3LGVA

H198p mutant of the degs-deltapdz protease
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
217
structure length
204
Chain Sequence
QFDSTDETPASYNLAVRRAAPAVVNVYNRGLNLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGNFLQTDASINPGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 46
structure length 204
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgvA02
1JOUB 1S83A 5F03A 4BTIB 4UE7H 3S9CA 5AVDA 1CT2E 4ZXXH 4CRBA 1HUTH 2AFQB 3SJIA 1TPPA 1SGRE 6CHAB 4A5TS 2CHAC 1MU6B 3DA9B 2PSXA 1Y59T 3A8DA 3ODFA 4YESB 3RXMA 2R3YA 1D6RA 2TIOA 3MU0A 1P05A 2ZWLH 1AKSA 4FUCA 1AHTH 2FMJA 3PTNA 3SUFA 1ZRKA 3SGQE 1EPTB 1QRZA 4X2YA 2QY0B 2BD4A 2OC8A 4WY3A 1TE0A 3U1IB 2FZZA 5FHTA 1GJAB 4A92A 1KSNA 1ZHRA 1SR5C 1D3DB 1WBGB 1J15A 1FIZA 1HV7A 1LMWB 3MO9A 3LONA 3P8OA 1BTWA 1SLVB 1O34A 2ANWA 5EPNA 1FDPA 2FOGA 3EDXB 1QJ6B 1Y8TA 2GTBA 4NIYA 1CGJE 2ZTYA 1ZMJA 1VGCC 3M5OA 3ZVDA 1HB0B 1FNIA 1ZMNA 4JZ1A 5TJXA 2C8YB 1KYNA 1EP5A 2NU1E 1XXDA 2UUFB 2J2UA 3BG8A 2FTLE 1O2ZA 1FJSA 5F8XA 1ELCA 3SOSA 1W0YH 3SU4A 2P3FH 3F9GA 4B1TA 1GPZA 3HK3B 4JK5A 1IQKA 1X7AC 1QQ4A 4LZ4B 7LPRA 2CMYA 1H8IH 3DUXH 2FOEA 4UONA 1XUJA 3TJUA 2C8XB 3M37A 1SGPE 3TGIE 1W11U 2RDLA 4KKDA 3ZZAA 5JPMH 1C2IA 3KL6A 1JXPA 1EP6A 3PV4A 2BVXH 1YGCH 1VCQA 4I8JA 4DCDA 1DUEA 1O3EA 4ZROA 1WV7H 2GZ9A 3BG4C 3LKWA 2UWPA 2ALVA 2XCFA 1QGFA 8KME2 2ZFPH 1O3IA 1TALA 1A5GH 4ZKSU 3MYWA 4HGCA 3MH5A 1JIRA 1ZHPA 2ZO3H 1NESE 4DG4A 4DIHH 1THPB 3VB4A 1GBDA 3LDXH 1INCA 1GL1A 2ZU3A 2Z9JA 3UUZA 3CS7A 1K1NA 2TRMA 1IQNA 1O3OA 1Z8RA 2PGQB 4GVUA 4KELA 2BLQA 4X8TH 2M5TA 5FPTA 3TJOA 5JYIA 2ODQA 3T26A 3P8GA 1C5OH 1C1WH 3TH4H 4M7GA 5ESTE 3P8FA 5CE1A 3NZIA 1C1RA 3K9XB 2XBXA 2ZFRH 1NRPH 2YNBA 3MNSA 3Q76A 1TBZH 1TQ0B 1ARBA 2FO9A 2P8OB 3ZVEA 1GWAA 5GDSH 4JZEH 4YOJA 4BAMB 4JMYA 5ETXA 1C5ZB 1A3EH 1C1UH 1V2KT 4QT8C 1C1TA 1WSSH 4K8YA 1O5EH 3KQDA 1OXGA 1KDQA 4O03A 4HFPB 1O2YA 4ZHLU 5EXNA 4NA7A 3MI4A 2V35A 1BTHH 3LC3A 3C1KA 2O8UA 2H5CA 2OINA 1TABE 1AB9B 1UK3A 3VEQB 4INHA 4KTSA 1W7GH 4CBNA 3TPIZ 5A0AE 1DY8A 4X1RU 3TK6A 1Q2WA 3KQEA 5HM2A 2NWNA 1LCYA 1QJ1B 2BY6X 5FX6A 4YM9A 2V3OH 4Q7XA 3LT3A 4BXSA 1D9IA 1G3EA 1ID5H 2ULLA 1O2PA 2ANYA 4MNWA 1K1IA 4I7YH 1AZ8A 3S69A 2ZPQA 1A61H 2WPJS 4IN2A 4Y8YA 2TBSA 3OYPA 2XYAA 5L30H 2GDEH 3SHCH 5JB9S 1XVOA 1O36A 1M9UA 1SOZA 1V2NT 1C9TA 2BDAA 2STAE 1C2FA 1YPEH 1MAXA 2VWLA 1YCPH 3F9FA 4MG3A 1IQLA 1F5RA 1YLCA 4IS5A 2OP9A 2I6SA 6GCHF 1O3CA 1V6DA 1LO6A 2OLGA 3FVFB 5EW2H 3QZQA 1NPMA 3PLKA 1GVZA 4MNXA 5FXLA 3HKIB 1CU1A 5C5NA 4OS2A 4MNVA 2PW8H 1P06A 5K7RA 1P2IA 1LVBA 4X6MA 4H42U 3ESTA 1LQEA 1YLDA 2C93B 1T8LA 4OS7A 1H8DH 4AX9H 3UWJH 4ABEA 1GBHA 3MFJA 4DW2U 1SLUB 2GP9B 4FU9A 4FVBA 3RXUA 4XBDA 1EAIA 4HZHA 1KTTB 1L1NA 1NRQH 4OS5A 2Z9GA 2Z9LA 3P8NA 1AU8A 2NU4E 1XUGA 1W14U 2VWMA 1V2RT 3O8DA 1N8OC 1KLJH 2ZDLA 3SHAH 1UJ1A 1ZSJA 1TNKA 4MPVA 3RXLA 4CHAB 1GG6C 3T28A 2R9PA 1LQDB 1O2NA 5L6NH 1DWBH 4AZ2B 1GJ5H 1TIOA 3SGAE 1AMHA 4Y8XA 3M7UA 1Z71A 1ZHMA 2BM2A 1IQFA 1P01A 1NTPA 1WOFA 4ZHAA 3TU7H 2BDIA 1QB9A 2A0QB 3SI3H 4TPYA 2Y7ZA 1BB0B 4A6LA 1A5IA 3FZDA 3GY3A 5T6DA 4X1PU 1HAIH 3RUOA 3GCTF 2ZGBH 1DLEA 1SGQE 1YBWA 1W2KH 1QRXA 3RMNH 1DWDH 3K6YA 2FWWA 4Y6DA 1JBUH 2B9LA 3ZV8A 1XUFA 1BHXF 3H5CB 2Z3CA 4TWYA 4ESTE 1ABIH 5JDUB 1TMTH 1G9IE 3GY2A 1CQQA 4R0IA 1YPLH 1CT0E 1Y3YA 1CGHA 1BMNH 5JBTA 1G2LA 5GPIB 4WH6A 1SMFE 3MU8A 5LPEA 1H9HE 1SL3A 1XKBC 2TGPZ 1DXWA 4I8GA 4O97A 1MBQA 3UWIA 3PMAB 4IN1A 3UPEA 1G32B 3RXGA 1G30B 1J9CH 3GY6A 4MVNA 3FP7E 1SC8U 2CF9H 1HCGA 3P92A 1C5SA 1GI3A 3GY4A 1O5DH 3LGUA 4VGCB 2C8WB 3RXQA 3QUMP 1ANCA 5FAHA 2QCYA 1YKTA 2Q6DA 2A4GA 4I31A 5EQRA 2LPRA 2XWAA 4NA8A 1MQ6A 2O8MA 3RLYH 5LPRA 3HKJB 5AHGH 2QF0A 2EI8A 3T27A 3VXFH 3ZZ6A 1AQ7A 1FY5A 2Y82A 4Q2KA 3SUGA 1E36B 4JCNA 5DG6A 2XWBI 5DJ7A 1TMUH 2CHAB 4BAHB 1HAHH 5A8XA 1GBLA 3SUDA 1GI5A 3S9BA 2BD5A 2BY5X 1O5FH 1H1BA 3VB3A 1LKAA 2WPHS 1EX3A 4U30A 2ZDVH 2SGAA 3RU4E 3FP6E 4FUBA 2P94A 1O3LA 3S7KB 4KTCA 3UNQA 1EASA 3TJNA 1O38A 4AB8A 2Q6FA 1O5AB 1BRBE 2FTMA 1MMJN 1OOKB 3LGYA 4ZAEA 2BD9A 4NSYA 4HI3A 2KAIB 1S84A 1J8AA 4X2VA 1BMLA 3GYLB 1AFQB 1WTHD 1MKXH 3PO1C 2YOLA 4WH8A 2F9VA 4LZ1H 1DX5M 2P59A 1OSSA 3BIUH 2R0LA 1G36A 2WUBA 2H9HA 4HTCH 5BPEA 1Z1JA 4IGDA 4BAKB 2QF3A 2PKSC 3EQ0H 5EOKA 1VJ9U 2SNWA 3SU5A 3RXEA 1YPHE 1GHBF 2WV5A 1O3HA 1QL8A 3OX7U 4KGAA 4O3UA 1UTMA 1XXFA 2W3KA 2WYJA 1GBFA 1DXPA 3A82A 5EXLA 3ZYDA 2PLXA 3UQOA 3M3VA 1P2MA 4UD9H 2VIWA 1NU9A 4UFGH 5F8TA 5DKMA 1AO5A 4TY6A 3GOVB 3R3GB 1UTLM 4AB9A 1SQTA 1XKAC 1P8VC 3C27B 1UCYE 5FPSA 1RJXB 4X1SU 1HLTH 1HNEE 2FOFA 1P11E 4X0WU 3LJOA 4AOQA 2PUXB 1EAUA 3ZVFA 3V12A 3BG4B 2OC0A 4B75A 4NIXA 1H9IE 2B0FA 3SBKA 4D9RA 4MTBA 5C1XA 1XUHA 1P09A 1JRSA 2J95A 1HAVA 3KQBA 2AGEX 3F1SB 1BJUA 3SN8A 1KLTA 4B74A 1AIXH 4GPGA 2F91A 3AAUA 3NUMA 4AG1A 1F2SE 1GDUA 3Q3YA 4CR9A 1GVLA 3W94A 3BTME 3BF6H 4DURA 3MWIU 1ESBA 3TK9A 1TA2A 2VNTA 5I46H 5DP7A 1C2HA 3ATIA 5C3NA 2ZCKP 2GT7A 1GI0A 3GCOA 4X6NA 1C4U2 3MNXA 3G01A 1DM4B 1ELDE 2H9TH 4VGCC 1DVAH 4YTAA 1O3JA 3LPRA 3SJ8A 1O2KA 1PYTD 2WPLS 2G81E 4RKOB 3UOPA 2A7CA 1GBIA 1NZQH 1HAZB 5DGJA 1QL7A 