1EPTA

Refined 1.8 angstroms resolution crystal structure of porcine epsilon-trypsin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
43
structure length
43
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORCINE E-TRYPSIN
publication title Refined 1.8 A resolution crystal structure of the porcine epsilon-trypsin.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Hydrolase (serine protease)
total genus 5
structure length 43
sequence length 43
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1994-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1eptA00
2A4RA 1O5CB 1UTOA 1LKAA 1V2VT 4NIXA 1AVWA 4BAHB 4Y8ZA 5HGGA 3A81A 1O3FA 2C8XB 1OWDA 5ABWA 3BTEE 2Z7FE 2TGTA 1C2IA 2ZGCA 5FBEA 4MDSA 2BLOA 1HAYB 4Y7BA 3VPKA 4PROA 4GPGA 3QGJA 1GHXH 2AIPA 2VWMA 3T25A 3TK6A 1BHXF 2XW9A 1H9HE 4GCHG 1P9UA 1W13U 1XMNB 2BD4A 5EXMA 2WPLS 1BBRH 1HAHH 1O37A 5GCHF 5EPYA 1O3HA 1EKBB 1AB9B 1CA8B 3GYLB 3D23A 5AHGH 2QXHA 2C8ZB 1JRSA 1FPHH 1V2ST 2ZPRA 1QJ7B 4VGCC 2O8LA 3BEFB 4XFQA 3ZZDA 1NZQH 1MCTA 1Y59T 1DITH 1SR5C 6GCHG 3UNQA 1HYLA 2JH0D 2FTLE 1MAYA 4CRBA 5C1XA 1C5SA 1G37A 1WQVH 2FOHA 1QRWA 3F9GA 3GY2A 1BITA 2BD8A 1CGJE 1ZSLA 2CMYA 1QB1A 1UHBA 5DP5A 1V2QT 4O3TA 4I8GA 1K22H 4D7FA 8KME2 4DURA 1Z71A 2PUXB 4Q7ZA 3M7QA 4GUXA 5F03A 3SU3A 1XUFA 2P8OB 1HAGE 2G52A 1M9UA 1OSSA 1KDQB 1WTGH 1ZHPA 1FJSA 4MG3A 1GJAB 3SV6A 3RXCA 1SOZA 2G81E 1AVGH 2BQ7B 3BEUA 5AVDA 2Q6FA 3ZV9A 1G2LA 3SV7A 1KY9A 3MOCA 1P06A 2VU8E 2BD2A 4WXVA 3ZVFA 3VB4A 3PV4A 2VGCC 1EPTC 3AW1A 2ANYA 1O2MA 2XWAA 2FI4E 2GGVB 3U9AH 1HIAB 4B74A 5ETXA 1DXWA 3RU4T 1E36B 1FLEE 1RFNA 1TMTH 4TPIZ 3S7KB 1Z8GA 1SQAA 1EZSC 2WINI 1MD7A 3GY6A 3RXRA 1KYNA 5EG4A 1VGCB 1V2WT 4MPUA 2BY9X 4FUCA 2GVFA 3KQEA 3LH1A 3OX7U 1DANH 4FUJA 2XYAA 3MTYA 1IQKA 1HRTH 4ABIA 2GMTC 4ZKNU 2HLCA 3VXEH 1QJ6B 3PLBA 1O2JA 1ZPBA 3SNEA 1C5OH 1SHYA 2J9NA 2BDCA 4BNRA 1DXPA 2C93B 3IWMA 4CR9A 1BTPA 1A0HB 1QGFA 5JB8S 4UONA 1AIXH 1HAVB 2K1QA 1T8NA 1ZSJA 1CO7E 2AMQA 5C20A 4WJG2 5DP9A 3TIUA 1D4PB 1CHOF 5CMXH 1OYTH 1C5WB 2BQ6B 2IJOB 1O2YA 2FS8A 4NZLA 1BMLA 1ELBA 1B0EA 1SLXB 1ZHRA 1QB6A 2PKSB 1IHTH 1HGTH 1QR3E 1P01A 2Y5FA 2V0BA 4IW4E 4CRGA 3MFJA 1T32A 1ZHMA 1MTNC 4YESB 2ZPSA 3KQCA 1V2KT 2KAIA 3D49H 1PPHE 4ZROA 2ZU4A 1CHOG 3DA9B 1O36A 3ATMA 8GCHG 2O8WA 1N6XA 5GIBA 5J4SA 3GYMA 1VJAU 4X2XA 4WH8A 1NC6A 4LK4A 1NFUA 1KXCA 3ZZ6A 1Y5AT 1XM1A 3S9CA 4X1RU 3TNSA 1ELGA 2VIOA 1CHGA 1QL8A 2R3UA 3P8GA 3ZZ9A 1C1OA 1EASA 1TOMH 3VB7A 1C2DA 3SZNA 1LQEA 1MBQA 1XUHA 2ODPA 3MU5A 1SGPE 1C1NA 4Y11E 1SBWA 4FUIA 1GI5A 3A80A 3WY8A 4AG2A 2EEKA 3UUZA 1GJ8B 4NCYA 5L30H 4O03A 5E0JA 2GD4B 5LGOA 4VGCB 3QZRA 1FAXA 4XBDA 3SHCH 1WOFA 4CBOA 1GMHF 2ZGJA 2FOFA 2ODQA 2ZCLP 4FUBA 1P05A 1LHDH 2VB0A 4XBBA 5LPEA 1HJAC 1A5IA 1T8MA 4ISOA 1DLEA 3FP7E 3QGNB 1LPKB 3ZVBA 3S0NA 3DUXH 5B6OA 3ENSB 1YPLH 3GCHB 1G32B 3MU8A 1SLWB 4KGAA 1AFQB 1TBRH 4ABEA 1BQYA 2F83A 2GZ9A 2CGAA 1H9IE 1Z8RA 2VNTA 3E3TA 3LPRA 2A4QA 2OUAA 2QXJA 3A7VA 3ATWA 3GY8A 1MKWK 3NXPA 4UD9H 1N8OC 4CRFA 1EP5A 1ARBA 3U8RH 3RXEA 1GBIA 5BRRE 5EXNA 1UK4A 1YCPM 5FXLA 1O3CA 2ALVA 2FOEA 3I78A 3SNDA 1P2OA 1S5SA 1TRMA 4OS2A 1V2RT 4MTBA 1GJCB 2ZDMA 4XE4A 1K21H 1E38B 3H7TA 2A7CA 4MPXA 3PMAB 2HRVA 1QCPA 3BTKE 1CGHA 1K1NA 2OD3B 3UNSA 1VITG 1HNEE 1GVZA 3SGAE 3TH3H 1KXFA 3SJOA 1FY3A 3RM0H 2GMTB 1ZOMA 1QNJA 4Q7XA 1LHGH 3PMJA 5K7RA 2BY8X 1N6YA 5FPTA 5DGJA 2EI8A 3SJ9A 1MBMA 2ZFFH 3ZVCA 4AOQA 1TNKA 4BOHA 3EDXB 1SLUB 1SGIB 2XTTB 2FWWA 1W2KH 4OS1A 5FAHA 1IOEA 3KQDA 1O31A 1GI1A 2CXVA 2FXRA 3BTQE 4I7YH 2F9BH 4DW2U 7GCHG 1EAUA 1QA7A 5A8XA 1EXFA 1LVYA 1QL9A 2Y6TA 4MNXA 2F3CE 4IMQA 1F7ZA 3BIUH 2Y82A 4CH2B 3S9BA 2FP7B 4Q80A 3QO6A 3SI3H 1HLTH 3GDUA 1VITH 1SL3A 3I77A 1MTNB 3E1XB 2I6QA 1TA6A 1MKXK 1NU9A 4OS7A 4ISIH 4ESTE 1C2KA 4D8NA 1BRAA 1HAZB 3RXIA 4A7IB 3UPEA 1GDQA 4JZFH 3QLPH 3A7YA 4A5TS 2FOAA 1FXYA 1SQOA 2PSXA 1G3CA 1K1MA 3K6YA 1E0FD 1GBBA 2WPKS 2Z9GA 3HKJB 4WMFA 4CRAA 1Z6JH 1JRTA 3PMHB 1LVBA 1GHBF 1ZSKA 2FYRA 4DG4A 1UTJA 3UTUH 1E34B 3EA8A 1A2CH 3H7OA 3ZVEA 1RRKA 2XWBI 3A8AA 1SC8U 1D3TB 2H1UA 3BTDE 4X1NU 1EATA 4NA9H 1WU1A 1XUGA 3PO1C 4OS6A 1ELAA 1BT7A 1L0ZA 1SMFE 1O3NA 3CENA 1GI8B 3BTGE 4E7RG 1LKBA 2VVVA 2H9TH 4LXBH 1DOJA 2F9OA 4A1TA 3PLKA 4NIVA 1DWEH 2BLWA 2XRCA 2AIQA 3GOVB 4FXGH 3RXBA 2G00A 1XUIA 2FYQA 1H1BA 5C2ZA 2G4TA 4CBNA 3E0PB 1BTZA 3MH7A 3RMLH 4MPWA 1QURH 1EB2A 1CQQA 2VVCA 3ZV8A 5TCAA 5HM9A 2CV3A 4BTIB 4INKA 3S69A 1TX6A 1Z7KA 1HJAB 4YLQH 1GBLA 3MYWA 3P17H 1QBVH 1GHYH 5I25A 4AN7A 1EP6A 4WVPE 3LGVA 1QB9A 3CS0A 4Y6DA 1YCPH 1GHWH 1CT0E 3UOUA 1UCYE 1CE5A 1SGTA 2IOTA 1Y3UA 1TRNA 2C8YB 1THRH 2ZCHP 3QK1A 2GV6A 1GMDF 2R3YA 1YPGH 1P02A 2PV9B 3SGQE 2SGQE 1OKXA 1H8IH 4K1EA 4QT8C 1W11U 4O97A 7LPRA 1PPBH 3GY4A 3M61U 1CA0C 1GMCF 1EB1H 3ODFA 1N8OB 1NN6A 5PTPA 1EX3A 1HIAA 3T62A 2BVRH 2ZG0H 3M5MA 2SFAA 5A0AE 1UVTH 3RMNH 4KELA 1YP9A 1GBHA 4JYUH 5GWZA 3MU1A 3S9AA 1G9IE 1V2JT 2H2ZA 4ZHAA 2C90B 3N7OA 1TABE 4XDEA 1ARCA 4Y71A 1MTUA 4B2BA 1P03A 2EA3A 3GICB 1QA0A 2Y81A 1HUTH 3L6PA 1O3OA 1TPOA 1SGCA 4BTTB 1S0RA 1SI5H 4O9VA 1ANCA 4ZAEA 2ZTXA 1TBZH 3SJ8A 1HBTH 3A89A 1GHAG 3C1KA 1GJDB 2QY0B 