1MZAA

Crystal structure of human pro-granzyme k
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
240
structure length
240
Chain Sequence
MEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDAGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pro-granzyme K
publication title The 2.2-A Crystal Structure of Human Pro-granzyme K Reveals a Rigid Zymogen with Unusual Features
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzaA01
1HAOH 1TBRH 1TPSA 2JH0D 2LPRA 2ZHDA 3KF2A 3QN7A 1LCYA 1GBJA 7GCHG 4ZUHA 1HAZB 1DPOA 1O33A 4XBCA 3SGAE 1UTKA 2R9PA 2PLXA 2VNTA 1KXAA 1IQMA 3LH1A 1GJ8B 2P94A 1BRCE 1TAWA 1TBZH 1SOZA 3OTJE 2AIPA 1TNGA 1O3OA 3FZZA 1O2JA 1QBOA 1KSNA 1X7AC 2EI7A 5SGAE 1C5UA 2K1QA 2BDCA 5EG4A 2STAE 4X1QU 2P8OC 1PPEE 3ZZ6A 3E90B 2R2MB 1E36B 1NRPH 1XUIA 1CSOE 1KTTB 1XXFA 1LHGH 3UY9A 4LOYH 2LNCA 1O2XA 1BBRE 1L2EA 3ZV8A 1PQAA 2C8ZB 3Q3XA 3RXGA 1S5SA 3F9HA 1W14U 3VEQB 1HUTH 1CGHA 4NFFA 1QTFA 3TIUA 1J17T 1Q2WA 1A0HB 3LJJA 3LDXH 3WY8A 4Y0ZE 5TCCA 3MNCA 2Z6BD 1K2I1 2SGDE 3S7KB 2XNIA 2ZCHP 3QZRA 4X6NA 3U9AH 3GOVB 1IHSH 4B2BA 1LHDH 1GHWH 1NPMA 4I8HA 1ELAA 4OGYA 4Q80A 1IQNA 1A0JA 2RA0A 1W13U 2BLVA 3SGQE 3F68H 2BB4A 2XBXA 4ABEA 1BRUP 1UO6A 1EAIA 5G4BA 2BDBA 3LGWA 2VJ1A 1T8NA 2ALVA 3T26A 1VCQA 4I33A 2OC7A 3MI4A 2Z9IA 3HKIB 2ZU4A 1GMHG 3LGIA 4ZKRU 1KLTA 1JXPA 4F49A 4UDWH 1OOKB 3UWJH 1RS0A 4ISHH 1Q31A 1ELTA 1QB1A 2AERH 2ZC9H 2UUJB 3B9FH 4JCNA 1SGDE 1UTOA 3UOUA 2OD3B 2CMYA 2NU3E 1G30B 3SZNA 3LGVA 1JMOH 1QA7A 1DWEH 1GJBB 2QF3A 3KEEA 3RUOA 5L6NH 3SU5A 4IC6A 2VWOA 1V2LT 2FLBH 2Q1JA 1TONA 3Q00A 2Q6FA 3UREA 1V2UT 1Y3WA 1C2GA 1Z6JH 3MHWU 1LQDB 4X1PU 3SHAH 2ZZUH 4E7NA 4I8KA 2HNTC 4FUBA 1ZOMA 4UFGH 2OXSA 3BTME 2NU0E 4Y8XA 1AWFH 1A1RA 1PPHE 1FY5A 3SORA 1LVYA 3Q77A 1MTSA 3KCGH 1GMCF 3GCTF 1D3DB 2Y82A 1EPTA 4X8TH 1PJPA 1ELEE 4K8BA 3A88A 3RC6A 2RCEA 4K1SA 1MCVA 2H2ZA 4MNXA 2P93A 5JB8S 1GBKA 2PTNA 4CH8B 2CHAB 4KP0A 2TPIZ 4YLUA 1AKSB 5T6GA 1UTLM 1C5MD 1T4VH 5FAHA 1O3NA 1CHGA 1ZHPA 1H1BA 4I8GA 3TK5A 1ELGA 4MTBA 1Y5UT 3OU0A 4UFFH 1GCTB 5DP7A 2AGGX 3UR9A 4YOIA 1SQAA 1C1MA 2FTMA 3P8FA 2W7SA 5BPEA 1QL9A 2PGQB 3KQEA 4O9VA 1DLKB 2C8WB 2TGAA 5BRRE 3MU1A 4RN6A 3M5NA 1TOCB 3P8OA 3PLPA 1DWCH 1QIXB 1P10A 2WPIS 2NU4E 1YCPM 1G3CA 4A1TA 4NZQA 2UUFB 3NWUA 2ALPA 1W0ZU 1L1JA 2G8TA 5AVDA 1AWHB 2C93B 3RU4D 3RXCA 1GHVH 1P9UA 1HGTH 1FMGA 1Y3YA 1C1VH 1C5QA 2BX3A 2ZP0H 2VH6A 5E0GA 1P03A 2ZQ1A 1ANEA 1CA0C 2BY7X 4GCHF 1V2ST 4RKOB 2DE9A 1ZJDA 1WOFA 3T28A 1RJXB 1FN8A 1ZMJA 1V2PT 1AUTC 3P92A 4U32A 2ZPSA 1ZTLA 1GDQA 1TBQH 1P04A 1SGTA 2DUCA 1OYTH 4IN2A 2QYIA 1UK2A 4X1NU 3EGKH 3M7UA 3OY6U 1P09A 2A7CA 2B9LA 1Y3XA 1KLJH 2O8LA 1SLXB 3S69A 3K9XB 2FI5E 5LPRA 1GJ4H 4MDSA 5JPMH 4YO9A 3ENSB 4BAHB 6GCHG 3MYWA 2GV6A 1ESTA 4KELA 4A1VA 3O8CA 2FESH 1A46H 1E34B 3FP7E 1IQLA 5ESTE 5F03A 1FIWA 5EODA 1CHOF 3T2NA 1FIZA 3EYDA 1GBEA 4R8TB 4B74A 3RXUA 2IPHA 3TK6A 4JZEH 1MTNB 2OLGA 2HPPH 1MAYA 1TPPA 1VCPA 2QAAA 3KIDU 3MH5A 5HM2A 1YLCA 3ZZDA 1L0ZA 1O2NA 1HV7A 1YCPK 2CV3A 1SC8U 1O5FH 1AE8H 4YT6H 2ZFPH 4Y0YE 2ZKSA 4OS2A 4NFEA 1P05A 1FONA 5A8ZA 3SNBA 1PPCE 5JBAS 1GHAG 4AOQA 3BTFE 3H7TA 2XC0A 4CH2B 4GPGA 1F5RA 3KL6A 4AORA 3TU7H 1LHEH 3PMJA 3PO1C 6LPRA 5AHGH 2FWWA 4FU7A 3EQ0H 4BAKB 1WV7H 1XVMA 1SLUB 1KXBA 1FPCH 1G3EA 1FY4A 5EW1H 1GPZA 1DT2A 3TNSA 1EZUC 2VVUA 3D49H 5C1YA 2JKHA 1EP5A 2A2QH 1FY8E 4AZ2B 4FVBA 2Y5GA 3P95A 3ZZ3A 1MU8B 1DY8A 1SL3A 3V3MA 4H6SB 1ZGVA 2VIVA 1P02A 3DD2H 1MBQA 2GMTB 3HK3B 1YYY1 1UVOA 1TX8A 2P3UB 3A7TA 1CHOG 1TRMA 3ZVCA 4FU8A 2VIDA 2BXUH 1WBGB 1P3EA 1MAXA 1NRQH 1QJ1B 2BDAA 2OUAA 1O3KA 1Y5AT 4FUEA 3R3GB 1TOMH 4A5TS 2A2XH 1QQ4A 2ZCLP 5C5OA 3SJ9A 2O8MA 2SNWA 4Y8YA 1MQ6A 1TIOA 2VWLA 4Y71A 4A6LA 1W3CA 1YPKH 3GCHB 4I8JA 1AMHA 2Y6TA 7ESTE 1K1NA 1JBUH 1O2TA 2PKSB 1V2NT 2KAIA 1C4Y2 2XCNA 2F9UA 3RU4T 5DP9A 2QCYA 3VXEH 4ZKNU 1F0TA 1C9PA 1OP8A 4LK4A 5EQQA 4ZKSU 1P01A 1DOJA 5I46H 2SNVA 2FIRH 5T6FA 1HIAA 1TNKA 3O8DA 4Q7YA 2O9QA 3ZZ9A 1MTVA 2OTVA 5C5NA 2OBQA 4GHTA 4A7IB 1C1NA 3LGTA 4YESB 1MQ5A 2AEIH 3FFGA 3RXSA 3STJA 4ASHA 1MMJN 1MTUA 3RXKA 1M9UA 3BTQE 2BQ7B 1DUAA 1GHBG 1V6DA 3NPSA 1FZZA 4Y7AA 4WWYA 1AI8H 4HFPB 3DHKH 1O2IA 5DP5A 4CBNA 2QXIA 2P95A 1A3EH 1EAWA 3GDVA 2FLRH 2PKAB 3BTKE 2ULLA 3AW1A 2QN5T 4ZAEA 4K2YA 3B8JA 3E6PH 1Z6EA 1XUGA 1TB6H 3T29A 1A5IA 2UUKB 1TALA 1QQUA 3E0PB 3PWBA 1PPZA 1KY9A 2VWNA 4MVNA 4WMEA 3SU1A 4I7YH 2WUBA 1SG8B 1JRSA 1C5ZB 2BLWA 3MH6A 4CR9A 4ZHMU 2B7DH 1KXCA 4B2AA 1UVSH 3SNAA 4D7FA 3RXHA 3M61U 5FCKA 4WH6A 1ZMNA 5EGMA 3NXPA 4BTTB 1BTXA 4NCYA 3L6PA 1FV9A 1SVPA 3MOCA 1C2JA 4INLA 1YPGH 1DM4B 2IJOB 2FS8A 4H42U 3U98H 1O2LA 4JK5A 1NC6A 2J34A 1ZHRA 2WV4A 3LIWA 1QB9A 2G55A 3A7XA 3QTOH 3V12A 4UFEH 3TLOA 1WQVH 2WPLS 2Y5FA 3LH3A 1ZGIA 3A84A 2P8OB 3A7ZA 2F9OA 1AHTH 1H4WA 3BG8A 2BLOA 4Y7BA 2F9NA 1OYQA 4WY3A 3SOSA 1CT2E 3IWMA 2RDLA 1ID5H 5LPEA 3F1SB 1G37A 5EXMA 2ZGHA 1UJ1A 4X0WU 9ESTA 3A7VA 3FVFB 1W0YH 4JMYA 2BDHA 1DLEA 4ZHAA 1HFDA 3M37A 1TGCA 1ZPBA 1WU1A 2TBSA 2V3HH 3PTBA 1EAUA 1A61H 1F0RA 1YLDA 3DA9B 5FPTA 1TWXB 2B5TB 5B6OA 1GHYH 3UIRA 1DWBH 4BNRA 4LXBH 3SUDA 2Q6DA 1O3PB 2M5TA 4I8LA 