2EA3A 2BZ6H 1DWCH 1A2CH 2BX3A 3SU1A 2ZGXH 4K1TA 1F5KU 3A8BA 1ZJDA 3GY7A 2ZFQH 4KTUA 1AVXA 3JZ1B 1A0LA 2XBVA 3CP7A 1THRH 3E0PB 2Z94A 3AW0A 4YOGA 2R2MB 1O2TA 2HNTE 2ZZUH 2PV9B 1A7SA 2V6NA 1V2OT 4E05H 4I32A 1P57B 5IYTA 3BEUA 2B8OH 4MDSA 4Y8ZA 1BZXE 1O2GH 4MLFB 1VR1H 1UHBB 4FXGH 1A4WH 1GHVH 1HYLA 2FX4A 1MD7A 2ZGHA 2ZFFH 4YZUA 5FBIA 4B73A 4ASHA 2XBYA 2Y7XA 1ZLRA 5CHAB 3GISB 4K1SA 2VWNA 4OS4A 3I77A 1YP9A 4X2XA 1C1QA 1F0UA 1FMGA 4YT6H 1KXDA 4JZDH 1P3CA 5G4BA 3BTKE 2AIPA 4IW4E 2BHGA 1C2MA 1ARCA 1AFQC 1FLEE 3T29A 1FN8A 2DE9A 1ZMLA 4NWLA 4CRGA 4GSOA 3K65B 2VINA 1E35B 3QWCH 3AW1A 1DLKB 1EPTA 2FI3E 3SV6A 1RD3B 2FESH 1D6WA 1YPGH 4OGYA 3SNCA 1A46H 1N6XA 4YO9A 1WQVH 1O35A 1GHYH 1V2UT 2QGRA 3L33A 4ABAA 2QA9E 1UVTH 1O3AA 4D7GA 2FIRH 2ZTXA 4CRFA 1SLWB 2BY8X 2RG3A 1FIWA 3S9AA 2Y6TA 1DE7H 2GT8A 3F9EA 6GCHG 1O2UA 2R0KA 1QB1A 3SU2A 2A7HA 4MPXA 2VGCC 2QIQA 3ZZ9A 1V2TT 1Z6JH 5GCHG 1GDQA 1QRWA 3R0FA 3UR9A 1GBEA 3V7TA 1GJBB 4BXWA 3ATWA 5GWZA 1KY9A 3ATKA 1NFXA 2A5KA 1O5CB 1CBWC 3TH3H 3W95A 1ELEE 3B23B 2QAAA 1O2HA 1BDAA 3MU5A 4WF8A 1C5RA 1MKWK 2ZCLP 2OQUA 3FP8E 3VB7A 2VH0A 3OU0A 2HRVA 3O8RA 1G3BA 2JH5D 1C5XB 1JMOH 1SGYE 1W3CA 1DFPA 3CS0A 3MMGA 3MH6A 1N8OB 1AZZA 1VZQH 1O5BB 1V2VT 1BBRK 1O3KA 3SNAA 1GG6B 4ABIA 4GLYA 1EZUC 4XBBA 1UTOA 1TPAE 1C4V2 2XTTB 3ZZ7A 1AGJA 3QLPH 2VB0A 1AUJA 1GBBA 5J4QA 1Z7KA 2CF8H 5LGOA 4RSPA 1V2LT 2EI7A 2BX4A 2ZPRA 3L6PA 1V2ST 3KF2A 2VIQA 1GJ4H 5EPYA 1SBWA 2OUAA 3UREA 2GKVE 3UOUA 1T4UH 1VJAU 1TBQH 2FS9A 3GCNA 3ZZCA 2ZNKH 1EJNA 1TWXB 3DD2H 1KXBA 1GMCG 2ILNA 1YYY1 3URDA 1FY4A 1H9LB 4B2AA 1AWFH 3MU4A 4NIVA 1MQ5A 2C8ZB 1PYTC 3E91A 2J9NA 2GV6A 1ZTKA 2V0BA 1UVPA 1LHFH 1K28D 2JETC 3TNTA 3ZZ8A 1TYNA 1JWTA 1UK2A 1CA8B 2BVSH 3BSQA 3GCTG 1EJMA 4IBLH 3SORA 4NWKA 8LPRA 4RN6A 1O3PB 6LPRA 3FZZA 3MNBA 2XCNA 1OP0A 1UVSH 1LHGH 3PB1E 5A09A 4FUFA 3IG6B 3B8JA 4CRCA 1O3BA 1O2QA 2R3UA 1UTJA 4Q7ZA 4AFQA 1NRRH 2SGDE 3MOCA 5C1UA 5DP6A 1D3QB 3K2UA 1ANBA 1IOEA 1V2WT 5CHAC 8GCHF 2H1UA 1GBJA 4K69A 2A1DB 5CMXH 1LHCH 4U32A 3KGPA 3VGCB 2IOTA 4K60A 1GHAF 2GZ7A 1O2WA 3UR6A 1P9SA 3Q3XA 1ACBE 2QN5T 1HAOH 1LPGB 3RXPA 1NFYA 4Y0YE 1NRSH 1K1OA 2Z9IA 3OSYA 1TNIA 1G37A 3DFLA 2F9BH 3Q3KA 2BD7A 4YLUA 4TY7A 2BDBA 3PWBA 2QXIA 1TGBA 2QXJA 4ZXYH 2ZGJA 2Y5FA 5L2YH 1ETTH 2VIDA 1TNGA 1O39A 1XMNB 3A7XA 3KNXA 1P03A 2UUKB 3E3TA 4B2BA 1C5QA 1XUIA 1OWIA 2AEIH 3E6PH 5BRRE 5GCHF 1S0QA 1UO6A 5DPAA 3OY6U 1ZZZA 1WUNH 1QFKH 2FEQH 2BXTH 2J34A 3VXEH 3KEEA 3UQVA 2XNIA 3M5LA 1GJCB 2BDCA 5F8ZA 2XXLA 2ZGCA 1DT2A 3LU9B 1XM1A 3MH7A 4NFEA 2VVUA 5GJ4B 1O3DA 2VIVA 4WJG2 3T25A 1QTFA 1SI5H 8ESTE 1KLIH 1FY3A 1XUKA 3LOXA 3A7WA 2F9NA 4IMQA 3A89A 2ZFTA 1O2IA 3TVJB 3SV2H 3URCA 5C2ZA 1OWHA 1SGFA 2G4TA 3NXPA 2FM2A 1KXFA 5E0HA 1YPMH 3PO1B 2Z3DA 4CR5A 2DE8A 3ZV9A 1YPJH 1CO7E 4IC6A 1MZDA 4NZQA 1GHZA 2JH6D 3RXAA 3PLBA 2BQWB 4Z6AH 2SGPE 3EGKH 5LH8A 2OBOA 1Y3WA 1UCYK 2PKSB 3E8LA 1EUFA 5JB8S 1NT1A 1OWDA 1O3GA 1Q3XA 2J38A 5J4SA 1AD8H 1LDTT 1BTUA 3QO6A 4J1YA 1BT7A 1GMCF 2Q1JA 1EB1H 1GHXH 2G5NA 1OKXA 1TX7A 2GCHF 1ESAA 1BBRE 3KCGH 2IN2A 1ELFA 4XOJA 3NCLA 2RA3A 3GYMA 1O0DH 1GHBG 3TGKE 2ALPA 1RGQA 2A4OA 2JH0D 1IQMA 1KTSB 1HGTH 2PFEA 2NU0E 3P95A 1NN6A 2ZTZA 1NU7B 4INKA 2EI6A 3QDZB 1KXAA 4ABJA 4CBOA 4CRAA 3GY8A 1SGDE 2VVCA 3NWUA 4Y11E 1ELTA 3ZVBA 4CH2B 3A85A 4FUDA 3RMOH 1TX6A 1OS8A 2RA0A 3BTFE 1MBMA 2VU8E 1C5TA 1GI8B 1LTOA 1S82A 2BQ7B 5HXFA 1OP8A 1GL0E 2FP7B 1ZRBA 1WCZA 1BITA 3M61U 3EA8A 1QBNA 5EG4A 1P02A 2G8TA 1OWKA 4NFFA 2VH6A 3SNEA 2ODPA 1G3DA 3Q77A 3TH2H 2BDYA 1O3FA 1RRKA 1DOJA 1PPCE 1L4DA 4ISIH 2SNVA 3ZVGA 3HK6B 5H4IB 2PTNA 3VGCC 1N1LA 4R8TB 2BY7X 3A7TA 1O31A 3D62A 2BQ6B 2FLRH 3LGVA 4DT7B 1CHGA 2STBE 3KN2A 3F6UH 1HXEH 3SI4H 2BOHB 1HRTH 1MTWA 2QV1A 4BAOB 1RTFB 1J17T 1EZSC 1YCPM 2ZHFH 1PPEE 1LPKB 4FU7A 5EXMA 3OTJE 2J4IA 2Y5GA 3M3SA 3FFGA 5EW1H 4TPIZ 1P2OA 3Q00A 2PSYA 3F9HA 4X8SH 1T31A 1BUIA 3M35A 1C5PA 5PTPA 4K2YA 1O2XA 1CVWH 2FX6A 1AE8H 1C2JA 1W10U 1O2VA 3SNDA 2OTVA 2ASUB 1F7ZA 3RXJA 4UFFH 5HM9A 4BOHA 1K22H 1NROH 4NSVA 3NK8A 1OX1A 1TGTA 1FAKH 2AMQA 2H5DA 4X8UH 1Y5AT 5DP5A 4ISNA 1GCTC 1C5WB 1YPHC 1IAUA 4J2YB 2GD4B 1CSOE 1QJ7B 1GI1A 2ZDMA 2F9PA 5L2ZH 4GUXA 1QIXB 1PQAA 1QQUA 1B5GH 1ZSLA 1CA0C 1BTYA 3UNSA 3GDUA 1GJ7B 1YF4A 1O2SA 3P70B 2BD8A 2GX4A 2XW9A 1GBCA 1KIGH 4AGKA 1ETSH 1SSXA 4I8KA 1P9UA 1PJPA 1WAYB 3D23A 1ZSKA 2WPKS 1SQOA 1EZXC 2PWXA 3MHWU 2PR3A 1PQ5A 5FBEA 1BTXA 4FUJA 4GCHF 1GBTA 4FU8A 1WTGH 1Z8GA 5A2MH 4YOIA 1DS2E 1EOLA 1BRUP 2OC7A 3MO3A 3IWMA 4BANB 5EODA 2P93A 1V2MT 2A4QA 4MQAA 4XE4A 4NG9H 2A45B 9ESTA 4D8NA 2AGIX 1MUEB 1V2JT 2WPMS 4Q7YA 1UVOA 2XRCA 4ZHMU 2XC4A 1DICA 4JZFH 3SV8A 2KAIA 4NIWA 1MAYA 1MCTA 1QHRB 4D9QA 2D1JA 2VIOA 2VGCB 3DT0H 2GVFA 1F0TA 1L0ZA 1Y5BT 5C1YA 4B2CA 1C4Y2 2OQ5A 1PPHE 2BOKA 2GCTC 3O8BA 3RXVA 3UIRA 5EU8A 3V13A 4WWYA 3RXDA 2TGDA 1IQHA 1CBWB 2ZHWH 1UMAH 3SV9A 3U1JB 3A87A 1F92A 1A0JA 1BA8B 2GMTB 5HGGA 1FN6A 1GBAA 1ZTJA 3MTYA 2UWOA 1DPOA 1C2GA 2V3HH 1MKWH 4JYUH 3A8CA 3M5MA 2BDHA 2HNTF 3V3MA 1SFIA 2G52A 1TPOA 1FZZA 2W26A 1EZQA 1GBMA 2HOBA 1W7XH 3LH3A 1W8BH 1QNJA 4K3JA 5ABWA 4I33A 