1EPTA

Refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
43
structure length
43
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (serine protease)
molecule keywords PORCINE E-TRYPSIN
publication title Refined 1.8 A resolution crystal structure of the porcine epsilon-trypsin.
pubmed doi rcsb
source organism Sus scrofa
total genus 5
structure length 43
sequence length 43
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eptA00
2ANMH 1PJPA 1TQ7B 1MD7A 1C5TA 2C8WB 2LNCA 2QIQA 3UREA 1IQJA 1GHWH 2PTNA 5ESTE 1QBVH 3RM0H 2VIQA 2NU3E 3F9FA 2F9OA 4WXIA 2WV5A 5C1YA 1SMFE 4ABBA 3FANA 4BOHA 3KQBA 3KGPA 1CSOE 4FVDA 4ASHA 3MH5A 4AORA 2GZ7A 1LTOA 4DW2U 3ZZDA 1YPJH 1ZTJA 3OTJE 3I77A 1EP6A 4CH2B 1B0EA 3NCLA 3W94A 1O3GA 2EEKA 3QUMP 4RKOB 4OS5A 5E0HA 1DSTA 4UDWH 2G51A 3QX5H 1K22H 2GT8A 1PPGE 4K3JA 5ETXA 3HPTB 2STAE 2BVXH 3M37A 2GTBA 2WYJA 2GCHG 1O2XA 5C3NA 4FUGA 4X8VH 2BM2A 1AHTH 3RLWH 4JYTA 1NZQH 1C1WH 3RXRA 1W7XH 2WPIS 5F8XA 1O2RA 1K1JA 2XNIA 1MD8A 1AB9B 1FPCH 1GG6B 1SPJA 3ZVEA 3T28A 1ZMNA 1BUIA 1P10A 2WV4A 4Y11E 4JK6A 3MU4A 1CA0B 2QC2A 4INKA 1QB1A 1GDUA 1J17T 1O2WA 4H6SB 3H5CB 1TONA 2F3CE 3MH6A 3PLKA 5F8TA 3RXKA 4ABJA 4HTCH 3MH4A 1BBRK 5HMAA 3OYPA 1WQSA 3TNTA 2J9NA 1NRPH 2HGTH 2SGAA 2CHAC 3RLYH 4U2WA 1G3CA 1ABIH 2HLCA 1IQLA 5AF9H 3IWMA 4FUJA 1TGCA 1OWDA 1MU6B 1NC6A 1GHVH 3RXIA 1OPHB 1NU9A 1OSSA 3UWIA 4ISNA 1O30A 2ZFQH 1OP0A 3QO6A 2ZGCA 1GMHG 1S84A 2FXRA 1P0SH 2A7CA 1GBJA 3A89A 1GJBB 1O35A 3KQDA 1SHYA 2BD3A 2ZTYA 4X2XA 4ZKSU 2HWLB 5J4SA 1MCTA 3SI3H 1TPAE 1V2UT 3RMNH 4Y71A 5T6FA 1ELDE 1RIWB 3LH1A 4INHA 3CS7A 2CN0H 2JETB 1C5OH 1YCPH 1KXFA 2FEQH 2DE9A 2TBSA 1AI8H 1KLJH 1UTMA 2ODQA 1YCPK 3F9EA 4NSYA 1ELBA 3RXAA 1PFXC 1A5HA 2UUKB 2D2DA 4YT6H 1FZZA 1C4V2 2Z6BD 4TPYA 1FIZA 3GYMA 3V13A 3LGYA 2CGAA 3LGTA 4CRAA 1GJ6A 1KY9A 1UK4A 3SUEA 4BTUB 3Q3KA 3ATWA 3UQOA 1H8IH 2WPKS 1H4WA 3VB6A 3AW1A 4Y10E 3MO3A 1BTXA 1HJAB 3SN8A 4DY7B 1GVKB 2UUYA 2GV6A 4JYVH 3QZQA 5FPYA 3OSYA 1SQOA 4MLFB 2W3KA 1TBQH 1VITG 1LKBA 2BHGA 4OS4A 4JZDH 1EXFA 2ZFFH 2BDIA 1QY6A 3BF6H 1GJCB 2ZPSA 3SZNA 1DS2E 3BTKE 2VWLA 1Z8JB 3RXMA 2ZDVH 4Y6DA 2G5NA 3NUMA 1GBIA 1BRBE 3PMJA 4MPVA 4GHTA 2BX4A 4XBDA 3HKIB 1YF4A 2OTVA 3BG4C 4J2YB 3GDSA 3V12A 1NESE 1AUTC 5DGJA 2OC7A 2ZPRA 1C2GA 1ZGIA 1BCUH 3EA7A 2C8ZB 2D26C 1SGFG 2ZNKH 5LGOA 1BDAA 1DDJA 5J4QA 3LC5A 3PMHB 2H2ZA 2W5EA 1LPKB 2OD3B 2ZA5A 1WSSH 4WWYA 3RU4E 2G8TA 5HXFA 1V2PT 2QAAA 1FJSA 1VGCB 5BPEA 4A1TA 2ZFRH 1XUHA 1BRAA 2YNBA 2A4OA 1PQAA 1BIOA 3Q76A 1JRSA 4UD9H 1QRXA 4AYVB 3MFJA 4ABIA 1OOKB 5CMXH 3NWUA 1C1UH 1PPFE 1TA2A 4ZHMU 2RA3A 4A6LA 1P09A 4X0WU 4ISHH 4CHAC 3G01A 5GDSH 3NPSA 1G37A 4I32A 2CMYA 3HK3B 3NKKA 1SLXB 4Y76A 4UFGH 4B2CA 5JB8S 1AE8H 3WY8A 4CBNA 1ETRH 1MAYA 4XDEA 3MNSA 3RC5A 1BTHH 5GPIB 1G2MA 5PTPA 1OWEA 4Y7AA 2VGCB 2ZF0H 1GCDA 4WMEA 4DOQA 4YOJA 1YPHE 2XBXA 1SL3A 6CHAB 2XBVA 1DXWA 2C8XB 1GJ4H 1GMCF 1C4Y2 1C1VH 1HV7A 1VITH 2OBOA 1LVBA 1BJUA 1D4PB 2A2XH 4GPGA 1O3HA 1G3DA 4MPUA 3LH3A 1TX8A 1EB2A 1YKTA 4CREA 1IHTH 2A1DB 4O3UA 3KF2A 1GHYH 2O8LA 2GT7A 2Z9JA 1C1OA 2OC1A 1A2CH 3R3GB 1QJ1B 4JCNA 5GJ4B 2H9TH 3HGNA 3RXBA 1OKXA 3SJ8A 5JBAS 2ZU5A 2V3HH 1JIRA 2PFEA 2JKHA 4YO9A 5EODA 4U32A 2Q6DA 4I33A 5B6OA 4I8LA 5DP4A 1W0YH 1W14U 2IN2A 3F9GA 5HGGA 1IQHA 4FVBA 4ZROA 5EXNA 3RXSA 5DK1A 1P04A 3QDZB 1JMOH 1YLDA 1S0RA 3SHCH 1BQYA 5LPFA 3RXJA 3SQHE 1T8LA 1ZSLA 4Q7YA 2F9BH 1ZLRA 4UEHH 1YC0A 5CHAC 1H9LB 3OY6U 1CBWB 1P12E 4MNWA 2ILNA 2QN5T 3HK6B 4U01A 2PW8H 5L6NH 4B73A 1FY8E 4YZUA 1C2DA 4D7GA 4Y0YE 3ZVFA 2P3UB 3PTBA 1HJ8A 3KN2A 4MVNA 3LU9B 1GHAF 2VNTA 3H7OA 1MQ5A 1MTVA 2PUXB 3KQCA 1DT2A 1DWEH 5DP9A 3UWJH 1QA0A 1TMUH 4AGJA 2PSYA 2BD4A 4RN6A 1FY5A 1P3EA 1KLTA 1O3AA 2NWNA 3LKWA 3SGAE 1OP8A 2V35A 4OS6A 2QXIA 9ESTA 1J14A 2Z9LA 1JIMA 3N7OA 2ZDMA 3A7ZA 3RXQA 3SNDA 3ZV9A 7KMEH 1ZHPA 1ANEA 2AIPA 3I29A 3PROA 4TY6A 3ZZ5A 1C4U2 1QCPA 1EJMA 1MBMA 1N6XA 4DVAU 1TNLA 1O5GH 1CU1A 4YLQH 3C27B 2RA0A 3P6ZB 1GBCA 4JZ1A 3UY9A 1O3JA 1TA6A 1O3PB 2WPLS 2FP7B 3PB1E 3TPIZ 2FOFA 1CGIE 1QL8A 3D65E 2AIQA 1J15A 4TYDA 4UFEH 1SOTA 2BB4A 2OCVB 2ZU3A 1XMNB 4TWYA 1THRH 4LZ1H 1MMJN 1BTPA 2R3YA 3E1XB 1O5BB 3GCTF 1XKBC 1L0ZA 1XXDA 1YPEH 1NRQH 1EAXA 2GX4A 1EAUA 2H9EH 3M5NA 1TNGA 2F9NA 1F92A 1V2MT 1HLTH 1GI8B 4JZEH 1JWTA 1C5WB 3LIWA 4YTAA 1K1PA 2VH0A 3UNSA 4H6TA 2SNVA 4BNRA 3EE0B 4JYUH 5AFYH 2CF8H 2VJ1A 3TJNA 2ZG0H 1PYTD 3V0XA 1FIWA 3DHKH 1O2JA 1OS8A 1LCYA 1QR3E 4B71A 2HOBA 2AGGX 3UQVA 1V2JT 3QTVH 2PR3A 3VEQB 4FU7A 2FLRH 2VWOA 4MTBA 5DP6A 4NZQA 2FTMA 1FV9A 3D49H 3Q77A 1LVYA 3M5MA 3PYHA 3TITA 3LJOA 1QJ6B 1IQGA 2VINA 2W7UA 5DJ7A 1MH0A 5IYTA 1T4UH 1MZDA 1YP9A 3BTME 1CA8B 1KSNA 2ZGHA 3O8DA 2FM2A 5L30H 1BOQA 3A82A 1T32A 2GKVE 4X8TH 1YYY1 2OUAA 1GI2A 1O3EA 4AGKA 5K7RA 2ZEBA 3M36A 1CBWC 1Z1JA 4WF8A 4UE7H 1UVSH 2VWMA 2A2QH 1SGRE 3RXPA 2GGVB 1D3DB 4E05H 1IQKA 1NM6A 1UO6A 1UCYH 2R9PA 1NY22 3A80A 4NSVA 5GWZA 1UVTH 3MH7A 3Q3XA 2B0FA 1SC8U 2IOTA 1UK2A 1QHRB 2H6MA 3ENSB 5F8ZA 3P8FA 1L2EA 3SU4A 5HYOA 3L3TA 4CRDA 2GCHF 1SGQE 2BD9A 1SQAA 1O3NA 1TMTH 4AG1A 5HM9A 2ZHWH 3PLBA 3P8NA 3PWBA 5EPYA 2Y5HA 4Z6AH 1HAPH 