4PROA

Alpha-lytic protease complexed with pro region
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACMGRGDSGGSWITSAGQAQGVASGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of alpha-lytic protease complexed with its pro region.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Serine protease
molecule keywords ALPHA-LYTIC PROTEASE
total genus 54
structure length 198
sequence length 198
chains with identical sequence B
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1998-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4proA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4proA01
3SJIA 2WYGA 3SNDA 2A5IA 3T25A 2QC2A 1E37B 1QFKH 2W7SA 1UVSH 2ZFPH 1PYTC 1DANH 2ZPSA 2XYAA 1GJ5H 4CREA 1GJCB 1EX3A 1ESTA 3BIUH 3JZ2B 2QXJA 3UTUH 1IQMA 2AMQA 3BTWE 4BANB 1P05A 2SNVA 5FBEA 2TRMA 2ILNA 1O2YA 1T31A 1BMMH 2A45B 3OYPA 2H9TH 1E36B 2FMJA 4NFEA 4GVUA 2XTTB 1ZLRA 4I8HA 3QGJA 3RXEA 1NU9A 3DFJA 2ZFFH 3M7TA 3UR9A 1GWAA 1KIGH 3SQHE 3LT3A 4X6PA 3MO9A 4AORA 2HGTH 2QXHA 1D3TB 2C3SA 2Y6TA 3QN7A 2HALA 4GHTA 4DW2U 2BD4A 2ZCLP 3QO6A 1NS3A 1GHAF 3BTDE 7KMEH 3T27A 1ELBA 2VIPA 3RXAA 2VB0A 1OP0A 2FYRA 2ZNKH 1CGIE 2UUJB 2Y80A 1TGCA 3ZZDA 3KGPA 2PWXA 1TAWA 4WMFA 1E0FD 1WV7H 1UTQA 1ELCA 1CQQA 1RD3B 3U1IB 1UVTH 1O3MA 4YOGA 2WV5A 3DFLA 1CT2E 1A61H 3K2UA 1KTSB 1TWXB 3P8NA 4BAHB 1HAHH 3MO3A 3SUEA 1FPHH 2AGIX 3A8DA 3GYLB 1YGCH 4MPVA 1O3FA 2EEKA 1V2JT 3ATKA 4DURA 2V6NA 1K1NA 3TPIZ 1V2VT 1Y3VA 2O8TA 1EJAA 4I8GA 3BIVH 3ZYDA 2V0BA 3SW2B 1UO6A 1FY8E 2P59A 4MLFB 1UTOA 3URCA 5FX6A 5C1XA 1BJUA 3HATH 1EASA 1G32B 3SU0A 2AERH 1MKXK 4DY7B 2XBVA 1DT2A 2TGDA 1W7GH 4A6LA 1WQVH 1F5LA 1F5KU 5GDSH 1WYKA 3URDA 5DP5A 1JRTA 3VB7A 2Y5GA 4GCHF 1T32A 2RDLA 5JYIA 2ZDAH 4DOQA 1LHEH 5HXFA 2EI8A 2SFAA 1SGTA 3BF6H 3QWCH 3Q76A 1AVXA 3S0NA 3F6UH 3PROA 3ZVEA 1RTKA 2BVSH 1S85A 2VWNA 3B9FH 4IMQA 2TGAA 1W14U 4NA8A 1O34A 2FOGA 1MQ6A 1N8OB 3SUFA 1GL1A 5EQQA 4X6OA 1IQFA 1J16A 2QAAA 1G36A 2CHAB 3BEUA 1O2WA 1HAVA 2XNIA 4KELA 3MU5A 4I32A 3W94A 1KXCA 4TPIZ 2ZHWH 4KTSA 2RCEA 1O2UA 1SGFG 1C5YB 1Z1IA 2ODQA 2F9NA 4AGKA 1C1TA 3T62A 3MU1A 2BZAA 2PR3A 2A4QA 1IQEA 1KYNA 2SGDE 1YLDA 1H8IH 2W5EA 2G5VA 3GDUA 4NFFA 2DUCA 1BTUA 1BOQA 1RJXB 1XXFA 1IHTH 2BY7X 5GCHF 1UVOA 2VIDA 5LH8A 5FHTA 3BTQE 2BDBA 1O2JA 2RG3A 1O3NA 5EXNA 5A8ZA 3ATIA 1GJ9B 2NU1E 3LGVA 3M61U 1V6DA 1MTWA 1LVMA 5EU8A 2FOFA 4ABAA 1EPTB 2GZ8A 3SO3A 4BOHA 1KLJH 1P2KA 4HFPB 2HNTE 1T8OA 2ZO3H 3RXFA 1P0SH 1JBUH 1J15A 4XBCA 1HB0B 2BY5X 4Y11E 1VCPA 3M7UA 2NU3E 4FU8A 2BD9A 2ZCHP 1O2RA 1U6QA 3SV6A 1O3AA 4UFDH 4AFZA 1GI3A 2Z9LA 5EPYA 1EZXC 4I8JA 3MNSA 3STJA 1Q3XA 1ACBE 2C8ZB 4OGXA 3O8CA 1OWKA 2FIRH 2G00A 4UDWH 1GBTA 1ABIH 3OY6U 4GCHG 2ZDLA 1GI1A 1V2OT 1AE5A 2YNAA 2ZA5A 5F6MA 2ZG0H 4NZLA 1IQGA 3P8GA 2G51A 3E0PB 1SLXB 2BY8X 5FXLA 1BBRE 2OQ5A 3N7OA 2D2DA 3DHKH 1TBRH 3EA8A 1OP8A 2UWOA 2GD4B 4I8LA 1Z8GA 2ZGBH 1V3XA 3RXDA 1GMHF 4AFSA 2FLRH 3MH5A 1XUGA 4YT6H 3K65B 3IITA 2PSXA 2ZTXA 1CU1A 3MNCA 4D7FA 3SU5A 4LXBH 3QTOH 1HPGA 2KAIB 2J38A 1GCDA 3QK1A 1BMNH 1ZPBA 1HIAA 2LNCA 1K1JA 4BAOB 2PUQH 3ZZ9A 5L2YH 3GCTF 1TNKA 2ZU3A 3KF2A 1EXFA 3A7TA 3GDSA 5DKMA 4B73A 1GBMA 5L6NH 5DGJA 3SJ8A 2ZTZA 4FU9A 4CHAB 1OYQA 2ZFRH 5J4QA 4SGBE 4CBOA 1GGDC 1SGIB 3ZVBA 2P93A 3KNXA 3F9GA 5C1UA 2BLOA 1UCYE 1ZOMA 4TYDA 1BRBE 2Z94A 2ZHFH 3S9CA 1GI0A 4K1SA 1G9IE 2A4RA 3AVZA 1SQOA 1GMCF 2Z9JA 1FY3A 2J4IA 2B8OH 1LPGB 1Y3UA 4ZHAA 5GPIB 1GI7B 1UHBB 1LVOA 2BDYA 2F91A 1O3LA 3UY9A 4Y79A 3M5NA 4MNVA 3MHWU 5TCCA 1LQDB 2H9EH 3GY2A 4LOYH 2Q6DA 2R0KA 3FVFB 4B2BA 1GI5A 3BSQA 1GI9B 1BQYA 1UVPA 4ZKNU 1FY5A 4CH2B 3LKWA 1LHGH 1HJAB 1E35B 2PFEA 1RTFB 1A5HA 4BXSA 5EXLA 1LDTT 1GBFA 1C5XB 3LJOA 4Y10E 1Z6EA 2VH0A 3KHVA 4X8UH 1L4ZA 2K1QA 1FONA 1GDUA 3FZZA 1DPOA 3PWCA 1BTXA 1O5BB 3TGKE 1A4WH 3A7XA 3LH3A 1O0DH 1S6HA 3V13A 3BTHE 2PGBB 4ZHMU 1C1NA 3M3SA 1ZZZA 4CR5A 2ZHDA 1EQ9A 1TMBH 3SV9A 1A1RA 1UMAH 1YC0A 1BRUP 1S84A 1LVYA 2ZFSA 1GJ4H 1DY8A 1C2DA 2PTCE 3K9XB 1W10U 1DX5M 3MU8A 3L3TA 1CSOE 1EAXA 2VIQA 5A0AE 2ZDKA 3NXPA 1NZQH 4X1SU 1B5GH 1EPTA 3TH3H 1NC6A 1O3KA 2CJIA 1C1SA 1L1JA 2BHGA 1AN1E 3A85A 1C2KA 1C2LA 4J1YA 4F4OC 4INLA 2ZKSA 4X2WA 3FP6E 2ZIQH 4FUDA 1NN6A 5BRRE 4NIWA 4ABBA 2ZF0H 3TITA 3IG6B 2VWLA 3ZZAA 4H6SB 1AWHB 1ZMLA 4X2XA 1J8AA 2ZFQH 3KQBA 4ISLA 1BDAA 1NRPH 5IDKA 1GMDG 2XCNA 1P8VC 2EC9H 4UFFH 3KN2A 5GXPA 1UTJA 3SQEE 3OY5U 2ANWA 1DUEA 3ZZCA 5E0JA 3SU4A 4E05H 1T8LA 4INHA 1SGDE 2AMPA 2DE9A 1BHXB 3TVJB 2FODA 1O2VA 1THPB 3QLPH 2PSYA 2UUKB 3T26A 2BD8A 3F9EA 3TH4H 1F0UA 4KP0A 2ZQ1A 1AUTC 2Y82A 2FOEA 1AD8H 3SGQE 1WTGH 1XKAC 5DPAA 1DOJA 2G5NA 4WWYA 1SGCA 3LONA 1H8DH 3LGWA 3P95A 2A7HA 1DWBH 4DT7B 1HAPH 4H4FA 4FUJA 2R2MB 2BX4A 4U32A 3FP8E 3M5LA 1SGQE 2ZDVH 3PV4A 5DG6A 1TMUH 2VVVA 4JYVH 2WPJS 1AU8A 2BZ6H 4TY7A 1O36A 3SNAA 2FX6A 1GJ7B 2B5TB 2GCHF 1JIRA 4M7GA 1GHVH 1G3DA 1UCYK 1SGRE 1RS0A 7ESTE 1ARCA 1O2KA 7GCHF 2HRVA 2AH4X 2O9QA 2YOLA 1C1UH 1VITH 2A0QB 3M5OA 4MNYA 1H9HE 1F0SA 1Y5UT 2P95A 1C5UA 1OWEA 2VWOA 2ZEBA 2F3CE 2CV3A 2GV7A 1TPPA 1TA2A 2BLQA 4ABFA 1EJNA 1TRYA 5FPTA 2G55A 4HZHA 5ETXA 2XWAA 1BTPA 4NGAH 1GG6C 1QL7A 4R8TB 4HI3A 