2G55A

Anomalous substructure of trypsin (p3121)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g55A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g55A02
8GCHG 1ZTKA 2ODQA 3BN9A 1PPHE 1ELVA 1NT1A 5HGGA 3UOUA 3UR9A 1MQ6A 1LPGB 3U98H 2Y81A 5AHGH 1E35B 3BEIB 1CGJE 1Z71A 3EA7A 1GDQA 1NTPA 4TYDA 2VWMA 4CH2B 3URDA 1C5LH 1UVSH 4THNH 2WV4A 1YYY1 1SBWA 1P2KA 3ODFA 4X1QU 4ZH8A 1GWAA 1QTFA 4FUBA 5A8XA 2ZGJA 5A8ZA 4Y11E 1DLEA 1C4U2 2R0KA 3A84A 3M5NA 2FOFA 2OC7A 4AN7A 3SV8A 1BTHH 1KTTB 1DFPA 1WTGH 3DA9B 4JZFH 1OOKB 1W8BH 1PJPA 2QN5T 5T6GA 3UREA 2O8TA 1OWHA 4CRAA 1O5GH 1AFEH 2ZHWH 1P2JA 4GLYA 4TPIZ 1MZDA 5TCAA 1GHVH 2QV1A 5GXPA 3URCA 1BITA 3BEUA 1C9PA 1VJAU 1ZZZA 5DJ7A 1QBNA 1QRWA 1DWBH 1ZHRA 1TA2A 2ANMH 2VGCB 5HYOA 4RKOB 5GIBA 3SNBA 4WXVA 1BB0B 1O3LA 2LPRA 4ABGA 1O2LA 1HV7A 4K1TA 1E34B 1SG8B 2Z3CA 2ZCHP 3B9FH 3CENA 3MHWU 5F8ZA 3U8OH 1RS0A 1ANBA 3VGCB 3TH4H 3VPKA 1VCPA 1ZRKA 1HJ9A 4X6PA 1C1TA 2VVVA 1DSTA 2WINI 1SPJA 1BCUH 2Z6BD 3M61U 3UNRA 3O8BA 1GHXH 4NA7A 1V2TT 3PB1E 3V3MA 4X0WU 1MTVA 4KTUA 3KF2A 4YZUA 2BM2A 2J38A 5EXLA 3UIRA 4A1VA 3V7TA 1O5FH 2EI6A 2ZI2H 3AW1A 4ISHH 5EQSA 3MI4A 4YLQH 4AG1A 3P8NA 1HAXB 1IQJA 1AU8A 1L1NA 2A4QA 4U32A 3SU3A 5CHAB 2AMPA 1QURH 1C2MA 4B71A 1CHGA 1D3PB 2GDEH 1QFKH 3L33A 2AS9A 3VXEH 1T8NA 4BOHA 1E38B 2ZFTA 1K21H 1GL0E 3VFEA 3RXBA 2P3UB 1FN6A 4DGJA 3A86A 3UQVA 4NA8A 4CRGA 1GMHF 3LH1A 3BG4B 1K28D 1A3BH 2KAIA 3RXEA 1ELCA 1MBMA 3QN7A 2BQWB 1AWFH 2V0BA 4K60A 2TGTA 1XUJA 5GWZA 3ZZDA 2F9BH 5ETXA 1GCTC 1GI7B 1H9IE 1TALA 3ATKA 1QRZA 3LT3A 1VZQH 1K1MA 1LPZB 2CMYA 2W3KA 4R8TB 3STJA 4AB9A 1YKTA 3ZVGA 3I78A 4K1SA 4AG2A 2BDHA 2BZAA 1J17T 2AERH 3F1SB 1WOFA 1HXFH 2C3SA 3RU4E 2Y80A 1NU7B 1O2TA 2Z9JA 4B74A 4XBCA 1CT2E 1K22H 1GDUA 1YPEH 3E0PB 5F8XA 1HAGE 2IJOB 3HKIB 1O35A 3D62A 3OTJE 4JK5A 1E36B 2A5KA 2SGDE 3KIDU 1O33A 1NC6A 2DE8A 3Q00A 1AD8H 1BBRE 4DY7B 1WV7H 3SZNA 1MU8B 1QIXB 1ELGA 1PQ8A 3VB4A 1M9UA 3ZZ9A 1VGCB 1UHBA 1ELTA 2HNTE 1TNIA 4AYYB 2CJIA 3ESTA 1V2MT 1LVMA 1PPFE 3E8LA 3P92A 1NRNH 1GL1A 1TNKA 2BOHB 2FMJA 4HGCA 4HZHA 3T27A 4GAWA 4WXIA 2Y5GA 3E0NB 3TGJE 3IWMA 1SSXA 1OP2A 1UMAH 1ZMJA 1PQ5A 4AFQA 1XXFA 1ZLRA 1PYTD 5E0GA 5E2OA 2D8WA 2BD2A 2ZF0H 1DOJA 4CHAB 1INCA 4X8UH 4WY3A 1QA7A 2G52A 1QJ7B 