3CENA 1S0QA 5E0GA 1FPHH 3SBKA 1O3MA 3DUXH 1KYNA 3EAJA 2A5AA 3RUOA 2FDAA 4BAMB 1B5GH 2CXVA 1XM1A 1ESAA 1EQ9A 2Z9IA 1YPLH 4IC5A 1AGJA 1LHEH 1P05A 2FPZA 4K1TA 1TQ0B 1WCZA 3E90B 4NGAH 1G3EA 2BD2A 3RXVA 3BTDE 1LHFH 3U8RH 2V3OH 4ABAA 3H7TA 2PKAB 1F0UA 2Y5FA 3A8AA 3MO6A 3OU0A 1VR1H 3GYLB 3MYWA 2WUCA 1TWXB 3B23B 2TGPZ 3ZYDA 5F6MA 1G3BA 1SGPE 1FY1A 1O5CB 3T26A 2BZAA 4ISIH 1GMHF 1P2MA 3GCHB 1MTUA 2DE8A 2RDLA 2VVUA 1Y8TA 1A7SA 5A0CA 2A4QA 1BJVA 1QGFA 3DFJA 2OC8A 3BEIB 1FN8A 4WMDA 5AFZH 4BAHB 2ZGBH 4DIIH 1CQQA 1AKSB 4WH8A 1ANDA 1Z1IA 3P17H 3TGJE 4D9RA 1TMBH 2OQ5A 2Z7FE 3S9BA 1Z8RA 1TNJA 4BTTB 2PKSC 3LDXH 1C2IA 1F2SE 1ACBE 2A45B 4WVPE 3S7KB 3TLOA 2SGFE 1NFUA 2F9PA 3MO9A 3GY4A 1P2KA 2ALPA 2A4RA 2FI3E 4NIWA 1C2MA 1TALA 1TX7A 1Z7KA 3NK8A 1DM4B 4XBCA 1O2OA 1GJ5H 2SGQE 5LPRA 2HNTC 1MUEB 1JBUH 2HRVA 3QK1A 4O9VA 4E7NA 1GBLA 3T29A 1AO5A 4KELA 1QJ7B 4X2WA 3V7TA 1GDNA 1TLDA 3BG4B 1K1MA 4OS1A 1TGBA 1QA7A 2P94A 4HZHA 1PQ8A 2WPJS 1J9CH 3V3MA 3BSQA 2QGRA 1VITF 3M5OA 3QLPH 2AGIX 1NROH 1HNEE 2BQ7B 1FXYA 3UIRA 3ZZ6A 3W95A 2FESH 1SGCA 2PKAA 1GHBG 1CO7E 1BBRH 1A5IA 3CP7A 1BITA 4IS5A 3ZZ9A 4B74A 5T6GA 3O8CA 1EJNA 1KTSB 4GUXA 4IN2A 1KXDA 1C2EA 2P3TB 3HATH 1E38B 1JXPA 2ZI2H 2VIVA 2YOLA 1S6HA 4GLYA 1NU7B 2TIOA 3Q3YA 1O3BA 1Q3XA 2W26A 1TNIA 1Y3XA 3AW0A 1SGNE 3TJOA 4CHAB 3SW2B 1GMDG 3F68H 1MTSA 1TYNA 4ZKOU 4B75A 3M5LA 1AKSA 5C20A 4LXBH 2BVSH 4RKJB 1A3BH 1ELAA 3PTNA 2ZPQA 1PPBH 4R8TB 1FQ3A 3U69H 1VJ9U 2JH0D 1MU8B 1WV7H 1XUJA 1C9PA 2C8YB 1FNIA 1BTZA 2A4GA 4NWKA 1EUFA 3RXDA 3PV4A 1W2KH 1GVLA 4WY3A 4DCDA 1RJXB 3BV9B 3SUDA 1O5DH 3ZZ8A 2P93A 2OXSA 3GISB 1Y3VA 2H5CA 1UTNA 1TGSZ 2UUJB 1UTOA 1HXFH 2BY8X 2HVXA 3SU3A 4VGCB 1QRZA 2OP9A 4BAKB 4ISOA 1DITH 1GBDA 1RTFB 3GCHC 4AB9A 1BMNH 5K0HA 1C1MA 1FAXA 1P02A 2WUBA 1OWIA 2RCEA 5DG6A 2XRCA 1IQNA 1DX5M 1K1NA 1QB9A 2VWNA 1C5UA 4Y8ZA 3GICB 1EJAA 1D9IA 1H1BA 1V2RT 1YGCH 2QCYA 2Z3CA 3KCGH 3UR9A 2O8UA 5ABWA 3BEUA 5F03A 4MQAA 1W3CA 2FOCA 1Y5UT 4IMZA 3QN7A 1KXEA 1EKBB 3ZZ4A 7LPRA 4XSKU 1G2LA 4LZ4B 1KDQB 2QXGA 1FY4A 1SOZA 1K21H 4CRCA 2FODA 2VB0A 1GBEA 2QY0B 1T8NA 2BD8A 5CHAB 8KME2 2NU0E 4FXGH 4UFFH 1LVMA 1WTGH 2VIWA 3ELAH 1G30B 4MPWA 1FLEE 4FUBA 3URCA 3E0PB 1UTJA 1P2IA 3QZRA 4IN1A 3SHAH 1O2PA 4K5ZA 5A8YA 1HJ9A 5HM2A 1FONA 2GV7A 4DGJA 1ZPBA 2O8TA 3A88A 2A32A 1DLKB 1A0LA 2DUCA 5JB9S 2FOEA 1ZOMA 2Y7ZA 2ODYB 4GHQA 1ANBA 3M61U 1TABE 3TGKE 1FI8A 2FYQA 5A8ZA 2BXUH 3O8RA 5A0AE 1EOJA 1RS0A 1P2JA 2OINA 5JDUB 1W7GH 3A8CA 2F9UA 2ZECA 2BZ6H 1HAHH 1V2LT 4CR9A 4TY7A 3ITIA 5EQQA 2PUQH 3KHVA 3PLPA 1PQ5A 1GJAB 1B0FA 1GBHA 6GCHG 1K9OE 3HKJB 5EW2H 1LHGH 2PHBA 1BTYA 4NIYA 2BQ6B 1D6WA 5FPTA 4D8NA 1A3EH 2ZTXA 4ZHLU 4ABDA 3BG8A 2EA3A 4A5TS 1A4WH 2QF3A 1DXPA 1SG8B 1ESTA 3QGNB 1DSUA 1V2NT 5E2OA 1UJ1A 1O2SA 1MZAA 2J95A 1O3FA 4CRBA 3EYDA 1YPHC 1M9UA 4AG2A 1PPCE 4BXSA 3T25A 1E0FD 1NT1A 2FWWA 9LPRA 4X6MA 1GJ9B 1VCPA 2ZO3H 2D8WA 1ELTA 2HNTF 2BMGB 1U6QA 1EPTC 1Y3YA 4U30A 3SGBE 1C1RA 1V2QT 3S0NA 3SNBA 3A86A 3LC3A 8GCHG 2UWOA 4FUEA 1UTPA 1TOCB 3A7TA 2VVCA 1EOLA 4VGCC 3ZYEA 5DP7A 1Y5BT 1IAUA 1AVGH 1WTHD 2WPHS 3M3TA 1SFQB 3U8TH 2AH4X 4X6OA 1JRTA 4I8JA 1S85A 1W10U 2ZCKP 4H42U 2M5TA 3GY7A 4F49A 4A7IB 2TPIZ 5G4BA 1FAKH 2ASUB 3RU4D 2BX3A 1MTWA 2JH6D 3SGQE 3MNCA 1O33A 1NRNH 3RXOA 2Z9KA 4KTUA 3BTWE 3UPEA 1D3TB 5GCHG 2YNAA 4NFEA 3EA9A 2WPMS 2OLGA 1O34A 4YESB 5C67A 2ZQ2A 3C1KA 1LO6A 4KKDA 2GD4B 1UTQA 3D62A 3SJ9A 1IHSH 1DVAH 3UNQA 5DPAA 1LVOA 1QRWA 3KIDU 2V0BA 2FOBA 2BY5X 3M7UA 1RXPA 2EC9H 1P2QA 4GAWA 1QIXB 4NWLA 3DD2H 1V2WT 1GL1A 2BDYA 2ANKH 3M3VA 1O31A 1NRSH 3GY6A 1LKAA 1AY6H 1HAYB 1NPMA 1DWDH 1O3OA 1TX6A 3MNXA 2GP9B 1C2FA 1AWHB 5H4IB 1BMLA 1O2QA 5E0JA 2VIPA 3LOXA 1GBFA 1INCA 1T7CA 4O03A 1BTWA 1PPHE 1C5YB 3SU1A 1UTLM 1CT4E 4NFFA 3K6YA 1HAIH 1P2NA 1XUKA 5GXPA 5FXLA 5LPEA 1KLIH 4X6PA 1C1TA 2XWAA 2ALVA 1SHHB 3TK6A 4Y7BA 4YLUA 1YLCA 1DY9A 2NU2E 4IC6A 1KIGH 1GGDC 3PWCA 1WYKA 1BMAA 2P95A 3MMGA 1F5LA 3NZIA 4O3TA 5TJXA 3ZVCA 2K1QA 1ZPZA 4KTCA 2VVVA 1C1PA 3BTGE 1L1JA 1O2YA 4Q80A 1K2I1 3SU0A 4FU8A 1W12U 1MKWK 1SGFA 3RMLH 3A85A 2A31A 4O97A 1O3IA 3RC4A 5EW1H 1HAVB 1J16A 7ESTE 1GPZA 4X6NA 1AWFH 3MU5A 5DKMA 4B2AA 2V6NA 2Q6FA 3RXTA 1CHOG 1AIXH 1EATA 3E8LA 5DP5A 1BB0B 4B2BA 2Y5GA 3AASA 2FOAA 2EI8A 1H9IE 3M7QA 5FCKA 4K8YA 3UOPA 1AFQC 1BMMH 1V6DA 1O5FH 1F0RA 2BQWB 2EI7A 3FZDA 1LHCH 4MNVA 1MQ6A 1L4ZA 2FYRA 2XC4A 1RRKA 1HRTH 2BVRH 3E16B 4JMYA 1ARBA 7GCHG 1DICA 1L1NA 5A09A 4KGAA 1FUJA 2IPHA 1O39A 3GY8A 5E8EH 4CBOA 1GCTC 4I31A 3ZVAA 4R0IA 4YT7H 3ZV8A 2ANWA 1BRUP 4DT7B 2B8OH 1GL0E 3SV7A 2ANYA 4ABEA 2PKSB 2ULLA 2ZCHP 2PGBB 2F83A 1P2OA 2A7JA 3BTHE 2G00A 5C2ZA 1QBNA 2Q1JA 3T27A 3BTTE 1O2ZA 5AVDA 5T3HA 1YBWA 1UVOA 2Y6TA 1C1SA 2XXLA 4ZH8A 2B5TB 4DG4A 4MNYA 1A46H 1ARCA 1GI3A 3E91A 4KTSA 1OX1A 4A1VA 4ISLA 2XW9A 1E35B 1TFXA 1ZR0A 2J2UA 4AFZA 1F0SA 2ZFTA 2ZZUH 5C5NA 2Y82A 2QV1A 2IJOB 3UOUA 1WBGB 1HAOH 1HFDA 3SORA 1F0TA 1GHXH 2G4TA 3T5FH 1P11E 2P8OC 1IQIA 2BTCE 2XYAA 4AN7A 1A5GH 2HPQH 1O38A 2BDCA 1IQFA 3TH4H 1XVOA 1LPZB 1TRMA 3KL6A 3U9AH 3IG6B 3K2UA 1DE7H 2R3UA 2TGAA 3O8BA 2AMPA 1XUIA 4ZKRU 1P3CA 1ELFA 4DJZB 1SGIB 