4Y10E 1ETRH 1QR3E 2W7UA 5I25A 3RLWH 1QBVH 2QXGA 1OPHB 2W5EA 4FUGA 5TCAA 4OS1A 1UTNA 1GCDA 2TGAA 1LKBA 3M3TA 3TJVA 1TGCA 1E34B 3QN7A 3GCHB 4Y76A 3RXCA 2W7SA 5HYOA 1IQGA 1C5NH 1GI7B 1SGCA 1DUAA 2ZEBA 3E1XB 3STJA 4Y79A 1LVOA 1U6QA 3SU6A 7GCHG 1SHYA 2BY9X 2ZPSA 4SGBE 1K2I1 1O2LA 3EE0B 2HLCA 1W13U 4BAQB 4IMZA 3I78A 3M7QA 1MH0A 2D26C 5ESBA 3LH1A 3ODDA 3ZVCA 2JETB 1RS0A 2CGAA 3MO6A 4Y7BA 1D3TB 1ZGVA 1AFEH 5F6MA 3QGNB 3A81A 4E7RG 2ZF0H 1FY1A 1TNLA 2CXVA 3HGNA 5GXPA 1C1PA 4DGJA 1OYTH 1C1OA 2CN0H 2A2XH 2WUCA 2ZHDA 1MZAA 4DVAU 2WINI 2XC5A 1FY8E 1T8MA 3ENSB 2ZU1A 2Y81A 1WQSA 1NM6A 2QXHA 4DIIH 3HGPA 2Y5HA 1LHDH 3TNSA 2SGQE 2D2DA 1G2MA 4WMFA 1DWEH 8GCHG 2IJOB 5EQQA 2OD3B 1S5SA 1RTKA 2Z9KA 1SGTA 2FDAA 1MTSA 1PQ8A 1IQIA 4I8HA 2Z7FE 4PROA 1V2PT 1GMDF 2QYIA 4DY7B 1PPBH 7ESTE 1ESTA 1FONA 1GHAG 2J94A 1UHBA 1MKXK 1TAWA 1CHOF 1TPSA 1SVPA 4TWWA 1PFXC 2WYGA 4XFQA 3RU4T 1RXPA 2F9UA 4O9VA 1YPKH 1TRYA 1VCWA 3KQCA 2OC1A 4WVPE 1E37B 4A1VA 3L3TA 3ATLA 1ORFA 4ZUHA 1AUTC 1K1JA 1O32A 4ABBA 1UK4A 1UTQA 3DHKH 1WU1A 1QY6A 3NPSA 3PMHB 4K1EA 3GDSA 3VB5A 1GMHF 2AYWA 3EYDA 4CH8B 9LPRA 4ISHH 2HALA 4A1TA 1MTVA 4NCYA 1FUJA 1S6HA 5A0CA 5K0HA 1RTLA 4FUHA 4XBCA 1Q31A 3FAOA 3SU0A 5JBCS 2CJIA 1K9OE 1HJAB 1VITF 1EJAA 2GMTC 2FOBA 1Y3VA 3LGTA 1C1VH 4UDWH 2I6QA 3RXSA 3ITIA 2HPQH 1C9PA 4Y7AA 5EGMA 2A32A 1Z1IA 1ELAA 4LK4A 1S85A 4AYVB 1GI2A 1EQ9A 1GJDB 1IHTH 3BEIB 4ZH8A 1VCPA 1E38B 1OP2A 4X1QU 4THNH 1LHEH 1SGNE 1LVMA 1SLXB 4MPUA 3MNCA 3A84A 1XX9A 2NU3E 4X6OA 1ABJH 1RIWB 2ZECA 2ZCHP 1SPJA 1GI4A 1AVWA 1Y5UT 3SU3A 4AYYB 3NKKA 2FODA 1NFWA 4UFDH 4ISOA 2ZI2H 4WMEA 1L4ZA 4ABHA 2YNAA 1O30A 2FOHA 1KXCA 3GCHC 7GCHF 3HPTB 1MTNC 4MPWA 1UCYH 1BTZA 1T4VH 1G3CA 3KIDU 4WXIA 1HAPH 1A3BH 4XDEA 2FOMB 3D49H 1AE5A 1C5MD 1NFUA 1KDQB 4K8BA 2BLOA 1AY6H 4AFZA 3RXIA 1GGDB 4B76A 2GCHG 3A8AA 4NZLA 1HPGA 2ZFSA 1W12U 4U2WA 2Z3EA 3U69H 1BMMH 4Q80A 3SNBA 1BHXB 3BTHE 2GGVB 3RP2A 4E7NA 5JBBS 2A7JA 4CRDA 1BCUH 1SHHB 1K1MA 3RXKA 1C2KA 4X2WA 1HJ8A 2OBQA 1C5LH 5DP3A 1MU8B 1CE5A 2C4FH 3RU4D 2ZG0H 3EAJA 1QURH 2GV7A 2PHBA 3TGJE 2ZA5A 1NO9H 2HVXA 6CHAC 3SW2B 1O37A 1TLDA 3QZRA 4GAWA 3LIWA 1D4PB 3MU1A 5EQSA 3VB6A 2FOAA 3ZZ5A 3VPKA 1SFQB 3AAVA 1FI8A 3SUEA 4INLA 2GDDA 1EPTC 3PWCA 5FX5A 1TA6A 4IC5A 2H2ZA 3STIA 1ZR0A 2PUQH 1AVGH 1SB1H 2JKHA 4ZKOU 3T2NA 2WPIS 1PPGE 4B71A 1IHSH 3RC6A 2AMPA 4UFEH 4DOQA 3ATMA 4OGXA 4X6PA 2FPZA 1FQ3A 2C90B 1FPHH 5E2OA 3U98H 1TFXA 2UUYA 1O2JA 1Y3UA 2AMDA 4OS6A 2BTCE 3BIVH 2TPIZ 2XBWA 3S7HB 3U8OH 2BD2A 2P3UB 2DUCA 2UUJB 3M5NA 4AGJA 3QGJA 1D3PB 1GI6A 7KMEH 3PTBA 1GDNA 2VIPA 4BNRA 3RXFA 1RFNA 3EA9A 2ANMH 3ZVAA 3SZNA 3V0XA 1ZPCA 2A2QH 1SGEE 2A4RA 1NS3A 1P04A 1MD8A 3U8RH 1T8OA 2Q6GA 2EEKA 1UVUH 3RXOA 1ELVA 5E0GA 1BMAA 1YC0A 2SGEE 1B0FA 1GCTB 2PGBB 1EKBB 2F3CE 1ANDA 1A0HB 1E0FD 3ZZDA 4CREA 1F5LA 1K1LA 3RC5A 5B6OA 5T3HA 1K1PA 3M36A 2ZHQH 4AN7A 1TNHA 3SO3A 3WY8A 3UNRA 3BN9A 1TRMA 1C5VA 1CA0B 1HJAC 3RM2H 4JYTA 1SGFG 4TYDA 1O3NA 3OY5U 4BTUB 1TGNA 4DJZB 4X8VH 3SQEE 2FOCA 3SQHE 5T6GA 1PPZA 1H4WA 1K21H 1P2JA 3RC4A 3U9AH 1J16A 2O8WA 1GJ8B 1QA7A 3PMBB 1RIWC 5E8EH 2ZQ1A 2Z6BD 2ZKSA 1J14A 3TIUA 1F0RA 1EXFA 1W0ZU 2G4UA 3TLOA 3P17H 2EC9H 2FYQA 4GCHG 1FXYA 1C2LA 4FUEA 1AWHB 1MCVA 2A5IA 4Y71A 5FCKA 1IQJA 4E06H 2G51A 4RKJB 1Z8IB 1F0SA 2O8LA 2B5TB 2Y80A 1O2MA 1BQYA 1MTUA 1BOQA 1TGSZ 2F9OA 1GGDC 1HIAB 1ZYOA 3GY5A 4XSKU 4Z0KA 2GCTB 3RMMH 3BTWE 1EATA 3A7ZA 5DK1A 4X1NU 5C67A 4F49A 1QA0A 4SGAE 1C1SA 4D76A 1FAXA 2ESTE 4H6TA 1HDTH 1S81A 1C2EA 1V3XA 2AS9A 4YLQH 1QCPA 1DANH 1B0EA 3SV7A 2P8OC 1EAWA 1ELGA 1B7XB 2CV3A 4ABFA 4ABGA 2FI4E 3GDVA 4JYVH 3GICB 4Y0ZE 4AFSA 2HWLB 1TOMH 3D65E 3T5FH 1Y3XA 1P2KA 2AH4X 3A7YA 3UFAA 5FPYA 3RXBA 1QB6A 2OCVB 1NC6A 2BDGA 3RXRA 2XC0A 5DP4A 5TCCA 2BZAA 1HIAA 2AIQA 2SGFE 3A86A 5DP9A 1XVMA 1ZGIA 1OYQA 1O2OA 2VJ1A 3E0NB 3ZZ3A 3A88A 2LNCA 3RDZA 1AB9C 3A80A 2IPHA 1GJ6A 2P16A 1TONA 3MH4A 1VITH 2C3SA 1TB6H 4H6SB 1GJ9B 3DFJA 1HBTH 1C5YB 3ELAH 3ZZ4A 4KP0A 2H6MA 2ZDKA 1A5HA 1DDJA 1QBOA 1HFDA 1TMBH 1GHWH 1P2NA 3S0NA 4FUIA 2ZC9H 1QL9A 2HPPH 3IITA 4U01A 3FANA 2J92A 2FLBH 2TGTA 1HXFH 4O3TA 1P10A 1BRAA 3LC5A 1O3MA 1ZPBA 5E0JA 2OXSA 4WMDA 1S6FA 1YCPK 3N7OA 1P0SH 3SJ9A 3AVZA 3BTGE 4UEHH 1O5GH 1DSUA 4JK6A 1HAXB 1FV9A 2A5AA 1C2DA 2VVVA 2BVRH 1NRNH 4ABDA 2K1QA 5FCRA 2HGTH 3TK5A 2H9EH 3BEFB 1SQAA 4GHTA 5HMAA 1EOJA 1S0RA 5E2PA 5AF9H 5A8ZA 3LJJA 2BLWA 1PQ7A 1BRCE 3PMJA 2O8TA 1LPZB 2G55A 1EAXA 2PTCE 1T32A 3TITA 1ZTLA 3BTTE 3BV9B 4NA9H 3SJKA 4AFUA 2BMGB 2ZDAH 1DSTA 2QC2A 5DO4H 1AI8H 2FS8A 2AGGX 3P6ZB 2BYAX 1BJVA 1THSH 2F83A 2PKAB 1Z8JB 2ZU5A 2A31A 3EA7A 3RXTA 4D7FA 3M7TA 3U8TH 1FPCH 2VWOA 3H7OA 4A1XA 2ZU2A 1TX8A 5GIBA 1OWJA 3LGWA 3T62A 1IQEA 2SFAA 2ZQ2A 6ESTA 2ZIQH 3JZ2B 3SGBE 3PLPA 3I29A 1GVKB 1GMDG 1SGIB 1Z6EA 1CT4E 1DY9A 3SJOA 1HJ9A 1C1MA 4CHAC 1CHOG 5IDKA 1VGCB 4K5ZA 2BLVA 3PROA 3K6ZA 4ZMAH 1CGIE 1TQ7B 1UTPA 3KHVA 4FVDA 2O9QA 2G5VA 2PKAA 3LGIA 2BXUH 3RMLH 2R2WU 2UWLA 3O8CA 4NGAH 1L1JA 3A7VA 1YM0A 4MNYA 1T7CA 3CENA 1BIOA 2AERH 1ZOMA 2P95A 3VFEA 1HAVB 1GMHG 1BTPA 1EB2A 1HAYB 3H7TA 1PPFE 1GI9B 1HAGE 3RXHA 3ZYEA 1WYKA 2FXRA 3BTEE 1TOCB 4F4OC 2G00A 1GBKA 4I8LA 1N6YA 4A7IB 3E90B 1O33A 1JRTA 2ZU4A 3HATH 1V2QT 1OWEA 1ZPZA 2FYRA 2BB4A 1VITG 2ZP0H 1O2RA 3F68H 4WXVA 2ZDNA 3PYHA 3QX5H 1P3EA 5A8YA 4LOYH 1JIMA 2HNTC 4ZKRU 4GHQA 1KXEA 1TBRH 1LVYA 3QK1A 1AN1E 1BBRH 4H4FA 1SG8B 5JBAS 3UTUH 1SOTA 1ELBA 5LPFA 1L1GA 1MTNB 4ISLA 1C5UA 4YT7H 4JZIA 1L2EA 3E16B 3PM3A 3QTVH 1P2QA 5T6FA 4AORA 1P12E 2D8WA 3A83A 1T8NA 1TNJA 2FI5E 2NU2E 5C20A 1TRNA 2ANKH 1NY22 2W3IA 2WV4A 1C1NA 1DITH 3UY9A 5AFYH 5DP8A 2GZ8A 2ZHEH 4LXBH 3ZZBA 4BTTB 3BTDE 3AASA 2BD3A 3B9FH 1A1RA 3QTOH 4ZKNU 2P3TB 5C5OA 5SGAE 1AKSB 3RM0H 2B7DH 1UTKA 1ANEA 4AG2A 2THFB 5A0BA 2RCEA 3BTQE 1ZJKA 5AFZH 2ODYB
