1EPTA

Refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
43
structure length
43
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE E-TRYPSIN
publication title Refined 1.8 A resolution crystal structure of the porcine epsilon-trypsin.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase (serine protease)
total genus 5
structure length 43
sequence length 43
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eptA00
2Y5GA 3STJA 2A5IA 3VXEH 2A4OA 4MPUA 5JBTA 1W3CA 1P9SA 2XCFA 1DUAA 4X2XA 4LZ1H 1GDQA 5J4SA 1NRPH 1EZQA 1L0ZA 5FBEA 1HUTH 2ZPQA 1S85A 1Y3YA 4ABDA 2H5CA 1GGDC 4KGAA 1SFIA 3VB5A 4NWLA 1UHBB 3UNRA 1C1VH 2AMPA 1AFQC 4Y76A 1T4UH 4BAQB 1TRMA 2OUAA 1EZSC 1TGNA 3RDZA 1V2VT 3I78A 1FONA 4CH2B 2GT7A 2HNTE 3MU1A 3UWIA 1YPMH 1BQYA 5C2ZA 4DURA 1KSNA 2P16A 1MQ6A 4Q2KA 1RJXB 2SNWA 4H4FA 1TONA 2VB0A 1AB9C 1IQEA 1OXGA 1HYLA 3FP8E 1GGDB 3LJOA 3LGYA 1DWDH 1EJNA 1N8OC 1NS3A 1O3LA 2BQ7B 3L3TA 2A0QB 2JKHA 1AFQB 1MAYA 4JZEH 1BRBE 2HWLB 1XM1A 3KHVA 4INLA 2ZHEH 1H9IE 1J16A 1GBCA 3U1IB 1WQVH 4DIIH 4DT7B 3RXVA 3TH3H 2NU1E 1JWTA 3M5LA 1OWKA 3QZQA 3QK1A 3D65E 1C4Y2 1P3CA 1KXAA 3MH5A 4X6MA 1AB9B 1A3EH 1BUIA 1C2KA 2A7CA 1C5TA 4UFGH 1N8OB 5CHAC 4X1PU 3VFEA 4CBNA 1BRCE 3ZVFA 3SV2H 1C9PA 1MTVA 1SC8U 1SR5C 5DPAA 1MTSA 2ZU4A 1S84A 2QF3A 1AVXA 4WWYA 3SV6A 2C4FH 3ZZBA 1OWIA 1WQSA 1Z71A 2ESTE 5EPNA 4AGKA 1O36A 1P2IA 3SU0A 1C1NA 3LGWA 1QA0A 4FUEA 1P02A 1GMHG 1H9LB 1ANCA 1GHAG 2D26C 2Y7ZA 1IQKA 1VITG 5C1UA 2A7JA 3AAUA 3SQEE 1JRTA 1UVPA 2PTCE 3ZYEA 3NK8A 1K9OE 2FS8A 1O5AB 1BB0B 3RU4E 1DFPA 1IHSH 1O3EA 5CHAB 1AKSA 4NWKA 4BTIB 1QCPA 3V13A 1V2MT 2ZEBA 2VIDA 3G01A 3UY9A 3A7VA 5K0HA 1CU1A 3QN7A 1JBUH 3MU0A 1TMUH 1AQ7A 7GCHG 5E2OA 3A85A 1NZQH 3OYPA 1F5RA 1SL3A 3RMOH 1Z7KA 2VVVA 1BTPA 1KIGH 1RRKA 4CRBA 1Q31A 1XUKA 1BMNH 1M9UA 1O0DH 2Z3DA 2B9LA 3BTHE 4ZROA 3KQEA 1SGFG 1SPJA 2ZA5A 3KQCA 2HNTC 4NIVA 1G30B 1OWHA 2Y5FA 1WTGH 1TAWA 2AMDA 3U8TH 2QXIA 2W3KA 3OTJE 5HGGA 4AYVB 2OQUA 1EP5A 1SGNE 1CQQA 5FPYA 3U98H 4AZ2B 2OBOA 1QBOA 5DP4A 1P2QA 2XNIA 1HLTH 4Y8YA 2FESH 1PPZA 1SGPE 2AGEX 3Q3YA 2HNTF 1O5EH 3ZYDA 1IAUA 1EPTC 2ZFFH 3UNQA 3E0PB 3O8DA 1O2KA 1O2NA 3RUOA 1QGFA 3SO3A 3MH4A 4LK4A 1CT2E 1BITA 4JYUH 1RTKA 2FO9A 1AI8H 3ATMA 1S6FA 5DGJA 2PUXB 4MTBA 2BVSH 2H5DA 1FDPA 2PKAB 4FUFA 1VZQH 3RC5A 2CF8H 1SVPA 2XBVA 2W3IA 2OBQA 4IW4E 3RXFA 1C1OA 3KGPA 3S7HB 1P2KA 3N7OA 1MCVA 2UWLA 1JMOH 1SQOA 1ZJKA 2ZP0H 1TX8A 1EPTB 1ZMLA 1QL7A 3RXPA 4FVBA 3QO6A 3RLYH 3I29A 3MTYA 3TNTA 1GI8B 2FM2A 1T8MA 4XOJA 1TPSA 4Y7AA 1O3MA 1V3XA 3UTUH 4UE7H 3E8LA 1EKBB 1XKAC 1EOJA 3DT0H 3URDA 1TRNA 4A7IB 4K69A 1VCWA 2AEIH 1BT7A 2BDYA 1K1IA 1C2JA 1IQNA 3SNAA 2VGCC 4AFQA 1DWCH 2PHBA 1THSH 3UR6A 4FUIA 1QURH 4X8UH 3RXDA 2ZU1A 1TX7A 2TGTA 1SLVB 3LKWA 1GVLA 5L2ZH 3SQHE 2QXGA 1LHCH 2D1JA 4O97A 1AFEH 1LPGB 2BY7X 2GCHG 4WMFA 1FN6A 1A0LA 2ZDVH 4MNWA 1SI5H 3LOXA 3UOPA 5FBIA 5HM9A 4X2VA 3GCOA 7LPRA 1V2RT 2XYAA 1HIAA 5E8EH 8GCHF 2VGCB 2BY8X 3PV4A 3ATLA 1CHGA 2GX4A 3A80A 1C5XB 3P17H 3DA9B 1F0RA 3IWMA 3RXOA 1J15A 2HPQH 4GPGA 2ZECA 2Z3EA 4Y6DA 4A1TA 5GJ4B 4TPYA 1C5RA 2ZCHP 1F5LA 1SLXB 1KTSB 1GBTA 3NWUA 1WV7H 4X1RU 2A5KA 1MTUA 1THPB 2VIWA 3ZZCA 4FVDA 3STIA 2QXHA 1L4ZA 4X6OA 1GJ8B 2OC8A 4MNVA 2BD4A 2WYJA 2KAIB 3P70B 2WPMS 1GI4A 1TX6A 1FAKH 1TA6A 2XBXA 5DP3A 4YZUA 1WOFA 1NPMA 1TGCA 1T7CA 1TA2A 4I8LA 1ELVA 2ZHDA 1OSSA 1AY6H 1UTKA 3FAOA 3P8OA 1TBZH 3LGTA 1VGCC 1D3PB 4B2CA 1V2KT 4FUBA 1GJCB 3A7WA 1TNIA 2ZFQH 4DOQA 4FU9A 2GV7A 5EW1H 1BHXB 1A5HA 4B73A 1YYY1 5G4BA 5J4QA 3Q00A 4JMYA 2Q6DA 1O3JA 1T4VH 4DG4A 5DP7A 2UWPA 3FVFB 1O2WA 1SG8B 1NRSH 2BY6X 3BTGE 1YM0A 3B8JA 1LVBA 4ABJA 1FIZA 2B8OH 2CJIA 5GWZA 2SGDE 4Y79A 1FPCH 1QB1A 3EA9A 3EQ0H 4X2WA 1ANBA 1EZUC 4Y8XA 2ZIQH 1C5WB 1GJ7B 3U69H 1O3NA 1GBIA 2ZU5A 3K65B 4YLQH 4ISNA 1UCYH 1ZJDA 2XBYA 1YPGH 1AUJA 1VGCB 2F3CE 3SU1A 3GY5A 1S6HA 4NA7A 3ZZDA 3RXGA 1ZTLA 5I46H 2GKVE 1MD7A 1PPEE 3GY4A 2VNTA 3PO1C 3RC6A 3ODFA 1TBQH 1XX9A 2OC0A 1EX3A 3PYHA 4NZQA 6CHAC 1LPZB 1T8OA 1MQ5A 3PTNA 1DY9A 2PLXA 1FXYA 2Y80A 3KQDA 2P59A 4NG9H 2R0KA 4ASHA 5ABWA 1HCGA 2Q6GA 1CVWH 1MTWA 4I31A 3F9GA 4BTUB 3VB6A 4J1YA 3M7QA 1TNLA 1P57B 2PGQB 2BXUH 1ACBE 2OINA 6ESTA 4I7YH 1SB1H 1SGCA 3PO1B 2QA9E 4TY7A 2BY5X 1ABJH 1UTLM 4NA9H 1P05A 3ESTA 2B7DH 2RDLA 3TITA 3U9AH 6CHAB 2C8ZB 1O3FA 2FI4E 1H8IH 1SGQE 4GLYA 5A09A 1NTPA 1GBDA 1Y5AT 5C3NA 3TGJE 3AASA 1QRWA 3U8RH 1NO9H 4JK5A 3A89A 3ENSB 4JCNA 3UR9A 4GUXA 1G3BA 3P92A 1ZMNA 1KLTA 2ODYB 1NRQH 1LHGH 2J4IA 4GHTA 1GMHF 1GHAF 1V2ST 1IQIA 1C5UA 1A5GH 1O38A 1PPBH 1VITF 2UUFB 1GHZA 1O3OA 3QGNB 3V12A 2C90B 1UTQA 2THFB 3NXPA 2PTNA 3PMJA 4YM9A 1GHWH 1MTNC 1CHOG 4E7RG 1ZMJA 3RXIA 2YOLA 3D23A 2CXVA 1L4DA 1BJUA 2O8UA 3MU4A 1HBTH 2BOKA 1ESBA 3FFGA 1QNJA 2JH5D 3DUXH 4WJG2 1LQEA 3GCTG 3SHCH 3LT3A 3SJIA 3MO9A 1LVOA 4I32A 7GCHF 3TJVA 2DE9A 1FY8E 1YCPK 7ESTE 1BTZA 5L2YH 1TQ0B 2RG3A 1C1RA 3ZZ7A 1RGQA 1O5CB 1D4PB 4IC5A 2Y6TA 1BA8B 1OYQA 2FX4A 5C5OA 1MTNB 1UVSH 1ESAA 1VR1H 5HM2A 1GDUA 4ZXYH 2FOBA 1QBNA 4XDEA 5JYIA 3TGKE 4Y0ZE 4LOYH 1O5FH 1SBWA 3EA8A 1SGRE 2FTLE 3JZ2B 1K1NA 5E0GA 2V35A 2XW9A 2FOAA 