3ATLA 2BD5A 1FDPA 4WMFA 1DWBH 1THPB 1D3QB 3SI4H 1FMGA 2ESTE 4I8KA 2BLVA 1EZUC 2AFQB 3ZZCA 2ZDKA 2FX6A 1MKXK 1CGJE 1DWCH 4SGBE 1WOFA 1G32B 3D23A 5FPSA 3RXUA 2O9QA 3GDUA 1UVPA 3L33A 3B9FH 3BIVH 1ZRBA 3EA8A 1GHBF 3FZZA 3GY3A 3VGCC 4CH8B 3TGIE 2I6QA 5JBCS 3MU0A 1OYQA 1C5ZB 4D7FA 3A81A 2PV9B 2BOHB 1NRRH 3MWIU 3I78A 4NA9H 1K28D 4ZXYH 1O32A 2GMTC 4MNXA 3LGVA 2BXTH 1TGNA 1O2GH 1HAZB 1N1LA 1PPZA 3FFGA 3GDVA 3LT3A 5FBIA 3MU8A 1GWAA 4FUCA 1C1QA 3U1IB 3GY2A 1GI9B 4K1EA 2W3IA 3TIUA 1GMDF 1GJ8B 1ZMJA 4UFDH 1WQVH 1DY8A 4AB8A 3BTQE 3VB3A 2AS9A 2BLWA 3SO3A 3M7TA 1O2TA 4RSPA 5EXLA 2BLQA 1V2VT 3LGUA 2A5IA 3RXLA 1SI5H 1O3LA 1EZSC 3TK5A 2ZC9H 1O37A 3DA9B 1W13U 5TCCA 4NIXA 4GCHG 3RMOH 2ZU2A 1O5AB 3T62A 3L6PA 4BXWA 2HPPH 2GCTC 1CE5A 2ZFPH 1HBTH 1SR5C 1V2ST 3VB5A 1EP5A 1E34B 2VIDA 3NXPA 3EQ0H 1D3PB 1ZSJA 2ZHQH 4DURA 2EI6A 2G55A 2PTCE 3P8GA 3STJA 1E36B 4MPXA 1GI0A 2C93B 2SNWA 2VU8E 4ZKNU 2ZP0H 4TPIZ 1OWKA 5A8XA 1G9IE 1HGTH 1A1RA 1NFWA 2R2MB 5FX5A 1G36A 3RXHA 8ESTE 2P3FH 3VFEA 3R0FA 1GHZA 1XUFA 2OC0A 2ZIQH 1N8OB 4ZAEA 1AMHA 1ORFA 3T2NA 3S9AA 1O2VA 2GZ9A 1VCWA 4CR5A 1P06A 1F7ZA 3UTUH 3ZZ3A 1AVWA 2HNTE 2GVFA 4ZUHA 1UCYE 3SU2A 2Y80A 2Z94A 1S82A 2QXJA 4X1SU 1ELCA 1ID5H 3GOVB 3GCOA 2NU1E 2NU4E 4JK5A 1ANCA 3ODDA 1F5KU 1KTTB 2HALA 1C5PA 1J8AA 1E37B 1TGTA 4ABHA 4IMQA 1SQTA 3KQEA 3SNEA 1ZTLA 2I6SA 1P8VC 1SVPA 3RMMH 2XC5A 1O2IA 2CJIA 2G81E 3LONA 1A0HB 4ABGA 1EZXC 4AZ2B 5L2ZH 4CRFA 1BHXF 1K1IA 1GBBA 2BDHA 2BOKA 5FCRA 1NFXA 3LGWA 3ODFA 1P03A 3S7HB 2R2WU 5FHTA 4DIHH 2AEIH 1QBOA 1AN1E 1XUGA 5IDKA 3TJVA 2XWBI 3ZZBA 4ABFA 3VXEH 1C5VA 1HUTH 2Y7XA 2P16A 2QF0A 1TNKA 2C90B 1MTNC 5LH8A 3ZVBA 6GCHF 2Q6GA 1TBZH 2O8WA 1ZZZA 1EPTB 1BT7A 2XBWA 3E6PH 3RP2A 3A83A 2W7SA 3IITA 6ESTA 2ZHEH 1SGEE 1BTUA 1HXEH 4F4OC 2O8MA 1NS3A 2D1JA 1OWJA 3E0NB 2TGDA 4OS2A 1L4DA 1ZYOA 2XCFA 1SBWA 3F6UH 4WXVA 1P01A 1VCQA 1UK3A 5BRRE 5JYIA 1QL9A 1TRNA 5C1XA 1O2LA 3QTOH 3ZVGA 2ZDNA 2SGPE 1Q31A 4AFSA 4K8BA 3PO1C 4B1TA 2BLOA 1RFNA 1Z8GA 1N6YA 4Q7ZA 4BTIB 1HB0B 4IW4E 1Y3WA 1C2HA 4FUDA 1YPGH 4IGDA 4CRGA 8GCHF 1RTLA 1SLUB 2ZDLA 1ZJKA 1BZXE 4LOYH 2STBE 3JZ2B 1TIOA 2J4IA 3BEFB 1CVWH 4BAOB 2KAIB 1EB1H 2LPRA 2ZCLP 4YOGA 4X8SH 1K1OA 4INLA 2AMDA 1AUJA 1C9TA 1B7XB 1W0ZU 2VIOA 4X1QU 4XBBA 3U8OH 1HIAB 2FTLE 5C5OA 1BA8B 1C5NH 1GI4A 2ZQ1A 4NZLA 1LPGB 1O2MA 1XXFA 3RXFA 3U1JB 4ESTE 4I8HA 1YPMH 5GCHF 4AFUA 2PGQB 1L1GA 1N8OC 3OX7U 2FIRH 1IQEA 1SSXA 4WJG2 1YPKH 2H9HA 2ZKSA 3RM2H 2PSXA 1UTKA 1S81A 3A84A 3MHWU 3TVJB 4AFQA 1O36A 3ZZ7A 5EOKA 2UWPA 1EPTA 1MBQA 1LQDB 2XCNA 1WU1A 1NTPA 1O5EH 1W8BH 2R0KA 1DLEA 3TNSA 2FS9A 1BBRE 1GGDB 5A0BA 1VJAU 1GBAA 4FUIA 3SU6A 2PWXA 3BTFE 1AB9C 1GG6C 1KXAA 1S5SA 1SGTA 2Z3DA 4E06H 3SUGA 1C2LA 2P59A 1ZMLA 4BANB 4OGXA 1OP2A 1H8DH 4XOJA 1CA0C 3TH3H 3P70B 1CT2E 5I46H 2CV3A 5AHGH 3GCNA 4Z0KA 1TNHA 1O2HA 1UMAH 2G4UA 1GI6A 4ZXXH 4Y0ZE 3MTYA 2UWLA 3UNRA 3MU1A 2A5KA 1AFQB 3P95A 1EX3A 1KDQA 2SGDE 3PM3A 2TGTA 2H5DA 2H1UA 1O3KA 1JOUB 1SB1H 3BTEE 4I8GA 3K65B 3A7WA 1GI1A 2KAIA 1DANH 3DFLA 5SGAE 1QQ4A 4HFPB 3SUFA 1CT0E 1MCVA 3AAVA 4QT8C 1ELEE 3F1SB 5EXMA 2FZZA 1HIAA 2QYIA 4KP0A 1GCTB 3MI4A 3FVFB 5JBTA 1TOMH 1IOEA 1PPEE 1T31A 1SGYE 4MDSA 3GY5A 4K2YA 3SV6A 1BHXB 4X1NU 1X7AC 1CHOF 1W11U 3HGPA 2XTTB 3M35A 4YOIA 3VPKA 4X8UH 1GBMA 2ZFSA 2OQUA 1RIWC 1C2JA 1RD3B 4X1PU 5C1UA 2JETC 4H4FA 2B7DH 1C5XB 3A87A 4IBLH 1ZTKA 3P92A 5I25A 4NA7A 1TBRH 1CHGA 1ZRKA 2FS8A 3LPRA 1O0DH 3SV9A 3A7YA 3AVZA 4Y8XA 6LPRA 7GCHF 4YM9A 4D76A 1GDQA 1XX9A 3BN9A 1Y59T 4I7YH 1V3XA 4MG3A 2UUFB 2ZU1A 1ETSH 2ZTZA 1SFIA 4PROA 4D9QA 4SGAE 1DUEA 1Q2WA 1C5LH 2ZWLH 3RC6A 1OWHA 2F91A 1LMWB 5EG4A 1GBKA 1ZGVA 1OXGA 1HPGA 1NFYA 1HCGA 4TWWA 2G5VA 2BDGA 3SJOA 4X1RU 2Y81A 1ZHRA 3PMAB 2BDBA 3QWCH 1HJAC 2C3SA 3S9CA 5CE1A 1LHDH 1GJ7B 2P8OB 3ATKA 4GSOA 1ELGA 1QB6A 2WYGA 1TB6H 3RXEA 3RU4T 1PYTC 1AE5A 3M3SA 1XVMA 4LK4A 2AGEX 2FOMB 2J34A 2J94A 4Q2KA 1QL7A 1SGDE 1MAXA 2RG3A 1WAYB 3SV2H 1VZQH 3ATIA 2B9LA 3F9HA 3ZVDA 4THNH 4XE4A 1AD8H 3TH2H 1TRYA 3B8JA 3SNAA 2XBYA 2C4FH 3K6ZA 2QA9E 1AVXA 3RXGA 2SGEE 5A2MH 4M7GA 4AX9H 1YCPM 1ETTH 1THSH 3VGCB 1TE0A 1MKWH 1XKAC 2AERH 1T8OA 2FOHA 4JZIA 2VH6A 2A0QB 4ZHAA 2GDEH 1CGHA 2BD7A 1DUAA 2GMTB 4OGYA 5GIBA 1VGCC 1D6RA 3LGIA 1FY3A 4E7RG 1YM0A 3BIUH 1GMCG 1UHBB 4JZFH 1FN6A 3UFAA 2THFB 5DP8A 3SJKA 2FLBH 5JBBS 1ABJH 3U98H 3FAOA 3SV8A 5EQSA 3VXFH 4AYYB 1SLVB 3A8BA 1GVZA 1TAWA 4J1YA 5L2YH 1QTFA 1RTKA 3VB7A 3A7VA 5TCAA 4WH6A 1QNJA 4UONA 1KXCA 3SNCA 4BAQB 1GBTA 3SQEE 3FP6E 3SJIA 2FOGA 1DPOA 1HAGE 1C5MD 2VGCC 1ZJDA 1ESBA 1Y5AT 2ODPA 4FU9A 2GDDA 3RDZA 2TRMA 3P8OA 4HGCA 4A92A 2GCTB 6CHAC 4NIVA 3KNXA 1IQMA 2J92A 2CF9H 3UR6A 1OYTH 3MNBA 5E2PA 2ZHFH 3LJJA 3TJUA 1QQUA 1ELVA 3ATMA 2OBQA 1Z71A 4XFQA 1AFEH 1ZSKA 1RGQA 1P9SA 1GI5A 3KEEA 1AQ7A 1O3CA 2AMQA 2FI4E 1P57B 3VB4A 2ZGXH 5DP3A 1T4VH 2ZU4A 5T6DA 3EGKH 1QURH 1GJDB 1EZQA 1EASA 3S69A 1K1LA 2FO9A 1C2KA 2BY6X 1C5RA 2ZHDA 4HI3A 1Z6JH 8LPRA 4GCHF 2BY9X 2PLXA 5FX6A 1GHAG 1T8MA 3FP8E 1TPOA 2QXHA 5EU8A 4K69A 2G52A 1BRCE 4OS7A 3JZ1B 4K60A 2ZDAH 1S6FA 3ESTA 4NA8A 2BDAA 1V2TT 3STIA 4K1SA 1HAVA 3CS0A 1P9UA 1EAIA 5DO4H 1Z6EA 4Y8YA 2FI5E 3QGJA 4FUFA 1Y3UA 3EDXB 1PQ7A 1HDTH 5EGMA 1A0JA 4Y79A 2ZGJA 1LDTT 4B76A 1Z8IB 1UHBA 4AOQA 3PMBB 3E3TA 2R0LA 4FUHA 1V2KT 3FP7E 1MKXH 3URDA 3TK9A 1LQEA 1C1NA 4X2YA 4NG9H 3ZZAA 1UCYK 3MOCA 2AYWA 5JPMH 2XC0A 2Z9GA 2J38A 1SLWB 3A7XA 3OY5U 5EPNA 1TPSA 3UUZA 2CHAB 2WINI 1DFPA 2F9VA 1ZPCA 1F5RA 5EQRA 1TPPA 2JH5D 3A8DA 3AAUA 1S83A 3K9XB 3TU7H 3SOSA 1WUNH 1HAXB 2A7HA 2GZ8A 3DT0H 1AZ8A 1MTNB 2SFAA 3GCTG 2BY7X 1O2NA 1GI7B 1O2UA 1C5SA 2FX4A 3Q00A 1AZZA 1UVUH 3RXCA 1O3DA 1NO9H 1AU8A 1C5QA 4Q7XA 1A61H 2FMJA 1NN6A 1ZHMA 2BYAX 1EAWA 5FBEA 1KXBA 3SU5A 4GVUA 4NCYA 1QFKH 5ESBA 4A1XA 1HYLA 5FAHA 2Z3EA 1O2KA 3PO1B 1H9HE 1V2OT 1DOJA 4X2VA 4ZMAH
