCRA 5DJ7A 2F43B 1Z8JB 2GCTC 3ZZ3A 1E1QD 3KIDU 2ULLA 3FANA 3M5OA 1O34A 4P02A 1FY4A 3MNBA 3STIA 3SW2B 1SQRA 1ZR0A 2NU3E 2L6OA 4MNVA 3GCOA 1GI7B 1QURH 2ZFRH 4NGAH 1UMAH 2AIPA 3LGIA 1AE5A 1QB6A 4JZ1A 4Y10E 1V3XA 2O8TA 2ZGCA 3PYHA 4INKA 2J4IA 4WWYA 1BTPA 2A4GA 2WPLS 1J9CH 1V2OT 1C5ZB 1GMCF 3AASA 4YT6H 2FOEA 3RM2H 3A8BA 4B75A 3VB5A 3VG8A 1O3BA 1YCPM 4Q80A 1TA2A 5DN6D 3F9EA 3SORA 4ISIH 2Z7FE 3EYDA 3PMHB 1C2JA 4NA8A 5JBBS 5TCAA 1MQ6A 3ZZ9A 1E0FD 2EI7A 3RU4T 2BQ7B 3T2NA 1XM1A 1F0RA 2SNWA 1O2SA 3Q76A 3K6ZA 1F92A 2PLXA 2J9NA 3HK3B 2Z6BD 1MU8B 4JMYA 5DG6A 3HGPA 2V3OH 5DP8A 3RDZA 3ODFA 2OQ5A 2QF3A 2G55A 4JYUH 1SLXB 1HJAB 3VXFH 1PPBH 1E35B 1FNIA 4Y0YE 4X2VA 1O2ZA 1SFIA 4X8VH 3E1XB 4KP0A 3T26A 2BD5A 1P03A 1C5RA 1O3MA 3MO9A 1SGCA 5A09A 3I29A 1LQDB 4ABEA 3RC6A 1FQ3A 4I8LA 1MTNB 2F9NA 1MKWH 1PPGE 3RXKA 1J14A 4TT3D 4IGDA 2ANKH 2UUKB 1KLTA 1SQAA 3IITA 4XD7D 2ZDMA 1PPFE 1XUIA 3ZVBA 1QL7A 3MH7A 2ZDAH 1WYKA 3GYMA 1DS2E 3VFEA 2FOBA 2PKSC 5FPTA 3ELAH 1NRPH 1BCUH 2Y81A 1WBGB 2UWPA 1UJ1A 1AB9B 1GMDF 1PPCE 4YT7H 1NBME 1QR3E 2ZF0H 2QY0B 2F83A 3F9FA 5DPAA 5HM9A 3QWCH 3TIUA 1TQ0B 2ZKSA 3A80A 2ZQ1A 4MNYA 5JB8S 5EQSA 5EXLA 4B73A 1GHBF 4U2WA 5DP4A 1VCPA 1DWDH 2Z9JA 3BTGE 1BZXE 2G5NA 1VITG 3EDXB 2VIDA 2ODYB 3U1IB 4X6MA 1CVWH 4KELA 2CHAC 4ZAEA 6CHAC 1IQEA 1GBKA 4I8JA 1UO6A 4QT8C 5C1UA 2KCPA 1O2PA 3GCTG 1UHBA 2ZZUH 1HAHH 1XUHA 1GDNA 3S69A 1CGHA 4RKOB 1LQEA 1Z8RA 4R0IA 1QL9A 1IQHA 1BRBE 1UCYH 1O3GA 4X1SU 3ITIA 2IPHA 2A2XH 1M9UA 1GCTB 1OWHA 2A0QB 2FI5E 4ZKOU 5TCCA 1HBTH 2VIWA 3HK6B 1O2JA 4CH8B 1LVBA 1G3BA 1SI5H 3LJJA 3DHKH 4BAHB 1THRH 1V2TT 1AIXH 2C90B 1GBAA 1N6YA 1JMOH 5EJ1A 5ESTE 1UVPA 2VWOA 3ZVGA 1Q2WA 2XNIA 2VIQA 2ALVA 1NN6A 1DWCH 4TWYA 1KXFA 1O2IA 1YPHE 5T6DA 4Y7AA 1EZQA 1O3PB 3LPRA 4OM9A 3PLKA 1P04A 4Z0KA 5HMAA 3UOPA 1O3IA 2BVXH 1AWHB 2HOBA 2IPQX 4GLYA 4K2YA 5PTPA 4YOGA 3F2GA 1LKAA 5EPYA 2G00A 3SNAA 4ASHA 4WVPE 3O8CA 2EI6A 1V2ST 2Y5GA 4ABHA 7LPRA 1O35A 2RA3A 1TGTA 5C3NA 1COWD 3ESTA 3KGPA 4BTUB 3OYPA 2OK5A 1TMUH 2OD3B 4Y11E 2W26A 1V2WT 1Z8IB 3QGNB 2HALA 1PJPA 1AZZA 1O33A 3A7YA 2FOGA 2VH0A 3VXEH 3CP7A 1K1JA 4CHAC 1AKSA 3RXSA 4F48B 4WH8A 8ESTE 3E91A 3LGYA 3LKWA 3VGCB 1EAXA 2AIQA 1DVAH 1ZGVA 2THFB 3SV7A 1LHGH 2KZ4A 1SGFG 1JIMA 4ISLA 2FXRA 3CS0A 1EP6A 1BRCE 1ESBA 1DUAA 1WSSH 2FTMA 3BTME 1NFXA 1O2QA 4HTCH 1O2KA 2VVVA 5LH8A 3GY6A 4WMFA 2FPZA 1VZQH 3TITA 2XC4A 1O2XA 1C1MA 1TGSZ 4AB9A 1CHGA 3F9HA 3P8NA 5E2PA 1IQFA 3ATKA 1HUTH 1WUNH 1TNKA 2PSXA 4YXWD 5FXLA 4DIHH 1NBMD 2ILNA 1GHAF 5FX6A 4NCYA 