3LGVA

H198p mutant of the degs-deltapdz protease
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
217
structure length
204
Chain Sequence
QFDSTDETPASYNLAVRRAAPAVVNVYNRGLNLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGNFLQTDASINPGNSGGALVNSLGELMGINTLSFDKSNDGETPEGIGFAIPFQLATKIMDKLIRDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 46
structure length 204
sequence length 217
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lgvA02
3A7ZA 3S7KB 1ELDE 3SORA 1GBMA 3SU6A 1HAXB 3MHWU 1FJSA 1TGNA 1BB0B 5JBBS 2QV1A 3VB3A 1GHAF 2BQ7B 3W95A 1C1RA 1QNJA 3O8BA 1BTWA 2P94A 1P2OA 3HGPA 1MH0A 5ETXA 1YBWA 2NU3E 3ZV9A 2R0LA 1ABIH 5AFZH 2PFEA 1UK3A 1LPGB 1YCPH 1TBQH 1SGEE 3P8FA 4DGJA 3SJ9A 3NUMA 2B7DH 1EJAA 1BTXA 3URCA 2LPRA 1GI8B 3ITIA 1FZZA 3U8TH 3GDVA 4HZHA 5JDUB 3SU2A 2A2QH 1V2WT 1ANDA 1EB2A 1Z8GA 1A2CH 2V35A 1JIMA 8ESTE 3TLOA 3K6ZA 4B2BA 1O5CB 4OGXA 2BXTH 1LHGH 2ASUB 2QA9E 3QTOH 4ASHA 1QA7A 2OD3B 2TRMA 3RU4T 1W13U 3BF6H 5FPTA 1OWDA 2UUJB 1GVLA 2C3SA 2TGAA 1O5FH 1L4DA 1TALA 2VJ1A 3P70B 3RXLA 5LPFA 1PPCE 4WH6A 3QDZB 2WUCA 2DE9A 3V3MA 3URDA 1TGSZ 2JH0D 1GBIA 1GHBG 3G01A 2BB4A 1C4Y2 3MO3A 1DSUA 1JBUH 3E6PH 3EGKH 3TJOA 3ZZ9A 3ZZCA 1AB9C 1Z6EA 1SFIA 1SGDE 4FUCA 1Q31A 2A4OA 1KXEA 2D26C 2GCHG 4OS5A 2VGCB 3F6UH 3OY6U 3UFAA 5SGAE 1ARCA 1YYY1 4FUGA 1CGHA 1BHXF 1XVOA 3SQHE 4YOGA 4SGBE 4JZIA 5C3NA 1CT4E 1P9UA 3BSQA 3I78A 1AHTH 2P3TB 1O39A 4YO9A 1LKBA 4Y0YE 4RKOB 1ZTKA 2QXHA 3GY2A 1DWCH 2H6MA 4AB9A 5JYIA 2Y5HA 1GL0E 4DVAU 2VIPA 1SL3A 1ZLRA 1OWIA 1A3BH 2W7SA 2VWNA 1NRQH 1YPGH 1PQ5A 1AQ7A 4TWYA 1C2LA 3VB7A 4H42U 2F9UA 2ZHWH 1NU7B 4B74A 2QC2A 4GAWA 2BDAA 5DP6A 2Y5GA 1ZGVA 4DW2U 2AGGX 2XWBI 1FDPA 4CH8B 3KQEA 3MI4A 1C5QA 1EZXC 1GI9B 1S82A 1EOJA 2XBYA 2ZHFH 5EGMA 4MPUA 4FVDA 1ARBA 1IQFA 4CHAC 1W14U 4GUXA 5JBCS 3BIUH 1O3FA 3MH6A 3RC4A 1ELVA 1TX6A 1O5AB 1A46H 1OX1A 2AMDA 3W94A 4ABAA 3KEEA 2ESTE 3MFJA 4X8VH 3HPTB 1MKXK 2ODQA 1K1IA 1O3OA 2CN0H 1O2KA 1ZHMA 2Y6TA 2J4IA 1G30B 1DOJA 5FXLA 4YOJA 2AMPA 3EE0B 2XWAA 5EQRA 6CHAB 1HYLA 1HRTH 4AN7A 9ESTA 1TBRH 1EPTC 3RXJA 4A92A 1EZUC 1GMDG 4XFQA 3L33A 1JRSA 2YNAA 2ZQ2A 1NU9A 2CHAB 1RXPA 2XBVA 2ZCLP 2ZHEH 1J8AA 1V2PT 1KXFA 2Y80A 1O5BB 3N7OA 3SNDA 1UHBA 3FFGA 1O3PB 1ELTA 2FOFA 3QK1A 1IOEA 1DWDH 4A1TA 1TX8A 3T5FH 3QO6A 1E36B 1OYTH 2PKAB 3Q3YA 1MKXH 4CRBA 3R0FA 2NWNA 5DK1A 1CHOG 4AGJA 1WTGH 3R3GB 1QIXB 1MTUA 2A7JA 3NXPA 5GPIB 1TGCA 1D6RA 2Q1JA 3VGCB 1RD3B 2Z9KA 2F91A 1E34B 1V2NT 3T28A 3TK5A 1O2TA 4X6MA 2GCHF 4AZ2B 2ZGHA 1SGFA 2GCTC 3MMGA 2AERH 3A87A 5LGOA 1V2VT 2WPLS 1DSTA 1EP5A 1P0SH 1LO6A 1P05A 1O38A 1AKSB 3PWCA 3LC3A 2B0FA 1KXDA 3MH7A 1V2RT 2HALA 1AU8A 1D3TB 1LQEA 4NGAH 3RXKA 3BEFB 1KTTB 2VWOA 3ODFA 1NFYA 2ZU2A 1GCTB 4B1TA 3GY4A 4K1EA 3P8NA 2BLWA 1H9IE 4X0WU 1UK4A 3RXHA 1AZZA 1MTNC 1LHFH 1Z8IB 5EQQA 3ZZ7A 4B73A 1AWFH 2FLBH 4OS1A 4WMDA 6GCHG 1Y3XA 1ZHPA 1TNLA 2D8WA 2AGIX 2C8YB 5C20A 3NWUA 1YCPM 2BD8A 3RP2A 3CENA 1K1LA 2G4UA 3RXGA 4I8HA 2Q6FA 3EYDA 1LPZB 3BV9B 1Z7KA 2F3CE 4XBBA 4UFDH 2ANMH 4MNVA 1FMGA 3SU1A 4E06H 3U8OH 1SQAA 1G2LA 4AX9H 3AAUA 2RA3A 5DO4H 2H1UA 2BD3A 1CT2E 1V2ST 4ZKOU 1K1OA 1JIRA 4ZXXH 1FONA 1F5KU 5JPMH 4F4OC 1V2QT 4FU8A 1VCQA 2PTNA 3SU3A 3TK6A 3V0XA 3SUGA 4ISLA 3ZZ8A 3PM3A 1Y8TA 3GDSA 2O8TA 4BAMB 2BD5A 1S85A 3GCTG 1C1UH 1EJMA 4AOQA 1BHXB 1BTHH 2FESH 3SUEA 5IDKA 1P2IA 1ESTA 5CE1A 1GMDF 1KDQB 1W0YH 2VNTA 5F8XA 1CSOE 2A4RA 2SGFE 4OS7A 1HAVA 1MQ5A 1S6FA 1J16A 1PPBH 1V2JT 1NO9H 1YF4A 3OU0A 3A8DA 1ELFA 2VWLA 5T6DA 3MH5A 1NRPH 1LVYA 1MU6B 1NT1A 1PYTD 3M61U 3RXRA 3ZVEA 1GJAB 1RTFB 4U30A 2OC7A 4UE7H 2VB0A 2VINA 3C1KA 2C8XB 3HATH 5HMAA 3RUOA 3HK6B 2VVCA 2PR3A 4IGDA 4NA7A 4U32A 1HDTH 2B5TB 1Y3UA 2Z9GA 3MH4A 4KP0A 1GI0A 2WYGA 1SOZA 1AFQC 1SLWB 2ZTYA 2XC4A 3RXFA 3Q00A 2AGEX 4BNRA 1EX3A 1K1MA 2W26A 3OX7U 4JK6A 5DP7A 4Y8YA 2BDBA 4X8UH 4ZKNU 2Y82A 3MYWA 1TPPA 3A7VA 1PPFE 3EA8A 4WWYA 4Y0ZE 1NFUA 1RTKA 2J92A 1BZXE 3M35A 4Y79A 2ZP0H 4O97A 1DDJA 1P2QA 2ZDLA 2D1JA 4DY7B 2GCTB 1TB6H 1DICA 3NZIA 1Z6JH 3VB5A 1H8IH 2ZCHP 3BTME 2GZ9A 2HNTF 3GY8A 4CRDA 3RXBA 1LHDH 4WY3A 3KN2A 1DUEA 2V3OH 3M37A 1HCGA 1GGDC 2XYAA 5LH8A 4JMYA 3AASA 2UWOA 1MBQA 1O3BA 1BQYA 2Q6DA 3M7UA 4D9RA 1THPB 3SN8A 7ESTE 2BX3A 1NFXA 1AUTC 2H5DA 1PPEE 6GCHF 1GG6B 4IN1A 1O5DH 1A61H 1V2MT 4VGCC 1C2IA 4ZROA 3B23B 1A0LA 1P2NA 1YPMH 8GCHG 3BTFE 4UFEH 2H9EH 1PQAA 2OC1A 1T4UH 2SNWA 1OWKA 2HNTE 3A8BA 5EG4A 1GHXH 1L2EA 1XUHA 2F9OA 3UOUA 4TY7A 1XKBC 3P8OA 3LH3A 3IWMA 5E0GA 5FBEA 3E0NB 2B9LA 2OP9A 2ZNKH 4NZLA 1AI8H 2P8OB 4NIWA 2C4FH 1DLEA 1RGQA 2R9PA 3AVZA 4I31A 4Q7ZA 1TX7A 4WVPE 1W12U 1CQQA 1GHAG 2I6SA 1LHEH 1XXDA 2B8OH 4ZUHA 2C8WB 1SI5H 1ZJDA 5A8ZA 3LC5A 4D8NA 4IS5A 4U2WA 1NFWA 4CRFA 1GI7B 3HKJB 1L1JA 1AVWA 4BTUB 4JZEH 1Y5BT 3KF2A 4UFGH 3M5MA 4ZKRU 3NKKA 1ZYOA 4ZHAA 1QCPA 1PFXC 1FN8A 1ZMNA 2F9VA 3DT0H 2CMYA 2WPJS 1ANCA 3RXOA 3GYMA 2ZI2H 1RRKA 1T8MA 1WQSA 1P10A 5T6GA 2KAIA 1A5IA 2G4TA 2ZFPH 1SC8U 1LPKB 1SVPA 1HJ8A 5DP3A 1A5GH 3A86A 1GVZA 2FYQA 4GHTA 3SUDA 4AFSA 1TNKA 4XDEA 1HNEE 4AYVB 2GV7A 2M5TA 2XCFA 1B0EA 3PTNA 2G51A 1HV7A 5BRRE 1SB1H 1K2I1 3ZVBA 3M36A 