1MZAA

Crystal structure of human pro-granzyme k
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
240
structure length
240
Chain Sequence
MEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDAGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords pro-granzyme K
publication title The 2.2-A Crystal Structure of Human Pro-granzyme K Reveals a Rigid Zymogen with Unusual Features
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzaA01
1P2NA 3SV7A 4AFUA 2H5DA 4WXIA 8ESTE 1IQMA 1NM6A 1NO9H 3RMOH 2A4GA 4NG9H 3TH2H 4YOGA 2BDAA 2G8TA 2XCFA 1Z8RA 1IQIA 1DT2A 1QB9A 1EZSC 1O2HA 3MU5A 1XM1A 4ZHLU 2QYIA 5C1XA 5FX6A 1HAGE 4F49A 1FXYA 2ZU3A 1V2KT 3RXKA 2WUBA 5FBEA 3RXHA 5DKMA 3FP6E 2ULLA 1HAXB 2BM2A 2RA3A 2J34A 1L0ZA 1C2LA 2JETC 1C9TA 1C2FA 3KHVA 3L6PA 4H6TA 2GX4A 1BTYA 3P95A 5FAHA 1TPSA 3S69A 1N6YA 4B76A 4R0IA 2GD4B 3HGPA 2Z3EA 1ANBA 3HATH 4JYTA 2RG3A 5HM9A 1H8DH 1SVPA 2XBWA 5JB9S 3U8OH 2W5EA 2A7HA 4NZQA 4JK5A 1BT7A 1MU6B 1JRTA 2WINI 2C8WB 2HRVA 3E6PH 4FU9A 1ZLRA 1GI2A 1DXPA 1PQ8A 2VGCC 1QB1A 2KAIB 3A7ZA 1O5GH 1V2LT 5CHAC 1UVOA 4ZKRU 1S6HA 1OSSA 1O3OA 3A8CA 1EAUA 4O3TA 4BAHB 4KTUA 1SGYE 3KQBA 4JZIA 5H4IB 3TH4H 8GCHG 1YCPM 3ATIA 1K21H 1QCPA 3Q3KA 1IQKA 4OGYA 2FODA 1BIOA 5FXLA 3A8AA 3K65B 3SOSA 1T31A 4CR5A 1SOTA 5A0BA 2FIRH 1OP8A 4JZFH 1TPPA 1DLEA 2XBXA 4TPYA 7GCHG 3F9FA 1SI5H 1E0FD 3LT3A 4MNVA 2FEQH 4OS7A 2PTCE 2BVSH 1YPLH 3EYDA 2ZQ1A 3DT0H 1J16A 4WY3A 1HAVB 3A8DA 3A80A 1BTPA 1LKBA 4AFQA 1NY22 3EE0B 3C1KA 3PMBB 5FPSA 1BDAA 1ZSKA 1S81A 2FXRA 1AE8H 1UCYE 2BLOA 4OGXA 3BTQE 1O5CB 3MO6A 3ZZ6A 1LQDB 1T4UH 3L3TA 1GHVH 1TNLA 1HPGA 1OWKA 3LKWA 2OC7A 3MH7A 4OS1A 3FANA 1NZQH 2H2ZA 2NU1E 4E05H 3OSYA 2FYQA 2QXIA 3SNCA 4AB9A 3QTVH 2ZHDA 3SGAE 3S7HB 2A5AA 5K7RA 2QN5T 4I8HA 1C5VA 1TPOA 3TK5A 4MTBA 4MVNA 1TIOA 1KY9A 5JYIA 1DXWA 1AVGH 1P2JA 3RXAA 4YLQH 3RM2H 1T7CA 5B6OA 5GJ4B 1NROH 1IQFA 1ZJKA 1C2GA 1GI7B 1VJAU 2FOFA 2A4OA 4UFEH 3URCA 1EZQA 1JIMA 1SLVB 2D1JA 1Z1JA 3ZV8A 2BQ7B 4A6LA 1YPHE 6LPRA 1GI6A 4CRFA 1O31A 5E8EH 2AMDA 1NPMA 3VPKA 3TGIE 5BRRE 2QXJA 1IQNA 5F03A 1A0HB 3RXBA 3MO9A 3QO6A 2AFQB 1FAXA 2A32A 2R0LA 3ZYEA 3GCHC 1CQQA 2GZ9A 4NSYA 1P2KA 3A7XA 1RS0A 2VIOA 2OC1A 2F9VA 3MYWA 3KL6A 2OCVB 4AYYB 1W7XH 1EUFA 1GDUA 3A7YA 2C8ZB 1LHDH 4DVAU 2AIQA 2ANYA 3NPSA 4K1EA 4U2WA 1O2KA 1O34A 4VGCC 1GBCA 1C5SA 3T62A 3MNXA 2GDDA 1D6WA 1TONA 4DGJA 2ZGBH 2ZCHP 2ZECA 2DUCA 2F9OA 2BMGB 1BMNH 5DP4A 3TU7H 1V2RT 5EGMA 2C93B 4TY7A 2CJIA 3SJKA 4BTTB 2JH5D 1FAKH 4NA7A 3LPRA 1JXPA 3SJOA 1GGDC 3S9CA 1CHOF 1MQ6A 3UQVA 1EPTA 1OX1A 3RXQA 2ZU4A 1EJNA 1C1WH 5HM2A 2G51A 3KQDA 4JYVH 1O2IA 4WF8A 3T2NA 1AWFH 1ZR0A 1GI1A 4ISLA 2BYAX 3EAJA 2SGQE 1IHSH 4XFQA 1IAUA 1GVKB 1ELTA 1FY8E 4YT7H 2J4IA 2ZHFH 3MH6A 3E90B 4TWWA 1T8LA 4Y8ZA 2VIDA 3CS0A 4B74A 1SGFA 1TA2A 3BN9A 3FZZA 3LGWA 2Q6DA 4HTCH 3F9GA 1AUTC 4GSOA 1FY3A 1P2QA 2ZEBA 5EW2H 2A4RA 3GY3A 1EB2A 1UVPA 1W11U 1Z71A 2PR3A 4SGBE 1LO6A 5J4QA 2CF8H 1WOFA 3M61U 2IJOB 5ABWA 1GBAA 1V2MT 1K1NA 4WJG2 2HALA 2R3YA 3MU0A 2UUKB 2O8WA 2PTNA 5GCHF 2M5TA 1NN6A 1EQ9A 1LVYA 4OS2A 1GI9B 1ETRH 1SL3A 4TWYA 5A09A 1GHAF 4E7RG 4Y76A 1HLTH 3GY8A 2BY7X 4UFFH 4AN7A 3S9BA 2BY5X 3SV8A 1FDPA 1C5RA 3FVFB 3FAOA 4ABAA 2GVFA 3PLPA 1P11E 1OKXA 1BRAA 2GMTB 3TJUA 2I6QA 4AB8A 1XUIA 2BHGA 4WWYA 2A4QA 1JOUB 4NIYA 5E0JA 3ZZ7A 2P94A 1C4U2 2EA3A 2XRCA 3MU1A 3VB3A 4Y6DA 1C1SA 2O9QA 1ESAA 1EOLA 2RCEA 2LNCA 1DY8A 1EATA 4BXSA 1FIZA 1GBLA 1BZXE 5E0HA 2PGBB 1GMHG 1FONA 1OWIA 2BD5A 1DWDH 2CF9H 1LMWB 1MUEB 3GY7A 1KXBA 3QUMP 4UFGH 5GIBA 1MAXA 2Z3DA 1ELBA 4ABHA 3MH4A 3SGBE 3JZ1B 3SBKA 1QL7A 1QJ7B 4AZ2B 1E36B 1GBJA 5DG6A 1G3CA 1S85A 2BDBA 3B8JA 1HRTH 1X7AC 1C4Y2 1HB0B 2YNAA 3SNDA 3B9FH 2ESTE 5I46H 2ODPA 1F7ZA 5C5OA 1WCZA 3UNRA 1T8OA 1YBWA 4TPIZ 2VIWA 2BOKA 1AN1E 5FBIA 4CBNA 4CR9A 5EQRA 3BV9B 4B1TA 5FX5A 3K6ZA 3LDXH 1SLUB 2FZZA 2IPHA 3RMNH 2GV6A 2ZGHA 4R8TB 2STBE 5FCKA 4IN2A 1B0EA 1O3GA 5AFYH 3LH1A 1C5WB 1A1RA 1YKTA 2GCHF 3UR9A 2FLRH 1G9IE 1MQ5A 2BDIA 1E37B 1O2LA 3JZ2B 2C3SA 3MNSA 2D26C 3HKIB 3UOUA 1MBMA 4JZDH 4X1RU 1LHGH 2ZQ2A 2GCTB 1WQVH 2BY8X 3NZIA 3K9XB 5DP8A 2W7SA 5LGOA 4MPVA 3SUDA 3T27A 2P59A 3ZVCA 1O2XA 1TOCB 3PM3A 2WV4A 1GBBA 1SPJA 1V2UT 2BDYA 2VIVA 2VWOA 1O37A 3Q3YA 1CBWC 1YCPH 1ANCA 1TMBH 1SMFE 5JPMH 4ZH8A 1VCPA 1ESBA 5LPRA 4BAOB 1SGEE 2WV5A 1C5PA 2EI7A 1V3XA 1NFWA 1V2ST 1W14U 1MD8A 2BDHA 2SFAA 1VCQA 2Y5HA 1VITH 3SU3A 1C1TA 2ZDNA 1Y5UT 1NESE 3ATWA 1Q31A 1VITG 2Z94A 1THSH 3SO3A 1TNJA 4H6SB 1BRCE 3TIUA 6GCHF 2A2QH 5L2ZH 4ZXXH 4ZKOU 4X2XA 1LKAA 2PWXA 3OX7U 1O2RA 2PKAB 3FP7E 3WY8A 4IMZA 1G36A 1P02A 1MD7A 1IHTH 1A7SA 1HGTH 1O2SA 1NFUA 5A8YA 3CENA 4ZROA 2BDGA 1O3DA 1EAIA 1AGJA 1ZYOA 3A86A 4Y7AA 5EW1H 1T8MA 1FY1A 1F5LA 1QGFA 5L30H 3GYMA 5JB8S 3E8LA 1MTVA 5FPTA 1P2MA 3GDVA 4CRAA 1A0JA 1D9IA 2SNVA 1TQ0B 3MNCA 4X6NA 4JCNA 1O2QA 2BY6X 1EJMA 1BMLA 4YT6H 3SUGA 1HAPH 4QT8C 4Y0YE 2FLBH 1CT4E 1THRH 5EPNA 2A2XH 4Y8YA 1UTMA 5HMAA 1DWBH 7ESTE 2UUYA 1P03A 6CHAB 2VVUA 5EXNA 5DP5A 1IOEA 3P8GA 3M5OA 1JBUH 3P8NA 2H9HA 1XVOA 3VB4A 2GZ7A 3SHAH 3P6ZB 1C1QA 1ZGIA 1GMCF 5T6GA 1F5KU 1O2PA 3M7UA 3RC5A 