4RN6A 1D9IA 3M3TA 1L4ZA 3SW2B 2V35A 4OS5A 1MKXH 2PHBA 3LC5A 1F2SE 1Z6EA 3A82A 3QTVH 4Z6AH 3OTJE 1Z1IA 4MLFB 3ELAH 1SSXA 3S7HB 1NY22 1ZGIA 1ZPZA 4K3JA 4TYDA 1QIXB 2TIOA 5F8ZA 3TU7H 1A5HA 2Q6GA 4JZEH 1MQ5A 1AHTH 4ABJA 1UTLM 3QTOH 1PFXC 1GPZA 3G01A 3SV9A 2OINA 1WYKA 4ZXXH 3IITA 1L1JA 3DHKH 2ZFPH 2C4FH 4WH6A 4X2VA 4NIWA 1D6RA 2FI3E 1C1VH 1O5AB 1YPJH 4OGYA 1AKSB 3T5FH 1IQLA 3VB6A 2D8WA 1P12E 4K2YA 1ID5H 2ESTE 2W26A 8LPRA 1Y5UT 3RXLA 2ZDLA 5FCKA 4GCHF 1SB1H 3B23B 3D65E 1ANBA 1ETSH 2ZNKH 4FUDA 1C2MA 3OY6U 2BQWB 2VIWA 3RXFA 2WYGA 1AI8H 3BSQA 4NZQA 1UVOA 4X8UH 1BMNH 1DWDH 1O3LA 1AWHB 4YLUA 1LHEH 3LGTA 2Y80A 1TQ7B 3PO1B 1P2JA 1P3CA 2CJIA 2FPZA 2Z9IA 1TNGA 5GJ4B 1O5GH 1ABJH 1JMOH 2ZDNA 6GCHF 9LPRA 1A3BH 1BTYA 1O2LA 1O3IA 2CHAB 1SVPA 2OTVA 1FUJA 5C5NA 5J4QA 2OP9A 2ZEBA 1O3EA 3NCLA 2HALA 2IN2A 2PGQB 4ISNA 3RXOA 5JYIA 2R2WU 2Z9JA 3EE0B 1ZZZA 2ANKH 1YPEH 1QFKH 5A8ZA 3P8FA 3KQBA 4UFEH 1UVSH 3CP7A 4JZ1A 1F0SA 2Y5GA 1V6DA 5FX5A 2WPHS 3RP2A 1MTVA 1SFQB 4X6NA 3NUMA 4WF8A 1MQ6A 2QAAA 1TA2A 2O8MA 5DJ7A 4AYYB 2BDYA 2GZ8A 3Q3XA 1O2HA 1QHRB 1AO5A 2HVXA 1WTHD 2PGBB 4WXIA 1UJ1A 3GCHC 5EXLA 1ZTJA 4X8TH 1AFQC 5GPIB 1BA8B 1O2UA 2XNIA 1D3PB 2PW8H 2BDAA 1BBRE 3VB5A 1GCTC 2VIDA 1INCA 2ZU1A 3A85A 1EPTA 3DT0H 3U69H 1S6HA 4JYVH 3ZVGA 1ANDA 1DFPA 4NSYA 2Z9LA 1CA0B 5I46H 3U1IB 1GJ4H 2H5CA 1O2QA 3MH6A 1RJXB 4H6TA 1KTSB 5E8EH 2O8TA 2LPRA 2GCTB 4MNYA 1KXEA 2AYWA 3BTME 3RMOH 1EQ9A 3NWUA 1ZTLA 3O8RA 1C5TA 2FM2A 4M7GA 3NK8A 3W95A 4TY7A 1B7XB 2FIRH 3SU2A 3FZDA 1VR1H 2PKAA 2EI7A 3URDA 1TGNA 1NS3A 4AFZA 1FDPA 3SN8A 2QYIA 2Q6DA 3GDVA 3IG6B 1ZMJA 4UDWH 1O2VA 3LONA 3A7TA 4NGAH 4ZMAH 4CR5A 1EAWA 1P2MA 1GHZA 4INLA 5JPMH 1W10U 2W3IA 4TWYA 5HXFA 4AX9H 2EC9H 2BD7A 3K9XB 3RXTA 3V13A 3SHAH 3F68H 3LU9B 2RCEA 1EZUC 1UMAH 4YOGA 2I6SA 3JZ2B 5A0BA 1B0FA 3KF2A 2WV5A 4TWWA 3RC5A 3SQEE 1HCGA 3C27B 1BDAA 1ESBA 2NU3E 3RC4A 1OYQA 4K69A 2VIVA 1UK3A 4ISHH 1TGCA 2UWPA 8GCHF 4X6MA 3DFJA 1LTOA 2G4UA 1P3EA 2FLBH 3UQOA 3STIA 4IC5A 1PJPA 1TONA 1AU8A 3A88A 4IC6A 1WUNH 2FOCA 1Y3XA 2YNBA 3TJVA 1KLIH 1TNLA 1ZMNA 4YO9A 1TNJA 1TB6H 3RXAA 2Z3DA 1P8VC 1BMMH 3ZVAA 5DP3A 3LDXH 3LT3A 1SGQE 1C5YB 2XC4A 1EOLA 1E37B 3ZVDA 2BZ6H 2BYAX 1T7CA 1SOTA 4XSKU 5T6FA 1NT1A 4IMZA 2ZGHA 4Y79A 1IHSH 4ABBA 4DIHH 5JBTA 1MU8B 3MNBA 5AFYH 2GT7A 3M5OA 4Y7AA 4HGCA 1W7GH 3I29A 4XBCA 1TOCB 4MNWA 4Y0YE 3D62A 2TGPZ 2BX4A 1P9SA 2OQUA 5E0GA 2G5VA 1UTMA 1WCZA 2SNVA 5F6MA 1P2IA 3NZIA 4AGJA 1ZPCA 1ABIH 3F9EA 1CU1A 1LPGB 4B75A 7ESTE 1NRNH 2VINA 1NRSH 1O3DA 2AS9A 5EGMA 2BDGA 2GCHF 3A84A 1GG6C 3MHWU 4D76A 3PTBA 2BDIA 2OC1A 1C5UA 1GDUA 1AD8H 2PTNA 4ABAA 3NKKA 1GDNA 4DVAU 2QC2A 2TBSA 3U8OH 5DP7A 3SI4H 3RXMA 1T4UH 2Y7ZA 1O5FH 1YPHC 2Z9KA 5DKMA 1T8OA 1EOJA 1PPZA 2P59A 1UO6A 3GCNA 2GDEH 2UWOA 3MWIU 1P04A 1TX7A 4X2YA 3RDZA 2NWNA 4GSOA 5DP6A 1UVPA 1EUFA 1G3DA 2HGTH 4KKDA 2GCHG 3A7XA 3BV9B 2PFEA 1TPSA 1AUTC 1ZYOA 3RMMH 1W14U 1AY6H 1ESTA 1C1SA 1O35A 1O2WA 2XBWA 3M35A 1TPPA 4ABFA 3M3SA 4ASHA 4YZUA 2R0KA 3ESTA 1GGDB 1DUEA 2FODA 2ZDKA 1GCTB 1O30A 1JWTA 2J4IA 3V7TA 4Y8XA 5LPFA 3SUDA 4A1VA 2FDAA 4ZH8A 1C5QA 2Z94A 3U1JB 3UNRA 1C4U2 1OWKA 5JBAS 4U2WA 4E06H 1JXPA 1DS2E 1GJBB 1UTNA 1C1PA 3SJKA 3BTTE 1VITF 4U30A 5C5OA 4RKJB 3UWJH 2NU2E 1UHBB 1Z8IB 2TGAA 4B1TA 5AF9H 2BOHB 4TY6A 2HNTC 1A7SA 1O2RA 2WPJS 1THPB 5BPEA 2BXUH 2SGEE 1C2HA 3P8OA 3TH4H 2VWLA 2ILNA 1O3MA 2OC0A 2SGFE 1HAPH 1T4VH 3QDZB 1FY1A 1P2QA 4ISLA 4NFEA 9ESTA 1MU6B 3SQHE 2UWLA 3VGCB 1JIMA 1S85A 1GI9B 1K1JA 2ZTYA 3A8BA 1LPZB 3E16B 4DJZB 1Z8JB 2PWXA 7GCHF 2OC8A 3MNXA 1RTFB 4F49A 4F4OC 4JZIA 1TWXB 1PQAA 4OGXA 4A1XA 3RXVA 3Q00A 1KSNA 4RSPA 4Y10E 1BUIA 5DO4H 1LCYA 4AYVB 2B7DH 3M3VA 2BB4A 1KTTB 2IPHA 2P3TB 2F9VA 3ATLA 3E90B 3FZZA 5FX6A 4NSVA 4BTUB 4K8BA 1DPOA 2BY5X 4CHAC 1GJ7B 2STBE 1TBQH 1C5ZB 3RUOA 2FOMB 3SO3A 1C1TA 1S81A 1NRQH 2ZCKP 1O39A 1TNIA 3F9FA 3M36A 1A5GH 1A1RA 3K2UA 3LGWA 4NA7A 5C1YA 1OP2A 1IQFA 1D3DB 2BVSH 1MMJN 1QTFA 1DDJA 2A7HA 5FHTA 5H4IB 2JH5D 2R9PA 3RLWH 4A92A 4AB9A 1GBFA 1O2KA 5TCCA 1BRUP 1TPAE 1ZLRA 2Q1JA 5K0HA 5A09A 3E91A 4Y8YA 3LGIA 5E2PA 1BJVA 3HGPA 3LJJA 1Y8TA 5GDSH 1A3EH 3SU5A 2QXIA 4FUGA 3SBKA 1RD3B 1Y3VA 4HI3A 1YKTA 5JBBS 1S84A 2VJ1A 1NTPA 4OS4A 5EQQA 1J9CH 1AUJA 1V2OT 4K8YA 5FPSA 1SGRE 1SG8B 1V2UT 4GLYA 2HOBA 1YPKH 2A2QH 1XKAC 4X1QU 4I33A 4AZ2B 3EA7A 1TRYA 1FAKH 1QBOA 2B0FA 2CHAC 1QL7A 2KAIB 3BF6H 1IQMA 3MO3A 2F91A 2F9UA 1CGIE 1O2XA 1O5DH 4E7NA 5T6DA 1HFDA 1FY5A 3GY3A 1GG6B 1K1LA 3P6ZB 3QWCH 4B76A 4WWYA 1C1QA 1H9LB 3HKIB 1MTWA 2VVUA 2BVXH 4NWKA 1AN1E 4ABGA 4X2WA 1RS0A 5EPNA 1MKWH 5IDKA 4I8JA 1K9OE 1BTUA 4ZKSU 1L2EA 2Y5HA 2AFQB 1WQSA 4IBLH 2YOLA 3GY5A 1CBWC 3LGUA 4UE7H 4DY7B 5HMAA 1YF4A 2FOGA 3UOPA 1DT2A 1W8BH 3PTNA 1SFIA 1P09A 2C8WB 3GCTG 2FOBA 3LOXA 1N1LA 1KDQA 2SGDE 3A7WA 1OP8A 4SGBE 3T29A 1GWAA 1SHHB 1GI0A 1SGEE 1MH0A 2F9NA 4AFSA 3RU4D 3B9FH 3VXFH 4Q7YA 3ZYEA 3UWIA 1GL0E 1PPCE 3P92A 1DSUA 1A46H 4AGKA 3SU6A 3BN9A 3P8NA 1Q31A 1GJ5H 5C1UA 2UUKB 2R2MB 1CVWH 1TMBH 4MVNA 1K2I1 1DWBH 1ETRH 4H6SB 2JETC 3T2NA 1LHCH 3AW0A 2UUFB 3KL6A 1UK2A 1YGCH 4J1YA 2GCTC 2OBOA 2W7UA 1C9TA 1FIWA 1GHAF 3FANA 2ZU5A 1IQJA 1HJ9A 