4IC5A 5JPMH 1YPHC 2J9NA 3LPRA 2ZQ2A 1AI8H 2FYQA 1RRKA 5A0CA 4IMZA 3MNBA 5PTPA 1NU7B 5CMXH 3A80A 1WUNH 1CA8B 6CHAC 1GJBB 4WVPE 2A7CA 1TNIA 4ABHA 1OWHA 1RTLA 1ZHRA 1XKBC 1GDNA 3M7QA 4X6MA 6LPRA 3CS7A 8LPRA 2ANYA 1P09A 4E7NA 4RKOB 1DY9A 2Z9KA 1XXDA 2OINA 4GPGA 4E06H 1YKTA 5JDUB 1FLEE 5C67A 4OS7A 1XVMA 2WPKS 1D9IA 1JRSA 4D8NA 4FUCA 2QF3A 4WXVA 2OC0A 5EW2H 1HAOH 3ATMA 1BUIA 1F2SE 1Z8JB 2FOMB 4QT8C 2IJOB 4ABEA 4D7GA 3NCLA 2BVRH 2A7JA 1GJDB 1PQAA 3TNSA 2F9VA 3KCGH 1TQ7B 1TOMH 1EZQA 1O37A 1CT4E 3A87A 3H7OA 3TK9A 2J92A 1RXPA 4GAWA 2QXGA 3BTEE 4D76A 1QJ1B 2F9PA 1C5PA 1OS8A 5C3NA 1O2SA 2XBYA 2BYAX 5JBCS 2FOHA 2ZU1A 2BDAA 2UUFB 4NWLA 3Q3KA 4VGCB 4KTUA 4YT7H 1ELEE 2H6MA 1XMNB 3GDVA 2A32A 1BBRH 4FVDA 3P8OA 3EYDA 1SG8B 1NESE 3SZNA 1LO6A 3FFGA 3LOXA 3V12A 3VFEA 1ETRH 3SU3A 1UCYH 1W3CA 4OGYA 4UFEH 3RC4A 1QY6A 2HPQH 1LKAA 4FU7A 2WPMS 1NTPA 4NIYA 3TJOA 2XCFA 3ZZ5A 4DIIH 5AFYH 1AMHA 4Z0KA 3MU4A 4AZ2B 2AGEX 1Z8RA 4YM9A 1W11U 1GBKA 1O3CA 1ANDA 1BMLA 4NCYA 3AAVA 4LZ4B 1EJMA 4ZMAH 2AIPA 1BTWA 2GZ7A 1A0JA 1AO5A 1LVBA 1PPEE 3SI3H 1DVAH 2PW8H 1A3EH 1CA0B 2Z9IA 1MBQA 5DP7A 2GTBA 3BEFB 3O8DA 2R2WU 2BD3A 4FUBA 1C2EA 1P2IA 2VJ1A 4MG3A 1KSNA 2BB4A 5C1YA 1AQ7A 1C1WH 1HLTH 2PKAA 1CBWB 1G3BA 3UREA 3RXMA 1B0FA 3PTBA 3U8TH 2C8WB 1GJ8B 1SLVB 2C4FH 4U2WA 1H9IE 4NSYA 1SGEE 4Y76A 2XBXA 5F03A 1J17T 4XDEA 1LHDH 1HV7A 1ZGVA 1O3DA 1OX1A 3TIUA 4TY6A 3RM0H 1AUJA 5T6DA 3NZIA 1MTNC 3NK8A 1XUJA 5B6OA 3QZQA 4NIVA 3L33A 3I78A 1LKBA 3M3TA 2BOHB 1Y3WA 5DP9A 3QGNB 1PFXC 3B8JA 2V35A 2XXLA 2G8TA 1WBGB 2BLWA 2ANKH 2VIOA 3RU4D 4MPWA 1W8BH 4NA9H 2PHBA 3QZRA 2UUYA 3TH2H 2SGQE 4ZHLU 1MBMA 3GCHB 1NFXA 1K21H 5LPFA 1FN8A 3BTKE 1QR3E 1P2JA 5LGOA 4NZQA 1EAUA 3MH4A 3PYHA 1RGQA 2Z7FE 3W95A 1HAXB 2ZGCA 1ELFA 2BQWB 1A7SA 1A5GH 4WY3A 1XUIA 1VITF 4K3JA 3A81A 1JXPA 4AG1A 1EKBB 2GDEH 8KME2 1O2QA 2JH0D 3VB6A 1O2GH 1V2TT 2WPIS 2XC0A 1YLCA 1GVLA 4AOQA 2QYIA 4TWWA 4JZDH 2V3OH 3ODFA 4NA7A 1P3EA 1BTZA 5H4IB 4A5TS 3LJJA 2J95A 1FQ3A 1Q31A 2SGEE 2SGPE 1ZRBA 1QB1A 2NU0E 5HM9A 1EPTC 1HAYB 1LPZB 4IN1A 2ZU2A 1ELAA 2Z3DA 1GBJA 1G3CA 2ZWLH 4Y0ZE 5AF9H 1Z1JA 4IGDA 3LGYA 2ZGJA 3E0NB 3NWUA 2CHAC 5C2ZA 1THSH 1PPBH 3E8LA 2H9HA 4OS5A 1O2HA 4PROA 5EQSA 4A1VA 4MNWA 1O32A 3ZZ6A 4ZH8A 3U8RH 1CGJE 1ESAA 4B75A 5EG4A 1INCA 5DP4A 1GI2A 1CT0E 4XBDA 1AKSB 2ODPA 1C5QA 1IHSH 4O97A 1L2EA 1TGNA 2A1DB 2Z3EA 3E91A 5GCHG 2OLGA 1HAGE 4WMDA 2OTVA 1DE7H 1HJ9A 1AFQC 3MMGA 3MNXA 4E7RG 4UD9H 2FOBA 5AVDA 1PQ5A 2F9BH 3I29A 2LPRA 3VGCC 3A7YA 2WYJA 2BXUH 4MTBA 2FLBH 3TJNA 1F92A 1MCVA 1UVUH 1QGFA 4B71A 1JIMA 9ESTA 1O39A 1S0RA 4I8KA 1TNLA 2QA9E 1ZSJA 9LPRA 1GHYH 4OS2A 2BD5A 3A82A 1HCGA 1QHRB 1SGYE 4CHAC 3GY8A 1ZMJA 2GCTC 2ZFTA 2O8LA 2WINI 4K1EA 1X7AC 2NWNA 1ZTKA 2VVUA 4DVAU 1SQAA 2TGPZ 1H4WA 3LGTA 3UNSA 2JKHA 1SL3A 6GCHG 2BDCA 4YESB 1O3BA 2WPLS 1ZPZA 1C5MD 2Q6GA 3DT0H 3SUGA 2PKSB 1DFPA 1KLIH 4FVBA 1G2MA 1BJVA 1OYTH 1FIZA 5JBBS 1PYTD 2I6SA 1UK3A 3PMHB 4J2YB 2GVFA 1BA8B 1GBAA 4AYYB 1SQTA 1D6WA 2STBE 2BD7A 3BTFE 3TLOA 1EOJA 4ZXYH 4ZKRU 3ZZ8A 1MZDA 1Y8TA 2FI4E 1O2MA 3RLYH 1GCTC 4YO9A 4FUGA 2HNTF 1IQKA 3MYWA 5C5OA 1ELVA 1ZMNA 1AHTH 1OOKB 3RXOA 1GHXH 1OWJA 1O5FH 3S7KB 1LHFH 1GGDB 1Y3YA 2PV9B 3VPKA 3HKIB 3VEQB 1FAXA 1BTHH 2C93B 5FPYA 5G4BA 1ZHMA 3U1JB 1EP5A 1WAYB 1GBEA 3TU7H 5EQRA 3P8FA 1O3GA 4FUIA 1YYY1 7LPRA 2HNTC 4OS1A 4ISNA 3MFJA 3ZV9A 4Q7YA 1N6YA 1MTNB 5EPNA 3VB4A 2FTMA 3TGJE 1P57B 3FAOA 1AE8H 2ZZUH 4ABGA 1P06A 3SHCH 3RLWH 1RIWC 3EAJA 1DSTA 1XM1A 2BQ6B 4X2VA 2FZZA 3MH6A 1JOUB 4JZFH 1DXPA 1O2IA 3BTGE 2VWMA 1C1PA 2D26C 3HGPA 1ZHPA 2FPZA 3KQEA 2C8XB 1HYLA 1T4UH 4GHQA 3CENA 2D8WA 2ZP0H 1Z6JH 2BXTH 1ETSH 3Q00A 4SGAE 3GCTG 3EE0B 2Z9GA 3PMAB 3JZ1B 1HFDA 4A1XA 5CHAC 1MD8A 5T6FA 2BLVA 5FAHA 1VJAU 3VXEH 3SHAH 1QIXB 2KAIA 2SGFE 3ATLA 1FUJA 5EOKA 3ZVAA 1V2NT 1TGSZ 1TRNA 2JETB 4JZIA 1YF4A 5E8EH 1K22H 2H1UA 4K69A 3HPTB 4IS5A 1Z8IB 1KDQA 3CS0A 1E34B 1WSSH 3K6ZA 1W2KH 3T2NA 1ANEA 3UUZA 2R9PA 3A83A 1KY9A 3QDZB 1W0YH 1L4DA 1QBNA 2G4TA 3LC3A 5AHGH 1EZUC 2WPHS 1BB0B 3H7TA 3SU2A 2A2XH 1IQIA 1C9PA 4JK6A 4YOIA 5A2MH 1BZXE 2VVCA 2EI6A 1UHBA 1O5DH 1SOTA 1J14A 1ETTH 3P6ZB 3SV7A 1HAVB 1SHHB 1YPGH 5FCKA 2J94A 1SSXA 1W12U 1TIOA 1QURH 3L6PA 5A8XA 3CP7A 2VGCB 1UTMA 2GMTB 3V3MA 3K6YA 1GI4A 1AFQB 3AW1A 3M5MA 4X8TH 1TPSA 3SNCA 3FANA 1DS2E 1TX6A 2BQ7B 4X1QU 1GMCG 3E6PH 1SGPE 1CHOG 5CE1A 1XUKA 3M35A 5E0GA 2PGQB 4Y8XA 4UFGH 2W26A 1C5NH 1LTOA 1OP2A 2AEIH 3E16B 1EAIA 3GYMA 3NKKA 4DG4A 3RXGA 5TCAA 4GSOA 3U98H 2FP7B 8GCHG 1MU8B 2Y81A 4X1RU 2AMDA 3RXIA 2RA0A 1NM6A 2BX3A 2XRCA 1CE5A 2G52A 1CHGA 2GV6A 2VH6A 4FUEA 1AWFH 3R3GB 5F8ZA 5EXMA 3PTNA 1HXFH 4BXWA 2ZC9H 1HJ8A 3UOPA 1A2CH 3D62A 1PPZA 4RN6A 1TRMA 1F7ZA 2P8OB 1H1BA 1HXEH 2ZCKP 5AFZH 1TQ0B 1MTVA 1EP6A 1TONA 4JYUH 1V2PT 5HYOA 1DWDH 1O30A 3EA7A 1P04A 2FOCA 1WTHD 1IQLA 4B1TA 4FUHA 2FTLE 2BY6X 1IQJA 3RXLA 2A4GA 4YZUA 3P17H 4AGJA 1K1PA 4X0WU 3SOSA 1EZSC 3ZVFA 1GVKB 1ESBA 1Q2WA 4AFQA 3TJUA 1DUAA 4Y0YE 2NU4E 2FM2A 3OX7U 1O2TA 5DJ7A 1M9UA 4IC6A 2Y5FA 1NFUA 1SC8U 1AFEH 1SBWA 1TGTA 1YBWA 1B7XB 2GDDA 2Z6BD 2CGAA 5EODA 4AFUA 2VINA 1AVWA 1QBVH 3A84A 3RXHA 1O2NA 