2Z9GA 1TE0A 1C5NH 4GHQA 1UK4A 1DOJA 1LHCH 1RTFB 3QWCH 4NA8A 2CMYA 2EEKA 1MKWK 1K22H 3ODDA 2VVVA 1HAHH 1O3KA 4ABJA 2Y7ZA 1NC6A 1UVUH 2TRMA 3E0NB 2SGDE 5DP9A 5SGAE 2QGRA 2A1DB 1CGIE 3T25A 3SI3H 2FOBA 4FUCA 1GBIA 1GBDA 2WPKS 1S6FA 2SNWA 5HXFA 1O2TA 1UTPA 1XXFA 4M7GA 3V0XA 2O8LA 2OUAA 1ZSLA 4ABBA 2QIQA 1TGTA 3SU0A 1B7XB 1Y5BT 3KEEA 4ISIH 4AYVB 2ZA5A 4AG2A 1YYY1 3UR6A 1N6XA 2CV3A 1C5YB 3P92A 4NIVA 1BTZA 3TJVA 3RXFA 2GKVE 3M7QA 3TJOA 4Y11E 1RRKA 1JIRA 3N7OA 2XXLA 3L33A 1HIAA 3PROA 2PFEA 2FS8A 3RXLA 1XUJA 2GMTC 1P04A 3LJOA 1RTLA 3M35A 3H7TA 3RMMH 2FYRA 3A7WA 3RU4D 1V2PT 2BDCA 2EI6A 1C5OH 1MTNC 2J94A 2V6NA 2OBQA 1C1RA 1SB1H 3SJ9A 1SR5C 1W12U 4FUIA 1DUAA 4ABFA 4X1PU 1G2MA 1PQ5A 1ELGA 4RKJB 1O3HA 1AHTH 2ZHEH 2DE9A 1MKWH 3SUFA 3GY5A 1A4WH 1SFIA 1PYTD 1UHBA 2WPLS 3ENSB 3UPEA 2QV1A 1C5QA 1E38B 2ZWLH 2J38A 2B9LA 3SV2H 3MFJA 1GI0A 1BUIA 2AIPA 1SOZA 1V2NT 3RXDA 4UE7H 1TNIA 1P0SH 1D3PB 3GISB 2GV7A 1HXEH 1QURH 2VU8E 1JRSA 3MU4A 3DFLA 5C1UA 1AB9B 4MPXA 2BTCE 2GP9B 3E3TA 3QN7A 2W26A 1NS3A 2FOHA 1A46H 1L4DA 1FMGA 3T28A 5AF9H 1SGCA 4XOJA 1ELVA 2WPMS 5BPEA 1RIWB 3OU0A 1DY9A 4I33A 4Q80A 4GLYA 4CRGA 1FUJA 1BBRK 1EZUC 4ZKNU 2UUJB 1TGBA 3SU6A 1AFQB 2D2DA 3LGUA 1DVAH 3TPIZ 1NRSH 3O8CA 2ZF0H 2TIOA 1TGCA 4DIHH 2Y5FA 2G52A 4K60A 4CH2B 1O2OA 1PPBH 2Q6FA 2FO9A 1FY4A 1GBMA 2BLVA 2TGDA 4O9VA 1AU8A 1MZDA 2G55A 4K3JA 1LVOA 5FHTA 1HAZB 2PSYA 3U1IB 4IC5A 5EXLA 2GCTC 3IITA 4O97A 3OY5U 1Y3WA 4MPUA 1OWDA 2XNIA 3BF6H 3MHWU 4KTSA 3UWJH 2J9NA 2K1QA 4ZHMU 1XXDA 4XSKU 1GJ4H 1HCGA 1LCYA 1C5XB 4WMDA 1EP6A 4FUJA 4E7NA 2ASUB 1P06A 1TA6A 1EXFA 1TQ7B 1CU1A 1EOJA 1V2WT 3BEFB 2GT7A 1WUNH 1KYNA 2QXGA 1WBGB 3QGJA 1GPZA 1QRZA 2PKSC 3HK6B 3P8FA 3SZNA 3BTFE 2BLWA 4D9QA 1OS8A 1PPFE 3SN8A 1AVWA 1P2IA 2BXUH 3VB7A 4YOJA 5EQSA 2ZFPH 1HDTH 2ANWA 4DW2U 2FI4E 3M3VA 2W7UA 1F92A 1BBRH 5CE1A 5DP3A 2ZDKA 5EQQA 3RXVA 2H9EH 2AS9A 4CREA 2FTLE 4UEHH 3ZZ5A 4LZ4B 2F91A 3V7TA 3HPTB 2H1UA 5A8XA 2XC0A 4Y10E 3NUMA 3ESTA 3NK8A 1XX9A 1KTTB 5AVDA 3I77A 3OYPA 1TNHA 1AUJA 2ZO3H 1RGQA 4ZUHA 4X6MA 1GHXH 4D76A 3AW1A 1HUTH 1CBWB 5GCHG 1B5GH 1GBEA 1PFXC 3UREA 2C4FH 2BD4A 3MOCA 4GVUA 1ELCA 1AMHA 1MTWA 2IN2A 3GICB 3QGNB 3QZQA 4GCHG 1SGRE 3RDZA 1DS2E 1TPAE 3SJIA 1O2MA 1OP0A 1EJAA 1Y5AT 3MMGA 3BIVH 1GHBG 7LPRA 1K1LA 1RXPA 1A0LA 5FCRA 3SJ8A 1ZHPA 1J14A 3UIRA 3UNSA 2I6SA 1W7GH 1ZPZA 4WMEA 5GXPA 3O8BA 6CHAC 1EAWA 1M9UA 3OY6U 1ARCA 4ZHAA 1QRWA 2GDEH 4CRDA 2H9TH 4NCYA 5IDKA 4Y79A 4K2YA 1O3MA 1C9PA 2C8YB 8KME2 2BVRH 1F0SA 1V2OT 1ELFA 2HNTC 4ZXYH 5A2MH 3U98H 1TMTH 1SSXA 3PV4A 1IQJA 5EOKA 1GI3A 4JZEH 2Y80A 1GBKA 2ZTXA 4F4OC 1CA0B 2AGEX 8GCHF 1GJ9B 1SQAA 1QL9A 1K1MA 1TBQH 4INLA 1THPB 1ETTH 1P05A 2NU2E 1AIXH 1CT0E 4MQAA 2J2UA 2RDLA 2YNBA 1QQUA 2ZCLP 1GJ6A 1H8IH 4X6OA 2B5TB 1EP5A 5JBBS 1LVMA 2P3UB 1ZTKA 7GCHF 3T26A 1J9CH 1FNIA 1H1BA 2ZFRH 2G4TA 1DWEH 3SW2B 3PLBA 5T6FA 2FP7B 1HJAB 3A82A 2PUXB 3U69H 3G01A 1P10A 2O8MA 5JBAS 1B0FA 1AVXA 3STIA 3M37A 1KXDA 1ZHRA 1ZPCA 2BOHB 3ELAH 3H7OA 1BHXB 3ZZ3A 5JDUB 1QIXB 1FIWA 4MPWA 1C2MA 1DITH 2D8WA 4BAQB 1KSNA 5DP7A 3PMJA 3DD2H 1AKSB 4NWKA 1J8AA 1GCTC 1ZSJA 4X1SU 1XUGA 2XC5A 1H9HE 1GVLA 3EA7A 1Z1IA 1BOQA 3PYHA 4HGCA 3RXTA 1KLTA 1HXFH 1BTHH 4A1TA 5L6NH 1UTNA 3I29A 1TX8A 2AGIX 1SGDE 3SU2A 2TPIZ 2R9PA 3RXJA 4AG1A 3PMHB 1GBHA 3QDZB 1F2SE 2TGAA 1A5HA 1PPGE 2ZGJA 1GMDG 5FPYA 1S82A 2XTTB 1WTGH 2A5KA 3K2UA 5AHGH 3MI4A 1AB9C 1VZQH 4BANB 4CRBA 4ZKSU 1C2IA 1DDJA 1O3IA 1ZOMA 1L1NA 4LXBH 1WAYB 1OWJA 1MTNB 2FPZA 1DSUA 1RIWC 3RM0H 1CO7E 2JH0D 1G32B 2VINA 3LGVA 2VNTA 2RA0A 3KQCA 3BSQA 5T3HA 1G30B 2C8XB 1SBWA 1AFQC 1P9UA 2A0QB 1AD8H 4MNXA 4YLUA 3V12A 1MCVA 1OP2A 2ILNA 4ABEA 1O3PB 2F83A 2PGQB 3GOVB 1ESTA 3SHCH 1U6QA 3SGQE 1C2EA 1E34B 1CE5A 1HJ8A 1W8BH 4FU7A 3RXRA 2FOMB 1V2TT 2P8OC 1GWAA 2Y6TA 4FUBA 2R2WU 3PB1E 3GCTG 4Q7XA 1XUKA 1ZMNA 1YCPK 2OQUA 1KDQA 1UTKA 2XBVA 4BNRA 4DOQA 1XUHA 2YOLA 3LGIA 4DCDA 3BTTE 3LH3A 7KMEH 1SLWB 4NIWA 4H4FA 1ID5H 3RXSA 1LPZB 5DJ7A 1GG6C 1L1GA 1UTOA 2GZ8A 1GI4A 3A7VA 1EZXC 1NFYA 1C5ZB 1MBQA 3PTBA 3LU9B 1ZMJA 4A7IB 1NT1A 2Z9LA 1IQHA 1JMOH 1GI5A 1QB6A 5A8ZA 2Y7XA 2Z6BD 2GTBA 1O5AB 4FUEA 3Q76A 2R2MB 2OXSA 1DWCH 1O0DH 1O2ZA 1IQLA 4J1YA 4X0WU 1EB1H 2P16A 1H9LB 1QTFA 2ZFFH 4IGDA 2ZPQA 3BTDE 3QTOH 2FI5E 1GMCG 1UVTH 3D65E 2W3KA 2FI3E 1Z6EA 3GCNA 1TX7A 4X2YA 1AFEH 4FU8A 4KKDA 1LPGB 2UWLA 5DK1A 1YPEH 1ETSH 1T4VH 1CA8B 3TK9A 1QFKH 3V13A 1Z8GA 1GJDB 3D62A 3DFJA 5PTPA 2ODYB 1O2JA 4I31A 3MWIU 4K69A 2BD3A 4OS6A 4CHAC 2KAIA 1BTUA 1PPCE 2ZGCA 1F0UA 1FPCH 1EAXA 1F5RA 4NWLA 4DJZB 1BCUH 2XW9A 2PKSB 3KN2A 5A0CA 2G4UA 3Q3XA 1BRUP 1P2OA 2BX4A 3U8RH 4FUHA 1HV7A 1TFXA 1S0RA 1W0ZU 3AAUA 3PWCA 2Y81A 1ZRBA 2NU0E 4Q7ZA 3SNAA 5A0AE 1CGJE 2EI8A 2ZC9H 1WSSH 4RN6A 2BD9A 2FX6A 1Y8TA 1WTHD 2FOGA 1XVMA 4RKOB 1UTLM 1S84A 1WYKA 4X1QU 4MNYA 9LPRA 5L2YH 3PO1B 4I8GA 4MDSA 3UUZA 1UJ1A 1TABE 1TOMH 1L2EA 2AMPA 3A84A 1HAIH 2QCYA 1HAVA 2HOBA 1VGCB 1J17T 1SG8B 1K9OE 1NTPA 1GMHF 1P01A 1VR1H 3RP2A 3BIUH 1YF4A 1EPTB 4Q2KA 3QLPH 1CA0C 2ZHQH 4BOHA 4ESTE 2HVXA 3BTEE 3A7TA 1YM0A 1O39A 2XBYA 3A85A 2STAE 1TX6A 4J2YB 4LK4A 3D49H 4X2WA 2FESH 