2YNAA 3M5OA 1UTJA 1C1UH 1ZJKA 2GV6A 3BTDE 4ESTE 5F8TA 3M7UA 4MDSA 2FTMA 1HIAB 3FP8E 3QO6A 2YOLA 5FCRA 1QR3E 2PSYA 3N7OA 1ETTH 1BZXE 1JWTA 2SGAA 1GMCF 3W94A 1UO6A 5DP8A 1FI8A 1UTLM 2FZZA 1UTQA 4BTTB 3DFJA 3T5FH 5T6DA 3FP7E 2H9TH 1W2KH 1GCDA 1ESBA 1RTKA 2OC0A 1C5XB 2O8WA 2A5AA 3CS0A 1SGFG 1GBAA 1AY6H 4I8HA 1YPHE 4ZHLU 1EP6A 4ABDA 5C20A 1K1NA 1XUHA 2Y82A 1ZOMA 1SLVB 1V2LT 1C2EA 2O8MA 4Q80A 4D8NA 3A7ZA 3QZRA 3NZIA 4UONA 3RXRA 4QT8C 2ZPRA 1HAPH 2XW9A 2ZQ1A 4IMQA 1TPPA 2V35A 1IQEA 1HIAA 4Y8XA 3ZZ6A 2BX3A 3UR6A 1DT2A 1P0SH 5C1XA 1BT7A 5BRRE 5I25A 4FVBA 5FHTA 2DE9A 4WF8A 1C1OA 4IC5A 1QBOA 4ISNA 1A0JA 3KCGH 1FN8A 1F7ZA 5DO4H 1G32B 1BBRH 1GDNA 5TJXA 4D9QA 3HK3B 2A45B 3BTME 3D65E 1H9LB 3LGWA 3BTTE 4KTCA 5DK1A 1XKBC 3SI4H 1OP0A 1GBKA 4UD9H 3ZVFA 1BMNH 4FUCA 1O2GH 1D3TB 4MNYA 4YO9A 4ZUHA 1YF4A 2BQ6B 1OWJA 1DY8A 3T62A 1ZHMA 3SN8A 2QYIA 3F68H 2J2UA 3FVFB 1N8OC 1VITF 2QF0A 4DW2U 1TNLA 3EDXB 1A5GH 1AQ7A 2VJ1A 1C5VA 1OS8A 4A7IB 1MCVA 1GHBF 1W12U 1FUJA 2FOAA 5IYTA 1MKWK 2WPKS 1GHBG 3I29A 5AVDA 1EOLA 3ZYDA 2OBOA 4ISLA 4OS1A 2FOCA 2ZKSA 2OTVA 2ZG0H 3E16B 3DFLA 2TPIZ 2PHBA 2GT7A 1CA0C 3IITA 4F49A 1S84A 5EPNA 4NIYA 3ZV9A 1VCWA 3RU4D 4BTIB 2R3UA 1PPZA 1SGRE 8LPRA 1EPTB 3H5CB 2ZU4A 2A2XH 4XFQA 1C5OH 2UWLA 1QL9A 2PUXB 2JH6D 2FESH 2F9OA 3A7TA 2D1JA 5DP9A 1C5RA 2BDGA 1GI6A 1P09A 3F9EA 4LOYH 4Y6DA 4OS5A 1WQVH 1D3DB 1SLUB 1T8MA 2GCHF 2XBWA 1XUGA 2JH5D 1O3DA 3RP2A 2Y7ZA 1QCPA 2GCHG 1HJ8A 3SJ9A 4BNRA 1GI2A 1WYKA 4MLFB 1NFUA 3RC4A 3S9CA 1TPOA 1FIWA 3ZZ5A 1MQ5A 2ESTE 2XYAA 3FANA 3TITA 3BTEE 3MH5A 1BTUA 2HWLB 1LPKB 1XX9A 2W7SA 3UFAA 1C1QA 4DIHH 4JMYA 4I8GA 3E3TA 3MU8A 2ZFFH 1C2FA 1GHAG 2PKAB 3GICB 3K9XB 1A4WH 1F5LA 3EA8A 4Y71A 1MTWA 2Z9GA 3UNSA 4Y10E 2ZU3A 2NU2E 2H9EH 1WSSH 2P93A 3A85A 1O2JA 1PPBH 1FPCH 1KXAA 3KNXA 1O3NA 1CHOG 3GY7A 3KGPA 3VGCC 2B8OH 4O9VA 1PYTC 4JZ1A 3SGBE 1KSNA 1QY6A 1EZSC 2BD7A 3S9AA 4OS2A 1TBQH 1P05A 1O2IA 3MNXA 2HPQH 2OINA 3SORA 4K2YA 1UTNA 4FUGA 2AGGX 3RXJA 1NROH 4AZ2B 5JB9S 1GVLA 1G3DA 1ZSJA 4A92A 1MUEB 2H5CA 4ZROA 3A8DA 1EZUC 1QA0A 4U01A 3T29A 3BEFB 2WUCA 5E0JA 2BB4A 3TGKE 3RC5A 2ZC9H 3A7VA 3PMJA 5CHAC 1O38A 1GBMA 1FLEE 1GI9B 1WBGB 2R0LA 1C5ZB 1E37B 2G81E 2NWNA 3EAJA 4YM9A 2HVXA 3MO3A 3TH2H 3RC6A 3UWIA 5EODA 