1JWTA 1L1NA 1V2MT 2P3FH 1JMOH 4IN2A 5LPRA 3RXSA 1A5IA 1C5RA 5DP3A 2FESH 2WV4A 3TK5A 1FDPA 4I7YH 3KIDU 4X2YA 3DUXH 2YNBA 3ZZ7A 5A0BA 3RU4E 1WQSA 1C2FA 2J2UA 1CA0C 2P3TB 3GCNA 2FEQH 3ZZ4A 2G81E 3BTTE 4H6TA 3S9BA 2OC1A 2UWLA 3LDXH 1AGJA 1G30B 5FCRA 1T8MA 1A0LA 1UTKA 4VGCC 3R0FA 6ESTA 4UE7H 3UQVA 1C2HA 1ELGA 1ZR0A 4CRGA 3GY3A 1EATA 2BDIA 3SGAE 4K5ZA 3MWIU 2O8MA 4R0IA 1ZSLA 1MTSA 1QB9A 3PLPA 1BHXF 3P92A 2GGVB 1TX7A 2TPIZ 2ZTYA 3LH1A 2EI7A 4K60A 3HKJB 2XC4A 3UWIA 3C27B 1C4V2 4B2CA 5J4SA 1QJ6B 5GWZA 1KLTA 3C1KA 5GIBA 2H5DA 4ISIH 1DLKB 3NUMA 2A5KA 2G4UA 1OWDA 4WXIA 1KXFA 2ESTE 4X6NA 2CXVA 2PKAB 4BAQB 5EW1H 1GVZA 2HPPH 1EUFA 1C5WB 1K9OE 5E2PA 3SU1A 4A7IB 1DDJA 3S7HB 1K2I1 3U8OH 4MPXA 4DGJA 3A7VA 4KTCA 1Z7KA 1NRSH 2ZGXH 2QCYA 1EOLA 2QF0A 3P70B 1AKSA 3I77A 1L0ZA 4AG2A 4ISHH 1O3JA 1P10A 1CBWC 1AB9C 1N1LA 4IBLH 1C2IA 4B76A 3E90B 4RKJB 1P2OA 4F49A 1VZQH 3PB1E 1ZSKA 3GICB 2OXSA 3RXUA 2F9UA 2B7DH 1C5LH 4THNH 5I46H 1CGHA 2OUAA 8GCHF 1HDTH 1Y59T 3QX5H 1XVOA 4ZROA 1QQUA 4O03A 4ISOA 1FMGA 2GT7A 5TJXA 3Q77A 1P12E 3UQOA 4U01A 5LPEA 1HAIH 1ELTA 1VGCB 3UIRA 1K1LA 3UWJH 1W0ZU 3RMNH 1BTYA 1MKWH 4OS6A 3OSYA 4CRCA 2QGRA 1S82A 1TYNA 3RUOA 4NSVA 3RMOH 1GJAB 1A0HB 1P3CA 1FNIA 3RC6A 3GY5A 2VNTA 3PLKA 3PMBB 3T5FH 4AB8A 1C4Y2 3GCHC 2VGCC 1O33A 2GMTC 2OBOA 5F8TA 1DSUA 1DXWA 2BTCE 2VIVA 1GBIA 2QV1A 3ZYEA 1P9SA 2BOKA 3TNTA 3GCOA 1O3OA 4BTUB 1UTNA 2F83A 2F9OA 3U69H 1O2ZA 3LGIA 4BAMB 4GUXA 1C1OA 1S6FA 1CVWH 1FAKH 1TA6A 1BMAA 3S9AA 2DE8A 3F9HA 1YPHE 4LK4A 2Y5HA 4WJG2 1ORFA 1MU6B 2GKVE 4UEHH 3SJ9A 1C5ZB 4HTCH 4HGCA 1GHBF 1BRAA 2BDGA 5T3HA 1BITA 2R3YA 4YOJA 1K28D 1GJ6A 3V0XA 4WH8A 2H2ZA 3RXJA 4Y8YA 4O9VA 4CR9A 2O8WA 1GDQA 2QN5T 1C5SA 3KQDA 3U9AH 3WY8A 1BRCE 3LC5A 1D3QB 1MUEB 2BDHA 1O2OA 2R3UA 2ALPA 2XBWA 3GY4A 3BEIB 1YP9A 3LGUA 1PQ7A 4X8VH 1MAXA 2ZDNA 1GBHA 1MQ5A 3EA9A 5FPSA 2BMGB 5C5NA 2P8OC 1NO9H 1TB6H 3UR6A 2HLCA 1PPGE 3SNEA 4U30A 2VU8E 3F68H 7GCHG 1WOFA 3OTJE 3MI4A 4AN7A 2Q1JA 3FP7E 4MNXA 4RSPA 4DIHH 1ARBA 1YPKH 1O31A 4CH8B 1CHOF 3KEEA 4AX9H 3STIA 1SFIA 4ZKOU 2ZECA 4AYVB 1V2ST 4KGAA 1TABE 2TBSA 3ZZ3A 1HRTH 1PPCE 1KXDA 3MH7A 1KXAA 1P11E 1S83A 1ZJDA 3HGNA 3A7WA 4BTTB 2ZU5A 1AZ8A 1N8OC 2PUXB 4X8SH 1MH0A 1XX9A 5E0HA 3MTYA 2OC7A 2CF9H 1T8NA 4K8BA 1QB6A 1PQ8A 3A88A 1ANBA 4JZ1A 1ZTLA 3VB5A 2FXRA 1C2JA 1NRQH 2AFQB 1O38A 3SN8A 1OSSA 2IPHA 1GBDA 2A2QH 2GT8A 2SGAA 1NRRH 1W13U 1QL8A 1PPHE 1S0QA 4A1TA 1UJ1A 5DP6A 4ZUHA 4Y6DA 2JH5D 1TBQH 1QNJA 4MDSA 3PMJA 2R0LA 1HGTH 2IN2A 1IAUA 1D3DB 2W7UA 5JB8S 1S5SA 3AW0A 4Y71A 1D4PB 1THRH 2ANMH 3EQ0H 3TGIE 2QIQA 1O5EH 3F9FA 4BTIB 3RP2A 1GL0E 4MVNA 1YPMH 1DITH 2UWPA 3RXVA 3UNQA 4INKA 1GG6B 3SV2H 4DCDA 3BG4B 1EB2A 1ZYOA 3GY6A 3ATWA 3S69A 1AY6H 2A31A 1TLDA 1V2QT 1SB1H 3QUMP 1MKXH 3O8RA 4IW4E 1UTPA 3MU0A 1T4VH 5DP8A 4LZ1H 1C1QA 2ZGHA 2ZHQH 4I33A 4JMYA 3RXKA 1QA0A 3BG8A 2I6QA 2OC8A 3D49H 3ZV8A 4Y7AA 3F1SB 4ZXXH 1GHBG 3GY7A 3ESTA 1DICA 5EGMA 3Q3YA 3GOVB 1MTUA 1NFWA 1HUTH 3SU6A 2SNWA 1OXGA 5DO4H 4CRFA 4O3TA 3PO1C 2ASUB 4YLQH 2STAE 4XE4A 3MOCA 1SR5C 2OQUA 5I25A 3ITIA 1P2MA 1FXYA 1GHWH 1SGNE 2Q6FA 3PWBA 1V2RT 1QL9A 4ZAEA 3A8CA 1VCWA 2BVXH 1OWIA 1C5TA 4NWKA 1V2KT 3NPSA 1W7XH 1GBLA 1P2QA 2A4OA 1ZJKA 4TPYA 1TOCB 1EAWA 1C5OH 1TALA 4ASHA 1DWCH 1T7CA 1BT7A 1TNJA 1SI5H 5FX5A 1Y5AT 3SGBE 2AS9A 3OU0A 2FS8A 3RXBA 1FZZA 4CRBA 1TMTH 1C5VA 3SNBA 1C2GA 1O2PA 3TK6A 1FY4A 1FIWA 4BAKB 2O8UA 2Y7XA 2HOBA 2XWBI 1Z71A 1BBRK 8ESTE 1C9TA 3RXQA 2QXIA 1NPMA 5K7RA 5FBIA 5CHAB 2Z3CA 1XUFA 4FXGH 4B74A 1A46H 1C4U2 3RC5A 3A8AA 1QTFA 4ZKSU 3VB3A 1ANCA 3TJVA 4JZEH 3RXCA 3UNRA 3HK6B 4NG9H 1ZGIA 2V3HH 1F0TA 2ZHEH 4K2YA 2Y7ZA 2D1JA 4YTAA 3SJOA 3UPEA 1FI8A 2IOTA 3RMLH 2JETC 3BTME 4XFQA 1KXBA 1AZZA 2BY9X 1GI6A 5GJ4B 3RMMH 1GHAG 5ESBA 4Q7ZA 1LCYA 1O3IA 1FY1A 3SJKA 5DK1A 3M36A 1NROH 4A92A 4B2AA 2OD3B 5L2ZH 4X1PU 3DD2H 2NU2E 4WMEA 5HMAA 1G37A 3A86A 1C1RA 1YPEH 4Z6AH 1O35A 1FV9A 3D23A 1J9CH 4Q7XA 1UK4A 1C2MA 1C1MA 3V7TA 1QRZA 1K1MA 3UOUA 1Y3XA 1RFNA 4DJZB 1VCQA 3HK3B 1IQNA 1QQ4A 1YPLH 2CN0H 1ABJH 2FOAA 1QRWA 4X1NU 2XC5A 2ZPQA 1EB1H 1ZTJA 1V2UT 1UK2A 1MKWK 3A8BA 1FJSA 3BV9B 2P16A 3PM3A 1SPJA 1WU1A 1LPKB 2GCHG 2ZI2H 1MAYA 1MCTA 3VXFH 1TE0A 1QBOA 3O8BA 3M37A 4O3UA 3UFAA 2FO9A 2EA3A 1GBBA 1GPZA 1NRNH 3ZVCA 1HJAC 3AAUA 5A8YA 2GP9B 5HM2A 2H5CA 1GMHG 2TGTA 2W3IA 1GBCA 2GZ9A 2HWLB 1PJPA 2CF8H 1ZPCA 3B23B 3LIWA 2PTNA 1MD7A 2QY0B 1QRXA 1TFXA 3A89A 4MQAA 1LHCH 3LU9B 3ODDA 6GCHF 1F0RA 1ID5H 1P02A 1TPAE 1VITG 2ULLA 2AIQA 1Y5BT 2FDAA 4CRDA 3T29A 3SUDA 1HIAB 1P9UA 3RXTA 2FWWA 5IYTA 5C20A 5SGAE 1O5GH 4KKDA 1SOZA 3T28A 4NIXA 1FN6A 1YCPK 4K8YA 3VGCB 2AYWA 5F8XA 3ENSB 1N6XA 1SGFA 1SLWB 1TPOA 1YM0A 1DM4B 3RXRA 2ALVA 5K0HA 1G2LA 2XW9A 1HNEE 1O3PB 4K1TA 2BD2A 4ESTE 1ELDE 1L1GA 4Q2KA 1NFYA 3AASA 1TBZH 1ZRKA 1AIXH 4JCNA 1SFQB 1FPCH 3H5CB 2WUBA 1MZAA 1XUHA 3M3VA 2TIOA 3SORA 2FS9A 2GCTB 5HGGA 4JYTA 3E1XB 3ZVGA 1OKXA 4FUFA 3BG4C 1P01A 3EGKH 4UONA 3PLBA 1F5RA 2ZDMA 2BM2A 4CRAA 1G3EA 1S81A 2VIWA 3BN9A 4D9RA 1YCPM 4WH6A 1O2LA 2FI3E 1P03A 1KDQB 1MMJN 4D9QA 1E38B 1KXEA 1UTLM 4JK5A 2P3UB 3RDZA 2GX4A 5JB9S 3MO6A 4CBNA 3A7ZA 2PKSC 1NT1A 