2J95A 2BQWB 1DX5M 1AZ8A 4X1NU 1LPKB 1D3TB 4A5TS 1MU8B 3F9HA 3UNQA 3ITIA 3TNSA 4XDEA 2QC2A 3M3TA 5AFZH 1C1MA 3Q00A 2XWAA 1HJAC 2OD3B 2UUFB 2QAAA 1BRBE 1QJ6B 4D7FA 5LH8A 3TJNA 1P3CA 2ZNKH 1D4PB 4IN1A 1PQAA 1GL0E 1QA0A 1V2VT 3ZVFA 1PQ7A 4ISHH 1DICA 2Z9KA 3P8OA 4AX9H 1Y3XA 2ZGXH 1ANEA 3F1SB 5LPFA 1C5TA 2HNTE 4JMYA 4WH8A 1NRPH 2PSXA 1JWTA 5E2PA 1UK3A 1ZTLA 2AYWA 2AEIH 2CHAC 1O5EH 1SGIB 4Y7BA 1XMNB 3RXEA 1MH0A 2ALPA 2FTMA 3RXGA 4PROA 2P3FH 4HZHA 2OTVA 2G5NA 3RC6A 4B73A 3O8DA 5JBTA 3RU4E 3ZZDA 2WPIS 4WXVA 2VWNA 2O8UA 1YPGH 1MKXK 1INCA 1YPKH 1O2VA 5TCAA 4NSVA 2Z7FE 1KXFA 4YZUA 1O3JA 1OYQA 2ZKSA 1LHEH 1GJ7B 4GUXA 2A7JA 4IS5A 2ZU1A 4AGKA 1P9SA 1W0YH 4XBBA 5CMXH 1G3EA 1BTXA 2V3HH 4U01A 5GWZA 3GYLB 2ZU5A 1DSTA 1SGFG 2ANKH 4ABGA 2TGPZ 2BXTH 4K5ZA 1FPHH 2XYAA 3F6UH 1ELEE 1O3EA 1QRXA 2ZG0H 4AFZA 3PTNA 1SGPE 1GCTB 1T32A 1KLIH 1K1IA 3ZZ8A 4X8UH 2F9UA 2Z9JA 1PPHE 1NRRH 3BTWE 2O8TA 1EASA 3SI4H 1O5FH 1QQ4A 2FOAA 5C2ZA 2VH0A 1QBVH 1OXGA 2ANMH 5ESBA 3M5NA 4U32A 1GJCB 1TRNA 3UY9A 2F9NA 3TK6A 3UQOA 4I8JA 1ABIH 4UDWH 1Z8JB 1W10U 4YTAA 2G5VA 3VB6A 1D6RA 5HYOA 1UMAH 1Z6JH 1HAYB 2VB0A 4O3UA 3ZZAA 4NZLA 5K0HA 3ATMA 3KIDU 5HGGA 1AKSA 4Y71A 3MH5A 1O38A 1TYNA 2XWBI 1MKXH 3SNEA 5LPEA 3TGJE 4B2CA 4O03A 5GPIB 1FN6A 1C5UA 1RTKA 3FFGA 4TYDA 4ABDA 1O2NA 2ZHWH 3R3GB 1H4WA 3DA9B 2QF3A 3ZVBA 2ALVA 3M7TA 1ZTJA 1FV9A 3DHKH 4E06H 1BBRE 4NGAH 1TALA 1DPOA 5DPAA 3E0PB 4LOYH 2P8OB 4FVBA 1HAOH 1CHGA 1W3CA 2V35A 4IC6A 1YLCA 2WUCA 1A3EH 2ZZUH 3KF2A 3NCLA 4ZAEA 1MCTA 3RXPA 2WYGA 1C2HA 1K1JA 1O2GH 3HK3B 3RLWH 2FM2A 1GG6B 1O2YA 4AFSA 2AGGX 1AZZA 4K8BA 1L1JA 2GT8A 4BAKB 5F8ZA 1GCDA 2ZFTA 2VIPA 3LIWA 2NU3E 3S7KB 2ZFQH 3ZZBA 1ABJH 3M5MA 2C90B 4DIIH 4LZ1H 1KIGH 1CHOG 4JZ1A 4A1XA 3SQHE 1MTUA 3A89A 2OC0A 4OS5A 4KGAA 3MU8A 1TGSZ 1TMUH 4I32A 4ISNA 4CRCA 2TGTA 3LC5A 1J15A 1BITA 1UCYK 1GVZA 1BMAA 4DURA 1MMJN 1Q3XA 3TH3H 5DP6A 3A83A 4KELA 3VGCB 3VXEH 4K1SA 3IG6B 2FX4A 2VJ1A 4UONA 3PO1C 1MZAA 3LGTA 3RC4A 4IW4E 1LQEA 1QBNA 1K1OA 4CHAB 4BAMB 1VGCC 2PHBA 6ESTA 3QK1A 3CP7A 5DGJA 1C4V2 5E2OA 1ZZZA 3CS7A 5EG4A 3GDSA 3T5FH 3Q77A 4U30A 3URDA 1GBFA 2V0BA 1SHHB 4WH6A 4ASHA 1EPTC 2HNTF 1GHAG 3LC3A 1C1PA 1QNJA 4D8NA 3EGKH 1ORFA 2ZTYA 1O2WA 4THNH 3UOPA 3SQEE 4UD9H 1HFDA 3NKKA 2B7DH 3RXCA 1FY5A 3AASA 1C2JA 2Y82A 1GI8B 1DANH 1KTSB 3VXFH 1A2CH 2XCNA 3ATKA 4BTIB 3PLKA 1C1NA 1YPJH 1GJBB 3FZDA 4KP0A 1FLEE 1BB0B 1UCYH 1AO5A 1EX3A 1LHFH 3BEIB 1DE7H 5GDSH 2OQ5A 2HGTH 1O5BB 3ZVAA 2OC8A 3BG4C 5E0GA 1RJXB 5T6DA 1BQYA 2F9PA 4WVPE 1C5MD 5F6MA 3M3SA 3RXOA 2QXHA 1O5DH 1QR3E 2ZDLA 1OYTH 2W3IA 5C1YA 2JH6D 1Q2WA 3A81A 4DG4A 2PKAA 4D9RA 2ZCKP 2ZDVH 1QJ1B 4CBOA 3KGPA 1K28D 2THFB 1F0RA 3TGKE 1HIAB 1TGNA 3VB5A 1ZHMA 4YM9A 1D3QB 1NRQH 2OP9A 1VCWA 4K8YA 4FUDA 4Y8XA 4INHA 3OTJE 3DUXH 1GBTA 2ZTZA 5C20A 2AMQA 1SLXB 1BA8B 1GDNA 3TVJB 2ZPRA 4FUGA 1SFQB 4NA9H 3SU5A 1N8OB 1PYTC 3TLOA 1V6DA 1QL8A 1HYLA 2P95A 3KNXA 1TLDA 1OPHB 2ODQA 1ARBA 1V2QT 3K6YA 1ZMLA 1UHBB 2GCHG 1G2LA 2ZI2H 3O8RA 4X8SH 9ESTA 3KCGH 1MTSA 1IQGA 3SU1A 3QX5H 3SUEA 1BJUA 1AQ7A 1SGQE 1GHYH 1ELDE 1HBTH 2XC4A 2HLCA 2QA9E 3P17H 4FXGH 2ZP0H 3ZYDA 1TNKA 2CHAB 1S5SA 3AAVA 3V3MA 2AERH 1QHRB 3BTGE 4X2VA 3PWBA 2GGVB 2PV9B 4AORA 1H9IE 3ZVEA 1CT2E 4I8LA 2HPPH 2FS9A 1A5IA 4H42U 1XKAC 2BQ6B 3RXUA 1SC8U 2P3TB 2Q6GA 2H6MA 1AWHB 1GHWH 2A31A 2SGPE 2ZDMA 3BTHE 1O3LA 1TNGA 2A7CA 2BVXH 5EXMA 2SGEE 4NFEA 1NU9A 1YP9A 4GCHF 3E16B 4IMQA 1FI8A 2ZFSA 2A45B 3RXMA 1GHBF 3MNBA 1LTOA 2UWOA 4HI3A 1UO6A 1SQTA 3SU4A 6GCHG 2BX3A 3UWIA 4AOQA 3ZVGA 1O33A 3SORA 3QZRA 1KXEA 3B23B 1P57B 1GJAB 4B71A 1O36A 4Q7YA 1OWEA 2DE8A 2Q1JA 4INKA 3EA8A 1HNEE 2VIQA 1CSOE 2VH6A 1ANDA 2AH4X 4I7YH 4K1TA 2FWWA 5C3NA 3E91A 1FJSA 5ESTE 1C2KA 1TBZH 2F3CE 2P93A 2R0KA 1TB6H 1WU1A 1QBOA 1AI8H 2NU4E 2PLXA 1D3DB 4JK6A 2JETB 1DLKB 1A3BH 2FDAA 3A88A 1TBRH 1C5LH 3RUOA 3LJJA 1VJ9U 1C1UH 3A87A 2FOCA 3T29A 2BZAA 2ZIQH 4JYUH 2VWMA 1KLJH 1TRMA 1RFNA 4HFPB 2UWPA 3S9AA 1TAWA 1W2KH 5TCCA 1S83A 1Z8IB 2QY0B 1XUFA 5IYTA 1O3CA 4UFDH 1HJ9A 2VGCB 3VGCC 4MG3A 5CHAB 4YESB 3MTYA 4Y0ZE 4DT7B 5F8XA 5I25A 1L4ZA 2VWLA 2SGAA 4B75A 2ZPSA 3GY6A 1O2UA 1NU7B 3ZVDA 3LOXA 4GHTA 3U8TH 1NFXA 4GAWA 5TJXA 1S0QA 2CXVA 3VEQB 3A8BA 2FMJA 3BEUA 1QA7A 1EKBB 3SV9A 1DUEA 1YLDA 2HPQH 1PJPA 3ZZ9A 3I78A 2LPRA 1YC0A 3EA9A 1GDQA 1Y3VA 1UK2A 2H5CA 1GL1A 4FUFA 2IOTA 1T8NA 4X6PA 1E35B 3D23A 1KXAA 4MNWA 3KQEA 1WQSA 1YPHC 3HGNA 2BZ6H 3GY4A 1AY6H 1Y59T 1SGTA 1W13U 2PUQH 4FVDA 1GMDF 1ZGVA 1G3DA 4IBLH 1PPZA 2QF0A 1P3EA 1FQ3A 1LDTT 1P09A 3ZZCA 5G4BA 3S0NA 1FZZA 3ODFA 1F0TA 1SGNE 3VFEA 2WYJA 1O3AA 5EU8A 1Z7KA 1P8VC 1O3BA 3EQ0H 3C27B 1Y3YA 1UVSH 2ZU2A 4B2BA 1O32A 4AGJA 2HWLB 4X8VH 4BTUB 2NWNA 3W94A 3RLYH 3STJA 2V3OH 1TRYA 4ABIA 1O30A 2BD7A 1AE5A 4GPGA 4D7GA 1BTWA 5DO4H 3R0FA 2BD8A 2EC9H 4A1VA 4BXWA 1WV7H 1YPMH 3BG8A 1GJ5H 1C1VH 1DFPA 3ZZ4A 2R3UA 1UTQA 3UTUH 1BHXF 5EPYA 4CH8B 1GJ8B 8LPRA 3NXPA 5F8TA 2ZDAH 3GCTF 3GY2A 3M5LA 4XBCA 1XKBC 3W95A 1RD3B 2F9BH 4RSPA 1G37A 1K2I1 1UTJA 2BY9X 1ZJDA 2G00A 3AVZA 2FOEA 3FP8E 2B8OH 1BMMH 1BJVA 1O3NA 3TNTA 4A92A 3BTKE 3LONA 1N8OC 2Y5GA 5C67A 4MLFB 4TY6A 4KTCA 4NFFA 2VVCA 1CVWH 4B2AA 2TBSA 1CGHA 3IWMA 2OLGA 3BG4B 3GCHB 3LGYA 2BLQA 5JBCS 1ZRKA 1C2DA 3M36A 2WPJS 1QY6A 4ISOA 4Z6AH 2BD2A 1GHZA 2A5IA 5C5NA 2OINA 4XE4A 1TWXB 1ELAA 3F9EA 1A61H 3GDUA 1MAYA 3GCOA 3TITA 1OOKB 4I8KA 4ZMAH 1P12E 1DM4B 4YOIA 4OS4A 4NIXA 3MO3A 1C1OA 1KXCA 1N1LA 4VGCB 2CN0H 4XBDA 4Z0KA 1LVBA 2B0FA 3PMAB 2SGFE 1ACBE 1G3BA 3SV6A 2PW8H 2OBOA 2WPHS 3ATLA 3NWUA 1OWHA 3HKJB 1V2JT 2BB4A 2G81E 1FN8A 3AW0A 3RXIA 1ZPBA 3E1XB 4DY7B 1GGDB 2CGAA 5EODA 1SHYA 1IQEA 1PPEE 3RMLH 3BTME 1SQOA 4WMFA 3U9AH 3F68H 1A5GH 1K1PA 2J92A 4YO9A 2JKHA 1Y3UA 2Z9IA 3H5CB 1O3FA 3ZV9A 1NRNH 3U1JB 1VITF 1O35A 3P70B 1YGCH 4X8TH 3SNBA 3RU4T 3UFAA 4SGAE 5ETXA 2Z3CA 3EDXB 5J4SA 1KDQB