2QGRA 1A5HA 1DY8A 3M37A 4Y8ZA 1XUFA 3M3VA 2C4FH 3P6ZB 2VNTA 1MUEB 1NRNH 1LVMA 2B9LA 5FPSA 5GWZA 4OGYA 1QZ8A 2WYJA 4FUHA 1ETSH 2A4RA 2VH6A 2BX3A 1BA8B 1TX7A 1C5YB 3M61U 1PYTD 2SGEE 3SV2H 1T8OA 4XBDA 2FODA 1GHWH 4FUDA 3MYWA 1N8OB 2JH6D 1GWAA 1S83A 3Q3YA 1GJAB 1O3HA 1L1NA 1LDTT 1C9TA 1LPGB 2L74A 2H5DA 4IS5A 4DVAU 1NRSH 1ETTH 1BRUP 3A8AA 2SGPE 1VJAU 1GBCA 3M5LA 3DSGA 3VB7A 2GP9B 1CGIE 3TVJB 2BDBA 3N7EA 1GI5A 2A4QA 1MH0A 2ODPA 4RN6A 3M7TA 5C20A 5A0CA 2ALPA 1EJNA 1RIWB 2DE8A 2R3UA 2VVCA 1EQ9A 2B7DH 4INHA 3RLWH 1QCPA 1BOQA 3V13A 1A1RA 2TIOA 2FESH 1K22H 1F0SA 1SGPE 1V2PT 2AGEX 2XWAA 2BLOA 4AOQA 2Z3CA 2B0FA 2SGFE 1QQ4A 3BEIB 3RC4A 1TPPA 2J5UA 2OC8A 3GCNA 2CN0H 4NIWA 4CRFA 2CGAA 3SNEA 1S81A 3R0FA 3N7OA 1MBQA 5T1VA 3U69H 1TWXB 3UWIA 1GG6B 2FIRH 2QA9E 1GJ4H 3V0XA 1FONA 2H2ZA 1C1RA 4BTIB 3PO1B 4K1EA 3SZEA 3T28A 5EXMA 1C1UH 2ESTE 4I33A 4Q2KA 4K5ZA 1CA0B 3EE0B 1F7ZA 3ZVEA 2OXSA 3U8RH 4ISOA 1JIRA 1FN6A 4J1YA 3UQVA 1V2QT 1NU7B 2HVYB 2QXJA 1D3DB 4WXVA 1AVWA 4CRGA 1BT7A 1IHTH 3MNXA 5J4QA 1MAXA 2TPIZ 3QZQA 1ZSJA 4BAOB 3OE7D 1C1TA 3UR6A 1UTNA 1F5RA 2ZQ2A 1O2UA 2J95A 4ACAA 3TGKE 1A46H 1ORFA 5A2MH 1EAWA 1VR1H 1S82A 2XNDD 4U32A 1O2RA 1YPKH 1QRWA 1H9LB 1W0YH 2ZC9H 1O3DA 3S9CA 1NRRH 1FY3A 4FU8A 1YC0A 2A5AA 3KQEA 2A31A 1SOZA 2BTCE 5A0AE 1O5EH 1SB1H 4H42U 2XBWA 1C5SA 4I7YH 2ZHFH 2WPMS 2J98B 3KCGH 5C17A 1BDAA 1MD7A 1QB9A 2ZI2H 2ANMH 3SU6A 1DDJA 2WHXA 2AYWA 5I46H 2BXTH 2YNBA 3HGNA 3LH1A 1Z71A 2GKVE 1HXFH 2WPDD 3TPIZ 2XC5A 3EE7A 3NK8A 1P09A 1XUKA 1C1OA 2Y80A 3PMBB 3LU9B 4XBCA 1HLTH 3OY5U 2VIOA 4I8GA 2D8WA 2ZGJA 1MTUA 4J2YB 4ZHAA 4CH2B 3K9XB 1MMJN 1EKBB 2XWBI 1HAVB 2C8ZB 3B8JA 1ANBA 1DT2A 1YYY1 1HIAB 3BN9A 2ZU2A 4IBLH 5L2YH 1S0QA 4MPVA 3MOCA 1TBRH 1CHOG 1B7XB 3RU4E 1AU8A 3SU2A 2RG3A 4D8NA 1BTUA 2F9VA 1V2LT 5HIYA 4DURA 3HPTB 2IN2A 5L30H 5CHAB 1IOEA 3SJ9A 4LZ4B 3KF2A 2BYAX 2F3CE 1A3EH 3RXRA 5FAHA 1DXWA 5AVDA 3E90B 5C0TA 4TPIZ 1LCYA 4GUXA 4HG6A 2VWMA 1TYNA 3ATLA 3GICB 4IC6A 1ABJH 4AFZA 5CMXH 4DT7B 2OCVB 1G30B 3OTJE 3E16B 1UTPA 1GMHG 2JETB 1V6DA 4MNWA 1O31A 2QV1A 1LO6A 4FUGA 1OSSA 3BG4B 3W94A 3PV2A 5DP9A 1DWEH 1D9IA 1BHXF 1GBLA 1K1NA 1TPOA 4D9QA 2JKHA 3A8CA 5ABWA 1HDTH 3LOXA 4NFEA 2F91A 5EGMA 1XXDA 1P06A 4INLA 3SJ8A 2Z9IA 3KQ5A 3SUDA 1O2NA 1GGDC 5E0GA 2FEQH 3FO8D 1BMLA 1YCPK 2BY5X 3UQOA 4GPGA 3SV6A 3T27A 1XKBC 3CNRA 1O5BB 2HNTE 2XW9A 1VITF 2WUBA 1Z8GA 4MPXA 1AFQB 2XTTB 1MU6B 1H9HE 1LHDH 2XCFA 3PTNA 1NFUA 3ZYEA 2FTLE 4BOHA 1OPHB 1YLNA 3RXEA 1DSUA 1A5IA 4UFDH 3GCTF 3HKJB 3MU5A 4SGBE 