3K6ZA 2TGPZ 3MH6A 3MNBA 4NIYA 2B0FA 2STBE 3GYMA 5I25A 3QGJA 1V6DA 1C1QA 1C1MA 2FI5E 3SGQE 4NGAH 5JDUB 5FXLA 3RP2A 5C67A 3K2UA 1NT1A 1O2SA 1FY5A 5HYOA 2CHAC 4R0IA 3UUZA 3PM3A 4KKDA 2Z94A 4K8BA 1G2MA 3PLPA 2FPZA 1YBWA 1FPHH 4MNXA 1J17T 2HPPH 3BEUA 1SOZA 1C9TA 2ZF0H 5JBAS 1DDJA 3BEIB 5A8XA 2GZ9A 3A83A 1UO6A 4KTUA 2A31A 4H6TA 5LPRA 4XBDA 3K9XB 2BDHA 1BBRE 1LHFH 5C20A 1A2CH 1TIOA 2QYIA 1Y3WA 2NWNA 4UD9H 4K1EA 1GVKB 4X8VH 1DSUA 2HLCA 4ISIH 2EI6A 3VXFH 3VPKA 2BM2A 5ETXA 4IMZA 3ODDA 4I8GA 2CHAB 1O34A 4I8KA 3SU6A 1ELTA 3M61U 4X8SH 1P03A 3GDSA 3GY7A 1B0EA 1TYNA 1OWDA 4A1XA 1KYNA 2BD8A 2C8XB 1NU9A 1TGSZ 1W7XH 5DP6A 4IGDA 3FP6E 3BV9B 1C2GA 1O2OA 1HAHH 4E05H 2AS9A 2OD3B 2Y5HA 3BTTE 4XBBA 3SBKA 5AFYH 1HXFH 4TWYA 1GBJA 2BY9X 1W10U 1HAVB 2SFAA 2GCTC 1LTOA 1E38B 2P3FH 3O8RA 3PLBA 5A8YA 1D6RA 4JZ1A 1P12E 2GCHF 2ZPRA 1MZAA 3BTWE 2GZ8A 2ANKH 3P6ZB 3R3GB 5AVDA 3UIRA 1E36B 1OX1A 1BBRH 4I8JA 4H6SB 5K7RA 4AX9H 1O35A 3ZV8A 4JYVH 1BTUA 1ABIH 1FAXA 1PPGE 1FY3A 3E1XB 4Y8ZA 3A8CA 1O39A 1A46H 3E3TA 4B71A 3O8BA 4E7NA 3D49H 2FYRA 1IQFA 1AWFH 2GCTB 3HK3B 4NCYA 2G51A 3UWJH 1ELBA 1O2IA 3TNSA 2WINI 4A1VA 3A7ZA 2VJ1A 1BMMH 1OS8A 1BTWA 2TGDA 1J8AA 3R0FA 4BAKB 3SV9A 2O8LA 3NCLA 1DANH 1O3PB 1O2RA 1QQ4A 1A7SA 4WF8A 1MU6B 3LGUA 1KY9A 2R3UA 1P2MA 1ZGVA 5HXFA 2FOEA 4K8YA 2G4UA 2VVCA 4X0WU 3SN8A 1RTLA 2GMTC 2BZAA 1UK3A 4OS6A 2G4TA 1GWAA 3LC3A 4CREA 3ZZ3A 4AOQA 1GMDG 5A8ZA 1W0ZU 2ZFTA 2WPKS 1LVYA 2ALPA 1GG6C 2ZGCA 1SHHB 1THRH 5T3HA 1YC0A 1IOEA 4R8TB 4X1NU 1J9CH 2Y7XA 2BQWB 8LPRA 3PMBB 1MU8B 1DY8A 1PPFE 5CMXH 1ZSKA 2QC2A 3M5OA 1AWHB 3HGPA 5F8ZA 1H1BA 2RA0A 1W0YH 2GP9B 3F1SB 3M5NA 1TOCB 1LHEH 2A7HA 3A7TA 3MNSA 4HI3A 3KNXA 4AORA 2ZHFH 2GMTB 2P94A 1A4WH 1WTHD 3T25A 1HGTH 1HB0B 5FAHA 1TGTA 1T32A 1K21H 2O8WA 4U32A 1EB2A 1GG6B 1OKXA 3S69A 1NC6A 4ABFA 3SU4A 3CENA 1Y3VA 4CBOA 3M3TA 3SU3A 4JK6A 4GCHG 1MBQA 1UTJA 3MMGA 4Z0KA 2H9TH 4IN1A 3L6PA 1D3DB 4WVPE 3RM2H 1O2XA 1SOTA 4Y7BA 1PPCE 1EAWA 2Y81A 1KDQB 1WUNH 2OXSA 2UWOA 2BB4A 6GCHG 2XWBI 2IJOB 2AIQA 1A61H 3KQBA 2BXTH 3V3MA 1G2LA 4FUJA 4MDSA 4AG1A 1N1LA 1W2KH 2BVXH 1C2EA 3VB7A 4ZKRU 3VB3A 1NESE 4K60A 1SLWB 2W7UA 4YTAA 1O2YA 3F68H 3P8NA 5EQSA 2OTVA 4D7FA 1HFDA 1PYTD 1GBMA 4K5ZA 3SNBA 1EJAA 1HAZB 4CRAA 3L33A 2V0BA 1S0QA 4FU7A 1F92A 2ZWLH 1UHBA 5FPSA 4JZDH 2GGVB 1CA8B 3LIWA 3SZNA 4NIWA 4K1SA 2GT8A 3F9HA 2A45B 2FOCA 4Q7XA 3EDXB 1F5KU 4BAOB 1RFNA 3CS0A 1BRAA 5A0CA 4IC6A 1W8BH 1D6WA 1WU1A 4ZHLU 2ZFSA 1V2NT 1F0TA 1V2QT 3ATKA 2PV9B 2D8WA 4U30A 4ABIA 4RSPA 5GIBA 1O3IA 1ETTH 2WUBA 4PROA 1ZPZA 2BLOA 2C3SA 1GI6A 2BD9A 2BD3A 1HNEE 1UTPA 5TCCA 2IOTA 3TJOA 1T31A 2I6QA 3HKJB 1CHOF 1YGCH 1T8NA 1YPJH 3ZV9A 5A2MH 1HAGE 1ELDE 1YF4A 4INHA 3LC5A 3TJUA 2QIQA 3RU4T 3DHKH 3RXEA 1OP2A 4A92A 4NSYA 3GCTF 2G5NA 2PUQH 2AGIX 3M3SA 5E0JA 1E35B 1UVOA 1C2HA 1SGDE 1NM6A 4YESB 2HRVA 1SQTA 3F9EA 4LXBH 3ZVCA 4LZ4B 2WPLS 1O2LA 2XTTB 4DCDA 1BRUP 3LU9B 4ISLA 1KXEA 3A88A 3PB1E 2EA3A 4UDWH 1Q3XA 2Q1JA 2ZZUH 1GMCG 3S9BA 2SGEE 2OP9A 1Y59T 3VB4A 1EB1H 2BD5A 4X1SU 1MCTA 3A84A 3F6UH 5C5NA 2PFEA 3AW0A 1GBFA 1XUIA 2G55A 1N6XA 1O33A 1SSXA 3ZZ9A 1OOKB 2H1UA 5L30H 5PTPA 1AHTH 2XBWA 1FI8A 4AFUA 2LPRA 4Q7YA 2VWLA 1Z6JH 1E37B 1FNIA 5DP9A 1YKTA 4F4OC 2QCYA 3LONA 4B74A 2YNAA 4Y71A 3H7TA 1IQGA 2ZG0H 3FZZA 1O3HA 4CRDA 2AMQA 5FCRA 1SHYA 1NN6A 2D2DA 3DFLA 1L1NA 4JZFH 4TWWA 4D8NA 5GDSH 5BPEA 1O5DH 5LPEA 3TIUA 1D3TB 3V0XA 3SNEA 1GL1A 1PQAA 1QRXA 2EC9H 2ZDLA 3TK5A 1Y3UA 4YO9A 3SNDA 2H6MA 4BAHB 2F9NA 2VH6A 2QV1A 1CSOE 3ZVBA 4YT7H 1Y5UT 2W26A 2J9NA 2G52A 2FX6A 1YPHE 1XUGA 3BIVH 4Y11E 5AFZH 3MOCA 1DT2A 5AHGH 1A5IA 3LH3A 2VU8E 1ZTJA 3A7YA 1W13U 1TNKA 1AMHA 1C2FA 3VGCC 4OS4A 5F03A 5H4IB 3FP7E 1BMLA 3QDZB 4MPWA 3KF2A 4YOGA 2C8WB 2F9PA 1AVWA 3URCA 1K22H 1VCQA 2J94A 2GTBA 1G3EA 1GI3A 1C1UH 3W94A 1LKAA 1G9IE 2FLBH 3MU8A 2EI8A 1OWJA 1AZZA 1LO6A 2PKAA 2G00A 2ZO3H 4XE4A 1PJPA 1HPGA 9LPRA 1C2IA 1CGIE 1UK4A 1LVMA 2W7SA 3VGCB 2P8OC 5FX6A 1IHTH 1EPTA 1ZPBA 5IYTA 4CRFA 2AGGX 2ZU3A 2TRMA 1EASA 1F0SA 3A86A 1C5PA 2FEQH 4MVNA 2Z9JA 2QGRA 3SJ9A 1ZHMA 1RIWC 1XUFA 1KTTB 2BOHB 3MHWU 1QFKH 3ZVGA 4ABGA 1NFWA 3QTOH 3RLWH 1ZSJA 2VVUA 2R2WU 1DWEH 1SQAA 2ZTZA 4U2WA 3ZZAA 2VIPA 4GSOA 2P8OB 4WH6A 3BG4C 1RTFB 1DM4B 3NUMA 3NKKA 1YPLH 1MKXH 1XVMA 1EZXC 2WV5A 1UMAH 2YNBA 5HMAA 1GBBA 1DXWA 3ZZ6A 3Q3XA 1WYKA 5DJ7A 1MBMA 1P2NA 1P10A 1C5OH 1FIWA 1GJ6A 3ZZ4A 1DLEA 2Z7FE 5BRRE 2HGTH 3EA7A 1HAIH 1LMWB 1GMDF 3H7OA 2Z9KA 5EXNA 5ESTE 1O3DA 4BOHA 3KIDU 2Y82A 1P8VC 1RIWB 1TMTH 1QRZA 2ZKSA 1HJ9A 2O9QA 2WPHS 1P3EA 2XCNA 2OC1A 2A5AA 1FUJA 3QLPH 3SUDA 3UOUA 3H5CB 3JZ1B 4YLUA 1GI5A 1NFXA 2V6NA 1O2PA 5F6MA 3BG4B 1YPHC 4NFEA 1GCTC 4MG3A 4ZAEA 3M7TA 1QL9A 2FTMA 1AD8H 2P3UB 2ZGBH 6LPRA 1GI9B 1QIXB 1V2OT 1S5SA 2F9OA 2VWNA 1QA7A 3MNCA 5DO4H 1UCYK 2XC0A 3QUMP 1UVTH 2ZQ1A 1LDTT 1PQ8A 1TOMH 1CGHA 1EAIA 2FWWA 1KLIH 2KAIA 1FQ3A 1IQHA 1S0RA 1WAYB 4GCHF 3AW1A 1O5GH 4AB8A 2JETC 3S9AA 4WH8A 1YLDA 5T6GA 2DUCA 2XC5A 4DY7B 2ODPA 2ZHQH 2BHGA 1ORFA 3SUFA 4ZMAH 3BEFB 1UJ1A 1F2SE 3DFJA 1GCTB 3GY8A 4BXSA 6GCHF 2CGAA 1LKBA 2PKSC 4XBCA 1GHYH 3RXSA 3ITIA 1CE5A 1TE0A 4SGAE 2FLRH 