chains in the Genus database with same CATH superfamily
3OEHD 1P2NA 3SV7A 4AFUA 5HKKD 2H5DA 3DCLA 4WXIA 8ESTE 1IQMA 1NM6A 1NO9H 3RMOH 2A4GA 4NG9H 3TH2H 4YOGA 2BDAA 2G8TA 2XCFA 2HLDD 1Z8RA 1IQIA 1DT2A 1QB9A 1EZSC 1O2HA 3MU5A 1XM1A 4ZHLU 2QYIA 5C1XA 5FX6A 1HAGE 4F49A 1FXYA 2ZU3A 1V2KT 4YXWD 3RXKA 2WUBA 5FBEA 3RXHA 5DKMA 3FP6E 2ULLA 1HAXB 2BM2A 2RA3A 2J34A 1L0ZA 1C2LA 2JETC 1C9TA 1C2FA 3KHVA 3L6PA 4H6TA 2GX4A 1BTYA 3P95A 1UW7A 5FAHA 1TPSA 3S69A 1N6YA 4B76A 4R0IA 3PRDA 2GD4B 3HGPA 2Z3EA 1ANBA 3HATH 3FN8A 2RG3A 4JYTA 5HM9A 1H8DH 1SVPA 2XBWA 5JB9S 3U8OH 2W5EA 2A7HA 4NZQA 4JK5A 1BT7A 1MU6B 1JRTA 2WINI 2C8WB 2HRVA 3E6PH 4FU9A 2WSSD 1ZLRA 1GI2A 1DXPA 1PQ8A 2VGCC 1QB1A 2KAIB 3A7ZA 1O5GH 1V2LT 5CHAC 1UVOA 4ZKRU 4P02A 1S6HA 1OSSA 1O3OA 3A8CA 4Q4LA 1EAUA 4O3TA 4BAHB 4KTUA 1SGYE 3KQBA 4JZIA 5H4IB 3TH4H 8GCHG 1YCPM 3ATIA 1K21H 1QCPA 3Q3KA 1IQKA 4OGYA 2FODA 1BIOA 5FXLA 3A8AA 3K65B 3SOSA 1T31A 4CR5A 1SOTA 4XRNA 5A0BA 2FIRH 1OP8A 4JZFH 1TPPA 2QF5A 1DLEA 2XBXA 4TPYA 7GCHG 3F9FA 1SI5H 1E0FD 3LT3A 4MNVA 2FEQH 4OS7A 1W0JD 2PTCE 2BVSH 1YPLH 3EYDA 2ZQ1A 3DT0H 1J16A 4WY3A 1HAVB 2KM0A 3A8DA 1W0KD 3A80A 1BTPA 1LKBA 4AFQA 1NY22 3EE0B 3C1KA 3PMBB 5FPSA 1BDAA 1ZSKA 1S81A 2FXRA 1AE8H 1UCYE 2BLOA 4OGXA 3BTQE 1O5CB 3MO6A 3ZZ6A 1LQDB 1T4UH 3L3TA 1GHVH 1TNLA 1HPGA 1OWKA 5KECA 3LKWA 2OC7A 3MH7A 4OS1A 3FANA 1NZQH 2H2ZA 2NU1E 4E05H 2GJGA 3OSYA 2FYQA 2QXIA 3SNCA 4AB9A 3QTVH 2ZHDA 3SGAE 5HIYA 3S7HB 2A5AA 5K7RA 5C94A 2QN5T 4I8HA 1C5VA 1TPOA 3TK5A 4MTBA 4MVNA 1TIOA 1KY9A 5JYIA 1DXWA 4RI0A 1AVGH 1P2JA 3RXAA 2RDEA 4YLQH 3RM2H 1T7CA 5B6OA 5GJ4B 1NROH 1IQFA 1ZJKA 1C2GA 1GI7B 1VJAU 2FOFA 2A4OA 4UFEH 3URCA 1EZQA 1JIMA 1SLVB 2D1JA 1VKYA 1Z1JA 3ZV8A 1EFRD 2BQ7B 4A6LA 1YPHE 6LPRA 1GI6A 4CRFA 1O31A 5E8EH 2AMDA 1NPMA 3VPKA 3TGIE 5BRRE 2QXJA 1IQNA 5F03A 1A0HB 1NBME 3RXBA 3MO9A 3QO6A 2AFQB 1FAXA 2A32A 2R0LA 3ZYEA 3GCHC 1CQQA 2GZ9A 4NSYA 1P2KA 3A7XA 1RS0A 2VIOA 2OC1A 2F9VA 3MYWA 3KL6A 2OCVB 4AYYB 1W7XH 1EUFA 1GDUA 3A7YA 2C8ZB 1LHDH 4DVAU 2AIQA 2ANYA 3NPSA 4K1EA 2QE7D 4U2WA 1O2KA 1O34A 4VGCC 1C5SA 1GBCA 3T62A 3MNXA 5DSFA 2GDDA 1D6WA 1TONA 4DGJA 2ZGBH 2ZCHP 2ZECA 2DUCA 2F9OA 2BMGB 1BMNH 5DP4A 3TU7H 5HIZA 1V2RT 5EGMA 2C93B 4TY7A 2CJIA 3SJKA 4BTTB 2JH5D 1FAKH 4NA7A 3LPRA 1JXPA 3SJOA 1GGDC 3S9CA 4M9FA 1CHOF 1MQ6A 3UQVA 1EPTA 1OX1A 3RXQA 2ZU4A 3CNRA 1EJNA 1C1WH 5HM2A 2G51A 3KQDA 4JYVH 1O2IA 4WF8A 3T2NA 1AWFH 1BMFD 3WWBA 1ZR0A 1GI1A 4ISLA 2BYAX 3EAJA 2SGQE 1IHSH 4XFQA 1IAUA 4Z1MD 1GVKB 1ELTA 1FY8E 4YT7H 2J4IA 2ZHFH 3MH6A 3E90B 4TWWA 1T8LA 4Y8ZA 2VIDA 2J5UA 3CS0A 4B74A 1SGFA 1TA2A 3BN9A 3FZZA 3LGWA 2Q6DA 4HTCH 3F9GA 1AUTC 4GSOA 1FY3A 1P2QA 2ZEBA 5EW2H 2A4RA 3GY3A 1EB2A 1UVPA 1W11U 1Z71A 2PR3A 4SGBE 1LO6A 5J4QA 5CDFE 2CF8H 1WOFA 3M61U 2IJOB 5ABWA 1GBAA 1V2MT 1K1NA 4WJG2 2HALA 2R3YA 3MU0A 2UUKB 2O8WA 2PTNA 5GCHF 2M5TA 3DSOA 1NN6A 1EQ9A 1LVYA 4OS2A 1GI9B 1ETRH 1SL3A 4TWYA 5A09A 1GHAF 4E7RG 4Y76A 1HLTH 3GY8A 2BY7X 4UFFH 4AN7A 3S9BA 2BY5X 3SV8A 1FDPA 1C5RA 3FVFB 2KCAA 3FAOA 4ABAA 2GVFA 3PLPA 1P11E 1OKXA 1BRAA 2GMTB 3TJUA 2I6QA 4AB8A 1XUIA 2BHGA 4WWYA 2A4QA 1JOUB 4NIYA 5E0JA 3ZZ7A 2P94A 1C4U2 2EA3A 2XRCA 3MU1A 3VB3A 4Y6DA 1C1SA 1FX0B 2O9QA 3N99A 1ESAA 1EOLA 2RCEA 2LNCA 1DY8A 1EATA 4BXSA 1FIZA 1GBLA 1BZXE 5E0HA 2PGBB 1GMHG 1FONA 1YWUA 1OWIA 2BD5A 1DWDH 5C0UA 2CF9H 1LMWB 1MUEB 3GY7A 1KXBA 3QUMP 4UFGH 5GIBA 1MAXA 2Z3DA 1ELBA 4ABHA 3MH4A 2JJ1D 3SGBE 3JZ1B 3SBKA 1QL7A 1QJ7B 4AZ2B 1E36B 1GBJA 2W6ID 5DG6A 1G3CA 1S85A 2BDBA 3B8JA 5C0TA 1HRTH 4TT3D 1OHHD 1X7AC 1C4Y2 1HB0B 2YNAA 3SNDA 3B9FH 2ESTE 5I46H 2ODPA 1F7ZA 5C5OA 1WCZA 3UNRA 1T8OA 1YBWA 4TPIZ 2VIWA 2BOKA 1AN1E 5FBIA 4CBNA 1SKYE 4CR9A 5EQRA 3BV9B 4B1TA 5FX5A 3K6ZA 3LDXH 1SLUB 2FZZA 2IPHA 3RMNH 2GV6A 2ZGHA 4R8TB 2STBE 5FCKA 4IN2A 1B0EA 1O3GA 5AFYH 3LH1A 1C5WB 1A1RA 1YKTA 2GCHF 3UR9A 2FLRH 1G9IE 1MQ5A 2BDIA 1E37B 1O2LA 3JZ2B 2C3SA 3MNSA 2D26C 3HKIB 3UOUA 1MBMA 3VG8A 2LP6A 4JZDH 4X1RU 1LHGH 2ZQ2A 2GCTB 1WQVH 2BY8X 3NZIA 3K9XB 5DP8A 2W7SA 5LGOA 4MPVA 3SUDA 3T27A 2P59A 3ZVCA 1O2XA 4F48B 1TOCB 3PM3A 2WV4A 1GBBA 1SPJA 1V2UT 2BDYA 2VIVA 2VWOA 1O37A 3Q3YA 1CBWC 1YCPH 1ANCA 1TMBH 1SMFE 5JPMH 4ZH8A 1VCPA 1ESBA 2EY4C 5LPRA 1K0HA 4BAOB 1SGEE 2WV5A 5EJZA 1C5PA 2EI7A 2J98A 1V3XA 1NFWA 1V2ST 1W14U 1MD8A 5C17A 2BDHA 2SFAA 1VCQA 2Y5HA 1VITH 1QZ8A 3SU3A 1C1TA 2ZDNA 2JJ2D 1Y5UT 1NESE 3ATWA 1Q31A 1VITG 