2P95A 3PLPA 1HB0B 4R0IA 3KNXA 2K1QA 2CXVA 1AD8H 3RXSA 2WV5A 2Z94A 2FI5E 1A7SA 4IBLH 2BY6X 4BAHB 1QURH 4HTCH 1B0FA 4ABDA 2BXUH 3RMOH 4LZ1H 4NG9H 2P59A 2HPQH 1VITH 1P11E 3KQBA 2F9PA 1GDQA 2Z3EA 3TGKE 3O8CA 1SQTA 1C5NH 4ISOA 4NIVA 1O37A 3S9CA 2J34A 2H2ZA 2BLOA 3ZYDA 4FUFA 1ETTH 5DP9A 2WYJA 3TH4H 1HXEH 4RN6A 3NCLA 3MWIU 5I25A 3TGIE 2P3FH 1KTSB 1BMNH 2A4QA 3RXMA 3TITA 1QB1A 1GBJA 2DUCA 1VZQH 2Q6GA 2SGQE 1CE5A 4Z0KA 5CHAB 3AW1A 2WPKS 3QWCH 5L2ZH 3UPEA 2SGDE 3SV7A 3MOCA 3ATWA 5F6MA 3SBKA 4K8BA 1G3CA 1SSXA 4K5ZA 3MU8A 1TQ7B 3GY6A 3SNEA 2SGEE 1QQUA 1G36A 4I8GA 4BTIB 2R2WU 4HGCA 1EKBB 2GT7A 5DKMA 2R3YA 4MVNA 3KHVA 4NCYA 1C5TA 1Y3YA 3M7QA 1DFPA 2BM2A 3RU4E 1Z8RA 2BLVA 4X1RU 1V6DA 1WAYB 3MO9A 2XC5A 3BTGE 4O3UA 1UVSH 1QJ7B 1L1GA 4YT7H 1BA8B 2FI4E 1P2KA 3LGWA 2ZFFH 4BXWA 6CHAC 1O3CA 1QB6A 2BZ6H 3F9FA 3OTJE 3P8GA 5HGGA 4DCDA 1XMNB 1D3PB 1TONA 2RG3A 4H6TA 2QY0B 1ZTJA 4ISNA 4Y7BA 2CHAC 3TJVA 1D4PB 1TFXA 3SQEE 4TWWA 1UVPA 3UREA 5LPEA 3A81A 1IQGA 4OS6A 2ZZUH 1FLEE 2A32A 3K9XB 4XBCA 1EATA 2QGRA 1C9TA 2UUKB 1LTOA 1TMBH 5FCRA 3RXTA 2BHGA 1F0RA 3HGNA 1Z1JA 3RXCA 2ZU3A 3SJKA 2GX4A 1FQ3A 1H1BA 4O3TA 3H7TA 1SGNE 2FOBA 7KMEH 1P2JA 1S81A 1C1QA 3GISB 4YESB 5F8TA 4JZ1A 2UUFB 3VGCC 1MKWK 1E37B 1O2UA 2BY7X 3PWBA 4Q7XA 3F1SB 1EJNA 1EXFA 1HFDA 1A3EH 1EOLA 1P01A 2IPHA 2BOHB 4K2YA 1QL9A 1RS0A 1C5YB 4GSOA 5A2MH 1AIXH 3ZVDA 3TJNA 1ZRBA 2BDHA 4A1XA 1DWBH 1TQ0B 5EXMA 1LCYA 1P8VC 1RTLA 2PKSC 3ZVGA 4B2AA 1GCTC 5K7RA 5FAHA 2FZZA 1W7XH 1O32A 2XC0A 1OWJA 1GVKB 2ZWLH 1YPKH 3SV2H 1H8DH 2ZFTA 1BDAA 2P16A 2IJOB 5E2OA 1HAIH 5C1YA 1MKWH 1HUTH 3ZZ6A 5HXFA 3U1JB 2JH5D 3DD2H 4CR9A 1TMUH 2OTVA 1UVUH 5AFYH 4FXGH 4JYTA 1Y5AT 3D62A 1PYTC 4NZQA 1K1JA 1N1LA 3T26A 2QXIA 2VH0A 2O8UA 4X6NA 2V6NA 1EASA 3KQCA 2ZCKP 1AY6H 3M5OA 2ZO3H 1JXPA 3P6ZB 1MQ6A 1IQKA 1GBEA 1O2VA 3RC6A 2GTBA 2W7UA 1F5RA 1C1MA 1DY9A 1GI2A 3FZDA 3KCGH 3KIDU 1XXFA 1CO7E 2TGDA 3ATIA 4WXVA 1G37A 1GBDA 1C9PA 2G00A 2ALPA 2FOAA 2O8MA 3RDZA 3RXVA 3MNBA 1DX5M 3P95A 4K8YA 2FEQH 2ZPRA 1CA0B 1ZMLA 2GD4B 4CBNA 1VGCC 2PGBB 3I77A 2SGPE 4AGKA 1W2KH 1ZZZA 1TOCB 1D3DB 1U6QA 1QRWA 4MG3A 1Q2WA 1OP8A 5TCAA 4CRCA 4JYUH 4R8TB 1C5ZB 1LDTT 2A7HA 1IQMA 1SGPE 4ABJA 3TH3H 3ZZ4A 1O5GH 4DJZB 3Q3XA 4KKDA 1O3HA 3D23A 3MO6A 5HYOA 1D3QB 1O2ZA 1QRXA 2VWMA 4CBOA 2C93B 1J17T 5L30H 4MLFB 1SGRE 2BQWB 1Z8JB 3U8RH 1EZSC 3ESTA 1DM4B 3F9HA 2G52A 1E35B 1HIAA 2P3UB 4AG1A 1SGYE 2BQ6B 4GCHF 4NIXA 1CGIE 3VPKA 1S0RA 3STJA 1LQDB 4MDSA 1Z1IA 3S9AA 1MTWA 1EAWA 6ESTA 4INLA 3TH2H 3QUMP 3SGAE 4M7GA 4IC6A 2BY5X 2ODPA 1V2UT 1UHBB 4DURA 3P17H 1TA6A 1E0FD 4BOHA 1VCPA 5GDSH 1EUFA 2Y81A 2QIQA 3BTHE 5FHTA 3GICB 4D7FA 1O33A 3IITA 3SHAH 4AFUA 1JRTA 1DXPA 4FUEA 4Q80A 1GHWH 1NM6A 4ABGA 4FUJA 3TIUA 1GJ6A 1UTOA 3M3TA 1EQ9A 3SO3A 2GP9B 1O34A 1SFQB 2J2UA 4FUIA 1C2GA 2PKSB 3SJOA 1NESE 3PROA 5HM9A 1GBCA 2ZKSA 1GG6C 3FP6E 5A0CA 1T4VH 1YC0A 2GKVE 2V3HH 2A5IA 1CVWH 3SGQE 1YP9A 2BY8X 3K65B 1MTVA 4Y8ZA 1EP6A 2Z9JA 4X2VA 3DFLA 4LOYH 5AVDA 1TWXB 1O2HA 2FIRH 2OC0A 2VIOA 3KGPA 1O36A 1TNIA 4AFQA 1O2NA 2BD9A 1AZ8A 1HAYB 2BDGA 1VITF 1BOQA 1GJDB 5I46H 1BRCE 3F68H 1DE7H 1ZHRA 2I6QA 4WMFA 2TIOA 4NSVA 2P8OC 1FUJA 1FPCH 4A7IB 4NA8A 3ZZBA 3VB6A 1KSNA 4DG4A 2J94A 1GMHF 3EA9A 1OWEA 3M5NA 4WMEA 1ZSJA 4SGAE 1TPOA 3PMHB 3RM0H 3GDUA 1EAUA 3PLBA 2ZDAH 1MU8B 1VGCB 1HXFH 1QBVH 3T29A 1A4WH 1O2XA 1TMTH 4X6PA 1YM0A 5JB9S 2BVSH 1B7XB 3RXIA 4Y8XA 3GCOA 2BY9X 1WYKA 3UTUH 4MNYA 1BITA 3LDXH 2THFB 2WPIS 1EAXA 4X1NU 1T8LA 2ZPSA 3JZ1B 1ZOMA 1CGJE 2IN2A 3BN9A 2R0KA 3D49H 3BTDE 2VH6A 2PSXA 1MD7A 2A45B 3V7TA 2YNBA 1ORFA 3RMNH 3TJUA 2BDCA 3RM2H 1EPTA 4MPXA 1O3IA 1O0DH 3GYLB 3CP7A 2CF9H 1OYQA 2ZFQH 1KLIH 2FS8A 1GJ5H 3LJJA 1GI4A 5A0BA 3TNSA 1FAKH 1GJBB 3LONA 1P02A 3SU4A 1HGTH 1AMHA 1MTSA 1MCVA 4Z6AH 1TNGA 3BTKE 1A0HB 1EB1H 1C5WB 5PTPA 7GCHF 5GWZA 1BJUA 2A5KA 1HAVB 3PTBA 1YLCA 2ZGXH 3BEIB 2ZTXA 1TGBA 1K9OE 1OSSA 2Z9LA 4IC5A 2HGTH 1G2MA 2ILNA 2QF3A 3SJIA 5LPRA 1HAOH 1GBLA 1O2WA 1FIWA 3U1IB 3QTVH 5DGJA 5AHGH 3SJ8A 4X2XA 4DT7B 4ZHLU 2Z3CA 2A4GA 1K22H 1N6YA 1QTFA 1L4ZA 4GHQA 2FTMA 4Y71A 2FOEA 3UNQA 4JYVH 2FODA 1SPJA 1VJAU 1C1SA 4O9VA 5DP4A 1LMWB 4RKJB 1S5SA 1KY9A 1IQNA 2Y7ZA 3Q3KA 3PLKA 2FOMB 2PUQH 5L2YH 2FX6A 1C2FA 3A80A 2FOCA 1ELBA 1TRYA 3V13A 1AWHB 1XUIA 1CBWC 1ZSLA 2FOHA 1O35A 1TOMH 1HLTH 1BTPA 3H5CB 1KLTA 1C1NA 1IAUA 5CHAC 2TPIZ 3MU1A 3RXQA 1YLDA 1F2SE 3LJOA 5JB8S 1SLUB 4I8KA 1FIZA 2ZGJA 1C1VH 2R2MB 3OYPA 1SOTA 1H9LB 3SI3H 2BMGB 3MU4A 1QY6A 3EAJA 1ABJH 1GHVH 1SHHB 2WPHS 3T2NA 3E16B 1UCYE 4AORA 3KQDA 1WUNH 1JMOH 4MNXA 1O3LA 2PUXB 2OQ5A 2ZHDA 1Y5UT 1F7ZA 1G3BA 1P3EA 1OPHB 1DITH 1DT2A 1HBTH 2FS9A 4LK4A 4FVBA 2FLRH 4Y6DA 3BG8A 4LXBH 2ZG0H 4OGYA 1N8OC 3FP7E 1UTKA 1GMCF 1C1WH 1YPEH 5E2PA 2HNTC 1GBFA 4XSKU 1EAIA 1RJXB 4WJG2 3A7YA 3E1XB 4MPVA 4Q2KA 2AH4X 1Y59T 5BPEA 1GL1A 5A09A 2PW8H 3S69A 4H4FA 5FPSA 4X2YA 1SGFG 1AFEH 1O2RA 1QHRB 1C1PA 1FAXA 1QJ1B 2ALVA 1TAWA 2AEIH 2CF8H 4I8LA 5DG6A 2BD4A 2NU1E 3T25A 3SOSA 1NRSH 2FOGA 2F9NA 2ZPQA 2AS9A 3FP8E 3VEQB 1GBKA 1NROH 1GPZA 2W5EA 2EI6A 4XBDA 5A8YA 3A84A 4RSPA 5FCKA 5F03A 1INCA 1F5LA 1MMJN 