2GVFA 1BOQA 3SGAE 1GI7B 3TH2H 3E0NB 1ELEE 1ZTKA 4X2YA 2NU2E 3SJOA 3WY8A 1DLKB 5JBBS 1TGBA 2PSXA 1S81A 1GJ9B 1BTYA 1O3AA 3E16B 3D62A 2LNCA 2FIRH 2ZCLP 3LDXH 2F91A 3HPTB 1ZLRA 2JETB 2GZ7A 1EOLA 1EAUA 1QR3E 2Z9IA 4UFEH 1GHVH 1EQ9A 3PWCA 1PQ5A 5DK1A 1QB6A 3AVZA 2P93A 2PKSB 2Z6BD 1HAPH 4DIHH 3SOSA 3M5MA 1HDTH 2A4GA 1AUTC 4TY6A 1Y3XA 1W14U 1SGIB 5DP8A 1MKXK 2RCEA 1DOJA 3HK6B 4D9QA 1P9UA 3RXAA 4MPXA 2SGPE 1B7XB 3QX5H 1HJ8A 1O2GH 1KXBA 1O2JA 2BYAX 1A1RA 1BIOA 2ZDMA 1GCDA 2GDDA 3HATH 2VINA 4Y10E 1YLCA 1AGJA 1ARBA 2QXJA 1BCUH 1HXEH 2ZU2A 1G36A 3AAVA 1WCZA 1RD3B 2XXLA 2BDCA 3PLKA 2TGAA 1O2HA 3V7TA 1BDAA 3PMAB 4AYYB 3BG8A 5E2PA 2ZQ2A 3LPRA 2Q6FA 1S83A 4I8HA 3T26A 3M3VA 1TPPA 2F9VA 1RXPA 2FOFA 3GCHC 4HTCH 4OS7A 3TK6A 1ELCA 1P2OA 2WV4A 3OSYA 2FS9A 3OX7U 4FUDA 3TU7H 2A1DB 4K3JA 2H9EH 4F49A 1D9IA 4BAMB 1MZDA 2BLQA 3BTEE 4J2YB 3QTVH 1W12U 2FYQA 2I6SA 3TPIZ 2J95A 3BTKE 3RXTA 1GJ4H 5JB8S 2ZDKA 1FN8A 3T27A 5F8XA 1GMCF 4GAWA 4IN2A 2UUKB 1ZPCA 2Z9GA 2ANMH 1ZRBA 4BNRA 4UONA 3BTFE 3ZVDA 1ELAA 3EGKH 5GCHG 2FP7B 3GCHB 1XVOA 2F9UA 2J38A 2F9BH 4X1QU 4B75A 3DD2H 2ILNA 2TPIZ 4CHAC 3BTQE 1NFUA 4O3TA 1MAXA 1HAYB 1CT4E 1O3KA 1K1MA 1PQ7A 4OS2A 2AH4X 3B9FH 4JYTA 2VIVA 5FPTA 2FXRA 2H9HA 3A7XA 2TIOA 2G8TA 3MO3A 2WYGA 2CMYA 2PGBB 4ZH8A 3SW2B 2AFQB 4ESTE 1CGJE 1NRNH 2SGAA 2V3HH 4BTTB 4MNYA 1DITH 3A87A 1GHBG 1Z1JA 1SGYE 5EOKA 1AN1E 1O2TA 3FZDA 2ZCKP 4FUHA 2NU4E 5EU8A 3F9FA 1F7ZA 4BANB 3TGIE 3SUGA 4OGXA 2BVRH 3RXBA 1SGEE 5EQQA 3T5FH 1SMFE 4O9VA 4CHAB 1HIAB 1O2QA 2XRCA 1C5NH 2BD2A 2PW8H 5L6NH 1P2JA 1P0SH 2ASUB 3GY3A 1SGFA 4OS5A 1QHRB 4TYDA 4DVAU 3GYLB 1ANEA 3MYWA 3M36A 3CP7A 3RXJA 1L2EA 3SU2A 1OYTH 2BMGB 3BTME 1HAOH 1ZSLA 3T62A 1JOUB 1JIRA 1ESTA 3TH4H 3LGIA 4MQAA 4CR9A 5T6DA 1A3BH 2F83A 4X8TH 2BD7A 3P95A 4HZHA 4QT8C 1DICA 4ZXXH 2OQ5A 4YOIA 1MUEB 2PWXA 1TNGA 3NZIA 1IQJA 1GJAB 1FZZA 2EEKA 4HFPB 2CF9H 1P06A 5JB9S 2VH0A 3PROA 4WY3A 2UUJB 1B5GH 2Z9LA 1D3QB 1BBRK 5LPFA 3MU5A 1CT0E 3QZRA 3ZVAA 2ANYA 3SGBE 2ZTYA 2M5TA 1SFQB 3Q3KA 2J92A 1C4V2 1NFYA 4A6LA 3BTDE 2BDGA 1LQDB 2ANWA 1CBWC 1O5BB 4AFSA 1C5SA 1XXDA 1C1TA 3RXMA 1HRTH 2RA3A 1ZGIA 1TNHA 3CS7A 3RXUA 1BJVA 1W11U 4Y0YE 1KXDA 1DX5M 3LJJA 1V2UT 2XC4A 5EGMA 1HV7A 3MFJA 3T2NA 2B5TB 1FMGA 1V2JT 4OS1A 1C5VA 1K1PA 1ZHRA 4B2BA 1G37A 3KCGH 1JRSA 2HVXA 1AE5A 3LGVA 1DUEA 1O37A 2BLWA 4THNH 2ZHWH 1XXFA 3C27B 4ZKOU 3GCNA 1PYTC 1TRYA 1J14A 3UQVA 4Q7ZA 4D9RA 1HAVA 1ZOMA 1O2ZA 1CBWB 1GBAA 2STAE 1ARCA 3GY2A 2ZFRH 2BDIA 5E0HA 2AERH 3A8DA 1CO7E 1HJAC 4ZUHA 1K28D 2NU0E 2DE8A 3A8AA 1C2LA 2FDAA 5C1XA 5GPIB 4MPVA 4WXVA 1H9HE 1Y8TA 4FUCA 1V2PT 4I33A 4AGJA 4GVUA 1INCA 1QJ7B 2ZGJA 3A82A 4IMQA 3UPEA 3W95A 5CE1A 1RS0A 3RU4D 1Z6EA 1EP6A 2ZTXA 1QTFA 4KTCA 4AN7A 1L1JA 2GV6A 3KL6A 5EPYA 5LGOA 3S7KB 4CRGA 1WBGB 4JZIA 4ZKNU 2BX3A 3T29A 1NROH 3RXLA 2G5VA 2QN5T 3ZZ8A 4ABHA 1YPKH 1C1SA 1GBHA 2UUYA 3SU5A 2FMJA 3SJKA 7KMEH 5T6FA 1FJSA 5A0AE 1HJAB 4NIXA 2NU3E 2A2QH 1Y5BT 2FOMB 1C4U2 1C5MD 1AIXH 3TVJB 2C8YB 1DWBH 4NFFA 4B1TA 5IDKA 2ODQA 3SI3H 3QWCH 3P8FA 4H42U 4ZHMU 1H4WA 1O30A 1QJ1B 2IN2A 1DXPA 2HALA 1QB9A 4YT6H 1EATA 5TJXA 2ZDNA 1TNJA 1C1PA 2FOHA 4Z6AH 2HOBA 1GI1A 2ULLA 1PFXC 1C1WH 3GOVB 1BZXE 1TPOA 4SGBE 2FZZA 2O8MA 1DE7H 2WPIS 1TWXB 2CV3A 1FLEE 3RMNH 1GPZA 4ABEA 1Z8GA 3RXHA 3GDVA 1UK2A 3ATIA 3E90B 1K1LA 4K1TA 1B0FA 1OWEA 9ESTA 4ISHH 3VEQB 3E6PH 3BN9A 4YOJA 1ANDA 5EQRA 1U6QA 1MH0A 4D76A 1O3CA 2K1QA 1GJ5H 3IG6B 4WMDA 1C2DA 1FV9A 1QJ6B 1BTHH 4FU8A 2WPJS 1GDNA 1UCYE 1TLDA 3UREA 3SV7A 4WXIA 2A4QA 5SGAE 1C5ZB 3UNSA 5JBCS 3KEEA 3PTBA 1TALA 1DSTA 4UFFH 3HKIB 1YP9A 3M35A 5LH8A 1QL8A 3EYDA 1V2LT 4KELA 1QY6A 4RKJB 3SNCA 4DJZB 1QBVH 1LHDH 1Z8JB 1ELGA 3M7UA 1TFXA 1ZYOA 1BTXA 3O8CA 4ZKSU 1JIMA 1KDQA 4WMEA 1TMBH 2OC7A 3GICB 1BHXF 3B23B 4UFDH 4KP0A 2R2MB 3Q77A 4B76A 1ZHPA 2WUCA 2VWMA 2ZDAH 4A5TS 2FODA 2SNVA 2C93B 3ZVEA 1UTNA 3UFAA 5FHTA 1G3CA 1K1OA 1GHXH 1WSSH 3RXCA 4XFQA 5EG4A 3RMMH 5B6OA 1XKBC 1YPEH 1OP8A 2ZC9H 1GBEA 1VITH 1CA0C 1C5QA 4AFZA 3RXQA 3K6YA 1VCPA 2R9PA 3BF6H 5EXMA 3ELAH 4O3UA 1LPKB 1NU7B 1AU8A 1ETSH 4CRCA 1P11E 1T8LA 3BIUH 4K2YA 8KME2 1NY22 1GVZA 2ZGHA 2BLVA 3GISB 2P3TB 5DKMA 1YCPH 2G81E 4X6PA 3OU0A 3E91A 1C5LH 4RN6A 4AB9A 2QAAA 4ZHAA 1LCYA 1ZZZA 3SJ8A 4AG2A 1TBRH 2FI3E 3I77A 2QF0A 4NZLA 3NPSA 4X6NA 2J2UA 1GJDB 1XUJA 4Q80A 3SV8A 5EW2H 1OPHB 1OP0A 1CA0B 1GBKA 3FANA 1N6YA 5GCHF 3SORA 4IS5A 1O2VA 3A8BA 1MKWH 2ALVA 2BDAA 8ESTE 2ZFPH 2AYWA 3RXKA 5EODA 1K2I1 1Q2WA 1TPAE 2SGFE 3MH7A 4XSKU 2VWOA 1GI2A 5EXLA 2GD4B 3PWBA 4FUGA 1XMNB 1MMJN 4CH8B 2A32A 3LH1A 3S0NA 1VJAU 1EJMA 2BTCE 5ESBA 1IQLA 1ZRKA 1IQMA 2ZI2H 1GHBF 3A81A 1P01A 3U8OH 2BZ6H 4OGYA 2BQ6B 1DPOA 1SLUB 3GDUA 3PMHB 2A2XH 1FY1A 1GBLA 1E0FD 4KTSA 4RKOB 1E34B 3MI4A 4DW2U 1KXCA 3U1JB 1O3BA 1S82A 4U01A 4ABBA 2QY0B 5A0BA 1KLJH 2OLGA 1A0HB 3IITA 4VGCC 1X7AC 1L1GA 1JXPA 2EI7A 2J34A 3BSQA 1NRRH 1DVAH 3RM0H 3EE0B 2AIPA 3MWIU 1V2WT 3HGNA 4FXGH 1UTOA 4NSVA 1AE8H 4O03A 5C1YA 4D7GA 2XWAA 5F8TA 1TABE 2PR3A 4M7GA 1C2MA 1W7GH 3SHAH 4TPIZ 4IBLH 1UTMA 1F0UA 1TQ7B 5TCAA 4MLFB 3MNXA 1FY4A 1DS2E 3SI4H 3RMLH 2IPHA 2R3YA 3T28A 2BX4A 3C1KA 4ABAA 2SGQE 1TB6H 2A4RA 2R0LA 4GHQA 4CR5A 2H2ZA 1HAXB 5AF9H 4VGCB 3TJNA 5GXPA 2PSYA 4UEHH 3GY6A 3OY6U 1XUHA 4E06H 2V3OH 1AVGH 1ETRH 1Z8IB 1UVUH 1ID5H 2JH6D 1VJ9U 4HGCA 2TBSA 1PPHE 4DGJA 1AZ8A 3ZZ5A 8GCHG 3KN2A 3Q76A 5FCKA 1AKSB 2JH0D 2FOGA 2Z3CA 1GJBB 1MKWK 1Z1IA 1EAXA 4ISOA 1BMAA 2W5EA 5FX5A 1MD8A 1QQUA 4NA8A 1KXFA 1ELFA 1ZR0A 3TK9A 4INKA 3RC4A 1H8DH 1A0JA 2VIQA 3MO6A 1P09A 2GDEH 1Z8RA 1O32A 1V2TT 1GL0E 1EXFA 4B2AA 1O2UA 3EAJA 4BXWA 3M37A 3SUEA 3ATWA 2VIOA 1EUFA 2O8TA 5DP5A 1O3GA 2ZPSA 3RXRA 1AO5A 1G32B 5DG6A 3S9CA 3OY5U 1C5YB 1GI0A 3TLOA 2CN0H 3P8GA 2ZGXH 2OCVB 3UQOA 1G3DA 1O31A 2BDBA 1P04A 1K1JA 1O2MA 2P95A 5JPMH 2ZNKH 1YCPM 1SGTA