4AB9A 1TGBA 4BNRA 3EDXB 2P94A 1SLUB 2OP9A 1PPFE 2JH6D 3G01A 2OBQA 1VJ9U 3SBKA 1SMFE 1D3PB 1VR1H 2C90B 1CO7E 5E2OA 1LMWB 3PO1B 2THFB 5BPEA 2ODYB 2CMYA 4XBBA 4H42U 1H9LB 6CHAB 1O3HA 2B9LA 1WCZA 1GCTB 2FI5E 2J34A 4Y7BA 1D6RA 3DA9B 3QTVH 1TX8A 1QJ7B 1O5CB 2PLXA 2A5AA 4ABJA 2WUCA 4MPUA 4XOJA 1K1OA 1NY22 1IOEA 1K1IA 2B0FA 4ABIA 3D65E 4XSKU 2ZU4A 5L30H 4OS4A 1YCPH 1QA7A 1V2LT 5A09A 3ZVDA 3IWMA 2FX4A 4ABDA 1DWEH 1SVPA 4YLUA 3RM2H 1A3BH 1KTTB 1AVGH 1TNHA 2AGGX 3KL6A 4TWYA 5T6GA 3SV8A 1B0EA 1VGCC 1GMDF 1RIWB 4Q80A 3GISB 3KQCA 5JBAS 1BIOA 4WF8A 2OCVB 3SI4H 3ZZBA 1QCPA 2W3KA 1O2XA 2RA3A 3Q3XA 1TNGA 1GHZA 3ELAH 1YPJH 4GLYA 1C1VH 1IQHA 1HBTH 1P2NA 1HAZB 1LQEA 4Y8ZA 5JBTA 2HVXA 1SHYA 3E3TA 1BCUH 1GI8B 3RU4T 1OPHB 5ESTE 1AB9B 1O3EA 1DLEA 2ZPRA 4I31A 2C8YB 5ABWA 1O5AB 3FZDA 1V2WT 3RXPA 2M5TA
chains in the Genus database with same CATH superfamily
3SJIA 2WYGA 3SNDA 2A5IA 3T25A 2QC2A 1E37B 1QFKH 4FETA 2W7SA 1UVSH 2ZFPH 1PYTC 1DANH 2ZPSA 2XYAA 1GJ5H 4CREA 1GJCB 1EX3A 1ESTA 3BIUH 3JZ2B 2QXJA 3UTUH 1IQMA 2AMQA 3BTWE 3PRDA 4BANB 1P05A 2SNVA 5FBEA 2JJ1D 2TRMA 2ILNA 1O2YA 1T31A 1BMMH 2A45B 3OYPA 2H9TH 1E36B 2FMJA 4NFEA 4GVUA 4XRNA 2XTTB 1ZLRA 4I8HA 3QGJA 3RXEA 1NU9A 3DFJA 2ZFFH 3M7TA 3UR9A 1GWAA 1KIGH 3SQHE 1W0JD 3LT3A 4X6PA 3MO9A 4AORA 2HGTH 2QXHA 1D3TB 2C3SA 2Y6TA 3QN7A 2HALA 4GHTA 4DW2U 2BD4A 2ZCLP 3F3BA 3QO6A 1NS3A 1GHAF 3BTDE 7KMEH 3T27A 1ELBA 2VIPA 3RXAA 2VB0A 1OP0A 2FYRA 2ZNKH 1CGIE 2UUJB 2Y80A 1TGCA 3ZZDA 3KGPA 2PWXA 1TAWA 4WMFA 1E0FD 1WV7H 4B6EA 1UTQA 1ELCA 1CQQA 1RD3B 3U1IB 1UVTH 1O3MA 4YOGA 2WV5A 3DFLA 1CT2E 1A61H 3K2UA 4FOUC 1KTSB 1TWXB 3P8NA 4BAHB 1HAHH 3MO3A 4I86A 3U28C 3SUEA 1FPHH 2AGIX 3A8DA 3GYLB 1YGCH 4MPVA 1O3FA 2EEKA 1V2JT 3ATKA 4DURA 2V6NA 1K1NA 3TPIZ 1V2VT 1Y3VA 2O8TA 1EJAA 4I8GA 3BIVH 3ZYDA 2V0BA 3SW2B 1UO6A 1FY8E 2P59A 4MLFB 1UTOA 3URCA 5FX6A 5C1XA 1BJUA 3HATH 1EASA 1G32B 3SU0A 2AERH 1MKXK 3W1EA 4DY7B 2XBVA 1DT2A 2TGDA 1W7GH 2L74A 4A6LA 1WQVH 1F5LA 1F5KU 5GDSH 1WYKA 3URDA 5DP5A 1JRTA 3VB7A 2Y5GA 4GCHF 2PP6A 1T32A 2RDLA 5JYIA 2ZDAH 4DOQA 1LHEH 5GNDA 5HXFA 2EI8A 2SFAA 1SGTA 4TT3D 3BF6H 3QWCH 3Q76A 1AVXA 3S0NA 3F6UH 3PROA 3ZVEA 1RTKA 2BVSH 1S85A 2VWNA 3B9FH 4IMQA 2TGAA 1W14U 4NA8A 1O34A 2FOGA 1MQ6A 1N8OB 3SUFA 1GL1A 5EQQA 4X6OA 1IQFA 1J16A 4RT0A 2QAAA 1G36A 2CHAB 3BEUA 1O2WA 1HAVA 2XNIA 4KELA 3MU5A 4I32A 3W94A 1KXCA 4TPIZ 2ZHWH 4KTSA 2RCEA 1O2UA 1SGFG 1C5YB 1Z1IA 2ODQA 2F9NA 4AGKA 1C1TA 3T62A 3MU1A 2BZAA 2PR3A 2A4QA 1IQEA 1KYNA 2SGDE 1YLDA 1H8IH 2W5EA 2G5VA 3GDUA 4NFFA 2DUCA 1BTUA 1BOQA 1RJXB 1XXFA 1IHTH 4ACBA 2BY7X 5GCHF 1UVOA 2VIDA 5LH8A 5FHTA 3BTQE 2BDBA 2YMSD 1O2JA 2RG3A 1O3NA 5EXNA 5A8ZA 3ATIA 1GJ9B 2NU1E 3LGVA 3M61U 1V6DA 1MTWA 4Z1MD 1LVMA 5EU8A 2FOFA 4ABAA 1EPTB 2KZ4A 2GZ8A 3SO3A 4BOHA 1KLJH 1P2KA 4HFPB 2HNTE 1T8OA 2ZO3H 3RXFA 1P0SH 1JBUH 1J15A 4XBCA 1HB0B 2BY5X 4Y11E 1VCPA 5KEDA 3M7UA 2NU3E 4FU8A 2BD9A 2ZCHP 1O2RA 1U6QA 3SV6A 1O3AA 4UFDH 4AFZA 1GI3A 2Z9LA 5EPYA 1EZXC 4I8JA 3MNSA 3STJA 1Q3XA 1ACBE 2C8ZB 4OGXA 3O8CA 1OWKA 2FIRH 2G00A 4UDWH 1GBTA 2W6JD 1ABIH 3OY6U 4GCHG 2ZDLA 1GI1A 1V2OT 1AE5A 2YNAA 2ZA5A 5F6MA 2ZG0H 4NZLA 1IQGA 3P8GA 2G51A 3E0PB 1SLXB 2BY8X 5FXLA 1BBRE 2OQ5A 3N7OA 2D2DA 2QE7D 3DHKH 1TBRH 3EA8A 1OP8A 2UWOA 2GD4B 4I8LA 1Z8GA 2ZGBH 1V3XA 3RXDA 1GMHF 4AFSA 2FLRH 2VBCA 3MH5A 1XUGA 3N99A 4YT6H 3K65B 3IITA 2PSXA 2ZTXA 1CU1A 3MNCA 4D7FA 3SU5A 4LXBH 3QTOH 1HPGA 2KAIB 2J38A 1GCDA 3QK1A 1BMNH 1KMHB 1ZPBA 1HIAA 2LNCA 1K1JA 4BAOB 2PUQH 3ZZ9A 5L2YH 3GCTF 1TNKA 2ZU3A 3KF2A 1EXFA 3A7TA 3GDSA 2WV9A 5DKMA 4B73A 1GBMA 5L6NH 5DGJA 3SJ8A 2ZTZA 4FU9A 4CHAB 1OYQA 5HIZA 2ZFRH 5J4QA 4SGBE 4CBOA 1GGDC 1SGIB 3ZVBA 2P93A 3KNXA 3F9GA 5C1UA 2BLOA 1UCYE 1ZOMA 4TYDA 1BRBE 2Z94A 2ZHFH 3S9CA 1GI0A 4K1SA 1G9IE 2K0QA 2A4RA 3AVZA 1SQOA 1GMCF 2Z9JA 1FY3A 2J4IA 2B8OH 1LPGB 1Y3UA 4ZHAA 5GPIB 1GI7B 1UHBB 1LVOA 2BDYA 2F91A 1O3LA 3UY9A 2KCPA 4Y79A 3M5NA 4MNVA 3MHWU 5TCCA 1LQDB 2H9EH 3GY2A 4LOYH 2Q6DA 2R0KA 3FVFB 4B2BA 1GI5A 3BSQA 1GI9B 1BQYA 1UVPA 4ZKNU 1FY5A 4CH2B 3LKWA 1LHGH 1HJAB 1E35B 2PFEA 1RTFB 1A5HA 4BXSA 5EXLA 1LDTT 1GBFA 1C5XB 3LJOA 4Y10E 1Z6EA 2VH0A 3KHVA 4X8UH 1L4ZA 2K1QA 1FONA 1GDUA 3FZZA 1DPOA 3PWCA 1BTXA 1O5BB 4Q4LA 3TGKE 1A4WH 3A7XA 3LH3A 1O0DH 1S6HA 3V13A 3BTHE 2PGBB 4ZHMU 1C1NA 3M3SA 1ZZZA 4CR5A 2ZHDA 1EQ9A 1TMBH 2RDEA 3SV9A 1A1RA 1UMAH 1YC0A 1BRUP 1S84A 1LVYA 2ZFSA 1GJ4H 1DY8A 1C2DA 2PTCE 3K9XB 1W10U 3KYFA 1DX5M 3MU8A 3L3TA 3GS9A 1CSOE 1EAXA 2VIQA 5A0AE 4RI0A 2ZDKA 3NXPA 1NZQH 4X1SU 1B5GH 1EPTA 3EE7A 3TH3H 1NC6A 1O3KA 2CJIA 1C1SA 1L1JA 2BHGA 1AN1E 3A85A 1C2KA 1C2LA 4J1YA 4F4OC 4INLA 2ZKSA 4X2WA 3FP6E 2ZIQH 4FUDA 1NN6A 5BRRE 3AK5A 4NIWA 4ABBA 2ZF0H 3TITA 3IG6B 2VWLA 3ZZAA 4H6SB 1AWHB 1ZMLA 4X2XA 1J8AA 2ZFQH 3KQBA 3ZIAD 4ISLA 1BDAA 1NRPH 5IDKA 1GMDG 2XCNA 1P8VC 2EC9H 4UFFH 3KN2A 5GXPA 1UTJA 3FN8A 3SQEE 3OY5U 2ANWA 1DUEA 3ZZCA 5E0JA 3SU4A 4E05H 1T8LA 4INHA 1SGDE 2AMPA 2DE9A 1BHXB 3TVJB 2FODA 1O2VA 1THPB 3QLPH 2PSYA 2UUKB 3T26A 2BD8A 3F9EA 3TH4H 1F0UA 4KP0A 2ZQ1A 1AUTC 2Y82A 2FOEA 1AD8H 3SGQE 1WTGH 1XKAC 5DPAA 1DOJA 2G5NA 4WWYA 1SGCA 3LONA 1H8DH 3F2HA 