1B5GH 2J95A 4NIYA 1DY8A 2YOLA 3ELAH 5C5NA 1SLXB 1O2PA 1BMMH 2JETB 4JK5A 3ZZAA 2KAIB 3QGJA 3F9GA 4MTBA 3F9EA 3JZ2B 3ATMA 3CS0A 1IQHA 1O2MA 1AUJA 2G5VA 3GY7A 1XUKA 1PPGE 3A7WA 4CR5A 1BTZA 1YPJH 1QFKH 1WBGB 3STIA 4GVUA 5EXNA 4I32A 3RXEA 3T62A 4K1SA 1YPLH 4KTUA 4FUHA 2OXSA 1GI6A 3WY8A 2ODYB 4CRAA 1EZQA 4MQAA 5TJXA 3E3TA 1P3CA 2F83A 2QF0A 1NC6A 1C5UA 3BTWE 1VJ9U 3SV6A 1DXWA 1BBRE 2O9QA 4WH8A 1CBWB 4Y7AA 1XVMA 2ZDKA 4Q7YA 2FDAA 2FYRA 1YKTA 2BDIA 3SNCA 1ZPZA 2OBOA 4K60A 5IYTA 1A5HA 1ELEE 5B6OA 1TE0A 3EQ0H 3A8AA 5EU8A 1P09A 3MTYA 1QL8A 4YTAA 8LPRA 1GI3A 1S6HA 1O2JA 3U69H 1KIGH 3O8DA 4X6OA 2BYAX 2CGAA 3LGYA 1C5SA 4ZXYH 1A0JA 2O8WA 4ZAEA 4OS2A 1BTUA 1BUIA 1P03A 1YPHC 2PTCE 2ZGBH 2BOKA 1UK2A 1V2TT 1CHGA 2A1DB 2SNVA 3QZQA 1TRNA 1CA0C 1V2KT 1GWAA 3PMBB 1X7AC 1Y3WA 2NU0E 1L0ZA 2UWPA 1TABE 2GZ7A 2BVXH 1C2EA 3TK9A 1UCYK 1O3JA 1QBOA 1W10U 2FXRA 3RXUA 3SNBA 1C5VA 1UTMA 1N6XA 2HRVA 5C1UA 1F0TA 1VR1H 1L1NA 1N8OB 3OY5U 5C67A 1GBBA 1S0QA 2UWLA 3FANA 3ZVFA 4ZHMU 1G9IE 2GDEH 4ABFA 3E91A 2O8LA 3RMMH 4E05H 1OKXA 6LPRA 3C27B 1T7CA 1THSH 1W11U 2G81E 3SU0A 1NRNH 4ABBA 3UUZA 1GDNA 3QZRA 1E38B 1IHSH 1JWTA 3M3SA 3ODDA 3S0NA 5EPYA 2TGPZ 1ZGIA 1UCYH 2RCEA 3GY5A 7LPRA 4FU7A 1GJ8B 4GCHG 4HFPB 1IQEA 3DHKH 1IQLA 3SV9A 4B2CA 1A1RA 1HAGE 2W3IA 1O5EH 3ZVAA 2BTCE 1VCWA 1SQOA 3Q76A 4B75A 1S84A 4IW4E 4K69A 2F9BH 1SBWA 1FY8E 1KXAA 1OP2A 3ATKA 3LGUA 4I33A 2GT8A 1GBHA 2QXJA 1IQIA 3SNAA 1O3KA 1SGIB 1XUJA 3SZNA 3OSYA 3TPIZ 3GCHB 1K28D 4Y10E 3E0PB 2OC8A 3RMLH 3EDXB 4X1QU 1F92A 4TPYA 3UIRA 1WV7H 1O2GH 1UTQA 4ZMAH 1PJPA 3GCNA 1UVTH 3LU9B 5GJ4B 2OCVB 1C2HA 1BMAA 1DWEH 1DUAA 3LPRA 1AE8H 5J4SA 1RIWB 3LIWA 2FP7B 3DUXH 3EA7A 3SV8A 3VXEH 1BMLA 2VU8E 3A89A 2V0BA 4AYYB 4Y76A 5HM2A 1HJAB 5C2ZA 5EXLA 1C2MA 4BAKB 1BBRK 1TLDA 3U9AH 3S9BA 2FO9A 2ZEBA 1GBTA 1TPSA 1WCZA 2G55A 2EEKA 2G8TA 5J4QA 1UMAH 2VIDA 2DE8A 2FM2A 3A85A 1FY5A 1O3NA 1P06A 4F49A 3SUFA 1UO6A 2TGTA 1ESBA 1VITG 5ABWA 5GCHF 2ZDVH 1GHYH 3SGBE 8KME2 2NU2E 1C2KA 4YOIA 2BD7A 4NFEA 1AE5A 4JZFH 1GMHG 2J38A 5JBAS 2QN5T 4TY6A 4I7YH 3PYHA 2FI3E 1O3MA 3FAOA 3VFEA 1XKAC 1BBRH 1C4U2 4KELA 1XM1A 1AVGH 1BRAA 3B9FH 1BCUH 5DP8A 4NWKA 2ANKH 2VIQA 2ZU1A 1W8BH 1H4WA 5EPNA 4YLUA 1FY3A 5K0HA 1F0SA 1MAYA 1ZRKA 1SLVB 2QAAA 4INHA 1TNHA 3L6PA 2QXGA 2FTLE 3FVFB 1O2QA 4MPWA 4XOJA 1UTJA 2H9HA 2WINI 1TNJA 2GVFA 1BRUP 1QJ6B 2QYIA 1TYNA 3MNSA 2PWXA 4A6LA 1FN6A 4UEHH 4BXSA 2ZC9H 3BEUA 4NWLA 2A31A 2H5CA 2C90B 3NPSA 1UTLM 3QGNB 1C5PA 3NK8A 2ZFRH 1TRMA 1WTHD 5E8EH 3V12A 1OXGA 5DPAA 2XW9A 3SU5A 2PKAA 7GCHG 1GJCB 2Z3DA 5JBTA 1QL7A 1BIOA 4BAOB 1NY22 1RFNA 1WSSH 1O2IA 3UR9A 5FPYA 1HIAB 3DFJA 4X2WA 1O30A 2HVXA 1MZAA 1BJVA 1Q3XA 2ZDMA 4DOQA 3TVJB 1PQ7A 1W7GH 2GGVB 1FPHH 3A88A 2PSYA 4ISIH 1P12E 1C5MD 1FNIA 1LVOA 3PB1E 4D76A 2ANWA 1GHBF 2ZA5A 3QN7A 3SHCH 1AKSA 1NS3A 2HWLB 5CMXH 1O2LA 2A7CA 1HAPH 2ULLA 2ZGCA 2VIWA 3VXFH 5C1XA 4YT6H 1GJ9B 1IQJA 1SGQE 1UJ1A 3RLWH 1AB9B 1W0ZU 1ESAA 4I8JA 4ESTE 2GMTC 3KL6A 1QBNA 5GXPA 2HLCA 1DLKB 2Z9IA 1LVMA 1ELAA 3RU4D 3RLYH 2EI7A 4J1YA 1MD8A 1K1PA 1THRH 3ZVCA 1HPGA 3SW2B 2OBQA 4JCNA 3T27A 4H6SB 2CJIA 2ZU5A 4YZUA 3LKWA 4J2YB 1ID5H 2VIVA 1H9HE 2XCNA 3VB4A 2SFAA 1NTPA 5F8ZA 2BDYA 4HI3A 2J9NA 3BTEE 3SI4H 1ZSKA 2A0QB 4UD9H 3ENSB 1T32A 1UTPA 4A5TS 5AF9H 4WF8A 2BX4A 2GV6A 3UNRA 4IMZA 3U98H 1BT7A 2XNIA 4YM9A 1OWHA 1O2SA 3UWJH 1O2OA 2OQUA 1NZQH 2TBSA 3LGTA 4ABEA 1LHCH 1FI8A 1GMCG 2FWWA 1QGFA 4X1PU 5ESBA 1C5OH 2G5NA 1FY1A 3A7TA 2WUBA 4BAQB 5EQSA 1TIOA 1C5XB 1F0UA 2ZQ1A 1UVOA 4XE4A 1CT0E 1ANBA 3ATLA 1Z71A 2Z7FE 5TCCA 2STBE 1KDQA 3HK3B 4CHAB 1T8OA 4TPIZ 2AIPA 1O3EA 4BTTB 3S7HB 1C2DA 1O3GA 1J15A 5T3HA 3LGVA 2Y5FA 3UY9A 1K21H 5G4BA 1SR5C 2GZ8A 2AFQB 1QQ4A 1WOFA 3H7OA 4X8TH 3TU7H 2FMJA 5DJ7A 3LH1A 3QX5H 1KYNA 2JETC 3MU5A 1C1TA 1ELGA 1J9CH 1FY4A 2SGAA 1TBZH 2EI8A 1EPTB 1SGTA 1W3CA 1GBAA 2Y7XA 4K1TA 4FUDA 1UTNA 5E0HA 1AO5A 1NN6A 3ZYEA 2QCYA 3L3TA 1WU1A 3UNSA 3BG4C 4Y11E 3D65E 1CHOF 5EW2H 4LZ4B 3ZZ5A 1TGTA 1BRBE 3LOXA 3UOPA 3BTTE 3GOVB 1FXYA 5FBIA 1AN1E 2AIQA 3LGIA 1XUGA 4ISHH 1HJ9A 2UUYA 1O31A 2XBXA 1MAXA 2BD2A 2JH6D 1D9IA 4B76A 3BIVH 1DPOA 4KTCA 1O2YA 1ZMJA 1XUFA 2EA3A 3ZZ3A 4CRGA 1CU1A 4X1SU 1TA2A 1AGJA 2A5AA 2GMTB 3PMJA 1P04A 2HPPH 4ZKSU 4JZDH 5A0AE 3Q77A 1ETSH 3MU0A 2R3UA 4DIIH 5EW1H 3PV4A 1KLJH 9LPRA 2ZU4A 3A82A 5DP5A 3FZZA 5EODA 2CV3A 2P93A 2XTTB 3MNCA 1DANH 3HKIB 3MNXA 4QT8C 1V2LT 1OS8A 1SMFE 1PQ8A 1MTNB 3CS7A 1AVXA 3PO1C 2PLXA 5C5OA 1PPZA 1TPAE 1M9UA 1ZTLA 1GCDA 1ACBE 1CA8B 4KGAA 4ABHA 2ZFSA 4D9QA 5T6FA 1O3DA 2LNCA 2ZDNA 3A83A 1MZDA 1GI5A 1MUEB 3I29A 2OINA 4PROA 1D6WA 3B8JA 4UONA 2C8ZB 1P9SA 2RA0A 3M3VA 1QA0A 4OS4A 1ZJKA 4NA9H 2VVUA 3AAVA 4E7RG 3P92A 4WXIA 2A2XH 1V3XA 2XRCA 1DVAH 1QB9A 2WV4A 2PGQB 2BVRH 2IOTA 1ZPBA 2VVVA 2ZTZA 2BLQA 5GIBA 1HAZB 3GCTF 4ZH8A 3K2UA 4A1VA 4U01A 1C4V2 1G3EA 1DS2E 4K3JA 4THNH 1C2JA 1GJ4H 2PV9B 3E8LA 4MNWA 1LKAA 4AG2A 2ZECA 3QLPH 3TNTA 2ZF0H 4X8SH 3ZV8A 1LVBA 1C1OA 3A8CA 1S83A 1BTYA 3RXPA 1T31A 1KXBA 2XBWA 2Z6BD 3PMAB 3AW0A 4CH2B 2AYWA 1T8NA 4D7GA 5ESTE 1WQVH 4DIHH 1FV9A 2W3KA 3GCHC 4NFFA 4UDWH 2NU4E 3UQOA 1GJ7B 1ANEA 5FX5A 3BG4B 2OUAA 1ZR0A 1NPMA 2BZAA 3A7XA 2ZHQH 2ANYA 1AFQB 1G3DA 3RC5A 2PHBA 4O03A 5L6NH 1P57B 1O3AA 2JKHA 1C5RA 1GHZA 2WPMS 1SGCA 2RDLA 4FU9A 1V2OT 2VGCC 5E0JA 1RIWC 4B71A 3O8RA 4KTSA 4FUBA 3ZZDA 1J14A 3UWIA 4E7NA 1QRZA 1KXCA 5EOKA 3K6YA 4YLQH 1PPHE 1HJAC 2D2DA 4CREA 4GLYA 1HAHH 1GI1A 4BANB 4AFZA 1ZPCA 2GDDA 3M5LA 1ELCA 4AB8A 3TGJE 3M7TA 1OP0A 2FPZA 1OOKB 1SHYA 1IHTH 2FX4A 3E90B 4GPGA 4TYDA 5H4IB 1MBMA 1MCTA 4INKA 1NRRH 2OLGA 1XX9A 1GGDB 2HOBA 1JOUB 2H9TH 3DA9B 5A8XA 1GDUA 1YPHE 3IG6B 1P2MA 2ZIQH 4UFFH 3RXAA 1SG8B 1Y3VA 4IN2A 3UQVA 4NSYA 1ETRH 8GCHF 2STAE 3LT3A 3RXDA 2AMQA 2EC9H 1G32B 4VGCB 4ABIA 1YCPK 3PO1B 1QR3E 2XXLA 5GCHG 1YGCH 1C5LH 4IMQA 3BTQE 3UR6A 3GY3A 5FX6A 1K1NA