1Y3WA 1P2KA 3PYHA 2A5AA 1JOUB 1ZRKA 2ZF0H 6LPRA 4ZUHA 2V3HH 4JCNA 3TGKE 1O2TA 1F0TA 1BOQA 1O3JA 4J2YB 1FV9A 4GAWA 1DSTA 1A4WH 5HM2A 3E0NB 3FFGA 1A0JA 1GJ9B 1VCQA 2V6NA 3ZYDA 1GI7B 2SGPE 2A7JA 3ZZ4A 3GY7A 1OWHA 4ZHLU 1RTKA 3Q3YA 1HAVA 4O3UA 1FZZA 1S6FA 3UREA 1L1NA 2GKVE 5FCRA 1K1PA 5LH8A 3VEQB 1H4WA 1C5RA 1QQ4A 2XXLA 1F5LA 1IQGA 1O3AA 4FVBA 1LHFH 1T31A 2LNCA 2H9HA 4B2AA 3GCOA 1C9PA 4I8LA 1XVOA 2J2UA 3SJIA 1DUAA 3HK3B 2FI5E 1IQNA 1BJUA 2ZKSA 1TNHA 4CHAB 1JBUH 1TAWA 2ZGBH 2DUCA 2FESH 2P16A 2VIQA 6CHAC 2A0QB 1K28D 2BMGB 1TGBA 1FY4A 2G8TA 1O3BA 5T6GA 3GISB 2ZECA 2VIPA 3RXPA 2WPIS 4K5ZA 4U01A 3SOSA 5JDUB 1J14A 1AMHA 1DICA 4IGDA 1GBTA 2HPPH 1OP0A 1ZGVA 2ZHFH 4FU8A 4R8TB 2WUBA 4YOIA 1O2GH 2QIQA 2H5DA 4ZKOU 4FUFA 3A83A 2BY7X 1FONA 1LQDB 3TLOA 1BHXB 3AVZA 1BMAA 2A1DB 5C67A 1HDTH 2AMPA 3LH3A 2FX6A 1YPHE 5EQSA 2FMJA 1O38A 3PWCA 1Y5BT 1G2MA 3QX5H 3RXKA 1ELEE 1JIRA 1VZQH 3RXHA 4UEHH 1RXPA 3H5CB 3ATIA 5A0CA 1C1UH 3MU4A 1L4DA 2Y7XA 2P3FH 1DY9A 1WBGB 1GHVH 2QN5T 1Q2WA 3UFAA 1J15A 1AVXA 2QXGA 2V3OH 2WUCA 3W94A 1W0ZU 3M7UA 2QCYA 3UR6A 1PPGE 3SU0A 2STAE 5EU8A 5E2OA 1V2TT 2A2XH 1CBWB 2RA3A 4NFFA 2D26C 1PQ7A 1V2LT 1KXDA 1UTQA 1V2NT 5CHAB 2PR3A 2ZC9H 1QRXA 3PM3A 1V2PT 1DY8A 3HPTB 4MPVA 3SV8A 2RA0A 1O2PA 3A7ZA 8ESTE 2AERH 2OQ5A 1ZTKA 5DPAA 2CN0H 2Z3EA 2ZHDA 4B71A 4YM9A 2ZHEH 1AZZA 4FU7A 1AE5A 1O32A 2HNTE 3FP6E 2FTMA 2XCNA 3M7TA 1GGDC 1OXGA 1GBJA 2C3SA 2PUQH 1TGTA 2WPMS 5GCHG 1O3GA 1SGYE 2VH6A 3KN2A 1O2SA 1FNIA 1VCWA 2JETB 3LJOA 3SV2H 3A8CA 3V3MA 1J16A 2FEQH 2BY6X 1Q3XA 2JKHA 3TJUA 1ZR0A 1P2NA 4IS5A 3ZZAA 1FMGA 3V12A 3PB1E 1EZXC 1PQ8A 1SGFG 4BAOB 4RKOB 2NU4E 1F5KU 1W0YH 1GBAA 2A4OA 2DE8A 4WMEA 2WV4A 1H8DH 1BCUH 3BG4C 1GBKA 2ZQ2A 1CT4E 4WMDA 3VFEA 3O8DA 3MH4A 4ABHA 5DK1A 1GBEA 1O2OA 4I8HA 1YLCA 2BXTH 3SNAA 3EQ0H 4ABDA 1XUJA 3NPSA 3ZZ8A 2O8UA 4XOJA 2QGRA 3VGCC 2SGAA 2BLVA 2O9QA 4X0WU 3CS7A 2HWLB 4I31A 1WV7H 4IN1A 1C4Y2 5AFZH 3ZZCA 1W7XH 3A8DA 3RXQA 2BTCE 1TALA 1KXBA 4Q2KA 1ESAA 2JH6D 2AEIH 2D1JA 2Z3CA 1IQEA 3A86A 2PLXA 1KXAA 2ZA5A 2FO9A 6CHAB 4K1SA 4JMYA 1GBDA 3AASA 1V2MT 1U6QA 4KTSA 1GCDA 3ODDA 3O8BA 1PYTD 3BIVH 3EYDA 4H4FA 1O34A 3TITA 1BRCE 1XUKA 3Q76A 4HFPB 1FIZA 4BAQB 3K6ZA 1MAXA 2BD5A 1A61H 1NFYA 1O2ZA 1OWIA 1SGNE 1EJNA 2W5EA 3SNCA 1YBWA 5FPYA 4AB8A 1ORFA 5EQRA 1EJAA 3HATH 2ASUB 3TK5A 1GBMA 1D3QB 1EAXA 1F5RA 4X8VH 1FQ3A 1AFEH 2XBVA 4B73A 1NM6A 2OCVB 2ZTZA 3MO9A 1BIOA 1C5VA 1O5BB 3OY5U 1TE0A 5ESBA 4WY3A 1TIOA 1NO9H 1C5XB 1C2GA 3ZZBA 4CRCA 3TGIE 2ZDAH 1F0UA 4ZXYH 2CF8H 2GP9B 3EA9A 3EGKH 1KIGH 2UUJB 2W3KA 5L2ZH 4H42U 3OSYA 1YYY1 5EODA 2SNWA 1XKBC 2QF0A 4X1SU 2H6MA 4GHTA 2GTBA 1MUEB 2A45B 2VH0A 3RXJA 1HAXB 1C5NH 1HB0B 1ELFA 1Y3YA 4CH8B 5HYOA 1MZAA 1LDTT 5EW1H 1OWJA 2FZZA 1GI4A 1DVAH 1LVMA 1ETTH 1TQ0B 4SGAE 4FU9A 1TMUH 1ACBE 3JZ1B 3RXDA 7KMEH 2ZPQA 3E6PH 1ELCA 2G55A 2GDDA 4X8SH 1IQHA 6ESTA 1CSOE 1NRRH 1NRPH 1K1OA 1C4V2 1BTWA 1O0DH 1THSH 1MZDA 3EAJA 2BX3A 5JB9S 4UFGH 3PLPA 4D7GA 1ANEA 4UFDH 3DD2H 1XX9A 3M5LA 1TLDA 2PTCE 3QUMP 1UTPA 4NIYA 4DIIH 4AFQA 4THNH 4AFUA 1MD8A 1UCYK 1O3KA 1YC0A 2CF9H 1P10A 2F9PA 3ITIA 3K65B 2BDHA 2FX4A 1XXFA 3UQVA 1GMHG 3AAUA 1FN8A 3BTHE 4FUHA 3ZZ5A 1GL1A 1OPHB 3F9HA 3O8CA 3BTFE 4NWLA 5CE1A 1HXFH 4ZKRU 2QA9E 3PROA 3BG4B 5TJXA 3UR9A 1MTSA 4HZHA 2ZO3H 3M5NA 3U98H 1W12U 2GX4A 1RIWC 1C2EA 2VGCB 5FBIA 1EPTB 1GJ6A 3FVFB 1GBCA 2ZFTA 1YM0A 2AGGX 3TPIZ 1A0LA 3R3GB 4HTCH 4BAMB 2ALPA 1FN6A 2XC0A 1YCPK 1AWFH 1NROH 1SQTA 1BTXA 2BM2A 5F8XA 1IAUA 4JZDH 1KLTA 1TX8A 4K1TA 1ZJDA 2XC5A 1SPJA 2B9LA 2OC7A 3KIDU 3V0XA 1QRZA 1F0RA 3UIRA 2XBXA 2PKAB 1PYTC 2D2DA 1GI2A 2ZFQH 3ZZ3A 4LZ1H 1AKSA 1DWCH 2B5TB 2ODYB 2ANWA 3KHVA 2A5IA 2TGDA 1TYNA 4BANB 3A87A 3LKWA 4B2CA 2A5KA 3FP8E 4GVUA 4GHQA 5A2MH 3SUFA 3DFLA 1ELTA 2NU0E 1BRBE 4JK6A 2AH4X 3T28A 1FPCH 1BTHH 1FI8A 2RDLA 3LC3A 3MNSA 2AMDA 3VB3A 1V3XA 1ZJKA 1O33A 2HPQH 2XBYA 3HGNA 5F8TA 2P95A 3BTWE 3QZQA 1HXEH 1B5GH 1L1GA 2BDBA 2J38A 1OS8A 4KTCA 1FY8E 3SORA 1YPMH 1XXDA 2AGEX 3TJNA 3LIWA 1RGQA 1F92A 1C1WH 2J34A 3HK6B 3GDSA 3M37A 3RC6A 5LPRA 4X1PU 5ESTE 1SGDE 4BAKB 1SGFA 1VJ9U 1LMWB 4LZ4B 2ZQ1A 2J95A 1MCVA 2ZHWH 2ZU3A 3SU1A 1C2LA 3P95A 1W3CA 2ZFSA 4BXSA 3KNXA 2G5NA 2ZI2H 3RU4E 3PMBB 3GCTF 1DM4B 4YT6H 1UCYH 2A32A 3L3TA 3QN7A 5L2YH 1LVOA 2ZU2A 4E05H 1QQUA 2G51A 4AORA 3R0FA 3TVJB 1DX5M 1O5EH 1O2NA 3T27A 5T3HA 1C2JA 5EW2H 1DE7H 1GHBG 1EAIA 2THFB 4IN2A 1AQ7A 1C2FA 3U8TH 2W7SA 1AB9C 4KTUA 1EZQA 1E35B 4BXWA 5CHAC 1QJ1B 1NESE 2ZP0H 3SUGA 4A6LA 2PSYA 2A31A 3MNCA 1G3EA 1AE8H 2ZHQH 4INHA 4DT7B 1K1IA 1TGSZ 1S0QA 3KCGH 3LGYA 2ZIQH 3ZZ7A 1OX1A 5C3NA 4R0IA 1D6WA 1G3BA 2M5TA 2WYJA 3RXSA 5GXPA 2ZFRH 2YNAA 1NU7B 3TGJE 3Q3KA 3OU0A 4FUEA 3STJA 1X7AC 1NFWA 3SNBA 3MU0A 1YLDA 3TNTA 1VCPA 3RXGA 2NU1E 1BB0B 3OYPA 1P57B 1CT2E 1RTLA 2B8OH 3MO6A 4D9RA 1BBRK 3F1SB 3KEEA 4DOQA 3UY9A 1OOKB 2GV7A 3MMGA 2GZ7A 1C1MA 2P8OC 5A8YA 1HJ8A 1SLVB 2A4GA 2P93A 2ULLA 4JK5A 3BEIB 4TPYA 2FLRH 1GVKB 5DG6A 4YT7H 4MNVA 3MI4A 2ZWLH 1PQ5A 3MH5A 2AGIX 3B8JA 1HAOH 2P94A 1S82A 1RIWB 3P70B 1EJMA 3RLYH 2TRMA 2OXSA 4LOYH 1TFXA 1PPEE 1GMDG 1UTKA 2FS9A 4JYTA 1UVUH 1AGJA 4AG1A 1Z1JA 5JBCS 