chains in the Genus database with same CATH superfamily
2Y5GA 3STJA 2A5IA 3VXEH 2A4OA 4MPUA 5JBTA 1W3CA 1P9SA 2XCFA 1DUAA 4X2XA 4LZ1H 1GDQA 5J4SA 1NRPH 1EZQA 3DSPA 1L0ZA 5FBEA 4Z1MD 1HUTH 2ZPQA 3OFND 1S85A 1Y3YA 4ABDA 2H5CA 1GGDC 4KGAA 1SFIA 3VB5A 4NWLA 1UHBB 3UNRA 1C1VH 1K0HA 2AMPA 1AFQC 4Y76A 1T4UH 4BAQB 1TRMA 3OEHD 2OUAA 1EZSC 1TGNA 3RDZA 1V2VT 3I78A 1FONA 4CH2B 2GT7A 2HNTE 3MU1A 3UWIA 1YPMH 4P00A 2QF4A 1BQYA 5C2ZA 4DURA 1KSNA 2P16A 1MQ6A 2LP6A 4Q2KA 1RJXB 2SNWA 4H4FA 1TONA 3FO8D 2VB0A 1AB9C 1IQEA 1OXGA 1HYLA 3FP8E 1GGDB 3LJOA 2L6OA 3LGYA 1DWDH 1EJNA 1N8OC 1NS3A 1O3LA 5DSFA 2BQ7B 3L3TA 2A0QB 2JKHA 1AFQB 1MAYA 4JZEH 4M9FA 1BRBE 2HWLB 1XM1A 3KHVA 4INLA 2ZHEH 1H9IE 1J16A 1GBCA 3U1IB 1WQVH 4DIIH 4DT7B 3RXVA 3TH3H 2NU1E 1JWTA 3M5LA 1OWKA 3QZQA 2XOKD 3QK1A 3D65E 1C4Y2 1P3CA 1KXAA 3MH5A 4X6MA 1AB9B 1A3EH 1BUIA 5EJZA 1C2KA 2A7CA 1C5TA 4UFGH 1N8OB 5CHAC 4X1PU 3VFEA 1FX0B 4CBNA 1BRCE 3ZVFA 3SV2H 1C9PA 1MTVA 1SC8U 1SR5C 5DPAA 1MTSA 2ZU4A 1S84A 2QF3A 1AVXA 4WWYA 3SV6A 2C4FH 3ZZBA 1OWIA 1WQSA 1Z71A 2ESTE 5EPNA 4AGKA 1O36A 1P2IA 3SU0A 4XRNA 1C1NA 3LGWA 1QA0A 4FUEA 1P02A 1GMHG 1H9LB 2F43B 3EE7A 1ANCA 1GHAG 2D26C 2Y7ZA 1IQKA 1VITG 5C1UA 2A7JA 3AAUA 3SQEE 1JRTA 1UVPA 2PTCE 3ZYEA 3NK8A 1K9OE 2FS8A 1O5AB 1BB0B 3RU4E 1DFPA 1IHSH 1O3EA 5CHAB 1AKSA 4NWKA 4BTIB 1QCPA 4TSFD 3V13A 3NRLA 1V2MT 2ZEBA 2VIDA 3G01A 3UY9A 3A7VA 5K0HA 1CU1A 3QN7A 1JBUH 3MU0A 1TMUH 4I86A 1AQ7A 7GCHG 5E2OA 3A85A 1NZQH 3OYPA 1F5RA 1SL3A 3RMOH 4ACAA 1Z7KA 2VVVA 1BTPA 1KIGH 1RRKA 4CRBA 1Q31A 1XUKA 1BMNH 1M9UA 1O0DH 2Z3DA 2B9LA 3BTHE 4ZROA 3KQEA 1SGFG 1SPJA 2ZA5A 3KQCA 2HNTC 4NIVA 1G30B 1OWHA 2Y5FA 1WTGH 1TAWA 2AMDA 3U8TH 2QXIA 3SZEA 2W3KA 3OTJE 5HGGA 4AYVB 2XNDD 2OQUA 1EP5A 1SGNE 1CQQA 5FPYA 3U98H 4AZ2B 2OBOA 1QBOA 3U28C 5DP4A 1P2QA 2XNIA 1HLTH 4Y8YA 2FESH 1PPZA 1SGPE 2AGEX 3Q3YA 2HNTF 1O5EH 3ZYDA 1IAUA 1EPTC 2ZFFH 3UNQA 3E0PB 3O8DA 1O2KA 1O2NA 3RUOA 1QGFA 3SO3A 3MH4A 4LK4A 1CT2E 1BITA 4JYUH 1RTKA 2FO9A 3FKSD 1AI8H 3ATMA 1S6FA 5DGJA 2PUXB 4MTBA 2BVSH 2H5DA 1FDPA 2PKAB 4FUFA 1VZQH 3RC5A 2CF8H 1SVPA 2XBVA 2W3IA 2OBQA 4IW4E 3RXFA 1C1OA 3KGPA 3S7HB 1P2KA 3N7OA 1MCVA 2UWLA 1JMOH 1SQOA 1ZJKA 2ZP0H 1TX8A 1EPTB 1ZMLA 4F55A 1QL7A 3RXPA 4FVBA 3QO6A 3RLYH 3I29A 3MTYA 3TNTA 1GI8B 2FM2A 1T8MA 4XOJA 1TPSA 2KZ4A 4Y7AA 1O3MA 1V3XA 3UTUH 4UE7H 3E8LA 2JJ1D 1EKBB 1XKAC 1EOJA 3DT0H 3URDA 1TRNA 4A7IB 4K69A 1VCWA 2AEIH 1BT7A 2BDYA 1K1IA 1C2JA 1IQNA 3SNAA 2VGCC 4AFQA 1DWCH 2PHBA 1THSH 3UR6A 3OE7D 4FUIA 1QURH 4X8UH 3RXDA 2ZU1A 2CK3D 1TX7A 2TGTA 1SLVB 3LKWA 1GVLA 5L2ZH 3SQHE 2QXGA 1LHCH 2D1JA 4O97A 1AFEH 1LPGB 2EY4C 4B6FA 1EFRD 2BY7X 2GCHG 5C94A 4WMFA 1FN6A 1A0LA 2ZDVH 4MNWA 1SI5H 3LOXA 3UOPA 5FBIA 5HM9A 4X2VA 3GCOA 7LPRA 1V2RT 2XYAA 1HIAA 5E8EH 5CHBA 1SKYE 8GCHF 2VGCB 2BY8X 3PV4A 3ATLA 1CHGA 2GX4A 2JJ2D 2L74A 3A80A 1C5XB 3P17H 3DA9B 1F0RA 3IWMA 3RXOA 1J15A 2HPQH 4GPGA 2ZECA 2Z3EA 4Y6DA 4A1TA 5C17A 5GJ4B 1H8HD 4Q63A 4TPYA 3PV2A 2F4LA 3F0OA 1C5RA 2ZCHP 1F5LA 1SLXB 1KTSB 1GBTA 3NWUA 1WV7H 4X1RU 2A5KA 1MTUA 1THPB 2VIWA 3ZZCA 4FVDA 3STIA 2QXHA 1L4ZA 4X6OA 1GJ8B 2OC8A 4MNVA 2BD4A 2WYJA 2KAIB 3P70B 2WPMS 1GI4A 1TX6A 1FAKH 1TA6A 3W1EA 2XBXA 5DP3A 4YZUA 1WOFA 1NPMA 1TGCA 1T7CA 1TA2A 4I8LA 1ELVA 2ZHDA 1OSSA 1AY6H 1UTKA 3FAOA 3P8OA 1TBZH 3LGTA 1VGCC 1D3PB 4B2CA 1V2KT 4FUBA 1GJCB 3A7WA 1TNIA 2ZFQH 4DOQA 4FU9A 2GV7A 5EW1H 1BHXB 1A5HA 4B73A 1YYY1 5G4BA 5J4QA 3Q00A 2J5UA 4JMYA 2Q6DA 1O3JA 1T4VH 4DG4A 2AHME 5DP7A 2UWPA 3FVFB 1O2WA 1SG8B 1NRSH 2BY6X 3BTGE 1YM0A 3B8JA 1LVBA 4ABJA 1FIZA 2B8OH 2CJIA 5GWZA 2SGDE 4Y79A 1E1QD 1FPCH 1QB1A 3EA9A 3EQ0H 4X2WA 1ANBA 1EZUC 4Y8XA 2ZIQH 1C5WB 1GJ7B 3U69H 1O3NA 1GBIA 2ZU5A 3K65B 4YLQH 4ISNA 1UCYH 1ZJDA 2XBYA 1YPGH 1AUJA 1VGCB 2F3CE 3SU1A 3GY5A 1S6HA 4NA7A 3ZZDA 3RXGA 1ZTLA 5I46H 2GKVE 1MD7A 1PPEE 3GY4A 2VNTA 3PO1C 3RC6A 3ODFA 1TBQH 1XX9A 2OC0A 1EX3A 3PYHA 4NZQA 6CHAC 1LPZB 1T8OA 1MQ5A 3PTNA 1DY9A 2PLXA 1FXYA 2Y80A 3KQDA 3UB0A 2P59A 4NG9H 1WDIA 2R0KA 4ASHA 5ABWA 1HCGA 3DSOA 2Q6GA 1CVWH 1MTWA 4I31A 3F9GA 4RT1A 5HIZA 4BTUB 3VB6A 4J1YA 3M7QA 1TNLA 1P57B 2PGQB 2OK5A 2BXUH 2WSSD 1ACBE 2OINA 3F3BA 6ESTA 4I7YH 1SB1H 1SGCA 3PO1B 2QA9E 3DSGA 4TY7A 2BY5X 1ABJH 1UTLM 4NA9H 1P05A 3ESTA 2B7DH 2RDLA 3TITA 1QZ8A 3U9AH 5DN6D 6CHAB 2C8ZB 1O3FA 2FI4E 1H8IH 1SGQE 4GLYA 5A09A 1NTPA 1GBDA 1Y5AT 5C3NA 3TGJE 3AASA 1QRWA 3U8RH 1NO9H 4JK5A 3A89A 3ENSB 4JCNA 3UR9A 4GUXA 2KCOA 