1MZAA

Crystal structure of human pro-granzyme k
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
240
structure length
240
Chain Sequence
b'MEIIGGKEVSPHSRPFMASIQYGGHHVCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIKKFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDSCKGDAGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKYQTWIKSNLVPPHTN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords pro-granzyme K
publication title The 2.2-A Crystal Structure of Human Pro-granzyme K Reveals a Rigid Zymogen with Unusual Features
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.-:
pdb deposition date 2002-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzaA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mzaA01
3MHWU 2P94A 1XVMA 2ZGHA 2AMQA 3ZV9A 3STJA 1SGQE 4CR5A 5L2ZH 1O39A 2PTCE 3UNSA 3BIVH 1Y3YA 3M35A 1V2JT 1O5FH 1LHDH 2AMPA 5FXLA 4FVDA 3RXMA 1JOUB 4F4OC 3UQOA 4GCHG 3U8OH 2GCTB 4O3TA 1UTPA 2RA3A 1DPOA 2SGPE 1TLDA 1V2VT 4ISOA 4B71A 1XX9A 4K1EA 3MH4A 2GX4A 1BRBE 4LXBH 1T7CA 1BHXF 3MH5A 3RXKA 3TJUA 1MUEB 1A61H 3JZ2B 3UWJH 1G36A 1C1RA 1UTKA 3F9EA 1GJCB 2XCNA 3SOSA 2R2WU 4ZHMU 1C5NH 5GCHG 4BAKB 2ZF0H 1DX5M 1SSXA 3RXCA 1YPHE 3ATIA 1VZQH 5H4IB 1AY6H 4R0IA 1HAVB 1DLKB 3PTBA 1ESAA 4BAOB 4I8HA 1DE7H 4FVBA 1GBIA 4MTBA 1O2YA 4Y71A 5L2YH 3S7HB 1O2NA 3SW2B 2UUYA 1EASA 3LGUA 1MU8B 3CS7A 1EKBB 1CQQA 1FY4A 3RXPA 3ATWA 1O36A 2J94A 4WXIA 1TGSZ 2B7DH 1ZPCA 2C4FH 1EZSC 2Y80A 1SBWA 2BD5A 1YP9A 1C2MA 1WYKA 1AN1E 1O38A 4E7NA 4J2YB 4ABJA 1MD7A 3VB3A 1UVOA 2VWNA 2OXSA 2HRVA 3M36A 1QTFA 3SNEA 4BAQB 1CO7E 3I78A 1O5GH 2CF9H 1AQ7A 1BT7A 1C2FA 4GVUA 3UPEA 1MMJN 1RGQA 1UTMA 1O2IA 1Z7KA 2ANWA 1WTGH 3ODDA 5SGAE 3U1JB 4DT7B 4E05H 1RRKA 2TGTA 1HNEE 2UWLA 4B76A 1O2ZA 1FLEE 2VH0A 1QBVH 3KGPA 3M7TA 3Q77A 1GBTA 1S0RA 4Y11E 1DY9A 1MKWH 1AWFH 3GISB 1AD8H 2Y5HA 2FLBH 1YC0A 1DWEH 2J92A 1DY8A 1NM6A 1TPPA 1BUIA 1WU1A 1ZTJA 1AE8H 3VGCB 1GBJA 5JB8S 4AG1A 2EEKA 1HAVA 6GCHF 5GDSH 3PLBA 4M7GA 3RXAA 2SGDE 3RMOH 1QA0A 3OX7U 2D8WA 1L1NA 3ODFA 1J15A 1V3XA 2TPIZ 1MKXH 1O2TA 2PWXA 1WBGB 2O9QA 3GY5A 2AIQA 4K8BA 4WJG2 1TPAE 2BZ6H 4ZMAH 1O2XA 1YPKH 1MZAA 5C3NA 1C4Y2 2FI3E 1BMLA 1MTNC 2BDYA 3RLYH 4E7RG 4Y76A 1FUJA 2SFAA 1CA0C 1P01A 1GMHG 4MVNA 1Z8GA 3W95A 3UNRA 1X7AC 3M61U 2GDDA 2V3OH 1GI9B 5A2MH 1O31A 1OWDA 1SGIB 4MPUA 2G4UA 1FN8A 1T8MA 1TX8A 3Q3YA 1VGCC 3LJOA 5I25A 5A0BA 4LOYH 2A5AA 1VJ9U 2FOHA 2WYGA 1DVAH 1GBKA 4ABDA 1F7ZA 1BTPA 2BDBA 3O8DA 1NZQH 1O3FA 3SJ8A 4AFUA 2VWMA 3S0NA 1K22H 1C5OH 1EAWA 5EOKA 1XUFA 7LPRA 1NU7B 1V2PT 1NRPH 4ZAEA 5DP7A 1TMUH 1GCTB 2XBVA 1O32A 4XBDA 4MNYA 3LDXH 1O3OA 1PQ7A 1S83A 2Q6GA 1C1VH 1BJUA 4JZEH 4I7YH 3QZQA 2OC7A 1TGTA 3D62A 3LGVA 2NU4E 1UCYH 4D8NA 2ZGCA 1O3GA 3VFEA 4OS1A 2XRCA 1AGJA 1QRZA 5BRRE 1TAWA 1JXPA 3BF6H 2O8TA 1SHHB 3F6UH 4Y79A 2RCEA 1P06A 2EI6A 1ACBE 5EXNA 3SGAE 2D1JA 4SGAE 8ESTE 3MU8A 1INCA 1XUGA 1D9IA 3MOCA 3SJIA 4B75A 1K28D 1F5RA 1XUIA 1GBCA 3GCOA 2P93A 3P95A 2A5KA 4OS4A 1CBWB 1EB1H 3AAUA 1HDTH 2BYAX 4WVPE 4A1VA 2PR3A 2W7UA 2QGRA 3SUGA 1LTOA 1O2LA 3H5CB 3Q76A 5GXPA 1HAOH 3VXFH 2FOCA 5E0HA 1TRMA 2BOKA 1GI0A 1N1LA 3MWIU 5JPMH 1HLTH 4AB9A 4IGDA 5CHAC 5FPTA 1QA7A 2ZEBA 2I6QA 3MNCA 2KAIB 1CT2E 1OWJA 3UQVA 2BY5X 4FUJA 4DIHH 3T28A 2P59A 4LZ1H 3L33A 1PPHE 2ALVA 1P2KA 5DG6A 1GI8B 1IQGA 3GYMA 4INHA 4X1QU 2ASUB 3PTNA 1HFDA 2A2QH 5JBBS 3SUEA 1F5KU 1W0YH 2AMDA 5FCRA 1RS0A 2QC2A 4RKOB 2P3TB 2XYAA 1SC8U 2BTCE 5T6GA 1LPKB 1WAYB 4MPWA 5DO4H 1F5LA 1G9IE 1DLEA 3E8LA 5DP5A 1O3KA 3PO1C 1SFIA 5GIBA 4NFFA 5L6NH 1H1BA 1MU6B 4NG9H 2H5CA 1Z6EA 2QCYA 1K1OA 2XW9A 1G3CA 3P8NA 1BTZA 4WF8A 4TPYA 1AB9B 1O3DA 2ZNKH 4AFQA 4K1SA 1GJBB 5C2ZA 2Y7ZA 3S7KB 1C5PA 3P17H 3SN8A 1T31A 2A7HA 5FPSA 3B8JA 4GSOA 3OYPA 3SO3A 2NU2E 1TALA 3P6ZB 9ESTA 2ANYA 3RP2A 3V0XA 2A32A 3S69A 1EOJA 1SGNE 3RXDA 5HMAA 2AGEX 1MQ6A 4NCYA 2Z9JA 2WPLS 2C93B 1TE0A 5HYOA 5J4SA 7ESTE 3NXPA 1QL9A 2KAIA 3PMBB 1SL3A 5DKMA 1K1LA 2QF0A 3DA9B 1ELDE 2WV4A 5PTPA 1GJ8B 2P3FH 4CBOA 3CS0A 3SU0A 4CH8B 4MLFB 3O8RA 2HLCA 1Z1IA 1YBWA 2F3CE 3FP6E 1IQIA 1NFXA 2GV6A 1Y5BT 1ETTH 1JWTA 4ISLA 2H6MA 4MNWA 1ZSJA 2ZDAH 2BY9X 2BDHA 1EQ9A 1G3DA 1CGIE 1K2I1 3PMAB 4WMEA 3MNBA 4UFFH 5DPAA 2PKAB 1GVLA 3ATLA 3QX5H 1Z8JB 1Z8IB 5ABWA 1CHOF 1CGHA 1O2PA 2C8YB 4AFZA 3S9BA 2G4TA 1KLIH 1V2WT 1GMCG 2A4OA 2WPKS 5EU8A 3U69H 2QXJA 1EZXC 1VITF 1FY3A 3EAJA 3C27B 3TGJE 1UVTH 3TGIE 1Y3UA 1YPHC 1P57B 1M9UA 1YPGH 4X6PA 1TFXA 3SORA 1T8OA 4OS7A 1W7XH 3NK8A 4OS5A 5DJ7A 3STIA 3ZZDA 1O2SA 2ZTZA 2ZZUH 1C5MD 3ZVEA 4I32A 2EA3A 1VR1H 4CHAC 4ZUHA 2B0FA 1BTUA 2F9NA 1Y5AT 3GCHB 4AN7A 1TABE 1L2EA 1O5DH 1CVWH 4K60A 1FMGA 3URDA 1GI2A 2J38A 2Z3DA 2W3KA 3KN2A 1FN6A 2RG3A 5EW2H 2AH4X 1DWDH 2B9LA 3A8BA 1O3BA 3MMGA 1OSSA 1EAIA 2BLWA 2Y5FA 4IW4E 3TGKE 1PFXC 1UVSH 4X6OA 1TQ7B 4MPXA 1A46H 3AW1A 2A1DB 2J95A 1EAXA 3OTJE 2ZCHP 5FAHA 4IS5A 2QXHA 3UR9A 2O8WA 3A82A 4DG4A 3MO9A 3A7XA 1Y8TA 1HIAB 1C2EA 2BY8X 2SGAA 5JBAS 1HAHH 2A7JA 2JH0D 4Y0YE 1OWHA 1E34B 3D65E 2G5NA 4ZROA 3P8FA 3U9AH 2G55A 4H6TA 1KDQA 3RC6A 3PWCA 1F0TA 1DWBH 3LGYA 1GBHA 4BOHA 1IQEA 1D3QB 1THPB 2ZDNA 4UFDH 1QJ6B 2R3YA 3GDVA 