2Z94A 1THSH 3SO3A 1TNJA 4H6SB 1BRCE 3TIUA 6GCHF 2A2QH 1E1QD 5L2ZH 4ZXXH 4ZKOU 4X2XA 1LKAA 2PWXA 3OX7U 1O2RA 2PKAB 5KGOA 3FP7E 3WY8A 4IMZA 1G36A 1P02A 1MD7A 1IHTH 1A7SA 1HGTH 1O2SA 1NFUA 5A8YA 3CENA 3FKSD 3GS9A 4ZROA 2BDGA 1O3DA 1EAIA 3U28C 1AGJA 1ZYOA 3A86A 4Y7AA 5EW1H 1T8MA 1FY1A 1F5LA 1QGFA 5L30H 3GYMA 5JB8S 3E8LA 1MTVA 5FPTA 1P2MA 3GDVA 4CRAA 1A0JA 2WPDD 4AC9A 1D9IA 2SNVA 1TQ0B 3MNCA 4X6NA 4JCNA 1O2QA 2BY6X 2AHME 1EJMA 1BMLA 4YT6H 3SUGA 1HAPH 4QT8C 4Y0YE 2FLBH 1CT4E 1THRH 5EPNA 2A2XH 4Y8YA 1UTMA 5HMAA 1DWBH 7ESTE 2UUYA 1P03A 6CHAB 2VVUA 5EXNA 5DP5A 1IOEA 3P8GA 3M5OA 1JBUH 3P8NA 2H9HA 1XVOA 3VB4A 2GZ7A 3SHAH 3F2GA 3P6ZB 1C1QA 1ZGIA 1GMCF 5T6GA 1F5KU 1O2PA 3M7UA 3RC5A 2Z9GA 1TE0A 1C5NH 4GHQA 1UK4A 1DOJA 1LHCH 1RTFB 3QWCH 4NA8A 2CMYA 2EEKA 1MKWK 1K22H 3ODDA 2PP6A 2VVVA 1HAHH 1O3KA 4ABJA 3H09A 2Y7ZA 1NC6A 1UVUH 2TRMA 3E0NB 2SGDE 5DP9A 5SGAE 2QGRA 2A1DB 1CGIE 3T25A 3SI3H 2FOBA 4FUCA 1GBIA 1GBDA 2WPKS 1S6FA 2SNWA 5HXFA 3SZEA 1O2TA 1UTPA 1XXFA 1WXRA 4M7GA 3V0XA 2O8LA 2OUAA 1ZSLA 4ABBA 5T1VA 2QIQA 1TGTA 3SU0A 1B7XB 1Y5BT 3KEEA 4ISIH 4AYVB 2ZA5A 4AG2A 1YYY1 3UR6A 1N6XA 2CV3A 1C5YB 3P92A 4NIVA 1BTZA 3TJVA 3RXFA 2GKVE 3M7QA 3TJOA 4Y11E 1RRKA 1JIRA 3N7OA 2XXLA 3L33A 1HIAA 3PROA 2PFEA 2FS8A 3RXLA 1XUJA 2GMTC 1P04A 3LJOA 1RTLA 3M35A 3H7TA 3RMMH 2FYRA 3A7WA 3RU4D 1V2PT 2BDCA 2EI6A 1C5OH 1MTNC 2J94A 2V6NA 2OBQA 3EE7A 1C1RA 1SB1H 3SJ9A 1SR5C 1W12U 4FUIA 1DUAA 4ABFA 4X1PU 1G2MA 1PQ5A 1ELGA 4RKJB 1O3HA 1AHTH 2ZHEH 2DE9A 1MKWH 3SUFA 3GY5A 1A4WH 1SFIA 1PYTD 1UHBA 2WPLS 3ENSB 3F3BA 2YMSD 3UPEA 2QV1A 1C5QA 1E38B 2ZWLH 2J38A 2B9LA 3SV2H 3MFJA 3N7DA 1GI0A 1BUIA 2AIPA 1SOZA 1V2NT 3KYFA 3RXDA 4UE7H 1TNIA 1P0SH 1D3PB 3GISB 2GV7A 1HXEH 1QURH 2VU8E 1JRSA 3MU4A 3DFLA 5C1UA 1AB9B 4MPXA 2BTCE 5IK2D 3KQ5A 2GP9B 3E3TA 3QN7A 2W26A 1NS3A 2FOHA 1A46H 2IPQX 1L4DA 1FMGA 3T28A 5AF9H 1SGCA 4XOJA 1ELVA 2WPMS 5BPEA 1RIWB 3OU0A 1DY9A 4I33A 4Q80A 4GLYA 4CRGA 1FUJA 1BBRK 1EZUC 4ZKNU 2UUJB 1TGBA 3SU6A 1AFQB 2XOKD 2D2DA 4B6FA 3LGUA 3UB0A 3MQKC 1DVAH 3TPIZ 1NRSH 3O8CA 2ZF0H 2TIOA 1TGCA 4TSFD 4DIHH 2Y5FA 2G52A 4K60A 4CH2B 1O2OA 1PPBH 2Q6FA 2FO9A 1FY4A 1GBMA 2BLVA 2TGDA 4O9VA 3OAAD 1AU8A 1MZDA 2G55A 4K3JA 1LVOA 5FHTA 1HAZB 2PSYA 3U1IB 4ACBA 4IC5A 5EXLA 2GCTC 3IITA 4O97A 3OY5U 1Y3WA 4MPUA 1OWDA 2XNIA 3BF6H 3MHWU 4KTSA 3UWJH 2J9NA 2K1QA 4ZHMU 1XXDA 4XSKU 1GJ4H 1HCGA 1LCYA 4FETA 1C5XB 4WMDA 1EP6A 4FUJA 4E7NA 2ASUB 1P06A 1TA6A 1EXFA 1TQ7B 1CU1A 1EOJA 1V2WT 3WWFA 3BEFB 2GT7A 1WUNH 1KYNA 2QXGA 1WBGB 3QGJA 1GPZA 1QRZA 2PKSC 3HK6B 3P8FA 3SZNA 3BTFE 2BLWA 4D9QA 1OS8A 1PPFE 3SN8A 1AVWA 1P2IA 2BXUH 3VB7A 4YOJA 1YY3A 5EQSA 2ZFPH 1HDTH 5EJ1A 2ANWA 4DW2U 2FI4E 3M3VA 2W7UA 4P00A 1F92A 1BBRH 5CE1A 5DP3A 2ZDKA 5EQQA 3RXVA 2H9EH 2AS9A 4CREA 2FTLE 4UEHH 3ZZ5A 4LZ4B 2F91A 3FO8D 3V7TA 3HPTB 2H1UA 5A8XA 2XC0A 4Y10E 3NUMA 3ESTA 3NK8A 1XX9A 1KTTB 5AVDA 3I77A 3OYPA 1TNHA 1AUJA 2ZO3H 1RGQA 4ZUHA 4X6MA 1GHXH 4D76A 3OEED 3AW1A 1HUTH 1CBWB 5GCHG 1B5GH 1GBEA 1PFXC 3UREA 2C4FH 2BD4A 3MOCA 4GVUA 1ELCA 1AMHA 1MTWA 2IN2A 3GICB 3QGNB 3QZQA 2V3MA 4GCHG 1SGRE 3RDZA 1DS2E 1TPAE 3SJIA 1O2MA 1OP0A 1EJAA 1Y5AT 3MMGA 3BIVH 1GHBG 7LPRA 1K1LA 1E1RD 1RXPA 1A0LA 5FCRA 3SJ8A 1ZHPA 1J14A 3UIRA 3UNSA 2I6SA 1W7GH 1ZPZA 4WMEA 5GXPA 3O8BA 6CHAC 1EAWA 1M9UA 3OY6U 1ARCA 4ZHAA 1QRWA 2GDEH 4CRDA 2H9TH 4NCYA 5IDKA 4Y79A 4K2YA 1O3MA 1C9PA 2C8YB 8KME2 2BVRH 1F0SA 1V2OT 1ELFA 2HNTC 5GNDA 4ZXYH 5A2MH 3U98H 1TMTH 1SSXA 3PV4A 1IQJA 5EOKA 1GI3A 4JZEH 2Y80A 1GBKA 2ZTXA 4F4OC 1CA0B 2AGEX 8GCHF 1GJ9B 1SQAA 1QL9A 1K1MA 1TBQH 4INLA 1THPB 1ETTH 3KYGA 1P05A 2NU2E 1AIXH 1CT0E 4MQAA 2J2UA 2RDLA 2YNBA 1QQUA 2ZCLP 1GJ6A 1H8IH 4X6OA 2B5TB 1EP5A 5JBBS 1LVMA 2P3UB 1ZTKA 7GCHF 3T26A 1J9CH 1FNIA 1H1BA 2ZFRH 2G4TA 1DWEH 3SW2B 3PLBA 5T6FA 2YMSC 2FP7B 1HJAB 3A82A 2PUXB 3U69H 3G01A 1P10A 2O8MA 5JBAS 1B0FA 1AVXA 3STIA 3F2FA 3M37A 1KXDA 1ZHRA 1ZPCA 2BOHB 3ELAH 3H7OA 1BHXB 3ZZ3A 2V7QD 5JDUB 1QIXB 1FIWA 1H8ED 4MPWA 1C2MA 1DITH 2D8WA 4BAQB 5CHBA 1KSNA 5DP7A 3PMJA 3DD2H 1AKSB 4NWKA 1J8AA 1GCTC 1ZSJA 4X1SU 4HG6A 1XUGA 2XC5A 1H9HE 1GVLA 3EA7A 1Z1IA 1BOQA 3PYHA 4HGCA 3RXTA 1KLTA 1HXFH 1BTHH 2KFWA 4A1TA 5L6NH 1UTNA 3I29A 1TX8A 2AGIX 1SGDE 3SU2A 2TPIZ 2R9PA 3RXJA 4AG1A 3PMHB 1GBHA 2JIZD 3QDZB 1F2SE 2TGAA 1A5HA 1PPGE 2ZGJA 1GMDG 5FPYA 1S82A 2M2AA 2XTTB 1WTGH 2A5KA 3K2UA 5AHGH 3MI4A 1AB9C 1VZQH 4BANB 4CRBA 4ZKSU 1C2IA 1DDJA 1O3IA 1ZOMA 1L1NA 4LXBH 1WAYB 1OWJA 1MTNB 2HVYB 2FPZA 1DSUA 1RIWC 3RM0H 1CO7E 2JH0D 1G32B 2VINA 3LGVA 2VNTA 4ACAA 2RA0A 3KQCA 3BSQA 5T3HA 1G30B 2C8XB 1SBWA 1AFQC 1P9UA 2A0QB 1AD8H 4MNXA 4YLUA 3V12A 1MCVA 1OP2A 2L74A 2ILNA 4ABEA 1O3PB 2F83A 2KCYA 2PGQB 3GOVB 1ESTA 3SHCH 1U6QA 3SGQE 1C2EA 1MABB 1E34B 1CE5A 1HJ8A 1W8BH 3F2HA 4FU7A 3RXRA 2FOMB 2K0QA 1V2TT 2P8OC 1GWAA 2Y6TA 4FUBA 2R2WU 3PB1E 3GCTG 4Q7XA 1XUKA 1ZMNA 1YCPK 2OQUA 1KDQA 1UTKA 2XBVA 4BNRA 4DOQA 1XUHA 2YOLA 4ZCNA 3LGIA 4DCDA 3BTTE 3LH3A 7KMEH 1SLWB 4NIWA 4H4FA 1ID5H 3RXSA 1LPZB 5DJ7A 1GG6C 1L1GA 1UTOA 2GZ8A 1GI4A 3A7VA 1EZXC 1NFYA 1C5ZB 2F4LA 1MBQA 3PTBA 3LU9B 1ZMJA 4A7IB 1NT1A 2Z9LA 