3M5MA 1Y3XA 4RKJB 1HGTH 3K2UA 3SGAE 1ELCA 1GJBB 2PGBB 1BTYA 1LPKB 3D65E 3RXBA 1AMHA 3I78A 1NU9A 1XX9A 4UONA 1ANDA 1C5MD 3AAVA 3RXQA 3TJNA 1CQQA 3U28C 1UTLM 5LPFA 1MD8A 3WWBA 4DW2U 2ZHQH 1QJ7B 2ZU1A 5DGJA 2PHBA 4OS5A 2PV9B 1QTFA 1IQLA 1IHSH 1E36B 2TGTA 5CE1A 1BBRK 1FIWA 2O8MA 2OC7A 2ZU5A 3ATIA 3RM0H 2ZHDA 4B1TA 1FAKH 1AGJA 1NY22 5F8TA 2QCYA 4MLFB 2P3UB 1KXDA 3AVZA 3LGTA 1FLEE 3KQBA 5DO4H 1FX0B 2W5EA 2ZNKH 1GHXH 2AERH 4E7RG 2FLBH 1D3PB 4YM9A 3ATWA 4DY7B 4JZIA 2ZDKA 1BBRE 2OTVA 3LGVA 3RMOH 3OEHD 2NU4E 3U8TH 4BAQB 1PYTC 1GVLA 1MABB 2YOLA 1Q3XA 1QBVH 3KHVA 2ZDVH 3SO3A 4ZH8A 2PUXB 3SNBA 5B6LA 1KXEA 1DM4B 1W14U 2TGDA 4X2WA 1C1VH 5ESBA 4HGCA 1ZTKA 2KCAA 1BHXB 4BXSA 1BTHH 1GI8B 1TALA 1FDPA 4FUCA 3RU4D 2O9QA 1QNJA 1ZTJA 3PV5A 1W0ZU 3RC5A 2JH5D 1QA7A 4ZKSU 3W1EA 1TGCA 2H9TH 1QA0A 3O8BA 2VGCC 3QDZB 4I8HA 4K1TA 1BIOA 3SU0A 4MVNA 4MQAA 1VCWA 3ZV8A 2Q1JA 1IQJA 1G2MA 1IQKA 3Q3XA 1YGCH 1GJ7B 1H4WA 2G5VA 2G8TA 4UDWH 3AK5A 1TBZH 1T4VH 1AZ8A 2JDID 3H09A 2ZU3A 1GJDB 2BDYA 6CHAB 2KR7A 1TABE 2Z9GA 2ZFTA 1ACBE 1Y3YA 2QF0A 1XUGA 4MNXA 3RXIA 1YPHC 1O2WA 4IN1A 1EPTB 2ZGHA 4ABDA 1DX5M 1P2OA 3BV9B 1EFRD 3NCLA 4UFFH 1T8MA 3ZZ8A 1D3QB 4X1RU 1C5QA 1O0DH 2V0BA 3IG6B 4AFUA 2XCNA 3DCLA 2YMSB 2Y6TA 3P95A 5IK2D 1ARBA 2ZCLP 1E34B 1P3EA 5C5NA 1A61H 2J34A 4TPYA 1C2KA 5FBIA 1W13U 3MI4A 3QLPH 2WPHS 1YPLH 4CR5A 2HPPH 3OAAD 3NZIA 1TOCB 2QXGA 1C5NH 3K65B 1C1WH 4ABAA 4YO9A 1HPGA 2LPRA 5DSFA 4PROA 4UE7H 5C5OA 1BTXA 1SGYE 1SLUB 2G52A 2VIPA 3AW0A 3BIUH 5IDKA 1GI0A 1HAIH 3D49H 4AGJA 1BMMH 3GDSA 3A86A 2VU8E 3VB6A 1GBHA 4NA7A 1P2QA 2JH0D 1CA8B 1HYLA 5DK1A 1AWFH 1GBFA 1A0LA 1KXAA 2NU1E 3S9AA 3RXGA 9ESTA 2A7HA 1D6RA 2GMTC 4FOUC 1MKXK 3RXPA 2GT7A 2VWNA 1HRTH 3RXDA 3RXFA 5AFYH 2WV4A 3NUMA 2FMJA 5E0HA 9LPRA 5FL7D 1DPOA 2WUCA 1SLVB 1O5DH 1HAGE 3TK6A 1GDQA 4CREA 1RFNA 4XBBA 1PQ7A 1LHFH 5HXFA 4X2YA 1KLIH 3MH4A 4JYTA 3SUGA 1KTSB 1BMFD 4AGKA 1GBEA 1P0SH 2WPIS 4GAWA 3QN7A 2WINI 5GNDA 1ABIH 1D6WA 2ZCKP 2UWOA 3E0NB 4B2AA 1JRSA 1Y3WA 1OX1A 3SJOA 3UIRA 8LPRA 1TGNA 2VVUA 2GZ8A 2XOKD 1DY9A 1J15A 1LVYA 2VJ1A 2C8YB 1HAVA 2GVFA 4NIYA 4P00A 1TONA 2HNTF 3SN8A 1QY6A 5F03A 4ZCNA 1IQNA 1RTKA 3MH5A 5F8XA 3RUOA 1P12E 1GJCB 1ZPBA 1KMHB 1Z7KA 1SGDE 2P8OB 3PROA 3RLYH 5EQQA 3H5CB 3BTTE 5L2ZH 2A5IA 2AEIH 4Z6AH 1QBNA 4KTUA 5EJZA 2G4TA 2Z9LA 1OP2A 1MTNC 4F4OC 1C5PA 1TA6A 1ZJKA 3UPEA 1HNEE 1TFXA 5GIBA 1O39A 4ABFA 1T8LA 1WXRA 2Q6DA 4LK4A 4Y8XA 7GCHG 1FPCH 1MZDA 2KX4A 1PQ5A 1TGBA 1UK2A 1P2JA 2G4UA 1ZSLA 5A8XA 1ZPCA 1A0JA 1AB9C 1XVOA 