chains in the Genus database with same CATH superfamily
1JOUB 1S83A 5F03A 4BTIB 4UE7H 3S9CA 1YWUA 3OTPA 5AVDA 1CT2E 4ZXXH 4CRBA 1HUTH 2AFQB 3SJIA 1E1QD 1SGRE 1TPPA 6CHAB 4A5TS 2PP6A 2CHAC 4DT4A 1MU6B 3DA9B 2PSXA 1Y59T 3A8DA 3ODFA 4YESB 3RXMA 2KX4A 2R3YA 1D6RA 2TIOA 3MU0A 1P05A 2ZWLH 1AKSA 4FUCA 3SZEA 2F43B 1AHTH 2FMJA 3PTNA 3SUFA 1ZRKA 3SGQE 1EPTB 1QRZA 4X2YA 2QY0B 2BD4A 2OC8A 4WY3A 1TE0A 3U1IB 2FZZA 5FHTA 1GJAB 4A92A 1KSNA 1ZHRA 1SR5C 1D3DB 1WBGB 1J15A 3OEHD 1FIZA 1HV7A 1LMWB 3MO9A 3LONA 3P8OA 4I86A 1BTWA 1SLVB 1O34A 1COWD 2ANWA 5EPNA 1FDPA 2FOGA 3EDXB 1QJ6B 1Y8TA 2GTBA 4NIYA 1CGJE 2ZTYA 1ZMJA 1VGCC 3M5OA 1E1RD 3ZVDA 4F55A 1HB0B 1FNIA 1ZMNA 5HKKD 4JZ1A 5TJXA 2C8YB 1KYNA 1EP5A 2NU1E 1XXDA 2UUFB 2J2UA 3BG8A 2FTLE 1O2ZA 1FJSA 5F8XA 1ELCA 3SOSA 1W0YH 3SU4A 2P3FH 5B6LA 3F9GA 4B1TA 1GPZA 3HK3B 4JK5A 1IQKA 1X7AC 1QQ4A 4LZ4B 7LPRA 2CMYA 2V7QD 1H8IH 3DUXH 2FOEA 4UONA 1XUJA 3TJUA 2C8XB 3M37A 1SGPE 3TGIE 1W11U 2RDLA 2RDEA 4KKDA 3ZZAA 5JPMH 1C2IA 3KL6A 1JXPA 1EP6A 3PV4A 2BVXH 1YGCH 4ZCNA 1VCQA 4I8JA 4DCDA 1DUEA 1O3EA 4ZROA 1WV7H 2GZ9A 3BG4C 3LKWA 2UWPA 2ALVA 2XCFA 1QGFA 8KME2 5C17A 2ZFPH 1O3IA 1TALA 1A5GH 4ZKSU 3MYWA 4HGCA 3MH5A 1JIRA 1ZHPA 2ZO3H 1NESE 4DG4A 3F3BA 1EFRD 2J97A 4DIHH 1THPB 3VB4A 1GBDA 3LDXH 1INCA 1GL1A 2ZU3A 2Z9JA 3UUZA 3CS7A 1K1NA 2TRMA 1IQNA 3N99A 1O3OA 1Z8RA 2PGQB 4GVUA 4KELA 2BLQA 1E79D 4X8TH 2M5TA 5FPTA 1NBME 3TJOA 5JYIA 2ODQA 3T26A 3P8GA 1C5OH 1C1WH 3TH4H 4M7GA 5ESTE 3P8FA 5CE1A 3NZIA 1C1RA 5KEDA 3K9XB 2XBXA 2ZFRH 1NRPH 2YNBA 3MNSA 3Q76A 1TBZH 5IK2D 1TQ0B 1ARBA 2FO9A 2P8OB 3ZVEA 3KQ5A 1GWAA 3GS9A 5GDSH 4JZEH 4YOJA 4BAMB 4JMYA 5ETXA 1C5ZB 1A3EH 1C1UH 1V2KT 4QT8C 1C1TA 1WSSH 2V3MA 1O5EH 4K8YA 3KQDA 1OXGA 1KDQA 4O03A 4HFPB 1O2YA 4ZHLU 5EXNA 4NA7A 3MI4A 2V35A 1BTHH 3LC3A 4FETA 3C1KA 2O8UA 2H5CA 2OINA 1TABE 1AB9B 1UK3A 3VEQB 4INHA 4KTSA 1W7GH 4CBNA 3TPIZ 5A0AE 1DY8A 3PRDA 4X1RU 3TK6A 1Q2WA 3KQEA 5HM2A 2NWNA 1LCYA 1QJ1B 2BY6X 5FX6A 4YM9A 2V3OH 4Q7XA 3LT3A 4BXSA 4F48B 1D9IA 1G3EA 1ID5H 2ULLA 1O2PA 2ANYA 4MNWA 1K1IA 4I7YH 1AZ8A 3S69A 2ZPQA 1A61H 5HIZA 2WPJS 4IN2A 4Y8YA 2TBSA 3OYPA 4AC9A 2XYAA 5L30H 2GDEH 3SHCH 5JB9S 1XVOA 1O36A 1M9UA 1SOZA 1V2NT 1C9TA 2BDAA 2STAE 1C2FA 1YPEH 1MAXA 2VWLA 1SKYE 1YCPH 3F9FA 4MG3A 1IQLA 1F5RA 1YLCA 4IS5A 2OP9A 2I6SA 6GCHF 1O3CA 1V6DA 1LO6A 2OLGA 3CNRA 3FVFB 3KYFA 5EW2H 3QZQA 1NPMA 3PLKA 1GVZA 4MNXA 3WW7A 5C0UA 5FXLA 3HKIB 1CU1A 5C5NA 4OS2A 4MNVA 2PW8H 1P06A 5K7RA 1P2IA 2HLDD 1LVBA 4X6MA 4H42U 3ESTA 1LQEA 1YLDA 2C93B 1T8LA 4OS7A 1H8DH 4AX9H 3UWJH 4ABEA 1GBHA 3MFJA 4DW2U 1SLUB 2GP9B 4FU9A 4FVBA 3RXUA 4XBDA 1EAIA 4HZHA 1KTTB 2YMSD 1L1NA 1NRQH 4OS5A 2Z9GA 2Z9LA 3P8NA 1AU8A 2NU4E 1XUGA 1QZ8A 1W14U 2VWMA 1V2RT 3O8DA 1N8OC 1KLJH 2ZDLA 3SHAH 1UJ1A 1ZSJA 1TNKA 4MPVA 3F2HA 3RXLA 4CHAB 1GG6C 3T28A 2R9PA 1LQDB 1O2NA 5L6NH 1DWBH 4AZ2B 1GJ5H 1TIOA 1YLNA 3SGAE 1AMHA 4Y8XA 3M7UA 1Z71A 1ZHMA 2BM2A 1IQFA 1P01A 1NTPA 1WOFA 4ZHAA 3TU7H 2BDIA 1QB9A 2A0QB 3SI3H 4TPYA 2Y7ZA 1BB0B 4A6LA 1A5IA 3FZDA 3GY3A 5T6DA 4X1PU 1HAIH 2W6JD 3RUOA 3GCTF 2ZGBH 1DLEA 1SGQE 4ACAA 1YBWA 1W2KH 1QRXA 3RMNH 1K0HA 1DWDH 3K6YA 2FWWA 4Y6DA 1JBUH 2B9LA 3ZV8A 1XUFA 1BHXF 3H5CB 2Z3CA 4TWYA 4ESTE 1ABIH 5JDUB 1TMTH 1G9IE 3GY2A 1CQQA 4R0IA 1YPLH 1CT0E 1Y3YA 1CGHA 1BMNH 5JBTA 1G2LA 5GPIB 4WH6A 1SMFE 3MU8A 5LPEA 1H9HE 1SL3A 1XKBC 2TGPZ 2K0QA 1DXWA 4I8GA 4O97A 1MBQA 2IJD1 3UWIA 2JJ1D 3PMAB 4IN1A 3UPEA 1G32B 3RXGA 1G30B 3DSGA 1J9CH 3GY6A 4MVNA 3FP7E 1SC8U 2CF9H 2W6ID 1HCGA 3P92A 1C5SA 1GI3A 3WWFA 3GY4A 1O5DH 3LGUA 4VGCB 2C8WB 3RXQA 3QUMP 1ANCA 5FAHA 2QCYA 1YKTA 3FO8D 2Q6DA 3DSPA 2A4GA 4I31A 5EQRA 2LPRA 2XWAA 4NA8A 1MQ6A 2O8MA 3RLYH 5CHBA 5LPRA 3HKJB 5AHGH 5GNDA 2QF0A 2EI8A 3T27A 3VXFH 3ZZ6A 1AQ7A 1FY5A 2Y82A 4Q2KA 3SUGA 1E36B 4JCNA 5DG6A 2XWBI 5DJ7A 1TMUH 2CHAB 4BAHB 1HAHH 3W1EA 5A8XA 1GBLA 3SUDA 1GI5A 3S9BA 2BD5A 2BY5X 1O5FH 1H1BA 3VB3A 2GJGA 3FOAA 1LKAA 2WPHS 1EX3A 4U30A 2ZDVH 2SGAA 3RU4E 5EJLA 3FP6E 4FUBA 2P94A 1O3LA 3S7KB 4KTCA 3UNQA 1EASA 3TJNA 1O38A 4AB8A 2Q6FA 1O5AB 1BRBE 2FTMA 1W0JD 1MMJN 1OOKB 3LGYA 4ZAEA 2QE7D 2BD9A 4RT1A 4NSYA 4HI3A 2KAIB 1S84A 1J8AA 4X2VA 1BMLA 3GYLB 1AFQB 1WTHD 1MKXH 3PO1C 2YOLA 4WH8A 2F9VA 4LZ1H 1DX5M 2P59A 2YMSC 1OSSA 3BIUH 4HG6A 2R0LA 1G36A 2WUBA 4Z1MD 2H9HA 4HTCH 5BPEA 1Z1JA 4IGDA 4BAKB 2QF3A 2PKSC 3EQ0H 5EOKA 1VJ9U 2SNWA 3SU5A 3RXEA 1YPHE 1GHBF 2WV5A 1O3HA 1QL8A 3OX7U 4KGAA 