1IQHA 1JMOH 1GI5A 2KCOA 1QB6A 5A8ZA 2Y7XA 2Z6BD 2GTBA 1O5AB 4FUEA 3Q76A 3W1EA 2R2MB 2OXSA 1DWCH 1O0DH 1O2ZA 1IQLA 4J1YA 4X0WU 1EB1H 2P16A 1H9LB 1QTFA 2ZFFH 4IGDA 2ZPQA 3BTDE 3QTOH 2FI5E 1GMCG 1UVTH 3D65E 2W3KA 2FI3E 2OK5A 4OM9A 1Z6EA 3GCNA 1E79D 1TX7A 4X2YA 1AFEH 4FU8A 4KKDA 1LPGB 2UWLA 5DK1A 1YPEH 1ETSH 1T4VH 1CA8B 3TK9A 1QFKH 3V13A 1Z8GA 1GJDB 3D62A 3DFJA 5PTPA 2ODYB 1O2JA 4I31A 3MWIU 4K69A 2BD3A 4OS6A 4F55A 4CHAC 2KAIA 1BTUA 1PPCE 2ZGCA 1F0UA 1FPCH 1EAXA 1F5RA 4NWLA 4DJZB 1BCUH 2XW9A 2PKSB 3KN2A 5A0CA 2G4UA 3Q3XA 4ASUD 1BRUP 1P2OA 2BX4A 3U8RH 4DT4A 4FUHA 1HV7A 1TFXA 1S0RA 1W0ZU 2WV9A 3AAUA 3PWCA 2Y81A 1ZRBA 2NU0E 4Q7ZA 3SNAA 5A0AE 1CGJE 2EI8A 2ZC9H 1WSSH 4RN6A 2BD9A 2FX6A 1Y8TA 1WTHD 2FOGA 1XVMA 4RKOB 1UTLM 1S84A 1WYKA 4X1QU 4MNYA 9LPRA 5L2YH 3PO1B 4I8GA 4MDSA 3UUZA 1UJ1A 1TABE 1TOMH 3ZIAD 1L2EA 2AMPA 3A84A 1HAIH 2QCYA 1HAVA 2HOBA 1VGCB 1J17T 1SG8B 1K9OE 1NTPA 1WDIA 1GMHF 1P01A 1VR1H 2CK3D 4Q63A 3RP2A 3BIUH 1YF4A 1EPTB 4Q2KA 3QLPH 1CA0C 2ZHQH 4BOHA 4ESTE 2HVXA 3BTEE 3A7TA 1YM0A 1O39A 2XBYA 3A85A 2STAE 2EQNA 1TX6A 4J2YB 4LK4A 3D49H 4X2WA 2FESH 2J95A 2BQWB 1DX5M 1AZ8A 4X1NU 1LPKB 1D3TB 4A5TS 1MU8B 3F9HA 3UNQA 3ITIA 3TNSA 4XDEA 2QC2A 3M3TA 5AFZH 1C1MA 3Q00A 2XWAA 1HJAC 2OD3B 2UUFB 2QAAA 1BRBE 1QJ6B 4D7FA 5LH8A 3TJNA 1P3CA 2ZNKH 1D4PB 4IN1A 1PQAA 1GL0E 1QA0A 1V2VT 3ZVFA 1PQ7A 4ISHH 1DICA 2Z9KA 3P8OA 4AX9H 1Y3XA 2ZGXH 1ANEA 3F1SB 5LPFA 1C5TA 2HNTE 4JMYA 4WH8A 1NRPH 2PSXA 1JWTA 5E2PA 1UK3A 1ZTLA 2AYWA 2AEIH 2CHAC 1O5EH 1SGIB 4Y7BA 1XMNB 3RXEA 1MH0A 2ALPA 2FTMA 3RXGA 4PROA 2P3FH 4HZHA 2OTVA 2G5NA 3RC6A 4B73A 3O8DA 5JBTA 3RU4E 3ZZDA 2WPIS 4WXVA 2VWNA 2O8UA 2WZQA 1YPGH 1MKXK 1INCA 1YPKH 1O2VA 2WHXA 5TCAA 2YMSB 2K8IA 4NSVA 2Z7FE 1KXFA 4YZUA 1O3JA 1OYQA 2ZKSA 4RT1A 1LHEH 1GJ7B 4GUXA 2A7JA 4IS5A 3OE7D 2ZU1A 4AGKA 1P9SA 1W0YH 4XBBA 5CMXH 1G3EA 1BTXA 2V3HH 4U01A 5GWZA 3GYLB 2ZU5A 1DSTA 1SGFG 2ANKH 4ABGA 2TGPZ 2BXTH 4K5ZA 1FPHH 2XYAA 3F6UH 1ELEE 1O3EA 1QRXA 2ZG0H 4AFZA 3PTNA 1SGPE 1GCTB 1T32A 1KLIH 1K1IA 3ZZ8A 4X8UH 2F9UA 2Z9JA 1PPHE 1NRRH 3BTWE 2O8TA 1EASA 3SI4H 1O5FH 1QQ4A 2FOAA 5C2ZA 2VH0A 1QBVH 1OXGA 2ANMH 5ESBA 3M5NA 4U32A 1GJCB 1TRNA 3UY9A 4I86A 2F9NA 3TK6A 5KEDA 3UQOA 2VBCA 4I8JA 1ABIH 4UDWH 1Z8JB 1W10U 4YTAA 4B6EA 2G5VA 3VB6A 1D6RA 5HYOA 1UMAH 1Z6JH 1HAYB 2VB0A 4O3UA 3ZZAA 4NZLA 5K0HA 3ATMA 3KIDU 5HGGA 1AKSA 1H8HD 3F0PA 4Y71A 2KR7A 3MH5A 1O38A 1TYNA 2XWBI 2L6OA 1MKXH 3SNEA 5LPEA 3TGJE 4B2CA 4O03A 5GPIB 1FN6A 1C5UA 1RTKA 3FFGA 4TYDA 4ABDA 3PV5A 1O2NA 2ZHWH 3R3GB 1H4WA 3DA9B 2QF3A 3F0OA 3ZVBA 2ALVA 3M7TA 1ZTJA 1FV9A 3DHKH 4E06H 1BBRE 4NGAH 1TALA 1DPOA 5DPAA 3E0PB 4LOYH 2P8OB 4FVBA 1HAOH 5FL7D 1CHGA 3N7EA 1W3CA 2V35A 3OTPA 5F53A 4IC6A 1YLCA 2WUCA 1A3EH 2ZZUH 3KF2A 3NCLA 4ZAEA 1MCTA 3RXPA 2WYGA 1C2HA 1K1JA 1O2GH 3HK3B 3RLWH 2FM2A 1GG6B 1O2YA 4AFSA 2AGGX 1AZZA 2J98B 4K8BA 1L1JA 2GT8A 4BAKB 5F8ZA 1GCDA 2ZFTA 2VIPA 3LIWA 2NU3E 3S7KB 2ZFQH 3ZZBA 1ABJH 3M5MA 2C90B 4DIIH 4LZ1H 1KIGH 1CHOG 4JZ1A 4A1XA 3SQHE 1MTUA 3A89A 2OC0A 4OS5A 4KGAA 3MU8A 1TGSZ 1TMUH 4I32A 4ISNA 4CRCA 2TGTA 3LC5A 1J15A 1BITA 1UCYK 1GVZA 1BMAA 4DURA 1MMJN 1Q3XA 3TH3H 5DP6A 3A83A 4KELA 3VGCB 4XD7D 3PRBA 3VXEH 4K1SA 3IG6B 2FX4A 2VJ1A 4UONA 3PO1C 1MZAA 3LGTA 3RC4A 4IW4E 1LQEA 1QBNA 1K1OA 4CHAB 4BAMB 1VGCC 2PHBA 6ESTA 3QK1A 3CP7A 5DGJA 1C4V2 5E2OA 1ZZZA 3CS7A 5EG4A 3GDSA 3T5FH 3Q77A 4U30A 3URDA 1GBFA 2V0BA 1SHHB 4WH6A 4ASHA 1EPTC 2HNTF 1GHAG 1S6LA 3LC3A 1C1PA 1QNJA 4D8NA 3EGKH 1ORFA 2ZTYA 1O2WA 4THNH 3UOPA 3SQEE 4UD9H 1HFDA 3NKKA 2B7DH 3RXCA 1FY5A 3AASA 1C2JA 2Y82A 1GI8B 1DANH 1KTSB 3VXFH 1A2CH 2XCNA 3ATKA 4BTIB 3PLKA 1C1NA 1YPJH 3DSPA 1GJBB 3FZDA 4KP0A 1FLEE 5EJLA 1BB0B 1UCYH 1AO5A 1EX3A 1LHFH 3BEIB 1DE7H 5GDSH 2OQ5A 2HGTH 1O5BB 3ZVAA 2OC8A 3BG4C 5E0GA 1RJXB 5T6DA 1BQYA 2F9PA 4WVPE 1C5MD 2W6JD 5F6MA 2LELA 3M3SA 1NBMD 3RXOA 2QXHA 1O5DH 1QR3E 2ZDLA 1OYTH 2W3IA 5C1YA 2JH6D 1Q2WA 3A81A 4DG4A 2PKAA 4D9RA 2ZCKP 2ZDVH 1QJ1B 4CBOA 3KGPA 1K28D 2THFB 1F0RA 3TGKE 1HIAB 1TGNA 3VB5A 1ZHMA 4YM9A 1D3QB 1NRQH 2OP9A 1VCWA 4K8YA 4FUDA 4Y8XA 4INHA 3OTJE 3DUXH 1GBTA 2ZTZA 5C20A 2AMQA 1SLXB 1BA8B 1GDNA 3TVJB 2ZPRA 4FUGA 1SFQB 4NA9H 3SU5A 1N8OB 1PYTC 3TLOA 1V6DA 1QL8A 1HYLA 2P95A 3KNXA 1TLDA 1OPHB 2ODQA 1ARBA 1V2QT 3K6YA 1ZMLA 1UHBB 2GCHG 1G2LA 2ZI2H 3O8RA 4X8SH 9ESTA 3KCGH 1MTSA 1IQGA 3SU1A 3QX5H 3SUEA 1BJUA 1AQ7A 1SGQE 1GHYH 1ELDE 1HBTH 2XC4A 2HLCA 2QA9E 3P17H 4FXGH 2ZP0H 3ZYDA 1TNKA 2CHAB 1S5SA 3AAVA 3V3MA 2AERH 1QHRB 3BTGE 4X2VA 3PWBA 2GGVB 2PV9B 4AORA 1H9IE 3ZVEA 1CT2E 4I8LA 2HPPH 2FS9A 1A5IA 4H42U 1XKAC 2BQ6B 4FOUC 3RXUA 1SC8U 2P3TB 2Q6GA 2H6MA 1AWHB 1GHWH 2A31A 2SGPE 2ZDMA 3BTHE 1O3LA 1TNGA 2A7CA 2BVXH 5EXMA 2SGEE 4NFEA 1NU9A 1YP9A 4GCHF 3E16B 4IMQA 1FI8A 2ZFSA 2A45B 3RXMA 1GHBF 2IJD1 3MNBA 1LTOA 2UWOA 4HI3A 1UO6A 1SQTA 3SU4A 6GCHG 2BX3A 3UWIA 4AOQA 3ZVGA 1O33A 3SORA 3QZRA 1KXEA 3B23B 1P57B 3DSGA 1GJAB 4B71A 1O36A 4Q7YA 1OWEA 2DE8A 2Q1JA 4INKA 3EA8A 1HNEE 2F43B 2VIQA 1CSOE 2VH6A 1ANDA 2AH4X 4I7YH 4K1TA 2FWWA 5C3NA 3E91A 1FJSA 1COWD 5ESTE 1C2KA 1TBZH 2F3CE 2P93A 2R0KA 1TB6H 1WU1A 1QBOA 