chains in the Genus database with same CATH superfamily
3A7ZA 3S7KB 1ELDE 3SORA 1GBMA 3SU6A 1HAXB 3MHWU 1FJSA 1TGNA 1BB0B 5JBBS 2QV1A 3VB3A 1GHAF 2BQ7B 3W95A 1C1RA 1QNJA 3O8BA 1BTWA 2P94A 1P2OA 3HGPA 1MH0A 5ETXA 1YBWA 2NU3E 3ZV9A 2R0LA 2JIZD 1ABIH 5AFZH 2PFEA 1UK3A 1LPGB 1YCPH 1TBQH 1SGEE 3P8FA 4DGJA 3SJ9A 1OHHD 3NUMA 2B7DH 5FL7D 1EJAA 1BTXA 3URCA 2LPRA 1GI8B 3ITIA 1FZZA 3U8TH 3GDVA 1KMHB 4HZHA 5JDUB 3SU2A 2A2QH 1V2WT 1ANDA 1EB2A 1Z8GA 2KCPA 3GS9A 1A2CH 2V35A 3F3BA 1JIMA 8ESTE 3TLOA 3K6ZA 4B2BA 2WHXA 2WZQA 1O5CB 3FO8D 4OGXA 2BXTH 1LHGH 2ASUB 2QA9E 3QTOH 4ASHA 1QA7A 2OD3B 2TRMA 3RU4T 1W13U 3BF6H 5FPTA 1OWDA 2UUJB 1GVLA 2C3SA 2TGAA 1O5FH 1VKYA 1L4DA 1TALA 2VJ1A 3P70B 3RXLA 5LPFA 1PPCE 4WH6A 3QDZB 2WUCA 2DE9A 3V3MA 3URDA 1TGSZ 4FETA 2JH0D 1GBIA 1GHBG 3G01A 2BB4A 1C4Y2 3MO3A 1DSUA 1JBUH 3E6PH 3EGKH 3TJOA 3ZZ9A 3ZZCA 1K0HA 1AB9C 1Z6EA 1SFIA 1SGDE 4FUCA 1Q31A 2A4OA 1KXEA 2D26C 2GCHG 3F2FA 4OS5A 2VGCB 3F6UH 3OY6U 3UFAA 5SGAE 1ARCA 1YYY1 4FUGA 2YMSC 1CGHA 1BHXF 1XVOA 3SQHE 4YOGA 4SGBE 4JZIA 5C3NA 1CT4E 5EJZA 1P9UA 3BSQA 3I78A 1AHTH 2P3TB 1O39A 4YO9A 1LKBA 5DN6D 4Y0YE 4RKOB 1ZTKA 4TT3D 2QXHA 3GY2A 1DWCH 2H6MA 4AB9A 5JYIA 2Y5HA 1GL0E 4DVAU 2VIPA 1SL3A 1ZLRA 1OWIA 1A3BH 2W7SA 2VWNA 1NRQH 1YPGH 1PQ5A 1AQ7A 4TWYA 1C2LA 3VB7A 4H42U 2F9UA 2ZHWH 1NU7B 4B74A 2QC2A 4GAWA 2BDAA 5DP6A 2Y5GA 1ZGVA 4DW2U 2AGGX 2XWBI 1FDPA 4CH8B 3KQEA 3MI4A 1C5QA 1EZXC 4B6EA 1GI9B 1S82A 1EOJA 2XBYA 2ZHFH 5EGMA 4MPUA 2QF4A 4FVDA 1ARBA 1IQFA 5HKKD 4CHAC 1W14U 4GUXA 5JBCS 3BIUH 4F48B 1O3FA 3MH6A 3RC4A 1ELVA 3PV5A 1TX6A 1O5AB 1A46H 1OX1A 2AMDA 3W94A 3ZIAD 3KEEA 4ABAA 2ESTE 3MFJA 4X8VH 3HPTB 1MKXK 2ODQA 1K1IA 1O3OA 2CN0H 4HG6A 1O2KA 1ZHMA 2Y6TA 2J4IA 1G30B 1DOJA 5FXLA 4YOJA 2AMPA 4AC9A 3EE0B 4Z1MD 2XWAA 5EQRA 6CHAB 1HYLA 1HRTH 4AN7A 3PRDA 9ESTA 1TBRH 1EPTC 3RXJA 4A92A 1EZUC 1GMDG 4XFQA 3L33A 1JRSA 2YNAA 2ZQ2A 1NU9A 2CHAB 1RXPA 2XBVA 2ZCLP 1UW7A 2ZHEH 1J8AA 5KEDA 1V2PT 1KXFA 2Y80A 1O5BB 3N7OA 3SNDA 1UHBA 3FFGA 1O3PB 1ELTA 2FOFA 3QK1A 1IOEA 1DWDH 4A1TA 1TX8A 3T5FH 3QO6A 1E36B 1OYTH 2PKAB 3Q3YA 1MKXH 4CRBA 3R0FA 2NWNA 5DK1A 1CHOG 4AGJA 1WTGH 3R3GB 1QIXB 1MTUA 2A7JA 3NXPA 5KECA 5GPIB 1TGCA 1D6RA 2Q1JA 3VGCB 1RD3B 2Z9KA 2F91A 1E34B 1V2NT 3T28A 3TK5A 1O2TA 4X6MA 2GCHF 4AZ2B 2ZGHA 1SGFA 2GCTC 3MMGA 2AERH 3A87A 5LGOA 2WSSD 1V2VT 2WPLS 1DSTA 1EP5A 1P0SH 1LO6A 3SZEA 1P05A 1O38A 2F43B 1AKSB 3PWCA 3LC3A 2B0FA 1KXDA 3MH7A 1V2RT 3H09A 2HALA 1AU8A 1D3TB 1LQEA 4NGAH 3RXKA 4ACAA 2YMSB 3BEFB 1KTTB 2VWOA 3ODFA 1NFYA 2ZU2A 1GCTB 4B1TA 3GY4A 4K1EA 3P8NA 2BLWA 1H9IE 4X0WU 1UK4A 3RXHA 1AZZA 1MTNC 1LHFH 1Z8IB 5EQQA 3ZZ7A 4B73A 1AWFH 2FLBH 4OS1A 4WMDA 6GCHG 1Y3XA 1ZHPA 1TNLA 2D8WA 2AGIX 2C8YB 5C20A 3NWUA 1YCPM 2BD8A 3RP2A 3CENA 1K1LA 1W0JD 2G4UA 3RXGA 4I8HA 2Q6FA 3EYDA 1LPZB 3BV9B 5HIZA 1Z7KA 2F3CE 4XBBA 4UFDH 2ANMH 4MNVA 1FMGA 3SU1A 4E06H 3U8OH 1SQAA 1G2LA 4AX9H 3AAUA 2RA3A 5DO4H 2H1UA 2BD3A 1CT2E 1V2ST 4ZKOU 1K1OA 1JIRA 1W0KD 4ZXXH 1FONA 1F5KU 5GNDA 5JPMH 4F4OC 1V2QT 4FU8A 1VCQA 2PTNA 3SU3A 3TK6A 3V0XA 3SUGA 4ISLA 3ZZ8A 3PM3A 1Y8TA 3GDSA 2O8TA 4BAMB 1E1QD 2BD5A 1S85A 3GCTG 1C1UH 1EJMA 4AOQA 1BHXB 1BTHH 2FESH 3SUEA 5IDKA 1P2IA 1ESTA 5CE1A 2L6OA 1GMDF 1KDQB 1W0YH 2VNTA 5F8XA 1CSOE 2A4RA 2SGFE 4OS7A 1HAVA 1MQ5A 1S6FA 1J16A 1PPBH 1V2JT 3EE7A 1NO9H 1YF4A 3OU0A 3A8DA 1ELFA 2VWLA 5T6DA 3MH5A 1NRPH 1LVYA 1MU6B 1NT1A 1PYTD 3M61U 3RXRA 3ZVEA 1GJAB 1RTFB 4U30A 2OC7A 4UE7H 2VB0A 2VINA 3C1KA 2C8XB 3HATH 5HMAA 3RUOA 3HK6B 2VVCA 2PR3A 4IGDA 4NA7A 4U32A 1HDTH 2B5TB 1Y3UA 2Z9GA 3MH4A 4KP0A 1GI0A 2WYGA 3WWFA 1SOZA 1AFQC 1SLWB 2ZTYA 2XC4A 3RXFA 3Q00A 2AGEX 2M2AA 4BNRA 1EX3A 1K1MA 2W26A 3OX7U 4JK6A 5DP7A 4Y8YA 2BDBA 4X8UH 4ZKNU 2Y82A 3MYWA 1TPPA 3A7VA 1PPFE 3EA8A 4WWYA 4Y0ZE 1NFUA 1RTKA 2J92A 1BZXE 3M35A 4Y79A 2ZP0H 4O97A 1DDJA 4F55A 1P2QA 2ZDLA 2D1JA 4DY7B 2GCTB 1TB6H 1DICA 3NZIA 1Z6JH 3VB5A 1H8IH 3OAAD 3OTPA 2ZCHP 3BTME 2GZ9A 2HNTF 3GY8A 4CRDA 3RXBA 1LHDH 4WY3A 2PP6A 3KN2A 1DUEA 2V3OH 3M37A 1HCGA 1GGDC 2XYAA 5LH8A 2J97A 4JMYA 3AASA 2UWOA 1MBQA 1O3BA 2AHME 1BQYA 2Q6DA 4YXWD 3M7UA 4D9RA 1THPB 3N7DA 3SN8A 7ESTE 2BX3A 1NFXA 1AUTC 2H5DA 1PPEE 2EQNA 6GCHF 1GG6B 4IN1A 1O5DH 1A61H 1V2MT 4VGCC 1C2IA 4ZROA 3B23B 3F2HA 1A0LA 1P2NA 1YPMH 8GCHG 3BTFE 4UFEH 2H9EH 2KZ4A 1PQAA 2OC1A 1T4UH 2SNWA 1OWKA 2WV9A 2HNTE 3A8BA 5EG4A 1GHXH 3FN8A 1L2EA 1XUHA 