3M35A 1AB9C 2V6NA 4XDEA 2FXRA 2XCNA 3P8OA 4ABAA 1GJ5H 1BTYA 2A7HA 1THPB 1HAVA 7KMEH 3BG4C 3BV9B 1T7CA 1SQTA 2GVFA 3SU6A 1XVMA 3MH6A 1D6WA 3FZZA 4CH8B 5BPEA 1AKSA 2NU0E 2PW8H 1SHHB 3ODDA 3RM2H 2H1UA 1B0FA 3FP6E 1ZR0A 1FXYA 3U9AH 1FDPA 2ASUB 3EQ0H 2FO9A 1ARBA 4FU8A 4O3UA 5T6FA 1OPHB 2C8ZB 1GJ8B 4A5TS 1IQGA 2XRCA 4BAKB 5AFYH 1OP8A 4ZHMU 5JYIA 1Y5UT 1L0ZA 4D7GA 3LPRA 3RMNH 4XE4A 4DCDA 2AYWA 1AUTC 4NSVA 3TIUA 1CT4E 2JETB 3MO9A 3GY2A 1DUEA 5PTPA 1AZZA 1IQMA 1SLXB 3GDVA 1BOQA 2DUCA 1BMMH 2F91A 2W3IA 3LKWA 1DLKB 1NM6A 4X8TH 2O9QA 5HM9A 4HI3A 1FY3A 2QXJA 1ESAA 3ZZAA 4IC6A 1P10A 1UTKA 4ABEA 2STAE 1O37A 4CRDA 5GDSH 1B0EA 2AIQA 4GCHF 2BMGB 5JBCS 1HBTH 4KELA 4RSPA 3KL6A 3RXDA 1QJ6B 1CVWH 1EAUA 5GCHG 1N8OB 4GCHG 2F83A 1FQ3A 3E91A 1O5CB 1TGTA 1HJAC 1UVTH 1P02A 2ZGXH 5CE1A 2C4FH 1DXWA 2HRVA 2ALVA 1PPCE 1Q2WA 1OSSA 1NFYA 2XC4A 4TY7A 2VH6A 1CGIE 1ELAA 1TABE 4CHAC 4JYUH 1O2UA 3A7WA 1V2UT 4ZKNU 1GG6C 1CA0B 1QL8A 1YCPH 3GY3A 4WJG2 4UFFH 2G5NA 1L1GA 1C1RA 3LGYA 4LZ4B 3D49H 4IBLH 1NRSH 1QQ4A 1O36A 2OUAA 2RDLA 3Q3KA 4PROA 3U1IB 4FU7A 3KQBA 4SGBE 2AGIX 2V3HH 1YPGH 5J4QA 2R3YA 1QB1A 3TNTA 4GPGA 2RG3A 3LU9B 4XBBA 2FOGA 5A0CA 3SQEE 3M36A 1CQQA 1UTOA 1MTNB 4LXBH 1ID5H 3S7KB 1TQ7B 1ELEE 3A88A 2ZNKH 1O3HA 2ZGHA 2FPZA 3QWCH 1Z8GA 2G8TA 1LDTT 2XWAA 3UUZA 3SV2H 2ZO3H 1AHTH 1XUKA 2A1DB 1NZQH 1GBDA 3ZVCA 1FY1A 1TOMH 3MTYA 1YP9A 4ISIH 4GUXA 3LDXH 2BLVA 3MOCA 3L6PA 3F9HA 2AIPA 3ZVBA 4MVNA 1AWHB 1AZ8A 3SUFA 3A80A 2F9NA 3M7TA 1TFXA 4MG3A 1V2OT 1LQDB 2IPHA 3QTVH 2J9NA 1C5SA 1TE0A 5ESBA 4BXSA 2ZU1A 1T8LA 3M3VA 1GI0A 2KAIB 2QXHA 1O32A 2B5TB 1IOEA 3ATLA 2A4GA 1V2ST 3SHAH 3SNEA 4MNXA 1THSH 1ZTLA 1YPHC 3S0NA 3RXVA 3U8TH 3RMLH 2QIQA 4K8BA 4YESB 2VIQA 4BAHB 2BY9X 1SFQB 1LHFH 4K69A 3RDZA 2Z9KA 1WUNH 1Q31A 3LGIA 4JZDH 3UOPA 3VEQB 4YOGA 3OY6U 1HPGA 1RXPA 4INLA 1F0UA 1GHWH 1AB9B 1YCPK 3LIWA 2VIWA 2B0FA 3E1XB 4X8SH 3EA9A 3RM0H 1SB1H 3ZZ7A 1FMGA 3SJKA 4MNVA 1IQLA 3RXHA 1W7XH 1IQFA 1LVYA 2Z3DA 1EPTC 1GMHG 5DP3A 2BOKA 3CS7A 3MU4A 1L4DA 1T4UH 1AE8H 1KLTA 1LHEH 2FS9A 1V2JT 3TVJB 6LPRA 2J92A 1TNJA 3QUMP 1UVOA 1SGIB 2TIOA 2W5EA 3V13A 1V2VT 1B5GH 1A61H 1LVBA 3OSYA 1GHYH 2A31A 2Q6FA 3A81A 1UHBB 1HUTH 3K2UA 2A4OA 4TY6A 4R0IA 4GHTA 1V2NT 2GX4A 2BVSH 4IN2A 2RA3A 1SHYA 