3LGWA 3P95A 2A7HA 1DWBH 4DT7B 1HAPH 4H4FA 1S6LA 4FUJA 2R2MB 2BX4A 3DCLA 4U32A 3FP8E 3M5LA 1SGQE 2ZDVH 3PV4A 5DG6A 1TMUH 2VVVA 4JYVH 1AU8A 2WPJS 2BZ6H 4TY7A 1O36A 3SNAA 2FX6A 1GJ7B 2B5TB 2GCHF 1JIRA 4M7GA 1GHVH 1G3DA 1UCYK 1SGRE 1RS0A 7ESTE 1ARCA 1O2KA 7GCHF 2HRVA 2AH4X 3OFND 2O9QA 3OTPA 2YOLA 1C1UH 1VITH 2A0QB 3M5OA 4MNYA 1H9HE 1F0SA 1Y5UT 2P95A 1C5UA 1OWEA 2VWOA 2ZEBA 2F3CE 2CV3A 2GV7A 1TPPA 1TA2A 2BLQA 4ABFA 1EJNA 1TRYA 5FPTA 2G55A 4HZHA 5ETXA 2XWAA 1BTPA 4NGAH 1GG6C 1QL7A 4R8TB 4HI3A 4IC5A 5JPMH 5EJ1A 1YPHC 2J9NA 3LPRA 2ZQ2A 1AI8H 2FYQA 3PV2A 1RRKA 5A0CA 4IMZA 3MNBA 5PTPA 1NU7B 5CMXH 3A80A 1WUNH 1CA8B 6CHAC 1GJBB 4WVPE 2A7CA 1TNIA 4ABHA 1OWHA 1RTLA 1ZHRA 1XKBC 1GDNA 3M7QA 4X6MA 6LPRA 3CS7A 8LPRA 2ANYA 1P09A 4E7NA 4RKOB 5KECA 3OAAD 1DY9A 4OM9A 2Z9KA 1XXDA 2OINA 4GPGA 4E06H 2WZQA 1YKTA 5JDUB 1FLEE 5C67A 4OS7A 1XVMA 1YY3A 2WPKS 1D9IA 1JRSA 2EY4C 4D8NA 4FUCA 2QF3A 4WXVA 2OC0A 5EW2H 1HAOH 3ATMA 4P00A 1BUIA 1F2SE 1Z8JB 2FOMB 4QT8C 2IJOB 4ABEA 4D7GA 3NCLA 1K0HA 2BVRH 2A7JA 1GJDB 1PQAA 2WHXA 3TNSA 2F9VA 3KCGH 1TQ7B 1TOMH 1EZQA 1O37A 1CT4E 3A87A 3H7OA 3TK9A 2J92A 1RXPA 4GAWA 2QXGA 3BTEE 4D76A 1QJ1B 2F9PA 1C5PA 1OS8A 5C3NA 1O2SA 2XBYA 2BYAX 5JBCS 2FOHA 2ZU1A 2BDAA 2UUFB 4NWLA 3Q3KA 4VGCB 4KTUA 4YT7H 1ELEE 2H6MA 1XMNB 3GDVA 2A32A 1BBRH 4FVDA 3P8OA 3EYDA 1SG8B 1NESE 3SZNA 1LO6A 3FFGA 3LOXA 3V12A 3VFEA 1YLNA 1ETRH 3SU3A 1UCYH 1W3CA 4OGYA 4Q63A 4UFEH 3RC4A 1QY6A 2HPQH 1LKAA 4FU7A 2WPMS 1NTPA 4NIYA 3TJOA 2XCFA 3ZZ5A 2YMSC 4DIIH 5AFYH 1AMHA 4Z0KA 3MU4A 4AZ2B 2AGEX 1Z8RA 4YM9A 1W11U 1GBKA 1O3CA 1ANDA 1BMLA 4NCYA 3AAVA 4LZ4B 1EJMA 4ZMAH 2AIPA 1BTWA 2GZ7A 1A0JA 1AO5A 1LVBA 1PPEE 3SI3H 3UAIC 1DVAH 2PW8H 1A3EH 1CA0B 2Z9IA 1MBQA 5DP7A 2GTBA 3BEFB 3O8DA 2R2WU 2BD3A 4FUBA 1C2EA 1P2IA 2VJ1A 4MG3A 1KSNA 2BB4A 5C1YA 1AQ7A 1C1WH 1HLTH 2PKAA 1CBWB 1G3BA 3UREA 3RXMA 1B0FA 3PTBA 3U8TH 2C8WB 1GJ8B 1SLVB 2C4FH 4U2WA 1H9IE 1FX0B 4NSYA 1SGEE 4Y76A 2XBXA 5F03A 5HKKD 1J17T 4XDEA 1LHDH 1HV7A 1ZGVA 1O3DA 1OX1A 3TIUA 4TY6A 3RM0H 1AUJA 5T6DA 3NZIA 1MTNC 3NK8A 1XUJA 5B6OA 3QZQA 4NIVA 3L33A 3I78A 1LKBA 3M3TA 2BOHB 1Y3WA 5DP9A 3QGNB 1PFXC 3B8JA 2V35A 3WW7A 2XXLA 2G8TA 1WBGB 2BLWA 2CK3D 2ANKH 2VIOA 3RU4D 4MPWA 1W8BH 4NA9H 2PHBA 3QZRA 2UUYA 3TH2H 2SGQE 4ZHLU 1MBMA 3GCHB 1NFXA 1K21H 5LPFA 1FN8A 3BTKE 1QR3E 1P2JA 2KCYA 5LGOA 4NZQA 1EAUA 3MH4A 3PYHA 1RGQA 2Z7FE 3W95A 1HAXB 2ZGCA 1ELFA 2BQWB 1A7SA 1A5GH 4WY3A 1XUIA 1VITF 4K3JA 3A81A 3OEED 1JXPA 4AG1A 1EKBB 2GDEH 8KME2 1O2QA 2JH0D 3VB6A 1O2GH 1V2TT 2WPIS 2XC0A 1YLCA 1GVLA 4AOQA 2QYIA 2OK5A 4TWWA 4JZDH 2V3OH 3ODFA 4NA7A 1P3EA 1BTZA 5H4IB 4A5TS 3LJJA 2J95A 1FQ3A 1Q31A 2SGEE 2SGPE 1ZRBA 1QB1A 2NU0E 5HM9A 1EPTC 1HAYB 1LPZB 4IN1A 2ZU2A 1ELAA 2Z3DA 1GBJA 1G3CA 2ZWLH 4Y0ZE 5AF9H 4F55A 1Z1JA 4IGDA 3LGYA 2ZGJA 3E0NB 3NWUA 2CHAC 5C2ZA 1THSH 1PPBH 3E8LA 2H9HA 4OS5A 1O2HA 4PROA 5EQSA 2IJD1 4A1VA 3KYGA 4MNWA 1O32A 3ZZ6A 4ZH8A 3U8RH 1CGJE 1ESAA 4B75A 5EG4A 1INCA 5DP4A 1GI2A 1CT0E 4XBDA 1AKSB 2ODPA 1C5QA 1IHSH 4O97A 1L2EA 2F43B 1TGNA 2A1DB 2Z3EA 3E91A 5GCHG 2OLGA 1HAGE 4WMDA 2OTVA 1DE7H 1HJ9A 1AFQC 3MMGA 3MNXA 5C0TA 4E7RG 4UD9H 2FOBA 4P02A 5AVDA 1PQ5A 1E1RD 2F9BH 3I29A 2LPRA 3VGCC 3A7YA 2WYJA 2BXUH 4MTBA 2FLBH 3TJNA 1F92A 1MCVA 1UVUH 1QGFA 4B71A 1JIMA 9ESTA 1O39A 1S0RA 4I8KA 1TNLA 2QA9E 1ZSJA 9LPRA 1GHYH 4OS2A 2BD5A 3A82A 1HCGA 1QHRB 1SGYE 4CHAC 1QZ8A 3GY8A 1ZMJA 2GCTC 2ZFTA 2O8LA 2WINI 4K1EA 1X7AC 5KGOA 1E79D 2NWNA 1ZTKA 1YWUA 2VVUA 4DVAU 1SQAA 2TGPZ 1H4WA 3LGTA 3UNSA 2JKHA 1SL3A 6GCHG 2BDCA 4YESB 1O3BA 2WPLS 1ZPZA 1C5MD 2Q6GA 3DT0H 3SUGA 2PKSB 1DFPA 1KLIH 4FVBA 1G2MA 1BJVA 1OYTH 1FIZA 5JBBS 1PYTD 2I6SA 1UK3A 3PMHB 4J2YB 2GVFA 1BA8B 1GBAA 4AYYB 1SQTA 1D6WA 2STBE 2BD7A 3BTFE 3TLOA 1EOJA 4ZXYH 3CNRA 4ZKRU 2M2AA 3ZZ8A 1MZDA 1Y8TA 2FI4E 1O2MA 3RLYH 1GCTC 4YO9A 4FUGA 2HNTF 1IQKA 3MYWA 5C5OA 1ELVA 1ZMNA 1AHTH 1OOKB 3RXOA 1GHXH 1OWJA 1O5FH 3S7KB 1LHFH 1GGDB 1Y3YA 2PV9B 3VPKA 3HKIB 3VEQB 1FAXA 1BTHH 2C93B 5FPYA 5G4BA 2HLDD 1ZHMA 3U1JB 1EP5A 1WAYB 1GBEA 5B6LA 3TU7H 5EQRA 3P8FA 1O3GA 4FUIA 1YYY1 7LPRA 3VG8A 2HNTC 4OS1A 4ISNA 3MFJA 3ZV9A 4Q7YA 3SZEA 1N6YA 1MTNB 5EPNA 3VB4A 2FTMA 3TGJE 1P57B 3FAOA 1AE8H 2ZZUH 4ABGA 5EIYA 1P06A 3SHCH 3RLWH 1RIWC 3EAJA 1DSTA 1XM1A 2BQ6B 4X2VA 2FZZA 3MH6A 1JOUB 1SKYE 4JZFH 1DXPA 1O2IA 3OE7D 3BTGE 2VWMA 1C1PA 2D26C 3HGPA 1ZHPA 2FPZA 3KQEA 2C8XB 1HYLA 1T4UH 4GHQA 3CENA 2D8WA 2ZP0H 1Z6JH 2BXTH 1ETSH 2EQNA 3Q00A 4SGAE 3GCTG 3EE0B 2Z9GA 3PMAB 3JZ1B 1HFDA 4A1XA 5CHAC 1MD8A 5T6FA 2BLVA 5FAHA 1VJAU 3VXEH 3SHAH 1QIXB 2KAIA 2SGFE 3ATLA 3WWFA 1FUJA 2WSSD 2XOKD 5EOKA 3ZVAA 1V2NT 1TGSZ 1TRNA 2JETB 4JZIA 1YF4A 5E8EH 1K22H 2H1UA 4K69A 3OEHD 3HPTB 4IS5A 1Z8IB 1KDQA 3CS0A 1E34B 1WSSH 2JIZD 3K6ZA 1W2KH 1MABB 3T2NA 1ANEA 3UUZA 2R9PA 3A83A 1KY9A 3QDZB 1W0YH 1L4DA 1QBNA 2G4TA 3LC3A 5AHGH 1EZUC 5CHBA 2WPHS 5DSFA 1BB0B 3H7TA 3SU2A 2A2XH 1IQIA 1C9PA 4JK6A 4YOIA 5A2MH 1BZXE 2VVCA 2EI6A 1UHBA 1O5DH 1SOTA 1J14A 1ETTH 3P6ZB 3SV7A 1HAVB 1SHHB 1YPGH 5FCKA 2J94A 1SSXA 1W12U 1TIOA 1QURH 3L6PA 5A8XA 3CP7A 2VGCB 1UTMA 2GMTB 3V3MA 3K6YA 1GI4A 1AFQB 3AW1A 3M5MA 