1THSH 1W2KH 1BUIA 3SNEA 2ASUB 1UMAH 3ZZ7A 2WPKS 1D3QB 4CRBA 4ISLA 5AFYH 1GMDG 1O2OA 2ZPQA 5T6DA 1N1LA 1XKAC 2BY8X 3QLPH 1EPTC 7LPRA 3DUXH 1A4WH 2JH5D 2C3SA 1RFNA 7GCHF 1P2NA 2BOHB 5HXFA 4JZIA 2G4UA 1TGNA 4YT7H 5A2MH 1BT7A 1G2LA 5C3NA 1HCGA 4H6TA 1QCPA 3PMHB 1IQEA 1BIOA 3TJUA 4D8NA 3A7WA 2GZ8A 5GCHF 4DCDA 1GBMA 1TNIA 1FQ3A 1Z8JB 1O3MA 1FAKH 3U69H 1O2RA 2YNBA 2F9PA 4INKA 4RKJB 4UE7H 1WAYB 2NU1E 3RXEA 4FUIA 3H7OA 3NZIA 1G3BA 2ZNKH 2Y7XA 1SPJA 2GT8A 2CF8H 1ETTH 2TGDA 3SUGA 4WF8A 3BTGE 3ZZBA 3UNSA 1IQGA 2EEKA 1HPGA 4R0IA 1FPHH 3PWCA 4Y76A 5FPSA 1PYTD 2BD3A 1TE0A 1TX6A 4F4OC 1QHRB 3GY5A 4UONA 1BHXB 1D6RA 3BTDE 4ABBA 3EA9A 2FOAA 3RMLH 1AFEH 1PQ8A 1Y8TA 1GJDB 1TMTH 3BG4C 4A92A 3SQHE 4BTUB 1AUJA 2GP9B 2ZA5A 1W11U 2FP7B 1H9IE 1QB6A 2BDYA 2HOBA 1O2KA 2PSYA 3RXBA 2FO9A 3ZVGA 1SGCA 4VGCC 1E38B 4K69A 4H4FA 2TGPZ 1IQKA 2BYAX 1DSUA 5HYOA 2STBE 4X2WA 2VIOA 5JBTA 1GMHF 2ZHQH 2XYAA 3VB6A 3N7OA 4I31A 5GCHG 5ETXA 1HXEH 2VIPA 5IDKA 4X8UH 3GYLB 3SV9A 2YOLA 2ODPA 1XKBC 1YM0A 4BAQB 1PQ7A 5EXLA 4WH8A 1A7SA 3SV2H 1BTZA 1ZMLA 3M3VA 1J8AA 1ELCA 1HAVB 3U8OH 2BMGB 4NWLA 1UHBB 1K1MA 4ZH8A 1CU1A 2OINA 1BZXE 1XUHA 2QY0B 3GY7A 4TY7A 1HLTH 4JYUH 1TMBH 2ZQ2A 2A7JA 4Q7XA 2C90B 3GY3A 3LOXA 5EU8A 4RSPA 2ILNA 1HJAC 1C5YB 2HNTF 1C2KA 1CO7E 1SMFE 5DP6A 2EC9H 1YPEH 3GCNA 1CA0B 1F2SE 1ELFA 5EW2H 2XRCA 3URCA 3HATH 3M5MA 3TJNA 4ISIH 3OX7U 1GI0A 4O97A 4X6OA 2FEQH 3CS7A 1CT4E 2BD8A 2A4RA 5TCAA 2CN0H 1WQSA 1Y3VA 3QO6A 4WMDA 3VXFH 4IMQA 1LDTT 1RIWC 4MNVA 4Y8ZA 3SUFA 1GI9B 3KQBA 1MKXK 5GDSH 1CA8B 2FM2A 1AD8H 4CRCA 1NS3A 1OSSA 2Q6GA 3TGIE 1GI3A 4MLFB 4XDEA 1XMNB 3ZVBA 1OP2A 3EA8A 2VU8E 2ZTZA 2ODQA 3SJIA 2ZDAH 1K28D 4OS7A 2TGTA 5F8TA 1SI5H 1HAIH 5C20A 2AIQA 2BD2A 1O5EH 5GJ4B 1N8OC 1C5RA 1LHFH 1V2JT 4FUFA 4JK6A 4PROA 1GBLA 3BTTE 2OC8A 3M7TA 2GGVB 1FNIA 1J15A 2ZHWH 3M5LA 2ZIQH 5JDUB 1QJ6B 1EP6A 2GKVE 4HGCA 1G2MA 1BCUH 2A1DB 1YKTA 5A8YA 1O3DA 3A86A 2VVVA 4BTIB 5JBCS 5LGOA 4FUCA 1P57B 5LPFA 3PO1B 4CRFA 1AU8A 4X2YA 1C1QA 1GI2A 2FX4A 4TY6A 3UPEA 4BOHA 1OWJA 1FLEE 2HVXA 1QRWA 1LPGB 2FS9A 2VVCA 1EQ9A 3ZZAA 5GPIB 1ZPCA 4AGJA 1S0RA 2OC0A 2ZWLH 1Z1JA 1CGJE 1OWDA 1O2YA 1LO6A 4DJZB 1C1TA 1C1UH 4O03A 3PTNA 2BY6X 2V35A 5EQRA 1XX9A 2D26C 2FOHA 4X6PA 3SU3A 3RXDA 6GCHF 2AH4X 1DXPA 1FJSA 2AS9A 2QXJA 4I32A 1P2IA 4AFZA 4YTAA 4AG2A 1ZSLA 1O3JA 4ISNA 4ZXYH 3RXLA 1K22H 2FMJA 2JETC 1ABIH 1BMAA 3BEUA 3P70B 1GBIA 1BB0B 4DGJA 1ZHMA 1IOEA 2VIQA 3GCOA 4NA9H 3I77A 3STIA 3UQVA 2VB0A 4TWWA 1UTPA 2AGEX 2UWLA 1GBFA 1DXWA 1G32B 1QBNA 3S9AA 1GHAF 1ESBA 1TX7A 1AIXH 1ZRBA 3TITA 1BA8B 1HAYB 2V0BA 1OS8A 2BY9X 3RXPA 2XC4A 1FN6A 1AY6H 1LKAA 1D3PB 1VGCC 1WUNH 1YGCH 3FZDA 5E0HA 2Z3CA 1TABE 2GVFA 4FVDA 2ZFFH 3KQDA 5EXNA 2FX6A 1ORFA 3MO3A 2NU2E 1EUFA 4TYDA 4D76A 3S9CA 1THPB 4O3TA 4KTCA 1JIRA 5EQSA 5A0CA 4AFQA 1B7XB 1GCDA 3A8DA 1GDUA 3A87A 1MKXH 3RU4E 4HI3A 5FCRA 2EI8A 1VJ9U 1OWHA 1S84A 5I25A 2HPQH 1TRYA 1P9SA 1L4ZA 3GY6A 1SHYA 3W94A 5A0AE 2CF9H 3TGKE 1PFXC 1SGYE 1N6YA 2ZECA 4KTUA 3E1XB 1G9IE 1O5DH 1LQEA 4ABFA 3ZZ5A 2F91A 4MPVA 4AG1A 3T25A 1SGFG 2Z9JA 1OPHB 5FHTA 1FUJA 2ZHEH 2BD4A 3TGJE 2QF0A 2WPMS 1UCYH 2VGCC 1O3FA 3RXOA 3S7HB 1DUEA 2FOGA 1RTFB 1EZSC 5GXPA 1P2OA 3PROA 1ARCA 3E91A 2BQWB 4FUDA 4CRAA 1C2DA 3UWIA 3BF6H 2BOKA 2D1JA 1O36A 2ZGXH 1Z8RA 1MH0A 1B0EA 1O5CB 2A7HA 5L30H 3ELAH 1XVOA 2XWBI 3RDZA 2H9HA 1Y5BT 3A85A 1IQIA 1PPBH 1XUFA 3QGNB 1BRBE 3U1IB 1C2EA 1GJ9B 1HYLA 5F6MA 1O5AB 1Z8IB 1VITG 1W8BH 1AGJA 1GJ5H 1NRRH 2CXVA 2R2WU 4X6MA 3KGPA 3U8TH 1A5HA 1J14A 1ARBA 1MD8A 1KDQA 2XXLA 3BTHE 1GHBF 2PUXB 5HMAA 2PGBB 1NFUA 2A0QB 3RXAA 3T27A 2QGRA 2PR3A 3FANA 3PMBB 3ZVEA 2BX4A 4IS5A 2PFEA 1C1PA 2G00A 3PB1E 1W7GH 3U8RH 2G81E 3OSYA 4NWKA 9LPRA 3GICB 2ZFTA 4JYTA 1GG6C 2H9EH 1J16A 3ZYEA 3SHCH 1QL8A 4THNH 5F8XA 2AYWA 3FAOA 4IW4E 3C27B 2ZU5A 5EPNA 3V7TA 3MH4A 3P17H 4IC5A 4NIXA 2SGFE 2C4FH 1BMNH 2F83A 2GDEH 3FP6E 1BTUA 3Q3YA 3BIUH 1O39A 4X1SU 1C5PA 1CBWC 2H5CA 4Z0KA 2D2DA 3O8RA 5K0HA 1EPTB 1HJ9A 3MTYA 4ESTE 2FI4E 1O2QA 1ZTKA 2A4OA 2ANKH 2C8XB 4AN7A 2PV9B 2H1UA 2XW9A 2Z9GA 5E8EH 1YF4A 3TJVA 1ZRKA 2W3KA 4GHQA 3LGUA 2DE8A 3M3SA 3RC4A 1O3EA 2FYRA 4B2CA 1HAGE 3QTVH 3QX5H 5EPYA 8GCHG 3AAVA 1P2QA 4QT8C 2H5DA 2ZDNA 3VB7A 1UK4A 1BRAA 1ZSKA 1ELDE 2Z3EA 3F9FA 1PQ5A 2FI3E 1YPHC 2ZU3A 3A81A 3VFEA 1O3GA 2FZZA 3BN9A 1TQ0B 1S81A 4KGAA 2ZCKP 2ZGCA 4DY7B 1O3LA 4WJG2 1PYTC 2ZFQH 1MBMA 2FTLE 3F9EA 1HAVA 1ANBA 4X8SH 2CJIA 1DE7H 2PTCE 1BJUA 2TRMA 4DOQA 3SNDA 4LZ1H 3K6ZA 1INCA 1V2KT 5DJ7A 1C5XB 3ATMA 3BG4B 4JZFH 1YBWA 3W95A 5C2ZA 3SN8A 3A7YA 1SFQB 1G3DA 1O31A 2BQ6B 1C5NH 1C4U2 4XBBA 3QUMP 4WVPE 2Y7ZA 1GMDF 4GSOA 3SO3A 4VGCB 1EZQA 7KMEH 3RXFA 2PSXA 2FOMB 2W5EA 3TVJB 2BHGA 1DDJA 3SBKA 4B76A 4AFUA 3GDUA 1S0QA 2R0KA 1THRH 3ZYDA 1T8LA 5DG6A 2W7UA 3D23A 4BXWA 1W10U 1GBBA 1S85A 3L33A 5DKMA 3U1JB 4WXIA 1QRZA 1SB1H 3UFAA 1SLWB 1K9OE 2BD5A 1TPAE 2ZTXA 1F7ZA 1C1SA 1YPJH 4ABIA 1A5GH 5JB9S 2AMDA 4B71A 2A4QA 1NTPA 3OYPA 1Z1IA 5PTPA 8ESTE 4UD9H 3LKWA 3ZZ4A 1RD3B 1UVUH 2CGAA 1EB2A 4AB9A 4ZXXH 2C8YB 2WUCA 2SFAA 1DY9A 2Y80A 3ZZCA 4DW2U 2F3CE 1F92A 2GZ9A 4MPUA 3A8BA 3T62A 