1AI8H 2NU4E 2PLXA 1D3DB 4JK6A 3OFND 2JETB 2KZ4A 1DLKB 1A3BH 2FDAA 3A88A 1TBRH 1C5LH 3RUOA 3LJJA 1VJ9U 1C1UH 3A87A 3AK5A 2FOCA 3T29A 2BZAA 2ZIQH 4JYUH 2VWMA 1KLJH 1TRMA 1RFNA 4HFPB 2UWPA 3S9AA 1TAWA 3NRLA 1W2KH 4RT0A 5TCCA 1S83A 1Z8IB 2QY0B 5B6LA 1XUFA 3UAIC 5IYTA 1O3CA 4UFDH 1HJ9A 2VGCB 3VGCC 4MG3A 5CHAB 4YESB 3MTYA 4Y0ZE 4DT7B 5F8XA 5I25A 1L4ZA 2VWLA 2SGAA 5DN6D 4B75A 2ZPSA 3GY6A 1O2UA 1NU7B 3ZVDA 3LOXA 4GHTA 3U8TH 1NFXA 4GAWA 5TJXA 1S0QA 2CXVA 3VEQB 3A8BA 2FMJA 3BEUA 3SYJA 1QA7A 1EKBB 3SV9A 1DUEA 1YLDA 2HPQH 1PJPA 3ZZ9A 3I78A 2LPRA 1YC0A 3EA9A 1GDQA 1Y3VA 1UK2A 2H5CA 1GL1A 4FUFA 2IOTA 1T8NA 4X6PA 1E35B 3D23A 1KXAA 4MNWA 3KQEA 1WQSA 1YPHC 3HGNA 2BZ6H 3GY4A 1AY6H 1Y59T 1SGTA 1W13U 2PUQH 1SQRA 4FVDA 1GMDF 1ZGVA 1G3DA 4IBLH 1PPZA 2QF0A 1P3EA 1FQ3A 2J97A 1LDTT 1P09A 3ZZCA 5G4BA 3S0NA 1FZZA 3ODFA 1F0TA 1SGNE 3VFEA 5EIYA 2WYJA 1O3AA 5EU8A 1Z7KA 1P8VC 1O3BA 3EQ0H 3C27B 2XNDD 1Y3YA 1UVSH 2ZU2A 4B2BA 1O32A 4AGJA 2HWLB 4X8VH 4BTUB 2NWNA 3W94A 3RLYH 3STJA 2QF4A 1YLNA 2V3OH 1TRYA 4ABIA 1O30A 2BD7A 1AE5A 4GPGA 4D7GA 1BTWA 5DO4H 2JDID 3R0FA 2BD8A 2EC9H 4A1VA 4BXWA 1WV7H 1YPMH 3BG8A 1GJ5H 1C1VH 1DFPA 3ZZ4A 2R3UA 1UTQA 3UTUH 1BHXF 5EPYA 4CH8B 1GJ8B 8LPRA 3NXPA 5F8TA 2ZDAH 3GCTF 3GY2A 3M5LA 4XBCA 1XKBC 3W95A 1RD3B 2F9BH 4RSPA 1G37A 1K2I1 1UTJA 2BY9X 1ZJDA 2G00A 3AVZA 2FOEA 3FP8E 2B8OH 1BMMH 1BJVA 1O3NA 3TNTA 4A92A 3BTKE 3LONA 3PV2A 1N8OC 2Y5GA 5C67A 4MLFB 4TY6A 4KTCA 4NFFA 2VVCA 1CVWH 4B2AA 2TBSA 1CGHA 3IWMA 2OLGA 2RFKC 3BG4B 3GCHB 3LGYA 2BLQA 5JBCS 1ZRKA 1C2DA 3M36A 2WPJS 1QY6A 4ISOA 2KX4A 2KCPA 2BD2A 4Z6AH 1GHZA 2A5IA 5C5NA 2OINA 4XE4A 1TWXB 1ELAA 3F9EA 1A61H 3GDUA 1MAYA 3GCOA 3TITA 1OOKB 4I8KA 4ZMAH 1KMHB 1P12E 1DM4B 4YOIA 4OS4A 4NIXA 3MO3A 1C1OA 1KXCA 1N1LA 4VGCB 2CN0H 4XBDA 4Z0KA 1LVBA 2B0FA 3PMAB 2SGFE 1ACBE 1G3BA 3SV6A 2PW8H 2OBOA 2WPHS 3ATLA 3NWUA 1OWHA 3HKJB 1V2JT 2BB4A 2G81E 1FN8A 3AW0A 3RXIA 1ZPBA 3E1XB 3FOAA 4DY7B 1GGDB 2CGAA 5EODA 1SHYA 1IQEA 1PPEE 3RMLH 3BTME 3WW7A 1SQOA 4WMFA 3U9AH 3F68H 1A5GH 1K1PA 2J92A 4YO9A 2JKHA 1Y3UA 2Z9IA 3H5CB 1O3FA 3ZV9A 1NRNH 3U1JB 1VITF 1O35A 3P70B 1YGCH 4X8TH 3SNBA 3RU4T 3UFAA 4SGAE 5ETXA 2Z3CA 3EDXB 5J4SA 1KDQB
chains in the Genus database with same CATH topology
1P2NA 3SV7A 4AFUA 2H5DA 4WXIA 8ESTE 1IQMA 1NM6A 1NO9H 3RMOH 2A4GA 4NG9H 3TH2H 4YOGA 2BDAA 2G8TA 2XCFA 1Z8RA 1IQIA 1DT2A 1QB9A 1EZSC 1O2HA 3MU5A 1XM1A 4ZHLU 2QYIA 5C1XA 5FX6A 1HAGE 4F49A 1FXYA 2ZU3A 1V2KT 3RXKA 2WUBA 5FBEA 3RXHA 5DKMA 3FP6E 2ULLA 1HAXB 2BM2A 2RA3A 2J34A 1L0ZA 1C2LA 2JETC 1C9TA 1C2FA 3KHVA 3L6PA 4H6TA 2GX4A 1BTYA 3P95A 5FAHA 1TPSA 3S69A 1N6YA 4B76A 4R0IA 2GD4B 3HGPA 2Z3EA 1ANBA 3HATH 4JYTA 2RG3A 5HM9A 1H8DH 1SVPA 2XBWA 5JB9S 3U8OH 2W5EA 2A7HA 4NZQA 4JK5A 1BT7A 1MU6B 1JRTA 2WINI 2C8WB 2HRVA 3E6PH 4FU9A 1ZLRA 1GI2A 1DXPA 1PQ8A 2VGCC 1QB1A 2KAIB 3A7ZA 1O5GH 1V2LT 5CHAC 1UVOA 4ZKRU 1S6HA 1OSSA 1O3OA 3A8CA 1EAUA 4O3TA 4BAHB 4KTUA 1SGYE 3KQBA 4JZIA 5H4IB 3TH4H 8GCHG 1YCPM 3ATIA 1K21H 1QCPA 3Q3KA 1IQKA 4OGYA 2FODA 1BIOA 5FXLA 3A8AA 3K65B 3SOSA 1T31A 4CR5A 1SOTA 5A0BA 2FIRH 1OP8A 4JZFH 1TPPA 1DLEA 2XBXA 4TPYA 7GCHG 3F9FA 1SI5H 1E0FD 3LT3A 4MNVA 2FEQH 4OS7A 2PTCE 2BVSH 1YPLH 3EYDA 2ZQ1A 3DT0H 1J16A 4WY3A 1HAVB 3A8DA 3A80A 1BTPA 1LKBA 4AFQA 1NY22 3EE0B 3C1KA 3PMBB 5FPSA 1BDAA 1ZSKA 1S81A 2FXRA 1AE8H 1UCYE 2BLOA 4OGXA 3BTQE 1O5CB 3MO6A 3ZZ6A 1LQDB 1T4UH 3L3TA 1GHVH 1TNLA 1HPGA 1OWKA 3LKWA 2OC7A 3MH7A 4OS1A 3FANA 1NZQH 2H2ZA 2NU1E 4E05H 3OSYA 2FYQA 2QXIA 3SNCA 4AB9A 3QTVH 2ZHDA 3SGAE 3S7HB 2A5AA 5K7RA 2QN5T 4I8HA 1C5VA 1TPOA 3TK5A 4MTBA 4MVNA 1TIOA 1KY9A 5JYIA 1DXWA 1AVGH 1P2JA 3RXAA 4YLQH 3RM2H 1T7CA 5B6OA 5GJ4B 1NROH 1IQFA 1ZJKA 1C2GA 1GI7B 1VJAU 2FOFA 2A4OA 4UFEH 3URCA 1EZQA 1JIMA 1SLVB 2D1JA 1Z1JA 3ZV8A 2BQ7B 4A6LA 1YPHE 6LPRA 1GI6A 4CRFA 1O31A 5E8EH 2AMDA 1NPMA 3VPKA 3TGIE 5BRRE 2QXJA 1IQNA 5F03A 1A0HB 3RXBA 3MO9A 3QO6A 2AFQB 1FAXA 2A32A 2R0LA 3ZYEA 3GCHC 1CQQA 2GZ9A 4NSYA 1P2KA 3A7XA 1RS0A 2VIOA 2OC1A 2F9VA 3MYWA 3KL6A 2OCVB 4AYYB 1W7XH 1EUFA 1GDUA 3A7YA 2C8ZB 1LHDH 4DVAU 2AIQA 2ANYA 3NPSA 4K1EA 4U2WA 1O2KA 1O34A 4VGCC 1GBCA 1C5SA 3T62A 3MNXA 2GDDA 1D6WA 1TONA 4DGJA 2ZGBH 2ZCHP 2ZECA 2DUCA 2F9OA 2BMGB 1BMNH 5DP4A 3TU7H 1V2RT 5EGMA 2C93B 4TY7A 2CJIA 3SJKA 4BTTB 2JH5D 1FAKH 4NA7A 3LPRA 1JXPA 3SJOA 1GGDC 3S9CA 1CHOF 1MQ6A 3UQVA 1EPTA 1OX1A 3RXQA 2ZU4A 1EJNA 1C1WH 5HM2A 2G51A 3KQDA 4JYVH 1O2IA 4WF8A 3T2NA 1AWFH 1ZR0A 1GI1A 4ISLA 2BYAX 3EAJA 2SGQE 1IHSH 4XFQA 1IAUA 1GVKB 1ELTA 1FY8E 4YT7H 2J4IA 2ZHFH 3MH6A 3E90B 4TWWA 1T8LA 4Y8ZA 2VIDA 3CS0A 4B74A 1SGFA 1TA2A 3BN9A 3FZZA 3LGWA 2Q6DA 4HTCH 3F9GA 1AUTC 4GSOA 1FY3A 1P2QA 2ZEBA 5EW2H 2A4RA 3GY3A 1EB2A 1UVPA 1W11U 1Z71A 2PR3A 4SGBE 1LO6A 5J4QA 2CF8H 1WOFA 3M61U 2IJOB 5ABWA 1GBAA 1V2MT 1K1NA 4WJG2 2HALA 2R3YA 3MU0A 2UUKB 2O8WA 2PTNA 5GCHF 2M5TA 1NN6A 1EQ9A 1LVYA 4OS2A 1GI9B 1ETRH 1SL3A 4TWYA 5A09A 1GHAF 4E7RG 4Y76A 1HLTH 3GY8A 2BY7X 4UFFH 4AN7A 3S9BA 2BY5X 3SV8A 1FDPA 1C5RA 3FVFB 3FAOA 4ABAA 2GVFA 3PLPA 1P11E 1OKXA 1BRAA 2GMTB 3TJUA 2I6QA 4AB8A 1XUIA 2BHGA 4WWYA 2A4QA 1JOUB 4NIYA 5E0JA 