chains in the Genus database with same CATH superfamily
2ANMH 1PJPA 1TQ7B 1MD7A 1C5TA 2C8WB 2LNCA 2QIQA 3UREA 1IQJA 1GHWH 2PTNA 5ESTE 1QBVH 3RM0H 2VIQA 2NU3E 3F9FA 2F9OA 4WXIA 2WV5A 5C1YA 1SMFE 4ABBA 1YLNA 3FANA 4BOHA 3KQBA 5CHBA 3KGPA 1CSOE 4FVDA 4ASHA 3MH5A 4AORA 2GZ7A 1LTOA 4DW2U 3ZZDA 1YPJH 1ZTJA 3OTJE 3I77A 1EP6A 3W1EA 4CH2B 1B0EA 3NCLA 3W94A 1O3GA 2EEKA 3QUMP 4RKOB 2AHME 5C0UA 4OS5A 5E0HA 1DSTA 4UDWH 2G51A 3QX5H 1K22H 2GT8A 1PPGE 4K3JA 5ETXA 3HPTB 2STAE 2BVXH 3M37A 2GTBA 5KEDA 2WYJA 2GCHG 1O2XA 5C3NA 4FUGA 4X8VH 2BM2A 1AHTH 3RLWH 4JYTA 1NZQH 2J5UA 1C1WH 3RXRA 1W7XH 2WPIS 5F8XA 1O2RA 1K1JA 5EIYA 2XNIA 3EE7A 1MD8A 1AB9B 1FPCH 1GG6B 1SPJA 3ZVEA 3T28A 1ZMNA 1BUIA 1P10A 2WV4A 4Y11E 4JK6A 3MU4A 1CA0B 2QC2A 4INKA 1QB1A 1GDUA 1J17T 1O2WA 4H6SB 3H5CB 1TONA 2F3CE 3MH6A 3PLKA 5F8TA 3RXKA 4ABJA 4HTCH 3MH4A 1BBRK 5HMAA 3OYPA 1WQSA 3TNTA 2J9NA 1NRPH 2HGTH 2SGAA 2CHAC 3RLYH 4U2WA 1G3CA 1ABIH 2HLCA 1IQLA 5AF9H 3IWMA 4FUJA 1TGCA 1OWDA 1MU6B 1NC6A 1GHVH 5EJZA 3RXIA 1OPHB 1NU9A 1OSSA 3UWIA 4ISNA 3KYFA 1O30A 2ZFQH 1OP0A 3QO6A 2ZGCA 1GMHG 1S84A 2FXRA 1P0SH 2A7CA 1GBJA 3A89A 1GJBB 1O35A 2F4LA 3KQDA 1SHYA 2BD3A 2ZTYA 4X2XA 1SQRA 4ZKSU 2HWLB 5J4SA 1MCTA 3SI3H 1TPAE 1V2UT 3RMNH 4Y71A 5T6FA 2W6ID 1ELDE 1RIWB 3LH1A 4INHA 3CS7A 2CN0H 2JETB 1C5OH 1YCPH 1KXFA 2FEQH 2DE9A 2TBSA 1AI8H 1KLJH 1UTMA 2ODQA 1YCPK 3F9EA 4NSYA 1ELBA 4RT0A 3RXAA 1PFXC 1A5HA 2UUKB 2D2DA 4Q63A 4YT6H 1FZZA 1C4V2 2Z6BD 4TPYA 1FIZA 3GYMA 3V13A 3LGYA 2CGAA 3LGTA 2K0QA 4CRAA 1GJ6A 1KY9A 1UK4A 3SUEA 4BTUB 3Q3KA 3ATWA 3UQOA 1H8IH 2WPKS 3UB0A 1H4WA 3VB6A 3AW1A 4Y10E 3MO3A 1BTXA 1HJAB 3SN8A 4DY7B 1GVKB 2UUYA 2GV6A 4JYVH 3QZQA 5FPYA 3OSYA 1SQOA 4MLFB 2W3KA 1TBQH 1VITG 3N7EA 1LKBA 2BHGA 4OS4A 2YMSC 4JZDH 1EXFA 2ZFFH 2BDIA 1QY6A 3BF6H 1GJCB 2ZPSA 3SZNA 1DS2E 3BTKE 2VWLA 1Z8JB 3RXMA 2ZDVH 4Y6DA 2G5NA 3NUMA 1GBIA 1BRBE 3PMJA 4MPVA 4GHTA 2BX4A 4XBDA 3HKIB 1YF4A 2OTVA 3BG4C 4J2YB 3GDSA 4RI0A 3V12A 1NESE 1AUTC 5DGJA 2OC7A 2ZPRA 1C2GA 1ZGIA 1BCUH 3EA7A 2C8ZB 2D26C 1SGFG 2ZNKH 5LGOA 1BDAA 1DDJA 5J4QA 3LC5A 3PMHB 2H2ZA 2W5EA 1LPKB 2OD3B 2ZA5A 1WSSH 4WWYA 3RU4E 2G8TA 5HXFA 1V2PT 2QAAA 2KZ4A 1FJSA 1VGCB 5BPEA 4A1TA 2ZFRH 1XUHA 1BRAA 2YNBA 2A4OA 1PQAA 1BIOA 3Q76A 1JRSA 4UD9H 1QRXA 4AYVB 3MFJA 4ABIA 1OOKB 5CMXH 3NWUA 1C1UH 1PPFE 1TA2A 4ZHMU 2RA3A 4A6LA 1P09A 4X0WU 4ISHH 4CHAC 3G01A 5GDSH 3NPSA 1G37A 4I32A 2CMYA 3HK3B 3NKKA 1SLXB 4Y76A 4UFGH 4B2CA 5JB8S 1AE8H 3WY8A 4CBNA 1ETRH 1MAYA 4XDEA 3MNSA 3RC5A 1BTHH 2V3MA 5GPIB 1G2MA 5PTPA 1OWEA 4Y7AA 2VGCB 2ZF0H 1GCDA 4WMEA 4DOQA 4YOJA 1YPHE 2XBXA 4FOUC 1SL3A 6CHAB 2XBVA 1DXWA 2C8XB 2XOKD 1GJ4H 1GMCF 1C4Y2 1C1VH 1HV7A 1VITH 2OBOA 1LVBA 1BJUA 1D4PB 2A2XH 4GPGA 1O3HA 1G3DA 4MPUA 3LH3A 1TX8A 1EB2A 1YKTA 4CREA 1IHTH 2A1DB 4O3UA 3KF2A 1GHYH 2O8LA 2GT7A 2Z9JA 1C1OA 2OC1A 1A2CH 3R3GB 1QJ1B 4JCNA 5GJ4B 2H9TH 3HGNA 3RXBA 1OKXA 3SJ8A 5JBAS 2ZU5A 2V3HH 1JIRA 2PFEA 5IK2D 2JKHA 4YO9A 5EODA 4U32A 2Q6DA 4I33A 5B6OA 4I8LA 2KM0A 5DP4A 1W0YH 1W14U 2IN2A 3F9GA 5HGGA 1IQHA 4FVBA 4ZROA 5EXNA 3WWBA 3RXSA 2KFWA 5DK1A 1P04A 3QDZB 1JMOH 1YLDA 1S0RA 3SHCH 1BQYA 5LPFA 3RXJA 3SQHE 1T8LA 1ZSLA 4Q7YA 2F9BH 1ZLRA 3UAIC 4UEHH 1YC0A 5CHAC 1H9LB 3OY6U 1CBWB 1P12E 4MNWA 2ILNA 2QN5T 3HK6B 4U01A 2PW8H 5L6NH 4B73A 1FY8E 4YZUA 1C2DA 4D7GA 4Y0YE 3ZVFA 2P3UB 3PTBA 1HJ8A 3KN2A 4MVNA 3LU9B 1GHAF 2VNTA 3H7OA 2JJ1D 5HKKD 1MQ5A 1MTVA 2PUXB 3KQCA 1DT2A 1DWEH 5DP9A 3UWJH 1QA0A 1TMUH 1COWD 4AGJA 2PSYA 2BD4A 4RN6A 1FY5A 1P3EA 1KLTA 1O3AA 2NWNA 3LKWA 3SGAE 1OP8A 2V35A 4OS6A 2QXIA 3FOAA 9ESTA 1J14A 2Z9LA 1JIMA 3N7OA 2ZDMA 2K8IA 3A7ZA 3RXQA 3SNDA 3ZV9A 7KMEH 1ZHPA 2XNDD 1ANEA 2AIPA 3I29A 3PROA 4TY6A 3ZZ5A 1C4U2 1QCPA 1EJMA 1MBMA 1N6XA 4DVAU 1TNLA 1O5GH 4AC9A 1CU1A 4YLQH 3C27B 2RA0A 3P6ZB 1GBCA 4JZ1A 3UY9A 1O3JA 1TA6A 1O3PB 2WPLS 2FP7B 3DSPA 3PB1E 3TPIZ 2FOFA 1CGIE 1QL8A 3D65E 2AIQA 1J15A 4TYDA 4UFEH 1SOTA 2BB4A 2OCVB 2ZU3A 1XMNB 4TWYA 1THRH 4LZ1H 1MMJN 1BTPA 2R3YA 3E1XB 1O5BB 3GCTF 1XKBC 2PP6A 1L0ZA 1XXDA 1YPEH 1NRQH 1EAXA 2GX4A 1EAUA 2H9EH 3M5NA 1TNGA 2F9NA 1F92A 5HIZA 1V2MT 1HLTH 1GI8B 4JZEH 1JWTA 1C5WB 3LIWA 4YTAA 2GJGA 1K1PA 2VH0A 3UNSA 4H6TA 2SNVA 4BNRA 3EE0B 4JYUH 5AFYH 2CF8H 2VJ1A 3TJNA 2ZG0H 1PYTD 1EFRD 3V0XA 1FIWA 3DHKH 1O2JA 1OS8A 1LCYA 1QR3E 4B71A 2HOBA 2AGGX 3UQVA 1V2JT 2QF4A 3QTVH 2PR3A 3FKSD 3VEQB 4FU7A 2FLRH 2VWOA 4MTBA 5DP6A 4NZQA 2FTMA 1FV9A 3D49H 3Q77A 1LVYA 