2IN2A 3UR6A 3ESTA 1KLIH 1F5LA 3PLKA 2BDGA 1HJAB 3RMOH 1LVBA 1DVAH 1UVTH 1SSXA 1K21H 1GBCA 4BAMB 1Z7KA 4NZLA 1E0FD 1NN6A 3GISB 1ZJKA 2VIWA 3ATIA 3LGYA 4ISOA 3SV8A 1OX1A 4U30A 1TNJA 3DFLA 1W12U 1V2VT 1JRTA 1TA6A 2BLQA 1GGDC 2H6MA 2OQUA 1DWDH 1RIWB 1IHTH 1PPGE 3I29A 5DGJA 1YPLH 3Q76A 1C9TA 3O8BA 1OWIA 2ZFSA 2BDIA 3NK8A 5FX5A 3BTWE 1O3CA 1BBRK 2ZGBH 4CBOA 1N6XA 2GD4B 1T32A 5J4SA 3HK6B 1AKSA 3SV7A 5C67A 1TYNA 2ZEBA 3ODDA 1C5OH 2ZG0H 4B1TA 4GAWA 3HGPA 1LPKB 2Z94A 3TNTA 4AYVB 1BMLA 1JWTA 3HPTB 1AB9C 4XE4A 3RLYH 2PHBA 4MNWA 4AGKA 1O38A 1N8OB 3ZV9A 2A5KA 3KN2A 1LVOA 1NU9A 5CHAC 1ZTJA 1AFQC 5GIBA 1GVKB 4B73A 2FOFA 1P11E 2P3FH 2J2UA 4K60A 1D6WA 1BTPA 3A8AA 2XBWA 1C5TA 3CS0A 3LPRA 3RXMA 1LVMA 4FU9A 4TWYA 2KAIB 2BD7A 4MNYA 2UWOA 1L4DA 1RTLA 2PUQH 1BITA 3E8LA 3ZZ8A 2QXGA 1RTKA 2WPJS 3AASA 3KQCA 4O3UA 1KXEA 1NZQH 2PW8H 4MG3A 1HAPH 5H4IB 4UEHH 1HIAB 5F8ZA 1CQQA 1YPHE 6CHAC 1ETRH 1K1IA 4NIVA 3SJOA 4K1EA 2SGQE 2ZU2A 1IQHA 1O5BB 2GCTC 2YNAA 5FPYA 5A09A 2RA3A 4DT7B 2HLCA 1SGQE 1BTYA 3HGNA 1EJMA 4DIIH 2WPHS 1TLDA 3M35A 2QV1A 2THFB 2FOBA 4Z6AH 2FDAA 2G5NA 1B5GH 3A80A 1BMMH 1T31A 3BIVH 4BAOB 1C5VA 2G52A 3MO6A 1C5WB 2BY5X 1KYNA 1V3XA 2A5AA 5C1UA 1Z71A 2JETB 1RGQA 3TH2H 1WTHD 1NFWA 4Q7ZA 4CHAC 1EASA 3V13A 1C5SA 2A4GA 4IN1A 1K1JA 3L3TA 2WYJA 3SUEA 3A89A 4GLYA 1GBHA 1WCZA 1P2JA 4JZ1A 2B8OH 3S0NA 2WINI 1SLVB 1AO5A 3A8CA 1GJ6A 1BHXF 3VGCC 2A45B 1VGCB 4Y79A 3SU6A 1C1RA 3EAJA 4WXVA 1KTSB 1CGIE 1EAXA 3MU5A 2BVSH 1HJ8A 1OXGA 4J2YB 1OWKA 2XTTB 1QY6A 4ZHLU 1AZ8A 1GJAB 4E7RG 1MU6B 1O3HA 3MNXA 3RMNH 3NKKA 1SBWA 1BBRH 1O30A 3VPKA 2J92A 1D4PB 1BJVA 1YPMH 4YM9A 3D65E 1WSSH 1GJ7B 4ABHA 4NG9H 2GX4A 2EI6A 1V2WT 2ZDLA 1P06A 4OS5A 1FAXA 1ELBA 5ESBA 2Z9KA 3RMMH 2ZU1A 1LTOA 5JBBS 1AQ7A 1OP0A 1TGTA 1GHXH 1TFXA 3E3TA 5LH8A 2P59A 5K7RA 1P3CA 3ODFA 2BVXH 3A82A 2ZTYA 3BV9B 2HGTH 3LJOA 1KIGH 1MUEB 1O0DH 4CREA 1UCYK 2VGCB 2FYQA 1EX3A 1EXFA 1GI4A 1F0UA 1AN1E 1HRTH 2ZHFH 2XBYA 3NUMA 2FXRA 1C2IA 1L1NA 1OWEA 1TGBA 5FBIA 4UFDH 3ATKA 3S9BA 1NROH 3BEIB 1UVPA 3LU9B 4GUXA 3UUZA 3PMAB 4X2XA 1K1OA 1DANH 2UUYA 4B75A 1O2GH 2OCVB 3M36A 3SU4A 2QC2A 3UTUH 2D8WA 1BTWA 3RC5A 4IMZA 1EATA 3A83A 2J94A 1EOJA 2O8UA 2TIOA 1JOUB 1P2MA 3LT3A 8LPRA 1TRNA 1DSTA 2BTCE 4BANB 1S6HA 5TJXA 1AVXA 1O2VA 4NA8A 3VB3A 3TJOA 3RXQA 2GZ7A 3AAUA 3F6UH 1T8OA 1CE5A 5FX6A 2Z7FE 1AZZA 2H9TH 3QK1A 5DP8A 1MCTA 3MU0A 4INHA 2I6QA 1GG6B 1TNHA 2Z3DA 3RXIA 1H9LB 3ZVAA 3PLBA 2PKAA 1W7XH 3EE0B 2A32A 5A8XA 4JZDH 2OBOA 1LPZB 1GL0E 3G01A 1GDNA 3B23B 3TH3H 2A31A 2ZFRH 1YC0A 2ZDKA 1CBWB 3BEFB 3EDXB 1ZSJA 4U01A 1P0SH 3SQEE 4AYYB 4YOJA 4K1TA 4X1RU 3ATLA 1ANDA 3TH4H 1S6FA 3QDZB 1C4V2 1O35A 1F0SA 1BTHH 2O8TA 2NWNA 2WV5A 5ABWA 1GMCG 3GCTG 2J38A 4YZUA 1SGEE 1MTWA 4OS1A 1NU7B 1C1WH 1MZAA 2HWLB 5GWZA 3JZ1B 1MKWK 1FDPA 1EB1H 4HZHA 1VITF 3C1KA 1C5LH 1GBTA 4KKDA 1UCYE 3RXRA 1GHZA 3M7QA 1HAHH 3RXVA 1T8MA 2XBVA 4AB8A 2HALA 1VCWA 1QGFA 3MFJA 1LMWB 4NGAH 4XFQA 3RLWH 1YP9A 3SW2B 1O5GH 1SR5C 2ANYA 1TGSZ 1PPFE 2VWMA 1S83A 4OS4A 4YOGA 4ABDA 2ZGJA 3ZVDA 2FODA 5L2ZH 2XCFA 1BDAA 3UNQA 4OS6A 2GTBA 3M3TA 4M7GA 1NESE 5AF9H 3RP2A 4AX9H 3ZVFA 1GJCB 3VB4A 1P12E 1SQOA 1XXDA 1Q3XA 3VB5A 4FXGH 2Y81A 3I78A 5AFZH 1GI7B 1DX5M 4ZMAH 3Q3KA 3MU4A 2J95A 1U6QA 1O37A 1TA2A 1IAUA 3DT0H 3CP7A 4IGDA 4GCHG 1D3TB 3SU2A 1TPOA 5FXLA 2GCHF 2OP9A 2VINA 5J4QA 2VH0A 3IITA 3MWIU 1J9CH 2FOEA 2JH6D 1H8IH 3UQOA 1NY22 4YLQH 1QBVH 2Z9LA 2CHAC 3SI4H 4LZ4B 3BTEE 1XUJA 5L2YH 1SOTA 1GI6A 1GI8B 8GCHF 4NSYA 1QJ7B 4FUJA 1FY3A 1P2KA 4E06H 1S82A 1E35B 1GL1A 1WTGH 3GY4A 1T4UH 1NO9H 4AFSA 2HNTE 1V2OT 4Q2KA 1H8DH 4ABGA 2W3IA 1GCTC 2HRVA 4X2VA 5DK1A 1HBTH 1HDTH 2FOCA 3K65B 5E0JA 2P3TB 3R0FA 1C1OA 3LC3A 3ATWA 4JYVH 3SJKA 5DPAA 4SGAE 3TPIZ 2G5VA 4Y10E 1ZLRA 1V2QT 5HGGA 1O2WA 1V2MT 2BM2A 1ZZZA 1V2TT 2Y5HA 1AVWA 3AVZA 1O2SA 2PWXA 1QR3E 1TNLA 3PM3A 2ZO3H 1ZR0A 1O2HA 3P8NA 1GGDB 2F9BH 1EJNA 1EOLA 2R3UA 2GCHG 3P8GA 4MQAA 1P8VC 5DP4A 3K2UA 4D9QA 6ESTA 2FPZA 1AE5A 3V0XA 1O34A 3M5OA 4MPWA 4ZKOU 1RXPA 1DITH 4U2WA 1MKWH 1A0LA 2ANWA 3SU0A 1UTNA 4CRGA 5CE1A 3D62A 1TQ7B 1AB9B 1IQFA 2XWAA 1O2PA 2EA3A 3MNSA 2BD9A 1SGIB 3P6ZB 1EJAA 1O2ZA 2UWPA 3QGJA 4DVAU 1DICA 5DP3A 5CHAB 1AFQB 1V2RT 1MZDA 1BQYA 3E16B 2BZ6H 3PV4A 4NIWA 1UHBA 1A2CH 2GT7A 2J9NA 2J4IA 1QURH 5CMXH 1C2FA 1SHHB 3GDSA 1K1PA 1Y59T 3RM2H 1D9IA 1O3AA 1MTNC 5E2PA 4ABAA 1LHCH 1JIMA 3RXJA 3UNRA 3PYHA 1O2UA 1GVLA 1O2MA 1QRXA 1YCPH 2QIQA 2R0LA 4GVUA 4BXSA 5IYTA 2BZAA 1ABJH 1FY1A 2ESTE 3FP8E 5FBEA 1SFIA 6CHAB 2OQ5A 1NFXA 4XSKU 3URDA 4OGXA 1A3BH 1XM1A 2P16A 1HNEE 2GCTB 4K8YA 1MD7A 5E2OA 1ETSH 2AMPA 2QXHA 2ZPRA 2BVRH 4D9RA 4Y6DA 2GV7A 3OY5U 1GVZA 1UTMA 4TPIZ 1B0FA 1T7CA 1E37B 5DO4H 3AW0A 2F9VA 2RG3A 1ZYOA 2V3OH 2G51A 4E05H 1K1LA 1ELVA 2AGIX 3IG6B 3ITIA 4K3JA 2ZDMA 1SQTA 2XC5A 2WYGA 1O3IA 4NIYA 1IQJA 1GWAA 2OC1A 4CHAB 2GMTC 2SGPE 3SJ8A 1SGFA 3QZQA 3TK9A 3BSQA 1XUKA 1SGNE 4KTSA 1NFYA 2G4TA 3LC5A 2SGEE 1L1GA 1UTJA 1QNJA 1C2MA 3F9GA 1BOQA 1C2LA 1GBAA 3VGCB 1H9HE 1SGPE 1FXYA 1OKXA 1CT0E 1UTQA 1VZQH 2GDDA 1DS2E 3KNXA 5EOKA 3GCHC 2ZDVH 5JYIA 2AMQA 2PKSC 1NT1A 3QWCH 4FUGA 2ANMH 4XBDA 3UOPA 1GI1A 3MU8A 1DFPA 1FI8A 2ZF0H 5HM9A 4WMFA 3T5FH 2B0FA 4MPXA 3MNBA 1HXFH 3RM0H 1GI5A 4HTCH 1NM6A 1HAXB 2A5IA 1RRKA 3HKJB 3H5CB 3SNCA 2ZI2H 3EA7A 3CENA 1O32A 1QFKH 2R3YA 1EZXC 1KDQB 3JZ2B 1VR1H 4Y11E 1VITH 4XOJA 4DURA 3SV6A 1LKBA 5A0BA 1WYKA 1Y3UA 3SI3H 3K6YA 2ODYB 1GBDA 1AVGH 1QA0A 5C1XA 1SGRE 2SGAA 1UK3A 4ABJA 1EKBB 4CRDA 3MH7A 3E0NB 3GY8A 1VJAU 4CR5A 3KHVA 4IBLH 2IOTA 4SGBE 4NSVA 1QL7A 1NRNH 4DG4A 2W26A 3MO9A 1ESAA 4D7GA 1O3BA 1HB0B 2V6NA 3NCLA 1ZPZA 1Z8GA 3SGBE 4DIHH 1TMUH 4ZROA 3DFJA 2O8WA 8KME2 1CVWH 1ANCA 4TPYA 4NA7A 2I6SA 1C2HA 2AFQB 1ACBE 5T3HA 3RXTA 3GY2A 1KXFA 1F5KU 3GYMA 4A1XA 2BXTH 4X8VH 2QA9E 3MMGA 4J1YA 4FUHA 3LONA 1NRSH 1G36A 1KXDA 4K5ZA