4TPYA 1GBBA 4H6SB 2Q6GA 1S5SA 4FUDA 1WQSA 1FZZA 1YPKH 1B7XB 4WMDA 1P04A 4JZEH 1TGNA 1S81A 1O3AA 4ZXYH 3A7YA 2UWOA 4XBDA 2G4UA 3TPIZ 1OKXA 1P8VC 4AFSA 1DE7H 3RXLA 2P3FH 1RGQA 1KDQA 4X2WA 3GOVB 3IG6B 3DUXH 1BMAA 1KIGH 1IQHA 4NIWA 1A46H 2R2WU 3JZ1B 1UTPA 1C5QA 2ZHFH 1S6FA 3BTWE 4H6TA 3SW2B 1FPHH 1IHTH 1ORFA 3GCHC 2AEIH 4Y8ZA 2PTNA 3UY9A 1S0RA 5HMAA 1GMDF 1H8IH 3MYWA 3A82A 4FUHA 5EU8A 5C5OA 1GHZA 2PUQH 3BTGE 4E7NA 3GYMA 1S6HA 1N6YA 3MNSA 4NFEA 1HJAB 1QQUA 1JOUB 2CV3A 4Q7YA 1XUIA 3C1KA 5T3HA 1GI3A 1MD8A 3AVZA 1KXBA 5C1UA 4UEHH 5A2MH 4WWYA 1C2IA 4OGXA 1DVAH 1D9IA 4INKA 4K3JA 1O2RA 2ZTYA 1P06A 4D7FA 1GJ4H 2SFAA 1MKWH 1FONA 3UNQA 1GG6B 1AMHA 3AASA 3MNCA 3E6PH 3RXSA 5SGAE 4D76A 3ATMA 4BAOB 1DWCH 1EJNA 1QGFA 2VU8E 2GCTC 3OU0A 1O2WA 5FCKA 1W11U 2NU3E 1EZQA 5FPSA 2Q1JA 3T26A 4DURA 1GI5A 4GSOA 3EGKH 1WAYB 2BVXH 1ETRH 1BRBE 2OD3B 1LHGH 2ZGCA 2H5DA 2NU4E 2Q6DA 2ZHQH 2WPMS 4Y8YA 3R0FA 4ZHAA 3FFGA 4X1NU 1TB6H 2ANKH 5E8EH 2Z9LA 1EQ9A 2A0QB 1GMCG 5JBTA 1SFIA 2PFEA 2ZFRH 2EA3A 4NFFA 3F9GA 1GJBB 1G30B 1RIWC 1G37A 1QNJA 2VVUA 3M3SA 3LONA 4YTAA 3SV9A 1PFXC 2C8XB 2FYQA 3ITIA 4U30A 4B2AA 4TWYA 4MTBA 2QXIA 3HGPA 4A1XA 1C9TA 1Y5BT 3H7TA 1O3MA 1LO6A 1ZSKA 2FX6A 1C4V2 2ZFPH 1MU6B 4AGJA 2Z7FE 1EATA 3GISB 4X1PU 1C5MD 1FY5A 1TNGA 5EW2H 2FP7B 2H9HA 3NXPA 2JETC 2XWBI 1W0YH 4J2YB 4MPUA 2XBVA 2ODYB 1G2LA 2XXLA 1O3OA 1TOCB 3BTFE 1O2PA 1BHXB 2C8YB 3S69A 3RXPA 2M5TA 1P3CA 2VB0A 2VWLA 2F9UA 1PQAA 4B2BA 2OC8A 2R2MB 4Z0KA 1BJVA 4ABBA 3TH3H 2CXVA 4AB8A 3NK8A 2EI7A 1SQAA 5DP7A 3RXTA 3PTNA 2ZCLP 1TMUH 1L1JA 1MAYA 1ESTA 2OXSA 5C3NA 2HOBA 2VIPA 1PPGE 3KQDA 1GBFA 1KXCA 1VITG 2AH4X 4YOIA 5FXLA 4KGAA 3SGAE 1X7AC 1Z8JB 4DIIH 1LKAA 2ZU5A 5F6MA 3A8AA 1SGFA 4ZKOU 1GI4A 1F92A 1ZYOA 2QA9E 1J9CH 2BD3A 2WYGA 2ZFQH 1CT0E 2ZDMA 1H9HE 3OYPA 1GJ9B 1TGCA 2PSXA 2HGTH 1GGDC 4AOQA 1EUFA 1YM0A 1G2MA 1EAWA 1SL3A 3P6ZB 4LK4A 2GT8A 2SNVA 1O2OA 2B7DH 2BQ7B 4K5ZA 2SGFE 2ZIQH 1ZPZA 3SHCH 1FNIA 1O2SA 3VB5A 1K1OA 2ZP0H 4NZQA 4B73A 4I31A 1T8OA 3O8DA 2QY0B 1S85A 1MTNC 3LC5A 2XC0A 4K1EA 2RCEA 2BX4A 2TRMA 2ZDNA 1LKBA 2AMQA 2A7CA 3NPSA 3T25A 1YC0A 2UUFB 1TGBA 2GMTB 2ALPA 3A87A 1S83A 1ZSLA 2SGPE 4ZAEA 2OCVB 5EXNA 1EJAA 3ZYEA 2PTCE 4A1TA 2VWOA 2Y5HA 2ZHEH 3G01A 2Y7XA 5FX6A 5A09A 