3GDVA 1GJ6A 1K9OE 3GCHC 3GY3A 3E3TA 1ZMLA 2OINA 4NZLA 5FX5A 1SHHB 4OS4A 1YP9A 2BD3A 3F2HA 1HV7A 1L4ZA 4VGCC 3F3BA 4O3TA 1UVTH 2ZFPH 5LGOA 1K28D 2XYAA 4AFSA 2P59A 2RA0A 4ZUHA 2HLDD 1V2RT 5KEDA 1YY3A 4HZHA 1YWUA 1Z6JH 4ABGA 1FUJA 3OY6U 3VEQB 1ANEA 2V7QD 3LONA 1DLKB 1TIOA 1NZQH 3DFJA 1L1JA 1WTGH 2QAAA 1J17T 4XDEA 1ZHMA 1CHOF 2AS9A 1MTWA 1P10A 1ZMJA 1THSH 3RMMH 2TBSA 2JJ1D 3SBKA 4AN7A 4ISHH 2Q6FA 3A89A 1WQSA 1GCTC 1UVUH 4JCNA 3O8RA 5EPNA 2ZHWH 2ZIQH 3W95A 1XVMA 3GYLB 1DFPA 2UUFB 2BQ6B 3FP7E 1KLJH 3RP2A 4MPWA 2UUJB 3RXAA 3A87A 1GMHF 4Y6DA 3TJOA 1O3KA 4Q7YA 3M3SA 1C4V2 2Z94A 4Z1MD 4OS2A 5A8YA 1BRAA 3RXTA 1GHYH 2DUCA 1QFKH 3DA9B 3M5NA 3RXVA 2ZG0H 3OEED 3RXHA 1C9PA 2BHGA 3P17H 2Y5HA 2BDGA 3UREA 4B6FA 3PB1E 4M9FA 1TX8A 1FIZA 3LGWA 3ZVDA 4GCHG 4ABJA 1L4DA 1H8IH 2Q6GA 2Y7XA 3TGJE 2PR3A 1O3NA 1ELEE 2GT8A 1MBMA 2PFEA 1CO7E 4A7IB 1AO5A 1RD3B 4YESB 1TNIA 3EA8A 1GJ9B 1L0ZA 2Y82A 5JBCS 1DOJA 2KM0A 4B2BA 1O2GH 1AY6H 1TPAE 4Q7XA 3A88A 3N7DA 2AMPA 3DUXH 1YLCA 1GJ5H 1ZTLA 2GDDA 1TMTH 1W10U 3KNXA 3MWIU 1FPHH 2KFWA 4DIIH 3BTKE 4D9RA 3VGCC 2GJGA 1DITH 1DSTA 1OYQA 4WH6A 1J8AA 2VIVA 4WJG2 3GY2A 3S0NA 3QX5H 4D76A 2SGAA 1O32A 3L6PA 2ZEBA 1BTZA 3L33A 3S7KB 1SVPA 2CXVA 1W0JD 1ZRKA 2TRMA 3EA9A 4FUIA 1LHCH 2ZFQH 1SL3A 2GD4B 3TK5A 5A8ZA 1B5GH 1NS3A 1Y5UT 5C67A 4X8SH 3UY9A 1QB1A 1W7XH 4YTAA 2BLWA 1AD8H 4ZXXH 3SZNA 1ELBA 2EC9H 3WWFA 5K0HA 2FYRA 3SHAH 1HJ8A 1Q31A 3C27B 4Y0ZE 1XXFA 4Y71A 4YLQH 1Z6EA 3ZVAA 1TOMH 3BF6H 3RXCA 1G37A 3F0PA 4TY6A 3SNCA 2BDCA 2HNTC 5B6OA 2A45B 3FOAA 2IJOB 4AZ2B 5JBTA 2CV3A 2QXIA 1FN8A 1EAUA 2PSYA 1H8ED 1RGQA 1HXEH 2KCOA 3MU0A 3C1KA 1SQOA 3MO6A 4MDSA 2OQUA 1J16A 1W8BH 1VITH 4Q63A 1TRYA 1WTHD 1EJAA 1N8OC 1SR5C 2FX6A 1UTMA 3MNSA 3SV8A 1S84A 1Y8TA 3Q3KA 2BDHA 1Y59T 4B74A 2SGDE 2P3TB 4TSFD 4O3UA 4K60A 2HPQH 2ANWA 4AG1A 2HWLB 1T4UH 2GDEH 3EGKH 1KYNA 2NU0E 3H7OA 3IWMA 1RIWC 1AQ7A 1G3CA 5FPYA 3DD2H 1SMFE 4NWKA 1GDUA 3SJIA 1ELGA 1FMGA 2RDEA 4UEHH 1LVOA 3U8OH 1UVSH 5DKMA 1P05A 1UHBB 1C1PA 1C5LH 1LTOA 2IJD1 1RJXB 2ZGBH 3U98H 2QXHA 2ZO3H 1H8DH 1GVKB 1O38A 1PPEE 4CBOA 4LZ1H 2CF9H 2I6QA 2Z3EA 4OS7A 4U30A 3RXMA 2FS9A 2F4LA 1S0RA 6LPRA 1QRZA 3PRBA 4THNH 3BIVH 3E6PH 1GG6C 3LDXH 4AFQA 1A5GH 2K0QA 1O3JA 3TNTA 2H9HA 1EAIA 2AFQB 1SGFA 3TK9A 2GZ7A 4FUBA 3SI4H 3P8FA 1O2MA 1ESAA 1S5SA 1T8NA 2BOKA 2P3FH 3JZ2B 3Q77A 2ZTXA 2V35A 2YMSD 1SOTA 1UTJA 1CA0C 2R0KA 4MTBA 2AH4X 1NRQH 2ASUB 2H1UA 2BD9A 3TNSA 3NRLA 2BY8X 2LNCA 3NPSA 4KGAA 1VGCC 1QJ1B 4ZKRU 4IW4E 3R3GB 5GXPA 4K3JA 5JBAS 2P16A 