4O3UA 1UTMA 1XXFA 2W3KA 2WYJA 1GBFA 1DXPA 3A82A 5EXLA 3ZYDA 2PLXA 3UQOA 3M3VA 1P2MA 4UD9H 2VIWA 1NU9A 4UFGH 5F8TA 5DKMA 4XD7D 1AO5A 4TY6A 3GOVB 3R3GB 1UTLM 4AB9A 1SQTA 1XKAC 1P8VC 3C27B 1UCYE 5FPSA 1RJXB 4X1SU 1HLTH 1HNEE 2FOFA 1P11E 4X0WU 3LJOA 4AOQA 2PUXB 1EAUA 3ZVFA 2WZQA 3V12A 3BG4B 2OC0A 4B75A 4NIXA 1H9IE 2B0FA 3SBKA 4D9RA 4MTBA 5C1XA 1XUHA 1P09A 1JRSA 2J95A 1HAVA 3KQBA 2AGEX 3F1SB 1BJUA 3SN8A 1KLTA 4B74A 1AIXH 4GPGA 2F91A 3AAUA 3NUMA 4AG1A 1F2SE 1GDUA 3Q3YA 4CR9A 1GVLA 3W94A 2HVYB 3BTME 3BF6H 4DURA 3MWIU 1ESBA 3TK9A 1TA2A 2VNTA 5I46H 5DP7A 1C2HA 3ATIA 5C3NA 2ZCKP 2K8IA 1GI0A 2GT7A 3GCOA 4X6NA 1C4U2 3MNXA 3G01A 1DM4B 1ELDE 2H9TH 4VGCC 1DVAH 4YTAA 1O3JA 3LPRA 3SJ8A 1O2KA 1PYTD 2WPLS 2OK5A 2G81E 4RKOB 3UOPA 2A7CA 1GBIA 1NZQH 1HAZB 5DGJA 1QL7A 1WDIA 2EA3A 2BZ6H 1DWCH 1A2CH 2BX3A 3SU1A 2ZGXH 4K1TA 1F5KU 3A8BA 1ZJDA 3GY7A 2ZFQH 4KTUA 1AVXA 3JZ1B 1A0LA 2XBVA 3CP7A 1THRH 3E0PB 2Z94A 3AW0A 2WPDD 4YOGA 2R2MB 1O2TA 2HNTE 2ZZUH 2PV9B 1A7SA 2KR7A 2V6NA 1V2OT 4E05H 4I32A 1P57B 5IYTA 3BEUA 2B8OH 4MDSA 4Y8ZA 1BZXE 1O2GH 4MLFB 1VR1H 1UHBB 4FXGH 1A4WH 1GHVH 1HYLA 2FX4A 1MD7A 2ZGHA 2ZFFH 4YZUA 5FBIA 4B73A 4ASHA 2XBYA 2Y7XA 1ZLRA 5CHAB 3GISB 4K1SA 2VWNA 4OS4A 3I77A 1YP9A 2RFKC 4X2XA 1C1QA 1F0UA 1FMGA 4YT6H 1KXDA 4JZDH 1P3CA 5G4BA 3BTKE 2AIPA 4IW4E 2BHGA 4ASUD 1C2MA 1ARCA 1AFQC 1FLEE 3T29A 1FN8A 2DE9A 1ZMLA 4NWLA 4CRGA 4GSOA 3K65B 2VINA 1E35B 3QWCH 3AW1A 1DLKB 1EPTA 2FI3E 3SV6A 1RD3B 2FESH 1D6WA 1YPGH 4OGYA 3SNCA 1A46H 1N6XA 4YO9A 1WQVH 1O35A 1GHYH 1V2UT 2KFWA 2QGRA 3L33A 4ABAA 2QA9E 1UVTH 1O3AA 4D7GA 2FIRH 2ZTXA 4CRFA 1SLWB 2BY8X 2RG3A 1FIWA 3S9AA 2Y6TA 1DE7H 2GT8A 3F9EA 6GCHG 1O2UA 2R0KA 1QB1A 3SU2A 2A7HA 4MPXA 5CDFE 2VGCC 2QIQA 3ZZ9A 1V2TT 1Z6JH 5GCHG 1GDQA 1QRWA 3R0FA 3UR9A 1GBEA 3V7TA 1GJBB 4BXWA 3ATWA 5GWZA 1KY9A 4ACBA 4OM9A 3ATKA 2AHME 1NFXA 2A5KA 1O5CB 1CBWC 3TH3H 3W95A 1ELEE 3B23B 2QAAA 1O2HA 1BDAA 3MU5A 4WF8A 1C5RA 1MKWK 2ZCLP 2OQUA 3FP8E 3VB7A 2VH0A 3OU0A 2HRVA 3O8RA 1G3BA 2JH5D 1C5XB 1JMOH 1SGYE 1W3CA 1DFPA 3CS0A 3MMGA 3MH6A 1N8OB 1AZZA 1VZQH 1O5BB 1V2VT 1BBRK 1O3KA 3SNAA 1GG6B 4ABIA 4GLYA 1EZUC 4XBBA 1UTOA 1TPAE 1C4V2 2XTTB 3ZZ7A 1AGJA 3QLPH 2VB0A 1AUJA 1GBBA 5J4QA 1Z7KA 2CF8H 5LGOA 4RSPA 1V2LT 2EI7A 2BX4A 2ZPRA 3L6PA 1V2ST 3KF2A 2VIQA 1GJ4H 2EY4C 5EPYA 1SBWA 2OUAA 3UREA 2GKVE 3UOUA 1T4UH 1VJAU 1TBQH 2FS9A 3GCNA 3ZZCA 3MQKC 2ZNKH 1EJNA 1TWXB 3DD2H 1KXBA 1GMCG 2ILNA 1YYY1 3URDA 1FY4A 1H9LB 4B2AA 1AWFH 3MU4A 4NIVA 1MQ5A 2C8ZB 4RT0A 1PYTC 1S6LA 3E91A 2J9NA 2GV6A 1ZTKA 2V0BA 1UVPA 1LHFH 1K28D 2JETC 3TNTA 3U28C 3ZZ8A 1TYNA 1JWTA 1UK2A 1CA8B 2BVSH 3BSQA 3GCTG 1EJMA 4IBLH 3SORA 5KECA 4NWKA 8LPRA 4RN6A 1O3PB 6LPRA 3FZZA 3MNBA 2XCNA 3N7EA 1OP0A 1UVSH 1LHGH 3PB1E 5A09A 3F0PA 4FUFA 3IG6B 3B8JA 4CRCA 1O3BA 1O2QA 2R3UA 1UTJA 4Q7ZA 4AFQA 1NRRH 2IPQX 2SGDE 3MOCA 5C1UA 5DP6A 1D3QB 3K2UA 1ANBA 1IOEA 1V2WT 5CHAC 8GCHF 2H1UA 1GBJA 4K69A 2A1DB 5CMXH 1LHCH 4U32A 3KGPA 3VGCB 2IOTA 4K60A 1GHAF 2GZ7A 1O2WA 3UR6A 1P9SA 3Q3XA 1ACBE 2QN5T 1HAOH 1LPGB 3RXPA 1NFYA 4Y0YE 1NRSH 1K1OA 2Z9IA 3OSYA 1TNIA 1G37A 3DFLA 2F9BH 3Q3KA 2BD7A 4YLUA 4TY7A 2BDBA 3PWBA 2QXIA 1TGBA 2QXJA 4ZXYH 2ZGJA 2Y5FA 5L2YH 1ETTH 2VIDA 1TNGA 1O39A 1XMNB 3A7XA 3KNXA 1P03A 2UUKB 3E3TA 4B2BA 1C5QA 1XUIA 1OWIA 2WSSD 2AEIH 3E6PH 5BRRE 5EJZA 5GCHF 1S0QA 1UO6A 5DPAA 3OY6U 1ZZZA 1WUNH 1QFKH 2FEQH 2BXTH 2J34A 3VXEH 3KEEA 3UQVA 2XNIA 3M5LA 1GJCB 2BDCA 5F8ZA 2XXLA 2ZGCA 1DT2A 3LU9B 1XM1A 3MH7A 2L74A 4NFEA 2VVUA 5GJ4B 1O3DA 2VIVA 4WJG2 3T25A 1QTFA 1SI5H 8ESTE 1KLIH 1FY3A 1XUKA 3LOXA 3A7WA 2F9NA 4IMQA 3A89A 2ZFTA 1O2IA 3TVJB 3SV2H 3URCA 2F4LA 5C2ZA 1OWHA 1SGFA 2G4TA 3NXPA 2FM2A 1KXFA 5E0HA 1YPMH 3PO1B 3PRBA 2Z3DA 4CR5A 2DE8A 3ZV9A 1YPJH 1CO7E 4IC6A 2YMSB 1MZDA 1WXRA 4NZQA 1GHZA 2JH6D 3RXAA 3PLBA 2BQWB 4Z6AH 2SGPE 3EGKH 5LH8A 2OBOA 1Y3WA 1UCYK 2PKSB 3E8LA 1EUFA 5JB8S 1NT1A 1OWDA 1O3GA 1Q3XA 2J38A 5J4SA 1AD8H 1LDTT 1BTUA 3QO6A 4J1YA 1BT7A 1GMCF 2Q1JA 1EB1H 1GHXH 2G5NA 1OKXA 1TX7A 2GCHF 1ESAA 1BBRE 3KCGH 2IN2A 1ELFA 4XOJA 3NCLA 2RA3A 3GYMA 1O0DH 1GHBG 3TGKE 2ALPA 1RGQA 2A4OA 2JH0D 1IQMA 1KTSB 1HGTH 2PFEA 2NU0E 3P95A 1NN6A 1H8ED 2ZTZA 1NU7B 4INKA 2EI6A 3QDZB 1KXAA 4ABJA 4CBOA 4CRAA 3GY8A 1SGDE 2VVCA 3NWUA 4Y11E 1ELTA 3ZVBA 4CH2B 3A85A 4FUDA 3RMOH 1TX6A 1OS8A 2RA0A 3BTFE 1MBMA 2VU8E 1C5TA 1GI8B 1LTOA 1S82A 2BQ7B 5HXFA 1OP8A 1GL0E 2FP7B 1ZRBA 1WCZA 1BITA 3M61U 3EA8A 1QBNA 5EG4A 1P02A 2G8TA 1OWKA 4NFFA 2VH6A 3SNEA 2ODPA 1G3DA 3Q77A 3TH2H 2BDYA 1O3FA 1RRKA 1DOJA 1PPCE 1L4DA 4ISIH 2SNVA 3ZVGA 3HK6B 5H4IB 2PTNA 3VGCC 1N1LA 4R8TB 2BY7X 5T1VA 3A7TA 1O31A 3D62A 2BQ6B 2FLRH 3LGVA 4DT7B 1CHGA 2STBE 3KN2A 3F0OA 3F6UH 1MABB 1HXEH 3SI4H 2BOHB 1HRTH 1MTWA 2QV1A 4BAOB 1RTFB 1J17T 1EZSC 1YCPM 2ZHFH 1PPEE 1LPKB 4FU7A 5EXMA 3OTJE 2J4IA 2Y5GA 3M3SA 3FFGA 5EW1H 4P00A 4TPIZ 1P2OA 3Q00A 2PSYA 3F9HA 4X8SH 1T31A 1BUIA 3M35A 1C5PA 5PTPA 4K2YA 1O2XA 1FX0B 1CVWH 2FX6A 1AE8H 1C2JA 1W10U 1O2VA 3SNDA 2OTVA 2ASUB 1F7ZA 3RXJA 4UFFH 5HM9A 4BOHA 1K22H 1NROH 5KGOA 4NSVA 3NK8A 1OX1A 1TGTA 1FAKH 2AMQA 2H5DA 4X8UH 1Y5AT 5DP5A 