1WAYB 4DGJA 5G4BA 2BHGA 3AAVA 3KGPA 1G36A 2ZGXH 1GMCG 4I32A 1GVLA 5L6NH 2HNTF 4YTAA 4X6PA 2VWOA 1NPMA 1OWEA 2ANMH 1VGCC 2UUYA 2OBQA 3E8LA 2DE9A 5DP4A 4Z0KA 2GT8A 1GI3A 3RM2H 1ELDE 4ZHMU 2QV1A 2R0LA 4CREA 1ZMLA 2H9EH 2ZZUH 4DCDA 2EI6A 2BLQA 1P0SH 5E0HA 2RG3A 1LO6A 1QY6A 3SU4A 3TJOA 2BOKA 2QF3A 2J94A 3T26A 5SGAE 2P3UB 4Y76A 1J8AA 3L33A 4K60A 1WSSH 1HPGA 3TH2H 1BZXE 1C5MD 1HV7A 4KP0A 4CRDA 2Z6BD 3URCA 4D9QA 3SUEA 1O2IA 1KLJH 1XVMA 2ZDVH 4YOJA 4FVDA 1C5LH 4Y0ZE 5IYTA 2OLGA 1S83A 3BG8A 3PWBA 4MQAA 1IQIA 2PKSC 1G30B 3SGBE 3FAOA 1AZ8A 4NA8A 4I8KA 1J17T 1C5PA 3RXUA 4NG9H 5DP8A 2TPIZ 2VWNA 2BD3A 2XCFA 2J92A 3TK9A 1ELVA 4UFFH 1O3PB 4U32A 1GI6A 1QBNA 2BD9A 4X6OA 1P11E 1C1RA 1NFXA 2BZAA 1HAIH 3F6UH 3Q77A 5EOKA 3ATKA 1ZRBA 1PPFE 1DLKB 1T8LA
chains in the Genus database with same CATH superfamily
2A4RA 1O5CB 1UTOA 1YLNA 1LKAA 1V2VT 4NIXA 1AVWA 1FX0B 4BAHB 4Y8ZA 2OK5A 5HGGA 2QF4A 3A81A 1O3FA 3N99A 2C8XB 1OWDA 4ACBA 3BTEE 5ABWA 2Z7FE 2TGTA 1C2IA 2ZGCA 5FBEA 4MDSA 2BLOA 1HAYB 4Y7BA 3VPKA 4PROA 4GPGA 3QGJA 1GHXH 2KX4A 2AIPA 2VWMA 3T25A 3TK6A 1BHXF 2XW9A 1H9HE 4GCHG 1P9UA 1W13U 1XMNB 2BD4A 2KCOA 5EXMA 2WPLS 1BBRH 1HAHH 1O37A 5GCHF 5EPYA 1O3HA 1EKBB 1AB9B 1CA8B 3GYLB 3D23A 5AHGH 2QXHA 2C8ZB 1JRSA 1S6LA 1FPHH 1V2ST 2ZPRA 2WV9A 1QJ7B 4VGCC 2O8LA 3BEFB 4XFQA 3ZZDA 1NZQH 3EE7A 1MCTA 1Y59T 1DITH 1SR5C 5DN6D 6GCHG 3UNQA 1HYLA 2JH0D 2FTLE 1MAYA 4CRBA 5C1XA 1C5SA 1G37A 1WQVH 2FOHA 1QRWA 3F9GA 3GY2A 1BITA 2BD8A 1CGJE 1ZSLA 2CMYA 1QB1A 1UHBA 5DP5A 1V2QT 4O3TA 4I8GA 1K22H 4D7FA 8KME2 4DURA 1Z71A 2PUXB 4Q7ZA 3M7QA 4GUXA 5F03A 3SYJA 3SU3A 1XUFA 2P8OB 1HAGE 2G52A 1M9UA 1OSSA 1KDQB 1WTGH 1ZHPA 1FJSA 4MG3A 1GJAB 3SV6A 3RXCA 1SOZA 5CHBA 2G81E 1AVGH 2IPQX 2BQ7B 3BEUA 5AVDA 2Q6FA 3ZV9A 1G2LA 3SV7A 1KY9A 3MOCA 1P06A 2VU8E 2BD2A 4WXVA 3ZVFA 3VB4A 3PV4A 4YXWD 2VGCC 1EPTC 3AW1A 2ANYA 1O2MA 2XWAA 2FI4E 2GGVB 3U9AH 1HIAB 4B74A 5ETXA 2JJ2D 1DXWA 3RU4T 1E36B 1FLEE 1RFNA 1TMTH 4TPIZ 3S7KB 1Z8GA 1SQAA 1EZSC 2WINI 1MD7A 3GY6A 3RXRA 1KYNA 5EG4A 1E79D 1VGCB 1V2WT 3F3BA 4MPUA 2BY9X 4FUCA 2WZQA 2GVFA 3KQEA 3LH1A 3OX7U 1DANH 4FUJA 2XYAA 3MTYA 1IQKA 1HRTH 4ABIA 2GMTC 4ZKNU 2HLCA 3VXEH 1QJ6B 3PLBA 1O2JA 1ZPBA 3SNEA 1C5OH 1SHYA 2J9NA 2BDCA 4BNRA 1DXPA 2C93B 3IWMA 4CR9A 1BTPA 1A0HB 1QGFA 5JB8S 4UONA 1AIXH 1HAVB 2K1QA 1T8NA 1ZSJA 1CO7E 2AMQA 5C20A 4WJG2 2L6OA 5DP9A 3TIUA 1D4PB 4ZCNA 2LELA 1CHOF 3OEED 5CMXH 1OYTH 1C5WB 2BQ6B 2IJOB 1O2YA 2FS8A 4NZLA 1BMLA 1ELBA 1B0EA 1SLXB 1ZHRA 1QB6A 3ZIAD 2PKSB 1IHTH 1HGTH 1QR3E 1P01A 2Y5FA 2V0BA 4IW4E 4CRGA 3MFJA 1T32A 1ZHMA 1MTNC 4YESB 2ZPSA 3KQCA 1V2KT 2KAIA 3D49H 1PPHE 4ZROA 2ZU4A 1CHOG 3DA9B 1O36A 3ATMA 8GCHG 2O8WA 1N6XA 5GIBA 5J4SA 3GYMA 1VJAU 3F0PA 4X2XA 4WH8A 1NC6A 4LK4A 1NFUA 1KXCA 3ZZ6A 1Y5AT 1XM1A 3S9CA 4X1RU 3TNSA 1ELGA 2VIOA 1CHGA 1QL8A 2R3UA 3P8GA 3ZZ9A 1C1OA 1EASA 2JDID 1TOMH 3VB7A 1C2DA 3SZNA 1LQEA 1MBQA 3N7DA 1XUHA 2ODPA 3MU5A 1SGPE 1C1NA 4Y11E 1SBWA 3MQKC 4FUIA 1GI5A 3A80A 3WY8A 4AG2A 2EEKA 3UUZA 1GJ8B 4NCYA 5L30H 4O03A 5E0JA 2GD4B 5LGOA 4VGCB 3QZRA 1FAXA 4XBDA 3SHCH 1WOFA 4CBOA 1GMHF 2ZGJA 2FOFA 2ODQA 2ZCLP 4FUBA 1P05A 1LHDH 2VB0A 4XBBA 5LPEA 1HJAC 4OM9A 1A5IA 1T8MA 4ISOA 1DLEA 3FP7E 3QGNB 1LPKB 3ZVBA 3S0NA 3DUXH 5B6OA 3ENSB 1YPLH 3GCHB 1G32B 3MU8A 1SLWB 4KGAA 1AFQB 1TBRH 4ABEA 1BQYA 2F83A 3OTPA 2GZ9A 2CGAA 1H9IE 1Z8RA 2VNTA 3E3TA 3LPRA 2A4QA 2OUAA 2QXJA 3A7VA 3ATWA 3GY8A 1MKWK 3NXPA 4UD9H 1N8OC 4CRFA 1EP5A 1ARBA 3U8RH 3RXEA 1GBIA 5BRRE 5EXNA 1UK4A 1YCPM 5FXLA 1O3CA 2ALVA 2FOEA 3I78A 3SNDA 1P2OA 1S5SA 1TRMA 2F43B 4OS2A 1V2RT 4MTBA 4M9FA 1GJCB 2ZDMA 4XE4A 1K21H 1E38B 3H7TA 2A7CA 4MPXA 3PMAB 2HRVA 1QCPA 3BTKE 5EJLA 1CGHA 1K1NA 2OD3B 3UNSA 1VITG 1HNEE 1GVZA 3SGAE 3TH3H 1KXFA 3SJOA 1FY3A 3RM0H 2GMTB 1ZOMA 1QNJA 4Q7XA 1LHGH 3PMJA 5K7RA 2BY8X 1N6YA 5FPTA 3DSOA 5DGJA 2EI8A 3SJ9A 3CNRA 3SZEA 1MBMA 2ZFFH 3ZVCA 4AOQA 1TNKA 4BOHA 3EDXB 1SLUB 1SGIB 2XTTB 2FWWA 1W2KH 4OS1A 5FAHA 1IOEA 3KQDA 1O31A 1GI1A 2CXVA 2FXRA 3BTQE 4I7YH 2F9BH 1YY3A 4DW2U 7GCHG 1EAUA 1QA7A 2W6JD 5A8XA 1EXFA 1LVYA 1QL9A 2Y6TA 4MNXA 2F3CE 4IMQA 1F7ZA 3WWFA 3BIUH 2Y82A 4CH2B 3S9BA 2FP7B 4Q80A 3QO6A 3SI3H 1HLTH 3GDUA 1VITH 1SL3A 3I77A 1MTNB 3E1XB 2I6QA 1TA6A 1BMFD 1MKXK 1NU9A 4OS7A 4ISIH 4ESTE 1C2KA 4D8NA 1BRAA 1HAZB 3RXIA 4A7IB 3UPEA 1GDQA 4JZFH 3QLPH 3A7YA 2KFWA 2FOAA 1FXYA 1SQOA 2PSXA 1G3CA 1K1MA 4A5TS 3K6YA 1E0FD 1GBBA 2WPKS 2Z9GA 3HKJB 4WMFA 4CRAA 1Z6JH 1JRTA 3PMHB 1LVBA 1GHBF 1ZSKA 2FYRA 4DG4A 1UTJA 3UTUH 1E34B 3EA8A 1A2CH 3H7OA 3ZVEA 1RRKA 2XWBI 3A8AA 1SC8U 4B6EA 1D3TB 3WWBA 2H1UA 3BTDE 4X1NU 1EATA 4NA9H 1WU1A 1XUGA 3PO1C 4OS6A 1ELAA 1BT7A 1L0ZA 1SMFE 2LP6A 1O3NA 3CENA 1GI8B 3BTGE 4E7RG 1LKBA 2VVVA 2H9TH 4LXBH 1DOJA 2F9OA 4A1TA 3PLKA 4NIVA 1DWEH 2BLWA 2XRCA 2AIQA 3GOVB 4FXGH 3RXBA 2G00A 1XUIA 2FYQA 1H1BA 5C2ZA 2G4TA 4CBNA 3E0PB 1BTZA 3MH7A 3RMLH 4MPWA 1QURH 1EB2A 1CQQA 3PV2A 2VVCA 3ZV8A 5TCAA 5HM9A 2CV3A 4BTIB 4INKA 3S69A 1TX6A 1Z7KA 1HJAB 4YLQH 1GBLA 3MYWA 3P17H 5C94A 1QBVH 1GHYH 5I25A 4AN7A 1EP6A 4WVPE 3LGVA 1QB9A 2AHME 3CS0A 4Y6DA 1YCPH 1GHWH 1CT0E 3UOUA 1UCYE 1CE5A 1SGTA 2IOTA 3GS9A 1Y3UA 