1DPOA 4NGAH 1YPMH 1ETSH 2W26A 5C2ZA 1O3CA 3M5LA 1QB9A 3RXIA 5C5NA 1SGQE 3P8FA 1DDJA 1YBWA 1QHRB 2C93B 2ILNA 1C2HA 1Z1IA 1V2QT 4ISOA 2G00A 5JBAS 5LH8A 2XTTB 3GCHB 2FLRH 4H42U 4KKDA 2QAAA 3E90B 3F9FA 1C2LA 1HLTH 4Y7AA 1ZHPA 2VIOA 1HAVB 1VITH 3BF6H 2OLGA 1UCYK 1JXPA 1NO9H 3A83A 3EE0B 3T2NA 3SQHE 1HAOH 2G4TA 2UUKB 2Z94A 1O5BB 5LGOA 1GVKB 3GCTF 4NIVA 3PLKA 3HGNA 2FDAA 1O3EA 3QGJA 1AKSB 1THRH 7GCHF 3SI3H 4BAMB 3ZZ3A 1BA8B 2ZCKP 2BY7X 7GCHG 1BJUA 2A32A 2THFB 2BLWA 3RXOA 1DUAA 2TBSA 4B2CA 1TPSA 5FBEA 1IQNA 3MO6A 1ZRBA 2GCTB 5ABWA 4AORA 1HDTH 1DWEH 1VR1H 1C1VH 2ZTZA 1ELDE 3KQCA 1EASA 4WH6A 1O2NA 4NG9H 1N6XA 1UJ1A 3ZVEA 2BHGA 1SGCA 2P59A 3UTUH 3SJOA 1U6QA 2F9PA 3ZVAA 3SO3A 3KN2A 2BXUH 2AFQB 3SU4A 1WCZA 2HLCA 1CU1A 3PMHB 1RIWB 3RXQA 1MD7A 1SQOA 1JIRA 2D2DA 4Y76A 1OWKA 5HXFA 1J16A 4YT6H 2BD4A 4GVUA 3KEEA 2BDYA 1P11E 1F5KU 1K1IA 1OYTH 2ZGBH 4NWLA 3TK6A 4JK6A 1EOJA 1HXEH 4IGDA 1JRSA 3O8RA 4CR9A 5FAHA 3PROA 5EOKA 3VB7A 3SUDA 5I46H 1SMFE 2PR3A 3TLOA 1KXDA 3S9BA 2JH0D 3HKJB 2BD5A 3QX5H 5CMXH 1SOTA 1WTHD 2VVCA 3PV4A 2XCFA 1HB0B 1A3EH 3RU4T 6CHAB 2ZTXA 3LJOA 1SGYE 2EEKA 2GKVE 1CE5A 1P2NA 3ZVDA 1YCPM 3W95A 2A7JA 5C1YA 6ESTA 2C8WB 1O0DH 2IOTA 4YOJA 1BTPA 4YT7H 1OXGA 4NCYA 3RXAA 2BDIA 1GBIA 1Y3XA 2BXTH 1O3GA 3T28A 3SUGA 1CSOE 2GD4B 1H4WA 1SOZA 2FM2A 1BRUP 3BIUH 1GBJA 3TJOA 1NRRH 3PWCA 5TCCA 2PKSC 3GCOA 1TMBH 1FAKH 2ZU2A 3QZQA 1HAYB 2VIVA 5LPRA 1GGDB 4I8KA 1ACBE 4AYVB 2FOEA 1LQEA 4MQAA 2BY8X 1A1RA 1BUIA 1J8AA 1TX6A 4OS6A 8GCHF 3P8GA 3KQEA 4TWWA 1TONA 3PM3A 2HNTC 2OBQA 1SC8U 1V6DA 2H6MA 2BY6X 2J95A 3F6UH 4I7YH 4MPVA 3BTKE 5LPEA 1O34A 3A89A 2XBYA 2W7UA 3NCLA 1F2SE 1ANCA 4MPXA 2C90B 4ABFA 4Y79A 3RMOH 1ZMLA 1C1MA 2A2QH 1GJ6A 3CP7A 1P03A 1GJ7B 1ZGVA 1SGTA 3RLYH 2V3OH 8KME2 1CBWC 1TRNA 3MH4A 4WH8A 1AUJA 4NWKA 1MBQA 1P2MA 3SV6A 3TK5A 1IQIA 1P57B 3OX7U 3RXMA 4IW4E 1A5IA 4O03A 1DM4B 5E2PA 2ZDAH 3K6YA 1CGHA 4Q2KA 5F03A 4FVDA 3SBKA 1FAXA 1EX3A 1NS3A 3HATH 1SVPA 1EAIA 1TMTH 3PYHA 4X6MA 1P2OA 5AF9H 3QLPH 4HFPB 2AGEX 3SNDA 1NY22 1NESE 1QB6A 1GBLA 1E0FD 5C67A 2FX4A 2XBXA 3LOXA 1BTZA 2ZA5A 1DX5M 3RXUA 1YLDA 4UFEH 1GJDB 1FV9A 2ZWLH 2A4RA 4NSYA 4RN6A 2K1QA 1O2KA 3PO1C 1BMLA 4O3TA 3RXFA 1LMWB 4INHA 4UE7H 1QRXA 4AGKA 1UVUH 4X2XA 3ATIA 3HK6B 4BAQB 