3M5MA 3PYHA 4F48B 2LP6A 3TITA 3LJOA 1QJ6B 1IQGA 2VINA 2W7UA 5DJ7A 1MH0A 5IYTA 1T4UH 1MZDA 1YP9A 3BTME 1CA8B 1KSNA 2ZGHA 3O8DA 2FM2A 5L30H 1BOQA 3A82A 1T32A 2GKVE 1FX0B 4X8TH 1YYY1 2OUAA 1GI2A 1O3EA 3OE7D 4AGKA 5K7RA 2ZEBA 3M36A 1CBWC 1Z1JA 4WF8A 4UE7H 1UVSH 2VWMA 2A2QH 1SGRE 3RXPA 2GGVB 1D3DB 4E05H 1IQKA 1NM6A 1UO6A 1UCYH 2J97A 2R9PA 1NY22 3A80A 4NSVA 5GWZA 1UVTH 3MH7A 3Q3XA 2B0FA 1SC8U 2IOTA 1UK2A 1QHRB 2H6MA 3ENSB 5F8ZA 3P8FA 1L2EA 3SU4A 5HYOA 3L3TA 4CRDA 2GCHF 3U28C 1SGQE 2BD9A 1SQAA 1O3NA 1TMTH 4AG1A 5HM9A 3PRBA 2ZHWH 1YY3A 3PLBA 5T1VA 3P8NA 3PWBA 5EPYA 2Y5HA 4Z6AH 1HAPH 4ACAA 3CENA 1S0QA 5E0GA 1FPHH 3SBKA 1O3MA 3DUXH 1KYNA 3EAJA 2A5AA 3RUOA 2FDAA 4BAMB 1B5GH 2CXVA 1XM1A 1ESAA 1EQ9A 2Z9IA 1YPLH 4IC5A 1AGJA 1LHEH 1P05A 2FPZA 4K1TA 1TQ0B 1WCZA 3E90B 1YWUA 4NGAH 1G3EA 2BD2A 3RXVA 3BTDE 1LHFH 4OM9A 3U8RH 2V3OH 4ABAA 3H7TA 2PKAB 1F0UA 2Y5FA 3A8AA 3MO6A 3OU0A 1VR1H 3GYLB 3MYWA 2WUCA 1TWXB 3B23B 2TGPZ 3ZYDA 5F6MA 1G3BA 1SGPE 1FY1A 1KMHB 1O5CB 3T26A 2BZAA 4ISIH 1GMHF 1P2MA 3GCHB 1MTUA 2DE8A 2RDLA 2VVUA 1Y8TA 1A7SA 5A0CA 2A4QA 1BJVA 1QGFA 3DFJA 2OC8A 3BEIB 1FN8A 4WMDA 5AFZH 4BAHB 2ZGBH 4DIIH 1CQQA 1AKSB 4WH8A 1ANDA 1Z1IA 3P17H 3TGJE 4D9RA 1TMBH 2OQ5A 2Z7FE 3FO8D 2WZQA 3S9BA 1Z8RA 1TNJA 4BTTB 2PKSC 3LDXH 1C2IA 1H8ED 3NRLA 1F2SE 1ACBE 2A45B 4WVPE 3S7KB 3TLOA 2SGFE 1NFUA 2F9PA 2YMSB 3MO9A 3GY4A 1P2KA 2ALPA 2A4RA 2FI3E 4NIWA 1C2MA 1TALA 1TX7A 1Z7KA 3NK8A 1DM4B 1S6LA 1O2OA 4XBCA 1GJ5H 2SGQE 2WPDD 5LPRA 2WV9A 2HNTC 1MUEB 1JBUH 2HRVA 3QK1A 4O9VA 1NBMD 4E7NA 1GBLA 3T29A 1AO5A 4KELA 1QJ7B 4X2WA 3V7TA 1GDNA 1TLDA 3BG4B 1K1MA 4OS1A 1TGBA 1QA7A 2P94A 4HZHA 1PQ8A 2WPJS 1J9CH 3V3MA 3BSQA 2QGRA 1VITF 3M5OA 3QLPH 4ASUD 2AGIX 1NROH 1HNEE 2BQ7B 1FXYA 3UIRA 3ZZ6A 1OHHD 3W95A 2FESH 1SGCA 2PKAA 1GHBG 1CO7E 1BBRH 1A5IA 3CP7A 1BITA 4IS5A 3ZZ9A 4B74A 5T6GA 1BMFD 3O8CA 1EJNA 1KTSB 4GUXA 4IN2A 1KXDA 1C2EA 2P3TB 3HATH 1E38B 1JXPA 2ZI2H 2VIVA 2YOLA 1S6HA 4GLYA 1NU7B 2TIOA 3Q3YA 1O3BA 2KCPA 1Q3XA 2W26A 1TNIA 1Y3XA 3AW0A 1SGNE 3TJOA 4CHAB 3SW2B 1GMDG 3F68H 1MTSA 1TYNA 4ZKOU 4B75A 3M5LA 1AKSA 5C20A 4LXBH 2BVSH 4RKJB 5KECA 1A3BH 1ELAA 3PTNA 2ZPQA 1PPBH 4R8TB 3DSGA 1FQ3A 5EJLA 3U69H 1VJ9U 2JH0D 1MU8B 1WV7H 1XUJA 1C9PA 2C8YB 1FNIA 1BTZA 2A4GA 4NWKA 1EUFA 3RXDA 2F43B 3PV4A 1W2KH 1GVLA 4WY3A 4DCDA 1RJXB 3BV9B 3SUDA 1O5DH 3ZZ8A 2P93A 2OXSA 3GISB 1Y3VA 2H5CA 1UTNA 2VBCA 1TGSZ 2UUJB 1UTOA 1HXFH 2BY8X 2HVXA 3SU3A 2HVYB 4VGCB 1QRZA 2OP9A 4BAKB 4ISOA 4DT4A 5DSFA 1DITH 1GBDA 1RTFB 3GCHC 4AB9A 1BMNH 5K0HA 1C1MA 1FAXA 1P02A 2WUBA 1OWIA 2RCEA 5DG6A 2XRCA 1IQNA 5F53A 1DX5M 1K1NA 1WXRA 1QB9A 2VWNA 1C5UA 4Y8ZA 3GICB 1EJAA 1D9IA 1H1BA 1V2RT 1YGCH 2QCYA 2Z3CA 3KCGH 3UR9A 2O8UA 5ABWA 3BEUA 5EJ1A 5F03A 4MQAA 1W3CA 2FOCA 1Y5UT 3F0PA 4IMZA 3QN7A 1KXEA 1EKBB 3DSOA 3ZZ4A 7LPRA 4XSKU 1G2LA 4LZ4B 1KDQB 2QXGA 1FY4A 1SOZA 3WW7A 1K21H 4CRCA 2FODA 2VB0A 1GBEA 2QY0B 5B6LA 1T8NA 2BD8A 5CHAB 8KME2 2NU0E 4FXGH 4UFFH 1LVMA 1WTGH 2VIWA 3ELAH 1G30B 4MPWA 1FLEE 4FUBA 3F2FA 1SKYE 3URCA 3E0PB 1UTJA 1P2IA 3QZRA 4IN1A 3SHAH 1O2PA 4K5ZA 5A8YA 1HJ9A 5HM2A 1FONA 2GV7A 2M2AA 4DGJA 1ZPBA 2O8TA 3A88A 2KR7A 4M9FA 2A32A 1DLKB 1A0LA 2DUCA 5JB9S 1E1RD 2FOEA 2WHXA 1ZOMA 2Y7ZA 2ODYB 4GHQA 1ANBA 3M61U 1TABE 3TGKE 1FI8A 2FYQA 5A8ZA 2BXUH 3O8RA 5A0AE 1EOJA 1RS0A 1P2JA 2OINA 5JDUB 1W7GH 3A8CA 2F9UA 2ZECA 2BZ6H 1HAHH 1V2LT 4CR9A 4TY7A 3ITIA 5EQQA 2PUQH 3KHVA 3PLPA 1PQ5A 1GJAB 1B0FA 1GBHA 2WSSD 6GCHG 1K9OE 3HKJB 5EW2H 1LHGH 2PHBA 1BTYA 4NIYA 2BQ6B 1D6WA 5FPTA 4D8NA 1A3EH 5C0TA 2ZTXA 4ZHLU 4ZCNA 4ABDA 3BG8A 2EA3A 4A5TS 1A4WH 2QF3A 1DXPA 1SG8B 1ESTA 3QGNB 1DSUA 1V2NT 5E2OA 1UJ1A 1O2SA 1MZAA 2J95A 1O3FA 4CRBA 3EYDA 1YPHC 1M9UA 4AG2A 1PPCE 4BXSA 3T25A 1E0FD 1NT1A 2FWWA 9LPRA 4X6MA 1GJ9B 1VCPA 5FL7D 2ZO3H 2D8WA 1ELTA 2HNTF 2BMGB 1U6QA 1EPTC 1Y3YA 4U30A 3SGBE 1C1RA 1V2QT 3S0NA 3SNBA 3A86A 3LC3A 8GCHG 2UWOA 4FUEA 1UTPA 1TOCB 3A7TA 2VVCA 1EOLA 4VGCC 3ZYEA 5DP7A 1Y5BT 1IAUA 1AVGH 1WTHD 2WPHS 3M3TA 1SFQB 1W0KD 3U8TH 2AH4X 4X6OA 1JRTA 4I8JA 1S85A 1W10U 2ZCKP 4H42U 2M5TA 3GY7A 4F49A 4A7IB 2TPIZ 5G4BA 1FAKH 2ASUB 3RU4D 2BX3A 2V7QD 4P00A 1MTWA 2JH6D 3SGQE 3MNCA 1O33A 1NRNH 3RXOA 2Z9KA 4KTUA 3BTWE 3UPEA 1D3TB 5GCHG 2EY4C 2YNAA 4NFEA 3EA9A 2WPMS 2OLGA 1O34A 4YESB 5C67A 2ZQ2A 3C1KA 1LO6A 4KKDA 2GD4B 1UTQA 3D62A 3SJ9A 1IHSH 1DVAH 3UNQA 5DPAA 1LVOA 1QRWA 3KIDU 2V0BA 2FOBA 2BY5X 3M7UA 1RXPA 2EC9H 1P2QA 4GAWA 1QIXB 4NWLA 3DD2H 1V2WT 1GL1A 2BDYA 2ANKH 3M3VA 1O31A 1NRSH 3GY6A 1LKAA 1AY6H 1HAYB 1NPMA 1DWDH 1O3OA 1TX6A 3MNXA 2L6OA 2GP9B 1C2FA 1AWHB 5H4IB 1BMLA 1O2QA 5E0JA 2VIPA 3LOXA 3F2GA 1GBFA 1INCA 1T7CA 4O03A 1BTWA 1PPHE 1C5YB 4XD7D 3SU1A 1UTLM 1CT4E 4NFFA 3K6YA 3WWFA 1HAIH 1P2NA 1XUKA 5GXPA 5FXLA 5LPEA 1KLIH 4X6PA 1C1TA 2XWAA 2ALVA 1SHHB 3TK6A 4Y7BA 3N7DA 1YLCA 1DY9A 4YLUA 2NU2E 4IC6A 1KIGH 1GGDC 3PWCA 1WYKA 1BMAA 2P95A 3MMGA 1F5LA 3NZIA 4O3TA 5TJXA 3ZVCA 2K1QA 1ZPZA 4KTCA 2VVVA 1C1PA 3BTGE 1L1JA 1O2YA 4Q80A 1K2I1 3SU0A 4FU8A 1W12U 1MKWK 1SGFA 3RMLH 3A85A 2A31A 4O97A 1O3IA 3RC4A 5EW1H 1HAVB 3SZEA 1J16A 7ESTE 1GPZA 4X6NA 1AWFH 3MU5A 5DKMA 