1TRNA 2C8YB 1THRH 2ZCHP 3QK1A 1H8ED 2GV6A 1GMDF 2R3YA 1YPGH 1P02A 2PV9B 2XOKD 2SGQE 3SGQE 1OKXA 1H8IH 4K1EA 4QT8C 1W11U 4O97A 7LPRA 1PPBH 3GY4A 3M61U 1CA0C 1GMCF 1EB1H 3ODFA 1N8OB 1NN6A 5PTPA 2WHXA 1EX3A 1HIAA 3T62A 2BVRH 2ZG0H 1KMHB 3M5MA 2KCYA 1SKYE 2L74A 1UVTH 2SFAA 5A0AE 3RMNH 4KELA 1YP9A 1GBHA 4JYUH 1E1QD 5GWZA 3MU1A 3S9AA 1G9IE 1V2JT 2H2ZA 4ZHAA 2C90B 3N7OA 1TABE 4XDEA 1ARCA 4Y71A 1MTUA 4B2BA 1P03A 2EA3A 3GICB 1QA0A 2Y81A 1HUTH 3L6PA 1O3OA 1TPOA 4AC9A 1SGCA 4BTTB 1S0RA 1SI5H 4O9VA 1ANCA 4ZAEA 2ZTXA 1TBZH 3SJ8A 1HBTH 3A89A 1GHAG 3C1KA 1GJDB 2QY0B 4RN6A 1D9IA 3M3TA 1L4ZA 3SW2B 2V35A 3FKSD 4OS5A 1MKXH 2PHBA 3LC5A 1F2SE 1Z6EA 3A82A 3QTVH 4Z6AH 3OTJE 1Z1IA 4MLFB 3ELAH 1SSXA 3S7HB 3OEHD 1NY22 1ZGIA 1ZPZA 4K3JA 4TYDA 1QIXB 2TIOA 5F8ZA 3TU7H 1A5HA 2Q6GA 4JZEH 1MQ5A 1AHTH 4ABJA 1UTLM 3QTOH 1PFXC 1GPZA 3G01A 3SV9A 2OINA 1WYKA 4ZXXH 3IITA 1L1JA 3DHKH 4FETA 2ZFPH 2C4FH 4WH6A 4X2VA 4NIWA 1D6RA 2FI3E 1C1VH 3F2FA 1O5AB 1YPJH 4OGYA 1AKSB 3T5FH 1IQLA 3VB6A 2D8WA 1P12E 1MABB 4K2YA 1ID5H 2ESTE 2W26A 2VBCA 8LPRA 1Y5UT 3RXLA 2ZDLA 5FCKA 4GCHF 1SB1H 3B23B 3D65E 1ANBA 1ETSH 1VKYA 2ZNKH 4FUDA 1C2MA 3OY6U 2BQWB 2VIWA 3RXFA 2WYGA 1AI8H 3BSQA 4NZQA 1UVOA 4X8UH 1BMNH 1DWDH 1O3LA 1AWHB 4YLUA 1LHEH 3LGTA 2Y80A 1TQ7B 3OFND 3PO1B 1P2JA 1COWD 2JJ1D 1P3CA 2CJIA 2FPZA 2Z9IA 1TNGA 5GJ4B 1O5GH 1ABJH 1JMOH 2ZDNA 3KYGA 6GCHF 9LPRA 5C0TA 5EIYA 1A3BH 1BTYA 1O2LA 2J98A 1O3IA 2CHAB 1SVPA 2OTVA 1FUJA 4P00A 5C5NA 5J4QA 2OP9A 2ZEBA 1O3EA 3NCLA 2HALA 2IN2A 5C0UA 2PGQB 4ISNA 3RXOA 5JYIA 2R2WU 2Z9JA 3EE0B 1ZZZA 2ANKH 1YPEH 4Q63A 1QFKH 5A8ZA 3P8FA 3KQBA 2KZ4A 4UFEH 1UVSH 3CP7A 4JZ1A 1F0SA 2Y5GA 1V6DA 5HIZA 5FX5A 2WPHS 3RP2A 1MTVA 1SFQB 4X6NA 3NUMA 4WF8A 1MQ6A 2QAAA 1TA2A 2O8MA 5DJ7A 4AYYB 2WPDD 2BDYA 2GZ8A 3Q3XA 1O2HA 1QHRB 1AO5A 2HVXA 1WTHD 2PGBB 4WXIA 1UJ1A 3GCHC 5EXLA 1ZTJA 4X8TH 1AFQC 5GPIB 1BA8B 1O2UA 2XNIA 1D3PB 2PW8H 2BDAA 1BBRE 3VB5A 1GCTC 2VIDA 1INCA 2ZU1A 3A85A 1EPTA 3DT0H 3U69H 1S6HA 4JYVH 3ZVGA 1ANDA 1DFPA 4NSYA 2Z9LA 1CA0B 5I46H 3U1IB 1GJ4H 2H5CA 1O2QA 3MH6A 1RJXB 4H6TA 1KTSB 5E8EH 2EY4C 2O8TA 2LPRA 2GCTB 4MNYA 1KXEA 2AYWA 3BTME 3RMOH 1EQ9A 3NWUA 1ZTLA 3O8RA 1C5TA 2V7QD 2FM2A 4M7GA 3NK8A 3KYFA 3W95A 4TY7A 1B7XB 2FIRH 3SU2A 3FZDA 2KR7A 1VR1H 2PKAA 2EI7A 3URDA 1TGNA 1NS3A 4AFZA 1FDPA 3SN8A 2QYIA 2Q6DA 3GDVA 3IG6B 1ZMJA 4UDWH 1O2VA 3LONA 3A7TA 1WXRA 4NGAH 4ZMAH 4CR5A 1EAWA 1P2MA 1GHZA 4INLA 5JPMH 1W10U 2W3IA 4TWYA 5HXFA 4AX9H 2EC9H 2BD7A 3K9XB 3RXTA 3V13A 3SHAH 3F68H 3LU9B 2RCEA 1EZUC 1UMAH 4YOGA 2I6SA 3JZ2B 5A0BA 1B0FA 3KF2A 2WV5A 4TWWA 3RC5A 3SQEE 1HCGA 3C27B 1BDAA 1ESBA 2NU3E 3RC4A 1OYQA 4K69A 2KM0A 2VIVA 1UK3A 4ISHH 2GJGA 1TGCA 2UWPA 8GCHF 4X6MA 3DFJA 1LTOA 2PP6A 2G4UA 1P3EA 2FLBH 3UQOA 3STIA 4IC5A 1PJPA 1TONA 1AU8A 3A88A 4IC6A 1WUNH 2FOCA 1Y3XA 2YNBA 3TJVA 1KLIH 1TNLA 1ZMNA 4YO9A 1TNJA 1TB6H 3RXAA 2Z3DA 1P8VC 1BMMH 3ZVAA 5DP3A 3LDXH 3LT3A 1SGQE 1C5YB 2XC4A 1EOLA 1E37B 2WSSD 3ZVDA 2BZ6H 2BYAX 1T7CA 1SOTA 4XSKU 5T6FA 1NT1A 4IMZA 2ZGHA 4Y79A 1IHSH 4ABBA 4DIHH 5JBTA 1MU8B 3MNBA 5T1VA 5AFYH 2GT7A 3M5OA 5IK2D 4Y7AA 4HGCA 1W7GH 3I29A 4XBCA 1TOCB 4MNWA 4Y0YE 3D62A 2TGPZ 2BX4A 1P9SA 2OQUA 5E0GA 2KCAA 2G5VA 1UTMA 1WCZA 2SNVA 5F6MA 1P2IA 3NZIA 4AGJA 1ZPCA 1ABIH 3F9EA 1CU1A 1LPGB 4B75A 7ESTE 1NRNH 1QZ8A 2VINA 1NRSH 1O3DA 2AS9A 5EGMA 2BDGA 2GCHF 4P02A 3A84A 1GG6C 3MHWU 4D76A 3PTBA 2BDIA 1C5UA 1GDUA 2OC1A 1AD8H 2PTNA 2V3MA 4ABAA 3NKKA 1GDNA 4DVAU 2QC2A 2TBSA 3N7EA 3U8OH 2HVYB 5DP7A 3SI4H 3RXMA 1T4UH 2Y7ZA 1O5FH 1YPHC 2Z9KA 5DKMA 1T8OA 1EOJA 1PPZA 2P59A 1UO6A 3GCNA 2GDEH 2UWOA 3MWIU 1P04A 1TX7A 3FN8A 4X2YA 3RDZA 5KEDA 2NWNA 4GSOA 5DP6A 1UVPA 1EUFA 1G3DA 2HGTH 4KKDA 2GCHG 3A7XA 3BV9B 2PFEA 1TPSA 1AUTC 1ZYOA 3RMMH 1W14U 1AY6H 1ESTA 1C1SA 1O35A 1O2WA 2XBWA 3M35A 1TPPA 4ABFA 3M3SA 4ASHA 4YZUA 2R0KA 3ESTA 1GGDB 1DUEA 2FODA 2ZDKA 1GCTB 1O30A 1JWTA 2J4IA 3V7TA 4Y8XA 5LPFA 3DSPA 3SUDA 4A1VA 2FDAA 2YMSB 1C5QA 4ZH8A 2Z94A 3U1JB 3UNRA 1C4U2 1OWKA 5JBAS 4U2WA 4E06H 1JXPA 1DS2E 1GJBB 1UTNA 1C1PA 3SJKA 3BTTE 1VITF 4U30A 5C5OA 4RKJB 3UWJH 2NU2E 1UHBB 1Z8IB 2TGAA 4B1TA 5AF9H 2BOHB 4TY6A 2HNTC 1A7SA 1O2RA 2WPJS 1THPB 5BPEA 2BXUH 2SGEE 1C2HA 3P8OA 3TH4H 2VWLA 2ILNA 1O3MA 2OC0A 1E1RD 3VG8A 2SGFE 1HAPH 1T4VH 3QDZB 1FY1A 1P2QA 4ISLA 4NFEA 9ESTA 1MU6B 3SQHE 2UWLA 3VGCB 1JIMA 1S85A 1GI9B 1K1JA 2ZTYA 3A8BA 5EJZA 1LPZB 3E16B 4DJZB 1Z8JB 2PWXA 7GCHF 2OC8A 3MNXA 1RTFB 4F49A 4F4OC 4JZIA 1TWXB 1PQAA 4OGXA 5GNDA 4A1XA 3RXVA 3Q00A 1KSNA 4RSPA 4Y10E 1BUIA 5DO4H 1LCYA 4AYVB 2B7DH 3M3VA 2BB4A 1KTTB 2IPHA 2P3TB 2F9VA 3ATLA 3E90B 3FZZA 5FX6A 4NSVA 4BTUB 4K8BA 1DPOA 2BY5X 3PV5A 4CHAC 1GJ7B 2STBE 1TBQH 1C5ZB 3RUOA 2FOMB 3SO3A 1C1TA 1S81A 1NRQH 2ZCKP 1O39A 1TNIA 3F0OA 3F9FA 3M36A 1A5GH 1A1RA 3K2UA 3LGWA 4NA7A 5C1YA 1OP2A 1IQFA 1D3DB 2BVSH 1MMJN 1QTFA 1DDJA 2A7HA 5FHTA 5H4IB 2JH5D 2R9PA 3RLWH 4A92A 4AB9A 1GBFA 1O2KA 5TCCA 1BRUP 1TPAE 1ZLRA 2Q1JA 5K0HA 5A09A 3E91A 4Y8YA 3LGIA 5E2PA 1BJVA 3HGPA 3LJJA 1Y8TA 5GDSH 1A3EH 3SU5A 2QXIA 4FUGA 5KECA 3SBKA 1RD3B 1Y3VA 4HI3A 1YKTA 5JBBS 1S84A 2VJ1A 1NTPA 4OS4A 5EQQA 1J9CH 1AUJA 1V2OT 