3SJIA 1TBZH 3VB3A 2TGDA 1XVOA 3H7OA 5B6OA 1OYQA 4ZKSU 3SU1A 1AE5A 4DOQA 1CA8B 2ZECA 4NA9H 1HRTH 2VINA 1D6RA 4B75A 2ANWA 1NFWA 3I77A 3RMMH 4FXGH 1GVZA 1HCGA 2G51A 1C5NH 1EXFA 2TGAA 1UTMA 3LJJA 1Z7KA 1OWIA 1C1NA 1MTUA 3AAVA 1TBRH 1C1PA 2RA0A 3R3GB 1T32A 2GGVB 1W0ZU 2UUYA 2G55A 5DP4A 4DT7B 1Y3VA 4XSKU 1KDQB 1QL7A 5AFZH 2O8UA 1MCTA 1Y59T 3V12A 3RXCA 1S82A 4WVPE 7LPRA 2BYAX 1C1SA 1DSUA 5K7RA 1TX7A 2F9VA 5FPTA 1AGJA 1P2IA 1QBVH 1EAXA 4MNWA 2EC9H 2F3CE 4Q7ZA 1O2VA 1G36A 2GMTC 3TU7H 1V2PT 2GTBA 2GV7A 5A8YA 3NWUA 1O3PB 4AFZA 5IDKA 2GZ9A 4J1YA 1Y3YA 4IMZA 1S0QA 3NKKA 1Y3UA 4I8LA 2I6QA 4FU9A 3PMBB 3JZ2B 1DWDH 1BQYA 6GCHF 3MWIU 4Q7XA 4Y7BA 1Z1JA 3TJUA 6GCHG 4X2VA 2J4IA 1HGTH 3ELAH 5DPAA 3RXKA 1Z8RA 2I6SA 3LC3A 4X6NA 5EQRA 1OWDA 1F0SA 1O2YA 4AX9H 1AVWA 5DG6A 4BTUB 4JCNA 5L6NH 4UFGH 1C5UA 4I33A 1GBEA 1DITH 5JB8S 3A8CA 2NU1E 5DKMA 1UCYE 2ZPSA 4WMEA 2WPHS 4JYTA 1ELBA 3BSQA 1NN6A 4CBOA 1GMDG 4CRFA 1XUFA 5LPFA 3V0XA 2GZ7A 3M5MA 1KLIH 1YPLH 1QJ1B 2FI5E 3FZDA 1G3EA 1NU9A 1PQ7A 1N1LA 2VH0A 1HAIH 2Y5FA 1KXEA 1MKXH 1O5EH 1K1JA 3GDSA 3PTBA 1C5TA 2PKSB 1W13U 4MPWA 3C27B 1O3KA 2HNTF 1C1WH 1Z6EA 2OP9A 2STBE 3GY5A 3MU0A 1AVGH 1SGEE 3TJNA 1AFQC 1AIXH 1DANH 1J15A 3U8RH 3MNBA 5A0AE 4FUIA 1WU1A 3SU2A 1SGNE 2PGBB 2B9LA 1IHSH 2P16A 1BDAA 3DD2H 1ZPBA 3WY8A 2FLBH 3ZZ8A 4X1RU 1SR5C 2P3TB 3PMAB 1GBCA 4XOJA 1YGCH 1P3EA 2FWWA 1EZXC 1Y3WA 1OWEA 1YPJH 1C2JA 4WMFA 3KHVA 1A0LA 4B76A 4X1SU 1C2DA 4NZLA 1G3BA 3SV7A 1TYNA 3MU5A 1A7SA 2QXGA 3BTQE 1CBWB 4E05H 1GJAB 3RUOA 1O30A 3SNAA 3TGIE 2R9PA 1HAHH 1VCQA 3TNSA 2LNCA 1KY9A 2UWPA 1BHXF 2TGPZ 1MMJN 4U2WA 4D9RA 1T31A 5FBIA 3GYLB 2WPJS 1O3BA 3QTOH 2QGRA 4ZMAH 1Y5AT 5DP5A 1TGSZ 3PLBA 5K0HA 1O39A 1A5HA 2BLQA 1P9UA 1GJCB 3MMGA 1NRQH 6CHAC 1P01A 8ESTE 3SJ8A 2CGAA 3LH3A 4H4FA 1AN1E 1GPZA 1TLDA 3EYDA 3M7QA 4Y0ZE 3ZZCA 1KXFA 3PO1B 3QK1A 2Y6TA 1ZJDA 1G9IE 1D3QB 5L2YH 1PPEE 1SGDE 1GI8B 4YLUA 2BY5X 2SGEE 3ENSB 1KTSB 2CF8H 1FJSA 1UCYH 2BTCE 1O2MA 4JYVH 2FTLE 1NPMA 3RXGA 1MKXK 4ABJA 5A0BA 5FPYA 5JBBS 3BG8A 4VGCC 1TX8A 3K6ZA 3SUEA 2CF9H 3PLPA 1W3CA 3VXFH 4DVAU 5EW1H 5EXMA 1G3CA 3BIVH 1EJMA 1K1LA 3NUMA 5L30H 2PWXA 1ABIH 4CREA 1TAWA 4RKJB 4Y0YE 4CRCA 2GZ8A 3LGVA 3LGUA 1Q3XA 1HYLA 1F5RA 1DICA 2BD8A 2UUJB 1RRKA 1Y8TA 