4B2AA 2V6NA 2Q6FA 3RXTA 1CHOG 3F3BA 1AIXH 1EATA 3E8LA 5DP5A 1BB0B 4B2BA 2Y5GA 3AASA 2FOAA 2EI8A 1H9IE 3M7QA 5FCKA 4K8YA 1UW7A 3UOPA 1AFQC 1BMMH 1V6DA 1O5FH 1F0RA 2BQWB 2EI7A 3FZDA 1LHCH 4MNVA 1MQ6A 1L4ZA 2FYRA 5DN6D 2XC4A 1RRKA 1HRTH 2BVRH 3E16B 4JMYA 1ARBA 7GCHG 1DICA 1L1NA 3PV2A 5A09A 3CNRA 4KGAA 1FUJA 2IPHA 1O39A 3GY8A 5E8EH 4CBOA 1GCTC 4I31A 3ZVAA 4R0IA 4YT7H 3ZV8A 2ANWA 1BRUP 5KGOA 3PRDA 2B8OH 4DT7B 1GL0E 3SV7A 2ANYA 4ABEA 2PKSB 2ULLA 2ZCHP 2PGBB 2F83A 1P2OA 2A7JA 3BTHE 2G00A 5C2ZA 1QBNA 2Q1JA 3T27A 3BTTE 1O2ZA 5AVDA 5T3HA 1YBWA 4TSFD 1UVOA 2Y6TA 1C1SA 2XXLA 4ZH8A 2B5TB 4DG4A 4MNYA 1A46H 1ARCA 1GI3A 3E91A 4KTSA 1OX1A 4A1VA 4ISLA 2XW9A 1E35B 1TFXA 1ZR0A 2J2UA 4AFZA 1F0SA 2ZFTA 2ZZUH 5C5NA 2Y82A 2QV1A 2IJOB 4XRNA 3UOUA 1WBGB 1HAOH 1HFDA 3SORA 1F0TA 1GHXH 2G4TA 3T5FH 1P11E 2P8OC 1IQIA 2BTCE 2XYAA 4AN7A 1A5GH 2HPQH 1O38A 2BDCA 1IQFA 3TH4H 1XVOA 1LPZB 1TRMA 3KL6A 3U9AH 3IG6B 3K2UA 1DE7H 2R3UA 2TGAA 3O8BA 2AMPA 1XUIA 4ZKRU 1P3CA 1ELFA 4DJZB 1SGIB 3ATLA 2BD5A 1FDPA 4WMFA 1DWBH 1THPB 1D3QB 3SI4H 1FMGA 2ESTE 4I8KA 2BLVA 1EZUC 2AFQB 3ZZCA 2LELA 2ZDKA 2FX6A 1MKXK 3AK5A 1CGJE 1DWCH 4SGBE 1WOFA 1G32B 3D23A 5FPSA 3RXUA 2O9QA 3H09A 3GDUA 1UVPA 4Q4LA 2L74A 3L33A 3B9FH 3BIVH 1ZRBA 3EA8A 1GHBF 3FZZA 3GY3A 3VGCC 2JDID 4CH8B 3TGIE 2I6QA 5JBCS 3MU0A 1OYQA 1C5ZB 4D7FA 3A81A 2PV9B 2BOHB 1NRRH 3MWIU 3I78A 4NA9H 1K28D 4ZXYH 1O32A 2GMTC 4MNXA 3LGVA 2BXTH 1TGNA 1O2GH 1HAZB 1N1LA 1PPZA 3FFGA 3GDVA 3LT3A 5FBIA 3MU8A 1GWAA 4FUCA 1C1QA 3U1IB 3GY2A 1GI9B 4K1EA 2W3IA 3TIUA 1GMDF 1GJ8B 1ZMJA 2EQNA 4UFDH 1WQVH 1DY8A 4AB8A 3BTQE 3VB3A 2AS9A 2BLWA 3SO3A 3M7TA 1O2TA 4RSPA 5EXLA 2BLQA 1V2VT 2KCAA 3LGUA 2A5IA 3RXLA 1SI5H 1O3LA 1EZSC 3TK5A 2ZC9H 1O37A 3DA9B 1W13U 5TCCA 4NIXA 4GCHG 3RMOH 2ZU2A 3F0OA 1O5AB 5GNDA 3T62A 3L6PA 4BXWA 2HPPH 2GCTC 1CE5A 2ZFPH 1HBTH 1SR5C 2QE7D 1V2ST 3VB5A 3OAAD 1EP5A 1E34B 2VIDA 3NXPA 3EQ0H 1D3PB 1ZSJA 2ZHQH 4DURA 2EI6A 2G55A 2PTCE 3P8GA 3STJA 2RDEA 1E36B 4MPXA 1GI0A 2C93B 2SNWA 2VU8E 4ZKNU 2ZP0H 4TPIZ 1OWKA 5A8XA 1G9IE 1HGTH 1A1RA 1NFWA 2R2MB 1E1QD 1G36A 2CK3D 5FX5A 3RXHA 8ESTE 2P3FH 3VFEA 3R0FA 1GHZA 1XUFA 2OC0A 2ZIQH 1N8OB 4ZAEA 1AMHA 1ORFA 3GS9A 4P02A 3T2NA 3S9AA 1O2VA 2GZ9A 1VCWA 4CR5A 1P06A 1F7ZA 3UTUH 3ZZ3A 1AVWA 2HNTE 2GVFA 4ZUHA 1UCYE 3SU2A 2Y80A 2Z94A 1S82A 2QXJA 4X1SU 1ELCA 1ID5H 3GOVB 3GCOA 2NU1E 2NU4E 4JK5A 1ANCA 3ODDA 1F5KU 1KTTB 2HALA 1C5PA 1J8AA 1E37B 1H8HD 1TGTA 4ABHA 4IMQA 1SQTA 3KQEA 3MQKC 3SNEA 1ZTLA 2I6SA 1P8VC 1SVPA 3RMMH 2XC5A 1O2IA 2CJIA 2G81E 2QF5A 3LONA 1A0HB 4ABGA 1EZXC 4AZ2B 5L2ZH 4CRFA 1BHXF 1K1IA 1GBBA 2BDHA 2BOKA 5FCRA 1NFXA 3LGWA 3ODFA 1P03A 3S7HB 2R2WU 5FHTA 4DIHH 4B6EA 2AEIH 1QBOA 1AN1E 1XUGA 4B6FA 5IDKA 3TJVA 2XWBI 3ZZBA 4ABFA 3VXEH 1C5VA 1HUTH 2Y7XA 2P16A 2QF0A 1TNKA 2C90B 2KCOA 1MTNC 5LH8A 3ZVBA 6GCHF 2Q6GA 1TBZH 4HG6A 2O8WA 1ZZZA 1EPTB 1BT7A 2XBWA 3E6PH 3RP2A 3A83A 2W7SA 3IITA 6ESTA 2ZHEH 1SGEE 1BTUA 1HXEH 4F4OC 2O8MA 1NS3A 2D1JA 1OWJA 3E0NB 2TGDA 4OS2A 1L4DA 1ZYOA 2XCFA 1SBWA 3F6UH 4WXVA 1P01A 1VCQA 1UK3A 5BRRE 5JYIA 1QL9A 1TRNA 5C1XA 2IJD1 1O2LA 3QTOH 3ZVGA 2ZDNA 1VKYA 2SGPE 1Q31A 4AFSA 4K8BA 3PO1C 4B1TA 2BLOA 1RFNA 1Z8GA 1N6YA 4Q7ZA 4BTIB 1HB0B 4IW4E 1Y3WA 1C2HA 4FUDA 1YPGH 4IGDA 4CRGA 8GCHF 1RTLA 1SLUB 2ZDLA 1ZJKA 1BZXE 4LOYH 2STBE 3JZ2B 1TIOA 2J4IA 3BEFB 1CVWH 4BAOB 2KAIB 1EB1H 2LPRA 2ZCLP 4YOGA 4X8SH 2W6JD 1K1OA 4INLA 2AMDA 1AUJA 1C9TA 1B7XB 1W0ZU 2VIOA 4X1QU 4XBBA 3U8OH 1HIAB 2FTLE 5C5OA 1BA8B 1C5NH 1GI4A 2ZQ1A 4NZLA 1LPGB 1O2MA 3FN8A 1XXFA 3RXFA 4F55A 3U1JB 4ESTE 4I8HA 1YPMH 5GCHF 4AFUA 2PGQB 1L1GA 1N8OC 3OX7U 2FIRH 1IQEA 1SSXA 4WJG2 2KCYA 1YPKH 2H9HA 2ZKSA 3RM2H 2PSXA 1UTKA 1S81A 3A84A 3MHWU 3TVJB 4AFQA 1O36A 3ZZ7A 5EOKA 2UWPA 1EPTA 1MBQA 1LQDB 2XCNA 3N99A 1WU1A 1NTPA 1O5EH 1W8BH 2R0KA 1DLEA 3TNSA 2FS9A 1BBRE 1GGDB 5A0BA 1VJAU 1GBAA 4FUIA 3SU6A 2PWXA 3BTFE 1AB9C 1GG6C 1KXAA 1S5SA 1SGTA 2Z3DA 4E06H 3SUGA 1C2LA 2P59A 1ZMLA 4BANB 4OGXA 1OP2A 1H8DH 4XOJA 1CA0C 3TH3H 3P70B 1CT2E 5I46H 2CV3A 5AHGH 3GCNA 4Z0KA 1TNHA 3KYGA 1O2HA 1UMAH 2G4UA 2IPQX 1GI6A 4ZXXH 4Y0ZE 3MTYA 2UWLA 3UNRA 3MU1A 2A5KA 1AFQB 3P95A 1EX3A 1KDQA 2SGDE 3PM3A 2TGTA 2H5DA 2H1UA 1O3KA 1JOUB 1SB1H 2JJ2D 3BTEE 4I8GA 3K65B 3A7WA 1GI1A 2KAIA 1DANH 3DFLA 5SGAE 1QQ4A 4HFPB 3SUFA 1CT0E 1MCVA 2YMSD 3AAVA 1ELEE 4QT8C 3F1SB 5EXMA 2FZZA 1HIAA 2QYIA 4KP0A 1GCTB 3MI4A 3PV5A 3FVFB 5JBTA 1TOMH 1IOEA 1PPEE 1T31A 1SGYE 4MDSA 3GY5A 4K2YA 3SV6A 1BHXB 4X1NU 1X7AC 1CHOF 1W11U 3HGPA 2XTTB 3M35A 4YOIA 3VPKA 4X8UH 1GBMA 2ZFSA 2OQUA 1RIWC 1C2JA 1RD3B 4X1PU 5C1UA 2JETC 4H4FA 2B7DH 1C5XB 3A87A 4IBLH 1ZTKA 3P92A 5I25A 4NA7A 1TBRH 1CHGA 1ZRKA 2FS8A 3LPRA 1O0DH 3SV9A 3A7YA 3AVZA 4Y8XA 6LPRA 7GCHF 4YM9A 4D76A 1GDQA 1XX9A 3BN9A 1Y59T 4I7YH 1V3XA 4MG3A 2UUFB 2ZU1A 1ETSH 2ZTZA 1SFIA 4PROA 4D9QA 4SGAE 1DUEA 1Q2WA 1C5LH 4FETA 2ZWLH 3RC6A 1OWHA 2F91A 1LMWB 5EG4A 1GBKA 1ZGVA 1OXGA 1HPGA 1NFYA 1HCGA 4TWWA 2G5VA 2BDGA 1E79D 3SJOA 4X1RU 2Y81A 1ZHRA 3PMAB 2BDBA 3QWCH 1HJAC 2C3SA 3S9CA 5CE1A 1LHDH 1GJ7B 2P8OB 3ATKA 4GSOA 1ELGA 1QB6A 2WYGA 1TB6H 3RXEA 3RU4T 2HLDD 1PYTC 1AE5A 