4R8TB 3TH2H 1C5OH 2A1DB 3P92A 1SGQE 3PMAB 3MU1A 1ELTA 2EY4C 4A6LA 1EZUC 4RI0A 1AI8H 1O3CA 2GCHG 1O37A 2ANYA 3QTOH 3SUEA 3SYJA 5EQRA 1N6XA 2NWNA 2FOMB 2GCTB 1F2SE 4B6EA 1OWDA 1SPJA 3A7VA 1L2EA 2BLQA 4XE4A 2P94A 1Y3VA 1C2DA 2WV5A 1W2KH 3U1JB 3A85A 2FZZA 2PP6A 2ZPSA 5EW1H 4WF8A 2PUQH 4OS6A 1JOUB 1P57B 3BG8A 1BTWA 3MQKC 1AKSB 2SGQE 2C8XB 6GCHG 2FI3E 4DJZB 1YLDA 1D3TB 2CK3D 3RXUA 1CBWC 1T7CA 3A7WA 3ZIAD 2FOAA 3P8GA 3DSPA 2JJ2D 2W3KA 3QZRA 2XBYA 2A4OA 1KY9A 2ZFFH 1WV7H 2F9BH 4TWWA 2ZDLA 1W7GH 2F9UA 1NO9H 3HKIB 3QUMP 5KGOA 1XKAC 5F53A 2D1JA 4A1XA 2PW8H 1O5AB 4O97A 1ESTA 3A7TA 1RS0A 1KTTB 3URCA 1PQ8A 1T32A 1WDIA 4CRBA 4AYYB 2OP9A 4NA9H 1JRTA 1H9IE 2FYQA 3T5FH 2R2MB 5AHGH 1TNLA 2GTBA 4ZKNU 5GCHG 3ZV9A 1OWIA 1TBQH 3M7UA 5EOKA 2RFKC 1FY5A 1RTFB 4UD9H 1SGRE 3UUZA 4Y7BA 4E05H 4FUEA 5C94A 4YZUA 2ZTZA 1C5TA 4FUFA 3TU7H 1S85A 5GDSH 3UNSA 3A83A 1QRXA 3PMJA 4AX9H 2BB4A 3UOUA 1SBWA 2JETC 2WPJS 2J94A 1TX6A 5FBEA 4IMZA 7GCHF 5J4SA 1ZZZA 2XBXA 4X6OA 1NFYA 4K8YA 3MH6A 2KAIB 2I6SA 3BG4C 3S7HB 2XRCA 2R0LA 2K8IA 3A84A 4FVDA 1ANCA 2PKSB 4IN2A 1YPGH 1IQMA 3ZZ6A 3TJUA 1H1BA 3KL6A 2AHME 3QK1A 1W12U 2D2DA 2BZ6H 1KDQB 2OBQA 3A7ZA 2J2UA 3LC5A 5DP6A 3ZZBA 4GHTA 3URDA 1EASA 1ZPZA 1DXPA 2SFAA 1OXGA 5EJLA 1THPB 1GI4A 2B5TB 2BY7X 4ABIA 3MTYA 4JYVH 1UCYK 1EP5A 1GI9B 1AFQC 1QBOA 1OWEA 1DE7H 3AAUA 1C5WB 2GMTB 2BX4A 1TAWA 4Q4LA 1GJ8B 3NWUA 2YNAA 2P93A 1VCQA 4FXGH 1OP8A 2CHAB 4HI3A 1TE0A 2H6MA 3RMLH 1DUEA 3D62A 4I86A 5HGGA 1GPZA 5C1YA 5SGAE 1UCYE 4AB8A 3FZDA 1ZJDA 2RCEA 2ZU4A 4NIVA 1YCPH 1NFWA 4YOJA 1K21H 1EXFA 1P2IA 3BTEE 4GVUA 3HATH 1W11U 1L1GA 1YBWA 1DANH 4TY7A 3MFJA 6ESTA 3MHWU 5JYIA 4Y8YA 4E7NA 2M5TA 8GCHG 3RXOA 5A0BA 5CHBA 1Y3UA 3RXJA 2LP6A 4KTSA 3BSQA 2JIZD 1TQ7B 1NESE 5E0JA 4XRNA 2W7SA 1WQVH 4FU9A 1HAXB 1HAYB 2XC0A 1CE5A 4HFPB 2GGVB 2ZHEH 4H6SB 2A32A 1O2OA 2UUYA 1QQUA 1AFEH 4X0WU 2OC0A 1A2CH 2UWLA 3L3TA 4JK6A 5T6FA 1OKXA 1GL1A 4CR9A 2GV6A 1G3DA 4OGXA 3UFAA 4DOQA 3H7TA 3ZZ4A 1GBTA 1GCDA 1C1QA 4GCHF 3NXPA 3SU3A 1EZSC 4DT4A 3V3MA 4NFFA 3F9GA 1AVXA 1TLDA 1BBRH 2PTCE 2M2AA 4Q7ZA 5LPRA 2STBE 3T29A 1V2NT 1NT1A 7ESTE 1MZAA 1ELFA 5H4IB 2QIQA
chains in the Genus database with same CATH topology