3GDUA 4CBNA 2GP9B 1XXDA 2WPLS 4FUJA 1MZAA 2G5VA 4FUFA 5E0HA 4CRBA 4K8YA 2FOBA 4E7RG 2H2ZA 1SI5H 1H8DH 2CHAC 2BVRH 2QF3A 2P8OC 4UDWH 1TA6A 1LHDH 4OGYA 2GDDA 1Z8IB 1V2WT 3UWJH 2CN0H 2SNWA 2JKHA 4BANB 4DG4A 1HAZB 1W10U 2FS8A 4ABHA 1C2GA 1GCTB 3Q3YA 2QC2A 5GJ4B 3M3TA 3L3TA 2ZQ2A 4Z6AH 1C5WB 1UK3A 2HALA 5EQQA 4JZIA 9ESTA 1XMNB 4IN1A 3D23A 1DY9A 1RFNA 5JDUB 3K65B 1BRAA 4NIXA 5G4BA 1EB1H 3B8JA 4OS7A 4HTCH 2A5IA 2VWNA 3RLWH 1DXPA 5EGMA 1ZPCA 1GHAF 1SLWB 1UVPA 1EPTA 1ZTJA 1AVXA 2WUBA 4ABIA 1TRMA 2VGCC 1O2HA 3LGTA 1C2KA 1BBRK 1P9SA 2OQ5A 3A7XA 1CHOF 1JRTA 1RJXB 2IN2A 2WV5A 2WPIS 2PV9B 4ASHA 1O3JA 3GCTG 2XNIA 3S7HB 5ESTE 2P94A 1EKBB 2FIRH 2BDBA 3DT0H 1K2I1 1GBHA 3MH7A 2FOMB 1XKAC 3P17H 2FEQH 2P95A 3Q77A 4ZXXH 1ABJH 5HM2A 4SGAE 1TWXB 2ANYA 1JBUH 1BIOA 4FUEA 1KYNA 1ZMNA 1LCYA 1DS2E 4X8VH 3GY4A 4I8JA 2EI8A 1EP5A 1TPAE 4AFUA 2FI4E 2ULLA 1AFQB 1BRCE 1JMOH 2PKAA 1YLCA 2ZDLA 2VNTA 1CO7E 4E06H 1P2QA 1K9OE 1HNEE 1RTFB 1EB2A 1O2QA 3A8BA 1GBTA 5J4SA 3U1JB 1C5YB 3UPEA 1W14U 1ANDA 1O3IA 3VB6A 3ATWA 3BTHE 1L2EA 1UK4A 2Z3EA 1NRPH 2ZEBA 4BXWA 1O2ZA 4X6OA 1O31A 1LHCH 3TJVA 4F4OC 2BLOA 2OC1A 2BDCA 1D4PB 1K1PA 1C5PA 2XC5A 3SU5A 1KLJH 3OY5U 1A2CH 4UFDH 5H4IB 2PGQB 1LTOA 3GCNA 5JPMH 5EPYA 1C4Y2 1TIOA 2WYJA 3GY8A 2BD9A 1Z6JH 3PWBA 3UQOA 1V2RT 4OS4A 1OX1A 1O5AB 2FYRA 2AMDA 1F0RA 2J34A 1NFXA 2YNBA 1L4ZA 9LPRA 2O8LA 1IAUA 1MH0A 4B1TA 1RD3B 2D26C 1ELFA 1FIZA 4KP0A 2ZZUH 3MU1A 3TK9A 3M37A 2HPPH 1IQKA 3GY6A 5FX5A 1ANEA 1FY8E 3AAUA 1MTSA 2ZPQA 1J14A 5L2ZH 3ZZBA 5DP6A 3P95A 2ZDVH 4LZ1H 3Q3XA 2SGQE 1F0TA 1TQ0B 2ZDKA 3SOSA 2BZ6H 7ESTE 1BTWA 2OQUA 4I32A 1H1BA 1HFDA 4GHQA 1JIMA 2FODA 5EG4A 3P70B 2QCYA 2J94A 3QGNB 3U69H 4O97A 4X2YA 1O5DH 4VGCB 3STIA 1VGCC 5DGJA 3SGQE 1T4VH 4DJZB 3FAOA 3QDZB 2VIDA 4ZKRU 2FOHA 5GCHF 4IS5A 1VJ9U 1O3FA 1ARCA 3ZZ4A 1LVOA 3SNCA 1XM1A 3ZV8A 2BDAA 2ZFSA 2ODPA 3HPTB 3DHKH 1TRYA 2FI3E 3SU0A 1MAXA 1V2KT 1UK2A 4KTSA 1O2XA 3O8CA 4A6LA 1A0HB 1W7GH 3B23B 2PLXA 1AI8H 4M7GA 4CR5A 1SGPE 1TNHA 3MFJA 5GPIB 2CHAB 1BTXA 1FY4A 3Q76A 1RTLA 1GI1A 2ZHDA 1AO5A 2Z9IA 1ZGIA 3AW0A 2P8OB 1P12E 1V3XA
chains in the Genus database with same CATH superfamily