chains in the Genus database with same CATH superfamily
1HAOH 1TBRH 1TPSA 2JH0D 2LPRA 2ZHDA 3KF2A 3QN7A 2HVYB 1LCYA 1GBJA 7GCHG 4ZUHA 1HAZB 3PV5A 1DPOA 1O33A 4XBCA 3SGAE 1UTKA 2R9PA 5C17A 1E79D 2PLXA 2VNTA 1KXAA 1IQMA 3LH1A 1GJ8B 2P94A 1BRCE 1TAWA 1TBZH 1SOZA 3OTJE 2AIPA 1E1QD 1O3OA 1TNGA 2IJD1 3FZZA 1O2JA 1QBOA 1KSNA 1X7AC 2EI7A 5SGAE 1C5UA 2K1QA 2BDCA 5EG4A 2STAE 4X1QU 2P8OC 1PPEE 3ZZ6A 3E90B 2R2MB 1E36B 2VBCA 1NRPH 5EJ1A 1XUIA 1CSOE 1KTTB 1XXFA 1LHGH 3UY9A 4LOYH 2LNCA 1O2XA 1BBRE 1L2EA 3ZV8A 1PQAA 2C8ZB 3Q3XA 3RXGA 1S5SA 3F9HA 1W14U 3VEQB 1HUTH 1CGHA 4NFFA 1QTFA 3TIUA 1J17T 1Q2WA 1A0HB 3LJJA 3LDXH 3WY8A 4Y0ZE 5TCCA 3MNCA 2Z6BD 1K2I1 2SGDE 3S7KB 2XNIA 2ZCHP 3QZRA 4X6NA 3U9AH 3GOVB 1IHSH 4B2BA 1LHDH 1GHWH 1NPMA 4I8HA 1ELAA 4OGYA 4Q80A 1IQNA 1A0JA 2RA0A 1W13U 2BLVA 3SGQE 3F68H 2BB4A 2XBXA 4ABEA 1BRUP 1UO6A 1EAIA 5G4BA 2BDBA 3LGWA 2VJ1A 1T8NA 2ALVA 3T26A 1VCQA 4I33A 2OC7A 3MI4A 2Z9IA 3U28C 3HKIB 2ZU4A 1GMHG 3LGIA 4ZKRU 1KLTA 1JXPA 4F49A 4UDWH 1OOKB 3UWJH 1RS0A 4ISHH 1Q31A 1ELTA 1QB1A 2AERH 2ZC9H 2UUJB 3B9FH 4JCNA 1SGDE 1UTOA 3UOUA 2OD3B 2CMYA 1FX0B 2NU3E 1G30B 3SZNA 3LGVA 2JDID 1JMOH 1QA7A 4ACAA 1DWEH 3WWFA 1GJBB 2QF3A 3KEEA 3RUOA 5L6NH 3KQ5A 3SU5A 4IC6A 2VWOA 1V2LT 2FLBH 2Q1JA 1TONA 3Q00A 2Q6FA 4Z1MD 3UREA 1V2UT 1Y3WA 1C2GA 1Z6JH 3MHWU 1LQDB 4X1PU 3SHAH 2ZZUH 4E7NA 4I8KA 5C0TA 2HNTC 4HG6A 4FUBA 1ZOMA 4UFGH 3VG8A 2OXSA 3BTME 2NU0E 4Y8XA 1AWFH 1A1RA 1PPHE 1FY5A 3SORA 1LVYA 3Q77A 1MTSA 3KCGH 1GMCF 3GCTF 1D3DB 2Y82A 4FOUC 1EPTA 4X8TH 1PJPA 1ELEE 4K8BA 3A88A 3RC6A 2RCEA 4K1SA 1MCVA 2H2ZA 4MNXA 2P93A 5JB8S 1GBKA 2PTNA 4CH8B 2CHAB 4KP0A 2TPIZ 4YLUA 1AKSB 5T6GA 1UTLM 1C5MD 1T4VH 3SZEA 5FAHA 1O3NA 1CHGA 1ZHPA 1H1BA 4I8GA 3TK5A 1ELGA 4MTBA 1Y5UT 3PV2A 3OU0A 4UFFH 1GCTB 5DP7A 2AGGX 3UR9A 4YOIA 1SQAA 1C1MA 2FTMA 3P8FA 2W7SA 5BPEA 1QL9A 2PGQB 3KQEA 4O9VA 1DLKB 2C8WB 2TGAA 5BRRE 3MU1A 4RN6A 3M5NA 1TOCB 3P8OA 3PLPA 1DWCH 1QIXB 1P10A 2WPIS 2NU4E 1YCPM 1G3CA 4A1TA 4NZQA 2UUFB 3NWUA 2ALPA 1W0ZU 1L1JA 2G8TA 5AVDA 1AWHB 2C93B 3RU4D 3RXCA 1GHVH 1P9UA 1HGTH 1FMGA 1Y3YA 1C1VH 1C5QA 2BX3A 2ZP0H 2VH6A 2IPQX 5E0GA 1P03A 2ZQ1A 1ANEA 1CA0C 2BY7X 4GCHF 1V2ST 4RKOB 2DE9A 1ZJDA 1WOFA 3T28A 3N99A 1RJXB 1FN8A 1ZMJA 1V2PT 1AUTC 2PP6A 3P92A 4U32A 2ZPSA 1ZTLA 1GDQA 1TBQH 1P04A 1SGTA 2DUCA 1OYTH 4IN2A 2QYIA 1UK2A 4X1NU 3EGKH 3M7UA 3OY6U 1P09A 2A7CA 2B9LA 1Y3XA 1KLJH 2O8LA 1SLXB 3S69A 3K9XB 2FI5E 5LPRA 1GJ4H 4MDSA 5JPMH 4YO9A 3ENSB 4BAHB 6GCHG 3MYWA 2GV6A 1ESTA 4KELA 4A1VA 3O8CA 2FESH 1A46H 1E34B 3FP7E 1IQLA 5ESTE 5F03A 1FIWA 5EODA 1CHOF 3T2NA 1MABB 1FIZA 3EYDA 1GBEA 4R8TB 4B74A 1UW7A 3RXUA 2IPHA 3TK6A 4JZEH 1MTNB 2OLGA 2HPPH 1MAYA 1TPPA 1VCPA 2QAAA 3KIDU 3MH5A 5HM2A 1YLCA 3ZZDA 1L0ZA 1O2NA 1HV7A 5FL7D 1YCPK 2CV3A 1SC8U 1O5FH 1AE8H 4YT6H 2ZFPH 4Y0YE 2ZKSA 4OS2A 4NFEA 1P05A 1FONA 5A8ZA 3SNBA 1PPCE 5JBAS 1GHAG 4AOQA 3BTFE 3H7TA 2XC0A 4CH2B 4GPGA 1F5RA 3KL6A 4AORA 3TU7H 1LHEH 3PMJA 3PO1C 6LPRA 5AHGH 2FWWA 4FU7A 3EQ0H 4BAKB 1WV7H 1XVMA 1SLUB 1KMHB 1KXBA 1FPCH 1G3EA 1FY4A 5EW1H 1GPZA 1DT2A 3TNSA 1EZUC 2VVUA 3D49H 5C1YA 2JKHA 1EP5A 2A2QH 1FY8E 4AZ2B 4FVBA 2Y5GA 3P95A 3ZZ3A 4YXWD 1MU8B 1DY8A 1SL3A 3V3MA 4H6SB 1ZGVA 2VIVA 1P02A 3DD2H 1MBQA 2GMTB 3HK3B 1YYY1 1UVOA 1TX8A 1SKYE 2P3UB 3A7TA 4RT1A 1CHOG 1TRMA 3ZVCA 4FU8A 2VIDA 2BXUH 1WBGB 1P3EA 1MAXA 1NRQH 1QJ1B 2BDAA 2OUAA 1O3KA 1Y5AT 4FUEA 3R3GB 1TOMH 4A5TS 2A2XH 1QQ4A 2ZCLP 5C5OA 3SJ9A 2O8MA 2SNWA 4Y8YA 1MQ6A 1TIOA 2VWLA 4Y71A 4A6LA 1W3CA 4P02A 1YPKH 3GCHB 4I8JA 1AMHA 2Y6TA 7ESTE 1K1NA 1JBUH 1O2TA 2PKSB 1V2NT 2KAIA 1C4Y2 2XCNA 2F9UA 3RU4T 5DP9A 5HIYA 2QCYA 3VXEH 4ZKNU 1F0TA 1C9PA 5HKKD 1OP8A 4LK4A 5EQQA 4ZKSU 1P01A 1DOJA 5I46H 2SNVA 2FIRH 5T6FA 1HIAA 1TNKA 3FN8A 3O8DA 4Q7YA 2O9QA 3ZZ9A 1MTVA 2OTVA 5C5NA 2OBQA 2CK3D 4GHTA 4A7IB 1C1NA 3LGTA 4YESB 1MQ5A 2AEIH 3FFGA 3RXSA 3STJA 4ASHA 1MMJN 1MTUA 3RXKA 1M9UA 3BTQE 2BQ7B 1DUAA 1GHBG 1V6DA 3NPSA 1FZZA 4Y7AA 4WWYA 1AI8H 4HFPB 3DHKH 1O2IA 5DP5A 4CBNA 2QXIA 2P95A 2F43B 1A3EH 1EAWA 3GDVA 2FLRH 2PKAB 3BTKE 2ULLA 3AW1A 2QN5T 4ZAEA 4K2YA 3B8JA 3E6PH 1Z6EA 1XUGA 1TB6H 3T29A 1A5IA 2UUKB 1TALA 1QQUA 3E0PB 3PWBA 1PPZA 1KY9A 2VWNA 4MVNA 4WMEA 3SU1A 4I7YH 2WUBA 1SG8B 3MQKC 2QF4A 1JRSA 1C5ZB 2BLWA 3KYFA 3MH6A 4CR9A 4ZHMU 2B7DH 1KXCA 4B2AA 1UVSH 3SNAA 4D7FA 2KCPA 3RXHA 3F2GA 3M61U 5FCKA 4WH6A 1ZMNA 5EGMA 3NXPA 4BTTB 1BTXA 4NCYA 