2F9OA 3UOUA 4TY7A 1XKBC 3P8OA 3LH3A 3IWMA 5E0GA 5FBEA 3E0NB 2B9LA 2OP9A 2ZNKH 4NZLA 1AI8H 2P8OB 4NIWA 2C4FH 1DLEA 1RGQA 2CK3D 2R9PA 3AVZA 3F0PA 1TX7A 4I31A 1W12U 1CQQA 4Q7ZA 4WVPE 1GHAG 2I6SA 1LHEH 1XXDA 2B8OH 4ZUHA 2C8WB 1SI5H 1ZJDA 5A8ZA 3LC5A 4D8NA 4IS5A 4U2WA 1NFWA 4CRFA 1GI7B 3HKJB 1L1JA 1AVWA 4BTUB 4JZEH 1Y5BT 3KF2A 4UFGH 3M5MA 4ZKRU 3NKKA 1ZYOA 4ZHAA 1QCPA 1PFXC 1FN8A 1ZMNA 2F9VA 3DT0H 2CMYA 2WPJS 1ANCA 1SQRA 3RXOA 3GYMA 2ZI2H 1RRKA 1T8MA 1WQSA 1P10A 5T6GA 2KAIA 1A5IA 2G4TA 2ZFPH 1SC8U 1LPKB 1SVPA 1HJ8A 5DP3A 1A5GH 3A86A 1GVZA 2FYQA 4GHTA 3SUDA 4AFSA 1TNKA 4XDEA 1HNEE 4AYVB 2GV7A 2M5TA 2XCFA 1B0EA 3PTNA 2G51A 1HV7A 5BRRE 1SB1H 1K2I1 3ZVBA 3M36A 2P95A 3PLPA 1HB0B 4R0IA 2KX4A 3KNXA 1H8HD 2CXVA 2K1QA 1AD8H 3RXSA 2WV5A 1YLNA 2Z94A 2FI5E 1A7SA 4IBLH 2BY6X 4BAHB 1QURH 4HTCH 1B0FA 4ABDA 2BXUH 3RMOH 4LZ1H 4NG9H 2P59A 2HPQH 1VITH 1P11E 3KQBA 2F9PA 1GDQA 5CHBA 2Z3EA 3TGKE 3WWBA 3O8CA 1SQTA 1C5NH 4ISOA 4NIVA 1O37A 3S9CA 5F53A 2J34A 2H2ZA 2BLOA 3ZYDA 4FUFA 1ETTH 3KYFA 5DP9A 2WYJA 3TH4H 1HXEH 4RN6A 3NCLA 3MWIU 5I25A 3TGIE 5T1VA 2P3FH 1KTSB 1BMNH 2A4QA 3RXMA 3TITA 1QB1A 1GBJA 2DUCA 1VZQH 2Q6GA 5HIYA 2SGQE 1CE5A 4Z0KA 5CHAB 3AW1A 2WPKS 3QWCH 5L2ZH 3UPEA 2SGDE 3SV7A 3MOCA 3ATWA 5F6MA 3SBKA 4K8BA 1G3CA 1SSXA 4K5ZA 3MU8A 1TQ7B 3GY6A 3SNEA 2SGEE 1QQUA 1G36A 4I8GA 4BTIB 2R2WU 4HGCA 1EKBB 2GT7A 5DKMA 2R3YA 2J5UA 4MVNA 3KHVA 3DCLA 4NCYA 5DSFA 1C5TA 1Y3YA 3M7QA 1DFPA 2BM2A 3RU4E 1Z8RA 2BLVA 4X1RU 1V6DA 1WAYB 3MO9A 2XC5A 3BTGE 4O3UA 1UVSH 1QJ7B 1L1GA 4YT7H 1BA8B 2FI4E 1P2KA 3LGWA 2ZFFH 4BXWA 6CHAC 1O3CA 1QB6A 2BZ6H 3F9FA 3OTJE 3P8GA 5HGGA 4DCDA 1XMNB 1D3PB 1TONA 2RG3A 2OK5A 4H6TA 2QY0B 1ZTJA 4ISNA 4Y7BA 2CHAC 3TJVA 1D4PB 1TFXA 3SQEE 4TWWA 1UVPA 3UREA 5LPEA 3A81A 1IQGA 4OS6A 2ZZUH 1FLEE 2A32A 3K9XB 4XBCA 1EATA 2QGRA 1C9TA 2UUKB 1LTOA 1TMBH 5FCRA 4M9FA 3RXTA 2BHGA 1F0RA 3HGNA 1Z1JA 3RXCA 2ZU3A 3SJKA 2GX4A 1FQ3A 1H1BA 4O3TA 3H7TA 1SGNE 2FOBA 7KMEH 4RT1A 1P2JA 1S81A 1C1QA 2KM0A 3GISB 4YESB 5F8TA 4JZ1A 2UUFB 3VGCC 1MKWK 1E37B 1O2UA 2BY7X 3PWBA 4Q7XA 3F1SB 1EJNA 1EXFA 1HFDA 1A3EH 1EOLA 1P01A 2IPHA 2BOHB 4K2YA 1QL9A 1RS0A 1C5YB 4GSOA 5A2MH 1AIXH 4FOUC 3ZVDA 3TJNA 1ZRBA 2BDHA 4A1XA 1DWBH 1TQ0B 5EXMA 1LCYA 1P8VC 1RTLA 2KFWA 2PKSC 3ZVGA 1GCTC 4B2AA 5K7RA 5FAHA 2FZZA 1W7XH 1O32A 2V3MA 1OWJA 1GVKB 2XC0A 1YPKH 2ZWLH 3SV2H 1H8DH 2ZFTA 1BDAA 2P16A 2IJOB 5E2OA 1HAIH 5C1YA 1MKWH 1HUTH 3ZZ6A 5HXFA 3U1JB 2JH5D 3DD2H 4CR9A 1TMUH 2OTVA 1UVUH 1NBME 5AFYH 4FXGH 4JYTA 1Y5AT 3D62A 2K0QA 1PYTC 4NZQA 1K1JA 1N1LA 3T26A 2QXIA 2VH0A 2O8UA 4X6NA 2V6NA 1EASA 3KQCA 2ZCKP 1AY6H 3M5OA 2ZO3H 1JXPA 3P6ZB 1MQ6A 1IQKA 1GBEA 1O2VA 3RC6A 4ASUD 2GTBA 2W7UA 1F5RA 1C1MA 1DY9A 1GI2A 3FZDA 3KCGH 3KIDU 1XXFA 1CO7E 2TGDA 3ATIA 4WXVA 1G37A 1GBDA 1C9PA 2G00A 4B6FA 2ALPA 2FOAA 2O8MA 3RDZA 3RXVA 3MNBA 1DX5M 3P95A 4K8YA 2FEQH 2ZPRA 1CA0B 1ZMLA 2GD4B 4CBNA 1VGCC 2PGBB 1COWD 3I77A 2SGPE 4AGKA 1W2KH 1ZZZA 1TOCB 1D3DB 1U6QA 1QRWA 4MG3A 1Q2WA 1OP8A 5TCAA 4CRCA 4JYUH 4R8TB 2RFKC 1C5ZB 1LDTT 2A7HA 1IQMA 1SGPE 4ABJA 3TH3H 3ZZ4A 1O5GH 4DJZB 5C17A 3Q3XA 2QE7D 4KKDA 1O3HA 3D23A 3MO6A 5HYOA 1D3QB 1O2ZA 1QRXA 2VWMA 4CBOA 2C93B 1J17T 5L30H 4MLFB 1SGRE 2BQWB 1Z8JB 3U8RH 1EZSC 3ESTA 1DM4B 4Q4LA 3KYGA 3F9HA 2G52A 1E35B 1HIAA 2P3UB 4AG1A 1SGYE 2BQ6B 4GCHF 4NIXA 1CGIE 3VPKA 1S0RA 5IK2D 3STJA 1LQDB 2KCOA 4MDSA 1Z1IA 3S9AA 1MTWA 1EAWA 6ESTA 4INLA 3TH2H 3QUMP 3SGAE 5C0UA 4M7GA 4IC6A 2BY5X 3UAIC 2ODPA 1V2UT 1UHBB 4DURA 3P17H 1TA6A 1E0FD 4BOHA 1VCPA 5GDSH 1EUFA 2Y81A 2QIQA 3BTHE 5FHTA 3GICB 4D7FA 1O33A 2JJ1D 3IITA 3SHAH 4AFUA 1JRTA 1DXPA 4FUEA 4Q80A 1GHWH 1NM6A 4ABGA 2LP6A 4FUJA 3TIUA 1GJ6A 1UTOA 3M3TA 1EQ9A 3SO3A 2GP9B 1YY3A 1O34A 1SFQB 2J2UA 4FUIA 3U28C 1C2GA 2PKSB 3SJOA 1NESE 3PROA 5HM9A 1GBCA 2EY4C 2ZKSA 1GG6C 3FP6E 5A0CA 1T4VH 1YC0A 5C0TA 2GKVE 2V3HH 2A5IA 1CVWH 3SGQE 1YP9A 2BY8X 3K65B 1MTVA 4Y8ZA 1EP6A 2Z9JA 4X2VA 3DFLA 4LOYH 5AVDA 1TWXB 1O2HA 2FIRH 2OC0A 2VIOA 3KGPA 1O36A 1TNIA 4AFQA 1O2NA 2BD9A 1AZ8A 1HAYB 2BDGA 1VITF 1BOQA 1GJDB 5I46H 1BRCE 3F68H 1DE7H 1ZHRA 2I6QA 4WMFA 2W6JD 2TIOA 4NSVA 2HLDD 1FUJA 1FPCH 2P8OC 4A7IB 4NA8A 3ZZBA 3VB6A 1KSNA 4DG4A 2J94A 3FOAA 1GMHF 3EA9A 1OWEA 3M5NA 4WMEA 1ZSJA 4SGAE 1TPOA 3PMHB 3RM0H 3GDUA 1EAUA 3PLBA 2ZDAH 1MU8B 1VGCB 1HXFH 1QBVH 3T29A 1A4WH 1O2XA 1TMTH 4X6PA 1YM0A 5JB9S 3OE7D 2BVSH 1B7XB 3RXIA 4Y8XA 3GCOA 2BY9X 1WYKA 3UTUH 4MNYA 1BITA 3LDXH 2THFB 2WPIS 1EAXA 4X1NU 1T8LA 2ZPSA 3JZ1B 1ZOMA 1CGJE 2IN2A 3BN9A 2R0KA 3FKSD 3D49H 3BTDE 2VH6A 2PSXA 1MD7A 2A45B 3V7TA 2YNBA 1ORFA 3RMNH 3TJUA 2BDCA 3RM2H 1EPTA 4MPXA 1O3IA 1O0DH 2YMSD 3CP7A 2CF9H 3GYLB 1OYQA 2ZFQH 1KLIH 2FS8A 1GJ5H 3LJJA 4P00A 1GI4A 5A0BA 3TNSA 1FAKH 1GJBB 3LONA 1P02A 3SU4A 1HGTH 4I86A 1AMHA 1MTSA 1MCVA 4Z6AH 1TNGA 3BTKE 1A0HB 1EB1H 1C5WB 5PTPA 7GCHF 5GWZA 1BJUA 2A5KA 1HAVB 3PTBA 1YLCA 2ZGXH 3BEIB 2KR7A 2ZTXA 1TGBA 1K9OE 1OSSA 2Z9LA 4IC5A 2HGTH 1G2MA 2ILNA 3WW7A 2QF3A 3SJIA 2IPQX 3DSPA 5LPRA 1HAOH 1GBLA 1O2WA 1FIWA 3U1IB 3QTVH 5DGJA 5AHGH 3SJ8A 4X2XA 4DT7B 4ZHLU 2Z3CA 2A4GA 1K22H 1N6YA 1QTFA 1L4ZA 4GHQA 2FTMA 