3M3SA 1XVMA 4LK4A 3OEHD 2AGEX 2FOMB 2J34A 2J94A 4Q2KA 1QL7A 1SGDE 1MAXA 2RG3A 1WAYB 3SV2H 1VZQH 1WDIA 3ATIA 2B9LA 3F9HA 3ZVDA 4THNH 4TT3D 4XE4A 3OTPA 3OEED 1AD8H 3TH2H 1TRYA 1K0HA 3B8JA 3SNAA 3DCLA 2XBYA 2C4FH 3K6ZA 2QA9E 1AVXA 3RXGA 2SGEE 5A2MH 4M7GA 4AX9H 1YCPM 1ETTH 1THSH 3VGCB 5C94A 1TE0A 2J98B 1MKWH 1XKAC 2AERH 1T8OA 2FOHA 4JZIA 2VH6A 2A0QB 4ZHAA 2GDEH 1CGHA 2BD7A 1DUAA 2GMTB 4OGYA 5GIBA 1VGCC 1D6RA 3VG8A 4ACBA 3LGIA 1FY3A 4E7RG 1YM0A 2JIZD 3BIUH 1GMCG 1UHBB 4JZFH 1FN6A 3UFAA 2THFB 5DP8A 3SJKA 2FLBH 5JBBS 1ABJH 3U98H 3FAOA 3SV8A 5EQSA 3VXFH 4AYYB 1SLVB 3A8BA 1GVZA 1TAWA 4J1YA 5L2YH 1QTFA 1RTKA 3VB7A 3A7VA 5TCAA 4WH6A 1QNJA 4UONA 1KXCA 3SNCA 4BAQB 1GBTA 3SQEE 3FP6E 3SJIA 2FOGA 1DPOA 1HAGE 1QZ8A 1C5MD 2VGCC 1ZJDA 1ESBA 1Y5AT 2ODPA 4FU9A 2GDDA 3RDZA 2TRMA 3P8OA 4HGCA 4A92A 2GCTB 6CHAC 4NIVA 3KNXA 1IQMA 2J92A 2CF9H 3UR6A 1OYTH 3MNBA 5E2PA 2ZHFH 3LJJA 3TJUA 1QQUA 1ELVA 3ATMA 2OBQA 1Z71A 4XFQA 1AFEH 1ZSKA 1RGQA 1P9SA 1GI5A 3KEEA 1AQ7A 1O3CA 2AMQA 2FI4E 1P57B 3VB4A 2ZGXH 5DP3A 1T4VH 2ZU4A 5T6DA 4RT1A 3EGKH 1QURH 1GJDB 1EZQA 1EASA 3S69A 1K1LA 2FO9A 5HIYA 1C2KA 2BY6X 1C5RA 2ZHDA 4HI3A 1Z6JH 8LPRA 4GCHF 2BY9X 2PLXA 5FX6A 1GHAG 1T8MA 3FP8E 2J98A 1TPOA 2QXHA 4Z1MD 5EU8A 4K69A 2G52A 1BRCE 4OS7A 3JZ1B 4K60A 2ZDAH 4I86A 1S6FA 3ESTA 4NA8A 2BDAA 1V2TT 3STIA 4K1SA 1HAVA 3OFND 3CS0A 1P9UA 1EAIA 5DO4H 1Z6EA 4Y8YA 2FI5E 3QGJA 4FUFA 1Y3UA 3EDXB 1PQ7A 1HDTH 5EGMA 1A0JA 2KX4A 2ZGJA 4Y79A 1LDTT 4B76A 1Z8IB 2RFKC 1UHBA 4AOQA 3PMBB 3E3TA 5C17A 2R0LA 4FUHA 1V2KT 3FP7E 1MKXH 3URDA 3TK9A 1LQEA 3SYJA 1C1NA 4X2YA 4NG9H 1W0JD 3ZZAA 1UCYK 3MOCA 2AYWA 5JPMH 2XC0A 2Z9GA 3ZIAD 2J38A 1SLWB 3KQ5A 3A7XA 3OY5U 5EPNA 1TPSA 3UUZA 2CHAB 2WINI 1DFPA 2F9VA 5CDFE 1ZPCA 1F5RA 5EQRA 1TPPA 2JH5D 3A8DA 3AAUA 1S83A 3K9XB 3TU7H 3SOSA 1WUNH 1HAXB 2OK5A 2A7HA 2GZ8A 3DT0H 1AZ8A 1MABB 1MTNB 2SFAA 3F2HA 3GCTG 2BY7X 1O2NA 1GI7B 1O2UA 1C5SA 2FX4A 4YXWD 3Q00A 1AZZA 1UVUH 3RXCA 1O3DA 1NO9H 1AU8A 1C5QA 4Q7XA 1NBME 1A61H 2FMJA 1NN6A 1ZHMA 2BYAX 1EAWA 5FBEA 1KXBA 3SU5A 4GVUA 4NCYA 1QFKH 5ESBA 4A1XA 1HYLA 5FAHA 2Z3EA 1O2KA 3PO1B 1H9HE 1V2OT 1DOJA 4X2VA 4ZMAH
chains in the Genus database with same CATH topology
2ANMH 1PJPA 1TQ7B 1MD7A 1C5TA 2C8WB 2LNCA 2QIQA 3UREA 1IQJA 1GHWH 2PTNA 5ESTE 1QBVH 3RM0H 2VIQA 2NU3E 3F9FA 2F9OA 4WXIA 2WV5A 5C1YA 1SMFE 4ABBA 3FANA 4BOHA 3KQBA 3KGPA 1CSOE 4FVDA 4ASHA 3MH5A 4AORA 2GZ7A 1LTOA 4DW2U 3ZZDA 1YPJH 1ZTJA 3OTJE 3I77A 1EP6A 4CH2B 1B0EA 3NCLA 3W94A 1O3GA 2EEKA 3QUMP 4RKOB 4OS5A 5E0HA 1DSTA 4UDWH 2G51A 3QX5H 1K22H 2GT8A 1PPGE 4K3JA 5ETXA 3HPTB 2STAE 2BVXH 3M37A 2GTBA 2WYJA 2GCHG 1O2XA 5C3NA 4FUGA 4X8VH 2BM2A 1AHTH 3RLWH 4JYTA 1NZQH 1C1WH 3RXRA 1W7XH 2WPIS 5F8XA 1O2RA 1K1JA 2XNIA 1MD8A 1AB9B 1FPCH 1GG6B 1SPJA 3ZVEA 3T28A 1ZMNA 1BUIA 1P10A 2WV4A 4Y11E 4JK6A 3MU4A 1CA0B 2QC2A 4INKA 1QB1A 1GDUA 1J17T 1O2WA 4H6SB 3H5CB 1TONA 2F3CE 3MH6A 3PLKA 5F8TA 3RXKA 4ABJA 4HTCH 3MH4A 1BBRK 5HMAA 3OYPA 1WQSA 3TNTA 2J9NA 1NRPH 2HGTH 2SGAA 2CHAC 3RLYH 4U2WA 1G3CA 1ABIH 2HLCA 1IQLA 5AF9H 3IWMA 4FUJA 1TGCA 1OWDA 1MU6B 1NC6A 1GHVH 3RXIA 1OPHB 1NU9A 1OSSA 3UWIA 4ISNA 1O30A 2ZFQH 1OP0A 3QO6A 2ZGCA 1GMHG 1S84A 2FXRA 1P0SH 2A7CA 1GBJA 3A89A 1GJBB 1O35A 3KQDA 1SHYA 2BD3A 2ZTYA 4X2XA 4ZKSU 2HWLB 5J4SA 1MCTA 3SI3H 1TPAE 1V2UT 3RMNH 4Y71A 5T6FA 1ELDE 1RIWB 3LH1A 4INHA 3CS7A 2CN0H 2JETB 1C5OH 1YCPH 1KXFA 2FEQH 2DE9A 2TBSA 1AI8H 1KLJH 1UTMA 2ODQA 1YCPK 3F9EA 4NSYA 1ELBA 3RXAA 1PFXC 1A5HA 2UUKB 2D2DA 4YT6H 1FZZA 1C4V2 2Z6BD 4TPYA 1FIZA 3GYMA 3V13A 3LGYA 2CGAA 3LGTA 4CRAA 1GJ6A 1KY9A 1UK4A 3SUEA 4BTUB 3Q3KA 3ATWA 3UQOA 1H8IH 2WPKS 1H4WA 3VB6A 3AW1A 4Y10E 3MO3A 1BTXA 1HJAB 3SN8A 4DY7B 1GVKB 2UUYA 2GV6A 4JYVH 3QZQA 5FPYA 3OSYA 1SQOA 4MLFB 2W3KA 1TBQH 1VITG 1LKBA 2BHGA 4OS4A 4JZDH 1EXFA 2ZFFH 2BDIA 1QY6A 3BF6H 1GJCB 2ZPSA 3SZNA 1DS2E 3BTKE 2VWLA 1Z8JB 3RXMA 2ZDVH 4Y6DA 2G5NA 3NUMA 1GBIA 1BRBE 3PMJA 4MPVA 4GHTA 2BX4A 4XBDA 3HKIB 1YF4A 2OTVA 3BG4C 4J2YB 3GDSA 3V12A 1NESE 1AUTC 5DGJA 2OC7A 2ZPRA 1C2GA 1ZGIA 1BCUH 3EA7A 2C8ZB 2D26C 1SGFG 2ZNKH 5LGOA 1BDAA 1DDJA 5J4QA 3LC5A 3PMHB 2H2ZA 2W5EA 1LPKB 2OD3B 2ZA5A 1WSSH 4WWYA 3RU4E 2G8TA 5HXFA 1V2PT 2QAAA 1FJSA 1VGCB 5BPEA 4A1TA 2ZFRH 1XUHA 1BRAA 2YNBA 2A4OA 1PQAA 1BIOA 3Q76A 1JRSA 4UD9H 1QRXA 4AYVB 3MFJA 4ABIA 1OOKB 5CMXH 3NWUA 1C1UH 1PPFE 1TA2A 4ZHMU 2RA3A 4A6LA 1P09A 4X0WU 4ISHH 4CHAC 3G01A 5GDSH 3NPSA 1G37A 4I32A 2CMYA 3HK3B 3NKKA 1SLXB 4Y76A 4UFGH 4B2CA 5JB8S 1AE8H 3WY8A 4CBNA 1ETRH 1MAYA 4XDEA 3MNSA 3RC5A 1BTHH 5GPIB 1G2MA 5PTPA 1OWEA 4Y7AA 2VGCB 2ZF0H 1GCDA 4WMEA 4DOQA 4YOJA 1YPHE 2XBXA 1SL3A 6CHAB 2XBVA 1DXWA 2C8XB 1GJ4H 1GMCF 1C4Y2 1C1VH 1HV7A 1VITH 2OBOA 1LVBA 1BJUA 1D4PB 2A2XH 4GPGA 1O3HA 1G3DA 4MPUA 3LH3A 1TX8A 1EB2A 1YKTA 4CREA 1IHTH 2A1DB 4O3UA 3KF2A 1GHYH 2O8LA 2GT7A 2Z9JA 1C1OA 2OC1A 1A2CH 3R3GB 1QJ1B 4JCNA 5GJ4B 2H9TH 3HGNA 3RXBA 1OKXA 3SJ8A 5JBAS 2ZU5A 2V3HH 1JIRA 2PFEA 2JKHA 4YO9A 5EODA 4U32A 2Q6DA 4I33A 5B6OA 4I8LA 5DP4A 1W0YH 1W14U 2IN2A 3F9GA 5HGGA 1IQHA 4FVBA 4ZROA 5EXNA 3RXSA 5DK1A 1P04A 3QDZB 1JMOH 1YLDA 1S0RA 3SHCH 1BQYA 5LPFA 