3L6PA 1FV9A 1SVPA 3MOCA 1C2JA 4INLA 1YPGH 1DM4B 2IJOB 2FS8A 4H42U 3U98H 1O2LA 4JK5A 1NC6A 2J34A 1ZHRA 2WV4A 3LIWA 1QB9A 2G55A 3A7XA 3QTOH 3V12A 4UFEH 3TLOA 1WQVH 2WPLS 2Y5FA 3LH3A 1ZGIA 3A84A 5EIYA 2P8OB 3A7ZA 2F9OA 1AHTH 1H4WA 3BG8A 2BLOA 4Y7BA 2F9NA 1OYQA 4WY3A 3SOSA 1CT2E 3IWMA 2RDLA 1ID5H 5LPEA 3F1SB 1G37A 5EXMA 2ZGHA 1UJ1A 4X0WU 9ESTA 3A7VA 3FVFB 1W0YH 4JMYA 2BDHA 1DLEA 4ZHAA 1HFDA 3M37A 1TGCA 1ZPBA 1WU1A 2TBSA 2V3HH 3PTBA 1EAUA 1A61H 1F0RA 1YLDA 3DA9B 5FPTA 1TWXB 2B5TB 5B6OA 1GHYH 3UIRA 1DWBH 4BNRA 4LXBH 3SUDA 2Q6DA 1O3PB 2M5TA 4I8LA 1THSH 1W2KH 1BUIA 3SNEA 2ASUB 1UMAH 3ZZ7A 2WPKS 1D3QB 4CRBA 4ISLA 5AFYH 1GMDG 1O2OA 2ZPQA 5T6DA 1N1LA 1XKAC 2BY8X 3QLPH 1EPTC 7LPRA 3DUXH 1A4WH 2JH5D 2C3SA 1RFNA 7GCHF 1P2NA 2BOHB 5HXFA 3OAAD 4JZIA 2G4UA 1COWD 1TGNA 4YT7H 5A2MH 1BT7A 1G2LA 5C3NA 1HCGA 4H6TA 1QCPA 3PMHB 1IQEA 1BIOA 3N7DA 5F53A 3TJUA 4D8NA 3A7WA 2GZ8A 5GCHF 4DCDA 1GBMA 4B6EA 1TNIA 1FQ3A 1Z8JB 1O3MA 1FAKH 3U69H 1O2RA 2YNBA 2F9PA 4INKA 3H09A 4RKJB 4UE7H 1WAYB 2NU1E 3RXEA 4FUIA 3H7OA 3NZIA 1G3BA 2ZNKH 2Y7XA 3DSOA 1SPJA 2GT8A 3PRBA 2CF8H 1ETTH 2TGDA 3SUGA 3GS9A 4WF8A 3BTGE 3ZZBA 3UNSA 1IQGA 2EEKA 1HPGA 4Q63A 4R0IA 1FPHH 3PWCA 4Y76A 5FPSA 1PYTD 2BD3A 1TE0A 1TX6A 4F4OC 1QHRB 3GY5A 4UONA 1BHXB 1EFRD 1D6RA 3BTDE 4ABBA 3EA9A 2FOAA 3RMLH 1AFEH 1PQ8A 1Y8TA 1GJDB 1TMTH 3BG4C 4A92A 3SQHE 4BTUB 1AUJA 2GP9B 2ZA5A 1W11U 2FP7B 1H9IE 1QB6A 2BDYA 2HOBA 1O2KA 2PSYA 3RXBA 2FO9A 3ZVGA 1SGCA 4VGCC 1E38B 4K69A 4H4FA 2TGPZ 1IQKA 2BYAX 1DSUA 3NRLA 5HYOA 2STBE 4X2WA 2VIOA 5JBTA 1GMHF 2ZHQH 2XYAA 3VB6A 3N7OA 4I31A 5GCHG 5ETXA 1HXEH 2RFKC 2VIPA 5IDKA 4X8UH 3GYLB 3SV9A 2YOLA 2ODPA 1XKBC 1YM0A 4BAQB 1PQ7A 5EXLA 4WH8A 1A7SA 3SV2H 1BTZA 1ZMLA 3M3VA 1J8AA 1ELCA 1HAVB 3U8OH 2BMGB 4NWLA 1UHBB 1K1MA 4ZH8A 1CU1A 2OINA 1BZXE 1XUHA 2LELA 2QY0B 3GY7A 4TY7A 1HLTH 4JYUH 1TMBH 2ZQ2A 2A7JA 2KR7A 4Q7XA 2C90B 3GY3A 3LOXA 5EU8A 4RSPA 2ILNA 1HJAC 1C5YB 2HNTF 1C2KA 1CO7E 1SMFE 5DP6A 2EC9H 1YPEH 3GCNA 1CA0B 1F2SE 2YMSD 1ELFA 5EW2H 2XRCA 3URCA 3HATH 3M5MA 3TJNA 4ISIH 3OX7U 1GI0A 4O97A 4X6OA 2FEQH 3CS7A 1CT4E 2BD8A 2A4RA 5TCAA 2CN0H 1WQSA 1Y3VA 3QO6A 4WMDA 3VXFH 4IMQA 3OTPA 1LDTT 1RIWC 4MNVA 4Y8ZA 3SUFA 4DT4A 1GI9B 3KQBA 1MKXK 5GDSH 1CA8B 2FM2A 1AD8H 4CRCA 1NS3A 2OK5A 1OSSA 2Q6GA 3TGIE 1GI3A 4MLFB 4XDEA 1XMNB 3ZVBA 1OP2A 3EA8A 2VU8E 2ZTZA 2ODQA 3SJIA 2ZDAH 1K28D 4OS7A 2TGTA 5F8TA 1SI5H 1HAIH 5C20A 2AIQA 2BD2A 2WPDD 1O5EH 5GJ4B 1N8OC 1C5RA 1LHFH 1V2JT 4FUFA 4JK6A 4PROA 1GBLA 3BTTE 2OC8A 3M7TA 2GGVB 1FNIA 1J15A 2ZHWH 3M5LA 2ZIQH 5JDUB 1QJ6B 1EP6A 2GKVE 3WWBA 1NBMD 2JIZD 4HGCA 1G2MA 1BCUH 2A1DB 1YKTA 5A8YA 1O3DA 2XOKD 3A86A 2VVVA 4BTIB 5JBCS 5LGOA 4FUCA 1P57B 5LPFA 3PO1B 4CRFA 1AU8A 2K0QA 1C1QA 1GI2A 4X2YA 2FX4A 1SQRA 4TY6A 3UPEA 4BOHA 1OWJA 1FLEE 2HVXA 1QRWA 1LPGB 2FS9A 2VVCA 1EQ9A 3ZZAA 5GPIB 1ZPCA 4AGJA 3UAIC 1S0RA 2OC0A 2ZWLH 1Z1JA 1CGJE 1OWDA 1O2YA 1NBME 1E1RD 1BMFD 1LO6A 4DJZB 1C1TA 1C1UH 4O03A 3PTNA 2BY6X 2V35A 5EQRA 1XX9A 2D26C 2FOHA 4X6PA 3SU3A 3RXDA 6GCHF 5DN6D 2AH4X 1DXPA 1FJSA 2AS9A 2QXJA 4I32A 1P2IA 4AFZA 1W0JD 4YTAA 4AG2A 1ZSLA 1O3JA 4ISNA 4ZXYH 3RXLA 1K22H 2FMJA 3SYJA 2JETC 1ABIH 1BMAA 3BEUA 3P70B 1GBIA 1BB0B 2J98B 4DGJA 1ZHMA 1IOEA 2VIQA 3GCOA 4NA9H 3I77A 3STIA 3UQVA 2VB0A 3ZIAD 4TWWA 1UTPA 2AGEX 2UWLA 1GBFA 1DXWA 1G32B 1QBNA 3S9AA 1GHAF 1ESBA 1TX7A 1AIXH 1ZRBA 3TITA 1BA8B 1HAYB 2V0BA 1OS8A 2BY9X 3RXPA 2XC4A 1FN6A 1AY6H 1LKAA 1D3PB 1VGCC 1WUNH 1YGCH 2KFWA 3FZDA 5E0HA 2Z3CA 1TABE 2GVFA 4FVDA 2ZFFH 3KQDA 5EXNA 2FX6A 1ORFA 3MO3A 4OM9A 2NU2E 1EUFA 4TYDA 4D76A 3S9CA 1THPB 4O3TA 4KTCA 1JIRA 5EQSA 5A0CA 4AFQA 1B7XB 1GCDA 3A8DA 1GDUA 3A87A 1MKXH 3RU4E 4HI3A 5FCRA 2EI8A 3FKSD 1VJ9U 1OWHA 1S84A 2EY4C 5I25A 2HPQH 1TRYA 1P9SA 1L4ZA 3GY6A 1SHYA 3W94A 5A0AE 2CF9H 3TGKE 1PFXC 1SGYE 1N6YA 2ZECA 4KTUA 3E1XB 1G9IE 1O5DH 1LQEA 5DSFA 4ABFA 3ZZ5A 4TT3D 2F91A 4MPVA 5GNDA 4AG1A 3T25A 1SGFG 2Z9JA 1OPHB 5FHTA 1FUJA 2ZHEH 2BD4A 3TGJE 2QF0A 2WPMS 1UCYH 2VGCC 1O3FA 1H8HD 3RXOA 3S7HB 1DUEA 2FOGA 1RTFB 1EZSC 2HLDD 5GXPA 1P2OA 3PROA 1ARCA 3E91A 2BQWB 4FUDA 4CRAA 1C2DA 3UWIA 3KYGA 3BF6H 2BOKA 2D1JA 1O36A 2ZGXH 1Z8RA 1MH0A 1B0EA 1O5CB 2A7HA 5L30H 3ELAH 1XVOA 3WW7A 2XWBI 2F4LA 2H9HA 3RDZA 1Y5BT 2V7QD 3A85A 1IQIA 1PPBH 1XUFA 3QGNB 1BRBE 3U1IB 1C2EA 1GJ9B 1HYLA 5F6MA 1O5AB 2JJ2D 1Z8IB 1VITG 1W8BH 1AGJA 4Q4LA 1GJ5H 1NRRH 2CXVA 2R2WU 4X6MA 3KGPA 4AC9A 3U8TH 1A5HA 1J14A 1ARBA 1MD8A 1KDQA 2XXLA 3BTHE 1GHBF 2PUXB 5HMAA 2PGBB 1NFUA 2A0QB 3RXAA 3T27A 2QGRA 2RDEA 2PR3A 3FANA 3PMBB 3ZVEA 1YLNA 2BX4A 4IS5A 2PFEA 1C1PA 2G00A 3PB1E 1W7GH 2KCAA 3U8RH 2G81E 3OSYA 4NWKA 9LPRA 3GICB 2ZFTA 4JYTA 1GG6C 2H9EH 1WXRA 1J16A 3ZYEA 3SHCH 1QZ8A 1QL8A 4THNH 5F8XA 2AYWA 3FAOA 4IW4E 3C27B 2ZU5A 5EPNA 3V7TA 3MH4A 3P17H 4IC5A 4NIXA 2SGFE 2C4FH 1BMNH 2F83A 2GDEH 3FP6E 1BTUA 3Q3YA 2KCYA 3BIUH 1O39A 4X1SU 1C5PA 1CBWC 2H5CA 4Z0KA 2D2DA 3DSGA 3O8RA 5K0HA 1EPTB 1HJ9A 3MTYA 4ESTE 2FI4E 1O2QA 1ZTKA 2A4OA 2ANKH 2C8XB 2J97A 4AN7A 2PV9B 2H1UA 2XW9A 2Z9GA 5E8EH 1YF4A 2J5UA 3TJVA 1ZRKA 2W3KA 4GHQA 3LGUA 2DE8A 3M3SA 3RC4A 5HIZA 1O3EA 2FYRA 