4Y71A 2FOEA 3UNQA 2GJGA 4JYVH 2FODA 1SPJA 1VJAU 1C1SA 4O9VA 5DP4A 1LMWB 4RKJB 1S5SA 1KY9A 1IQNA 2Y7ZA 3Q3KA 1MABB 2FOMB 3PLKA 2PUQH 5L2YH 2FX6A 1C2FA 3A80A 2FOCA 1ELBA 1TRYA 3V13A 1AWHB 5EIYA 1XUIA 1CBWC 1ZSLA 2FOHA 1O35A 1TOMH 1HLTH 1BTPA 1FX0B 1KLTA 3DSGA 3H5CB 1C1NA 1IAUA 5CHAC 2TPIZ 3MU1A 3RXQA 1YLDA 1F2SE 3LJOA 5JB8S 1SLUB 4I8KA 1FIZA 2ZGJA 1C1VH 2R2MB 3OYPA 1SOTA 1H9LB 3SI3H 2BMGB 3MU4A 1QY6A 3EAJA 2J98A 1ABJH 1GHVH 1SHHB 2WPHS 3T2NA 3E16B 1UCYE 4AORA 3KQDA 1WUNH 1JMOH 4MNXA 1O3LA 2PUXB 2OQ5A 2ZHDA 1Y5UT 1F7ZA 1G3BA 1P3EA 1OPHB 1DITH 1DT2A 1HBTH 2FS9A 3MQKC 4LK4A 4FVBA 2FLRH 4Y6DA 3BG8A 3PRBA 2ZG0H 4LXBH 1N8OC 3FP7E 4OGYA 1UTKA 1GMCF 1C1WH 1YPEH 5E2PA 2HNTC 1GBFA 4XSKU 1EAIA 1RJXB 4WJG2 3A7YA 1SKYE 3E1XB 4MPVA 2AH4X 1Y59T 4Q2KA 5BPEA 1GL1A 5A09A 2PW8H 3S69A 4H4FA 5FPSA 4X2YA 1SGFG 1AFEH 1O2RA 1QHRB 1C1PA 1FAXA 1QJ1B 2ALVA 1TAWA 2AEIH 2CF8H 2LELA 4I8LA 5DG6A 2BD4A 2NU1E 3T25A 3SOSA 3NRLA 1NRSH 2FOGA 2F9NA 2ZPQA 2AS9A 3FP8E 3VEQB 1GBKA 1NROH 1GPZA 2W5EA 2EI6A 4XBDA 5A8YA 3A84A 4RSPA 5FCKA 5F03A 1WDIA 1INCA 1F5LA 2J95A 1B5GH 1MMJN 4NIYA 1DY8A 2YOLA 3ELAH 5C5NA 1SLXB 1O2PA 1BMMH 2JETB 4JK5A 1E1RD 3ZZAA 2KAIB 3QGJA 3F9GA 4MTBA 3F9EA 5CDFE 3JZ2B 3ATMA 3CS0A 1IQHA 1O2MA 1AUJA 2G5VA 3GY7A 1XUKA 1PPGE 3A7WA 4CR5A 1BTZA 1YPJH 1QFKH 1WBGB 3STIA 4GVUA 5EXNA 4I32A 3RXEA 3T62A 4K1SA 1YPLH 4KTUA 4FUHA 2OXSA 1GI6A 3WY8A 2ODYB 4CRAA 1EZQA 4MQAA 5TJXA 3E3TA 1P3CA 2F83A 2QF0A 1NC6A 5C94A 1C5UA 3BTWE 1VJ9U 3SV6A 2XOKD 1DXWA 1BBRE 2O9QA 4WH8A 1CBWB 4Y7AA 1XVMA 2ZDKA 4Q7YA 2FDAA 2FYRA 1YKTA 2BDIA 3SNCA 1ZPZA 2OBOA 4K60A 5IYTA 1A5HA 1ELEE 5B6OA 1TE0A 3EQ0H 3A8AA 5EU8A 1P09A 3MTYA 1QL8A 4YTAA 8LPRA 1GI3A 1S6HA 1O2JA 3U69H 1KIGH 3O8DA 4X6OA 2BYAX 2CGAA 3LGYA 1C5SA 4ZXYH 1QZ8A 5B6LA 1A0JA 2O8WA 4ZAEA 4OS2A 1BTUA 1BUIA 1P03A 1YPHC 2PTCE 2ZGBH 2BOKA 1UK2A 1V2TT 1CHGA 2A1DB 2SNVA 3QZQA 1TRNA 1CA0C 1V2KT 1GWAA 3PMBB 1X7AC 2VBCA 1Y3WA 1YWUA 1L0ZA 2NU0E 3KQ5A 2UWPA 1TABE 2GZ7A 2BVXH 1C2EA 3TK9A 1UCYK 1O3JA 1QBOA 1W10U 3OEED 2FXRA 3RXUA 3SNBA 1C5VA 1UTMA 1N6XA 2HRVA 5C1UA 1F0TA 1VR1H 1L1NA 1N8OB 2KCYA 3OY5U 5C67A 1GBBA 1S0QA 2UWLA 3FANA 3ZVFA 4ZHMU 1G9IE 2GDEH 4ABFA 3E91A 2O8LA 3RMMH 4E05H 1OKXA 6LPRA 3C27B 1T7CA 1THSH 1W11U 2G81E 3SU0A 1NRNH 4ABBA 3UUZA 1GDNA 3QZRA 1E38B 1IHSH 1JWTA 3M3SA 3ODDA 3S0NA 5EPYA 2TGPZ 1ZGIA 1UCYH 2RCEA 3GY5A 7LPRA 4FU7A 1GJ8B 4GCHG 4HFPB 1IQEA 3DHKH 1IQLA 3SV9A 4B2CA 1A1RA 1HAGE 2W3IA 1O5EH 3ZVAA 2BTCE 1VCWA 1SQOA 3Q76A 4B75A 1S84A 4IW4E 4K69A 2F9BH 1SBWA 1FY8E 1KXAA 1OP2A 3ATKA 3LGUA 4I33A 2GT8A 1GBHA 2QXJA 1IQIA 3SNAA 1O3KA 1SGIB 1XUJA 3SZNA 3OSYA 3TPIZ 2JJ2D 3GCHB 1K28D 4Y10E 3E0PB 2OC8A 2JDID 3RMLH 3EDXB 4X1QU 1F92A 4TPYA 3UIRA 1WV7H 1O2GH 1UTQA 4ZMAH 1PJPA 3GCNA 1UVTH 3LU9B 5GJ4B 2OCVB 1C2HA 4ACBA 1BMAA 1DWEH 1DUAA 3LPRA 1AE8H 5J4SA 1RIWB 3LIWA 2FP7B 3DUXH 3EA7A 3SV8A 3VXEH 1BMLA 2VU8E 3A89A 2V0BA 4AYYB 4Y76A 5HM2A 1HJAB 5C2ZA 5EXLA 1C2MA 4BAKB 1BBRK 1TLDA 3U9AH 3S9BA 2FO9A 2ZEBA 1GBTA 1TPSA 1WCZA 2G55A 2EEKA 2G8TA 5J4QA 1UMAH 2VIDA 2DE8A 2FM2A 3A85A 1FY5A 1O3NA 1P06A 4F49A 3SUFA 1UO6A 2TGTA 1ESBA 1VITG 5ABWA 5GCHF 2ZDVH 1GHYH 3SGBE 8KME2 2NU2E 1C2KA 4YOIA 2BD7A 4NFEA 1AE5A 4JZFH 4XD7D 1GMHG 2J38A 5JBAS 3F0OA 2QN5T 4TY6A 4I7YH 3PYHA 2FI3E 1O3MA 3FAOA 3PV2A 3VFEA 1XKAC 1BBRH 1C4U2 4KELA 1XM1A 1AVGH 1BRAA 3B9FH 1BCUH 5DP8A 4NWKA 2ANKH 2VIQA 2ZU1A 1W8BH 1H4WA 5EPNA 4YLUA 1FY3A 4Q63A 5K0HA 1F0SA 5EJLA 1MAYA 1ZRKA 1SLVB 2QAAA 4INHA 1TNHA 3L6PA 2F4LA 2QXGA 2FTLE 3FVFB 1O2QA 4MPWA 4XOJA 1UTJA 2H9HA 2WINI 1TNJA 2QF5A 2GVFA 1BRUP 1QJ6B 2QYIA 1TYNA 3MNSA 2PWXA 4A6LA 1FN6A 4UEHH 4BXSA 2ZC9H 3BEUA 4NWLA 2A31A 2H5CA 2C90B 3NPSA 1UTLM 3QGNB 1C5PA 3NK8A 2ZFRH 1TRMA 1WTHD 5E8EH 3V12A 1OXGA 5DPAA 2XW9A 1BMFD 3SU5A 2PKAA 7GCHG 1GJCB 2Z3DA 5JBTA 1QL7A 1BIOA 4BAOB 3UB0A 1NY22 1RFNA 1WSSH 1O2IA 3UR9A 5FPYA 1HIAB 3DFJA 2KCAA 4X2WA 1O30A 2HVXA 1MZAA 1BJVA 1Q3XA 2ZDMA 4DOQA 3TVJB 1PQ7A 1W7GH 2GGVB 1FPHH 3A88A 2PSYA 4ISIH 1P12E 1C5MD 1FNIA 1LVOA 3PB1E 4D76A 2ANWA 1GHBF 2ZA5A 3QN7A 3SHCH 1AKSA 1NS3A 2HWLB 5CMXH 1O2LA 2A7CA 1HAPH 2ULLA 2ZGCA 2VIWA 3VXFH 5C1XA 4YT6H 3OFND 1GJ9B 1IQJA 1SGQE 1UJ1A 3RLWH 1AB9B 1W0ZU 1ESAA 4I8JA 4ESTE 2GMTC 3KL6A 1QBNA 5GXPA 2HLCA 1DLKB 2Z9IA 1LVMA 1ELAA 3RU4D 3RLYH 3W1EA 2EI7A 4J1YA 4RT0A 1MD8A 1K1PA 1THRH 3ZVCA 1HPGA 3SW2B 2OBQA 4JCNA 3T27A 4H6SB 2CJIA 2ZU5A 4YZUA 3LKWA 4J2YB 3N7EA 1ID5H 2VIVA 1H9HE 2XCNA 3VB4A 2SFAA 1NTPA 5F8ZA 2BDYA 4HI3A 2J9NA 2WPDD 3BTEE 3SI4H 1ZSKA 2A0QB 4UD9H 3ENSB 1WXRA 1T32A 1UTPA 4A5TS 5AF9H 4WF8A 2BX4A 2GV6A 3UNRA 4IMZA 3U98H 1BT7A 2K8IA 2XNIA 4YM9A 1OWHA 3N99A 1O2SA 3UWJH 1O2OA 2OQUA 1NZQH 2TBSA 3LGTA 4ABEA 1LHCH 1FI8A 1GMCG 2FWWA 1QGFA 4X1PU 5ESBA 1C5OH 2G5NA 1FY1A 4ZCNA 3A7TA 2WUBA 4BAQB 5EQSA 1TIOA 1C5XB 1F0UA 2ZQ1A 1UVOA 4XE4A 1CT0E 1ANBA 3ATLA 1Z71A 2Z7FE 5TCCA 2STBE 1KDQA 3HK3B 4CHAB 1T8OA 4TPIZ 2AIPA 1O3EA 4BTTB 3S7HB 1C2DA 1O3GA 1J15A 5T3HA 3LGVA 2Y5FA 3UY9A 1K21H 5G4BA 1SR5C 2GZ8A 2AFQB 1QQ4A 1WOFA 3H7OA 4X8TH 3TU7H 2FMJA 5DJ7A 3LH1A 1EFRD 3QX5H 1KYNA 2JETC 3MU5A 1C1TA 1ELGA 