4ISNA 1GCTC 1C5WB 1YPHC 1IAUA 4J2YB 2GD4B 1CSOE 1QJ7B 1GI1A 2ZDMA 2F9PA 5L2ZH 4GUXA 1QIXB 1PQAA 1QQUA 1B5GH 1ZSLA 1CA0C 1BTYA 3UNSA 3GDUA 1GJ7B 1YF4A 1O2SA 3P70B 2BD8A 2GX4A 2XW9A 1GBCA 1KIGH 4AGKA 1ETSH 1SSXA 4I8KA 1P9UA 1PJPA 1WAYB 3D23A 1ZSKA 2WPKS 4TT3D 1SQOA 1EZXC 2PWXA 3MHWU 3UAIC 2PR3A 1PQ5A 5FBEA 1BTXA 4FUJA 4GCHF 1GBTA 4FU8A 1WTGH 1Z8GA 5A2MH 4YOIA 1DS2E 1EOLA 1BRUP 2OC7A 3MO3A 3IWMA 3FN8A 4BANB 5EODA 2P93A 1V2MT 2A4QA 1NBMD 4MQAA 4XE4A 2L6OA 4NG9H 2A45B 9ESTA 4D8NA 2AGIX 1MUEB 1V2JT 2WPMS 4Q7YA 1UVOA 2XRCA 4ZHMU 2XC4A 1DICA 4JZFH 3SV8A 2KAIA 4NIWA 1MAYA 1MCTA 1QHRB 4D9QA 2XNDD 2D1JA 2VIOA 3OEED 2VGCB 3DT0H 2GVFA 1F0TA 1L0ZA 1Y5BT 5C1YA 4B2CA 1C4Y2 2OQ5A 1PPHE 2BOKA 2GCTC 3O8BA 3RXVA 3UIRA 5EU8A 3V13A 4WWYA 3RXDA 2TGDA 1IQHA 1CBWB 2ZHWH 1UMAH 3SV9A 3U1JB 3F2GA 3A87A 1F92A 1A0JA 1BA8B 2GMTB 5HGGA 1FN6A 1GBAA 1ZTJA 3MTYA 2UWOA 1DPOA 1C2GA 2V3HH 1MKWH 4JYUH 3A8CA 3M5MA 2BDHA 2HNTF 1OHHD 1SFIA 3V3MA 2G52A 1TPOA 1FZZA 2W26A 1EZQA 1GBMA 2HOBA 1W7XH 3LH3A 1W8BH 1QNJA 4K3JA 5ABWA 4I33A 4Y10E 1ETRH 1QR3E 2W7UA 5I25A 3RLWH 2J5UA 1QBVH 2QXGA 1OPHB 2W5EA 4FUGA 5TCAA 4OS1A 1UTNA 1GCDA 2TGAA 3DCLA 2J98B 1LKBA 3M3TA 3TJVA 1TGCA 5F53A 1E34B 3QN7A 3GCHB 2JJ2D 4Y76A 3RXCA 2W7SA 5HYOA 3UB0A 1IQGA 1C5NH 1GI7B 1SGCA 1DUAA 3NRLA 5HIYA 2ZEBA 3E1XB 3STJA 4Y79A 1LVOA 1U6QA 3SU6A 7GCHG 1SHYA 2BY9X 2ZPSA 4SGBE 1K2I1 1O2LA 3EE0B 2M2AA 2HLCA 1W13U 4BAQB 4IMZA 3I78A 3M7QA 1MH0A 2D26C 5ESBA 3LH1A 3ODDA 3ZVCA 2JETB 1RS0A 2CGAA 3MO6A 4Y7BA 1D3TB 1ZGVA 1AFEH 5F6MA 3QGNB 3A81A 4E7RG 2ZF0H 1FY1A 1TNLA 2CXVA 1W0KD 3HGNA 5GXPA 1C1PA 4DGJA 1OYTH 1C1OA 2CN0H 5C94A 2A2XH 2WUCA 2ZHDA 1MZAA 4DVAU 2WINI 2XC5A 1FY8E 1T8MA 3ENSB 2ZU1A 2Y81A 1WQSA 1NM6A 2QXHA 4DIIH 3HGPA 2Y5HA 1LHDH 3TNSA 2SGQE 2D2DA 1G2MA 4WMFA 1DWEH 8GCHG 2IJOB 5EQQA 2OD3B 1S5SA 1RTKA 2Z9KA 1SGTA 2FDAA 1MTSA 1PQ8A 1IQIA 4I8HA 2Z7FE 4PROA 1V2PT 1GMDF 2QYIA 4DY7B 1PPBH 7ESTE 1ESTA 1FONA 1GHAG 2J94A 1UHBA 1MKXK 1TAWA 1CHOF 1TPSA 1SVPA 4TWWA 1PFXC 2WYGA 4M9FA 4XFQA 3RU4T 1RXPA 2F9UA 4O9VA 1YPKH 1TRYA 1VCWA 2JIZD 3KQCA 2OC1A 4WVPE 2EQNA 1E37B 4A1VA 3L3TA 3ATLA 1ORFA 4ZUHA 1AUTC 1K1JA 1O32A 4ABBA 1UK4A 1UTQA 3DHKH 1WU1A 1QY6A 3NPSA 3PMHB 4K1EA 3GDSA 3VB5A 1GMHF 2AYWA 3EYDA 5DSFA 4CH8B 9LPRA 4ISHH 2HALA 4A1TA 1MTVA 4NCYA 1FUJA 1S6HA 5A0CA 5K0HA 1RTLA 4FUHA 4XBCA 1Q31A 4XRNA 3FAOA 3SU0A 5JBCS 2CJIA 1K9OE 1HJAB 1VITF 1EJAA 2GMTC 2FOBA 1Y3VA 3FKSD 3LGTA 2KZ4A 1C1VH 4Q4LA 4UDWH 2I6QA 3DSOA 3RXSA 3ITIA 2HPQH 1C9PA 4Y7AA 5EGMA 2A32A 1Z1IA 1ELAA 4LK4A 1S85A 4AYVB 1GI2A 1EQ9A 1GJDB 1IHTH 1H8HD 1UW7A 3BEIB 4ZH8A 1VCPA 1E38B 1OP2A 4X1QU 4THNH 1LHEH 1SGNE 1LVMA 1SLXB 4MPUA 3MNCA 3A84A 1XX9A 2NU3E 4X6OA 1ABJH 1RIWB 2ZECA 2ZCHP 1SPJA 1GI4A 1AVWA 1Y5UT 3H09A 3SU3A 4AYYB 3NKKA 3WWBA 2FODA 1NFWA 4UFDH 4ISOA 2ZI2H 4WMEA 1L4ZA 4ABHA 2YNAA 1O30A 2CK3D 2FOHA 1KXCA 3GCHC 7GCHF 3HPTB 1MTNC 4MPWA 1UCYH 1BTZA 1T4VH 1G3CA 3N7DA 3KIDU 4WXIA 1YY3A 1HAPH 1A3BH 4XDEA 2FOMB 3D49H 1AE5A 1C5MD 1NFUA 1KDQB 4K8BA 3OFND 2BLOA 1AY6H 3ZIAD 4AFZA 3RXIA 1GGDB 3SYJA 2GCHG 4B76A 3A8AA 4NZLA 2QF5A 4P02A 1HPGA 2ZFSA 1BMFD 1W12U 4U2WA 2Z3EA 3U69H 1BMMH 4Q80A 3SNBA 1BHXB 3BTHE 2GGVB 3RP2A 4E7NA 5JBBS 2A7JA 4CRDA 1BCUH 1SHHB 1K1MA 3RXKA 2XOKD 1C2KA 4X2WA 1HJ8A 3AK5A 2OBQA 1C5LH 5DP3A 1MU8B 1CE5A 2C4FH 3RU4D 2ZG0H 3EAJA 1QURH 2GV7A 2PHBA 3TGJE 2ZA5A 1NO9H 2HVXA 6CHAC 3SW2B 1O37A 1TLDA 3QZRA 4GAWA 3KYGA 3LIWA 1D4PB 2KCAA 3MU1A 5EQSA 3VB6A 2FOAA 3ZZ5A 3VPKA 1SFQB 3AAVA 1FI8A 2WV9A 2KCPA 3SUEA 4INLA 2GDDA 1EPTC 2JDID 3PWCA 4RI0A 5FX5A 1TA6A 4IC5A 2H2ZA 3STIA 1ZR0A 3VG8A 2PUQH 1AVGH 1SB1H 2JKHA 4ZKOU 3T2NA 2WPIS 1PPGE 4B71A 1IHSH 3RC6A 2AMPA 4UFEH 4DOQA 3ATMA 4OGXA 4X6PA 2FPZA 1FQ3A 2C90B 1FPHH 5E2OA 3U98H 1TFXA 2UUYA 1O2JA 1Y3UA 2AMDA 4OS6A 2BTCE 3BIVH 2TPIZ 2XBWA 3S7HB 3U8OH 2BD2A 2P3UB 2DUCA 2UUJB 3M5NA 4AGJA 3QGJA 1D3PB 1GI6A 7KMEH 3PTBA 1GDNA 2VIPA 3PV5A 4BNRA 3RXFA 1RFNA 3EA9A 2ANMH 3ZVAA 3SZNA 3V0XA 1ZPCA 2A2QH 1SGEE 2A4RA 1NS3A 1P04A 1MD8A 3U8RH 1T8OA 2Q6GA 2EEKA 1UVUH 3RXOA 1ELVA 5E0GA 1BMAA 1YC0A 2SGEE 1B0FA 1GCTB 2PGBB 1EKBB 2F3CE 1ANDA 1A0HB 1E0FD 3ZZDA 4CREA 1F5LA 1K1LA 3RC5A 5B6OA 5T3HA 1K1PA 3M36A 2ZHQH 4AN7A 1TNHA 3SO3A 3WY8A 3UNRA 3BN9A 1TRMA 1C5VA 1CA0B 1HJAC 3RM2H 4JYTA 1SGFG 4TYDA 1O3NA 3OY5U 4BTUB 1TGNA 4DJZB 4X8VH 3SQEE 2FOCA 3SQHE 5T6GA 1PPZA 1H4WA 1K21H 1P2JA 3RC4A 2KCYA 3U9AH 1J16A 2O8WA 1GJ8B 1QA7A 3PMBB 1RIWC 5E8EH 2ZQ1A 2Z6BD 2ZKSA 1J14A 3TIUA 1F0RA 1EXFA 1W0ZU 2G4UA 3TLOA 3P17H 2EC9H 2FYQA 4GCHG 1FXYA 1C2LA 4FUEA 1AWHB 1MCVA 2A5IA 2WHXA 4Y71A 1IQJA 5FCKA 4E06H 2G51A 4RKJB 1Z8IB 1F0SA 2O8LA 2B5TB 2VBCA 2Y80A 1O2MA 1BQYA 1MTUA 1BOQA 1TGSZ 2F9OA 1GGDC 1HIAB 1ZYOA 3GY5A 4XSKU 4Z0KA 2GCTB 3RMMH 3BTWE 1EATA 3A7ZA 5DK1A 4X1NU 5C67A 4F49A 1QA0A 4SGAE 1C1SA 4D76A 1FAXA 2ESTE 4H6TA 1HDTH 1S81A 1C2EA 1V3XA 2AS9A 4YLQH 1QCPA 1DANH 1B0EA 3SV7A 2P8OC 1EAWA 1ELGA 1B7XB 2CV3A 4ABFA 4ABGA 2FI4E 3GDVA 4JYVH 3GICB 4Y0ZE 4AFSA 2HWLB 1TOMH 1KMHB 3D65E 5EJ1A 3T5FH 1Y3XA 1P2KA 2AH4X 3A7YA 3UFAA 5FPYA 3RXBA 2LP6A 1QB6A 2OCVB 1NC6A 