1G3BA 3P92A 1ZMNA 1KLTA 2ODYB 1NRQH 1LHGH 2J4IA 4GHTA 1GMHF 1GHAF 1V2ST 1IQIA 1C5UA 1A5GH 1O38A 1PPBH 1VITF 2UUFB 1GHZA 1O3OA 3QGNB 3V12A 2C90B 1UTQA 2THFB 3NXPA 2PTNA 3PMJA 4YM9A 1GHWH 1MTNC 1CHOG 4E7RG 1ZMJA 3RXIA 5EIYA 2YOLA 4ACBA 3D23A 2CXVA 1L4DA 1BJUA 2O8UA 3MU4A 1HBTH 2BOKA 1ESBA 3FFGA 1QNJA 2JH5D 3DUXH 4WJG2 1LQEA 3GCTG 3SHCH 4XD7D 3LT3A 3SJIA 3WW7A 3MO9A 1LVOA 4I32A 7GCHF 3TJVA 2DE9A 1FY8E 1YCPK 7ESTE 1BTZA 5L2YH 1TQ0B 2RG3A 1C1RA 3ZZ7A 1RGQA 2WV9A 1O5CB 1D4PB 4IC5A 3MQKC 3WWBA 2Y6TA 1BA8B 1OYQA 2FX4A 5C5OA 1MTNB 1UVSH 1ESAA 1VR1H 5HM2A 1GDUA 4ZXYH 2FOBA 1QBNA 4XDEA 5JYIA 3TGKE 4Y0ZE 2GJGA 4LOYH 1O5FH 1SBWA 3EA8A 1SGRE 2FTLE 3JZ2B 1K1NA 5E0GA 2V35A 2XW9A 2FOAA 3K6ZA 2M2AA 2TGPZ 3MH6A 3MNBA 4NIYA 2B0FA 2STBE 3GYMA 5I25A 3QGJA 2KM0A 1V6DA 1C1QA 1C1MA 2FI5E 3SGQE 4NGAH 5JDUB 5FXLA 3RP2A 5C67A 3K2UA 1NT1A 1O2SA 1FY5A 4Q4LA 5HYOA 2CHAC 4R0IA 3UUZA 3PM3A 4KKDA 2Z94A 4K8BA 1G2MA 5F53A 3PLPA 2FPZA 1YBWA 1FPHH 4MNXA 1J17T 2HPPH 3BEUA 1SOZA 1C9TA 2ZF0H 5JBAS 1DDJA 3BEIB 5A8XA 2GZ9A 3A83A 1UO6A 4KTUA 2A31A 4H6TA 5LPRA 4XBDA 3K9XB 2BDHA 1BBRE 1LHFH 5C20A 1A2CH 1TIOA 2QYIA 1Y3WA 2NWNA 4UD9H 4K1EA 1GVKB 4X8VH 1DSUA 2HLCA 4ISIH 2EI6A 3VXFH 3VPKA 2BM2A 5ETXA 4IMZA 3ODDA 4I8GA 2CHAB 1O34A 4I8KA 3SU6A 1ELTA 3M61U 4X8SH 4DT4A 1P03A 3GDSA 3GY7A 1B0EA 1TYNA 1OWDA 4A1XA 1KYNA 2BD8A 2C8XB 1NU9A 1TGSZ 1W7XH 5DP6A 4IGDA 3FP6E 3BV9B 1C2GA 1O2OA 1HAHH 4E05H 2AS9A 2OD3B 2Y5HA 3BTTE 4XBBA 3SBKA 5AFYH 1HXFH 4TWYA 1GBJA 2BY9X 1W10U 1HAVB 2SFAA 2GCTC 2VBCA 1LTOA 1E38B 2P3FH 3O8RA 3PLBA 5A8YA 1D6RA 4JZ1A 1P12E 2GCHF 2ZPRA 1MZAA 3BTWE 2GZ8A 2ANKH 3P6ZB 3R3GB 5AVDA 3UIRA 1E36B 5C0TA 1OX1A 1BBRH 2KX4A 4I8JA 4H6SB 5K7RA 4AX9H 1O35A 3ZV8A 4JYVH 1BTUA 1ABIH 1FAXA 1PPGE 1FY3A 3E1XB 4Y8ZA 3A8CA 1O39A 1A46H 3E3TA 4B71A 3O8BA 4E7NA 3D49H 2FYRA 1IQFA 1AWFH 1NBMD 2GCTB 1COWD 3HK3B 4NCYA 2G51A 3UWJH 1ELBA 1O2IA 3TNSA 2WINI 4A1VA 3A7ZA 2VJ1A 1BMMH 1OS8A 1BTWA 2TGDA 1J8AA 3R0FA 4BAKB 3SV9A 2O8LA 3NCLA 1DANH 1O3PB 1O2RA 1QQ4A 1A7SA 4WF8A 1MU6B 3LGUA 1KY9A 2R3UA 1P2MA 1ZGVA 5HXFA 2WHXA 2FOEA 4K8YA 2G4UA 3AK5A 2VVCA 4X0WU 3SN8A 1RTLA 2GMTC 2BZAA 4ZCNA 1UK3A 4OS6A 2G4TA 1GWAA 3LC3A 4CREA 3ZZ3A 4AOQA 1GMDG 5A8ZA 1W0ZU 2ZFTA 2WPKS 1LVYA 2ALPA 1GG6C 2ZGCA 1SHHB 1THRH 5T3HA 1YC0A 1IOEA 4R8TB 4X1NU 2RFKC 1J9CH 2Y7XA 2BQWB 8LPRA 3PMBB 1MU8B 1DY8A 1PPFE 5CMXH 1ZSKA 2QC2A 3M5OA 1AWHB 3HGPA 5F8ZA 1H1BA 2RA0A 1W0YH 2GP9B 3F1SB 3M5NA 1TOCB 1LHEH 2A7HA 3A7TA 3MNSA 4HI3A 3KNXA 4AORA 2ZHFH 2GMTB 2P94A 1A4WH 1WTHD 3T25A 1HGTH 1HB0B 5FAHA 1TGTA 1T32A 1K21H 2O8WA 4U32A 1EB2A 1GG6B 1OKXA 3S69A 1NC6A 4ABFA 5FL7D 3SU4A 3CENA 1Y3VA 4CBOA 3M3TA 3SU3A 4JK6A 4GCHG 1MBQA 1MABB 1UTJA 3MMGA 4Z0KA 2H9TH 4IN1A 3L6PA 1D3DB 4WVPE 3RM2H 1O2XA 1SOTA 4Y7BA 1PPCE 1EAWA 2Y81A 1KDQB 1WUNH 2OXSA 2UWOA 5EJLA 2BB4A 2YMSD 6GCHG 2XWBI 2JIZD 2IJOB 2AIQA 1A61H 3KQBA 2BXTH 3V3MA 2KR7A 1G2LA 4FUJA 4MDSA 4AG1A 1N1LA 1W2KH 2BVXH 1C2EA 3VB7A 4ZKRU 3VB3A 1NESE 4K60A 1SLWB 2W7UA 4YTAA 1O2YA 3F68H 3P8NA 2YMSC 2OTVA 5EQSA 4D7FA 1HFDA 1PYTD 1GBMA 4K5ZA 3SNBA 1EJAA 1HAZB 4CRAA 3L33A 2V0BA 1S0QA 4FU7A 1F92A 2ZWLH 3GS9A 1UHBA 5FPSA 4JZDH 2GGVB 1CA8B 3LIWA 3SZNA 4NIWA 4K1SA 2GT8A 3F9HA 2A45B 2FOCA 4Q7XA 3EDXB 1F5KU 4BAOB 1RFNA 3CS0A 1BRAA 5A0CA 4IC6A 1W8BH 1D6WA 1WU1A 4ZHLU 2ZFSA 1V2NT 1F0TA 1V2QT 3ATKA 2PV9B 2D8WA 4U30A 4ABIA 4RSPA 5GIBA 1O3IA 1ETTH 2WUBA 4PROA 1ZPZA 2YMSB 2BLOA 2C3SA 1GI6A 2BD9A 2BD3A 1HNEE 1UTPA 5TCCA 2IOTA 3TJOA 1T31A 2I6QA 3HKJB 1CHOF 1YGCH 1T8NA 1YPJH 3ZV9A 5A2MH 1HAGE 1ELDE 1YF4A 4INHA 3LC5A 3TJUA 2QIQA 3RU4T 3DHKH 3RXEA 1OP2A 4A92A 4NSYA 3GCTF 2G5NA 5KECA 2PUQH 2AGIX 3M3SA 2IJD1 5E0JA 4OM9A 1E35B 1UVOA 1C2HA 1SGDE 1NM6A 4YESB 2HRVA 1SQTA 3F9EA 4LXBH 3ZVCA 4LZ4B 2WPLS 1O2LA 2XTTB 3DCLA 4DCDA 1BRUP 3LU9B 4ISLA 3OTPA 1KXEA 3A88A 3PB1E 2EA3A 4UDWH 1Q3XA 2Q1JA 2ZZUH 1GMCG 3S9BA 2SGEE 2OP9A 1Y59T 3VB4A 1EB1H 2BD5A 4X1SU 1MCTA 3A84A 3F6UH 5C5NA 2PFEA 3AW0A 1GBFA 1XUIA 2G55A 1N6XA 1O33A 1SSXA 3ZZ9A 1OOKB 2H1UA 5L30H 5PTPA 1AHTH 2XBWA 1FI8A 4AFUA 2LPRA 4Q7YA 3F0PA 2VWLA 4FOUC 1Z6JH 1E37B 1FNIA 5DP9A 1YKTA 4F4OC 2QCYA 3LONA 4B74A 2YNAA 4Y71A 3H7TA 1IQGA 1YWUA 2ZG0H 3FZZA 5HIYA 1O3HA 4CRDA 2AMQA 5FCRA 1SHYA 1NN6A 2D2DA 3DFLA 1L1NA 4JZFH 4TWWA 4D8NA 5GDSH 5BPEA 1O5DH 5LPEA 3TIUA 1D3TB 3V0XA 3SNEA 1GL1A 1PQAA 1QRXA 2EC9H 2ZDLA 3TK5A 1Y3UA 4YO9A 3SNDA 2H6MA 2W6JD 4BAHB 2F9NA 2VH6A 2QV1A 1CSOE 3ZVBA 4YT7H 1Y5UT 3OAAD 2W26A 2J9NA 2G52A 2FX6A 1YPHE 1XUGA 3BIVH 3N7DA 5GNDA 4Y11E 5AFZH 3MOCA 3WWFA 1DT2A 1E1RD 5AHGH 1A5IA 3LH3A 2VU8E 1ZTJA 3A7YA 1W13U 1OHHD 1TNKA 1AMHA 1C2FA 3VGCC 4OS4A 5F03A 5H4IB 3FP7E 1BMLA 3QDZB 4MPWA 3KF2A 4YOGA 2C8WB 2F9PA 1AVWA 3URCA 1K22H 1VCQA 2J94A 2GTBA 1G3EA 1GI3A 1YY3A 1C1UH 3W94A 1LKAA 1G9IE 2FLBH 3MU8A 2EI8A 1OWJA 1AZZA 1LO6A 2PKAA 2G00A 2ZO3H 4XE4A 1S6LA 1PJPA 1HPGA 9LPRA 1C2IA 1CGIE 1UK4A 1LVMA 2W7SA 3KQ5A 3VGCB 2P8OC 2KCYA 5FX6A 1IHTH 1EPTA 1ZPBA 5IYTA 4CRFA 2AGGX 2ZU3A 2TRMA 2QE7D 1EASA 1F0SA 3A86A 1C5PA 2FEQH 4MVNA 2Z9JA 2QGRA 3SJ9A 1ZHMA 1RIWC 1XUFA 1KTTB 2BOHB 3MHWU 1QFKH 3ZVGA 