1J9CH 1FY4A 2SGAA 1TBZH 2EI8A 1EPTB 1SGTA 1W3CA 1GBAA 2Y7XA 4K1TA 4FUDA 1UTNA 4OM9A 5E0HA 1AO5A 1NBMD 1NN6A 3ZYEA 2QCYA 3L3TA 1WU1A 3UNSA 3BG4C 4Y11E 3D65E 1CHOF 5EW2H 4LZ4B 3ZZ5A 1TGTA 1BRBE 3LOXA 3UOPA 3BTTE 3GOVB 1FXYA 5FBIA 1AN1E 2AIQA 3LGIA 1XUGA 4ISHH 3AK5A 3DSOA 1HJ9A 2IJD1 2UUYA 1O31A 2XBXA 1MAXA 2BD2A 2JH6D 1D9IA 4B76A 3BIVH 1DPOA 1E79D 4KTCA 1O2YA 1ZMJA 1XUFA 2EA3A 3ZZ3A 3F2GA 5EJ1A 4CRGA 1CU1A 4X1SU 1TA2A 1AGJA 2A5AA 2HVYB 2GMTB 3PMJA 1P04A 2HPPH 4ZKSU 4JZDH 5A0AE 3Q77A 1ETSH 3MU0A 2R3UA 4DIIH 5EW1H 3PV4A 1KLJH 4TSFD 9LPRA 2ZU4A 3A82A 5DP5A 3FZZA 5EODA 2CV3A 2P93A 3VG8A 2XTTB 3MNCA 1DANH 3HKIB 3MNXA 1S6LA 4QT8C 1V2LT 1OS8A 1SMFE 1PQ8A 1MTNB 3CS7A 1AVXA 4RI0A 3PO1C 2PLXA 3SYJA 5C5OA 1PPZA 1TPAE 4P02A 1M9UA 1ZTLA 1GCDA 1ACBE 1CA8B 4KGAA 4ABHA 2ZFSA 4D9QA 5T6FA 1O3DA 2LNCA 2ZDNA 4XRNA 2J98B 3A83A 1MZDA 1GI5A 1MUEB 2L74A 3I29A 2OINA 4PROA 1D6WA 3B8JA 4UONA 2C8ZB 1P9SA 2RA0A 3M3VA 1QA0A 4OS4A 1ZJKA 4NA9H 2VVUA 3AAVA 4E7RG 3P92A 4WXIA 2A2XH 1V3XA 2XRCA 1DVAH 1QB9A 2WV4A 2PGQB 2BVRH 2IOTA 1ZPBA 2VVVA 2ZTZA 2BLQA 5GIBA 1HAZB 3GCTF 4ZH8A 3K2UA 4A1VA 4U01A 1G3EA 1C4V2 1DS2E 4K3JA 4THNH 1C2JA 1GJ4H 2PV9B 3E8LA 4MNWA 1LKAA 4AG2A 2ZECA 3QLPH 3TNTA 2ZF0H 4X8SH 3ZV8A 1LVBA 1C1OA 3A8CA 1S83A 1BTYA 3RXPA 1T31A 1KXBA 2XBWA 2Z6BD 3PMAB 3AW0A 4CH2B 2AYWA 1T8NA 4D7GA 5ESTE 1WQVH 4DIHH 1FV9A 2W3KA 3GCHC 4NFFA 4UDWH 2NU4E 3UQOA 1GJ7B 1ANEA 2RDEA 5FX5A 3BG4B 2OUAA 1ZR0A 1NPMA 2BZAA 3A7XA 2ZHQH 2ANYA 1AFQB 1G3DA 3RC5A 2PHBA 4O03A 5L6NH 1P57B 1O3AA 2JKHA 1C5RA 1GHZA 2WPMS 1SGCA 2RDLA 4FU9A 1V2OT 2VGCC 2XNDD 1RIWC 5E0JA 4B71A 2V7QD 3O8RA 4KTSA 4FUBA 3ZZDA 1J14A 2W6ID 3UWIA 4E7NA 1QRZA 1H8ED 1KXCA 3K6YA 5EOKA 4YLQH 1PPHE 1HJAC 2D2DA 4CREA 4GLYA 1HAHH 1GI1A 5KGOA 4BANB 4AFZA 1ZPCA 2GDDA 3M5LA 1ELCA 4AB8A 3TGJE 3M7TA 1OP0A 2FPZA 1OOKB 1SHYA 1IHTH 2FX4A 3E90B 4GPGA 4TYDA 5H4IB 1MBMA 1MCTA 4INKA 4DT4A 1NRRH 2OLGA 1XX9A 1GGDB 2HOBA 1JOUB 2H9TH 3DA9B 5A8XA 1GDUA 1YPHE 3IG6B 1P2MA 2ZIQH 4UFFH 3RXAA 1SG8B 1Y3VA 4IN2A 3UQVA 4NSYA 1ETRH 8GCHF 2STAE 3LT3A 3RXDA 2AMQA 2EC9H 1G32B 4VGCB 3CNRA 3OEHD 4ABIA 1YCPK 3PO1B 1QR3E 2XXLA 5GCHG 1YGCH 1C5LH 4IMQA 3BTQE 3UR6A 3GY3A 5FX6A 1K1NA
chains in the Genus database with same CATH topology
3A7ZA 3S7KB 1ELDE 3SORA 1GBMA 3SU6A 1HAXB 3MHWU 1FJSA 1TGNA 1BB0B 5JBBS 2QV1A 3VB3A 1GHAF 2BQ7B 3W95A 1C1RA 1QNJA 3O8BA 1BTWA 2P94A 1P2OA 3HGPA 1MH0A 5ETXA 1YBWA 2NU3E 3ZV9A 2R0LA 1ABIH 5AFZH 2PFEA 1UK3A 1LPGB 1YCPH 1TBQH 1SGEE 3P8FA 4DGJA 3SJ9A 3NUMA 2B7DH 1EJAA 1BTXA 3URCA 2LPRA 1GI8B 3ITIA 1FZZA 3U8TH 3GDVA 4HZHA 5JDUB 3SU2A 2A2QH 1V2WT 1ANDA 1EB2A 1Z8GA 1A2CH 2V35A 1JIMA 8ESTE 3TLOA 3K6ZA 4B2BA 1O5CB 4OGXA 2BXTH 1LHGH 2ASUB 2QA9E 3QTOH 4ASHA 1QA7A 2OD3B 2TRMA 3RU4T 1W13U 3BF6H 5FPTA 1OWDA 2UUJB 1GVLA 2C3SA 2TGAA 1O5FH 1L4DA 1TALA 2VJ1A 3P70B 3RXLA 5LPFA 1PPCE 4WH6A 3QDZB 2WUCA 2DE9A 3V3MA 3URDA 1TGSZ 2JH0D 1GBIA 1GHBG 3G01A 2BB4A 1C4Y2 3MO3A 1DSUA 1JBUH 3E6PH 3EGKH 3TJOA 3ZZ9A 3ZZCA 1AB9C 1Z6EA 1SFIA 1SGDE 4FUCA 1Q31A 2A4OA 1KXEA 2D26C 2GCHG 4OS5A 2VGCB 3F6UH 3OY6U 3UFAA 5SGAE 1ARCA 1YYY1 4FUGA 1CGHA 1BHXF 1XVOA 3SQHE 4YOGA 4SGBE 4JZIA 5C3NA 1CT4E 1P9UA 3BSQA 3I78A 1AHTH 2P3TB 1O39A 4YO9A 1LKBA 4Y0YE 4RKOB 1ZTKA 2QXHA 3GY2A 1DWCH 2H6MA 4AB9A 5JYIA 2Y5HA 1GL0E 4DVAU 2VIPA 1SL3A 1ZLRA 1OWIA 1A3BH 2W7SA 2VWNA 1NRQH 1YPGH 1PQ5A 1AQ7A 4TWYA 1C2LA 3VB7A 4H42U 2F9UA 2ZHWH 1NU7B 4B74A 2QC2A 4GAWA 2BDAA 5DP6A 2Y5GA 1ZGVA 4DW2U 2AGGX 2XWBI 1FDPA 4CH8B 3KQEA 3MI4A 1C5QA 1EZXC 1GI9B 1S82A 1EOJA 2XBYA 2ZHFH 5EGMA 4MPUA 4FVDA 1ARBA 1IQFA 4CHAC 1W14U 4GUXA 5JBCS 3BIUH 1O3FA 3MH6A 3RC4A 1ELVA 1TX6A 1O5AB 1A46H 1OX1A 2AMDA 3W94A 4ABAA 3KEEA 2ESTE 3MFJA 4X8VH 3HPTB 1MKXK 2ODQA 1K1IA 1O3OA 2CN0H 1O2KA 1ZHMA 2Y6TA 2J4IA 1G30B 1DOJA 5FXLA 4YOJA 2AMPA 3EE0B 2XWAA 5EQRA 6CHAB 1HYLA 1HRTH 4AN7A 9ESTA 1TBRH 1EPTC 3RXJA 4A92A 1EZUC 1GMDG 4XFQA 3L33A 1JRSA 2YNAA 2ZQ2A 1NU9A 2CHAB 1RXPA 2XBVA 2ZCLP 2ZHEH 1J8AA 1V2PT 1KXFA 2Y80A 1O5BB 3N7OA 3SNDA 1UHBA 3FFGA 1O3PB 1ELTA 2FOFA 3QK1A 1IOEA 1DWDH 4A1TA 1TX8A 3T5FH 3QO6A 1E36B 1OYTH 2PKAB 3Q3YA 1MKXH 4CRBA 3R0FA 2NWNA 5DK1A 1CHOG 4AGJA 1WTGH 3R3GB 1QIXB 1MTUA 2A7JA 3NXPA 5GPIB 1TGCA 1D6RA 2Q1JA 3VGCB 1RD3B 2Z9KA 2F91A 1E34B 1V2NT 3T28A 3TK5A 1O2TA 4X6MA 2GCHF 4AZ2B 2ZGHA 1SGFA 2GCTC 3MMGA 2AERH 3A87A 5LGOA 1V2VT 2WPLS 1DSTA 1EP5A 1P0SH 1LO6A 1P05A 1O38A 1AKSB 3PWCA 3LC3A 2B0FA 1KXDA 3MH7A 1V2RT 2HALA 1AU8A 1D3TB 1LQEA 4NGAH 3RXKA 3BEFB 1KTTB 2VWOA 3ODFA 1NFYA 2ZU2A 1GCTB 4B1TA 3GY4A 4K1EA 3P8NA 2BLWA 1H9IE 4X0WU 1UK4A 3RXHA 1AZZA 1MTNC 1LHFH 1Z8IB 5EQQA 3ZZ7A 4B73A 1AWFH 2FLBH 4OS1A 4WMDA 6GCHG 1Y3XA 1ZHPA 1TNLA 2D8WA 2AGIX 2C8YB 5C20A 3NWUA 1YCPM 2BD8A 3RP2A 3CENA 1K1LA 2G4UA 3RXGA 4I8HA 2Q6FA 3EYDA 1LPZB 3BV9B 1Z7KA 2F3CE 4XBBA 4UFDH 2ANMH 4MNVA 1FMGA 3SU1A 4E06H 3U8OH 1SQAA 1G2LA 4AX9H 3AAUA 2RA3A 5DO4H 2H1UA 2BD3A 1CT2E 1V2ST 4ZKOU 1K1OA 1JIRA 4ZXXH 1FONA 1F5KU 5JPMH 4F4OC 1V2QT 4FU8A 1VCQA 2PTNA 3SU3A 3TK6A 3V0XA 3SUGA 4ISLA 3ZZ8A 3PM3A 1Y8TA 3GDSA 2O8TA 4BAMB 2BD5A 1S85A 3GCTG 1C1UH 1EJMA 