4B2CA 1HAGE 3QTVH 3QX5H 5EPYA 8GCHG 3AAVA 1P2QA 4QT8C 2H5DA 2ZDNA 3VB7A 1UK4A 1BRAA 1ZSKA 1ELDE 2Z3EA 3F9FA 1PQ5A 2FI3E 1YPHC 2ZU3A 3A81A 3VFEA 1O3GA 2FZZA 3BN9A 1TQ0B 1S81A 4KGAA 2ZCKP 2ZGCA 4DY7B 1O3LA 4WJG2 1PYTC 2ZFQH 1MBMA 2FTLE 3F9EA 1HAVA 1ANBA 4X8SH 2CJIA 1DE7H 2PTCE 1BJUA 2TRMA 4DOQA 3SNDA 4LZ1H 3K6ZA 2LP6A 1INCA 1V2KT 5DJ7A 1C5XB 3ATMA 3BG4B 4JZFH 1YBWA 3W95A 5C2ZA 3SN8A 3A7YA 1SFQB 1G3DA 2GJGA 1O31A 2BQ6B 1C5NH 1C4U2 4XBBA 3QUMP 4WVPE 2Y7ZA 1GMDF 4GSOA 3SO3A 4VGCB 1EZQA 7KMEH 3RXFA 2PSXA 2FOMB 2W5EA 3TVJB 2BHGA 1DDJA 2KZ4A 3SBKA 4B76A 4AFUA 3GDUA 1S0QA 2R0KA 1THRH 3ZYDA 1T8LA 5DG6A 2W7UA 3D23A 4BXWA 1W10U 1GBBA 1S85A 3L33A 5DKMA 3U1JB 4WXIA 1QRZA 1SB1H 3UFAA 1SLWB 1K9OE 2BD5A 1TPAE 2ZTXA 1F7ZA 1C1SA 1YPJH 4ABIA 1A5GH 5JB9S 2AMDA 4B71A 2A4QA 1NTPA 3OYPA 1Z1IA 5PTPA 8ESTE 4UD9H 3LKWA 3ZZ4A 1RD3B 1UVUH 2CGAA 1EB2A 4AB9A 4ZXXH 2C8YB 2WUCA 2SFAA 1DY9A 2Y80A 3DCLA 3ZZCA 4DW2U 2F3CE 1F92A 2GZ9A 4MPUA 3A8BA 3T62A 3CNRA 2IN2A 3UR6A 3ESTA 1KLIH 1F5LA 3PLKA 2BDGA 1HJAB 3RMOH 1LVBA 2YMSC 1DVAH 1UVTH 1SSXA 1K21H 1GBCA 4BAMB 1Z7KA 4NZLA 1E0FD 1NN6A 3GISB 1ZJKA 2VIWA 3ATIA 3LGYA 4ISOA 3SV8A 1OX1A 4U30A 1TNJA 3DFLA 1W12U 1V2VT 1JRTA 1TA6A 2BLQA 1GGDC 2H6MA 1DWDH 2OQUA 1RIWB 1IHTH 1PPGE 3I29A 5DGJA 1YPLH 3Q76A 1C9TA 3O8BA 1OWIA 2ZFSA 2BDIA 3NK8A 5FX5A 3BTWE 1O3CA 1BBRK 2ZGBH 4CBOA 1N6XA 2GD4B 1T32A 5J4SA 3HK6B 1AKSA 3SV7A 5C67A 1TYNA 2ZEBA 3ODDA 1C5OH 2ZG0H 4B1TA 4GAWA 3HGPA 1W0KD 1LPKB 2Z94A 3TNTA 4AYVB 1BMLA 1JWTA 3HPTB 1AB9C 4XE4A 3RLYH 2PHBA 4MNWA 4AGKA 1O38A 1N8OB 5T1VA 3ZV9A 2A5KA 3KN2A 2KM0A 1LVOA 1NU9A 5CHAC 1ZTJA 1AFQC 5GIBA 1GVKB 4B73A 2FOFA 1P11E 2P3FH 2J2UA 4K60A 1D6WA 1BTPA 3A8AA 2XBWA 1C5TA 3CS0A 3LPRA 3RXMA 1LVMA 4FU9A 4TWYA 2KAIB 2BD7A 4MNYA 4P00A 2UWOA 1L4DA 1RTLA 2PUQH 1BITA 3E8LA 3ZZ8A 2QXGA 1RTKA 2WPJS 2AHME 3AASA 3KQCA 1KXEA 1NZQH 4O3UA 2PW8H 4RI0A 4MG3A 1HAPH 5H4IB 4UEHH 1HIAB 5F8ZA 1CQQA 1YPHE 2V3MA 6CHAC 1ETRH 1K1IA 4NIVA 3SJOA 4K1EA 2SGQE 2ZU2A 1IQHA 1O5BB 2GCTC 2YNAA 5FPYA 5A09A 2RA3A 4DT7B 1K0HA 2HLCA 1SGQE 1BTYA 3HGNA 1EJMA 4DIIH 2WPHS 1TLDA 3M35A 2QV1A 2THFB 2FOBA 4Z6AH 2FDAA 2G5NA 1B5GH 3A80A 1BMMH 1T31A 3BIVH 4BAOB 1C5VA 2G52A 3MO6A 2BY5X 1C5WB 1KYNA 1V3XA 2A5AA 5C1UA 1Z71A 3FO8D 2JETB 3F0PA 1RGQA 3TH2H 1WTHD 1NFWA 3PRDA 4Q7ZA 4CHAC 1EASA 3V13A 1C5SA 2A4GA 4IN1A 1K1JA 3L3TA 2WYJA 1S6LA 3SUEA 3A89A 5IK2D 4TSFD 4GLYA 1GBHA 1WCZA 1P2JA 4JZ1A 2B8OH 3S0NA 2WINI 1SLVB 1AO5A 3A8CA 1GJ6A 1BHXF 3VGCC 2A45B 2W6JD 1VGCB 4Y79A 3SU6A 1C1RA 3EAJA 4WXVA 1KTSB 4FETA 1CGIE 1EAXA 3MU5A 2BVSH 1HJ8A 1OXGA 4J2YB 1OWKA 2XTTB 1QY6A 4ZHLU 1AZ8A 1GJAB 4E7RG 1MU6B 1O3HA 3MNXA 3RMNH 3NKKA 1SBWA 1BBRH 1O30A 3VPKA 2J92A 2M2AA 1D4PB 1BJVA 1YPMH 4YM9A 3D65E 1WSSH 1GJ7B 4ABHA 4NG9H 2GX4A 2EI6A 1V2WT 2ZDLA 1P06A 4OS5A 4F55A 1FAXA 1ELBA 5ESBA 2Z9KA 3RMMH 2ZU1A 1LTOA 5JBBS 1AQ7A 1OP0A 1TGTA 1GHXH 1TFXA 3E3TA 5LH8A 2P59A 5K7RA 1P3CA 3ODFA 2BVXH 3A82A 2ZTYA 3BV9B 2HGTH 3LJOA 1KIGH 1MUEB 1O0DH 4CREA 1UCYK 2VGCB 2FYQA 1EX3A 1EXFA 1GI4A 1F0UA 1AN1E 1HRTH 2ZHFH 2XBYA 3NUMA 2FXRA 1C2IA 1L1NA 1OWEA 1TGBA 5FBIA 4UFDH 2EQNA 3ATKA 3S9BA 1NROH 3BEIB 3OEED 1UVPA 3LU9B 4GUXA 3UUZA 3PMAB 4X2XA 1K1OA 1DANH 2UUYA 4B75A 1O2GH 2OCVB 3M36A 3SU4A 2QC2A 3UTUH 2D8WA 1BTWA 3RC5A 4IMZA 1EATA 3A83A 2J94A 1EOJA 2O8UA 2TIOA 4I86A 1JOUB 1P2MA 3LT3A 2WV9A 8LPRA 1TRNA 1DSTA 2BTCE 4BANB 1S6HA 5TJXA 1AVXA 1O2VA 4NA8A 3VB3A 3TJOA 3RXQA 3FOAA 2GZ7A 3AAUA 3F6UH 1T8OA 4ZCNA 1CE5A 5FX6A 5C94A 2Z7FE 1AZZA 5B6LA 2H9TH 3QK1A 5DP8A 1MCTA 3MU0A 5KECA 4INHA 2I6QA 1GG6B 1TNHA 2Z3DA 3RXIA 1H9LB 3ZVAA 3PLBA 2PKAA 1W7XH 3EE0B 2A32A 3F2FA 5A8XA 4JZDH 2OBOA 1LPZB 1GL0E 1WDIA 1GDNA 3G01A 3B23B 3TH3H 2A31A 2ZFRH 1YC0A 2ZDKA 1CBWB 3BEFB 3EDXB 1ZSJA 4U01A 1P0SH 3SQEE 4AYYB 4YOJA 4K1TA 4X1RU 3ATLA 1ANDA 3TH4H 1S6FA 3QDZB 1C4V2 1O35A 1F0SA 1BTHH 2O8TA 2NWNA 2WV5A 5ABWA 1GMCG 3GCTG 2J38A 4YZUA 1SGEE 1MTWA 3W1EA 4OS1A 1NU7B 1C1WH 1MZAA 2HWLB 5GWZA 3JZ1B 1MKWK 1FDPA 1EB1H 4HZHA 1VITF 3C1KA 1C5LH 1GBTA 4KKDA 1UCYE 3RXRA 1GHZA 3M7QA 1HAHH 2QE7D 1T8MA 3RXVA 2XBVA 4AB8A 2HALA 1VCWA 2WHXA 1QGFA 3MFJA 1LMWB 4NGAH 4XFQA 3RLWH 1YP9A 3SW2B 1O5GH 1SR5C 3F2HA 2ANYA 1TGSZ 1PPFE 2VWMA 1S83A 4OS4A 4YOGA 5C0UA 4ABDA 3N7EA 5KEDA 2ZGJA 3ZVDA 2FODA 5L2ZH 4XRNA 2XCFA 1BDAA 3UNQA 4OS6A 2GTBA 3M3TA 4M7GA 1NESE 5AF9H 3RP2A 4AX9H 3ZVFA 1GJCB 4RT0A 3VB4A 1P12E 1SQOA 1XXDA 3EE7A 2K8IA 1Q3XA 3VB5A 4FXGH 2Y81A 1OHHD 3I78A 5AFZH 1GI7B 1DX5M 4ZMAH 3Q3KA 3MU4A 2J95A 1U6QA 1O37A 1TA2A 1IAUA 5KGOA 3DT0H 3CP7A 4IGDA 4GCHG 1D3TB 3SU2A 1TPOA 5FXLA 2GCHF 2OP9A 2VINA 5J4QA 2VH0A 3IITA 3MWIU 1J9CH 2JJ1D 2FOEA 5CDFE 4B6FA 2JH6D 1H8IH 3UQOA 1NY22 4YLQH 2W6ID 1QBVH 2Z9LA 2CHAC 2KX4A 3SI4H 3BTEE 4LZ4B 1XUJA 5L2YH 1SOTA 1GI6A 1GI8B 8GCHF 4NSYA 1QJ7B 4FUJA 1FY3A 1P2KA 4E06H 1S82A 1E35B 1GL1A 1WTGH 2WSSD 3GY4A 1T4UH 1NO9H 4AFSA 2HNTE 1V2OT 4Q2KA 1H8DH 4ABGA 2W3IA 1GCTC 2HRVA 4X2VA 5DK1A 1HBTH 1HDTH 2FOCA 3K65B 5E0JA 2P3TB 3R0FA 1C1OA 3LC3A 3ATWA 4JYVH 3SJKA 2YMSB 5DPAA 4SGAE 3TPIZ 2G5VA 4Y10E 1ZLRA 1V2QT 5HGGA 1O2WA 1V2MT 2BM2A 