4X8TH 1TPSA 3SNCA 3FANA 1DS2E 1TX6A 2BQ7B 4M9FA 4X1QU 1GMCG 3E6PH 1SGPE 1CHOG 2IPQX 5CE1A 1XUKA 2L6OA 3M35A 5E0GA 2PGQB 4Y8XA 4UFGH 2W26A 1C5NH 1LTOA 1OP2A 2AEIH 3E16B 1EAIA 3GYMA 3NKKA 4DG4A 3RXGA 5TCAA 5C0UA 4GSOA 3U98H 2FP7B 8GCHG 2J98A 1MU8B 2Y81A 4X1RU 2AMDA 3RXIA 2RA0A 1NM6A 2BX3A 2XRCA 1CE5A 2G52A 1CHGA 2GV6A 2VH6A 4FUEA 1AWFH 3R3GB 5F8ZA 5EXMA 3PTNA 1HXFH 4BXWA 2ZC9H 1HJ8A 3UOPA 1A2CH 3D62A 1PPZA 5IK2D 4RN6A 1TRMA 1F7ZA 2JJ2D 2P8OB 1H1BA 1HXEH 2ZCKP 5AFZH 1TQ0B 1MTVA 1EP6A 1TONA 4JYUH 1V2PT 5HYOA 1DWDH 1O30A 2W6ID 3EA7A 1P04A 2FOCA 1WTHD 1IQLA 4B1TA 4FUHA 2FTLE 2BY6X 1IQJA 3RXLA 2A4GA 4YZUA 1H8HD 3P17H 4AGJA 1K1PA 4X0WU 3SOSA 1EZSC 3ZVFA 1GVKB 1ESBA 1Q2WA 4AFQA 3TJUA 1DUAA 4Y0YE 2NU4E 2FM2A 1E1QD 1O2TA 3OX7U 5DJ7A 1M9UA 4IC6A 2Y5FA 1NFUA 1SC8U 1AFEH 1SBWA 1TGTA 1YBWA 1B7XB 2GDDA 2J5UA 2CGAA 2Z6BD 5EODA 4AFUA 2VINA 1AVWA 1QBVH 3A84A 3RXHA 1O2NA 1JWTA 1L1NA 1V2MT 2P3FH 1JMOH 4IN2A 5LPRA 5EJZA 3RXSA 1A5IA 1C5RA 2KX4A 5DP3A 2FESH 2WV4A 3TK5A 1FDPA 4I7YH 3KIDU 4X2YA 3DUXH 2YNBA 2KCOA 3ZZ7A 5A0BA 3RU4E 1WQSA 1C2FA 2J2UA 1CA0C 2P3TB 3GCNA 2FEQH 3ZZ4A 2G81E 3BTTE 4H6TA 3S9BA 2OC1A 2UWLA 3LDXH 1AGJA 2K8IA 1G30B 5FCRA 1T8MA 1A0LA 1UTKA 4VGCC 3NRLA 1BMFD 3R0FA 6ESTA 4UE7H 3UQVA 1C2HA 2RFKC 1ELGA 1ZR0A 4CRGA 3GY3A 1EATA 2BDIA 3SGAE 4K5ZA 3MWIU 2O8MA 4R0IA 1ZSLA 1MTSA 1QB9A 3PLPA 1BHXF 3P92A 2GGVB 1TX7A 2TPIZ 2ZTYA 1VKYA 3LH1A 2EI7A 4K60A 3HKJB 2XC4A 3UWIA 3C27B 1C4V2 4B2CA 5J4SA 1QJ6B 5GWZA 1KLTA 3C1KA 5GIBA 2H5DA 4ISIH 1DLKB 3NUMA 2A5KA 2G4UA 3MQKC 1OWDA 4WXIA 1KXFA 2ESTE 4X6NA 2CXVA 2PKAB 4BAQB 5EW1H 1GVZA 2HPPH 1EUFA 1C5WB 1K9OE 5E2PA 3SU1A 4A7IB 1DDJA 3S7HB 3F0OA 1K2I1 3U8OH 4MPXA 4DGJA 3A7VA 4KTCA 1Z7KA 1NRSH 2ZGXH 2QCYA 1EOLA 2QF0A 3P70B 1AKSA 3I77A 1L0ZA 4AG2A 4ISHH 1O3JA 1P10A 1CBWC 1AB9C 1N1LA 4IBLH 1C2IA 4B76A 3E90B 4RKJB 1P2OA 4F49A 1VZQH 3PB1E 1ZSKA 3GICB 2OXSA 3RXUA 2F9UA 2B7DH 1C5LH 4THNH 5I46H 1CGHA 3UB0A 2OUAA 8GCHF 3PV5A 1HDTH 1Y59T 3QX5H 1XVOA 4ZROA 1QQUA 4O03A 4ISOA 1FMGA 2GT7A 2V3MA 5TJXA 3Q77A 1P12E 3UQOA 5DN6D 4U01A 5LPEA 1HAIH 1ELTA 1VGCB 3UIRA 1K1LA 3UWJH 1W0ZU 3RMNH 3F0PA 3DSOA 1BTYA 1MKWH 4OS6A 3FKSD 3OSYA 2QGRA 4CRCA 1S82A 1TYNA 3RUOA 2V7QD 4NSVA 3RMOH 1GJAB 1A0HB 1P3CA 1FNIA 3RC6A 3GY5A 2VNTA 3PLKA 3PMBB 3T5FH 4AB8A 1C4Y2 3GCHC 2VGCC 1O33A 2GMTC 2OBOA 5F8TA 1DSUA 1DXWA 2BTCE 2VIVA 1GBIA 2QV1A 3ZYEA 1P9SA 2BOKA 3TNTA 3GCOA 1O3OA 4BTUB 1UTNA 2F83A 2F9OA 3U69H 1O2ZA 3LGIA 4BAMB 4GUXA 1C1OA 1S6FA 1CVWH 1FAKH 1TA6A 1BMAA 3S9AA 2DE8A 3F9HA 1YPHE 4LK4A 2Y5HA 4WJG2 1ORFA 1MU6B 2GKVE 4UEHH 3SJ9A 1C5ZB 4HTCH 4HGCA 1GHBF 1BRAA 2BDGA 5T3HA 1BITA 2R3YA 4YOJA 1K28D 1GJ6A 3V0XA 4WH8A 2H2ZA 3RXJA 4Y8YA 4O9VA 4CR9A 2O8WA 1GDQA 2QN5T 1C5SA 3KQDA 3U9AH 3WY8A 1BRCE 3LC5A 1D3QB 1MUEB 2BDHA 2J97A 1O2OA 2R3UA 2ALPA 2XBWA 3GY4A 1COWD 3BEIB 4B6FA 1YP9A 3LGUA 1PQ7A 4X8VH 1MAXA 2ZDNA 2KFWA 1GBHA 1MQ5A 3EA9A 5FPSA 2BMGB 5C5NA 2P8OC 1NBME 1NO9H 1TB6H 3UR6A 2HLCA 1PPGE 3SNEA 4U30A 2VU8E 3F68H 7GCHG 1WOFA 3OTJE 3MI4A 2KM0A 4AN7A 2Q1JA 3FP7E 4MNXA 4RSPA 4DIHH 1ARBA 1YPKH 1O31A 4CH8B 1CHOF 3KEEA 4AX9H 3FOAA 3STIA 1SFIA 4ZKOU 2ZECA 4AYVB 1V2ST 4KGAA 1TABE 4ASUD 2TBSA 3ZZ3A 1HRTH 1UW7A 1PPCE 1KXDA 3MH7A 1KXAA 2LELA 1P11E 1S83A 1ZJDA 2QF5A 3HGNA 3A7WA 4BTTB 2ZU5A 5T1VA 1AZ8A 5F53A 1N8OC 2PUXB 4X8SH 1MH0A 1XX9A 5E0HA 3MTYA 2OC7A 2CF9H 1T8NA 4K8BA 1QB6A 1PQ8A 3A88A 1ANBA 4JZ1A 1ZTLA 3VB5A 3FO8D 2FXRA 1C2JA 1NRQH 2AFQB 2XNDD 1O38A 3SN8A 1OSSA 2IPHA 1GBDA 2A2QH 2GT8A 2SGAA 1NRRH 1W13U 1QL8A 1PPHE 1S0QA 4A1TA 1UJ1A 5DP6A 4ZUHA 4Y6DA 2JH5D 5CDFE 1TBQH 1QNJA 4MDSA 3PMJA 2R0LA 1HGTH 2HVYB 2IN2A 1IAUA 1D3DB 2W7UA 5JB8S 1S5SA 3AW0A 4Y71A 1D4PB 1THRH 2ANMH 3EQ0H 3TGIE 2QIQA 1O5EH 3F9FA 4BTIB 3RP2A 1GL0E 4MVNA 1YPMH 1DITH 2UWPA 3RXVA 3UNQA 4INKA 1GG6B 3SV2H 4DCDA 3SYJA 3BG4B 1EB2A 1ZYOA 3GY6A 3ATWA 3S69A 1AY6H 2A31A 1TLDA 1V2QT 1SB1H 3QUMP 1MKXH 3O8RA 4IW4E 1UTPA 3MU0A 1T4VH 2KCAA 2LP6A 5DP8A 4LZ1H 1C1QA 2ZGHA 2ZHQH 4I33A 4JMYA 3RXKA 1QA0A 3BG8A 2I6QA 2OC8A 3D49H 3ZV8A 4Y7AA 3F1SB 4ZXXH 1GHBG 3GY7A 1SQRA 3ESTA 1DICA 5EGMA 3Q3YA 3GOVB 1MTUA 1NFWA 1HUTH 3SU6A 2SNWA 1OXGA 5DO4H 4CRFA 1OHHD 4O3TA 3PO1C 2ASUB 3F2FA 4YLQH 2STAE 4XE4A 3MOCA 1SR5C 2OQUA 5I25A 3ITIA 1P2MA 1FXYA 2WPDD 1GHWH 1SGNE 2Q6FA 3PWBA 1V2RT 1QL9A 4ZAEA 3A8CA 1VCWA 2BVXH 1OWIA 1C5TA 4NWKA 1V2KT 3NPSA 1W7XH 3DSPA 1GBLA 1P2QA 2A4OA 1ZJKA 4TPYA 5HIYA 1TOCB 1EAWA 1C5OH 1TALA 4ASHA 1DWCH 1T7CA 1BT7A 1TNJA 1SI5H 5FX5A 1Y5AT 3SGBE 2AS9A 3OU0A 2FS8A 3RXBA 1FZZA 4CRBA 1TMTH 1C5VA 4AC9A 3SNBA 1C2GA 1O2PA 3TK6A 1FY4A 1FIWA 4TSFD 4BAKB 2O8UA 2Y7XA 2HOBA 2XWBI 1NBMD 1Z71A 1BBRK 8ESTE 5EJLA 1C9TA 3RXQA 2QXIA 1NPMA 5K7RA 4RT1A 5FBIA 5CHAB 2Z3CA 1XUFA 4FXGH 4B74A 1A46H 1C4U2 3RC5A 3A8AA 1QTFA 2YMSB 4ZKSU 1ANCA 3VB3A 3TJVA 4JZEH 3RXCA 3UNRA 3HK6B 4NG9H 3WWBA 1ZGIA 2V3HH 1F0TA 2ZHEH 4K2YA 2Y7ZA 2D1JA 4YTAA 3SJOA 3UPEA 1FI8A 2IOTA 3RMLH 2JETC 3BTME 4XFQA 1KXBA 1AZZA 2BY9X 1GI6A 2GJGA 5GJ4B 3RMMH 1GHAG 5ESBA 4Q7ZA 1LCYA 1O3IA 1FY1A 3SJKA 5DK1A 3M36A 4YXWD 1NROH 4A92A 4B2AA 2OD3B 4DT4A 5L2ZH 4X1PU 3DD2H 2NU2E 4WMEA 5HMAA 