1ELAA 1LKBA 2IOTA 3GCHB 1O3EA 1OS8A 4ABBA 4JZFH 1C4Y2 2ZGXH 3KQDA 3S9BA 4VGCB 3F1SB 3LC3A 3FFGA 1WOFA 2BZAA 5EU8A 1LHEH 4CHAB 3UR9A 1JXPA 3EAJA 1ZGIA 3M7QA 5JDUB 2AGGX 4CRAA 1GBBA 1CU1A 5HM2A 1P9SA 4SGAE 4O03A 1LPZB 5HYOA 1O2TA 4X1QU 3UTUH 4H4FA 3LGUA 1BMAA 3SGQE 5G4BA 1OP0A 3B9FH 3E8LA 1HIAA 1EPTC 1ID5H 1O2YA 1GI2A 1V2MT 1HJAC 1C5XB 2HRVA 3ATMA 1Z1IA 4CRCA 2BMGB 2R9PA 1QGFA 1F5KU 1K1MA 3P8OA 3WY8A 3A8DA 4XSKU 1CT2E 1C2MA 1EZXC 4AORA 1HAZB 1MTVA 3F68H 4ZHMU 4XFQA 2G51A 1MCVA 1YPEH 2Y5FA 3LT3A 3PLPA 3UNQA 2A7CA 1EB2A 1SQTA 1RXPA 3V12A 1FY1A 1G2LA 2PKAB 2VB0A 4LOYH 1MAYA 4M7GA 1XUJA 1O3FA 2XBVA 3GY8A 1GHZA 2EEKA 2FP7B 3SU4A 4FU7A 1A3BH 3PLBA 2HGTH 2QN5T 2EA3A 3M36A 5T6GA 1E38B 3QO6A 4DGJA 3CENA 1P02A 1TNJA 1QIXB 1K2I1 3ZZ5A 1ZHPA 3MMGA 2BD4A 2Z3DA 2F9PA 3VPKA 3GOVB 1IQIA 1C1NA 3ZVCA 1P9UA 5BRRE 1UK4A 1P3CA 5GPIB 4BXWA 1DICA 1W3CA 4TYDA 4XOJA 4A5TS 1GBMA 2HVXA 4I31A 1MQ5A 1DWBH 2BVSH 2O8LA 5E8EH 4MG3A 1GMCG 5EW2H 4O9VA 1BB0B 1UK3A 1IQGA 3DFLA 1O5FH 2H5CA 3UNRA 2ZP0H 1GBDA 1FY8E 4FVBA 3RMNH 3A82A 5FHTA 1SHYA 2FO9A 1OOKB 1N1LA 4CBNA 3SU1A 3FP6E 5ETXA 7KMEH 5JB9S 3V7TA 1MKXH 5C2ZA 1ETRH 3FP8E 3VB4A 2BDIA 2FLRH 1UVOA 3BEFB 3T62A 1A7SA 4WMEA 1C2HA 1NPMA 1FAXA 5TJXA 3GY4A 1F0UA 3PWBA 2WYGA 1ZOMA 2P8OC 4K8BA 1SGIB 1ARCA 2GV7A 5IYTA 2FDAA 4ZXYH 1EX3A 5GJ4B 1YKTA 4GHQA 1O2HA 1TRNA 3BTHE 1CSOE 5DP3A 1ZYOA 2GCHF 1CT4E 1O2VA 3ZZ7A 1P11E 1ZHRA 5C1XA 1RRKA 4OS1A 3T25A 5L6NH 1SSXA 1QJ6B 2PWXA 1K1LA 2VINA 1E37B 4BNRA 1LMWB 1KXCA 1C2EA 1OWJA 2BD7A 1K1OA 4U01A 3UWJH 2GX4A 1BITA 2TGPZ 4A92A 1ZRBA 3OX7U 1O3OA 4BTTB 1BUIA 2BM2A 2XXLA 5FCKA 1UTOA 3JZ1B 2KAIA 4YLUA 3MO3A 1FJSA 1O36A 1GMDG 3CS7A 1ELDE 5DP5A 2OLGA 3SU5A 1PQAA 1SGEE 1TPSA 6GCHF 1G32B 4NIXA 1TNHA 4JZDH 1KXBA 1OWKA 2FM2A 2TGAA 1GI1A 2BQWB 4JK5A 1EATA 1VJ9U 1AE8H 2K1QA 4ISNA 1KDQA 1GHBG 1S6HA 3TLOA 5T3HA 3FVFB 1TNGA 4NSVA 4NWLA 3QTVH 1WU1A 4X1PU 4YOIA 1S6FA 4B76A 3K6YA 3DT0H 1NM6A 2V6NA 2QYIA 3A7XA 2R3YA 4DCDA 3SV9A 3SGBE 3SQEE 4DG4A 1KSNA 3F6UH 1V2UT 2ZPRA 3PV4A 3KN2A 2A2QH 3GY5A 4JZEH 1V2KT 1P2MA 1SGTA 2FX4A 1RTLA 1V2VT 1IAUA 1P8VC 4BAMB 2BDAA 4X8UH 5GCHF 1ZSKA 1QL8A 2V3HH 4WMDA 1CGJE 1O5GH 2VWLA 3KEEA 4B71A 1EPTA 2J92A 1BQYA 4I8KA 4X6PA 5F6MA 1HAPH 1PPHE 1NC6A 4X8TH 1C2IA 1G3EA 1EOLA 2BD2A 4CRDA 1WAYB 2ZECA 4NG9H 4D7FA 4ESTE 2A5KA 1TRMA 1FI8A 1K1PA 5AF9H 1GL0E 2ZPQA 1VGCB 3BTQE 4IMQA 1A0HB 1SFQB 3RXLA 3BTWE 2HLCA 1YPJH 1B0FA 3SNDA 3GDUA 4D7GA 2BY6X 4BANB 1C2FA 2CMYA 3STJA 2ZTYA 4KTCA 1O3LA 1C2LA 4K69A 1TMBH 1PPZA 3TGIE 2C8WB 4Y79A 2OUAA 3Q00A 1AN1E 1GGDB 3TH3H 1BJUA 1MCTA 5DP7A 3SHCH 2ZA5A 2H9EH 3ENSB 3M3TA 4RSPA 1FV9A 2DE9A 1WCZA 4BAKB 1V2JT 1NROH 2SNVA 1X7AC 1SGNE 1O2LA 4H6TA 2J38A 2AMDA 1EB1H 1O30A 3BTFE 4MPUA 1ZMNA 3PM3A 1TB6H 8KME2 2D26C 1U6QA 2RDLA 1A4WH 3MU4A 1CBWB 3FAOA 3ZYDA 3I77A 1AVGH 1D4PB 2Y7ZA 