4K8YA 5FPSA 1H8HD 1SGRE 1SG8B 1V2UT 4GLYA 2HOBA 1YPKH 2A2QH 1XKAC 4X1QU 4I33A 4AZ2B 4Z1MD 3EA7A 1TRYA 1FAKH 1QBOA 2B0FA 2CHAC 1QL7A 2KAIB 3BF6H 1IQMA 3MO3A 2F91A 2F9UA 1CGIE 1O2XA 1O5DH 4E7NA 5T6DA 1HFDA 1FY5A 3GY3A 1GG6B 3NRLA 1K1LA 3P6ZB 3QWCH 1NBMD 4B76A 4WWYA 1C1QA 5CDFE 1H9LB 3HKIB 1MTWA 2VVUA 2BVXH 4NWKA 1AN1E 4ABGA 4X2WA 1RS0A 5EPNA 1MKWH 5IDKA 4I8JA 1K9OE 1BTUA 4ZKSU 1L2EA 2Y5HA 2AFQB 1WQSA 4IBLH 2YOLA 3GY5A 1CBWC 3LGUA 4UE7H 4DY7B 5HMAA 1YF4A 2FOGA 3UOPA 1DT2A 1W8BH 3PTNA 1SFIA 1P09A 2IJD1 2C8WB 3GCTG 2FOBA 3LOXA 1N1LA 1KDQA 2SGDE 3A7WA 1OP8A 4SGBE 3T29A 1GWAA 5KGOA 1SHHB 1GI0A 1SGEE 1MH0A 2F9NA 4AFSA 3RU4D 3B9FH 3VXFH 4Q7YA 3ZYEA 3UWIA 1GL0E 1PPCE 3P92A 1DSUA 1A46H 4AGKA 3SU6A 3BN9A 3P8NA 1Q31A 1GJ5H 5C1UA 2UUKB 2K0QA 2R2MB 1CVWH 1TMBH 4MVNA 1K2I1 1DWBH 1ETRH 4H6SB 2JETC 3T2NA 1LHCH 2YMSD 3AW0A 2UUFB 3KL6A 1UK2A 1YGCH 4J1YA 2GCTC 4XD7D 2OBOA 2W7UA 1C9TA 1FIWA 1GHAF 3FANA 2ZU5A 1IQJA 1HJ9A 1Y3WA 1P2KA 5F53A 3PYHA 2A5AA 1JOUB 1ZRKA 2ZF0H 6LPRA 4ZUHA 2V3HH 4JCNA 3TGKE 1O2TA 1F0TA 1BOQA 1O3JA 4RI0A 4J2YB 1FV9A 4GAWA 1DSTA 1A4WH 2J97A 3PRDA 5HM2A 3E0NB 3FFGA 5C17A 1A0JA 1GJ9B 1VCQA 2V6NA 2QF5A 3ZYDA 1GI7B 2SGPE 2A7JA 3ZZ4A 3GY7A 4HG6A 1OWHA 4ZHLU 1RTKA 3Q3YA 1HAVA 4O3UA 1FZZA 1S6FA 3UREA 4F55A 1L1NA 2GKVE 5FCRA 1K1PA 5LH8A 3VEQB 1H4WA 1C5RA 1QQ4A 2XXLA 1F5LA 1IQGA 1O3AA 4FVBA 1LHFH 1T31A 2LNCA 2H9HA 4B2AA 4Q4LA 3GCOA 1C9PA 4F48B 4I8LA 1XVOA 2J2UA 3SJIA 1DUAA 3HK3B 2FI5E 1IQNA 1BJUA 2ZKSA 1TNHA 4CHAB 1JBUH 1TAWA 2ZGBH 2DUCA 2FESH 2P16A 2VIQA 6CHAC 2A0QB 1K28D 2BMGB 1TGBA 1FY4A 2G8TA 1O3BA 5T6GA 3GISB 2ZECA 2VIPA 3RXPA 2WPIS 4K5ZA 2RDEA 4U01A 3SOSA 5JDUB 1J14A 1AMHA 1DICA 4IGDA 1GBTA 2HPPH 1OP0A 1ZGVA 2ZHFH 4FU8A 4R8TB 2WUBA 4YOIA 1O2GH 2QIQA 2H5DA 4ZKOU 4FUFA 3A83A 2BY7X 1FONA 1LQDB 3TLOA 1BHXB 3AVZA 1BMAA 2A1DB 5C67A 1HDTH 2AMPA 3LH3A 2FX6A 1YPHE 5EQSA 3W1EA 2FMJA 1O38A 3PWCA 1Y5BT 1G2MA 3QX5H 3RXKA 1ELEE 1JIRA 1VZQH 3RXHA 4UEHH 1RXPA 3H5CB 3ATIA 5A0CA 1C1UH 3MU4A 1L4DA 2Y7XA 2P3FH 1DY9A 1WBGB 1GHVH 2QN5T 1Q2WA 3UFAA 1J15A 2QE7D 1AVXA 2QXGA 2V3OH 2WUCA 3W94A 1W0ZU 3M7UA 2QCYA 3UR6A 1PPGE 3SU0A 2STAE 5EU8A 5E2OA 1V2TT 2A2XH 1W0JD 1CBWB 2RA3A 4NFFA 2D26C 1PQ7A 1V2LT 1KXDA 1UTQA 1V2NT 5CHAB 2PR3A 2ZC9H 1QRXA 3PM3A 1V2PT 1DY8A 3HPTB 4MPVA 3SV8A 2RA0A 1O2PA 3WW7A 5B6LA 3A7ZA 8ESTE 2AERH 2OQ5A 1ZTKA 5DPAA 2CN0H 2Z3EA 2ZHDA 4B71A 4YM9A 3F2GA 2ZHEH 1AZZA 4FU7A 1AE5A 1O32A 2HNTE 3FP6E 2FTMA 2XCNA 3M7TA 1GGDC 1OXGA 1GBJA 2C3SA 2PUQH 1TGTA 2WPMS 1K0HA 5GCHG 1O3GA 1SGYE 2VH6A 3F2HA 3KN2A 2W6ID 2YMSC 1O2SA 1FNIA 1VCWA 2JETB 3LJOA 3SV2H 3A8CA 3V3MA 1J16A 3AK5A 2FEQH 2BY6X 1Q3XA 2JKHA 3TJUA 1ZR0A 1P2NA 4IS5A 3ZZAA 1FMGA 3V12A 3DSGA 3PB1E 1EZXC 1PQ8A 1SGFG 4BAOB 4I86A 4RKOB 2NU4E 1F5KU 1W0YH 1GBAA 2A4OA 2DE8A 4WMEA 2WV4A 1H8DH 4FOUC 1BCUH 3BG4C 1GBKA 2ZQ2A 3PRBA 1CT4E 4WMDA 3VFEA 3O8DA 3MH4A 4ABHA 5DK1A 1GBEA 1O2OA 4I8HA 1YLCA 2BXTH 3SNAA 3EQ0H 4ABDA 1XUJA 3NPSA 3ZZ8A 2O8UA 4XOJA 2QGRA 3VGCC 1SQRA 2SGAA 2BLVA 2O9QA 4X0WU 3CS7A 2HWLB 4I31A 1WV7H 4IN1A 1C4Y2 5AFZH 3ZZCA 1W7XH 3A8DA 3RXQA 2BTCE 1TALA 1KXBA 4Q2KA 1ESAA 2JH6D 2AEIH 2D1JA 2Z3CA 1IQEA 3A86A 2PLXA 1KXAA 2ZA5A 2FO9A 6CHAB 4K1SA 4JMYA 1GBDA 3AASA 1V2MT 1U6QA 4KTSA 1GCDA 3ODDA 3O8BA 1PYTD 3BIVH 3EYDA 4H4FA 1O34A 3TITA 1BRCE 1XUKA 3Q76A 4HFPB 1FIZA 4BAQB 3K6ZA 1MAXA 2BD5A 1A61H 1NFYA 1O2ZA 1OWIA 1SGNE 1EJNA 2W5EA 3SNCA 1YBWA 5FPYA 4AB8A 1ORFA 5EQRA 1EJAA 3HATH 2ASUB 1OHHD 3TK5A 1GBMA 1D3QB 1EAXA 1F5RA 4X8VH 1FQ3A 1AFEH 2XBVA 4B73A 1NM6A 2OCVB 2ZTZA 3MO9A 1BIOA 1C5VA 1O5BB 3OY5U 5DSFA 1TE0A 5ESBA 4WY3A 1TIOA 1NO9H 1C5XB 1C2GA 3ZZBA 4CRCA 3TGIE 2ZDAH 4B6FA 1F0UA 4ZXYH 2CF8H 2GP9B 3EA9A 3EGKH 1KIGH 2UUJB 2W3KA 5L2ZH 4H42U 1UW7A 3OSYA 1YYY1 5EODA 2SNWA 1XKBC 2QF0A 4X1SU 2H6MA 4GHTA 2GTBA 1MUEB 2A45B 2VH0A 3RXJA 1HAXB 1C5NH 1HB0B 1ELFA 1Y3YA 2M2AA 4CH8B 5HYOA 1MZAA 1LDTT 5EW1H 1OWJA 2FZZA 1GI4A 1DVAH 1LVMA 1ETTH 1TQ0B 4SGAE 4FU9A 1TMUH 1ACBE 3JZ1B 3RXDA 7KMEH 2ZPQA 3E6PH 1ELCA 2G55A 2GDDA 4X8SH 1IQHA 6ESTA 1CSOE 4RT0A 2JIZD 1NRRH 1NRPH 2J98B 1K1OA 1C4V2 1BTWA 1O0DH 1THSH 1MZDA 3EAJA 5EJ1A 2BX3A 5JB9S 4UFGH 3PLPA 4D7GA 1ANEA 4UFDH 3DD2H 1XX9A 2RFKC 3M5LA 1TLDA 2PTCE 3QUMP 1UTPA 4NIYA 4DIIH 4AFQA 4THNH 4AFUA 1MD8A 1UCYK 1O3KA 1YC0A 2CF9H 1P10A 2F9PA 3ITIA 3K65B 2BDHA 4RT1A 2FX4A 1XXFA 3UQVA 1GMHG 3AAUA 1FN8A 3BTHE 4FUHA 3ZZ5A 1GL1A 1OPHB 3F9HA 3O8CA 3BTFE 4NWLA 5CE1A 1HXFH 4ZKRU 2QA9E 3PROA 3BG4B 5TJXA 3UR9A 1MTSA 4HZHA 2ZO3H 3M5NA 3U98H 1W12U 2GX4A 1RIWC 1C2EA 2VGCB 3OAAD 5FBIA 1EPTB 1GJ6A 3FVFB 1GBCA 2HLDD 2ZFTA 1YM0A 2AGGX 3TPIZ 1A0LA 3R3GB 4HTCH 4BAMB 2XNDD 2ALPA 1FN6A 2XC0A 3FOAA 1YCPK 1AWFH 1NROH 1SQTA 1BTXA 2BM2A 5F8XA 1IAUA 4JZDH 1KLTA 1TX8A 4K1TA 1ZJDA 2XC5A 1SPJA 3UB0A 2B9LA 1YWUA 2OC7A 3KIDU 3V0XA 1QRZA 1F0RA 3UIRA 4ASUD 2XBXA 2PKAB 1PYTC 2D2DA 1GI2A 2ZFQH 3ZZ3A 4LZ1H 1AKSA 1DWCH 2B5TB 2ODYB 2ANWA 3KHVA 2A5IA 2TGDA 1TYNA 4BANB 3A87A 3LKWA 4TSFD 4B2CA 2A5KA 3FP8E 4GVUA 4GHQA 5A2MH 3SUFA 3DFLA 1ELTA 2NU0E 1BRBE 4JK6A 3UAIC 2AH4X 3T28A 1FPCH 1BTHH 1FI8A 2RDLA 3LC3A 3MNSA 2AMDA 3VB3A 1V3XA 1ZJKA 1O33A 