1G37A 3A86A 1C1RA 1YPEH 4Z6AH 1O35A 1FV9A 3D23A 1J9CH 4Q7XA 1UK4A 1C2MA 1C1MA 3V7TA 1QRZA 1K1MA 3UOUA 1Y3XA 1RFNA 4DJZB 1VCQA 3HK3B 1IQNA 1QQ4A 1YPLH 2CN0H 1ABJH 2FOAA 1QRWA 4X1NU 2JDID 2XC5A 2ZPQA 2KR7A 1EB1H 1ZTJA 1V2UT 1UK2A 4F48B 1MKWK 3A8BA 1FJSA 3BV9B 2P16A 3PM3A 1SPJA 1WU1A 1LPKB 2GCHG 2ZI2H 1MAYA 1MCTA 3VXFH 1TE0A 1QBOA 3O8BA 3M37A 4O3UA 3UFAA 2FO9A 2EA3A 1GBBA 1GPZA 1NRNH 3ZVCA 1WDIA 1HJAC 3AAUA 5A8YA 2GP9B 5HM2A 2H5CA 1GMHG 2TGTA 1W0KD 3F2GA 1GBCA 2GZ9A 2W3IA 2HWLB 1PJPA 2CF8H 3DSGA 4ZCNA 1ZPCA 3B23B 3LIWA 2PTNA 1MD7A 2QY0B 1QRXA 1TFXA 3A89A 4MQAA 1LHCH 3LU9B 2F4LA 3ODDA 6GCHF 1F0RA 1ID5H 1P02A 1TPAE 1VITG 2ULLA 2AIQA 1Y5BT 2FDAA 4CRDA 3T29A 3H09A 3SUDA 1HIAB 1P9UA 3RXTA 2FWWA 5IYTA 5C20A 5SGAE 1O5GH 4KKDA 1SOZA 3T28A 4NIXA 1FN6A 1YCPK 4K8YA 3VGCB 2AYWA 5F8XA 3ENSB 1N6XA 1SGFA 1SLWB 1TPOA 1YM0A 1DM4B 3RXRA 2ALVA 5K0HA 1G2LA 2XW9A 1HNEE 1O3PB 4K1TA 2BD2A 4ESTE 1ELDE 1L1GA 4Q2KA 1NFYA 3AASA 1TBZH 1ZRKA 1AIXH 4JCNA 1SFQB 1FPCH 3H5CB 2WUBA 1MZAA 1XUHA 3M3VA 2TIOA 3SORA 2FS9A 2GCTB 5HGGA 4JYTA 3E1XB 3ZVGA 1OKXA 4FUFA 2QF4A 3BG4C 1P01A 3EGKH 4UONA 3PLBA 1F5RA 2ZDMA 2BM2A 4CRAA 1G3EA 1S81A 2VIWA 3BN9A 5FL7D 3N7DA 4D9RA 1WXRA 1YCPM 4WH6A 1O2LA 2FI3E 1P03A 1KDQB 1MMJN 4D9QA 1E38B 1KXEA 1UTLM 4JK5A 2P3UB 3RDZA 2GX4A 5JB9S 3MO6A 4CBNA 3A7ZA 2PKSC 1NT1A 4AB9A 1TGBA 4BNRA 3EDXB 2P94A 1SLUB 5C17A 2OP9A 1PPFE 2JH6D 3G01A 2OBQA 1VJ9U 3SBKA 1SMFE 1D3PB 1VR1H 2C90B 1CO7E 5E2OA 1LMWB 3PO1B 2THFB 1EFRD 4HG6A 5BPEA 2ODYB 2CMYA 4XBBA 4H42U 4XD7D 1H9LB 6CHAB 1O3HA 2B9LA 1WCZA 1GCTB 2FI5E 2J34A 4Y7BA 1D6RA 3DA9B 3QTVH 1TX8A 1QJ7B 1O5CB 2AHME 2PLXA 2A5AA 4ABJA 2WUCA 4MPUA 4XOJA 1K1OA 1NY22 1IOEA 1K1IA 2B0FA 4ABIA 3D65E 4XSKU 2ZU4A 5L30H 4OS4A 1YCPH 1QA7A 1V2LT 5A09A 4ACAA 3ZVDA 3IWMA 2FX4A 4ABDA 1DWEH 1SVPA 4YLUA 3RM2H 1A3BH 1KTTB 1AVGH 1TNHA 2AGGX 3KL6A 4TWYA 5T6GA 3SV8A 1B0EA 1VGCC 1GMDF 1RIWB 4Q80A 3GISB 3KQCA 5JBAS 1BIOA 4WF8A 2J98B 2OCVB 3SI4H 3ZZBA 1QCPA 2W3KA 1O2XA 1H8ED 2RA3A 1TNGA 3Q3XA 3PRBA 5C94A 1GHZA 3ELAH 1YPJH 4GLYA 1C1VH 1IQHA 1HBTH 1P2NA 1HAZB 1LQEA 4Y8ZA 5JBTA 2HVXA 1SHYA 3E3TA 3KQ5A 1BCUH 1GI8B 3RU4T 1OPHB 3N7EA 5ESTE 1AB9B 1O3EA 1DLEA 2ZPRA 4I31A 2C8YB 5ABWA 1O5AB 3FZDA 1V2WT 3RXPA 2M5TA
chains in the Genus database with same CATH topology
3SJIA 2WYGA 3SNDA 2A5IA 3T25A 2QC2A 1E37B 1QFKH 2W7SA 1UVSH 2ZFPH 1PYTC 1DANH 2ZPSA 2XYAA 1GJ5H 4CREA 1GJCB 1EX3A 1ESTA 3BIUH 3JZ2B 2QXJA 3UTUH 1IQMA 2AMQA 3BTWE 4BANB 1P05A 2SNVA 5FBEA 2TRMA 2ILNA 1O2YA 1T31A 1BMMH 2A45B 3OYPA 2H9TH 1E36B 2FMJA 4NFEA 4GVUA 2XTTB 1ZLRA 4I8HA 3QGJA 3RXEA 1NU9A 3DFJA 2ZFFH 3M7TA 3UR9A 1GWAA 1KIGH 3SQHE 3LT3A 4X6PA 3MO9A 4AORA 2HGTH 2QXHA 1D3TB 2C3SA 2Y6TA 3QN7A 2HALA 4GHTA 4DW2U 2BD4A 2ZCLP 3QO6A 1NS3A 1GHAF 3BTDE 7KMEH 3T27A 1ELBA 2VIPA 3RXAA 2VB0A 1OP0A 2FYRA 2ZNKH 1CGIE 2UUJB 2Y80A 1TGCA 3ZZDA 3KGPA 2PWXA 1TAWA 4WMFA 1E0FD 1WV7H 1UTQA 1ELCA 1CQQA 1RD3B 3U1IB 1UVTH 1O3MA 4YOGA 2WV5A 3DFLA 1CT2E 1A61H 3K2UA 1KTSB 1TWXB 3P8NA 4BAHB 1HAHH 3MO3A 3SUEA 1FPHH 2AGIX 3A8DA 3GYLB 1YGCH 4MPVA 1O3FA 2EEKA 1V2JT 3ATKA 4DURA 2V6NA 1K1NA 3TPIZ 1V2VT 1Y3VA 2O8TA 1EJAA 4I8GA 3BIVH 3ZYDA 2V0BA 3SW2B 1UO6A 1FY8E 2P59A 4MLFB 1UTOA 3URCA 5FX6A 5C1XA 1BJUA 3HATH 1EASA 1G32B 3SU0A 2AERH 1MKXK 4DY7B 2XBVA 1DT2A 2TGDA 1W7GH 4A6LA 1WQVH 1F5LA 1F5KU 5GDSH 1WYKA 3URDA 5DP5A 1JRTA 3VB7A 2Y5GA 4GCHF 1T32A 2RDLA 5JYIA 2ZDAH 4DOQA 1LHEH 5HXFA 2EI8A 2SFAA 1SGTA 3BF6H 3QWCH 3Q76A 1AVXA 3S0NA 3F6UH 3PROA 3ZVEA 1RTKA 2BVSH 1S85A 2VWNA 3B9FH 4IMQA 2TGAA 1W14U 4NA8A 1O34A 2FOGA 1MQ6A 1N8OB 3SUFA 1GL1A 5EQQA 4X6OA 1IQFA 1J16A 2QAAA 1G36A 2CHAB 3BEUA 1O2WA 1HAVA 2XNIA 4KELA 3MU5A 4I32A 3W94A 1KXCA 4TPIZ 2ZHWH 4KTSA 2RCEA 1O2UA 1SGFG 1C5YB 1Z1IA 2ODQA 2F9NA 4AGKA 1C1TA 3T62A 3MU1A 2BZAA 2PR3A 2A4QA 1IQEA 1KYNA 2SGDE 1YLDA 1H8IH 2W5EA 2G5VA 3GDUA 4NFFA 2DUCA 1BTUA 1BOQA 1RJXB 1XXFA 1IHTH 2BY7X 5GCHF 1UVOA 2VIDA 5LH8A 5FHTA 3BTQE 2BDBA 1O2JA 2RG3A 1O3NA 5EXNA 5A8ZA 3ATIA 1GJ9B 2NU1E 3LGVA 3M61U 1V6DA 1MTWA 1LVMA 5EU8A 2FOFA 4ABAA 1EPTB 2GZ8A 3SO3A 4BOHA 1KLJH 1P2KA 4HFPB 2HNTE 1T8OA 2ZO3H 3RXFA 1P0SH 1JBUH 1J15A 4XBCA 1HB0B 2BY5X 4Y11E 1VCPA 3M7UA 2NU3E 4FU8A 2BD9A 2ZCHP 1O2RA 1U6QA 3SV6A 1O3AA 4UFDH 4AFZA 1GI3A 2Z9LA 5EPYA 1EZXC 4I8JA 3MNSA 3STJA 1Q3XA 1ACBE 2C8ZB 4OGXA 3O8CA 1OWKA 2FIRH 2G00A 4UDWH 1GBTA 1ABIH 3OY6U 4GCHG 2ZDLA 1GI1A 1V2OT 1AE5A 2YNAA 2ZA5A 5F6MA 2ZG0H 4NZLA 1IQGA 3P8GA 2G51A 3E0PB 1SLXB 2BY8X 5FXLA 1BBRE 2OQ5A 3N7OA 2D2DA 3DHKH 1TBRH 3EA8A 1OP8A 2UWOA 2GD4B 4I8LA 1Z8GA 2ZGBH 1V3XA 3RXDA 1GMHF 4AFSA 2FLRH 3MH5A 1XUGA 4YT6H 3K65B 3IITA 2PSXA 2ZTXA 1CU1A 3MNCA 4D7FA 3SU5A 4LXBH 3QTOH 1HPGA 2KAIB 2J38A 1GCDA 3QK1A 1BMNH 1ZPBA 1HIAA 2LNCA 1K1JA 4BAOB 2PUQH 3ZZ9A 5L2YH 3GCTF 1TNKA 2ZU3A 3KF2A 1EXFA 3A7TA 3GDSA 5DKMA 4B73A 1GBMA 5L6NH 5DGJA 3SJ8A 2ZTZA 4FU9A 4CHAB 1OYQA 2ZFRH 5J4QA 4SGBE 4CBOA 1GGDC 1SGIB 3ZVBA 2P93A 3KNXA 3F9GA 5C1UA 2BLOA 1UCYE 1ZOMA 4TYDA 1BRBE 2Z94A 2ZHFH 3S9CA 1GI0A 4K1SA 1G9IE 2A4RA 3AVZA 1SQOA 1GMCF 2Z9JA 1FY3A 2J4IA 2B8OH 1LPGB 1Y3UA 4ZHAA 5GPIB 1GI7B 1UHBB 1LVOA 2BDYA 