1NTPA 4NSYA 3SUFA 4A1VA 2PGQB 3NKKA 2FOCA 2BLVA 2F9OA 2GZ9A 2OBOA 4IC5A 2P95A 2C93B 1FXYA 1SLWB 1DLEA 2WPKS 3E0PB 2QC2A 4AG2A 8GCHF 1JWTA 2AMQA 3PO1C 2NU2E 2ZFSA 1O5CB 1HB0B 4A1TA 1YM0A 2ZCHP 2FI4E 1GHVH 3LH3A 2ODQA 3LIWA 2OC1A 3TH4H 4AYVB 1INCA 4X1NU 2O8WA 3LJOA 1P01A 2BD8A 3BEUA 4K1SA 5EXNA 5AFZH 2BOHB 1GHAG 3PTBA 1EJMA 2R2WU 1F0TA 5K7RA 5LPEA 1SG8B 4GSOA 3TJVA 3SI3H 3GY7A 5EODA 1GBIA 3OSYA 3G01A 3EQ0H 2A7JA 1YF4A 1UTKA 1P2KA 2ZDNA 4NZQA 1UTQA 1JBUH 1GBJA 1QHRB 4WY3A 2O8UA 4UFGH 1HJ9A 2C3SA 2PKAA 3FZZA 3SOSA 1C2GA 1AHTH 3A81A 3SQHE 5BPEA 4X2XA 3ZZAA 4WXIA 4I32A 1C4U2 1T31A 1C5VA 2CF8H 2W7UA 2BVRH 3P70B 2PTNA 1BJVA 3M35A 4KKDA 4ZROA 1PFXC 3EA7A 2STAE 1MTSA 1HAOH 2VGCB 2G81E 1HCGA 4Y76A 1G36A 1GI6A 1XMNB 3OU0A 1KIGH 5E2OA 1B0EA 1FZZA 3ODDA 5EG4A 1C1SA 1MKWK 3ZVFA 2AGIX 2FOFA 1AUJA 3GISB 2FS8A 1BMNH 3AW1A 3B23B 5CHAC 5I25A 1Y5BT 3QGJA 1C5UA 3U9AH 1Y5AT 2FWWA 1GVZA 4FUJA 1F5LA 1SC8U 1P2NA 1Z1JA 2ZWLH 1ZLRA 3MU8A 3D23A 3VB3A 1HFDA 1OYTH 3ZZDA 4UFEH 1K1IA 2B8OH 3KQCA 3MNCA 2BXUH 3BTDE 3SJKA 1G9IE 1EOJA 4F49A 4ZMAH 4B2CA 1EUFA 3PWCA 4X6NA 1CT0E 2EI8A 4ZHLU 1AUTC 2FOHA 4E06H 2W3IA 2BY9X 1O3AA 2Z9KA 5F8ZA 4LXBH 1ELVA 2CJIA 1YPMH 3ZZCA 1GI3A 3O8DA 5JPMH 5FCRA 5DJ7A 1Z8JB 2GCTC 3ZZ3A 3KIDU 2ULLA 3FANA 3M5OA 1O34A 1FY4A 3MNBA 3STIA 3SW2B 1ZR0A 2NU3E 4MNVA 3GCOA 1GI7B 1QURH 2ZFRH 4NGAH 1UMAH 2AIPA 3LGIA 1AE5A 1QB6A 4JZ1A 4Y10E 1V3XA 2O8TA 2ZGCA 3PYHA 4INKA 2J4IA 4WWYA 1BTPA 2A4GA 2WPLS 1J9CH 1V2OT 1C5ZB 1GMCF 3AASA 4YT6H 2FOEA 3RM2H 3A8BA 4B75A 3VB5A 1O3BA 1YCPM 4Q80A 1TA2A 3F9EA 3SORA 4ISIH 2Z7FE 3EYDA 3PMHB 1C2JA 4NA8A 5JBBS 5TCAA 1MQ6A 3ZZ9A 1E0FD 2EI7A 3RU4T 2BQ7B 3T2NA 1XM1A 1F0RA 2SNWA 1O2SA 3Q76A 3K6ZA 1F92A 2PLXA 2J9NA 3HK3B 2Z6BD 1MU8B 4JMYA 5DG6A 3HGPA 2V3OH 5DP8A 3RDZA 3ODFA 2OQ5A 2QF3A 2G55A 4JYUH 1SLXB 1HJAB 3VXFH 1PPBH 1E35B 1FNIA 4Y0YE 4X2VA 1O2ZA 1SFIA 4X8VH 3E1XB 4KP0A 3T26A 2BD5A 1P03A 1C5RA 1O3MA 3MO9A 1SGCA 5A09A 3I29A 1LQDB 4ABEA 3RC6A 1FQ3A 4I8LA 1MTNB 2F9NA 1MKWH 1PPGE 3RXKA 1J14A 4IGDA 2ANKH 2UUKB 1KLTA 1SQAA 3IITA 2ZDMA 1PPFE 1XUIA 3ZVBA 1QL7A 3MH7A 2ZDAH 1WYKA 3GYMA 1DS2E 3VFEA 2FOBA 2PKSC 5FPTA 3ELAH 1NRPH 1BCUH 2Y81A 1WBGB 2UWPA 1UJ1A 1AB9B 1GMDF 1PPCE 4YT7H 1QR3E 2ZF0H 2QY0B 2F83A 3F9FA 5DPAA 5HM9A 3QWCH 3TIUA 1TQ0B 2ZKSA 3A80A 2ZQ1A 4MNYA 5JB8S 5EQSA 5EXLA 4B73A 1GHBF 4U2WA 5DP4A 1VCPA 1DWDH 2Z9JA 3BTGE 1BZXE 2G5NA 1VITG 3EDXB 2VIDA 2ODYB 3U1IB 4X6MA 1CVWH 4KELA 2CHAC 4ZAEA 6CHAC 1IQEA 1GBKA 4I8JA 1UO6A 4QT8C 5C1UA 1O2PA 3GCTG 1UHBA 