3PMHB 1L4ZA 1QCPA 4BAMB 1LHGH 4NA9H 1OWIA 4ISIH 1GG6B 4A7IB 1FY5A 1PPFE 1AMHA 2H9EH 3GY7A 4WXVA 1SB1H 3PLKA 4FU8A 3M3SA 4BNRA 1OP8A 1GDQA 2VIDA 4B74A 1FIWA 2VWLA 3IG6B 1K1PA 5GJ4B 4ESTE 1ZZZA 2A4RA 3CENA 3SNBA 1HGTH 2WUCA 4Y8ZA 4AB8A 4YM9A 1MTSA 2OC1A 1RIWC 1O2RA 2C90B 4GCHF 3P92A 5F6MA 3DUXH 1PPBH 3OSYA 2XXLA 1TBRH 4ZKOU 4KKDA 2JETB 3TH4H 1JIRA 1G32B 1XUHA 5LPRA 2CHAB 4FUEA 2FS8A 1HIAA 1TNGA 1YF4A 4OS2A 5JB9S 2IJOB 3DHKH 4JYUH 4IMZA 3MYWA 3PM3A 2YOLA 1OYTH 3A7TA 1KXEA 3TU7H 5EQRA 5IDKA 1JMOH 4O9VA 1V2OT 2H9HA 4YOJA 3QK1A 1SQTA 3OU0A 2XBYA 3QGJA 3UNQA 1UTJA 1VCPA 2UUKB 1KYNA 2FM2A 2H5DA 3BTEE 2G8TA 1GGDC 3BEUA 2FOAA 1GHXH 4IN1A 5GCHF 1GMDG 3FP7E 4MNXA 5TCAA 1DXWA 1TGCA 2EI7A 3A85A 2V35A 5E8EH 1W11U 4CRDA 3E1XB 2Z9KA 3GY3A 1BJVA 4GHQA 1UTNA 2G51A 3PWBA 2OLGA 3LJJA 2FTMA 1B0FA 2QA9E 4HZHA 1PQ8A 1NO9H 2BM2A 3A8DA 4CRAA 3TK6A 4JK6A 1QR3E 1YGCH 2CXVA 1F0SA 1GDNA 1Z71A 1YKTA 2ZGJA 1UK3A 4IMQA 4E06H 4OGYA 3RU4T 2BD3A 5FCKA 1HB0B 3TJVA 1HAIH 2BDAA 3KIDU 3E0PB 1ESBA 3GDSA 3VB4A 4HGCA 1K21H 2ZU4A 1UO6A 2TIOA 2XWBI 1DITH 1ZYOA 2DUCA 5FX5A 3HGNA 1QIXB 1C2LA 4Y8XA 1ESTA 1ARBA 5EQSA 5C1XA 1O34A 1S5SA 1PPCE 4A92A 2Z9LA 2BDGA 1C2KA 2ZA5A 1EATA 7KMEH 4CH2B 4MNVA 3TH3H 3O8BA 3EDXB 2BQ7B 1BBRE 2FP7B 2FDAA 2C8ZB 1XMNB 1GHZA 1ZSKA 2FOFA 2OINA 2QN5T 4Q7XA 1BRUP 2NU3E 1AU8A 2VGCB 2A45B 1C9TA 3V12A 2BHGA 1C4U2 1ZTKA 2AEIH 2OTVA 3FFGA 1A4WH 3ESTA 3DT0H 1WCZA 3IWMA 1BZXE 1SG8B 1RTLA 2BB4A 3RXGA 1H4WA 1XUJA 3VB7A 3SU5A 2ZFFH 3A81A 3RMLH 1FJSA 1TB6H 4UEHH 4X8UH 1O33A 2YNAA 1O3HA 2GMTB 3RM0H 1BB0B 2C8XB 1GBAA 1AIXH 1XKBC 2R9PA 2JH5D 4AX9H 1OWEA 2O8LA 1VCWA 1UJ1A 2ZHDA 2WPJS 2O8MA 3RC4A 1KTSB 2ZWLH 1GVZA 1NROH 4B1TA 3T29A 3A7ZA 2NU1E 2ALPA 3BG8A 4ISHH 3LGTA 1FNIA 3A83A 4RN6A 1GMHF 3FZZA 2BLOA 1BITA 3RXOA 3RXHA 8KME2 1N8OC 3SJOA 4ABGA 1QNJA 1EPTC 5DK1A 4FUGA 4X2WA 4XSKU 4AYYB 1QB6A 1OP0A 1J8AA 1AWHB 2ZGXH 2R2MB 3NPSA 1LPZB 3M5LA 1W2KH 3ZYEA 3BTKE 1ZRBA 4WMDA 1TA2A 1UMAH 4X6NA 1NFWA 1FI8A 1ETRH 1JRTA 4KTSA 4K8YA 4TWWA 1BHXB 2A7CA 2J9NA 5GPIB 2GGVB 1IQKA 1A5GH 2ODPA 3A7WA 1OYQA 4ZKNU 6CHAC 2QXGA 1TIOA 3K2UA 2ZCLP 1HAPH 4BXWA 2ZI2H 4NIVA 3ZZ8A 1Z8RA 1TGBA 3EGKH 1LVMA 1TOMH 2ZFQH 1ZMJA 2F9VA 1WQVH 4J1YA 3P8OA 1P12E 1O2KA 1C2JA 2VIWA 1GGDB 2GD4B 3RDZA 1A0JA 1ABIH 2CF8H 1S84A 1AE5A 1YPMH 4X2YA 1GL0E 3CP7A 2SNVA 4MQAA 3F1SB 2BD8A 2WYJA 4SGBE 2A2XH 1SGDE 4VGCC 1ZRKA 1C4V2 1NESE 1CSOE 2Z94A 4NZQA 2HNTC 5EXLA 1CGJE 2CV3A 3SI4H 1O2WA 1GDUA 2XTTB 1PYTC 3PB1E 5E2OA 3FVFB 2TGDA 2B8OH 3E3TA 1O3PB 1AFEH 1ELCA 1L4DA 1LO6A 3WY8A 1QB9A 3V7TA 3E16B 3OY5U 2TGPZ 5A8XA 1QB1A 1C5WB 1SGEE 2Y5GA 3RC5A 2GZ9A 3GOVB 2K1QA 3RXJA 4U30A 3SU4A 3RLWH 3UOPA 4FUCA 1E37B 3NZIA 1AZ8A 3SHAH 1O5CB 4B2BA 4UD9H 3BTWE 3LH3A 4TY6A 1TX6A 3LT3A 4MPVA 2G81E 1SLWB 1IAUA 1UHBB 2ZHWH 3SQHE 1TYNA 1O2UA 2Z3EA 3M3VA 2HPQH 4INKA 2EI8A 2STAE 1IHSH 5C1YA 1O5EH 5C1UA 5K0HA 3SU1A 1GBFA 1E38B 1K9OE 2J2UA 5DP4A 5HM2A 1VJAU 1C5QA 2ZKSA 3SV7A 1Y5UT 5JBTA 3LPRA 4F49A 1FIZA 4FUDA 2Y82A 1MTUA 1V2ST 2R0KA 5A09A 4AORA 1T4VH 1O5AB 3KL6A 2HNTF 3G01A 1QRWA 2SNWA 2PSXA 2FX6A 3SV8A 2ZDMA 3E90B 2FS9A 3SU2A 3Q3XA 3ELAH 4X6MA 2R0LA 1XUKA 1FY8E 2VINA 4HFPB 1F92A 5AFZH 2ZDVH 2SGFE 3UUZA 1O2HA 1IQNA 2BXTH 1MQ5A 3BSQA 1N8OB 1GL1A 4K2YA 3UIRA 5DP3A 5E2PA 1BDAA 3E91A 4YTAA 1NTPA 4UDWH 2VB0A 2ZHEH 2BY6X 1P2IA 2AERH 2ZPQA 1P09A 1EZUC 1BQYA 1G3BA 1T32A 1NPMA 1L1JA 4K69A 3A8CA 1KXFA 1P2JA 2GZ7A 4CREA 1DUAA 2VWOA 4U32A 2FWWA 1TWXB 1GBDA 2LPRA 1QBNA 2IN2A 4KTUA 1UHBA 1V2MT 1AZZA 2GTBA 3BIUH 1YLCA 4Q2KA 1GWAA 1QRXA 1V6DA 2A31A 1XKAC 2WINI 4UFGH 4IBLH 3SNAA 1UK2A 1KY9A 1HPGA 3UTUH 1BCUH 1FQ3A 1GI5A 2OP9A 1NN6A 4Y7BA 3MU1A 1EB2A 4X1SU 5AVDA 1A7SA 2GVFA 1A0LA 3QWCH 1H8IH 1L1GA 1NFUA 4JZFH 2DE8A 2BDIA 2ZIQH 1SLUB 1ELVA 2ZDKA 1IOEA 1MTNB 5FBEA 1HJAC 1CA0B 3EA9A 3LU9B 1GMCF 2H2ZA 4WWYA 3MU5A 1TQ0B 3R3GB 3VXEH 2QAAA 4JK5A 2BD4A 1ORFA 1K1MA 3ZYDA 1HUTH 2W26A 3PROA 4NIWA 1B5GH 1O3LA 8LPRA 1A0HB 4XDEA 1C5RA 1ELAA 1MCTA 1ZHRA 2OBQA 2QY0B 1GHAG 3PYHA 1EZQA 1CT0E 1VGCB 4NFEA 2XNIA 1ANBA 1W3CA 2Q1JA 5L30H 1ELGA 1P2MA 2FOGA 3PLPA 4NIYA 2ZTYA 1YYY1 2FYRA 1MCVA 3BG4C 1VITH 1XXDA 3T26A 2ZG0H 4I31A 4A1TA 1C1QA 1QL8A 2Z7FE 4D9QA 1MH0A 1N6YA 1XVOA 3ZVGA 1P9UA 1G2MA 3MU0A 2W3IA 2ULLA 4I8JA 1D6RA 1OX1A 2Y6TA 3GY4A 1FDPA 4XE4A 2AYWA 2P8OC 1P05A 2OUAA 2HNTE 1E0FD 2PKSC 5ESBA 2F9BH 2O8UA 1Y3WA 1AFQC 1ZPBA 1ZLRA 4X2VA 1EUFA 2VIOA 5FPYA 2FZZA 5FBIA 2XCFA 3V13A 3M5NA 1S6HA 2W7SA 3HPTB 5DP9A 3A87A 5T3HA 2XC5A 4GUXA 1KXBA 4X1PU 1LDTT 4X1NU 3TK5A 3GCTG 1O3EA 2HALA 2PUQH 1SGRE 4UONA 3TJOA 2TGAA 4MDSA 2CMYA 4YESB 5C20A 2PW8H 1F2SE 3TNTA 5CMXH 3ENSB 2Y81A 1IQHA 2OBOA 1O2OA 3SHCH 1UTLM 3JZ1B 3T5FH 5K7RA 5LGOA 1BBRH 2ZU5A 3T62A 1C5YB 3RXVA 4DY7B 3UWIA 1AKSB 3BV9B 3U8TH 3ZVAA 1HBTH 1J9CH 1GBEA 2AS9A 1NT1A 1DS2E 2FMJA 2PFEA 3SU6A 5CHAB 5BPEA 3SU3A 4LZ4B 2ILNA 1GCDA 2GCTC 1Q31A 1K1NA 2PUXB 3F9FA 2QIQA 3QTVH 1W0ZU 1C1MA 1YM0A 2STBE 1ZMNA 4X1RU 1SQOA 1QBOA 2OC8A 2V3HH 4FXGH 1YPEH 1QQ4A 1TPOA 1C1UH 4OS6A 4FU9A 1SGCA 4XFQA 3LONA 3RU4D 4AZ2B 1MBMA 5E0GA 7GCHG 3UY9A 4H4FA 2PKAA 1OP2A 4ZXYH 4D7GA 4I33A 2ESTE 2ZECA 4O3UA 