1ZZZA 1V2TT 2Y5HA 1AVWA 2WZQA 3AVZA 1O2SA 2PWXA 3DSPA 1QR3E 1TNLA 3PM3A 2ZO3H 1ZR0A 1O2HA 3P8NA 1GGDB 2F9BH 1EJNA 1EOLA 2R3UA 2GCHG 3P8GA 4MQAA 1P8VC 2L6OA 5DP4A 3K2UA 4D9QA 3OFND 6ESTA 2FPZA 1AE5A 3V0XA 1O34A 3M5OA 4MPWA 4ZKOU 1RXPA 1DITH 4U2WA 1MKWH 1A0LA 4ACBA 2ANWA 3SU0A 1UTNA 5EJZA 4CRGA 5CE1A 3D62A 3F0OA 1TQ7B 1AB9B 1IQFA 2XWAA 1O2PA 2EA3A 3MNSA 2BD9A 1SGIB 3P6ZB 1EJAA 1O2ZA 2UWPA 3QGJA 4DVAU 1DICA 5DP3A 5CHAB 1AFQB 1V2RT 1MZDA 1BQYA 3E16B 2BZ6H 3PV4A 4NIWA 1UHBA 1A2CH 2GT7A 2J9NA 2J4IA 1QURH 5CMXH 1C2FA 1SHHB 3GDSA 1K1PA 1Y59T 4ASUD 3RM2H 1D9IA 1O3AA 1YY3A 1MTNC 5E2PA 4ABAA 1LHCH 1JIMA 3RXJA 3UNRA 3PYHA 1O2UA 1GVLA 1O2MA 1QRXA 1YCPH 2QIQA 2R0LA 4GVUA 4BXSA 5IYTA 2BZAA 1ABJH 1FY1A 2ESTE 3FP8E 5FBEA 1SFIA 6CHAB 2OQ5A 1NFXA 4XSKU 3URDA 4OGXA 1A3BH 1XM1A 5EJLA 2P16A 1HNEE 2GCTB 4K8YA 3OEHD 1MD7A 5E2OA 1ETSH 2AMPA 2QXHA 2ZPRA 2BVRH 4D9RA 4Y6DA 2GV7A 3OY5U 1GVZA 1UTMA 4TPIZ 1B0FA 1T7CA 1E37B 5DO4H 3AW0A 2F9VA 2RG3A 1H8ED 3AK5A 1ZYOA 2V3OH 2G51A 4E05H 1K1LA 1ELVA 2AGIX 3IG6B 3ITIA 4K3JA 2ZDMA 1SQTA 2XC5A 2WYGA 1O3IA 4NIYA 1IQJA 1GWAA 2OC1A 4CHAB 2GMTC 1VKYA 2SGPE 3SJ8A 1SGFA 3OE7D 3QZQA 3TK9A 3BSQA 1XUKA 1SGNE 4KTSA 1NFYA 4XD7D 2G4TA 3LC5A 2SGEE 1L1GA 1UTJA 1QNJA 1C2MA 2XNDD 1BOQA 3F9GA 1C2LA 1GBAA 3VGCB 1H9HE 1SGPE 1FXYA 1OKXA 1CT0E 1UTQA 1VZQH 2GDDA 1DS2E 3KNXA 5EOKA 3GCHC 2ZDVH 5JYIA 2AMQA 2PKSC 1NT1A 3QWCH 4FUGA 2ANMH 4XBDA 5CHBA 2L74A 4M9FA 3UOPA 1GI1A 3MU8A 1DFPA 1FI8A 2ZF0H 5HM9A 4WMFA 3T5FH 2B0FA 4MPXA 3MNBA 1HXFH 3RM0H 1GI5A 4HTCH 1NM6A 1HAXB 2A5IA 1RRKA 3HKJB 3H5CB 3SNCA 4F48B 2ZI2H 3EA7A 3CENA 1O32A 1QFKH 2R3YA 1EZXC 1KDQB 3JZ2B 1VR1H 4Y11E 1VITH 4XOJA 4DURA 3SV6A 1LKBA 2KCOA 1WYKA 5A0BA 1Y3UA 3SI3H 3K6YA 2ODYB 1GBDA 1AVGH 1QA0A 5C1XA 1SGRE 2SGAA 1UK3A 4ABJA 1EKBB 3F3BA 4CRDA 3MH7A 3E0NB 3GY8A 1VJAU 4CR5A 3KHVA 4IBLH 2IOTA 2QF5A 4NSVA 4SGBE 1QL7A 1NRNH 4DG4A 2W26A 3MO9A 1ESAA 4D7GA 2J98A 1O3BA 1HB0B 2V6NA 3NCLA 1ZPZA 1Z8GA 3SGBE 4DIHH 1TMUH 4ZROA 3DFJA 2O8WA 8KME2 1CVWH 1ANCA 4TPYA 4NA7A 3UB0A 2I6SA 1C2HA 2AFQB 1ACBE 5T3HA 3RXTA 3GY2A 1KXFA 1F5KU 3GYMA 4A1XA 2BXTH 4X8VH 2QA9E 3MMGA 4J1YA 4FUHA 3LONA 1NRSH 1YWUA 1G36A 1KXDA 4K5ZA
chains in the Genus database with same CATH topology
1HAOH 1TBRH 1TPSA 2JH0D 2LPRA 2ZHDA 3KF2A 3QN7A 1LCYA 1GBJA 7GCHG 4ZUHA 1HAZB 1DPOA 1O33A 4XBCA 3SGAE 1UTKA 2R9PA 2PLXA 2VNTA 1KXAA 1IQMA 3LH1A 1GJ8B 2P94A 1BRCE 1TAWA 1TBZH 1SOZA 3OTJE 2AIPA 1TNGA 1O3OA 3FZZA 1O2JA 1QBOA 1KSNA 1X7AC 2EI7A 5SGAE 1C5UA 2K1QA 2BDCA 5EG4A 2STAE 4X1QU 2P8OC 1PPEE 3ZZ6A 3E90B 2R2MB 1E36B 1NRPH 1XUIA 1CSOE 1KTTB 1XXFA 1LHGH 3UY9A 4LOYH 2LNCA 1O2XA 1BBRE 1L2EA 3ZV8A 1PQAA 2C8ZB 3Q3XA 3RXGA 1S5SA 3F9HA 1W14U 3VEQB 1HUTH 1CGHA 4NFFA 1QTFA 3TIUA 1J17T 1Q2WA 1A0HB 3LJJA 3LDXH 3WY8A 4Y0ZE 5TCCA 3MNCA 2Z6BD 1K2I1 2SGDE 3S7KB 2XNIA 2ZCHP 3QZRA 4X6NA 3U9AH 3GOVB 1IHSH 4B2BA 1LHDH 1GHWH 1NPMA 4I8HA 1ELAA 4OGYA 4Q80A 1IQNA 1A0JA 2RA0A 1W13U 2BLVA 3SGQE 3F68H 2BB4A 2XBXA 4ABEA 1BRUP 1UO6A 1EAIA 5G4BA 2BDBA 3LGWA 2VJ1A 1T8NA 2ALVA 3T26A 1VCQA 4I33A 2OC7A 3MI4A 2Z9IA 3HKIB 2ZU4A 1GMHG 3LGIA 4ZKRU 1KLTA 1JXPA 4F49A 4UDWH 1OOKB 3UWJH 1RS0A 4ISHH 1Q31A 1ELTA 1QB1A 2AERH 2ZC9H 2UUJB 3B9FH 4JCNA 1SGDE 1UTOA 3UOUA 2OD3B 2CMYA 2NU3E 1G30B 3SZNA 3LGVA 1JMOH 1QA7A 1DWEH 1GJBB 2QF3A 3KEEA 3RUOA 5L6NH 3SU5A 4IC6A 2VWOA 1V2LT 2FLBH 2Q1JA 1TONA 3Q00A 2Q6FA 3UREA 1V2UT 1Y3WA 1C2GA 1Z6JH 3MHWU 1LQDB 4X1PU 3SHAH 2ZZUH 4E7NA 4I8KA 2HNTC 4FUBA 1ZOMA 4UFGH 2OXSA 3BTME 2NU0E 4Y8XA 1AWFH 1A1RA 1PPHE 1FY5A 3SORA 1LVYA 3Q77A 1MTSA 3KCGH 1GMCF 3GCTF 1D3DB 2Y82A 1EPTA 4X8TH 1PJPA 1ELEE 4K8BA 3A88A 3RC6A 2RCEA 4K1SA 1MCVA 2H2ZA 4MNXA 2P93A 5JB8S 1GBKA 2PTNA 4CH8B 2CHAB 4KP0A 2TPIZ 4YLUA 1AKSB 5T6GA 1UTLM 1C5MD 1T4VH 5FAHA 1O3NA 1CHGA 1ZHPA 1H1BA 4I8GA 3TK5A 1ELGA 4MTBA 1Y5UT 3OU0A 4UFFH 1GCTB 5DP7A 2AGGX 3UR9A 4YOIA 1SQAA 1C1MA 2FTMA 3P8FA 2W7SA 5BPEA 1QL9A 2PGQB 3KQEA 4O9VA 1DLKB 2C8WB 2TGAA 5BRRE 3MU1A 4RN6A 3M5NA 1TOCB 3P8OA 3PLPA 1DWCH 1QIXB 1P10A 2WPIS 2NU4E 1YCPM 1G3CA 4A1TA 4NZQA 2UUFB 3NWUA 2ALPA 1W0ZU 1L1JA 2G8TA 5AVDA 1AWHB 2C93B 3RU4D 3RXCA 1GHVH 1P9UA 1HGTH 1FMGA 1Y3YA 1C1VH 1C5QA 2BX3A 2ZP0H 2VH6A 5E0GA 1P03A 2ZQ1A 1ANEA 1CA0C 2BY7X 4GCHF 1V2ST 4RKOB 2DE9A 1ZJDA 1WOFA 3T28A 1RJXB 1FN8A 1ZMJA 1V2PT 1AUTC 3P92A 4U32A 2ZPSA 1ZTLA 1GDQA 1TBQH 1P04A 1SGTA 2DUCA 1OYTH 4IN2A 2QYIA 1UK2A 4X1NU 3EGKH 3M7UA 3OY6U 1P09A 2A7CA 2B9LA 1Y3XA 1KLJH 2O8LA 1SLXB 3S69A 3K9XB 2FI5E 5LPRA 1GJ4H 4MDSA 5JPMH 4YO9A 3ENSB 4BAHB 6GCHG 3MYWA 2GV6A 1ESTA 4KELA 4A1VA 3O8CA 2FESH 1A46H 1E34B 3FP7E 1IQLA 5ESTE 5F03A 1FIWA 5EODA 1CHOF 3T2NA 1FIZA 3EYDA 1GBEA 4R8TB 4B74A 3RXUA 2IPHA 3TK6A 4JZEH 1MTNB 2OLGA 2HPPH 1MAYA 1TPPA 1VCPA 2QAAA 3KIDU 3MH5A 5HM2A 1YLCA 3ZZDA 1L0ZA 1O2NA 1HV7A 1YCPK 2CV3A 1SC8U 1O5FH 1AE8H 4YT6H 2ZFPH 4Y0YE 2ZKSA 4OS2A 4NFEA 1P05A 1FONA 5A8ZA 3SNBA 1PPCE 5JBAS 1GHAG 4AOQA 3BTFE 3H7TA 2XC0A 4CH2B 4GPGA 1F5RA 3KL6A 4AORA 3TU7H 1LHEH 3PMJA 3PO1C 6LPRA 5AHGH 2FWWA 4FU7A 3EQ0H 4BAKB 1WV7H 1XVMA 1SLUB 1KXBA 1FPCH 1G3EA 1FY4A 5EW1H 1GPZA 1DT2A 3TNSA 