4ABGA 1NFWA 3QTOH 3RLWH 1ZSJA 2VVUA 2R2WU 1DWEH 1SQAA 2ZTZA 4U2WA 3ZZAA 2VIPA 4GSOA 2P8OB 4WH6A 3BG4C 1RTFB 1DM4B 3NUMA 3NKKA 1YPLH 1MKXH 1XVMA 1EZXC 2WV5A 1UMAH 2YNBA 5HMAA 1GBBA 1DXWA 3ZZ6A 3Q3XA 1WYKA 5DJ7A 1MBMA 1P2NA 1P10A 1C5OH 1FIWA 1GJ6A 3ZZ4A 1DLEA 2Z7FE 5BRRE 2HGTH 3EA7A 1HAIH 1LMWB 1GMDF 3H7OA 2Z9KA 5EXNA 5ESTE 1O3DA 4BOHA 2K8IA 3KIDU 2Y82A 1P8VC 1RIWB 1TMTH 1QRZA 2ZKSA 1HJ9A 2O9QA 2WPHS 1P3EA 2XCNA 2OC1A 2A5AA 5C0UA 1FUJA 3QLPH 3SUDA 3UOUA 3H5CB 3JZ1B 4YLUA 1GI5A 1NFXA 2V6NA 1O2PA 5F6MA 3BG4B 1YPHC 4NFEA 1GCTC 2KCAA 4MG3A 4ZAEA 3M7TA 1QL9A 2FTMA 1AD8H 2P3UB 2ZGBH 4P02A 1GI9B 1QIXB 1V2OT 6LPRA 1S5SA 2F9OA 2VWNA 2HVYB 1QA7A 3MNCA 5DO4H 1UCYK 2XC0A 3QUMP 1UVTH 2ZQ1A 1W0JD 1LDTT 4ASUD 1PQ8A 1TOMH 1CGHA 1EAIA 2IPQX 2FWWA 1KLIH 3F2HA 2KAIA 1FQ3A 1IQHA 1S0RA 1WAYB 4GCHF 3AW1A 1O5GH 4AB8A 2JETC 3S9AA 4WH8A 1YLDA 5T6GA 2DUCA 2XC5A 4DY7B 2ODPA 2ZHQH 2K0QA 2BHGA 1ORFA 3SUFA 4ZMAH 3BEFB 1UJ1A 1F2SE 3DFJA 2LELA 1GCTB 3GY8A 4BXSA 6GCHF 2CGAA 1LKBA 2PKSC 4XBCA 1GHYH 3RXSA 3ITIA 1CE5A 1TE0A 4SGAE 2FLRH 2GVFA 1BOQA 3SGAE 2KCPA 1GI7B 3TH2H 3E0NB 1ELEE 1ZTKA 4X2YA 5B6LA 2NU2E 3SJOA 3WY8A 1DLKB 5JBBS 1TGBA 2PSXA 1S81A 1GJ9B 1BTYA 1O3AA 3E16B 3D62A 2LNCA 3ZIAD 2FIRH 2ZCLP 3LDXH 2F91A 3HPTB 1ZLRA 2JETB 2GZ7A 1EOLA 1NBME 1EAUA 1QR3E 2Z9IA 4UFEH 1GHVH 1EQ9A 3PWCA 1PQ5A 5DK1A 1QB6A 3AVZA 2P93A 2PKSB 2Z6BD 1HAPH 4DIHH 3SOSA 3M5MA 1HDTH 2A4GA 1AUTC 4TY6A 1Y3XA 1W14U 1SGIB 5DP8A 1MKXK 4HG6A 2RCEA 1DOJA 3HK6B 1E79D 1P9UA 3RXAA 4D9QA 5HKKD 4MPXA 2SGPE 1B7XB 3QX5H 1HJ8A 1O2GH 1KXBA 1O2JA 2BYAX 1A1RA 1BIOA 2ZDMA 1GCDA 2GDDA 3HATH 2VINA 4Y10E 1YLCA 1AGJA 1ARBA 2QXJA 1BCUH 1HXEH 4YXWD 2ZU2A 1G36A 3AAVA 1WCZA 1RD3B 2XXLA 2BDCA 3PLKA 2TGAA 1O2HA 2WZQA 3V7TA 4FETA 1BDAA 3PMAB 4AYYB 3BG8A 3CNRA 5E2PA 2ZQ2A 1KMHB 3LPRA 2Q6FA 5KEDA 1S83A 3F2GA 4I8HA 3T26A 3M3VA 1TPPA 2F9VA 1RXPA 2FOFA 3GCHC 4HTCH 4OS7A 3TK6A 1ELCA 1P2OA 2WV4A 3OSYA 2FS9A 3OX7U 4FUDA 3TU7H 2A1DB 4K3JA 2H9EH 4F49A 1D9IA 4BAMB 1MZDA 2BLQA 3BTEE 4J2YB 3QTVH 1W12U 2FYQA 2I6SA 3TPIZ 2J95A 3BTKE 3RXTA 1GJ4H 5JB8S 2ZDKA 1FN8A 3T27A 5F8XA 1GMCF 4GAWA 4IN2A 2UUKB 1ZPCA 2Z9GA 2ANMH 1ZRBA 4BNRA 4UONA 3BTFE 3ZVDA 1ELAA 3EGKH 5GCHG 2FP7B 3GCHB 1XVOA 1UW7A 2F9UA 2J38A 2F9BH 4X1QU 1VKYA 4B75A 3DD2H 2ILNA 2TPIZ 1BMFD 4CHAC 3BTQE 1NFUA 4O3TA 1MAXA 1HAYB 1CT4E 1O3KA 1K1MA 1PQ7A 4OS2A 2AH4X 3B9FH 4JYTA 2J98B 2VIVA 5FPTA 2FXRA 2H9HA 3A7XA 2TIOA 2G8TA 3MO3A 2WYGA 2CMYA 2PGBB 4ZH8A 3SW2B 2AFQB 4ESTE 1CGJE 1NRNH 2SGAA 2V3HH 4BTTB 4MNYA 1DITH 3A87A 2V3MA 1GHBG 1Z1JA 1SGYE 5EOKA 1AN1E 1O2TA 3FZDA 2ZCKP 4FUHA 2NU4E 5EU8A 3F9FA 1F7ZA 4BANB 3TGIE 3SUGA 4OGXA 2BVRH 3RXBA 1SGEE 5EQQA 3T5FH 1SMFE 4O9VA 4CHAB 1HIAB 1O2QA 2XRCA 1C5NH 2BD2A 2PW8H 5L6NH 1P2JA 1P0SH 2ASUB 3GY3A 1SGFA 4OS5A 1QHRB 4TYDA 4DVAU 3GYLB 1ANEA 3MYWA 3M36A 3CP7A 3RXJA 1L2EA 3FN8A 3SU2A 1OYTH 2BMGB 3BTME 1HAOH 1ZSLA 3T62A 1JOUB 1JIRA 1ESTA 3TH4H 3LGIA 4MQAA 4CR9A 5T6DA 1A3BH 2F83A 4X8TH 3VG8A 2BD7A 3P95A 4HZHA 4QT8C 1DICA 4ZXXH 2OQ5A 4YOIA 1MUEB 2PWXA 1TNGA 3NZIA 1IQJA 1GJAB 1FZZA 2EEKA 4HFPB 2CF9H 1P06A 5JB9S 2VH0A 3PROA 4WY3A 2UUJB 1B5GH 2Z9LA 1D3QB 1BBRK 5LPFA 3MU5A 1CT0E 3QZRA 3ZVAA 2ANYA 3SGBE 2ZTYA 2M5TA 1SFQB 3Q3KA 2J92A 1C4V2 1NFYA 4A6LA 3BTDE 2BDGA 1LQDB 2ANWA 1CBWC 1O5BB 3KYFA 4AFSA 1C5SA 1XXDA 1C1TA 3RXMA 1HRTH 2RA3A 1ZGIA 1TNHA 3CS7A 3RXUA 1BJVA 1W11U 4Y0YE 1KXDA 1DX5M 3LJJA 1V2UT 2XC4A 5EGMA 1HV7A 3MFJA 3T2NA 2B5TB 1FMGA 1V2JT 4OS1A 1C5VA 1K1PA 1ZHRA 4B2BA 1G37A 3KCGH 1JRSA 3H09A 2HVXA 1AE5A 3LGVA 1DUEA 1O37A 2BLWA 3PRDA 4THNH 2ZHWH 1XXFA 3C27B 4ZKOU 3GCNA 1PYTC 1TRYA 1J14A 3UQVA 4Q7ZA 4D9RA 1HAVA 1ZOMA 1O2ZA 1CBWB 1GBAA 2STAE 1ARCA 3GY2A 2ZFRH 2BDIA 5E0HA 2AERH 3A8DA 1CO7E 1HJAC 4ZUHA 1K28D 2NU0E 2DE8A 3A8AA 1C2LA 2FDAA 5C1XA 5GPIB 4MPVA 4WXVA 1H9HE 1Y8TA 2EQNA 1V2PT 4FUCA 4I33A 4AGJA 4GVUA 1INCA 1QJ7B 2ZGJA 3A82A 4IMQA 3UPEA 3W95A 5CE1A 1RS0A 3RU4D 1Z6EA 1EP6A 2ZTXA 1QTFA 2JDID 4KTCA 4AN7A 1L1JA 2GV6A 3KL6A 4F48B 5EPYA 5LGOA 1H8ED 3S7KB 4CRGA 1WBGB 4JZIA 4ZKNU 2BX3A 3T29A 1NROH 3RXLA 2G5VA 2QN5T 3ZZ8A 4ABHA 1YPKH 1C1SA 1GBHA 2UUYA 3SU5A 2FMJA 3SJKA 7KMEH 5T6FA 1FJSA 5A0AE 1HJAB 4NIXA 2NU3E 2A2QH 1Y5BT 2FOMB 1C4U2 1C5MD 1AIXH 2J98A 3TVJB 2C8YB 1YLNA 1DWBH 4NFFA 4B1TA 5IDKA 2ODQA 3SI3H 3QWCH 3P8FA 4H42U 4ZHMU 1H4WA 1O30A 1QJ1B 2IN2A 1DXPA 2HALA 1QB9A 4YT6H 1EATA 5TJXA 2ZDNA 1TNJA 1C1PA 2FOHA 4Z6AH 2HOBA 1GI1A 2ULLA 1PFXC 1C1WH 3GOVB 1BZXE 1TPOA 4SGBE 2FZZA 2O8MA 1DE7H 2WPIS 1TWXB 2CV3A 1FLEE 3RMNH 1GPZA 4ABEA 1Z8GA 3RXHA 3GDVA 1UK2A 3ATIA 3E90B 1K1LA 4K1TA 1B0FA 1OWEA 9ESTA 4RI0A 4ISHH 3VEQB 3E6PH 3BN9A 2V7QD 4YOJA 1ANDA 5EQRA 4AC9A 1U6QA 1MH0A 4D76A 1O3CA 2WPDD 2K1QA 1GJ5H 3IG6B 4WMDA 1C2DA 1FV9A 1QJ6B 1BTHH 4FU8A 2WPJS 1GDNA 2PP6A 3F2FA 1UCYE 1TLDA 3UREA 3SV7A 4WXIA 2A4QA 5SGAE 1C5ZB 3UNSA 5JBCS 3KEEA 3PTBA 1TALA 1DSTA 4UFFH 3HKIB 1YP9A 3M35A 5LH8A 1QL8A 3EYDA 1V2LT 4KELA 1QY6A 4RKJB 3SNCA 4DJZB 1QBVH 1LHDH 1Z8JB 1ELGA 3M7UA 1TFXA 1ZYOA 1BTXA 3O8CA 4ZKSU 1JIMA 1KDQA 4WMEA 1TMBH 2OC7A 3GICB 1BHXF 3B23B 4UFDH 4KP0A 2R2MB 5KGOA 3Q77A 4RT0A 