2F91A 1GJDB 2QF3A 2HWLB 4NSVA 1K1IA 1BRCE 4TWYA 4I8KA 3EA8A 3PO1B 1GI1A 2RA0A 1UVUH 3B9FH 1BTYA 3ZVCA 1ZGIA 2OQUA 4BTIB 4D9RA 2ZFPH 1TNJA 1UK4A 4ABAA 1NS3A 1SR5C 2Y7XA 1YCPK 2XBXA 3BN9A 2IOTA 3MNSA 3BTGE 4DURA 1GMDF 1MZDA 3EYDA 1AVGH 4DJZB 1FXYA 5DP8A 1GHVH 1O2GH 4AGKA 3BEIB 3KF2A 4A5TS 1ANEA 1SGYE 8GCHG 5TCCA 4MG3A 1THRH 3MH7A 1O3CA 1ZJDA 1GHYH 1EP6A 3ZZ3A 2RDLA 2FEQH 2ZO3H 3VEQB 1O30A 2BXUH 3HK3B 1C5VA 4ZHLU 2G5VA 2BZAA 3KQEA 4GHTA 5A8YA 4FUBA 1SLXB 1PQAA 3GYLB 5ESTE 3GDUA 2F9OA 2B5TB 1EP5A 2P95A 1K1JA 1C2DA 1J17T 4YT7H 2P16A 1GJ5H 3M3TA 1O37A 1GHWH 1S0QA 3SJ9A 1DDJA 4CRGA 3TK9A 1QJ1B 9LPRA 3FAOA 3URCA 5HM9A 1QL7A 2BY7X 4K5ZA 1C1OA 5E0JA 1F0UA 1TMBH 2ZGBH 3MTYA 1NU9A 4AGJA 1UVPA 1W13U 3GY6A 3SV9A 1ID5H 2PKSB 1FPHH 1RTFB 2OD3B 6LPRA 1S81A 1RFNA 2AGGX 1GVKB 1HYLA 1O35A 2DE9A 1WOFA 5B6OA 3VGCC 3ZZ7A 2HGTH 4ZKSU 3RMNH 2FODA 4YOIA 1CU1A 4D7FA 2SGQE 3QDZB 4PROA 1IQFA 1QFKH 3UFAA 5AFYH 4JZDH 1T4UH 3UR6A 1Z6JH 4B2CA 3A7YA 3RUOA 4R8TB 3HKIB 4KELA 5C5NA 4CHAB 1EXFA 2UUJB 4XBBA 4BTUB 2FIRH 3IITA 2AGIX 3MI4A 4ZXXH 2VH6A 1DOJA 1D3PB 2G00A 5LPEA 2XBWA 2VIQA 3TPIZ 1PQ5A 1NFYA 3QO6A 1FZZA 3P70B 4RSPA 4Z6AH 1U6QA 1YLDA 3A80A 2HVXA 2F83A 3SQEE 2BD7A 4NGAH 1O3AA 1ZTLA 4Y0ZE 1ELTA 4CR9A 5LPFA 2C3SA 2ZTXA 1P02A 4Y10E 1G30B 4CBNA 4WY3A 5FX6A 3L6PA 5IYTA 2VU8E 2XC0A 3UOUA 2CGAA 3SUDA 2M5TA 5A0CA 1YPJH 1C5UA 3D49H 4YT6H 1GJ4H 3RXQA 2J34A 3F9GA 3ITIA 4DGJA 3SNCA 4BTTB 3ZVBA 3AASA 2AIPA 1GCTC 2BVRH 3DFJA 2GP9B 1ETSH 1C1SA 1P0SH 2H1UA 5T6FA 3SV6A 2D26C 4A1XA 2XC4A 3K6YA 1SQAA 1V2KT 1GHBG 1RJXB 1Y3XA 1W10U 1MBQA 3LOXA 2ANKH 4DIIH 1P2QA 2GCHG 1C2IA 2ZQ2A 2Z3CA 2VVVA 2A4QA 3QLPH 3K6ZA 3M5MA 4GLYA 1ANDA 4Y7AA 2BD9A 2Z6BD 4NZLA 1SOTA 2EC9H 1O0DH 4U01A 1YPLH 1T8NA 3RXRA 5C5OA 3GY8A 1CE5A 2ZPRA 3ZZAA 3AVZA 1KXAA 1RIWB 1P10A 4KP0A 2PLXA 4JCNA 4CRBA 1C1WH 1CBWC 1BMAA 1TNLA 3TNSA 1XM1A 4YO9A 5AF9H 1ELEE 3C1KA 1DM4B 1EJAA 5FHTA 3TITA 4TY7A 2PSYA 1GBMA 3EE0B 1O3IA 3AAVA 4DVAU 2QYIA 1OPHB 2TBSA 1Y59T 1TGNA 1MAYA 1LHEH 1QY6A 1KXCA 2HPPH 1GI7B 4XOJA 1TNKA 3ZVDA 4JMYA 5A8ZA 1O2MA 3I29A 4D76A 1ANCA 1E36B 5JYIA 3MU4A 2ODYB 3NCLA 4WMFA 1C1TA 3F9HA 3H7TA 4NA7A 4X0WU 1G3EA 1NY22 4WH6A 1A2CH 3SNDA 3ZZ9A 1P2NA 1IQMA 2J4IA 1H9LB 1ZHMA 1IQLA 2FTLE 5JBCS 3EA7A 1O3MA 1WUNH 3A7VA 4ABBA 1D4PB 4RKJB 1RXPA 3FANA 2PGQB 1TRYA 2ZDLA 1YCPH 3ATKA 1HAZB 4ABHA 1JBUH 5F8ZA 2Q6DA 2IPHA 5G4BA 1NRSH 3LC5A 4XBCA 1C5LH 3KHVA 1W12U 1IQJA 1KXDA 1ARCA 1SGFG 2ZPSA 1BBRK 1THSH 4BAHB 2BLQA 1GBLA 3T25A 1AB9C 2CN0H 1OKXA 1SLVB 3S9CA 1WSSH 2WV5A 4LK4A 1BMNH 3ZZBA 1P11E 1DWCH 2JKHA 1HJ8A 1O2JA 2XWAA 2ANMH 5LH8A 5EPYA 3A8AA 4ABIA 5DP6A 1FONA 3SJKA 4IC5A 3TH2H 3HK6B 1EAUA 2ZC9H 4NIXA 1OWKA 1S6FA 2A4GA 3QTOH 1A5HA 1Y3VA 4NSYA 4Y6DA 1AUTC 2FESH 1OOKB 1GPZA 2ZQ1A 5F03A 1VCQA 1ABJH 1BA8B 1ZJKA 4X8VH 1HRTH 5EQQA 3U8RH 3HKJB 2PGBB 1H8DH 1KLJH 1CA8B 3BTQE 5HGGA 3ZZ6A 2ZU3A 1GJ9B 1ELFA 1GJAB 3RXFA 2ZU1A 1AO5A 4INLA 1LKBA 6GCHG 1NRNH 3P8GA 2WPIS 1BTXA 1NRQH 3MO6A 1V2NT 2AFQB 3Q3KA 3FP8E 2UUFB 1A3EH 3LGWA 1Q3XA 1C2GA 3A86A 4KTCA 4IN2A 1WV7H 4NA8A 1EJMA 1EX3A 1J14A 3EQ0H 1OXGA 2BX4A 4KGAA 4OGXA 2P3UB 5T6DA 1SGFA 2ZHFH 3ZZ5A 1TOCB 1TRNA 2VVCA 5CE1A 1F0RA 4O97A 1O2QA 4HI3A 1KLTA 1G2LA 2GDEH 3K9XB 2FI5E 4YOGA 2FO9A 3U98H 2Q6FA 1SGTA 2YNBA 1IHTH 1EPTB 1O2VA 1BMMH 1CT4E 1LQEA 5I46H 1D3DB 3PV4A 1C5SA 2FYQA 3SGQE 1TNHA 3O8CA 3RXBA 1LVYA 3M37A 3GCHC 1GHAF 1C5ZB 1GBBA 2C8WB 4ZH8A 1ZOMA 1SHYA 1WQSA 4FU7A 2ODQA 2QV1A 3RXLA 4H6SB 1GJ7B 2FI4E 4B2AA 3E6PH 1O3NA 4NWKA 6ESTA 3KNXA 4GAWA 6CHAB 1MAXA 3TLOA 5EPNA 2GV7A 3SZNA 3NKKA 4I8LA 1GI6A 3UREA 3LGIA 1PYTD 2BVSH 2OCVB 1ZSLA 3SGBE 4UFEH 2OQ5A 2FXRA 1G37A 3BTDE 2PTNA 1DFPA 1FAKH 3BTTE 1SVPA 3QUMP 4HTCH 3QN7A 3BTHE 4VGCB 4ABEA 4O03A 1P04A 2PV9B 1O5BB 2BMGB 5ETXA 2FLRH 1LVOA 4DW2U 2F9PA 1EJNA 3RMMH 3RXUA 3GCTF 4THNH 3ZVFA 3KQBA 2QXIA 1H9HE 2HOBA 1C2HA 1EPTA 1LCYA 1ZHPA 1AHTH 1GG6C 3B23B 1P3EA 3A88A 2ZFTA 3SV2H 1XXFA 1DXPA 3DD2H 3GY2A 2BVXH 2BD2A 3LKWA 1HJ9A 3MO3A 1P2OA 3ZV8A 2FOEA 4DCDA 3FZDA 3HGPA 1P9SA 4Y8YA 3PMJA 3W94A 5F8TA 1D6WA 1D3TB 1DANH 2V6NA 3R0FA 1HXEH 1P03A 3OY6U 1N6XA 1W14U 3TJNA 1C5TA 1TBZH 4QT8C 2JETC 1LPGB 4JYTA 1PPEE 5EGMA 2R3UA 2VVUA 2CHAC 1HCGA 1BOQA 4K3JA 4TYDA 2WPMS 1RD3B 4BXSA 3LIWA 1LMWB 1MD8A 7GCHF 1AI8H 3HATH 1QQUA 1Q2WA 1V2UT 4AFSA 4JZIA 2OC0A 4WH8A 3RM2H 1QGFA 1TX7A 4AG2A 5DGJA 2Z9IA 5HXFA 4BANB 1KSNA 1V2RT 1E35B 2FOBA 1BIOA 1S82A 1KDQB 1PJPA 3MH6A 3ATMA 4YZUA 1LVBA 1DUEA 3DFLA 3KQDA 1LKAA 1TONA 4AYVB 1FAXA 1BTHH 1SPJA 3RXTA 4X8TH 1ELBA 1S85A 3BTFE 3V3MA 5EW1H 5EG4A 1TBQH 1ZR0A 4DOQA 1KTTB 1HAGE 1W8BH 2W5EA 5EODA 4YLUA 1UCYE 3NUMA 1GJ6A 5EXMA 2TRMA 8GCHF 1CHGA 1SOZA 1C5XB 1AUJA 3KQCA 2ZU2A 1ZGVA 3BEFB 3A84A 4FUHA 4CRCA 4U2WA 2ZCKP 3LH1A 2THFB 1SMFE 1V2QT 3Q00A 3QZRA 5J4QA 1V2LT 3LC3A 3GICB 2SGEE 1BRAA 4ABFA 2BOHB 1JIMA 2GT7A 1O3JA 1B7XB 4ASHA 1TMTH 3H7OA 2GZ8A 1QJ7B 3S9AA 3M7UA 2JH6D 1FY1A 2ZFSA 2F9UA 1DSUA 4AOQA 1MKWK 2V0BA 1MTVA 2FPZA 1C9PA 1L0ZA 1RTKA 1TA6A 5AHGH 4NWLA 4B73A 1C1PA 2VGCC 1Z1JA 3KCGH 1P8VC 1LHFH 1KIGH 1CHOG 2BDCA 1V2TT 2ZP0H 2VJ1A 3L3TA 4X2XA 1NRRH 1HAXB 4FUFA 2UWPA 2FOMB 