2BDGA 3RXRA 2XC0A 5DP4A 5TCCA 2BZAA 1HIAA 2AIQA 2SGFE 3A86A 5DP9A 1XVMA 1ZGIA 1OYQA 1O2OA 2VJ1A 3E0NB 3ZZ3A 3A88A 2LNCA 3RDZA 4TSFD 1AB9C 3A80A 2IPHA 1GJ6A 2P16A 1TONA 3MH4A 1VITH 2C3SA 1TB6H 4H6SB 1GJ9B 3DFJA 1HBTH 1C5YB 1SQRA 3ELAH 3ZZ4A 4KP0A 2H6MA 2ZDKA 1A5HA 1DDJA 1QBOA 1HFDA 1TMBH 1GHWH 1P2NA 3S0NA 4FUIA 2ZC9H 1QL9A 2HPPH 3IITA 4U01A 3FANA 2J92A 2FLBH 2TGTA 1HXFH 4O3TA 1P10A 1BRAA 3LC5A 1O3MA 1ZPBA 5E0JA 2OXSA 4WMDA 1S6FA 1YCPK 3N7OA 1P0SH 3SJ9A 3PV2A 3AVZA 3BTGE 4UEHH 1O5GH 1DSUA 4JK6A 1HAXB 1FV9A 2A5AA 1C2DA 2VVVA 2BVRH 1NRNH 4ABDA 2K1QA 5FCRA 2HGTH 3TK5A 2H9EH 4B6FA 3BEFB 1SQAA 4GHTA 5HMAA 1EOJA 1S0RA 3EE7A 5E2PA 5A8ZA 5AF9H 3LJJA 2BLWA 1PQ7A 1BRCE 3PMJA 2O8TA 1LPZB 2G55A 1EAXA 2PTCE 1T32A 3TITA 1ZTLA 3BTTE 3BV9B 4NA9H 3SJKA 4AFUA 2BMGB 2ZDAH 1DSTA 2QC2A 5DO4H 1AI8H 2FS8A 2AGGX 3P6ZB 4B6EA 2BYAX 1BJVA 1THSH 2F83A 2PKAB 1Z8JB 2ZU5A 4YXWD 2A31A 3EA7A 3RXTA 4D7FA 3M7TA 3U8TH 1FPCH 2VWOA 3H7OA 4A1XA 2ZU2A 1TX8A 5GIBA 1OWJA 3LGWA 3T62A 1IQEA 2SFAA 2ZQ2A 6ESTA 2ZIQH 3JZ2B 3SGBE 3PLPA 3I29A 1GVKB 1GMDG 1SGIB 1Z6EA 1CT4E 1DY9A 3SJOA 1HJ9A 1C1MA 4CHAC 1CHOG 5IDKA 1VGCB 4K5ZA 5FL7D 2BLVA 3PROA 3K6ZA 4ZMAH 1CGIE 1TQ7B 1UTPA 3KHVA 4FVDA 2O9QA 2G5VA 2PKAA 3LGIA 2BXUH 3RMLH 2R2WU 2UWLA 5DN6D 3O8CA 4NGAH 1L1JA 3A7VA 2KCOA 1YM0A 4FOUC 4MNYA 1T7CA 3CENA 1BIOA 2AERH 1ZOMA 2P95A 3VFEA 1HAVB 1GMHG 1BTPA 3OE7D 1EB2A 1HAYB 3H7TA 1PPFE 1GI9B 1HAGE 3RXHA 3ZYEA 1WYKA 2FXRA 3BTEE 1TOCB 4F4OC 5EIYA 2G00A 1GBKA 4I8LA 1N6YA 4A7IB 3E90B 4Q63A 1O33A 5C0TA 1JRTA 2ZU4A 3HATH 1V2QT 1OWEA 1ZPZA 2FYRA 3OAAD 2BB4A 1VITG 2ZP0H 1O2RA 3F68H 4WXVA 2ZDNA 3PYHA 3QX5H 1P3EA 5A8YA 4LOYH 1JIMA 2HNTC 3F2FA 4ZKRU 4GHQA 1KXEA 1TBRH 1LVYA 3QK1A 1AN1E 1BBRH 4H4FA 1SG8B 5JBAS 3UTUH 1SOTA 1ELBA 2KM0A 5LPFA 1L1GA 1MTNB 4ISLA 1C5UA 4YT7H 4JZIA 1L2EA 3E16B 3PM3A 3QTVH 1P2QA 5T6FA 4AORA 1P12E 2D8WA 3A83A 1T8NA 1TNJA 2FI5E 2NU2E 5C20A 1TRNA 2ANKH 1NY22 2W3IA 2WV4A 1C1NA 1DITH 3UY9A 5AFYH 1VKYA 5DP8A 2GZ8A 2ZHEH 4LXBH 3ZZBA 4BTTB 3BTDE 3AASA 2BD3A 3B9FH 1A1RA 3QTOH 4ZKNU 2P3TB 5C5OA 2LELA 5SGAE 1AKSB 3RM0H 2B7DH 1UTKA 1ANEA 2QF4A 4AG2A 2THFB 2J98A 5A0BA 2RCEA 3BTQE 1ZJKA 5AFZH 2ODYB
chains in the Genus database with same CATH topology
1JOUB 1S83A 5F03A 4BTIB 4UE7H 3S9CA 5AVDA 1CT2E 4ZXXH 4CRBA 1HUTH 2AFQB 3SJIA 1TPPA 1SGRE 6CHAB 4A5TS 2CHAC 1MU6B 3DA9B 2PSXA 1Y59T 3A8DA 3ODFA 4YESB 3RXMA 2R3YA 1D6RA 2TIOA 3MU0A 1P05A 2ZWLH 1AKSA 4FUCA 1AHTH 2FMJA 3PTNA 3SUFA 1ZRKA 3SGQE 1EPTB 1QRZA 4X2YA 2QY0B 2BD4A 2OC8A 4WY3A 1TE0A 3U1IB 2FZZA 5FHTA 1GJAB 4A92A 1KSNA 1ZHRA 1SR5C 1D3DB 1WBGB 1J15A 1FIZA 1HV7A 1LMWB 3MO9A 3LONA 3P8OA 1BTWA 1SLVB 1O34A 2ANWA 5EPNA 1FDPA 2FOGA 3EDXB 1QJ6B 1Y8TA 2GTBA 4NIYA 1CGJE 2ZTYA 1ZMJA 1VGCC 3M5OA 3ZVDA 1HB0B 1FNIA 1ZMNA 4JZ1A 5TJXA 2C8YB 1KYNA 1EP5A 2NU1E 1XXDA 2UUFB 2J2UA 3BG8A 2FTLE 1O2ZA 1FJSA 5F8XA 1ELCA 3SOSA 1W0YH 3SU4A 2P3FH 3F9GA 4B1TA 1GPZA 3HK3B 4JK5A 1IQKA 1X7AC 1QQ4A 4LZ4B 7LPRA 2CMYA 1H8IH 3DUXH 2FOEA 4UONA 1XUJA 3TJUA 2C8XB 3M37A 1SGPE 3TGIE 1W11U 2RDLA 4KKDA 3ZZAA 5JPMH 1C2IA 3KL6A 1JXPA 1EP6A 3PV4A 2BVXH 1YGCH 1VCQA 4I8JA 4DCDA 1DUEA 1O3EA 4ZROA 1WV7H 2GZ9A 3BG4C 3LKWA 2UWPA 2ALVA 2XCFA 1QGFA 8KME2 2ZFPH 1O3IA 1TALA 1A5GH 4ZKSU 3MYWA 4HGCA 3MH5A 1JIRA 1ZHPA 2ZO3H 1NESE 4DG4A 4DIHH 1THPB 3VB4A 1GBDA 3LDXH 1INCA 1GL1A 2ZU3A 2Z9JA 3UUZA 3CS7A 1K1NA 2TRMA 1IQNA 1O3OA 1Z8RA 2PGQB 4GVUA 4KELA 2BLQA 4X8TH 2M5TA 5FPTA 3TJOA 5JYIA 2ODQA 3T26A 3P8GA 1C5OH 1C1WH 3TH4H 4M7GA 5ESTE 3P8FA 5CE1A 3NZIA 1C1RA 3K9XB 2XBXA 2ZFRH 1NRPH 2YNBA 3MNSA 3Q76A 1TBZH 1TQ0B 1ARBA 2FO9A 2P8OB 3ZVEA 1GWAA 5GDSH 4JZEH 4YOJA 4BAMB 4JMYA 5ETXA 1C5ZB 1A3EH 1C1UH 1V2KT 4QT8C 1C1TA 1WSSH 4K8YA 1O5EH 3KQDA 1OXGA 1KDQA 4O03A 4HFPB 1O2YA 4ZHLU 5EXNA 4NA7A 3MI4A 2V35A 1BTHH 3LC3A 3C1KA 2O8UA 2H5CA 2OINA 1TABE 1AB9B 1UK3A 3VEQB 4INHA 4KTSA 1W7GH 4CBNA 3TPIZ 5A0AE 1DY8A 4X1RU 3TK6A 1Q2WA 3KQEA 5HM2A 2NWNA 1LCYA 1QJ1B 2BY6X 5FX6A 4YM9A 2V3OH 4Q7XA 3LT3A 4BXSA 1D9IA 1G3EA 1ID5H 2ULLA 1O2PA 2ANYA 4MNWA 1K1IA 4I7YH 1AZ8A 3S69A 2ZPQA 1A61H 2WPJS 4IN2A 4Y8YA 2TBSA 3OYPA 2XYAA 5L30H 2GDEH 3SHCH 5JB9S 1XVOA 1O36A 1M9UA 1SOZA 1V2NT 1C9TA 2BDAA 2STAE 1C2FA 1YPEH 1MAXA 2VWLA 1YCPH 3F9FA 4MG3A 1IQLA 1F5RA 1YLCA 4IS5A 2OP9A 2I6SA 6GCHF 1O3CA 1V6DA 1LO6A 2OLGA 3FVFB 5EW2H 3QZQA 1NPMA 3PLKA 1GVZA 4MNXA 5FXLA 3HKIB 1CU1A 5C5NA 4OS2A 4MNVA 2PW8H 1P06A 5K7RA 1P2IA 1LVBA 4X6MA 4H42U 3ESTA 1LQEA 1YLDA 2C93B 1T8LA 4OS7A 1H8DH 4AX9H 3UWJH 4ABEA 1GBHA 3MFJA 4DW2U 1SLUB 2GP9B 4FU9A 4FVBA 3RXUA 4XBDA 1EAIA 4HZHA 1KTTB 1L1NA 1NRQH 4OS5A 2Z9GA 2Z9LA 3P8NA 1AU8A 2NU4E 1XUGA 1W14U 2VWMA 1V2RT 3O8DA 1N8OC 1KLJH 2ZDLA 3SHAH 1UJ1A 1ZSJA 1TNKA 4MPVA 3RXLA 4CHAB 1GG6C 3T28A 2R9PA 1LQDB 1O2NA 5L6NH 1DWBH 4AZ2B 1GJ5H 1TIOA 3SGAE 1AMHA 4Y8XA 3M7UA 1Z71A 1ZHMA 2BM2A 1IQFA 1P01A 1NTPA 1WOFA 4ZHAA 3TU7H 2BDIA 1QB9A 2A0QB 3SI3H 4TPYA 2Y7ZA 1BB0B 4A6LA 1A5IA 3FZDA 3GY3A 5T6DA 4X1PU 1HAIH 3RUOA 3GCTF 2ZGBH 1DLEA 1SGQE 1YBWA 1W2KH 1QRXA 3RMNH 1DWDH 3K6YA 2FWWA 4Y6DA 1JBUH 2B9LA 3ZV8A 1XUFA 1BHXF 3H5CB 2Z3CA 