2ZZUH 1HAHH 1XUHA 1GDNA 3S69A 1CGHA 4RKOB 1LQEA 1Z8RA 4R0IA 1QL9A 1IQHA 1BRBE 1UCYH 1O3GA 4X1SU 3ITIA 2IPHA 2A2XH 1M9UA 1GCTB 1OWHA 2A0QB 2FI5E 4ZKOU 5TCCA 1HBTH 2VIWA 3HK6B 1O2JA 4CH8B 1LVBA 1G3BA 1SI5H 3LJJA 3DHKH 4BAHB 1THRH 1V2TT 1AIXH 2C90B 1GBAA 1N6YA 1JMOH 5ESTE 1UVPA 2VWOA 3ZVGA 1Q2WA 2XNIA 2VIQA 2ALVA 1NN6A 1DWCH 4TWYA 1KXFA 1O2IA 1YPHE 5T6DA 4Y7AA 1EZQA 1O3PB 3LPRA 3PLKA 1P04A 4Z0KA 5HMAA 3UOPA 1O3IA 2BVXH 1AWHB 2HOBA 4GLYA 4K2YA 5PTPA 4YOGA 1LKAA 5EPYA 2G00A 3SNAA 4ASHA 4WVPE 3O8CA 2EI6A 1V2ST 2Y5GA 4ABHA 7LPRA 1O35A 2RA3A 1TGTA 5C3NA 4BTUB 3ESTA 3KGPA 3OYPA 1TMUH 2OD3B 4Y11E 2W26A 1V2WT 1Z8IB 3QGNB 2HALA 1PJPA 1AZZA 1O33A 3A7YA 2FOGA 2VH0A 3VXEH 3CP7A 1K1JA 4CHAC 1AKSA 3RXSA 4WH8A 8ESTE 3E91A 3LGYA 3LKWA 3VGCB 1EAXA 2AIQA 1DVAH 1ZGVA 2THFB 3SV7A 1LHGH 1SGFG 1JIMA 4ISLA 2FXRA 3CS0A 1EP6A 1BRCE 1ESBA 1DUAA 1WSSH 2FTMA 3BTME 1NFXA 1O2QA 4HTCH 1O2KA 2VVVA 5LH8A 3GY6A 4WMFA 2FPZA 1VZQH 3TITA 2XC4A 1O2XA 1C1MA 1TGSZ 4AB9A 1CHGA 3F9HA 3P8NA 5E2PA 1IQFA 3ATKA 1HUTH 1WUNH 1TNKA 2PSXA 5FXLA 4DIHH 2ILNA 1GHAF 5FX6A 4NCYA 2QGRA 1A5HA 1DY8A 3M37A 4Y8ZA 1XUFA 3M3VA 2C4FH 3P6ZB 2VNTA 1MUEB 1NRNH 1LVMA 2B9LA 5FPSA 5GWZA 4OGYA 2WYJA 4FUHA 1ETSH 2A4RA 2VH6A 2BX3A 1BA8B 1TX7A 1C5YB 3M61U 1PYTD 2SGEE 3SV2H 1T8OA 4XBDA 2FODA 1GHWH 4FUDA 3MYWA 1N8OB 2JH6D 1GWAA 1S83A 3Q3YA 1GJAB 1O3HA 1L1NA 1LDTT 1C9TA 1LPGB 2H5DA 4IS5A 4DVAU 1NRSH 1ETTH 1BRUP 3A8AA 2SGPE 1VJAU 1GBCA 3M5LA 3VB7A 2GP9B 1CGIE 3TVJB 2BDBA 1GI5A 2A4QA 1MH0A 2ODPA 4RN6A 3M7TA 5C20A 5A0CA 2ALPA 1EJNA 1RIWB 2DE8A 2R3UA 2VVCA 1EQ9A 2B7DH 4INHA 3RLWH 1QCPA 1BOQA 3V13A 1A1RA 2TIOA 2FESH 1K22H 1F0SA 1SGPE 1V2PT 2AGEX 2XWAA 2BLOA 4AOQA 2Z3CA 2B0FA 2SGFE 1QQ4A 3BEIB 3RC4A 1TPPA 2OC8A 3GCNA 2CN0H 4NIWA 4CRFA 2CGAA 3SNEA 1S81A 3R0FA 3N7OA 1MBQA 3U69H 1TWXB 3UWIA 1GG6B 2FIRH 2QA9E 1GJ4H 3V0XA 1FONA 2H2ZA 1C1RA 4BTIB 3PO1B 4K1EA 3T28A 5EXMA 1C1UH 2ESTE 4I33A 4Q2KA 4K5ZA 1CA0B 3EE0B 1F7ZA 3ZVEA 2OXSA 3U8RH 4ISOA 1JIRA 1FN6A 4J1YA 3UQVA 1V2QT 1NU7B 2QXJA 1D3DB 4WXVA 1AVWA 4CRGA 1BT7A 1IHTH 3MNXA 5J4QA 1MAXA 2TPIZ 3QZQA 1ZSJA 4BAOB 1C1TA 3UR6A 1UTNA 1F5RA 2ZQ2A 1O2UA 2J95A 3TGKE 1A46H 1ORFA 5A2MH 1EAWA 1VR1H 1S82A 4U32A 1O2RA 1YPKH 1QRWA 1H9LB 1W0YH 2ZC9H 1O3DA 3S9CA 1NRRH 1FY3A 4FU8A 1YC0A 2A5AA 3KQEA 2A31A 1SOZA 2BTCE 5A0AE 1O5EH 1SB1H 4H42U 2XBWA 1C5SA 4I7YH 2ZHFH 2WPMS 3KCGH 1BDAA 1MD7A 1QB9A 2ZI2H 2ANMH 3SU6A 1DDJA 2AYWA 5I46H 2BXTH 2YNBA 3HGNA 3LH1A 1Z71A 2GKVE 1HXFH 3TPIZ 2XC5A 3NK8A 1P09A 1XUKA 1C1OA