2NWNA 1ZPZA 4Q7ZA 1MKXK 1HAYB 1HJAB 2BLVA 3SBKA 1VITG 2G52A 1C1NA 3SI3H 2GMTC 5C67A 1WTHD 1HXFH 1A5IA 1HV7A 1ZMLA 3D23A 1MTWA 2FX4A 1TPSA 1LHCH 2WPHS 1YCPM 1A3BH 2VIVA 1P3CA 1SFQB 4I8GA 2H9TH 1AKSA 4X8SH 3NWUA 4JZ1A 1H9IE 3M5OA 3RXEA 2D2DA 5F8XA 1BTWA 1PPZA 3KEEA 5GWZA 3ZZ4A 4H42U 3TVJB 1FPCH 3BG4B 1SI5H 2CJIA 1LQDB 1T8LA 4FUIA 1AVWA 4Q7YA 2A5IA 3GCNA 2VIPA 3K65B 2BX3A 5A0AE 3BTME 1GI3A 4A6LA 1DSTA 4GPGA 4YLQH 3F68H 1DICA 4Q80A 1TNIA 3A89A 3QGNB 1NC6A 3VB6A 3T27A 4CRFA 1W7GH 1SGPE 1PPGE 3M7QA 1JRSA 3ZZCA 3RXSA 1J16A 4Z0KA 2P8OB 3TIUA 2GT8A 1FV9A 3VPKA 3U1IB 5TJXA 1GI4A 1OS8A 3AW0A 3MNXA 1UTQA 1QHRB 2ZHQH 4K1TA 1AFQB 4ZHAA 4ISNA 1EOLA 3VB5A 5JDUB 4UE7H 2BQ6B 1UCYK 2A0QB 3MFJA 3RU4E 2I6SA 3I77A 2GKVE 4JYVH 1A1RA 1B0EA 4IC6A 3RXIA 2Z9GA 2NU0E 2UWOA 3N7OA 4TPIZ 1UTOA 1QURH 4ZKRU 1GHBF 3SUFA 2BQWB 2WUBA 1AVXA 2LNCA 1DT2A 2ZFRH 2PHBA 3E0NB 2GCHF 3T2NA 2VNTA
chains in the Genus database with same CATH superfamily
3MHWU 2P94A 1W0JD 1XVMA 2ZGHA 2AMQA 3ZV9A 3STJA 1SGQE 4CR5A 5L2ZH 1O39A 2PTCE 3UNSA 3BIVH 1Y3YA 3M35A 1V2JT 1O5FH 1LHDH 2AMPA 5FXLA 4FVDA 3RXMA 1JOUB 4F4OC 3UQOA 4GCHG 4ACAA 3U8OH 2GCTB 4O3TA 3OEHD 1UTPA 2RA3A 1DPOA 2SGPE 1NBME 1TLDA 1V2VT 4ISOA 4B71A 1XX9A 4K1EA 3MH4A 2GX4A 1BRBE 4LXBH 1T7CA 1BHXF 3MH5A 3RXKA 3TJUA 1MUEB 1A61H 3JZ2B 3UWJH 1G36A 1C1RA 4XD7D 1UTKA 3F9EA 1GJCB 2XCNA 3SOSA 2R2WU 4ZHMU 1C5NH 5GCHG 4BAKB 2KCPA 1DX5M 1SSXA 2ZF0H 3RXCA 1YPHE 4XRNA 3ATIA 1VZQH 5H4IB 1AY6H 4R0IA 1HAVB 1DLKB 3PTBA 1ESAA 4BAOB 4I8HA 1DE7H 4FVBA 1GBIA 4MTBA 1O2YA 4Y71A 3DSPA 5L2YH 1YWUA 3S7HB 1O2NA 3SW2B 2K0QA 2UUYA 1EASA 2M2AA 3LGUA 1MU8B 3DSGA 3CS7A 1EKBB 1CQQA 4P02A 1FY4A 3RXPA 3ATWA 1O36A 2J94A 4WXIA 1TGSZ 2B7DH 1ZPCA 2C4FH 1EZSC 2Y80A 1SBWA 2BD5A 1BMFD 1YP9A 1C2MA 1WYKA 1AN1E 1O38A 4E7NA 4J2YB 4ABJA 1MD7A 3VB3A 1UVOA 2VWNA 2OXSA 2HRVA 3UB0A 3M36A 1QTFA 3SNEA 4BAQB 1CO7E 1SKYE 3I78A 1O5GH 2CF9H 1AQ7A 1BT7A 1C2FA 4GVUA 3UPEA 1MMJN 1RGQA 1UTMA 1O2IA 1Z7KA 2ANWA 1WTGH 3ODDA 5SGAE 3U1JB 4DT7B 4E05H 1RRKA 2TGTA 1HNEE 2UWLA 4B76A 1O2ZA 1FLEE 2VH0A 1QBVH 3KGPA 3M7TA 3Q77A 1GBTA 1S0RA 4Y11E 1DY9A 1MKWH 1AWFH 3GISB 1AD8H 2Y5HA 2FLBH 1YC0A 1DWEH 2J92A 5IK2D 1DY8A 1NM6A 1TPPA 1BUIA 1WU1A 1ZTJA 1AE8H 3VGCB 1GBJA 5JB8S 4AG1A 2EEKA 1HAVA 6GCHF 5GDSH 3PLBA 4M7GA 3RXAA 2SGDE 2V7QD 3RMOH 1QA0A 3OX7U 2D8WA 1L1NA 3ODFA 1J15A 1V3XA 2TPIZ 1MKXH 1O2TA 5B6LA 2PWXA 1OHHD 1WBGB 2O9QA 3DCLA 3GY5A 2AIQA 4K8BA 4WJG2 1TPAE 2BZ6H 4ZMAH 1O2XA 1YPKH 1MZAA 5C3NA 1C4Y2 2FI3E 1BMLA 1MTNC 2BDYA 3RLYH 4E7RG 3FKSD 4Y76A 1FUJA 2SFAA 1CA0C 5EJZA 1P01A 1GMHG 4MVNA 1Z8GA 3W95A 3UNRA 1X7AC 3M61U 2GDDA 2V3OH 1GI9B 5A2MH 1O31A 1OWDA 2F43B 1SGIB 5EJ1A 4MPUA 2G4UA 1FN8A 1T8MA 1TX8A 3Q3YA 1VGCC 3LJOA 5I25A 5A0BA 4LOYH 2A5AA 1VJ9U 2FOHA 2WYGA 1DVAH 1GBKA 4ABDA 1F7ZA 1BTPA 2BDBA 3O8DA 1NZQH 1O3FA 3SJ8A 4AFUA 2VWMA 3S0NA 1K22H 1C5OH 1EAWA 5EOKA 1XUFA 7LPRA 1NU7B 1V2PT 1NRPH 5KEDA 4ZAEA 5DP7A 1TMUH 1GCTB 2XBVA 1O32A 4XBDA 4MNYA 3LDXH 1O3OA 1PQ7A 1S83A 2Q6GA 1C1VH 1BJUA 4JZEH 4I7YH 3QZQA 2OC7A 1TGTA 3D62A 3LGVA 2NU4E 1UCYH 4D8NA 2ZGCA 1O3GA 3VFEA 4OS1A 2XRCA 1AGJA 1QRZA 5BRRE 1TAWA 1JXPA 3BF6H 2O8TA 1SHHB 3F6UH 4Y79A 2RCEA 1P06A 2EI6A 1ACBE 5EXNA 3SGAE 2D1JA 4SGAE 1WXRA 8ESTE 3MU8A 1SQRA 1INCA 1XUGA 1D9IA 2YMSC 3MOCA 3SJIA 4B75A 1K28D 1F5RA 1XUIA 1GBCA 3GCOA 2P93A 3P95A 2A5KA 4OS4A 1CBWB 1EB1H 3AAUA 1HDTH 2BYAX 3N7DA 5C0TA 4WVPE 4A1VA 2PR3A 2W7UA 2QGRA 2QE7D 3SUGA 1LTOA 1O2LA 3H5CB 3OE7D 3Q76A 5GXPA 1HAOH 3VXFH 2FOCA 2GJGA 5E0HA 1TRMA 2BOKA 1GI0A 1N1LA 3MWIU 5JPMH 1HLTH 4AB9A 4IGDA 5CHAC 5FPTA 1QA7A 2WV9A 2ZEBA 2I6QA 3MNCA 2KAIB 1CT2E 1OWJA 3UQVA 2BY5X 4FUJA 4DIHH 3T28A 2P59A 4LZ1H 3L33A 1PPHE 2EQNA 2ALVA 1P2KA 5DG6A 1GI8B 1IQGA 3GYMA 4INHA 4X1QU 2ASUB 3PTNA 2J98B 3PV5A 1HFDA 2A2QH 5JBBS 3SUEA 1F5KU 1W0YH 2AMDA 5FCRA 1RS0A 3FN8A 2QC2A 4RKOB 2P3TB 2XYAA 1SC8U 2BTCE 5T6GA 1LPKB 1WAYB 4MPWA 5DO4H 2KFWA 1F5LA 1G9IE 1DLEA 2HVYB 3E8LA 5DP5A 2JDID 1O3KA 3PO1C 1SFIA 5GIBA 4NFFA 4B6EA 5L6NH 1H1BA 1MU6B 2QF4A 2H5CA 4NG9H 1Z6EA 2J5UA 1K1OA 2QCYA 2XW9A 1G3CA 3P8NA 1BTZA 4WF8A 4TPYA 1AB9B 2QF5A 1O3DA 2ZNKH 4AFQA 4K1SA 1GJBB 5C2ZA 2Y7ZA 3S7KB 1C5PA 3P17H 3SN8A 1T31A 2A7HA 5FPSA 3B8JA 4GSOA 3OYPA 3SO3A 2NU2E 1TALA 3P6ZB 9ESTA 2ANYA 3RP2A 3V0XA 2A32A 3S69A 4YXWD 1EOJA 1SGNE 3RXDA 5HMAA 2AGEX 1MQ6A 4NCYA 2Z9JA 2WPLS 2C93B 1TE0A 5HYOA 5J4SA 7ESTE 3NXPA 1QL9A 1H8HD 5EIYA 2KAIA 3PMBB 1SL3A 5DKMA 1K1LA 5EJLA 2QF0A 3DA9B 1ELDE 2WV4A 5PTPA 1GJ8B 2P3FH 4CBOA 3CS0A 3SU0A 4CH8B 4MLFB 3O8RA 2HLCA 1Z1IA 1YBWA 2F3CE 3FP6E 1IQIA 1NFXA 2GV6A 2JJ1D 1Y5BT 1ETTH 1JWTA 4ISLA 2H6MA 4MNWA 1ZSJA 2ZDAH 2BY9X 2BDHA 1EQ9A 1G3DA 1CGIE 4FETA 1K2I1 3PMAB 4WMEA 2WZQA 3MNBA 4UFFH 5DPAA 2PKAB 1GVLA 3ATLA 3QX5H 1Z8JB 1Z8IB 5ABWA 1CHOF 1CGHA 1O2PA 2C8YB 3W1EA 4AFZA 3S9BA 2G4TA 1KLIH 1V2WT 1GMCG 2A4OA 2WHXA 2WPKS 5EU8A 3U69H 2QXJA 1EZXC 1VITF 1FY3A 3EAJA 3C27B 3TGJE 4RI0A 1UVTH 3TGIE 1Y3UA 1YPHC 1P57B 1M9UA 1YPGH 4X6PA 1TFXA 2OK5A 3SORA 3F2GA 1T8OA 4OS7A 1W7XH 2YMSB 3NK8A 4OS5A 5DJ7A 3STIA 3ZZDA 1O2SA 2KCAA 2ZTZA 2ZZUH 1C5MD 3ZVEA 4I32A 2EA3A 1VR1H 4CHAC 4ZUHA 5T1VA 