1EZUC 2VVUA 3D49H 5C1YA 2JKHA 1EP5A 2A2QH 1FY8E 4AZ2B 4FVBA 2Y5GA 3P95A 3ZZ3A 1MU8B 1DY8A 1SL3A 3V3MA 4H6SB 1ZGVA 2VIVA 1P02A 3DD2H 1MBQA 2GMTB 3HK3B 1YYY1 1UVOA 1TX8A 2P3UB 3A7TA 1CHOG 1TRMA 3ZVCA 4FU8A 2VIDA 2BXUH 1WBGB 1P3EA 1MAXA 1NRQH 1QJ1B 2BDAA 2OUAA 1O3KA 1Y5AT 4FUEA 3R3GB 1TOMH 4A5TS 2A2XH 1QQ4A 2ZCLP 5C5OA 3SJ9A 2O8MA 2SNWA 4Y8YA 1MQ6A 1TIOA 2VWLA 4Y71A 4A6LA 1W3CA 1YPKH 3GCHB 4I8JA 1AMHA 2Y6TA 7ESTE 1K1NA 1JBUH 1O2TA 2PKSB 1V2NT 2KAIA 1C4Y2 2XCNA 2F9UA 3RU4T 5DP9A 2QCYA 3VXEH 4ZKNU 1F0TA 1C9PA 1OP8A 4LK4A 5EQQA 4ZKSU 1P01A 1DOJA 5I46H 2SNVA 2FIRH 5T6FA 1HIAA 1TNKA 3O8DA 4Q7YA 2O9QA 3ZZ9A 1MTVA 2OTVA 5C5NA 2OBQA 4GHTA 4A7IB 1C1NA 3LGTA 4YESB 1MQ5A 2AEIH 3FFGA 3RXSA 3STJA 4ASHA 1MMJN 1MTUA 3RXKA 1M9UA 3BTQE 2BQ7B 1DUAA 1GHBG 1V6DA 3NPSA 1FZZA 4Y7AA 4WWYA 1AI8H 4HFPB 3DHKH 1O2IA 5DP5A 4CBNA 2QXIA 2P95A 1A3EH 1EAWA 3GDVA 2FLRH 2PKAB 3BTKE 2ULLA 3AW1A 2QN5T 4ZAEA 4K2YA 3B8JA 3E6PH 1Z6EA 1XUGA 1TB6H 3T29A 1A5IA 2UUKB 1TALA 1QQUA 3E0PB 3PWBA 1PPZA 1KY9A 2VWNA 4MVNA 4WMEA 3SU1A 4I7YH 2WUBA 1SG8B 1JRSA 1C5ZB 2BLWA 3MH6A 4CR9A 4ZHMU 2B7DH 1KXCA 4B2AA 1UVSH 3SNAA 4D7FA 3RXHA 3M61U 5FCKA 4WH6A 1ZMNA 5EGMA 3NXPA 4BTTB 1BTXA 4NCYA 3L6PA 1FV9A 1SVPA 3MOCA 1C2JA 4INLA 1YPGH 1DM4B 2IJOB 2FS8A 4H42U 3U98H 1O2LA 4JK5A 1NC6A 2J34A 1ZHRA 2WV4A 3LIWA 1QB9A 2G55A 3A7XA 3QTOH 3V12A 4UFEH 3TLOA 1WQVH 2WPLS 2Y5FA 3LH3A 1ZGIA 3A84A 2P8OB 3A7ZA 2F9OA 1AHTH 1H4WA 3BG8A 2BLOA 4Y7BA 2F9NA 1OYQA 4WY3A 3SOSA 1CT2E 3IWMA 2RDLA 1ID5H 5LPEA 3F1SB 1G37A 5EXMA 2ZGHA 1UJ1A 4X0WU 9ESTA 3A7VA 3FVFB 1W0YH 4JMYA 2BDHA 1DLEA 4ZHAA 1HFDA 3M37A 1TGCA 1ZPBA 1WU1A 2TBSA 2V3HH 3PTBA 1EAUA 1A61H 1F0RA 1YLDA 3DA9B 5FPTA 1TWXB 2B5TB 5B6OA 1GHYH 3UIRA 1DWBH 4BNRA 4LXBH 3SUDA 2Q6DA 1O3PB 2M5TA 4I8LA 1THSH 1W2KH 1BUIA 3SNEA 2ASUB 1UMAH 3ZZ7A 2WPKS 1D3QB 4CRBA 4ISLA 5AFYH 1GMDG 1O2OA 2ZPQA 5T6DA 1N1LA 1XKAC 2BY8X 3QLPH 1EPTC 7LPRA 3DUXH 1A4WH 2JH5D 2C3SA 1RFNA 7GCHF 1P2NA 2BOHB 5HXFA 4JZIA 2G4UA 1TGNA 4YT7H 5A2MH 1BT7A 1G2LA 5C3NA 1HCGA 4H6TA 1QCPA 3PMHB 1IQEA 1BIOA 3TJUA 4D8NA 3A7WA 2GZ8A 5GCHF 4DCDA 1GBMA 1TNIA 1FQ3A 1Z8JB 1O3MA 1FAKH 3U69H 1O2RA 2YNBA 2F9PA 4INKA 4RKJB 4UE7H 1WAYB 2NU1E 3RXEA 4FUIA 3H7OA 3NZIA 1G3BA 2ZNKH 2Y7XA 1SPJA 2GT8A 2CF8H 1ETTH 2TGDA 3SUGA 4WF8A 3BTGE 3ZZBA 3UNSA 1IQGA 2EEKA 1HPGA 4R0IA 1FPHH 3PWCA 4Y76A 5FPSA 1PYTD 2BD3A 1TE0A 1TX6A 4F4OC 1QHRB 3GY5A 4UONA 1BHXB 1D6RA 3BTDE 4ABBA 3EA9A 2FOAA 3RMLH 1AFEH 1PQ8A 1Y8TA 1GJDB 1TMTH 3BG4C 4A92A 3SQHE 4BTUB 1AUJA 2GP9B 2ZA5A 1W11U 2FP7B 1H9IE 1QB6A 2BDYA 2HOBA 1O2KA 2PSYA 3RXBA 2FO9A 3ZVGA 1SGCA 4VGCC 1E38B 4K69A 4H4FA 2TGPZ 1IQKA 2BYAX 1DSUA 5HYOA 2STBE 4X2WA 2VIOA 5JBTA 1GMHF 2ZHQH 2XYAA 3VB6A 3N7OA 4I31A 5GCHG 5ETXA 1HXEH 2VIPA 5IDKA 4X8UH 3GYLB 3SV9A 2YOLA 2ODPA 1XKBC 1YM0A 4BAQB 1PQ7A 5EXLA 4WH8A 1A7SA 3SV2H 1BTZA 1ZMLA 3M3VA 1J8AA 1ELCA 1HAVB 3U8OH 2BMGB 4NWLA 1UHBB 1K1MA 4ZH8A 1CU1A 2OINA 1BZXE 1XUHA 2QY0B 3GY7A 4TY7A 1HLTH 4JYUH 1TMBH 2ZQ2A 2A7JA 4Q7XA 2C90B 3GY3A 3LOXA 5EU8A 4RSPA 2ILNA 1HJAC 1C5YB 2HNTF 1C2KA 1CO7E 1SMFE 5DP6A 2EC9H 1YPEH 3GCNA 1CA0B 1F2SE 1ELFA 5EW2H 2XRCA 3URCA 3HATH 3M5MA 3TJNA 4ISIH 3OX7U 1GI0A 4O97A 4X6OA 2FEQH 3CS7A 1CT4E 2BD8A 2A4RA 5TCAA 2CN0H 1WQSA 1Y3VA 3QO6A 4WMDA 3VXFH 4IMQA 1LDTT 1RIWC 4MNVA 4Y8ZA 3SUFA 1GI9B 3KQBA 1MKXK 5GDSH 1CA8B 2FM2A 1AD8H 4CRCA 1NS3A 1OSSA 2Q6GA 3TGIE 1GI3A 4MLFB 4XDEA 1XMNB 3ZVBA 1OP2A 3EA8A 2VU8E 2ZTZA 2ODQA 3SJIA 2ZDAH 1K28D 4OS7A 2TGTA 5F8TA 1SI5H 1HAIH 5C20A 2AIQA 2BD2A 1O5EH 5GJ4B 1N8OC 1C5RA 1LHFH 1V2JT 4FUFA 4JK6A 4PROA 1GBLA 3BTTE 2OC8A 3M7TA 2GGVB 1FNIA 1J15A 2ZHWH 3M5LA 2ZIQH 5JDUB 1QJ6B 1EP6A 2GKVE 4HGCA 1G2MA 1BCUH 2A1DB 1YKTA 5A8YA 1O3DA 3A86A 2VVVA 4BTIB 5JBCS 5LGOA 4FUCA 1P57B 5LPFA 3PO1B 4CRFA 1AU8A 4X2YA 1C1QA 1GI2A 2FX4A 4TY6A 3UPEA 4BOHA 1OWJA 1FLEE 2HVXA 1QRWA 1LPGB 2FS9A 2VVCA 1EQ9A 3ZZAA 5GPIB 1ZPCA 4AGJA 1S0RA 2OC0A 2ZWLH 1Z1JA 1CGJE 1OWDA 1O2YA 1LO6A 4DJZB 1C1TA 1C1UH 4O03A 3PTNA 2BY6X 2V35A 5EQRA 1XX9A 2D26C 2FOHA 4X6PA 3SU3A 3RXDA 6GCHF 2AH4X 1DXPA 1FJSA 2AS9A 2QXJA 4I32A 1P2IA 4AFZA 4YTAA 4AG2A 1ZSLA 1O3JA 4ISNA 4ZXYH 3RXLA 1K22H 2FMJA 2JETC 1ABIH 1BMAA 3BEUA 3P70B 1GBIA 1BB0B 4DGJA 1ZHMA 1IOEA 2VIQA 3GCOA 4NA9H 3I77A 3STIA 3UQVA 2VB0A 4TWWA 1UTPA 2AGEX 2UWLA 1GBFA 1DXWA 1G32B 1QBNA 3S9AA 1GHAF 1ESBA 1TX7A 1AIXH 1ZRBA 3TITA 1BA8B 1HAYB 2V0BA 1OS8A 2BY9X 3RXPA 2XC4A 1FN6A 1AY6H 1LKAA 1D3PB 1VGCC 1WUNH 1YGCH 3FZDA 5E0HA 2Z3CA 1TABE 2GVFA 4FVDA 2ZFFH 3KQDA 5EXNA 2FX6A 1ORFA 3MO3A 2NU2E 1EUFA 4TYDA 4D76A 3S9CA 1THPB 4O3TA 4KTCA 1JIRA 5EQSA 5A0CA 4AFQA 1B7XB 1GCDA 3A8DA 1GDUA 3A87A 1MKXH 3RU4E 4HI3A 5FCRA 2EI8A 1VJ9U 1OWHA 1S84A 5I25A 2HPQH 1TRYA 1P9SA 1L4ZA 3GY6A 1SHYA 3W94A 5A0AE 2CF9H 3TGKE 1PFXC 1SGYE 1N6YA 2ZECA 4KTUA 3E1XB 1G9IE 1O5DH 1LQEA 4ABFA 3ZZ5A 2F91A 4MPVA 4AG1A 3T25A 1SGFG 2Z9JA 1OPHB 5FHTA 1FUJA 2ZHEH 2BD4A 3TGJE 2QF0A 2WPMS 1UCYH 2VGCC 1O3FA 3RXOA 3S7HB 1DUEA 2FOGA 1RTFB 1EZSC 5GXPA 1P2OA 3PROA 1ARCA 3E91A 2BQWB 4FUDA 4CRAA 1C2DA 3UWIA 3BF6H 2BOKA 2D1JA 1O36A 2ZGXH 1Z8RA 1MH0A 1B0EA 1O5CB 2A7HA