4AOQA 1BHXB 1BTHH 2FESH 3SUEA 5IDKA 1P2IA 1ESTA 5CE1A 1GMDF 1KDQB 1W0YH 2VNTA 5F8XA 1CSOE 2A4RA 2SGFE 4OS7A 1HAVA 1MQ5A 1S6FA 1J16A 1PPBH 1V2JT 1NO9H 1YF4A 3OU0A 3A8DA 1ELFA 2VWLA 5T6DA 3MH5A 1NRPH 1LVYA 1MU6B 1NT1A 1PYTD 3M61U 3RXRA 3ZVEA 1GJAB 1RTFB 4U30A 2OC7A 4UE7H 2VB0A 2VINA 3C1KA 2C8XB 3HATH 5HMAA 3RUOA 3HK6B 2VVCA 2PR3A 4IGDA 4NA7A 4U32A 1HDTH 2B5TB 1Y3UA 2Z9GA 3MH4A 4KP0A 1GI0A 2WYGA 1SOZA 1AFQC 1SLWB 2ZTYA 2XC4A 3RXFA 3Q00A 2AGEX 4BNRA 1EX3A 1K1MA 2W26A 3OX7U 4JK6A 5DP7A 4Y8YA 2BDBA 4X8UH 4ZKNU 2Y82A 3MYWA 1TPPA 3A7VA 1PPFE 3EA8A 4WWYA 4Y0ZE 1NFUA 1RTKA 2J92A 1BZXE 3M35A 4Y79A 2ZP0H 4O97A 1DDJA 1P2QA 2ZDLA 2D1JA 4DY7B 2GCTB 1TB6H 1DICA 3NZIA 1Z6JH 3VB5A 1H8IH 2ZCHP 3BTME 2GZ9A 2HNTF 3GY8A 4CRDA 3RXBA 1LHDH 4WY3A 3KN2A 1DUEA 2V3OH 3M37A 1HCGA 1GGDC 2XYAA 5LH8A 4JMYA 3AASA 2UWOA 1MBQA 1O3BA 1BQYA 2Q6DA 3M7UA 4D9RA 1THPB 3SN8A 7ESTE 2BX3A 1NFXA 1AUTC 2H5DA 1PPEE 6GCHF 1GG6B 4IN1A 1O5DH 1A61H 1V2MT 4VGCC 1C2IA 4ZROA 3B23B 1A0LA 1P2NA 1YPMH 8GCHG 3BTFE 4UFEH 2H9EH 1PQAA 2OC1A 1T4UH 2SNWA 1OWKA 2HNTE 3A8BA 5EG4A 1GHXH 1L2EA 1XUHA 2F9OA 3UOUA 4TY7A 1XKBC 3P8OA 3LH3A 3IWMA 5E0GA 5FBEA 3E0NB 2B9LA 2OP9A 2ZNKH 4NZLA 1AI8H 2P8OB 4NIWA 2C4FH 1DLEA 1RGQA 2R9PA 3AVZA 4I31A 4Q7ZA 1TX7A 4WVPE 1W12U 1CQQA 1GHAG 2I6SA 1LHEH 1XXDA 2B8OH 4ZUHA 2C8WB 1SI5H 1ZJDA 5A8ZA 3LC5A 4D8NA 4IS5A 4U2WA 1NFWA 4CRFA 1GI7B 3HKJB 1L1JA 1AVWA 4BTUB 4JZEH 1Y5BT 3KF2A 4UFGH 3M5MA 4ZKRU 3NKKA 1ZYOA 4ZHAA 1QCPA 1PFXC 1FN8A 1ZMNA 2F9VA 3DT0H 2CMYA 2WPJS 1ANCA 3RXOA 3GYMA 2ZI2H 1RRKA 1T8MA 1WQSA 1P10A 5T6GA 2KAIA 1A5IA 2G4TA 2ZFPH 1SC8U 1LPKB 1SVPA 1HJ8A 5DP3A 1A5GH 3A86A 1GVZA 2FYQA 4GHTA 3SUDA 4AFSA 1TNKA 4XDEA 1HNEE 4AYVB 2GV7A 2M5TA 2XCFA 1B0EA 3PTNA 2G51A 1HV7A 5BRRE 1SB1H 1K2I1 3ZVBA 3M36A 2P95A 3PLPA 1HB0B 4R0IA 3KNXA 2K1QA 2CXVA 1AD8H 3RXSA 2WV5A 2Z94A 2FI5E 1A7SA 4IBLH 2BY6X 4BAHB 1QURH 4HTCH 1B0FA 4ABDA 2BXUH 3RMOH 4LZ1H 4NG9H 2P59A 2HPQH 1VITH 1P11E 3KQBA 2F9PA 1GDQA 2Z3EA 3TGKE 3O8CA 1SQTA 1C5NH 4ISOA 4NIVA 1O37A 3S9CA 2J34A 2H2ZA 2BLOA 3ZYDA 4FUFA 1ETTH 5DP9A 2WYJA 3TH4H 1HXEH 4RN6A 3NCLA 3MWIU 5I25A 3TGIE 2P3FH 1KTSB 1BMNH 2A4QA 3RXMA 3TITA 1QB1A 1GBJA 2DUCA 1VZQH 2Q6GA 2SGQE 1CE5A 4Z0KA 5CHAB 3AW1A 2WPKS 3QWCH 5L2ZH 3UPEA 2SGDE 3SV7A 3MOCA 3ATWA 5F6MA 3SBKA 4K8BA 1G3CA 1SSXA 4K5ZA 3MU8A 1TQ7B 3GY6A 3SNEA 2SGEE 1QQUA 1G36A 4I8GA 4BTIB 2R2WU 4HGCA 1EKBB 2GT7A 5DKMA 2R3YA 4MVNA 3KHVA 4NCYA 1C5TA 1Y3YA 3M7QA 1DFPA 2BM2A 3RU4E 1Z8RA 2BLVA 4X1RU 1V6DA 1WAYB 3MO9A 2XC5A 3BTGE 4O3UA 1UVSH 1QJ7B 1L1GA 4YT7H 1BA8B 2FI4E 1P2KA 3LGWA 2ZFFH 4BXWA 6CHAC 1O3CA 1QB6A 2BZ6H 3F9FA 3OTJE 3P8GA 5HGGA 4DCDA 1XMNB 1D3PB 1TONA 2RG3A 4H6TA 2QY0B 1ZTJA 4ISNA 4Y7BA 2CHAC 3TJVA 1D4PB 1TFXA 3SQEE 4TWWA 1UVPA 3UREA 5LPEA 3A81A 1IQGA 4OS6A 2ZZUH 1FLEE 2A32A 3K9XB 4XBCA 1EATA 2QGRA 1C9TA 2UUKB 1LTOA 1TMBH 5FCRA 3RXTA 2BHGA 1F0RA 3HGNA 1Z1JA 3RXCA 2ZU3A 3SJKA 2GX4A 1FQ3A 1H1BA 4O3TA 3H7TA 1SGNE 2FOBA 7KMEH 1P2JA 1S81A 1C1QA 3GISB 4YESB 5F8TA 4JZ1A 2UUFB 3VGCC 1MKWK 1E37B 1O2UA 2BY7X 3PWBA 4Q7XA 3F1SB 1EJNA 1EXFA 1HFDA 1A3EH 1EOLA 1P01A 2IPHA 2BOHB 4K2YA 1QL9A 1RS0A 1C5YB 4GSOA 5A2MH 1AIXH 3ZVDA 3TJNA 1ZRBA 2BDHA 4A1XA 1DWBH 1TQ0B 5EXMA 1LCYA 1P8VC 1RTLA 2PKSC 3ZVGA 4B2AA 1GCTC 5K7RA 5FAHA 2FZZA 1W7XH 1O32A 2XC0A 1OWJA 1GVKB 2ZWLH 1YPKH 3SV2H 1H8DH 2ZFTA 1BDAA 2P16A 2IJOB 5E2OA 1HAIH 5C1YA 1MKWH 1HUTH 3ZZ6A 5HXFA 3U1JB 2JH5D 3DD2H 4CR9A 1TMUH 2OTVA 1UVUH 5AFYH 4FXGH 4JYTA 1Y5AT 3D62A 1PYTC 4NZQA 1K1JA 1N1LA 3T26A 2QXIA 2VH0A 2O8UA 4X6NA 2V6NA 1EASA 3KQCA 2ZCKP 1AY6H 3M5OA 2ZO3H 1JXPA 3P6ZB 1MQ6A 1IQKA 1GBEA 1O2VA 3RC6A 2GTBA 2W7UA 1F5RA 1C1MA 1DY9A 1GI2A 3FZDA 3KCGH 3KIDU 1XXFA 1CO7E 2TGDA 3ATIA 4WXVA 1G37A 1GBDA 1C9PA 2G00A 2ALPA 2FOAA 2O8MA 3RDZA 3RXVA 3MNBA 1DX5M 3P95A 4K8YA 2FEQH 2ZPRA 1CA0B 1ZMLA 2GD4B 4CBNA 1VGCC 2PGBB 3I77A 2SGPE 4AGKA 1W2KH 1ZZZA 1TOCB 1D3DB 1U6QA 1QRWA 4MG3A 1Q2WA 1OP8A 5TCAA 4CRCA 4JYUH 4R8TB 1C5ZB 1LDTT 2A7HA 1IQMA 1SGPE 4ABJA 3TH3H 3ZZ4A 1O5GH 4DJZB 3Q3XA 4KKDA 1O3HA 3D23A 3MO6A 5HYOA 1D3QB 1O2ZA 1QRXA 2VWMA 4CBOA 2C93B 1J17T 5L30H 4MLFB 1SGRE 2BQWB 1Z8JB 3U8RH 1EZSC 3ESTA 1DM4B 3F9HA 2G52A 1E35B 1HIAA 2P3UB 4AG1A 1SGYE 2BQ6B 4GCHF 4NIXA 1CGIE 3VPKA 1S0RA 3STJA 1LQDB 4MDSA 1Z1IA 3S9AA 1MTWA 1EAWA 6ESTA 4INLA 3TH2H 3QUMP 3SGAE 4M7GA 4IC6A 2BY5X 2ODPA 1V2UT 1UHBB 4DURA 3P17H 1TA6A 1E0FD 4BOHA 1VCPA 5GDSH 1EUFA 2Y81A 2QIQA 3BTHE 5FHTA 3GICB 4D7FA 1O33A 3IITA 3SHAH 4AFUA 1JRTA 1DXPA 4FUEA 4Q80A 1GHWH 1NM6A 4ABGA 4FUJA 3TIUA 1GJ6A 1UTOA 3M3TA 1EQ9A 3SO3A 2GP9B 1O34A 1SFQB 2J2UA 4FUIA 1C2GA 2PKSB 3SJOA 1NESE 3PROA 5HM9A 1GBCA 2ZKSA 1GG6C 3FP6E 5A0CA 1T4VH 1YC0A 2GKVE 2V3HH 2A5IA 1CVWH 3SGQE 1YP9A 2BY8X 3K65B 1MTVA 4Y8ZA 1EP6A 2Z9JA 4X2VA 3DFLA 4LOYH 5AVDA 1TWXB 1O2HA 2FIRH 2OC0A 2VIOA 3KGPA 1O36A 1TNIA 4AFQA 1O2NA 2BD9A 1AZ8A 1HAYB 2BDGA 1VITF 1BOQA 1GJDB 5I46H 1BRCE 3F68H 1DE7H 1ZHRA 2I6QA 4WMFA 2TIOA 4NSVA 2P8OC 1FUJA 1FPCH 4A7IB 4NA8A 3ZZBA 3VB6A 1KSNA 4DG4A 2J94A 1GMHF 3EA9A 1OWEA 3M5NA 4WMEA 1ZSJA 4SGAE 1TPOA 3PMHB 3RM0H 3GDUA 1EAUA 3PLBA 2ZDAH