2B0FA 1BTUA 2F9NA 1Y5AT 3GCHB 4AN7A 1TABE 1L2EA 1O5DH 1CVWH 4K60A 1FMGA 3URDA 1GI2A 2J38A 2Z3DA 2W3KA 3KN2A 1FN6A 2RG3A 5EW2H 2AH4X 1DWDH 2B9LA 3A8BA 1O3BA 3MMGA 1OSSA 1K0HA 1EAIA 2BLWA 2Y5FA 4IW4E 3TGKE 1PFXC 1UVSH 4X6OA 1TQ7B 4MPXA 1A46H 3AW1A 4DT4A 2K8IA 2A1DB 2J95A 1EAXA 3OTJE 2ZCHP 5FAHA 4IS5A 2QXHA 3UR9A 2O8WA 3U28C 3A82A 4DG4A 3MO9A 3A7XA 1Y8TA 1HIAB 1C2EA 3WWBA 2BY8X 2SGAA 5JBAS 1HAHH 2A7JA 2JH0D 2XNDD 4Y0YE 1OWHA 1E34B 3D65E 2G5NA 4ZROA 3P8FA 3U9AH 2G55A 2F4LA 4H6TA 1KDQA 3RC6A 3PWCA 1F0TA 1DWBH 3LGYA 1GBHA 4BOHA 1IQEA 1D3QB 1THPB 2ZDNA 4UFDH 1QJ6B 2R3YA 3GDVA 3PMHB 1L4ZA 1QCPA 4BAMB 1LHGH 4NA9H 1OWIA 5KGOA 4ISIH 1GG6B 4A7IB 1FY5A 1PPFE 1AMHA 2H9EH 3GY7A 4WXVA 1SB1H 3H09A 3PLKA 4FU8A 3M3SA 4BNRA 1OP8A 1GDQA 2VIDA 4B74A 1FIWA 2VWLA 3IG6B 1K1PA 5GJ4B 4ESTE 1ZZZA 2A4RA 3CENA 3SNBA 1HGTH 2WUCA 4Y8ZA 1NBMD 2KR7A 4AB8A 1MTSA 4YM9A 2OC1A 1RIWC 1O2RA 2C90B 4GCHF 3P92A 5F6MA 3DUXH 1PPBH 3OSYA 2XXLA 1TBRH 4ZKOU 4KKDA 2JETB 3TH4H 1JIRA 1G32B 1XUHA 5LPRA 2CHAB 4FUEA 2FS8A 1HIAA 1TNGA 1YF4A 4OS2A 5JB9S 2IJOB 3DHKH 4JYUH 4IMZA 3MYWA 3PM3A 2YOLA 1OYTH 3A7TA 1KXEA 3TU7H 5EQRA 5IDKA 1JMOH 4O9VA 1V2OT 2H9HA 4YOJA 3QK1A 1SQTA 3OU0A 5FL7D 2XBYA 3QGJA 3UNQA 1UTJA 1VCPA 2UUKB 1KYNA 2FM2A 2H5DA 3BTEE 5GNDA 2G8TA 1GGDC 3BEUA 2FOAA 1GHXH 4IN1A 5GCHF 1GMDG 3FP7E 4MNXA 5TCAA 1DXWA 1TGCA 2EI7A 3A85A 2V35A 5E8EH 1W11U 4CRDA 3E1XB 2Z9KA 3GY3A 1BJVA 4GHQA 1UTNA 2G51A 3PWBA 2OLGA 3LJJA 2FTMA 1B0FA 2QA9E 4HZHA 1PQ8A 1NO9H 2BM2A 3A8DA 4CRAA 3TK6A 4JK6A 1QR3E 1YGCH 2CXVA 1F0SA 1GDNA 1Z71A 3SYJA 1YKTA 2ZGJA 1UK3A 4IMQA 4E06H 4OGYA 3RU4T 2BD3A 5FCKA 5HIZA 1HB0B 3TJVA 1HAIH 2BDAA 3KIDU 3E0PB 1ESBA 3GDSA 3VB4A 4HGCA 1K21H 2ZU4A 1UO6A 2TIOA 2XWBI 1DITH 1ZYOA 2DUCA 5FX5A 3HGNA 1QIXB 1C2LA 4Y8XA 1ESTA 1ARBA 5EQSA 5C1XA 1O34A 1S5SA 1PPCE 4A92A 2Z9LA 2BDGA 1C2KA 5HKKD 2ZA5A 1EATA 3PRBA 7KMEH 5F53A 4CH2B 4MNVA 3TH3H 3O8BA 3EDXB 2BQ7B 1BBRE 2FP7B 2FDAA 2C8ZB 4ACBA 1XMNB 1GHZA 1ZSKA 2FOFA 2OINA 2QN5T 4Q7XA 1BRUP 2NU3E 1AU8A 2VGCB 2A45B 1C9TA 3V12A 2BHGA 1C4U2 1ZTKA 2AEIH 2OTVA 3FFGA 1A4WH 3ESTA 3DT0H 1WCZA 3IWMA 1BZXE 1SG8B 1RTLA 2BB4A 3RXGA 1H4WA 1XUJA 3VB7A 3SU5A 2ZFFH 3A81A 3RMLH 1FJSA 1TB6H 4UEHH 4X8UH 1O33A 2YNAA 2L74A 1O3HA 2GMTB 3RM0H 1BB0B 2C8XB 1GBAA 1AIXH 1XKBC 2R9PA 2JH5D 4AX9H 2EY4C 4Q63A 1OWEA 2O8LA 1VCWA 1UJ1A 2ZHDA 2WPJS 2O8MA 3RC4A 1KTSB 2ZWLH 1GVZA 1NROH 4B1TA 3T29A 4RT0A 3A7ZA 2NU1E 2ALPA 3BG8A 4ISHH 3LGTA 1FNIA 3A83A 4RN6A 1GMHF 3FZZA 2BLOA 1BITA 3RXOA 3RXHA 8KME2 1N8OC 3SJOA 4ABGA 1QNJA 1EPTC 5DK1A 4FUGA 4X2WA 4XSKU 4AYYB 1QB6A 1OP0A 1J8AA 1AWHB 2ZGXH 2R2MB 3NPSA 1LPZB 3M5LA 1W2KH 3ZYEA 3BTKE 1ZRBA 4WMDA 1TA2A 1UMAH 4X6NA 1NFWA 1FI8A 1ETRH 1JRTA 4KTSA 4K8YA 4TWWA 1BHXB 2A7CA 2J9NA 5GPIB 2GGVB 1IQKA 1A5GH 2ODPA 3A7WA 1OYQA 4ZKNU 6CHAC 2QXGA 3OAAD 1TIOA 3K2UA 2ZCLP 1HAPH 4BXWA 2ZI2H 4NIVA 3ZZ8A 1Z8RA 1TGBA 3EGKH 1LVMA 1TOMH 2ZFQH 1ZMJA 2F9VA 1WQVH 4J1YA 3P8OA 1P12E 1O2KA 1C2JA 2VIWA 1GGDB 2GD4B 3RDZA 1A0JA 1ABIH 2CF8H 4Z1MD 1S84A 2IPQX 1AE5A 1YPMH 4X2YA 1GL0E 3CP7A 2SNVA 4MQAA 3F1SB 2BD8A 2WYJA 4SGBE 4F48B 2A2XH 1SGDE 4VGCC 1ZRKA 1C4V2 1NESE 1CSOE 2Z94A 4NZQA 2HNTC 5EXLA 1CGJE 2CV3A 3SI4H 1O2WA 1GDUA 2XTTB 1PYTC 3PB1E 5E2OA 3FVFB 1E1RD 2TGDA 2B8OH 3E3TA 1O3PB 1AFEH 1ELCA 1H8ED 1L4DA 1LO6A 3WY8A 1QB9A 3V7TA 3E16B 4B6FA 3OY5U 2TGPZ 5A8XA 1QB1A 1C5WB 1SGEE 2Y5GA 3RC5A 2GZ9A 3GOVB 2K1QA 3RXJA 4U30A 3SU4A 3RLWH 3UOPA 4FUCA 1E37B 3NZIA 1AZ8A 3SHAH 1O5CB 4B2BA 4UD9H 3BTWE 3LH3A 4TY6A 1TX6A 3LT3A 4MPVA 2G81E 1SLWB 1IAUA 1UHBB 2ZHWH 3SQHE 1TYNA 5C17A 1O2UA 2Z3EA 3M3VA 2HPQH 4INKA 2EI8A 2STAE 1IHSH 5C1YA 1O5EH 5C1UA 5K0HA 3SU1A 1GBFA 1E38B 1K9OE 2J2UA 5DP4A 5HM2A 1VJAU 1C5QA 2ZKSA 3SV7A 1Y5UT 3WWFA 5JBTA 3LPRA 4F49A 1FIZA 4FUDA 2Y82A 1MTUA 1V2ST 2R0KA 5A09A 4AORA 1T4VH 1O5AB 3KL6A 2HNTF 3G01A 1QRWA 2SNWA 2PSXA 2FX6A 3SV8A 2ZDMA 3E90B 2FS9A 3SU2A 3Q3XA 3ELAH 4X6MA 2R0LA 1XUKA 1FY8E 2VINA 4HFPB 1F92A 5AFZH 2ZDVH 2SGFE 3UUZA 1O2HA 1IQNA 2BXTH 1MQ5A 3BSQA 1N8OB 1GL1A 4K2YA 3UIRA 5DP3A 5E2PA 1BDAA 2KCYA 3E91A 4YTAA 1NTPA 4UDWH 2VB0A 2ZHEH 2BY6X 1P2IA 2AERH 2ZPQA 1P09A 1EZUC 1BQYA 1G3BA 5HIYA 1T32A 1NPMA 1L1JA 4K69A 3A8CA 1KXFA 1P2JA 2GZ7A 4CREA 1DUAA 2VWOA 4U32A 2FWWA 1TWXB 1GBDA 2LPRA 4OM9A 1QBNA 2IN2A 3KQ5A 4KTUA 1UHBA 1V2MT 1AZZA 2GTBA 2V3MA 1YLCA 3BIUH 4Q2KA 1GWAA 1QRXA 1V6DA 2A31A 1XKAC 2WINI 3F2HA 4UFGH 4IBLH 3SNAA 1UK2A 1KY9A 1HPGA 5CHBA 3UTUH 1BCUH 1FQ3A 1GI5A 2OP9A 1EFRD 1NN6A 4Y7BA 3MU1A 1EB2A 4X1SU 5AVDA 1A7SA 2GVFA 1A0LA 3QWCH 1WDIA 1H8IH 1L1GA 1NFUA 4JZFH 2DE8A 2BDIA 2ZIQH 1SLUB 1ELVA 2ZDKA 1IOEA 1MTNB 5FBEA 1HJAC 1CA0B 3EA9A 3LU9B 1GMCF 2H2ZA 4WWYA 2KX4A 3MU5A 1TQ0B 3R3GB 3VXEH 4HG6A 2QAAA 4JK5A 2BD4A 1ORFA 1K1MA 3ZYDA 1HUTH 2W26A 3PROA 4NIWA 1B5GH 1O3LA 1S6LA 8LPRA 1A0HB 4XDEA 1C5RA 1ELAA 1MCTA 1ZHRA 2OBQA 2QY0B 1GHAG 3PYHA 1EZQA 1CT0E 1VGCB 4NFEA 2XNIA 1ANBA 3VG8A 1W3CA 2Q1JA 5L30H 1ELGA 1P2MA 2FOGA 3PLPA 4NIYA 2ZTYA 1YYY1 2FYRA 1MCVA 3BG4C 1VITH 1XXDA 3T26A 2ZG0H 4I31A 4A1TA 3MQKC 2J98A 1C1QA 1QL8A 2Z7FE 4D9QA 1MH0A 1N6YA 1XVOA 3ZVGA 1P9UA 3CNRA 1G2MA 1FX0B 3MU0A 2W3IA 2ULLA 