2HPQH 2XBYA 3HGNA 5F8TA 2P95A 3BTWE 3QZQA 2K8IA 1HXEH 1NBME 1B5GH 1L1GA 2BDBA 2J38A 1OS8A 4KTCA 1FY8E 3SORA 1YPMH 1XXDA 2AGEX 3TJNA 3LIWA 4XRNA 1RGQA 1F92A 1C1WH 2J34A 3HK6B 3GDSA 5FL7D 3M37A 3RC6A 5LPRA 4X1PU 2CK3D 5ESTE 1SGDE 4BAKB 1SGFA 1VJ9U 1LMWB 4LZ4B 2ZQ1A 2J95A 1MCVA 5HKKD 2ZHWH 2ZU3A 3SU1A 1C2LA 3P95A 1W3CA 2ZFSA 4BXSA 3KNXA 2G5NA 2ZI2H 3RU4E 3PMBB 3GCTF 1DM4B 4YT6H 1UCYH 2A32A 3L3TA 3QN7A 5L2YH 1LVOA 2ZU2A 4DT4A 4E05H 1QQUA 2G51A 4AORA 3R0FA 3TVJB 1DX5M 1O5EH 1O2NA 3T27A 5T3HA 1C2JA 5EW2H 1DE7H 1GHBG 1EAIA 2THFB 4IN2A 1AQ7A 1C2FA 3U8TH 2W7SA 1AB9C 4KTUA 1EZQA 1E35B 4BXWA 5CHAC 1QJ1B 1NESE 2ZP0H 3SUGA 4A6LA 2PSYA 3OE7D 2A31A 3MNCA 1G3EA 1AE8H 2ZHQH 4INHA 4DT7B 1K1IA 1TGSZ 1S0QA 3KCGH 3LGYA 2ZIQH 2F4LA 3ZZ7A 1OX1A 2EQNA 3KQ5A 2KCPA 5C3NA 4R0IA 1D6WA 1G3BA 2M5TA 2WYJA 3H09A 3RXSA 5GXPA 3U28C 2ZFRH 2YNAA 1NU7B 3TGJE 3Q3KA 3OU0A 4FUEA 3STJA 1X7AC 1NFWA 3SNBA 3MU0A 1YLDA 3TNTA 1VCPA 3RXGA 2NU1E 1BB0B 3OYPA 1P57B 1CT2E 1RTLA 2B8OH 3MO6A 4D9RA 4TT3D 1BBRK 3F1SB 3KEEA 4DOQA 3UY9A 1OOKB 2GV7A 3MMGA 2GZ7A 1C1MA 2P8OC 5A8YA 1HJ8A 1SLVB 2A4GA 2P93A 2ULLA 4JK5A 3BEIB 4TPYA 2FLRH 1GVKB 5DG6A 4YT7H 4MNVA 3MI4A 2ZWLH 1PQ5A 3MH5A 2AGIX 3B8JA 1HAOH 2P94A 1S82A 1RIWB 3P70B 1EJMA 3RLYH 2TRMA 2OXSA 4LOYH 1TFXA 1PPEE 1GMDG 1UTKA 2FS9A 4JYTA 1UVUH 1AGJA 4AG1A 1Z1JA 1W0KD 5JBCS 1WAYB 4DGJA 5G4BA 2BHGA 3AAVA 3KGPA 5HIYA 1G36A 2ZGXH 1GMCG 4I32A 1GVLA 5L6NH 2HNTF 4YTAA 4X6PA 2VWOA 1NPMA 1OWEA 2ANMH 1VGCC 2UUYA 2OBQA 3E8LA 2DE9A 5DP4A 4Z0KA 2GT8A 1GI3A 3RM2H 1ELDE 4ZHMU 2QV1A 2R0LA 4CREA 1ZMLA 2H9EH 2ZZUH 4DCDA 2EI6A 2BLQA 1P0SH 5E0HA 2RG3A 1LO6A 1QY6A 3SU4A 3TJOA 2BOKA 2QF3A 2J94A 3T26A 5SGAE 2P3UB 4Y76A 1J8AA 3L33A 4K60A 1WSSH 1HPGA 3FO8D 1BZXE 1C5MD 1HV7A 4KP0A 3TH2H 4CRDA 2Z6BD 3URCA 4D9QA 1WDIA 3SUEA 1O2IA 1KLJH 1XVMA 2ZDVH 4YOJA 4FVDA 1C5LH 4Y0ZE 5IYTA 4ACAA 2OLGA 1S83A 3BG8A 3PWBA 4MQAA 1IQIA 2J5UA 2PKSC 1G30B 3SGBE 3FAOA 1AZ8A 4NA8A 4I8KA 1J17T 1C5PA 3RXUA 4NG9H 5DP8A 2TPIZ 2VWNA 2BD3A 2XCFA 2J92A 3TK9A 3DCLA 1ELVA 4UFFH 1O3PB 4U32A 1GI6A 1QBNA 2BD9A 4X6OA 1P11E 1C1RA 1NFXA 2BZAA 1HAIH 3F6UH 3Q77A 5EOKA 3ATKA 1ZRBA 1PPFE 1DLKB 1EFRD 1T8LA
chains in the Genus database with same CATH topology
2A4RA 1O5CB 1UTOA 1LKAA 1V2VT 4NIXA 1AVWA 4BAHB 4Y8ZA 5HGGA 3A81A 1O3FA 2C8XB 1OWDA 5ABWA 3BTEE 2Z7FE 2TGTA 1C2IA 2ZGCA 5FBEA 4MDSA 2BLOA 1HAYB 4Y7BA 3VPKA 4PROA 4GPGA 3QGJA 1GHXH 2AIPA 2VWMA 3T25A 3TK6A 1BHXF 2XW9A 1H9HE 4GCHG 1P9UA 1W13U 1XMNB 2BD4A 5EXMA 2WPLS 1BBRH 1HAHH 1O37A 5GCHF 5EPYA 1O3HA 1EKBB 1AB9B 1CA8B 3GYLB 3D23A 5AHGH 2QXHA 2C8ZB 1JRSA 1FPHH 1V2ST 2ZPRA 1QJ7B 4VGCC 2O8LA 3BEFB 4XFQA 3ZZDA 1NZQH 1MCTA 1Y59T 1DITH 1SR5C 6GCHG 3UNQA 1HYLA 2JH0D 2FTLE 1MAYA 4CRBA 5C1XA 1C5SA 1G37A 1WQVH 2FOHA 1QRWA 3F9GA 3GY2A 1BITA 2BD8A 1CGJE 1ZSLA 2CMYA 1QB1A 1UHBA 5DP5A 1V2QT 4O3TA 4I8GA 1K22H 4D7FA 8KME2 4DURA 1Z71A 2PUXB 4Q7ZA 3M7QA 4GUXA 5F03A 3SU3A 1XUFA 2P8OB 1HAGE 2G52A 1M9UA 1OSSA 1KDQB 1WTGH 1ZHPA 1FJSA 4MG3A 1GJAB 3SV6A 3RXCA 1SOZA 2G81E 1AVGH 2BQ7B 3BEUA 5AVDA 2Q6FA 3ZV9A 1G2LA 3SV7A 1KY9A 3MOCA 1P06A 2VU8E 2BD2A 4WXVA 3ZVFA 3VB4A 3PV4A 2VGCC 1EPTC 3AW1A 2ANYA 1O2MA 2XWAA 2FI4E 2GGVB 3U9AH 1HIAB 4B74A 5ETXA 1DXWA 3RU4T 1E36B 1FLEE 1RFNA 1TMTH 4TPIZ 3S7KB 1Z8GA 1SQAA 1EZSC 2WINI 1MD7A 3GY6A 3RXRA 1KYNA 5EG4A 1VGCB 1V2WT 4MPUA 2BY9X 4FUCA 2GVFA 3KQEA 3LH1A 3OX7U 1DANH 4FUJA 2XYAA 3MTYA 1IQKA 1HRTH 4ABIA 2GMTC 4ZKNU 2HLCA 3VXEH 1QJ6B 3PLBA 1O2JA 1ZPBA 3SNEA 1C5OH 1SHYA 2J9NA 2BDCA 4BNRA 1DXPA 2C93B 3IWMA 4CR9A 1BTPA 1A0HB 1QGFA 5JB8S 4UONA 1AIXH 1HAVB 2K1QA 1T8NA 1ZSJA 1CO7E 2AMQA 5C20A 4WJG2 5DP9A 3TIUA 1D4PB 1CHOF 5CMXH 1OYTH 1C5WB 2BQ6B 2IJOB 1O2YA 2FS8A 4NZLA 1BMLA 1ELBA 1B0EA 1SLXB 1ZHRA 1QB6A 2PKSB 1IHTH 1HGTH 1QR3E 1P01A 2Y5FA 2V0BA 4IW4E 4CRGA 3MFJA 1T32A 1ZHMA 1MTNC 4YESB 2ZPSA 3KQCA 1V2KT 2KAIA 3D49H 1PPHE 4ZROA 2ZU4A 1CHOG 3DA9B 1O36A 3ATMA 8GCHG 2O8WA 1N6XA 5GIBA 5J4SA 3GYMA 1VJAU 4X2XA 4WH8A 1NC6A 4LK4A 1NFUA 1KXCA 3ZZ6A 1Y5AT 1XM1A 3S9CA 4X1RU 3TNSA 1ELGA 2VIOA 1CHGA 1QL8A 2R3UA 3P8GA 3ZZ9A 1C1OA 1EASA 1TOMH 3VB7A 1C2DA 3SZNA 1LQEA 1MBQA 1XUHA 2ODPA 3MU5A 1SGPE 1C1NA 4Y11E 1SBWA 4FUIA 1GI5A 3A80A 3WY8A 4AG2A 2EEKA 3UUZA 1GJ8B 4NCYA 5L30H 4O03A 5E0JA 2GD4B 5LGOA 4VGCB 3QZRA 1FAXA 4XBDA 3SHCH 1WOFA 4CBOA 1GMHF 2ZGJA 2FOFA 2ODQA 2ZCLP 4FUBA 1P05A 1LHDH 2VB0A 4XBBA 5LPEA 1HJAC 1A5IA 1T8MA 4ISOA 1DLEA 3FP7E 3QGNB 1LPKB 3ZVBA 3S0NA 3DUXH 5B6OA 3ENSB 1YPLH 3GCHB 1G32B 3MU8A 1SLWB 4KGAA 1AFQB 1TBRH 4ABEA 1BQYA 2F83A 2GZ9A 2CGAA 1H9IE 1Z8RA 2VNTA 3E3TA 3LPRA 2A4QA 2OUAA 2QXJA 3A7VA 3ATWA 3GY8A 1MKWK 3NXPA 4UD9H 1N8OC 4CRFA 1EP5A 1ARBA 3U8RH 3RXEA 1GBIA 5BRRE 5EXNA 1UK4A 1YCPM 5FXLA 1O3CA 2ALVA 2FOEA 3I78A 3SNDA 1P2OA 1S5SA 1TRMA 4OS2A 1V2RT 4MTBA 1GJCB 2ZDMA 4XE4A 1K21H 1E38B 3H7TA 2A7CA 4MPXA 3PMAB 2HRVA 1QCPA 3BTKE 1CGHA 1K1NA 2OD3B 3UNSA 1VITG 1HNEE 1GVZA 3SGAE 3TH3H 1KXFA 3SJOA 1FY3A 3RM0H 2GMTB 1ZOMA 1QNJA 4Q7XA 1LHGH 3PMJA 5K7RA 2BY8X 1N6YA 5FPTA 5DGJA 2EI8A 3SJ9A 1MBMA 2ZFFH 3ZVCA 4AOQA 1TNKA 4BOHA 3EDXB 1SLUB 1SGIB 2XTTB 2FWWA 1W2KH 4OS1A 5FAHA 