1ZHPA 2WUCA 2VWMA 2ZDAH 4A5TS 4B76A 2FODA 2SNVA 2C93B 3ZVEA 1UTNA 3UFAA 5FHTA 1G3CA 1K1OA 1GHXH 1WSSH 3N99A 4XFQA 2RDEA 3RXCA 5EG4A 3RMMH 2HLDD 5B6OA 1XKBC 1YPEH 1OP8A 2ZC9H 1GBEA 1VITH 1CA0C 1C5QA 4AFZA 3RXQA 3K6YA 1VCPA 2R9PA 3BF6H 5EXMA 3ELAH 4O3UA 1LPKB 1NU7B 1AU8A 1ETSH 4CRCA 1P11E 1T8LA 3BIUH 4K2YA 8KME2 1NY22 1GVZA 2ZGHA 2BLVA 3GISB 2P3TB 5DKMA 1YCPH 2G81E 4X6PA 3OU0A 3E91A 1C5LH 4RN6A 4AB9A 2QAAA 4ZHAA 1LCYA 1ZZZA 3SJ8A 4AG2A 1TBRH 2FI3E 3I77A 2QF0A 4NZLA 3NPSA 4X6NA 2J2UA 1GJDB 1XUJA 4Q80A 3SV8A 5EW2H 1OPHB 1OP0A 1CA0B 1GBKA 3FANA 1N6YA 5GCHF 3SORA 4IS5A 1O2VA 1WXRA 3A8BA 1MKWH 2ALVA 2BDAA 8ESTE 2ZFPH 2AYWA 3RXKA 5EODA 1K2I1 1Q2WA 1TPAE 2SGFE 3MH7A 4XSKU 2VWOA 1GI2A 5EXLA 2GD4B 3OEED 3PWBA 4FUGA 1XMNB 1MMJN 4CH8B 2A32A 3LH1A 3S0NA 1VJAU 1EJMA 2BTCE 1SQRA 5ESBA 5EJ1A 1IQLA 1ZRKA 1IQMA 2ZI2H 1GHBF 3A81A 1P01A 3U8OH 2BZ6H 4OGYA 2BQ6B 1DPOA 1SLUB 2J97A 3GDUA 3PMHB 2A2XH 1FY1A 1GBLA 1E0FD 4KTSA 4RKOB 1E34B 3SYJA 3MI4A 4DW2U 1KXCA 3U1JB 5CDFE 1O3BA 1S82A 4U01A 4ABBA 2QY0B 3PV5A 1KLJH 5A0BA 2OLGA 1A0HB 3IITA 3PRBA 4VGCC 1X7AC 1L1GA 1JXPA 2EI7A 2J34A 3BSQA 1NRRH 1DVAH 3RM0H 3EE0B 2AIPA 3MWIU 1V2WT 3HGNA 4FXGH 3FOAA 1UTOA 4NSVA 1AE8H 4O03A 5C1YA 4D7GA 2XWAA 5F8TA 1TABE 2PR3A 4M7GA 1C2MA 1W7GH 3SHAH 4TPIZ 4IBLH 1UTMA 1F0UA 1TQ7B 5TCAA 4MLFB 3MNXA 1FY4A 1DS2E 3SI4H 3RMLH 2IPHA 2R3YA 3T28A 2BX4A 3C1KA 4ABAA 3UAIC 2SGQE 1TB6H 2A4RA 2R0LA 4GHQA 4CR5A 2H2ZA 1HAXB 5AF9H 4VGCB 3TJNA 5GXPA 2PSYA 4UEHH 3GY6A 3OY6U 1XUHA 4E06H 3N7EA 2V3OH 1AVGH 1ETRH 1Z8IB 1UVUH 1ID5H 2JH6D 1VJ9U 4HGCA 2TBSA 1PPHE 4DGJA 1AZ8A 4B6EA 3ZZ5A 8GCHG 3KN2A 3Q76A 5FCKA 1AKSB 2JH0D 2FOGA 2Z3CA 2KFWA 1GJBB 1MKWK 1Z1IA 1EAXA 4ISOA 1BMAA 2W5EA 5FX5A 1MD8A 1QQUA 4NA8A 1KXFA 1ELFA 1ZR0A 3TK9A 4INKA 2QF5A 3RC4A 1H8DH 1A0JA 2VIQA 3MO6A 2W6ID 1P09A 2GDEH 1Z8RA 1O32A 1V2TT 1GL0E 1EXFA 3KYGA 4B2AA 1W0KD 1O2UA 3EAJA 4BXWA 3M37A 3SUEA 5T1VA 3ATWA 2VIOA 1EUFA 2O8TA 5DP5A 1O3GA 4TT3D 2ZPSA 3RXRA 5IK2D 1AO5A 1G32B 5DG6A 3S9CA 3OY5U 1C5YB 1GI0A 3TLOA 2CN0H 3P8GA 2ZGXH 2OCVB 3UQOA 1G3DA 1O31A 2BDBA 1P04A 1K1JA 1O2MA 2P95A 5JPMH 2ZNKH 1YCPM 1SGTA
chains in the Genus database with same CATH topology
2Y5GA 3STJA 2A5IA 3VXEH 2A4OA 4MPUA 5JBTA 1W3CA 1P9SA 2XCFA 1DUAA 4X2XA 4LZ1H 1GDQA 5J4SA 1NRPH 1EZQA 1L0ZA 5FBEA 1HUTH 2ZPQA 1S85A 1Y3YA 4ABDA 2H5CA 1GGDC 4KGAA 1SFIA 3VB5A 4NWLA 1UHBB 3UNRA 1C1VH 2AMPA 1AFQC 4Y76A 1T4UH 4BAQB 1TRMA 2OUAA 1EZSC 1TGNA 3RDZA 1V2VT 3I78A 1FONA 4CH2B 2GT7A 2HNTE 3MU1A 3UWIA 1YPMH 1BQYA 5C2ZA 4DURA 1KSNA 2P16A 1MQ6A 4Q2KA 1RJXB 2SNWA 4H4FA 1TONA 2VB0A 1AB9C 1IQEA 1OXGA 1HYLA 3FP8E 1GGDB 3LJOA 3LGYA 1DWDH 1EJNA 1N8OC 1NS3A 1O3LA 2BQ7B 3L3TA 2A0QB 2JKHA 1AFQB 1MAYA 4JZEH 1BRBE 2HWLB 1XM1A 3KHVA 4INLA 2ZHEH 1H9IE 1J16A 1GBCA 3U1IB 1WQVH 4DIIH 4DT7B 3RXVA 3TH3H 2NU1E 1JWTA 3M5LA 1OWKA 3QZQA 3QK1A 3D65E 1C4Y2 1P3CA 1KXAA 3MH5A 4X6MA 1AB9B 1A3EH 1BUIA 1C2KA 2A7CA 1C5TA 4UFGH 1N8OB 5CHAC 4X1PU 3VFEA 4CBNA 1BRCE 3ZVFA 3SV2H 1C9PA 1MTVA 1SC8U 1SR5C 5DPAA 1MTSA 2ZU4A 1S84A 2QF3A 1AVXA 4WWYA 3SV6A 2C4FH 3ZZBA 1OWIA 1WQSA 1Z71A 2ESTE 5EPNA 4AGKA 1O36A 1P2IA 3SU0A 1C1NA 3LGWA 1QA0A 4FUEA 1P02A 1GMHG 1H9LB 1ANCA 1GHAG 2D26C 2Y7ZA 1IQKA 1VITG 5C1UA 2A7JA 3AAUA 3SQEE 1JRTA 1UVPA 2PTCE 3ZYEA 3NK8A 1K9OE 2FS8A 1O5AB 1BB0B 3RU4E 1DFPA 1IHSH 1O3EA 5CHAB 1AKSA 4NWKA 4BTIB 1QCPA 3V13A 1V2MT 2ZEBA 2VIDA 3G01A 3UY9A 3A7VA 5K0HA 1CU1A 3QN7A 1JBUH 3MU0A 1TMUH 1AQ7A 7GCHG 5E2OA 3A85A 1NZQH 3OYPA 1F5RA 1SL3A 3RMOH 1Z7KA 2VVVA 1BTPA 1KIGH 1RRKA 4CRBA 1Q31A 1XUKA 1BMNH 1M9UA 1O0DH 2Z3DA 2B9LA 3BTHE 4ZROA 3KQEA 1SGFG 1SPJA 2ZA5A 3KQCA 2HNTC 4NIVA 1G30B 1OWHA 2Y5FA 1WTGH 1TAWA 2AMDA 3U8TH 2QXIA 2W3KA 3OTJE 5HGGA 4AYVB 2OQUA 1EP5A 1SGNE 1CQQA 5FPYA 3U98H 4AZ2B 2OBOA 1QBOA 5DP4A 1P2QA 2XNIA 1HLTH 4Y8YA 2FESH 1PPZA 1SGPE 2AGEX 3Q3YA 2HNTF 1O5EH 3ZYDA 1IAUA 1EPTC 2ZFFH 3UNQA 3E0PB 3O8DA 1O2KA 1O2NA 3RUOA 1QGFA 3SO3A 3MH4A 4LK4A 1CT2E 1BITA 4JYUH 1RTKA 2FO9A 1AI8H 3ATMA 1S6FA 5DGJA 2PUXB 4MTBA 2BVSH 2H5DA 1FDPA 2PKAB 4FUFA 1VZQH 3RC5A 2CF8H 1SVPA 2XBVA 2W3IA 2OBQA 4IW4E 3RXFA 1C1OA 3KGPA 3S7HB 1P2KA 3N7OA 1MCVA 2UWLA 1JMOH 1SQOA 1ZJKA 2ZP0H 1TX8A 1EPTB 1ZMLA 1QL7A 3RXPA 4FVBA 3QO6A 3RLYH 3I29A 3MTYA 3TNTA 1GI8B 2FM2A 1T8MA 4XOJA 1TPSA 4Y7AA 1O3MA 1V3XA 3UTUH 4UE7H 3E8LA 1EKBB 1XKAC 1EOJA 3DT0H 3URDA 1TRNA 4A7IB 4K69A 1VCWA 2AEIH 1BT7A 2BDYA 1K1IA 1C2JA 1IQNA 3SNAA 2VGCC 4AFQA 1DWCH 2PHBA 1THSH 3UR6A 4FUIA 1QURH 4X8UH 3RXDA 2ZU1A 1TX7A 2TGTA 1SLVB 3LKWA 1GVLA 5L2ZH 3SQHE 2QXGA 1LHCH 2D1JA 4O97A 1AFEH 1LPGB 2BY7X 2GCHG 4WMFA 1FN6A 1A0LA 2ZDVH 4MNWA 1SI5H 3LOXA 3UOPA 5FBIA 5HM9A 4X2VA 3GCOA 7LPRA 1V2RT 2XYAA 1HIAA 5E8EH 8GCHF 2VGCB 2BY8X 3PV4A 3ATLA 1CHGA 2GX4A 3A80A 1C5XB 3P17H 3DA9B 1F0RA 3IWMA 3RXOA 1J15A 2HPQH 4GPGA 2ZECA 2Z3EA 4Y6DA 4A1TA 5GJ4B 4TPYA 1C5RA 2ZCHP 1F5LA 1SLXB 1KTSB 1GBTA 3NWUA 1WV7H 4X1RU 2A5KA 1MTUA 1THPB 2VIWA 3ZZCA 4FVDA 3STIA 2QXHA 1L4ZA 4X6OA 1GJ8B 2OC8A 4MNVA 2BD4A 2WYJA 2KAIB 3P70B 2WPMS 1GI4A 1TX6A 1FAKH 1TA6A 2XBXA 5DP3A 4YZUA 1WOFA 1NPMA 1TGCA 1T7CA 1TA2A 4I8LA 