3AK5A 4I8JA 1D6RA 1OX1A 2Y6TA 3GY4A 2YMSD 1FDPA 4XE4A 2AYWA 2P8OC 1P05A 2OUAA 2HNTE 1E0FD 2PKSC 5ESBA 2F9BH 2JIZD 2O8UA 1Y3WA 1AFQC 1ZPBA 1ZLRA 4X2VA 1EUFA 1QZ8A 2VIOA 5FPYA 2FZZA 5FBIA 2XCFA 3V13A 3M5NA 1S6HA 2W7SA 3HPTB 5DP9A 3A87A 5T3HA 4TSFD 2XC5A 4GUXA 1KXBA 4X1PU 1LDTT 4X1NU 3TK5A 3GCTG 1O3EA 2HALA 2PUQH 1SGRE 4UONA 3TJOA 2TGAA 4MDSA 2CMYA 4YESB 5C20A 2PW8H 1F2SE 3TNTA 5CMXH 3ENSB 2Y81A 1IQHA 2OBOA 1O2OA 3SHCH 1UTLM 3JZ1B 3T5FH 5K7RA 5LGOA 1BBRH 2ZU5A 3T62A 1C5YB 3RXVA 4DY7B 3UWIA 1AKSB 3BV9B 3U8TH 3ZVAA 1HBTH 1J9CH 1GBEA 2AS9A 1NT1A 1DS2E 2FMJA 2PFEA 3SU6A 5CHAB 5BPEA 3SU3A 4LZ4B 2ILNA 1GCDA 2GCTC 1Q31A 1K1NA 2PUXB 3F9FA 2QIQA 3QTVH 1W0ZU 1C1MA 1YM0A 2STBE 1ZMNA 4X1RU 1SQOA 1QBOA 2OC8A 2V3HH 4FXGH 1YPEH 2J97A 1QQ4A 1TPOA 1C1UH 4OS6A 4FU9A 1SGCA 4XFQA 3LONA 3RU4D 4AZ2B 1MBMA 5E0GA 7GCHG 3UY9A 4H4FA 2PKAA 1OP2A 4ZXYH 4ZCNA 4D7GA 4I33A 2ESTE 2ZECA 4O3UA 2F91A 1GJDB 2QF3A 2HWLB 4NSVA 1K1IA 1BRCE 4TWYA 4I8KA 3EA8A 3PO1B 1GI1A 2RA0A 1UVUH 3B9FH 1BTYA 3ZVCA 1ZGIA 2OQUA 4BTIB 4D9RA 2ZFPH 1TNJA 1UK4A 4ABAA 1NS3A 1SR5C 2Y7XA 1YCPK 2XBXA 5DN6D 3BN9A 2IOTA 3MNSA 3BTGE 4DURA 1GMDF 1MZDA 3EYDA 1AVGH 4DJZB 1FXYA 5DP8A 1GHVH 1O2GH 2AHME 4AGKA 3BEIB 3KF2A 4A5TS 1ANEA 1SGYE 8GCHG 3N99A 5TCCA 4MG3A 1THRH 3MH7A 1O3CA 1ZJDA 1GHYH 1EP6A 3ZZ3A 2RDLA 2FEQH 2ZO3H 3VEQB 1O30A 2BXUH 3GS9A 3HK3B 1C5VA 4ZHLU 2G5VA 2BZAA 3KQEA 4GHTA 5A8YA 2WPDD 4FUBA 1SLXB 1PQAA 3GYLB 5ESTE 3GDUA 2F9OA 2B5TB 1EP5A 2P95A 2KM0A 1K1JA 1C2DA 1J17T 4YT7H 2P16A 1GJ5H 3M3TA 1O37A 1GHWH 1S0QA 3SJ9A 1DDJA 4CRGA 3TK9A 1QJ1B 9LPRA 3FAOA 3URCA 5HM9A 1QL7A 2BY7X 4K5ZA 1C1OA 5E0JA 1F0UA 1TMBH 2ZGBH 3MTYA 1NU9A 4AGJA 1UVPA 1W13U 3GY6A 3WW7A 3SV9A 1ID5H 2PKSB 1FPHH 1RTFB 2OD3B 6LPRA 1S81A 1RFNA 2AGGX 1GVKB 1HYLA 1O35A 2DE9A 1WOFA 2CK3D 5B6OA 3VGCC 3ZZ7A 2HGTH 4ZKSU 3RMNH 2FODA 4YOIA 1CU1A 4P00A 1E1QD 4D7FA 2SGQE 3QDZB 4PROA 1IQFA 1QFKH 3UFAA 5AFYH 4JZDH 1T4UH 3UR6A 1Z6JH 2LELA 4B2CA 3A7YA 3RUOA 4R8TB 3HKIB 4KELA 2WSSD 4ASUD 5C5NA 4CHAB 1EXFA 2UUJB 4XBBA 4BTUB 2FIRH 3IITA 2AGIX 3MI4A 4ZXXH 2VH6A 1DOJA 1D3PB 2G00A 5LPEA 2XBWA 2VIQA 3TPIZ 1PQ5A 1NFYA 3QO6A 1FZZA 3P70B 4RSPA 4Z6AH 1U6QA 1YLDA 3A80A 2RDEA 2HVXA 2F83A 3SQEE 2BD7A 4NGAH 1O3AA 1ZTLA 4Y0ZE 1ELTA 5DSFA 4CR9A 3F0PA 5LPFA 3N7EA 2C3SA 2ZTXA 1P02A 2XOKD 4Y10E 1G30B 3KYFA 4CBNA 4WY3A 5FX6A 3L6PA 5IYTA 2VU8E 2XC0A 3UOUA 2CGAA 3SUDA 2M5TA 5A0CA 1YPJH 3DSOA 1C5UA 3D49H 4YT6H 1GJ4H 3RXQA 2J34A 3F9GA 3ITIA 4DGJA 4RT1A 3SNCA 4BTTB 3ZVBA 3AASA 2AIPA 1GCTC 2BVRH 3DFJA 2GP9B 1ETSH 1C1SA 1P0SH 2H1UA 5T6FA 3SV6A 2D26C 4A1XA 2XC4A 3K6YA 1SQAA 3UAIC 1V2KT 1GHBG 1RJXB 1Y3XA 1W10U 1MBQA 3LOXA 2ANKH 4DIIH 1P2QA 2GCHG 1C2IA 2ZQ2A 2Z3CA 2VVVA 2A4QA 3QLPH 3K6ZA 3M5MA 4GLYA 1ANDA 4Y7AA 2BD9A 3FO8D 2Z6BD 4NZLA 1SOTA 2EC9H 1O0DH 4U01A 1YPLH 1T8NA 3RXRA 5C5OA 3GY8A 1CE5A 2ZPRA 3ZZAA 3AVZA 1KXAA 1RIWB 1P10A 4KP0A 2PLXA 4JCNA 4CRBA 1C1WH 1CBWC 1BMAA 1TNLA 3TNSA 1XM1A 4YO9A 5AF9H 1ELEE 3C1KA 1DM4B 1EJAA 5FHTA 3TITA 4TY7A 2PSYA 1GBMA 3EE0B 1O3IA 3AAVA 4DVAU 2QYIA 1OPHB 2TBSA 1Y59T 1TGNA 1MAYA 1LHEH 1QY6A 1KXCA 2HPPH 1GI7B 4XOJA 1TNKA 3ZVDA 4JMYA 5A8ZA 1O2MA 3I29A 4D76A 1ANCA 1E36B 5JYIA 3MU4A 2ODYB 3NCLA 4WMFA 1C1TA 3F9HA 3H7TA 4NA7A 4X0WU 1G3EA 1NY22 4WH6A 1A2CH 3SNDA 3ZZ9A 1P2NA 1IQMA 2J4IA 1H9LB 3OEED 1ZHMA 1IQLA 2FTLE 5JBCS 3EA7A 1O3MA 1WUNH 2VBCA 2RFKC 3A7VA 4ABBA 1D4PB 4RKJB 1RXPA 3FANA 2PGQB 3OTPA 1TRYA 2ZDLA 1YCPH 3ATKA 1HAZB 4FOUC 4ABHA 1JBUH 5F8ZA 2Q6DA 2IPHA 2IJD1 5G4BA 1NRSH 3LC5A 4XBCA 1C5LH 3KHVA 1W12U 1IQJA 1KXDA 1ARCA 1SGFG 1YY3A 2ZPSA 1BBRK 1THSH 4BAHB 2BLQA 1GBLA 3T25A 1AB9C 2CN0H 1OKXA 1SLVB 3S9CA 1WSSH 2WV5A 4LK4A 1BMNH 3ZZBA 1P11E 1DWCH 2JKHA 1HJ8A 1O2JA 2XWAA 2ANMH 5LH8A 5EPYA 1YLNA 3A8AA 1MABB 4ABIA 5DP6A 1FONA 3SJKA 4IC5A 1E79D 3TH2H 3HK6B 1EAUA 2ZC9H 4NIXA 1OWKA 1S6FA 2A4GA 3QTOH 1A5HA 1Y3VA 4NSYA 4Y6DA 1AUTC 2FESH 1OOKB 1GPZA 2ZQ1A 5F03A 1VCQA 1ABJH 1BA8B 1ZJKA 4X8VH 1HRTH 5EQQA 3U8RH 3HKJB 2PGBB 1H8DH 2JJ2D 1KLJH 1CA8B 3BTQE 5HGGA 3ZZ6A 2ZU3A 1GJ9B 3SZEA 1ELFA 1GJAB 3RXFA 2ZU1A 1AO5A 4INLA 1LKBA 6GCHG 1NRNH 3P8GA 2WPIS 1BTXA 1NRQH 3MO6A 1V2NT 2AFQB 3Q3KA 3FP8E 2UUFB 1A3EH 3LGWA 1Q3XA 3ZIAD 1C2GA 3A86A 3F3BA 4KTCA 4IN2A 5KECA 1WV7H 4NA8A 1EJMA 1EX3A 1J14A 3EQ0H 1OXGA 2BX4A 4KGAA 4OGXA 2P3UB 5T6DA 1SGFA 2ZHFH 3ZZ5A 1TOCB 1TRNA 2VVCA 5CE1A 1F0RA 4O97A 1O2QA 4HI3A 1KLTA 1G2LA 2GDEH 3K9XB 2FI5E 4YOGA 2FO9A 3U98H 2Q6FA 1SGTA 2YNBA 1IHTH 1EPTB 1O2VA 1BMMH 1CT4E 1LQEA 5I46H 1D3DB 3PV4A 1C5SA 2FYQA 3SGQE 1TNHA 3O8CA 3RXBA 1LVYA 3M37A 3GCHC 1GHAF 1C5ZB 3PRDA 1GBBA 2C8WB 4ZH8A 1ZOMA 1SHYA 1WQSA 4FU7A 2ODQA 2QV1A 2KCOA 3RXLA 4H6SB 1GJ7B 2FI4E 4B2AA 3E6PH 1O3NA 4NWKA 6ESTA 3KNXA 4GAWA 6CHAB 1MAXA 3TLOA 5EPNA 2GV7A 3SZNA 3NKKA 4I8LA 1GI6A 3UREA 3LGIA 2HLDD 1PYTD 2BVSH 1W0KD 2OCVB 1ZSLA 3SGBE 4UFEH 2OQ5A 2FXRA 1G37A 3BTDE 2PTNA 1DFPA 1FAKH 3BTTE 1SVPA 3QUMP 4HTCH 3QN7A 2LP6A 3BTHE 4VGCB 4ABEA 4O03A 1P04A 2PV9B 1O5BB 2BMGB 5ETXA 2FLRH 1LVOA 4DW2U 2F9PA 1EJNA 3RMMH 3RXUA 3GCTF 4THNH 3ZVFA 3KQBA 2QXIA 1H9HE 2HOBA 1C2HA 1EPTA 1LCYA 1ZHPA 1AHTH 1GG6C 3B23B 1P3EA 3A88A 2ZFTA 3SV2H 