1IOEA 3KQDA 1O31A 1GI1A 2CXVA 2FXRA 3BTQE 4I7YH 2F9BH 4DW2U 7GCHG 1EAUA 1QA7A 5A8XA 1EXFA 1LVYA 1QL9A 2Y6TA 4MNXA 2F3CE 4IMQA 1F7ZA 3BIUH 2Y82A 4CH2B 3S9BA 2FP7B 4Q80A 3QO6A 3SI3H 1HLTH 3GDUA 1VITH 1SL3A 3I77A 1MTNB 3E1XB 2I6QA 1TA6A 1MKXK 1NU9A 4OS7A 4ISIH 4ESTE 1C2KA 4D8NA 1BRAA 1HAZB 3RXIA 4A7IB 3UPEA 1GDQA 4JZFH 3QLPH 3A7YA 4A5TS 2FOAA 1FXYA 1SQOA 2PSXA 1G3CA 1K1MA 3K6YA 1E0FD 1GBBA 2WPKS 2Z9GA 3HKJB 4WMFA 4CRAA 1Z6JH 1JRTA 3PMHB 1LVBA 1GHBF 1ZSKA 2FYRA 4DG4A 1UTJA 3UTUH 1E34B 3EA8A 1A2CH 3H7OA 3ZVEA 1RRKA 2XWBI 3A8AA 1SC8U 1D3TB 2H1UA 3BTDE 4X1NU 1EATA 4NA9H 1WU1A 1XUGA 3PO1C 4OS6A 1ELAA 1BT7A 1L0ZA 1SMFE 1O3NA 3CENA 1GI8B 3BTGE 4E7RG 1LKBA 2VVVA 2H9TH 4LXBH 1DOJA 2F9OA 4A1TA 3PLKA 4NIVA 1DWEH 2BLWA 2XRCA 2AIQA 3GOVB 4FXGH 3RXBA 2G00A 1XUIA 2FYQA 1H1BA 5C2ZA 2G4TA 4CBNA 3E0PB 1BTZA 3MH7A 3RMLH 4MPWA 1QURH 1EB2A 1CQQA 2VVCA 3ZV8A 5TCAA 5HM9A 2CV3A 4BTIB 4INKA 3S69A 1TX6A 1Z7KA 1HJAB 4YLQH 1GBLA 3MYWA 3P17H 1QBVH 1GHYH 5I25A 4AN7A 1EP6A 4WVPE 3LGVA 1QB9A 3CS0A 4Y6DA 1YCPH 1GHWH 1CT0E 3UOUA 1UCYE 1CE5A 1SGTA 2IOTA 1Y3UA 1TRNA 2C8YB 1THRH 2ZCHP 3QK1A 2GV6A 1GMDF 2R3YA 1YPGH 1P02A 2PV9B 3SGQE 2SGQE 1OKXA 1H8IH 4K1EA 4QT8C 1W11U 4O97A 7LPRA 1PPBH 3GY4A 3M61U 1CA0C 1GMCF 1EB1H 3ODFA 1N8OB 1NN6A 5PTPA 1EX3A 1HIAA 3T62A 2BVRH 2ZG0H 3M5MA 2SFAA 5A0AE 1UVTH 3RMNH 4KELA 1YP9A 1GBHA 4JYUH 5GWZA 3MU1A 3S9AA 1G9IE 1V2JT 2H2ZA 4ZHAA 2C90B 3N7OA 1TABE 4XDEA 1ARCA 4Y71A 1MTUA 4B2BA 1P03A 2EA3A 3GICB 1QA0A 2Y81A 1HUTH 3L6PA 1O3OA 1TPOA 1SGCA 4BTTB 1S0RA 1SI5H 4O9VA 1ANCA 4ZAEA 2ZTXA 1TBZH 3SJ8A 1HBTH 3A89A 1GHAG 3C1KA 1GJDB 2QY0B 4RN6A 1D9IA 3M3TA 1L4ZA 3SW2B 2V35A 4OS5A 1MKXH 2PHBA 3LC5A 1F2SE 1Z6EA 3A82A 3QTVH 4Z6AH 3OTJE 1Z1IA 4MLFB 3ELAH 1SSXA 3S7HB 1NY22 1ZGIA 1ZPZA 4K3JA 4TYDA 1QIXB 2TIOA 5F8ZA 3TU7H 1A5HA 2Q6GA 4JZEH 1MQ5A 1AHTH 4ABJA 1UTLM 3QTOH 1PFXC 1GPZA 3G01A 3SV9A 2OINA 1WYKA 4ZXXH 3IITA 1L1JA 3DHKH 2ZFPH 2C4FH 4WH6A 4X2VA 4NIWA 1D6RA 2FI3E 1C1VH 1O5AB 1YPJH 4OGYA 1AKSB 3T5FH 1IQLA 3VB6A 2D8WA 1P12E 4K2YA 1ID5H 2ESTE 2W26A 8LPRA 1Y5UT 3RXLA 2ZDLA 5FCKA 4GCHF 1SB1H 3B23B 3D65E 1ANBA 1ETSH 2ZNKH 4FUDA 1C2MA 3OY6U 2BQWB 2VIWA 3RXFA 2WYGA 1AI8H 3BSQA 4NZQA 1UVOA 4X8UH 1BMNH 1DWDH 1O3LA 1AWHB 4YLUA 1LHEH 3LGTA 2Y80A 1TQ7B 3PO1B 1P2JA 1P3CA 2CJIA 2FPZA 2Z9IA 1TNGA 5GJ4B 1O5GH 1ABJH 1JMOH 2ZDNA 6GCHF 9LPRA 1A3BH 1BTYA 1O2LA 1O3IA 2CHAB 1SVPA 2OTVA 1FUJA 5C5NA 5J4QA 2OP9A 2ZEBA 1O3EA 3NCLA 2HALA 2IN2A 2PGQB 4ISNA 3RXOA 5JYIA 2R2WU 2Z9JA 3EE0B 1ZZZA 2ANKH 1YPEH 1QFKH 5A8ZA 3P8FA 3KQBA 4UFEH 1UVSH 3CP7A 4JZ1A 1F0SA 2Y5GA 1V6DA 5FX5A 2WPHS 3RP2A 1MTVA 1SFQB 4X6NA 3NUMA 4WF8A 1MQ6A 2QAAA 1TA2A 2O8MA 5DJ7A 4AYYB 2BDYA 2GZ8A 3Q3XA 1O2HA 1QHRB 1AO5A 2HVXA 1WTHD 2PGBB 4WXIA 1UJ1A 3GCHC 5EXLA 1ZTJA 4X8TH 1AFQC 5GPIB 1BA8B 1O2UA 2XNIA 1D3PB 2PW8H 2BDAA 1BBRE 3VB5A 1GCTC 2VIDA 1INCA 2ZU1A 3A85A 1EPTA 3DT0H 3U69H 1S6HA 4JYVH 3ZVGA 1ANDA 1DFPA 4NSYA 2Z9LA 1CA0B 5I46H 3U1IB 1GJ4H 2H5CA 1O2QA 3MH6A 1RJXB 4H6TA 1KTSB 5E8EH 2O8TA 2LPRA 2GCTB 4MNYA 1KXEA 2AYWA 3BTME 3RMOH 1EQ9A 3NWUA 1ZTLA 3O8RA 1C5TA 2FM2A 4M7GA 3NK8A 3W95A 4TY7A 1B7XB 2FIRH 3SU2A 3FZDA 1VR1H 2PKAA 2EI7A 3URDA 1TGNA 1NS3A 4AFZA 1FDPA 3SN8A 2QYIA 2Q6DA 3GDVA 3IG6B 1ZMJA 4UDWH 1O2VA 3LONA 3A7TA 4NGAH 4ZMAH 4CR5A 1EAWA 1P2MA 1GHZA 4INLA 5JPMH 1W10U 2W3IA 4TWYA 5HXFA 4AX9H 2EC9H 2BD7A 3K9XB 3RXTA 3V13A 3SHAH 3F68H 3LU9B 2RCEA 1EZUC 1UMAH 4YOGA 2I6SA 3JZ2B 5A0BA 1B0FA 3KF2A 2WV5A 4TWWA 3RC5A 3SQEE 1HCGA 3C27B 1BDAA 1ESBA 2NU3E 3RC4A 1OYQA 4K69A 2VIVA 1UK3A 4ISHH 1TGCA 2UWPA 8GCHF 4X6MA 3DFJA 1LTOA 2G4UA 1P3EA 2FLBH 3UQOA 3STIA 4IC5A 1PJPA 1TONA 1AU8A 3A88A 4IC6A 1WUNH 2FOCA 1Y3XA 2YNBA 3TJVA 1KLIH 1TNLA 1ZMNA 4YO9A 1TNJA 1TB6H 3RXAA 2Z3DA 1P8VC 1BMMH 3ZVAA 5DP3A 3LDXH 3LT3A 1SGQE 1C5YB 2XC4A 1EOLA 1E37B 3ZVDA 2BZ6H 2BYAX 1T7CA 1SOTA 4XSKU 5T6FA 1NT1A 4IMZA 2ZGHA 4Y79A 1IHSH 4ABBA 4DIHH 5JBTA 1MU8B 3MNBA 5AFYH 2GT7A 3M5OA 4Y7AA 4HGCA 1W7GH 3I29A 4XBCA 1TOCB 4MNWA 4Y0YE 3D62A 2TGPZ 2BX4A 1P9SA 2OQUA 5E0GA 2G5VA 1UTMA 1WCZA 2SNVA 5F6MA 1P2IA 3NZIA 4AGJA 1ZPCA 1ABIH 3F9EA 1CU1A 1LPGB 4B75A 7ESTE 1NRNH 2VINA 1NRSH 1O3DA 2AS9A 5EGMA 2BDGA 2GCHF 3A84A 1GG6C 3MHWU 4D76A 3PTBA 2BDIA 2OC1A 1C5UA 1GDUA 1AD8H 2PTNA 4ABAA 3NKKA 1GDNA 4DVAU 2QC2A 2TBSA 3U8OH 5DP7A 3SI4H 3RXMA 1T4UH 2Y7ZA 1O5FH 1YPHC 2Z9KA 5DKMA 1T8OA 1EOJA 1PPZA 2P59A 1UO6A 3GCNA 2GDEH 2UWOA 3MWIU 1P04A 1TX7A 4X2YA 3RDZA 2NWNA 4GSOA 5DP6A 1UVPA 1EUFA 1G3DA 2HGTH 4KKDA 2GCHG 3A7XA 3BV9B 2PFEA 1TPSA 1AUTC 1ZYOA 3RMMH 1W14U 1AY6H 1ESTA 1C1SA 1O35A 1O2WA 2XBWA 3M35A 1TPPA 4ABFA 3M3SA 4ASHA 4YZUA 2R0KA 3ESTA 1GGDB 1DUEA 2FODA 2ZDKA 1GCTB 1O30A 1JWTA 2J4IA 3V7TA 4Y8XA 5LPFA 3SUDA 4A1VA 2FDAA 4ZH8A 1C5QA 2Z94A 3U1JB 3UNRA 1C4U2 1OWKA 5JBAS 4U2WA 4E06H 1JXPA 1DS2E 1GJBB 1UTNA 1C1PA 3SJKA 3BTTE 1VITF 4U30A 5C5OA 4RKJB 3UWJH 2NU2E 1UHBB 1Z8IB 2TGAA 4B1TA 5AF9H 2BOHB 4TY6A 2HNTC 1A7SA 1O2RA 2WPJS 1THPB 5BPEA 2BXUH 2SGEE 1C2HA 3P8OA 3TH4H 2VWLA 2ILNA 1O3MA 2OC0A 2SGFE 1HAPH 1T4VH 3QDZB 1FY1A 1P2QA 4ISLA 4NFEA 9ESTA 1MU6B 3SQHE 2UWLA 3VGCB 1JIMA 1S85A 1GI9B 1K1JA 2ZTYA