3RXJA 3SQHE 1T8LA 1ZSLA 4Q7YA 2F9BH 1ZLRA 4UEHH 1YC0A 5CHAC 1H9LB 3OY6U 1CBWB 1P12E 4MNWA 2ILNA 2QN5T 3HK6B 4U01A 2PW8H 5L6NH 4B73A 1FY8E 4YZUA 1C2DA 4D7GA 4Y0YE 3ZVFA 2P3UB 3PTBA 1HJ8A 3KN2A 4MVNA 3LU9B 1GHAF 2VNTA 3H7OA 1MQ5A 1MTVA 2PUXB 3KQCA 1DT2A 1DWEH 5DP9A 3UWJH 1QA0A 1TMUH 4AGJA 2PSYA 2BD4A 4RN6A 1FY5A 1P3EA 1KLTA 1O3AA 2NWNA 3LKWA 3SGAE 1OP8A 2V35A 4OS6A 2QXIA 9ESTA 1J14A 2Z9LA 1JIMA 3N7OA 2ZDMA 3A7ZA 3RXQA 3SNDA 3ZV9A 7KMEH 1ZHPA 1ANEA 2AIPA 3I29A 3PROA 4TY6A 3ZZ5A 1C4U2 1QCPA 1EJMA 1MBMA 1N6XA 4DVAU 1TNLA 1O5GH 1CU1A 4YLQH 3C27B 2RA0A 3P6ZB 1GBCA 4JZ1A 3UY9A 1O3JA 1TA6A 1O3PB 2WPLS 2FP7B 3PB1E 3TPIZ 2FOFA 1CGIE 1QL8A 3D65E 2AIQA 1J15A 4TYDA 4UFEH 1SOTA 2BB4A 2OCVB 2ZU3A 1XMNB 4TWYA 1THRH 4LZ1H 1MMJN 1BTPA 2R3YA 3E1XB 1O5BB 3GCTF 1XKBC 1L0ZA 1XXDA 1YPEH 1NRQH 1EAXA 2GX4A 1EAUA 2H9EH 3M5NA 1TNGA 2F9NA 1F92A 1V2MT 1HLTH 1GI8B 4JZEH 1JWTA 1C5WB 3LIWA 4YTAA 1K1PA 2VH0A 3UNSA 4H6TA 2SNVA 4BNRA 3EE0B 4JYUH 5AFYH 2CF8H 2VJ1A 3TJNA 2ZG0H 1PYTD 3V0XA 1FIWA 3DHKH 1O2JA 1OS8A 1LCYA 1QR3E 4B71A 2HOBA 2AGGX 3UQVA 1V2JT 3QTVH 2PR3A 3VEQB 4FU7A 2FLRH 2VWOA 4MTBA 5DP6A 4NZQA 2FTMA 1FV9A 3D49H 3Q77A 1LVYA 3M5MA 3PYHA 3TITA 3LJOA 1QJ6B 1IQGA 2VINA 2W7UA 5DJ7A 1MH0A 5IYTA 1T4UH 1MZDA 1YP9A 3BTME 1CA8B 1KSNA 2ZGHA 3O8DA 2FM2A 5L30H 1BOQA 3A82A 1T32A 2GKVE 4X8TH 1YYY1 2OUAA 1GI2A 1O3EA 4AGKA 5K7RA 2ZEBA 3M36A 1CBWC 1Z1JA 4WF8A 4UE7H 1UVSH 2VWMA 2A2QH 1SGRE 3RXPA 2GGVB 1D3DB 4E05H 1IQKA 1NM6A 1UO6A 1UCYH 2R9PA 1NY22 3A80A 4NSVA 5GWZA 1UVTH 3MH7A 3Q3XA 2B0FA 1SC8U 2IOTA 1UK2A 1QHRB 2H6MA 3ENSB 5F8ZA 3P8FA 1L2EA 3SU4A 5HYOA 3L3TA 4CRDA 2GCHF 1SGQE 2BD9A 1SQAA 1O3NA 1TMTH 4AG1A 5HM9A 2ZHWH 3PLBA 3P8NA 3PWBA 5EPYA 2Y5HA 4Z6AH 1HAPH 3CENA 1S0QA 5E0GA 1FPHH 3SBKA 1O3MA 3DUXH 1KYNA 3EAJA 2A5AA 3RUOA 2FDAA 4BAMB 1B5GH 2CXVA 1XM1A 1ESAA 1EQ9A 2Z9IA 1YPLH 4IC5A 1AGJA 1LHEH 1P05A 2FPZA 4K1TA 1TQ0B 1WCZA 3E90B 4NGAH 1G3EA 2BD2A 3RXVA 3BTDE 1LHFH 3U8RH 2V3OH 4ABAA 3H7TA 2PKAB 1F0UA 2Y5FA 3A8AA 3MO6A 3OU0A 1VR1H 3GYLB 3MYWA 2WUCA 1TWXB 3B23B 2TGPZ 3ZYDA 5F6MA 1G3BA 1SGPE 1FY1A 1O5CB 3T26A 2BZAA 4ISIH 1GMHF 1P2MA 3GCHB 1MTUA 2DE8A 2RDLA 2VVUA 1Y8TA 1A7SA 5A0CA 2A4QA 1BJVA 1QGFA 3DFJA 2OC8A 3BEIB 1FN8A 4WMDA 5AFZH 4BAHB 2ZGBH 4DIIH 1CQQA 1AKSB 4WH8A 1ANDA 1Z1IA 3P17H 3TGJE 4D9RA 1TMBH 2OQ5A 2Z7FE 3S9BA 1Z8RA 1TNJA 4BTTB 2PKSC 3LDXH 1C2IA 1F2SE 1ACBE 2A45B 4WVPE 3S7KB 3TLOA 2SGFE 1NFUA 2F9PA 3MO9A 3GY4A 1P2KA 2ALPA 2A4RA 2FI3E 4NIWA 1C2MA 1TALA 1TX7A 1Z7KA 3NK8A 1DM4B 4XBCA 1O2OA 1GJ5H 2SGQE 5LPRA 2HNTC 1MUEB 1JBUH 2HRVA 3QK1A 4O9VA 4E7NA 1GBLA 3T29A 1AO5A 4KELA 1QJ7B 4X2WA 3V7TA 1GDNA 1TLDA 3BG4B 1K1MA 4OS1A 1TGBA 1QA7A 2P94A 4HZHA 1PQ8A 2WPJS 1J9CH 3V3MA 3BSQA 2QGRA 1VITF 3M5OA 3QLPH 2AGIX 1NROH 1HNEE 2BQ7B 1FXYA 3UIRA 3ZZ6A 3W95A 2FESH 1SGCA 2PKAA 1GHBG 1CO7E 1BBRH 1A5IA 3CP7A 1BITA 4IS5A 3ZZ9A 4B74A 5T6GA 3O8CA 1EJNA 1KTSB 4GUXA 4IN2A 1KXDA 1C2EA 2P3TB 3HATH 1E38B 1JXPA 2ZI2H 2VIVA 2YOLA 1S6HA 4GLYA 1NU7B 2TIOA 3Q3YA 1O3BA 1Q3XA 2W26A 1TNIA 1Y3XA 3AW0A 1SGNE 3TJOA 4CHAB 3SW2B 1GMDG 3F68H 1MTSA 1TYNA 4ZKOU 4B75A 3M5LA 1AKSA 5C20A 4LXBH 2BVSH 4RKJB 1A3BH 1ELAA 3PTNA 2ZPQA 1PPBH 4R8TB 1FQ3A 3U69H 1VJ9U 2JH0D 1MU8B 1WV7H 1XUJA 1C9PA 2C8YB 1FNIA 1BTZA 2A4GA 4NWKA 1EUFA 3RXDA 3PV4A 1W2KH 1GVLA 4WY3A 4DCDA 1RJXB 3BV9B 3SUDA 1O5DH 3ZZ8A 2P93A 2OXSA 3GISB 1Y3VA 2H5CA 1UTNA 1TGSZ 2UUJB 1UTOA 1HXFH 2BY8X 2HVXA 3SU3A 4VGCB 1QRZA 2OP9A 4BAKB 4ISOA 1DITH 1GBDA 1RTFB 3GCHC 4AB9A 1BMNH 5K0HA 1C1MA 1FAXA 1P02A 2WUBA 1OWIA 2RCEA 5DG6A 2XRCA 1IQNA 1DX5M 1K1NA 1QB9A 2VWNA 1C5UA 4Y8ZA 3GICB 1EJAA 1D9IA 1H1BA 1V2RT 1YGCH 2QCYA 2Z3CA 3KCGH 3UR9A 2O8UA 5ABWA 3BEUA 5F03A 4MQAA 1W3CA 2FOCA 1Y5UT 4IMZA 3QN7A 1KXEA 1EKBB 3ZZ4A 7LPRA 4XSKU 1G2LA 4LZ4B 1KDQB 2QXGA 1FY4A 1SOZA 1K21H 4CRCA 2FODA 2VB0A 1GBEA 2QY0B 1T8NA 2BD8A 5CHAB 8KME2 2NU0E 4FXGH 4UFFH 1LVMA 1WTGH 2VIWA 3ELAH 1G30B 4MPWA 1FLEE 4FUBA 3URCA 3E0PB 1UTJA 1P2IA 3QZRA 4IN1A 3SHAH 1O2PA 4K5ZA 5A8YA 1HJ9A 5HM2A 1FONA 2GV7A 4DGJA 1ZPBA 2O8TA 3A88A 2A32A 1DLKB 1A0LA 2DUCA 5JB9S 2FOEA 1ZOMA 2Y7ZA 2ODYB 4GHQA 1ANBA 3M61U 1TABE 3TGKE 1FI8A 2FYQA 5A8ZA 2BXUH 3O8RA 5A0AE 1EOJA 1RS0A 1P2JA 2OINA 5JDUB 1W7GH 3A8CA 2F9UA 2ZECA 2BZ6H 1HAHH 1V2LT 4CR9A 4TY7A 3ITIA 5EQQA 2PUQH 3KHVA 3PLPA 1PQ5A 1GJAB 1B0FA 1GBHA 6GCHG 1K9OE 3HKJB 5EW2H 1LHGH 2PHBA 1BTYA 4NIYA 2BQ6B 1D6WA 5FPTA 4D8NA 1A3EH 2ZTXA 4ZHLU 4ABDA 3BG8A 2EA3A 4A5TS 1A4WH 2QF3A 1DXPA 1SG8B 1ESTA 3QGNB 1DSUA 1V2NT 5E2OA 1UJ1A 1O2SA 1MZAA 2J95A 1O3FA 4CRBA 3EYDA 1YPHC 1M9UA 4AG2A 1PPCE 4BXSA 3T25A 1E0FD 1NT1A 2FWWA 9LPRA 4X6MA 1GJ9B 1VCPA 2ZO3H 2D8WA 1ELTA 2HNTF 2BMGB 1U6QA 1EPTC 1Y3YA 4U30A 3SGBE 1C1RA 1V2QT 3S0NA 3SNBA 3A86A 3LC3A 8GCHG 2UWOA 4FUEA 1UTPA 1TOCB 3A7TA 2VVCA 1EOLA 4VGCC 3ZYEA 5DP7A 1Y5BT 1IAUA 1AVGH 1WTHD 2WPHS 3M3TA 1SFQB 3U8TH 2AH4X 4X6OA 1JRTA 4I8JA 1S85A 1W10U 2ZCKP 4H42U 2M5TA 3GY7A 4F49A 4A7IB 2TPIZ 5G4BA 1FAKH 2ASUB 3RU4D 2BX3A 1MTWA 2JH6D 3SGQE 3MNCA 1O33A 1NRNH 3RXOA 2Z9KA 4KTUA 3BTWE 3UPEA 1D3TB 5GCHG 2YNAA 4NFEA 3EA9A 2WPMS 2OLGA 1O34A 4YESB 5C67A 2ZQ2A