1XXFA 1DXPA 3DD2H 3GY2A 2BVXH 2BD2A 3LKWA 1HJ9A 3MO3A 1P2OA 3ZV8A 2FOEA 4DCDA 3FZDA 3HGPA 1P9SA 3OFND 4Y8YA 3PMJA 3W94A 5F8TA 1D6WA 1D3TB 1DANH 2V6NA 3R0FA 1HXEH 1P03A 3OY6U 1N6XA 1W14U 3NRLA 3TJNA 1C5TA 1TBZH 3PV2A 2JETC 4QT8C 1LPGB 4JYTA 1PPEE 5EGMA 2R3UA 2VVUA 2CHAC 1HCGA 1BOQA 1VKYA 4K3JA 3F0OA 4TYDA 2WPMS 1RD3B 4BXSA 3LIWA 1LMWB 1MD8A 7GCHF 1AI8H 3HATH 1QQUA 1Q2WA 1KMHB 1V2UT 3F2FA 4AFSA 4JZIA 2OC0A 4WH8A 2L6OA 3RM2H 1QGFA 1TX7A 4AG2A 5DGJA 2Z9IA 5HXFA 4BANB 1KSNA 1V2RT 1E35B 2FOBA 1BIOA 1S82A 1KDQB 1PJPA 3MH6A 3ATMA 4YZUA 1LVBA 1DUEA 3DFLA 3KQDA 1LKAA 1TONA 4AYVB 1FAXA 1BTHH 1SPJA 3RXTA 4X8TH 1ELBA 1S85A 3BTFE 3V3MA 5EW1H 5EG4A 1TBQH 1ZR0A 4DOQA 1KTTB 1HAGE 1W8BH 2W5EA 5EODA 4YLUA 1UCYE 3NUMA 1GJ6A 5EXMA 2TRMA 8GCHF 1CHGA 1SOZA 1C5XB 1AUJA 3KQCA 2ZU2A 1ZGVA 3BEFB 3A84A 4FUHA 4CRCA 4U2WA 2ZCKP 3LH1A 2THFB 1SMFE 1V2QT 3Q00A 3QZRA 5J4QA 1V2LT 3LC3A 3GICB 2SGEE 1BRAA 4ABFA 2BOHB 3FOAA 1JIMA 2GT7A 1O3JA 1B7XB 4ASHA 1TMTH 4TT3D 3H7OA 2GZ8A 1QJ7B 3S9AA 3M7UA 2JH6D 1FY1A 2ZFSA 2F9UA 1DSUA 4AOQA 1MKWK 2V0BA 1MTVA 2FPZA 1C9PA 1L0ZA 1RTKA 1TA6A 5AHGH 4NWLA 4B73A 1C1PA 2VGCC 1Z1JA 3KCGH 1P8VC 1LHFH 1KIGH 1CHOG 2BDCA 1V2TT 2ZP0H 2VJ1A 1UW7A 3L3TA 4X2XA 1NRRH 1HAXB 4FUFA 2UWPA 2FOMB 2NWNA 1ZPZA 4Q7ZA 1MKXK 1HAYB 1HJAB 2BLVA 3SBKA 1VITG 2G52A 4I86A 1C1NA 2W6ID 3SI3H 2GMTC 5C67A 1WTHD 1HXFH 4Q4LA 1A5IA 1HV7A 1ZMLA 3D23A 1MTWA 2KZ4A 2FX4A 1TPSA 1LHCH 2WPHS 1YCPM 1A3BH 2VIVA 1P3CA 1SFQB 4I8GA 2H9TH 1AKSA 4X8SH 3NWUA 4JZ1A 1H9IE 3M5OA 3RXEA 5C0UA 2D2DA 5F8XA 1BTWA 1PPZA 3KEEA 5GWZA 3ZZ4A 4H42U 3TVJB 1FPCH 5CDFE 3BG4B 1SI5H 2CJIA 1LQDB 1T8LA 4FUIA 1AVWA 4Q7YA 2A5IA 1COWD 3GCNA 2VIPA 3K65B 2BX3A 5A0AE 3BTME 1GI3A 4M9FA 4A6LA 1DSTA 4GPGA 4YLQH 3F68H 1DICA 4Q80A 1TNIA 3A89A 3QGNB 1NC6A 3VB6A 3T27A 4CRFA 1W7GH 1SGPE 1PPGE 3M7QA 1JRSA 3ZZCA 3RXSA 1J16A 4Z0KA 2P8OB 3TIUA 2GT8A 1FV9A 3VPKA 3U1IB 5TJXA 1GI4A 1OS8A 3AW0A 3MNXA 1UTQA 1QHRB 2ZHQH 4K1TA 1AFQB 4ZHAA 4ISNA 1EOLA 3VB5A 5JDUB 4UE7H 2BQ6B 1UCYK 2A0QB 3MFJA 3RU4E 4F55A 2PP6A 2I6SA 3I77A 2GKVE 4JYVH 1A1RA 3KYGA 1B0EA 4IC6A 3RXIA 2Z9GA 2NU0E 2UWOA 3N7OA 4TPIZ 5C94A 1UTOA 1QURH 4ZKRU 1GHBF 3EE7A 3SUFA 2BQWB 2W6JD 2WUBA 1AVXA 2LNCA 1DT2A 2ZFRH 2PHBA 3E0NB 2GCHF 3T2NA 2VNTA 4AC9A
chains in the Genus database with same CATH topology
3MHWU 2P94A 1XVMA 2ZGHA 2AMQA 3ZV9A 3STJA 1SGQE 4CR5A 5L2ZH 1O39A 2PTCE 3UNSA 3BIVH 1Y3YA 3M35A 1V2JT 1O5FH 1LHDH 2AMPA 5FXLA 4FVDA 3RXMA 1JOUB 4F4OC 3UQOA 4GCHG 3U8OH 2GCTB 4O3TA 1UTPA 2RA3A 1DPOA 2SGPE 1TLDA 1V2VT 4ISOA 4B71A 1XX9A 4K1EA 3MH4A 2GX4A 1BRBE 4LXBH 1T7CA 1BHXF 3MH5A 3RXKA 3TJUA 1MUEB 1A61H 3JZ2B 3UWJH 1G36A 1C1RA 1UTKA 3F9EA 1GJCB 2XCNA 3SOSA 2R2WU 4ZHMU 1C5NH 5GCHG 4BAKB 2ZF0H 1DX5M 1SSXA 3RXCA 1YPHE 3ATIA 1VZQH 5H4IB 1AY6H 4R0IA 1HAVB 1DLKB 3PTBA 1ESAA 4BAOB 4I8HA 1DE7H 4FVBA 1GBIA 4MTBA 1O2YA 4Y71A 5L2YH 3S7HB 1O2NA 3SW2B 2UUYA 1EASA 3LGUA 1MU8B 3CS7A 1EKBB 1CQQA 1FY4A 3RXPA 3ATWA 1O36A 2J94A 4WXIA 1TGSZ 2B7DH 1ZPCA 2C4FH 1EZSC 2Y80A 1SBWA 2BD5A 1YP9A 1C2MA 1WYKA 1AN1E 1O38A 4E7NA 4J2YB 4ABJA 1MD7A 3VB3A 1UVOA 2VWNA 2OXSA 2HRVA 3M36A 1QTFA 3SNEA 4BAQB 1CO7E 3I78A 1O5GH 2CF9H 1AQ7A 1BT7A 1C2FA 4GVUA 3UPEA 1MMJN 1RGQA 1UTMA 1O2IA 1Z7KA 2ANWA 1WTGH 3ODDA 5SGAE 3U1JB 4DT7B 4E05H 1RRKA 2TGTA 1HNEE 2UWLA 4B76A 1O2ZA 1FLEE 2VH0A 1QBVH 3KGPA 3M7TA 3Q77A 1GBTA 1S0RA 4Y11E 1DY9A 1MKWH 1AWFH 3GISB 1AD8H 2Y5HA 2FLBH 1YC0A 1DWEH 2J92A 1DY8A 1NM6A 1TPPA 1BUIA 1WU1A 1ZTJA 1AE8H 3VGCB 1GBJA 5JB8S 4AG1A 2EEKA 1HAVA 6GCHF 5GDSH 3PLBA 4M7GA 3RXAA 2SGDE 3RMOH 1QA0A 3OX7U 2D8WA 1L1NA 3ODFA 1J15A 1V3XA 2TPIZ 1MKXH 1O2TA 2PWXA 1WBGB 2O9QA 3GY5A 2AIQA 4K8BA 4WJG2 1TPAE 2BZ6H 4ZMAH 1O2XA 1YPKH 1MZAA 5C3NA 1C4Y2 2FI3E 1BMLA 1MTNC 2BDYA 3RLYH 4E7RG 4Y76A 1FUJA 2SFAA 1CA0C 1P01A 1GMHG 4MVNA 1Z8GA 3W95A 3UNRA 1X7AC 3M61U 2GDDA 2V3OH 1GI9B 5A2MH 1O31A 1OWDA 1SGIB 4MPUA 2G4UA 1FN8A 1T8MA 1TX8A 3Q3YA 1VGCC 3LJOA 5I25A 5A0BA 4LOYH 2A5AA 1VJ9U 2FOHA 2WYGA 1DVAH 1GBKA 4ABDA 1F7ZA 1BTPA 2BDBA 3O8DA 1NZQH 1O3FA 3SJ8A 4AFUA 2VWMA 3S0NA 1K22H 1C5OH 1EAWA 5EOKA 1XUFA 7LPRA 1NU7B 1V2PT 1NRPH 4ZAEA 5DP7A 1TMUH 1GCTB 2XBVA 1O32A 4XBDA 4MNYA 3LDXH 1O3OA 1PQ7A 1S83A 2Q6GA 1C1VH 1BJUA 4JZEH 4I7YH 3QZQA 2OC7A 1TGTA 3D62A 3LGVA 2NU4E 1UCYH 4D8NA 2ZGCA 1O3GA 3VFEA 4OS1A 2XRCA 1AGJA 1QRZA 5BRRE 1TAWA 1JXPA 3BF6H 2O8TA 1SHHB 3F6UH 4Y79A 2RCEA 1P06A 2EI6A 1ACBE 5EXNA 3SGAE 2D1JA 4SGAE 8ESTE 3MU8A 1INCA 1XUGA 1D9IA 3MOCA 3SJIA 4B75A 1K28D 1F5RA 1XUIA 1GBCA 3GCOA 2P93A 3P95A 2A5KA 4OS4A 1CBWB 1EB1H 3AAUA 1HDTH 2BYAX 4WVPE 4A1VA 2PR3A 2W7UA 2QGRA 3SUGA 1LTOA 1O2LA 3H5CB 3Q76A 5GXPA 1HAOH 3VXFH 2FOCA 5E0HA 1TRMA 2BOKA 1GI0A 1N1LA 3MWIU 5JPMH 1HLTH 4AB9A 4IGDA 5CHAC 5FPTA 1QA7A 2ZEBA 2I6QA 3MNCA 2KAIB 1CT2E 1OWJA 3UQVA 2BY5X 4FUJA 4DIHH 3T28A 2P59A 4LZ1H 3L33A 1PPHE 2ALVA 1P2KA 5DG6A 1GI8B 1IQGA 3GYMA 4INHA 4X1QU 2ASUB 3PTNA 1HFDA 2A2QH 5JBBS 3SUEA 1F5KU 1W0YH 2AMDA 5FCRA 1RS0A 2QC2A 4RKOB 2P3TB 2XYAA 1SC8U 2BTCE 5T6GA 1LPKB 1WAYB 4MPWA 5DO4H 1F5LA 1G9IE 1DLEA 3E8LA 5DP5A 1O3KA 3PO1C 1SFIA 5GIBA 4NFFA 5L6NH 1H1BA 1MU6B 4NG9H 2H5CA 1Z6EA 