1ELVA 2ZHDA 1OSSA 1AY6H 1UTKA 3FAOA 3P8OA 1TBZH 3LGTA 1VGCC 1D3PB 4B2CA 1V2KT 4FUBA 1GJCB 3A7WA 1TNIA 2ZFQH 4DOQA 4FU9A 2GV7A 5EW1H 1BHXB 1A5HA 4B73A 1YYY1 5G4BA 5J4QA 3Q00A 4JMYA 2Q6DA 1O3JA 1T4VH 4DG4A 5DP7A 2UWPA 3FVFB 1O2WA 1SG8B 1NRSH 2BY6X 3BTGE 1YM0A 3B8JA 1LVBA 4ABJA 1FIZA 2B8OH 2CJIA 5GWZA 2SGDE 4Y79A 1FPCH 1QB1A 3EA9A 3EQ0H 4X2WA 1ANBA 1EZUC 4Y8XA 2ZIQH 1C5WB 1GJ7B 3U69H 1O3NA 1GBIA 2ZU5A 3K65B 4YLQH 4ISNA 1UCYH 1ZJDA 2XBYA 1YPGH 1AUJA 1VGCB 2F3CE 3SU1A 3GY5A 1S6HA 4NA7A 3ZZDA 3RXGA 1ZTLA 5I46H 2GKVE 1MD7A 1PPEE 3GY4A 2VNTA 3PO1C 3RC6A 3ODFA 1TBQH 1XX9A 2OC0A 1EX3A 3PYHA 4NZQA 6CHAC 1LPZB 1T8OA 1MQ5A 3PTNA 1DY9A 2PLXA 1FXYA 2Y80A 3KQDA 2P59A 4NG9H 2R0KA 4ASHA 5ABWA 1HCGA 2Q6GA 1CVWH 1MTWA 4I31A 3F9GA 4BTUB 3VB6A 4J1YA 3M7QA 1TNLA 1P57B 2PGQB 2BXUH 1ACBE 2OINA 6ESTA 4I7YH 1SB1H 1SGCA 3PO1B 2QA9E 4TY7A 2BY5X 1ABJH 1UTLM 4NA9H 1P05A 3ESTA 2B7DH 2RDLA 3TITA 3U9AH 6CHAB 2C8ZB 1O3FA 2FI4E 1H8IH 1SGQE 4GLYA 5A09A 1NTPA 1GBDA 1Y5AT 5C3NA 3TGJE 3AASA 1QRWA 3U8RH 1NO9H 4JK5A 3A89A 3ENSB 4JCNA 3UR9A 4GUXA 1G3BA 3P92A 1ZMNA 1KLTA 2ODYB 1NRQH 1LHGH 2J4IA 4GHTA 1GMHF 1GHAF 1V2ST 1IQIA 1C5UA 1A5GH 1O38A 1PPBH 1VITF 2UUFB 1GHZA 1O3OA 3QGNB 3V12A 2C90B 1UTQA 2THFB 3NXPA 2PTNA 3PMJA 4YM9A 1GHWH 1MTNC 1CHOG 4E7RG 1ZMJA 3RXIA 2YOLA 3D23A 2CXVA 1L4DA 1BJUA 2O8UA 3MU4A 1HBTH 2BOKA 1ESBA 3FFGA 1QNJA 2JH5D 3DUXH 4WJG2 1LQEA 3GCTG 3SHCH 3LT3A 3SJIA 3MO9A 1LVOA 4I32A 7GCHF 3TJVA 2DE9A 1FY8E 1YCPK 7ESTE 1BTZA 5L2YH 1TQ0B 2RG3A 1C1RA 3ZZ7A 1RGQA 1O5CB 1D4PB 4IC5A 2Y6TA 1BA8B 1OYQA 2FX4A 5C5OA 1MTNB 1UVSH 1ESAA 1VR1H 5HM2A 1GDUA 4ZXYH 2FOBA 1QBNA 4XDEA 5JYIA 3TGKE 4Y0ZE 4LOYH 1O5FH 1SBWA 3EA8A 1SGRE 2FTLE 3JZ2B 1K1NA 5E0GA 2V35A 2XW9A 2FOAA 3K6ZA 2TGPZ 3MH6A 3MNBA 4NIYA 2B0FA 2STBE 3GYMA 5I25A 3QGJA 1V6DA 1C1QA 1C1MA 2FI5E 3SGQE 4NGAH 5JDUB 5FXLA 3RP2A 5C67A 3K2UA 1NT1A 1O2SA 1FY5A 5HYOA 2CHAC 4R0IA 3UUZA 3PM3A 4KKDA 2Z94A 4K8BA 1G2MA 3PLPA 2FPZA 1YBWA 1FPHH 4MNXA 1J17T 2HPPH 3BEUA 1SOZA 1C9TA 2ZF0H 5JBAS 1DDJA 3BEIB 5A8XA 2GZ9A 3A83A 1UO6A 4KTUA 2A31A 4H6TA 5LPRA 4XBDA 3K9XB 2BDHA 1BBRE 1LHFH 5C20A 1A2CH 1TIOA 2QYIA 1Y3WA 2NWNA 4UD9H 4K1EA 1GVKB 4X8VH 1DSUA 2HLCA 4ISIH 2EI6A 3VXFH 3VPKA 2BM2A 5ETXA 4IMZA 3ODDA 4I8GA 2CHAB 1O34A 4I8KA 3SU6A 1ELTA 3M61U 4X8SH 1P03A 3GDSA 3GY7A 1B0EA 1TYNA 1OWDA 4A1XA 1KYNA 2BD8A 2C8XB 1NU9A 1TGSZ 1W7XH 5DP6A 4IGDA 3FP6E 3BV9B 1C2GA 1O2OA 1HAHH 4E05H 2AS9A 2OD3B 2Y5HA 3BTTE 4XBBA 3SBKA 5AFYH 1HXFH 4TWYA 1GBJA 2BY9X 1W10U 1HAVB 2SFAA 2GCTC 1LTOA 1E38B 2P3FH 3O8RA 3PLBA 5A8YA 1D6RA 4JZ1A 1P12E 2GCHF 2ZPRA 1MZAA 3BTWE 2GZ8A 2ANKH 3P6ZB 3R3GB 5AVDA 3UIRA 1E36B 1OX1A 1BBRH 4I8JA 4H6SB 5K7RA 4AX9H 1O35A 3ZV8A 4JYVH 1BTUA 1ABIH 1FAXA 1PPGE 1FY3A 3E1XB 4Y8ZA 3A8CA 1O39A 1A46H 3E3TA 4B71A 3O8BA 4E7NA 3D49H 2FYRA 1IQFA 1AWFH 2GCTB 3HK3B 4NCYA 2G51A 3UWJH 1ELBA 1O2IA 3TNSA 2WINI 4A1VA 3A7ZA 2VJ1A 1BMMH 1OS8A 1BTWA 2TGDA 1J8AA 3R0FA 4BAKB 3SV9A 2O8LA 3NCLA 1DANH 1O3PB 1O2RA 1QQ4A 1A7SA 4WF8A 1MU6B 3LGUA 1KY9A 2R3UA 1P2MA 1ZGVA 5HXFA 2FOEA 4K8YA 2G4UA 2VVCA 4X0WU 3SN8A 1RTLA 2GMTC 2BZAA 1UK3A 4OS6A 2G4TA 1GWAA 3LC3A 4CREA 3ZZ3A 4AOQA 1GMDG 5A8ZA 1W0ZU 2ZFTA 2WPKS 1LVYA 2ALPA 1GG6C 2ZGCA 1SHHB 1THRH 5T3HA 1YC0A 1IOEA 4R8TB 4X1NU 1J9CH 2Y7XA 2BQWB 8LPRA 3PMBB 1MU8B 1DY8A 1PPFE 5CMXH 1ZSKA 2QC2A 3M5OA 1AWHB 3HGPA 5F8ZA 1H1BA 2RA0A 1W0YH 2GP9B 3F1SB 3M5NA 1TOCB 1LHEH 2A7HA 3A7TA 3MNSA 4HI3A 3KNXA 4AORA 2ZHFH 2GMTB 2P94A 1A4WH 1WTHD 3T25A 1HGTH 1HB0B 5FAHA 1TGTA 1T32A 1K21H 2O8WA 4U32A 1EB2A 1GG6B 1OKXA 3S69A 1NC6A 4ABFA 3SU4A 3CENA 1Y3VA 4CBOA 3M3TA 3SU3A 4JK6A 4GCHG 1MBQA 1UTJA 3MMGA 4Z0KA 2H9TH 4IN1A 3L6PA 1D3DB 4WVPE 3RM2H 1O2XA 1SOTA 4Y7BA 1PPCE 1EAWA 2Y81A 1KDQB 1WUNH 2OXSA 2UWOA 2BB4A 6GCHG 2XWBI 2IJOB 2AIQA 1A61H 3KQBA 2BXTH 3V3MA 1G2LA 4FUJA 4MDSA 4AG1A 1N1LA 1W2KH 2BVXH 1C2EA 3VB7A 4ZKRU 3VB3A 1NESE 4K60A 1SLWB 2W7UA 4YTAA 1O2YA 3F68H 3P8NA 5EQSA 2OTVA 4D7FA 1HFDA 1PYTD 1GBMA 4K5ZA 3SNBA 1EJAA 1HAZB 4CRAA 3L33A 2V0BA 1S0QA 4FU7A 1F92A 2ZWLH 1UHBA 5FPSA 4JZDH 2GGVB 1CA8B 3LIWA 3SZNA 4NIWA 4K1SA 2GT8A 3F9HA 2A45B 2FOCA 4Q7XA 3EDXB 1F5KU 4BAOB 1RFNA 3CS0A 1BRAA 5A0CA 4IC6A 1W8BH 1D6WA 1WU1A 4ZHLU 2ZFSA 1V2NT 1F0TA 1V2QT 3ATKA 2PV9B 2D8WA 4U30A 4ABIA 4RSPA 5GIBA 1O3IA 1ETTH 2WUBA 4PROA 1ZPZA 2BLOA 2C3SA 1GI6A 2BD9A 2BD3A 1HNEE 1UTPA 5TCCA 2IOTA 3TJOA 1T31A 2I6QA 3HKJB 1CHOF 1YGCH 1T8NA 1YPJH 3ZV9A 5A2MH 1HAGE 1ELDE 1YF4A 4INHA 3LC5A 3TJUA 2QIQA 3RU4T 3DHKH 3RXEA 1OP2A 4A92A 4NSYA 3GCTF 2G5NA 2PUQH 2AGIX 3M3SA 5E0JA 1E35B 1UVOA 1C2HA 1SGDE 1NM6A 4YESB 2HRVA 1SQTA 3F9EA 4LXBH 3ZVCA 4LZ4B 2WPLS 1O2LA 2XTTB 4DCDA 1BRUP 3LU9B 4ISLA 1KXEA 3A88A 3PB1E 2EA3A 4UDWH 1Q3XA 2Q1JA 2ZZUH 1GMCG 3S9BA 2SGEE 2OP9A 1Y59T 3VB4A 1EB1H 2BD5A 4X1SU 1MCTA 3A84A 3F6UH 5C5NA 2PFEA 3AW0A 1GBFA 1XUIA 2G55A 1N6XA 1O33A 1SSXA 3ZZ9A 1OOKB 2H1UA 5L30H 5PTPA 1AHTH 2XBWA 1FI8A 4AFUA 2LPRA 4Q7YA 2VWLA 1Z6JH 1E37B 1FNIA 5DP9A 1YKTA 4F4OC 2QCYA 3LONA 4B74A 2YNAA 4Y71A 3H7TA 1IQGA 2ZG0H 3FZZA 1O3HA 4CRDA 2AMQA 5FCRA 1SHYA 1NN6A 2D2DA 3DFLA 1L1NA 4JZFH 4TWWA 4D8NA