2F91A 1O3LA 3UY9A 4Y79A 3M5NA 4MNVA 3MHWU 5TCCA 1LQDB 2H9EH 3GY2A 4LOYH 2Q6DA 2R0KA 3FVFB 4B2BA 1GI5A 3BSQA 1GI9B 1BQYA 1UVPA 4ZKNU 1FY5A 4CH2B 3LKWA 1LHGH 1HJAB 1E35B 2PFEA 1RTFB 1A5HA 4BXSA 5EXLA 1LDTT 1GBFA 1C5XB 3LJOA 4Y10E 1Z6EA 2VH0A 3KHVA 4X8UH 1L4ZA 2K1QA 1FONA 1GDUA 3FZZA 1DPOA 3PWCA 1BTXA 1O5BB 3TGKE 1A4WH 3A7XA 3LH3A 1O0DH 1S6HA 3V13A 3BTHE 2PGBB 4ZHMU 1C1NA 3M3SA 1ZZZA 4CR5A 2ZHDA 1EQ9A 1TMBH 3SV9A 1A1RA 1UMAH 1YC0A 1BRUP 1S84A 1LVYA 2ZFSA 1GJ4H 1DY8A 1C2DA 2PTCE 3K9XB 1W10U 1DX5M 3MU8A 3L3TA 1CSOE 1EAXA 2VIQA 5A0AE 2ZDKA 3NXPA 1NZQH 4X1SU 1B5GH 1EPTA 3TH3H 1NC6A 1O3KA 2CJIA 1C1SA 1L1JA 2BHGA 1AN1E 3A85A 1C2KA 1C2LA 4J1YA 4F4OC 4INLA 2ZKSA 4X2WA 3FP6E 2ZIQH 4FUDA 1NN6A 5BRRE 4NIWA 4ABBA 2ZF0H 3TITA 3IG6B 2VWLA 3ZZAA 4H6SB 1AWHB 1ZMLA 4X2XA 1J8AA 2ZFQH 3KQBA 4ISLA 1BDAA 1NRPH 5IDKA 1GMDG 2XCNA 1P8VC 2EC9H 4UFFH 3KN2A 5GXPA 1UTJA 3SQEE 3OY5U 2ANWA 1DUEA 3ZZCA 5E0JA 3SU4A 4E05H 1T8LA 4INHA 1SGDE 2AMPA 2DE9A 1BHXB 3TVJB 2FODA 1O2VA 1THPB 3QLPH 2PSYA 2UUKB 3T26A 2BD8A 3F9EA 3TH4H 1F0UA 4KP0A 2ZQ1A 1AUTC 2Y82A 2FOEA 1AD8H 3SGQE 1WTGH 1XKAC 5DPAA 1DOJA 2G5NA 4WWYA 1SGCA 3LONA 1H8DH 3LGWA 3P95A 2A7HA 1DWBH 4DT7B 1HAPH 4H4FA 4FUJA 2R2MB 2BX4A 4U32A 3FP8E 3M5LA 1SGQE 2ZDVH 3PV4A 5DG6A 1TMUH 2VVVA 4JYVH 2WPJS 1AU8A 2BZ6H 4TY7A 1O36A 3SNAA 2FX6A 1GJ7B 2B5TB 2GCHF 1JIRA 4M7GA 1GHVH 1G3DA 1UCYK 1SGRE 1RS0A 7ESTE 1ARCA 1O2KA 7GCHF 2HRVA 2AH4X 2O9QA 2YOLA 1C1UH 1VITH 2A0QB 3M5OA 4MNYA 1H9HE 1F0SA 1Y5UT 2P95A 1C5UA 1OWEA 2VWOA 2ZEBA 2F3CE 2CV3A 2GV7A 1TPPA 1TA2A 2BLQA 4ABFA 1EJNA 1TRYA 5FPTA 2G55A 4HZHA 5ETXA 2XWAA 1BTPA 4NGAH 1GG6C 1QL7A 4R8TB 4HI3A 4IC5A 5JPMH 1YPHC 2J9NA 3LPRA 2ZQ2A 1AI8H 2FYQA 1RRKA 5A0CA 4IMZA 3MNBA 5PTPA 1NU7B 5CMXH 3A80A 1WUNH 1CA8B 6CHAC 1GJBB 4WVPE 2A7CA 1TNIA 4ABHA 1OWHA 1RTLA 1ZHRA 1XKBC 1GDNA 3M7QA 4X6MA 6LPRA 3CS7A 8LPRA 2ANYA 1P09A 4E7NA 4RKOB 1DY9A 2Z9KA 1XXDA 2OINA 4GPGA 4E06H 1YKTA 5JDUB 1FLEE 5C67A 4OS7A 1XVMA 2WPKS 1D9IA 1JRSA 4D8NA 4FUCA 2QF3A 4WXVA 2OC0A 5EW2H 1HAOH 3ATMA 1BUIA 1F2SE 1Z8JB 2FOMB 4QT8C 2IJOB 4ABEA 4D7GA 3NCLA 2BVRH 2A7JA 1GJDB 1PQAA 3TNSA 2F9VA 3KCGH 1TQ7B 1TOMH 1EZQA 1O37A 1CT4E 3A87A 3H7OA 3TK9A 2J92A 1RXPA 4GAWA 2QXGA 3BTEE 4D76A 1QJ1B 2F9PA 1C5PA 1OS8A 5C3NA 1O2SA 2XBYA 2BYAX 5JBCS 2FOHA 2ZU1A 2BDAA 2UUFB 4NWLA 3Q3KA 4VGCB 4KTUA 4YT7H 1ELEE 2H6MA 1XMNB 3GDVA 2A32A 1BBRH 4FVDA 3P8OA 3EYDA 1SG8B 1NESE 3SZNA 1LO6A 3FFGA 3LOXA 3V12A 3VFEA 1ETRH 3SU3A 1UCYH 1W3CA 4OGYA 4UFEH 3RC4A 1QY6A 2HPQH 1LKAA 4FU7A 2WPMS 1NTPA 4NIYA 3TJOA 2XCFA 3ZZ5A 4DIIH 5AFYH 1AMHA 4Z0KA 3MU4A 4AZ2B 2AGEX 1Z8RA 4YM9A 1W11U 1GBKA 1O3CA 1ANDA 1BMLA 4NCYA 3AAVA 4LZ4B 1EJMA 4ZMAH 2AIPA 1BTWA 2GZ7A 1A0JA 1AO5A 1LVBA 1PPEE 3SI3H 1DVAH 2PW8H 1A3EH 1CA0B 2Z9IA 1MBQA 5DP7A 2GTBA 3BEFB 3O8DA 2R2WU 2BD3A 4FUBA 1C2EA 1P2IA 2VJ1A 4MG3A 1KSNA 2BB4A 5C1YA 1AQ7A 1C1WH 1HLTH 2PKAA 1CBWB 1G3BA 3UREA 3RXMA 1B0FA 3PTBA 3U8TH 2C8WB 1GJ8B 1SLVB 2C4FH 4U2WA 1H9IE 4NSYA 1SGEE 4Y76A 2XBXA 5F03A 1J17T 4XDEA 1LHDH 1HV7A 1ZGVA 1O3DA 1OX1A 3TIUA 4TY6A 3RM0H 1AUJA 5T6DA 3NZIA 1MTNC 3NK8A 1XUJA 5B6OA 3QZQA 4NIVA 3L33A 3I78A 1LKBA 3M3TA 2BOHB 1Y3WA 5DP9A 3QGNB 1PFXC 3B8JA 2V35A 2XXLA 2G8TA 1WBGB 2BLWA 2ANKH 2VIOA 3RU4D 4MPWA 1W8BH 4NA9H 2PHBA 3QZRA 2UUYA 3TH2H 2SGQE 4ZHLU 1MBMA 3GCHB 1NFXA 1K21H 5LPFA 1FN8A 3BTKE 1QR3E 1P2JA 5LGOA 4NZQA 1EAUA 3MH4A 3PYHA 1RGQA 2Z7FE 3W95A 1HAXB 2ZGCA 1ELFA 2BQWB 1A7SA 1A5GH 4WY3A 1XUIA 1VITF 4K3JA 3A81A 1JXPA 4AG1A 1EKBB 2GDEH 8KME2 1O2QA 2JH0D 3VB6A 1O2GH 1V2TT 2WPIS 2XC0A 1YLCA 1GVLA 4AOQA 2QYIA 4TWWA 4JZDH 2V3OH 3ODFA 4NA7A 1P3EA 1BTZA 5H4IB 4A5TS 3LJJA 2J95A 1FQ3A 1Q31A 2SGEE 2SGPE 1ZRBA 1QB1A 2NU0E 5HM9A 1EPTC 1HAYB 1LPZB 4IN1A 2ZU2A 1ELAA 2Z3DA 1GBJA 1G3CA 2ZWLH 4Y0ZE 5AF9H 1Z1JA 4IGDA 3LGYA 2ZGJA 3E0NB 3NWUA 2CHAC 5C2ZA 1THSH 1PPBH 3E8LA 2H9HA 4OS5A 1O2HA 4PROA 5EQSA 4A1VA 4MNWA 1O32A 3ZZ6A 4ZH8A 3U8RH 1CGJE 1ESAA 4B75A 5EG4A 1INCA 5DP4A 1GI2A 1CT0E 4XBDA 1AKSB 2ODPA 1C5QA 1IHSH 4O97A 1L2EA 1TGNA 2A1DB 2Z3EA 3E91A 5GCHG 2OLGA 1HAGE 4WMDA 2OTVA 1DE7H 1HJ9A 1AFQC 3MMGA 3MNXA 4E7RG 4UD9H 2FOBA 5AVDA 1PQ5A 2F9BH 3I29A 2LPRA 3VGCC 3A7YA 2WYJA 2BXUH 4MTBA 2FLBH 3TJNA 1F92A 1MCVA 1UVUH 1QGFA 4B71A 1JIMA 9ESTA 1O39A 1S0RA 4I8KA 1TNLA 2QA9E 1ZSJA 9LPRA 1GHYH 4OS2A 2BD5A 3A82A 1HCGA 1QHRB 1SGYE 4CHAC 3GY8A 1ZMJA 2GCTC 2ZFTA 2O8LA 2WINI 4K1EA 1X7AC 2NWNA 1ZTKA 2VVUA 4DVAU 1SQAA 2TGPZ 1H4WA 3LGTA 3UNSA 2JKHA 1SL3A 6GCHG 2BDCA 4YESB 1O3BA 2WPLS 1ZPZA 1C5MD 2Q6GA 3DT0H 3SUGA 2PKSB 1DFPA 1KLIH 4FVBA 1G2MA 1BJVA 1OYTH 1FIZA 5JBBS 1PYTD 2I6SA 1UK3A 3PMHB 4J2YB 2GVFA 1BA8B 1GBAA 4AYYB 1SQTA 1D6WA 2STBE 2BD7A 3BTFE 3TLOA 1EOJA 4ZXYH 4ZKRU 3ZZ8A 1MZDA 1Y8TA 2FI4E 1O2MA 3RLYH 1GCTC 4YO9A 4FUGA 2HNTF 1IQKA 3MYWA 5C5OA 1ELVA 1ZMNA 1AHTH 1OOKB 3RXOA 1GHXH 1OWJA 1O5FH 3S7KB 1LHFH 1GGDB 1Y3YA 2PV9B 3VPKA 3HKIB 3VEQB 1FAXA 1BTHH 2C93B 5FPYA 5G4BA 1ZHMA 3U1JB 1EP5A 1WAYB 1GBEA 3TU7H 5EQRA 3P8FA 1O3GA 4FUIA 1YYY1 7LPRA 2HNTC 4OS1A 4ISNA 3MFJA 3ZV9A 4Q7YA 1N6YA 1MTNB 5EPNA 3VB4A 2FTMA 3TGJE 1P57B 3FAOA 1AE8H 2ZZUH 4ABGA 1P06A 3SHCH 3RLWH