3ZZ7A 2P94A 1C4U2 2EA3A 2XRCA 3MU1A 3VB3A 4Y6DA 1C1SA 2O9QA 1ESAA 1EOLA 2RCEA 2LNCA 1DY8A 1EATA 4BXSA 1FIZA 1GBLA 1BZXE 5E0HA 2PGBB 1GMHG 1FONA 1OWIA 2BD5A 1DWDH 2CF9H 1LMWB 1MUEB 3GY7A 1KXBA 3QUMP 4UFGH 5GIBA 1MAXA 2Z3DA 1ELBA 4ABHA 3MH4A 3SGBE 3JZ1B 3SBKA 1QL7A 1QJ7B 4AZ2B 1E36B 1GBJA 5DG6A 1G3CA 1S85A 2BDBA 3B8JA 1HRTH 1X7AC 1C4Y2 1HB0B 2YNAA 3SNDA 3B9FH 2ESTE 5I46H 2ODPA 1F7ZA 5C5OA 1WCZA 3UNRA 1T8OA 1YBWA 4TPIZ 2VIWA 2BOKA 1AN1E 5FBIA 4CBNA 4CR9A 5EQRA 3BV9B 4B1TA 5FX5A 3K6ZA 3LDXH 1SLUB 2FZZA 2IPHA 3RMNH 2GV6A 2ZGHA 4R8TB 2STBE 5FCKA 4IN2A 1B0EA 1O3GA 5AFYH 3LH1A 1C5WB 1A1RA 1YKTA 2GCHF 3UR9A 2FLRH 1G9IE 1MQ5A 2BDIA 1E37B 1O2LA 3JZ2B 2C3SA 3MNSA 2D26C 3HKIB 3UOUA 1MBMA 4JZDH 4X1RU 1LHGH 2ZQ2A 2GCTB 1WQVH 2BY8X 3NZIA 3K9XB 5DP8A 2W7SA 5LGOA 4MPVA 3SUDA 3T27A 2P59A 3ZVCA 1O2XA 1TOCB 3PM3A 2WV4A 1GBBA 1SPJA 1V2UT 2BDYA 2VIVA 2VWOA 1O37A 3Q3YA 1CBWC 1YCPH 1ANCA 1TMBH 1SMFE 5JPMH 4ZH8A 1VCPA 1ESBA 5LPRA 4BAOB 1SGEE 2WV5A 1C5PA 2EI7A 1V3XA 1NFWA 1V2ST 1W14U 1MD8A 2BDHA 2SFAA 1VCQA 2Y5HA 1VITH 3SU3A 1C1TA 2ZDNA 1Y5UT 1NESE 3ATWA 1Q31A 1VITG 2Z94A 1THSH 3SO3A 1TNJA 4H6SB 1BRCE 3TIUA 6GCHF 2A2QH 5L2ZH 4ZXXH 4ZKOU 4X2XA 1LKAA 2PWXA 3OX7U 1O2RA 2PKAB 3FP7E 3WY8A 4IMZA 1G36A 1P02A 1MD7A 1IHTH 1A7SA 1HGTH 1O2SA 1NFUA 5A8YA 3CENA 4ZROA 2BDGA 1O3DA 1EAIA 1AGJA 1ZYOA 3A86A 4Y7AA 5EW1H 1T8MA 1FY1A 1F5LA 1QGFA 5L30H 3GYMA 5JB8S 3E8LA 1MTVA 5FPTA 1P2MA 3GDVA 4CRAA 1A0JA 1D9IA 2SNVA 1TQ0B 3MNCA 4X6NA 4JCNA 1O2QA 2BY6X 1EJMA 1BMLA 4YT6H 3SUGA 1HAPH 4QT8C 4Y0YE 2FLBH 1CT4E 1THRH 5EPNA 2A2XH 4Y8YA 1UTMA 5HMAA 1DWBH 7ESTE 2UUYA 1P03A 6CHAB 2VVUA 5EXNA 5DP5A 1IOEA 3P8GA 3M5OA 1JBUH 3P8NA 2H9HA 1XVOA 3VB4A 2GZ7A 3SHAH 3P6ZB 1C1QA 1ZGIA 1GMCF 5T6GA 1F5KU 1O2PA 3M7UA 3RC5A 2Z9GA 1TE0A 1C5NH 4GHQA 1UK4A 1DOJA 1LHCH 1RTFB 3QWCH 4NA8A 2CMYA 2EEKA 1MKWK 1K22H 3ODDA 2VVVA 1HAHH 1O3KA 4ABJA 2Y7ZA 1NC6A 1UVUH 2TRMA 3E0NB 2SGDE 5DP9A 5SGAE 2QGRA 2A1DB 1CGIE 3T25A 3SI3H 2FOBA 4FUCA 1GBIA 1GBDA 2WPKS 1S6FA 2SNWA 5HXFA 1O2TA 1UTPA 1XXFA 4M7GA 3V0XA 2O8LA 2OUAA 1ZSLA 4ABBA 2QIQA 1TGTA 3SU0A 1B7XB 1Y5BT 3KEEA 4ISIH 4AYVB 2ZA5A 4AG2A 1YYY1 3UR6A 1N6XA 2CV3A 1C5YB 3P92A 4NIVA 1BTZA 3TJVA 3RXFA 2GKVE 3M7QA 3TJOA 4Y11E 1RRKA 1JIRA 3N7OA 2XXLA 3L33A 1HIAA 3PROA 2PFEA 2FS8A 3RXLA 1XUJA 2GMTC 1P04A 3LJOA 1RTLA 3M35A 3H7TA 3RMMH 2FYRA 3A7WA 3RU4D 1V2PT 2BDCA 2EI6A 1C5OH 1MTNC 2J94A 2V6NA 2OBQA 1C1RA 1SB1H 3SJ9A 1SR5C 1W12U 4FUIA 1DUAA 4ABFA 4X1PU 1G2MA 1PQ5A 1ELGA 4RKJB 1O3HA 1AHTH 2ZHEH 2DE9A 1MKWH 3SUFA 3GY5A 1A4WH 1SFIA 1PYTD 1UHBA 2WPLS 3ENSB 3UPEA 2QV1A 1C5QA 1E38B 2ZWLH 2J38A 2B9LA 3SV2H 3MFJA 1GI0A 1BUIA 2AIPA 1SOZA 1V2NT 3RXDA 4UE7H 1TNIA 1P0SH 1D3PB 3GISB 2GV7A 1HXEH 1QURH 2VU8E 1JRSA 3MU4A 3DFLA 5C1UA 1AB9B 4MPXA 2BTCE 2GP9B 3E3TA 3QN7A 2W26A 1NS3A 2FOHA 1A46H 1L4DA 1FMGA 3T28A 5AF9H 1SGCA 4XOJA 1ELVA 2WPMS 5BPEA 1RIWB 3OU0A 1DY9A 4I33A 4Q80A 4GLYA 4CRGA 1FUJA 1BBRK 1EZUC 4ZKNU 2UUJB 1TGBA 3SU6A 1AFQB 2D2DA 3LGUA 1DVAH 3TPIZ 1NRSH 3O8CA 2ZF0H 2TIOA 1TGCA 4DIHH 2Y5FA 2G52A 4K60A 4CH2B 1O2OA 1PPBH 2Q6FA 2FO9A 1FY4A 1GBMA 2BLVA 2TGDA 4O9VA 1AU8A 1MZDA 2G55A 4K3JA 1LVOA 5FHTA 1HAZB 2PSYA 3U1IB 4IC5A 5EXLA 2GCTC 3IITA 4O97A 3OY5U 1Y3WA 4MPUA 1OWDA 2XNIA 3BF6H 3MHWU 4KTSA 3UWJH 2J9NA 2K1QA 4ZHMU 1XXDA 4XSKU 1GJ4H 1HCGA 1LCYA 1C5XB 4WMDA 1EP6A 4FUJA 4E7NA 2ASUB 1P06A 1TA6A 1EXFA 1TQ7B 1CU1A 1EOJA 1V2WT 3BEFB 2GT7A 1WUNH 1KYNA 2QXGA 1WBGB 3QGJA 1GPZA 1QRZA 2PKSC 3HK6B 3P8FA 3SZNA 3BTFE 2BLWA 4D9QA 1OS8A 1PPFE 3SN8A 1AVWA 1P2IA 2BXUH 3VB7A 4YOJA 5EQSA 2ZFPH 1HDTH 2ANWA 4DW2U 2FI4E 3M3VA 2W7UA 1F92A 1BBRH 5CE1A 5DP3A 2ZDKA 5EQQA 3RXVA 2H9EH 2AS9A 4CREA 2FTLE 4UEHH 3ZZ5A 4LZ4B 2F91A 3V7TA 3HPTB 2H1UA 5A8XA 2XC0A 4Y10E 3NUMA 3ESTA 3NK8A 1XX9A 1KTTB 5AVDA 3I77A 3OYPA 1TNHA 1AUJA 2ZO3H 1RGQA 4ZUHA 4X6MA 1GHXH 4D76A 3AW1A 1HUTH 1CBWB 5GCHG 1B5GH 1GBEA 1PFXC 3UREA 2C4FH 2BD4A 3MOCA 4GVUA 1ELCA 1AMHA 1MTWA 2IN2A 3GICB 3QGNB 3QZQA 4GCHG 1SGRE 3RDZA 1DS2E 1TPAE 3SJIA 1O2MA 1OP0A 1EJAA 1Y5AT 3MMGA 3BIVH 1GHBG 7LPRA 1K1LA 1RXPA 1A0LA 5FCRA 3SJ8A 1ZHPA 1J14A 3UIRA 3UNSA 2I6SA 1W7GH 1ZPZA 4WMEA 5GXPA 3O8BA 6CHAC 1EAWA 1M9UA 3OY6U 1ARCA 4ZHAA 1QRWA 2GDEH 4CRDA 2H9TH 4NCYA 5IDKA 4Y79A 4K2YA 1O3MA 1C9PA 2C8YB 8KME2 2BVRH 1F0SA 1V2OT 1ELFA 2HNTC 4ZXYH 5A2MH 3U98H 1TMTH 1SSXA 3PV4A 1IQJA 5EOKA 1GI3A 4JZEH 2Y80A 1GBKA 2ZTXA 4F4OC 1CA0B 2AGEX 8GCHF 1GJ9B 1SQAA 1QL9A 1K1MA 1TBQH 4INLA 1THPB 1ETTH 1P05A 2NU2E 1AIXH 1CT0E 4MQAA 2J2UA 2RDLA 2YNBA 1QQUA 2ZCLP 1GJ6A 1H8IH 4X6OA 2B5TB 1EP5A 5JBBS 1LVMA 2P3UB 1ZTKA 7GCHF 3T26A 1J9CH 1FNIA 1H1BA 2ZFRH 2G4TA 1DWEH 3SW2B 3PLBA 5T6FA 2FP7B 1HJAB 3A82A 2PUXB 3U69H 3G01A 1P10A 2O8MA 5JBAS 1B0FA 1AVXA 3STIA 3M37A 1KXDA 1ZHRA 1ZPCA 2BOHB 3ELAH 3H7OA 1BHXB 3ZZ3A 5JDUB 1QIXB 1FIWA 4MPWA 1C2MA 1DITH 2D8WA 4BAQB 1KSNA 5DP7A 3PMJA 3DD2H 1AKSB 4NWKA 1J8AA 1GCTC 1ZSJA 4X1SU 1XUGA 2XC5A 1H9HE 1GVLA 3EA7A 1Z1IA 1BOQA 3PYHA 4HGCA 3RXTA 1KLTA 1HXFH 1BTHH 4A1TA 5L6NH 1UTNA 3I29A 1TX8A 2AGIX 1SGDE 3SU2A 2TPIZ 2R9PA 3RXJA 4AG1A 3PMHB 1GBHA 3QDZB 1F2SE 2TGAA 1A5HA