4TWYA 4ESTE 1ABIH 5JDUB 1TMTH 1G9IE 3GY2A 1CQQA 4R0IA 1YPLH 1CT0E 1Y3YA 1CGHA 1BMNH 5JBTA 1G2LA 5GPIB 4WH6A 1SMFE 3MU8A 5LPEA 1H9HE 1SL3A 1XKBC 2TGPZ 1DXWA 4I8GA 4O97A 1MBQA 3UWIA 3PMAB 4IN1A 3UPEA 1G32B 3RXGA 1G30B 1J9CH 3GY6A 4MVNA 3FP7E 1SC8U 2CF9H 1HCGA 3P92A 1C5SA 1GI3A 3GY4A 1O5DH 3LGUA 4VGCB 2C8WB 3RXQA 3QUMP 1ANCA 5FAHA 2QCYA 1YKTA 2Q6DA 2A4GA 4I31A 5EQRA 2LPRA 2XWAA 4NA8A 1MQ6A 2O8MA 3RLYH 5LPRA 3HKJB 5AHGH 2QF0A 2EI8A 3T27A 3VXFH 3ZZ6A 1AQ7A 1FY5A 2Y82A 4Q2KA 3SUGA 1E36B 4JCNA 5DG6A 2XWBI 5DJ7A 1TMUH 2CHAB 4BAHB 1HAHH 5A8XA 1GBLA 3SUDA 1GI5A 3S9BA 2BD5A 2BY5X 1O5FH 1H1BA 3VB3A 1LKAA 2WPHS 1EX3A 4U30A 2ZDVH 2SGAA 3RU4E 3FP6E 4FUBA 2P94A 1O3LA 3S7KB 4KTCA 3UNQA 1EASA 3TJNA 1O38A 4AB8A 2Q6FA 1O5AB 1BRBE 2FTMA 1MMJN 1OOKB 3LGYA 4ZAEA 2BD9A 4NSYA 4HI3A 2KAIB 1S84A 1J8AA 4X2VA 1BMLA 3GYLB 1AFQB 1WTHD 1MKXH 3PO1C 2YOLA 4WH8A 2F9VA 4LZ1H 1DX5M 2P59A 1OSSA 3BIUH 2R0LA 1G36A 2WUBA 2H9HA 4HTCH 5BPEA 1Z1JA 4IGDA 4BAKB 2QF3A 2PKSC 3EQ0H 5EOKA 1VJ9U 2SNWA 3SU5A 3RXEA 1YPHE 1GHBF 2WV5A 1O3HA 1QL8A 3OX7U 4KGAA 4O3UA 1UTMA 1XXFA 2W3KA 2WYJA 1GBFA 1DXPA 3A82A 5EXLA 3ZYDA 2PLXA 3UQOA 3M3VA 1P2MA 4UD9H 2VIWA 1NU9A 4UFGH 5F8TA 5DKMA 1AO5A 4TY6A 3GOVB 3R3GB 1UTLM 4AB9A 1SQTA 1XKAC 1P8VC 3C27B 1UCYE 5FPSA 1RJXB 4X1SU 1HLTH 1HNEE 2FOFA 1P11E 4X0WU 3LJOA 4AOQA 2PUXB 1EAUA 3ZVFA 3V12A 3BG4B 2OC0A 4B75A 4NIXA 1H9IE 2B0FA 3SBKA 4D9RA 4MTBA 5C1XA 1XUHA 1P09A 1JRSA 2J95A 1HAVA 3KQBA 2AGEX 3F1SB 1BJUA 3SN8A 1KLTA 4B74A 1AIXH 4GPGA 2F91A 3AAUA 3NUMA 4AG1A 1F2SE 1GDUA 3Q3YA 4CR9A 1GVLA 3W94A 3BTME 3BF6H 4DURA 3MWIU 1ESBA 3TK9A 1TA2A 2VNTA 5I46H 5DP7A 1C2HA 3ATIA 5C3NA 2ZCKP 2GT7A 1GI0A 3GCOA 4X6NA 1C4U2 3MNXA 3G01A 1DM4B 1ELDE 2H9TH 4VGCC 1DVAH 4YTAA 1O3JA 3LPRA 3SJ8A 1O2KA 1PYTD 2WPLS 2G81E 4RKOB 3UOPA 2A7CA 1GBIA 1NZQH 1HAZB 5DGJA 1QL7A 2EA3A 2BZ6H 1DWCH 1A2CH 2BX3A 3SU1A 2ZGXH 4K1TA 1F5KU 3A8BA 1ZJDA 3GY7A 2ZFQH 4KTUA 1AVXA 3JZ1B 1A0LA 2XBVA 3CP7A 1THRH 3E0PB 2Z94A 3AW0A 4YOGA 2R2MB 1O2TA 2HNTE 2ZZUH 2PV9B 1A7SA 2V6NA 1V2OT 4E05H 4I32A 1P57B 5IYTA 3BEUA 2B8OH 4MDSA 4Y8ZA 1BZXE 1O2GH 4MLFB 1VR1H 1UHBB 4FXGH 1A4WH 1GHVH 1HYLA 2FX4A 1MD7A 2ZGHA 2ZFFH 4YZUA 5FBIA 4B73A 4ASHA 2XBYA 2Y7XA 1ZLRA 5CHAB 3GISB 4K1SA 2VWNA 4OS4A 3I77A 1YP9A 4X2XA 1C1QA 1F0UA 1FMGA 4YT6H 1KXDA 4JZDH 1P3CA 5G4BA 3BTKE 2AIPA 4IW4E 2BHGA 1C2MA 1ARCA 1AFQC 1FLEE 3T29A 1FN8A 2DE9A 1ZMLA 4NWLA 4CRGA 4GSOA 3K65B 2VINA 1E35B 3QWCH 3AW1A 1DLKB 1EPTA 2FI3E 3SV6A 1RD3B 2FESH 1D6WA 1YPGH 4OGYA 3SNCA 1A46H 1N6XA 4YO9A 1WQVH 1O35A 1GHYH 1V2UT 2QGRA 3L33A 4ABAA 2QA9E 1UVTH 1O3AA 4D7GA 2FIRH 2ZTXA 4CRFA 1SLWB 2BY8X 2RG3A 1FIWA 3S9AA 2Y6TA 1DE7H 2GT8A 3F9EA 6GCHG 1O2UA 2R0KA 1QB1A 3SU2A 2A7HA 4MPXA 2VGCC 2QIQA 3ZZ9A 1V2TT 1Z6JH 5GCHG 1GDQA 1QRWA 3R0FA 3UR9A 1GBEA 3V7TA 1GJBB 4BXWA 3ATWA 5GWZA 1KY9A 3ATKA 1NFXA 2A5KA 1O5CB 1CBWC 3TH3H 3W95A 1ELEE 3B23B 2QAAA 1O2HA 1BDAA 3MU5A 4WF8A 1C5RA 1MKWK 2ZCLP 2OQUA 3FP8E 3VB7A 2VH0A 3OU0A 2HRVA 3O8RA 1G3BA 2JH5D 1C5XB 1JMOH 1SGYE 1W3CA 1DFPA 3CS0A 3MMGA 3MH6A 1N8OB 1AZZA 1VZQH 1O5BB 1V2VT 1BBRK 1O3KA 3SNAA 1GG6B 4ABIA 4GLYA 1EZUC 4XBBA 1UTOA 1TPAE 1C4V2 2XTTB 3ZZ7A 1AGJA 3QLPH 2VB0A 1AUJA 1GBBA 5J4QA 1Z7KA 2CF8H 5LGOA 4RSPA 1V2LT 2EI7A 2BX4A 2ZPRA 3L6PA 1V2ST 3KF2A 2VIQA 1GJ4H 5EPYA 1SBWA 2OUAA 3UREA 2GKVE 3UOUA 1T4UH 1VJAU 1TBQH 2FS9A 3GCNA 3ZZCA 2ZNKH 1EJNA 1TWXB 3DD2H 1KXBA 1GMCG 2ILNA 1YYY1 3URDA 1FY4A 1H9LB 4B2AA 1AWFH 3MU4A 4NIVA 1MQ5A 2C8ZB 1PYTC 3E91A 2J9NA 2GV6A 1ZTKA 2V0BA 1UVPA 1LHFH 1K28D 2JETC 3TNTA 3ZZ8A 1TYNA 1JWTA 1UK2A 1CA8B 2BVSH 3BSQA 3GCTG 1EJMA 4IBLH 3SORA 4NWKA 8LPRA 4RN6A 1O3PB 6LPRA 3FZZA 3MNBA 2XCNA 1OP0A 1UVSH 1LHGH 3PB1E 5A09A 4FUFA 3IG6B 3B8JA 4CRCA 1O3BA 1O2QA 2R3UA 1UTJA 4Q7ZA 4AFQA 1NRRH 2SGDE 3MOCA 5C1UA 5DP6A 1D3QB 3K2UA 1ANBA 1IOEA 1V2WT 5CHAC 8GCHF 2H1UA 1GBJA 4K69A 2A1DB 5CMXH 1LHCH 4U32A 3KGPA 3VGCB 2IOTA 4K60A 1GHAF 2GZ7A 1O2WA 3UR6A 1P9SA 3Q3XA 1ACBE 2QN5T 1HAOH 1LPGB 3RXPA 1NFYA 4Y0YE 1NRSH 1K1OA 2Z9IA 3OSYA 1TNIA 1G37A 3DFLA 2F9BH 3Q3KA 2BD7A 4YLUA 4TY7A 2BDBA 3PWBA 2QXIA 1TGBA 2QXJA 4ZXYH 2ZGJA 2Y5FA 5L2YH 1ETTH 2VIDA 1TNGA 1O39A 1XMNB 3A7XA 3KNXA 1P03A 2UUKB 3E3TA 4B2BA 1C5QA 1XUIA 1OWIA 2AEIH 3E6PH 5BRRE 5GCHF 1S0QA 1UO6A 5DPAA 3OY6U 1ZZZA 1WUNH 1QFKH 2FEQH 2BXTH 2J34A 3VXEH 3KEEA 3UQVA 2XNIA 3M5LA 1GJCB 2BDCA 5F8ZA 2XXLA 2ZGCA 1DT2A 3LU9B 1XM1A 3MH7A 4NFEA 2VVUA 5GJ4B 1O3DA 2VIVA 4WJG2 3T25A 1QTFA 1SI5H 8ESTE 1KLIH 1FY3A 1XUKA 3LOXA 3A7WA 2F9NA 4IMQA 3A89A 2ZFTA 1O2IA 3TVJB 3SV2H 3URCA 5C2ZA 1OWHA 1SGFA 2G4TA 3NXPA 2FM2A 1KXFA 5E0HA 1YPMH 3PO1B 2Z3DA 4CR5A 2DE8A 3ZV9A 1YPJH 1CO7E 4IC6A 1MZDA 4NZQA 1GHZA 2JH6D 3RXAA 3PLBA 2BQWB 4Z6AH 2SGPE 3EGKH 5LH8A 2OBOA 1Y3WA 1UCYK 2PKSB 3E8LA 1EUFA 5JB8S 1NT1A 1OWDA 1O3GA 1Q3XA 2J38A 5J4SA 1AD8H 1LDTT 1BTUA 3QO6A 4J1YA 1BT7A 1GMCF 2Q1JA 1EB1H 1GHXH 2G5NA 1OKXA 1TX7A 2GCHF 1ESAA 1BBRE 3KCGH 2IN2A 1ELFA 4XOJA 3NCLA 2RA3A 3GYMA 1O0DH 1GHBG 3TGKE 2ALPA 1RGQA 2A4OA 2JH0D 1IQMA 1KTSB 1HGTH 2PFEA 2NU0E 3P95A 1NN6A 2ZTZA 1NU7B 4INKA 2EI6A 3QDZB 1KXAA 4ABJA 4CBO