2QCYA 1K1OA 2XW9A 1G3CA 3P8NA 1BTZA 4WF8A 4TPYA 1AB9B 1O3DA 2ZNKH 4AFQA 4K1SA 1GJBB 5C2ZA 2Y7ZA 3S7KB 1C5PA 3P17H 3SN8A 1T31A 2A7HA 5FPSA 3B8JA 4GSOA 3OYPA 3SO3A 2NU2E 1TALA 3P6ZB 9ESTA 2ANYA 3RP2A 3V0XA 2A32A 3S69A 1EOJA 1SGNE 3RXDA 5HMAA 2AGEX 1MQ6A 4NCYA 2Z9JA 2WPLS 2C93B 1TE0A 5HYOA 5J4SA 7ESTE 3NXPA 1QL9A 2KAIA 3PMBB 1SL3A 5DKMA 1K1LA 2QF0A 3DA9B 1ELDE 2WV4A 5PTPA 1GJ8B 2P3FH 4CBOA 3CS0A 3SU0A 4CH8B 4MLFB 3O8RA 2HLCA 1Z1IA 1YBWA 2F3CE 3FP6E 1IQIA 1NFXA 2GV6A 1Y5BT 1ETTH 1JWTA 4ISLA 2H6MA 4MNWA 1ZSJA 2ZDAH 2BY9X 2BDHA 1EQ9A 1G3DA 1CGIE 1K2I1 3PMAB 4WMEA 3MNBA 4UFFH 5DPAA 2PKAB 1GVLA 3ATLA 3QX5H 1Z8JB 1Z8IB 5ABWA 1CHOF 1CGHA 1O2PA 2C8YB 4AFZA 3S9BA 2G4TA 1KLIH 1V2WT 1GMCG 2A4OA 2WPKS 5EU8A 3U69H 2QXJA 1EZXC 1VITF 1FY3A 3EAJA 3C27B 3TGJE 1UVTH 3TGIE 1Y3UA 1YPHC 1P57B 1M9UA 1YPGH 4X6PA 1TFXA 3SORA 1T8OA 4OS7A 1W7XH 3NK8A 4OS5A 5DJ7A 3STIA 3ZZDA 1O2SA 2ZTZA 2ZZUH 1C5MD 3ZVEA 4I32A 2EA3A 1VR1H 4CHAC 4ZUHA 2B0FA 1BTUA 2F9NA 1Y5AT 3GCHB 4AN7A 1TABE 1L2EA 1O5DH 1CVWH 4K60A 1FMGA 3URDA 1GI2A 2J38A 2Z3DA 2W3KA 3KN2A 1FN6A 2RG3A 5EW2H 2AH4X 1DWDH 2B9LA 3A8BA 1O3BA 3MMGA 1OSSA 1EAIA 2BLWA 2Y5FA 4IW4E 3TGKE 1PFXC 1UVSH 4X6OA 1TQ7B 4MPXA 1A46H 3AW1A 2A1DB 2J95A 1EAXA 3OTJE 2ZCHP 5FAHA 4IS5A 2QXHA 3UR9A 2O8WA 3A82A 4DG4A 3MO9A 3A7XA 1Y8TA 1HIAB 1C2EA 2BY8X 2SGAA 5JBAS 1HAHH 2A7JA 2JH0D 4Y0YE 1OWHA 1E34B 3D65E 2G5NA 4ZROA 3P8FA 3U9AH 2G55A 4H6TA 1KDQA 3RC6A 3PWCA 1F0TA 1DWBH 3LGYA 1GBHA 4BOHA 1IQEA 1D3QB 1THPB 2ZDNA 4UFDH 1QJ6B 2R3YA 3GDVA 3PMHB 1L4ZA 1QCPA 4BAMB 1LHGH 4NA9H 1OWIA 4ISIH 1GG6B 4A7IB 1FY5A 1PPFE 1AMHA 2H9EH 3GY7A 4WXVA 1SB1H 3PLKA 4FU8A 3M3SA 4BNRA 1OP8A 1GDQA 2VIDA 4B74A 1FIWA 2VWLA 3IG6B 1K1PA 5GJ4B 4ESTE 1ZZZA 2A4RA 3CENA 3SNBA 1HGTH 2WUCA 4Y8ZA 4AB8A 4YM9A 1MTSA 2OC1A 1RIWC 1O2RA 2C90B 4GCHF 3P92A 5F6MA 3DUXH 1PPBH 3OSYA 2XXLA 1TBRH 4ZKOU 4KKDA 2JETB 3TH4H 1JIRA 1G32B 1XUHA 5LPRA 2CHAB 4FUEA 2FS8A 1HIAA 1TNGA 1YF4A 4OS2A 5JB9S 2IJOB 3DHKH 4JYUH 4IMZA 3MYWA 3PM3A 2YOLA 1OYTH 3A7TA 1KXEA 3TU7H 5EQRA 5IDKA 1JMOH 4O9VA 1V2OT 2H9HA 4YOJA 3QK1A 1SQTA 3OU0A 2XBYA 3QGJA 3UNQA 1UTJA 1VCPA 2UUKB 1KYNA 2FM2A 2H5DA 3BTEE 2G8TA 1GGDC 3BEUA 2FOAA 1GHXH 4IN1A 5GCHF 1GMDG 3FP7E 4MNXA 5TCAA 1DXWA 1TGCA 2EI7A 3A85A 2V35A 5E8EH 1W11U 4CRDA 3E1XB 2Z9KA 3GY3A 1BJVA 4GHQA 1UTNA 2G51A 3PWBA 2OLGA 3LJJA 2FTMA 1B0FA 2QA9E 4HZHA 1PQ8A 1NO9H 2BM2A 3A8DA 4CRAA 3TK6A 4JK6A 1QR3E 1YGCH 2CXVA 1F0SA 1GDNA 1Z71A 1YKTA 2ZGJA 1UK3A 4IMQA 4E06H 4OGYA 3RU4T 2BD3A 5FCKA 1HB0B 3TJVA 1HAIH 2BDAA 3KIDU 3E0PB 1ESBA 3GDSA 3VB4A 4HGCA 1K21H 2ZU4A 1UO6A 2TIOA 2XWBI 1DITH 1ZYOA 2DUCA 5FX5A 3HGNA 1QIXB 1C2LA 4Y8XA 1ESTA 1ARBA 5EQSA 5C1XA 1O34A 1S5SA 1PPCE 4A92A 2Z9LA 2BDGA 1C2KA 2ZA5A 1EATA 7KMEH 4CH2B 4MNVA 3TH3H 3O8BA 3EDXB 2BQ7B 1BBRE 2FP7B 2FDAA 2C8ZB 1XMNB 1GHZA 1ZSKA 2FOFA 2OINA 2QN5T 4Q7XA 1BRUP 2NU3E 1AU8A 2VGCB 2A45B 1C9TA 3V12A 2BHGA 1C4U2 1ZTKA 2AEIH 2OTVA 3FFGA 1A4WH 3ESTA 3DT0H 1WCZA 3IWMA 1BZXE 1SG8B 1RTLA 2BB4A 3RXGA 1H4WA 1XUJA 3VB7A 3SU5A 2ZFFH 3A81A 3RMLH 1FJSA 1TB6H 4UEHH 4X8UH 1O33A 2YNAA 1O3HA 2GMTB 3RM0H 1BB0B 2C8XB 1GBAA 1AIXH 1XKBC 2R9PA 2JH5D 4AX9H 1OWEA 2O8LA 1VCWA 1UJ1A 2ZHDA 2WPJS 2O8MA 3RC4A 1KTSB 2ZWLH 1GVZA 1NROH 4B1TA 3T29A 3A7ZA 2NU1E 2ALPA 3BG8A 4ISHH 3LGTA 1FNIA 3A83A 4RN6A 1GMHF 3FZZA 2BLOA 1BITA 3RXOA 3RXHA 8KME2 1N8OC 3SJOA 4ABGA 1QNJA 1EPTC 5DK1A 4FUGA 4X2WA 4XSKU 4AYYB 1QB6A 1OP0A 1J8AA 1AWHB 2ZGXH 2R2MB 3NPSA 1LPZB 3M5LA 1W2KH 3ZYEA 3BTKE 1ZRBA 4WMDA 1TA2A 1UMAH 4X6NA 1NFWA 1FI8A 1ETRH 1JRTA 4KTSA 4K8YA 4TWWA 1BHXB 2A7CA 2J9NA 5GPIB 2GGVB 1IQKA 1A5GH 2ODPA 3A7WA 1OYQA 4ZKNU 6CHAC 2QXGA 1TIOA 3K2UA 2ZCLP 1HAPH 4BXWA 2ZI2H 4NIVA 3ZZ8A 1Z8RA 1TGBA 3EGKH 1LVMA 1TOMH 2ZFQH 1ZMJA 2F9VA 1WQVH 4J1YA 3P8OA 1P12E 1O2KA 1C2JA 2VIWA 1GGDB 2GD4B 3RDZA 1A0JA 1ABIH 2CF8H 1S84A 1AE5A 1YPMH 4X2YA 1GL0E 3CP7A 2SNVA 4MQAA 3F1SB 2BD8A 2WYJA 4SGBE 2A2XH 1SGDE 4VGCC 1ZRKA 1C4V2 1NESE 1CSOE 2Z94A 4NZQA 2HNTC 5EXLA 1CGJE 2CV3A 3SI4H 1O2WA 1GDUA 2XTTB 1PYTC 3PB1E 5E2OA 3FVFB 2TGDA 2B8OH 3E3TA 1O3PB 1AFEH 1ELCA 1L4DA 1LO6A 3WY8A 1QB9A 3V7TA 3E16B 3OY5U 2TGPZ 5A8XA 1QB1A 1C5WB 1SGEE 2Y5GA 3RC5A 2GZ9A 3GOVB 2K1QA 3RXJA 4U30A 3SU4A 3RLWH 3UOPA 4FUCA 1E37B 3NZIA 1AZ8A 3SHAH 1O5CB 4B2BA 4UD9H 3BTWE 3LH3A 4TY6A 1TX6A 3LT3A 4MPVA 2G81E 1SLWB 1IAUA 1UHBB 2ZHWH 3SQHE 1TYNA 1O2UA 2Z3EA 3M3VA 2HPQH 4INKA 2EI8A 2STAE 1IHSH 5C1YA 1O5EH 5C1UA 5K0HA 3SU1A 1GBFA 1E38B 1K9OE 2J2UA 5DP4A 5HM2A 1VJAU 1C5QA 2ZKSA 3SV7A 1Y5UT 5JBTA 3LPRA 4F49A 1FIZA 4FUDA 2Y82A 1MTUA 1V2ST 2R0KA 5A09A 4AORA 1T4VH 1O5AB 3KL6A 2HNTF 3G01A 1QRWA 2SNWA 2PSXA 2FX6A 3SV8A 2ZDMA 3E90B 2FS9A 3SU2A 3Q3XA 3ELAH 4X6MA 2R0LA 1XUKA 1FY8E 2VINA 4HFPB 1F92A 5AFZH 2ZDVH 2SGFE 3UUZA 1O2HA 1IQNA 2BXTH 1MQ5A 3BSQA 1N8OB 1GL1A 4K2YA 3UIRA 5DP3A 5E2PA 1BDAA 3E91A 4YTAA 1NTPA 4UDWH 2VB0A 2ZHEH 2BY6X 1P2IA 2AERH 2ZPQA 1P09A 1EZUC 1BQYA 1G3BA 1T32A 1NPMA 1L1JA 4K69A 3A8CA 1KXFA 1P2JA 2GZ7A 4CREA 1DUAA 2VWOA 4U32A 2FWWA 1TWXB 1GBDA 2LPRA 1QBNA 2IN2A 4KTUA 1UHBA 1V2MT 1AZZA 2GTBA 3BIUH 1YLCA 4Q2KA 1GWAA 1QRXA 1V6DA 2A31A 1XKAC 2WINI 4UFGH 4IBLH