8GCHG 1ZTKA 2ODQA 3BN9A 1YWUA 1PPHE 1ELVA 1NT1A 5HGGA 3UOUA 3UR9A 1MQ6A 1LPGB 2HLDD 3U98H 2Y81A 5AHGH 1E35B 3BEIB 1CGJE 1Z71A 3EA7A 1GDQA 1NTPA 5C0UA 4TYDA 4B6EA 2VWMA 4CH2B 3URDA 1C5LH 1UVSH 4THNH 2WV4A 1YYY1 1SBWA 1P2KA 3ODFA 4X1QU 4ZH8A 4Q4LA 1GWAA 1QTFA 2V3MA 4FUBA 5A8XA 2ZGJA 5A8ZA 4Y11E 1DLEA 1C4U2 2R0KA 3A84A 3M5NA 2FOFA 2OC7A 3MQKC 4AN7A 3SV8A 1BTHH 1KTTB 1H8HD 1DFPA 1WTGH 3DA9B 4JZFH 1OOKB 1W8BH 1PJPA 2QN5T 4M9FA 5T6GA 3UREA 2O8TA 1OWHA 4CRAA 3WWBA 1O5GH 1AFEH 2ZHWH 1P2JA 4GLYA 4TPIZ 1MZDA 5TCAA 1GHVH 2QV1A 5GXPA 3URCA 1BITA 3BEUA 2WZQA 1C9PA 1VJAU 3DSOA 1ZZZA 5DJ7A 1QBNA 1QRWA 1DWBH 1ZHRA 1TA2A 2ANMH 2VGCB 5HYOA 4RKOB 5GIBA 3SNBA 4WXVA 1BB0B 1O3LA 2LPRA 4ABGA 1O2LA 1HV7A 4K1TA 1E34B 1SG8B 2Z3CA 2ZCHP 3B9FH 3CENA 3MHWU 5F8ZA 3U8OH 1RS0A 1ANBA 3VGCB 3TH4H 3VPKA 1VCPA 1ZRKA 1HJ9A 4X6PA 1C1TA 2VVVA 1DSTA 2WINI 1SPJA 2AHME 1BCUH 2Z6BD 3M61U 3UNRA 3O8BA 1GHXH 4NA7A 1V2TT 3PB1E 3V3MA 4X0WU 1MTVA 4KTUA 3KF2A 4YZUA 2BM2A 2J38A 5EXLA 3UIRA 4A1VA 3V7TA 1O5FH 2EI6A 2ZI2H 3AW1A 4ISHH 5EQSA 2KZ4A 3MI4A 4YLQH 4AG1A 3P8NA 3F2HA 1HAXB 1IQJA 1AU8A 1L1NA 2A4QA 4U32A 3SU3A 5CHAB 2AMPA 1QURH 1C2MA 4B71A 1CHGA 1D3PB 2GDEH 1QFKH 3L33A 2AS9A 3VXEH 1T8NA 4BOHA 1E38B 3UB0A 3AK5A 2ZFTA 1K21H 1GL0E 2YMSD 3VFEA 3RXBA 2P3UB 1FN6A 4DGJA 3A86A 3UQVA 4NA8A 4CRGA 1GMHF 3LH1A 3BG4B 1K28D 1A3BH 2KAIA 3RXEA 1ELCA 1MBMA 3QN7A 1KMHB 5GNDA 2BQWB 1AWFH 2V0BA 4K60A 2TGTA 1XUJA 5GWZA 3ZZDA 2F9BH 5ETXA 1GCTC 1GI7B 1H9IE 1TALA 2QE7D 3ATKA 1QRZA 3LT3A 1VZQH 1K1MA 1LPZB 2CMYA 2W3KA 4R8TB 3STJA 4AB9A 1YKTA 3ZVGA 3I78A 4K1SA 4AG2A 2BDHA 2BZAA 1J17T 2AERH 3F1SB 5KEDA 1WOFA 1HXFH 2C3SA 3RU4E 2Y80A 1NU7B 1O2TA 2Z9JA 4B74A 4XBCA 1CT2E 1K22H 1GDUA 1YPEH 3E0PB 5F8XA 3KQ5A 1HAGE 2IJOB 3HKIB 1O35A 3D62A 3OTJE 4JK5A 1E36B 2A5KA 2SGDE 3KIDU 1O33A 1VKYA 1NC6A 2DE8A 3Q00A 1AD8H 1BBRE 4DY7B 1WV7H 3SZNA 1MU8B 1QIXB 1ELGA 1PQ8A 3VB4A 1M9UA 3ZZ9A 1VGCB 1UHBA 1ELTA 3OTPA 5T1VA 2HNTE 4RI0A 1TNIA 4AYYB 2CJIA 3ESTA 1V2MT 1LVMA 1PPFE 3E8LA 3P92A 1NRNH 2JJ1D 1GL1A 1TNKA 2BOHB 5CHBA 2FMJA 4HGCA 4HZHA 3T27A 4GAWA 1H8ED 4WXIA 2Y5GA 3E0NB 3TGJE 3IWMA 1SSXA 1OP2A 1UMAH 1ZMJA 1PQ5A 2KCOA 4AFQA 1XXFA 1ZLRA 1PYTD 5E0GA 2F43B 5E2OA 2D8WA 2BD2A 2ZF0H 1DOJA 4CHAB 1INCA 4X8UH 4WY3A 1QA7A 2G52A 1QJ7B 2YNAA 3M5OA 1UTJA 1C1UH 1ZJKA 2GV6A 3BTDE 4ESTE 5F8TA 3M7UA 4MDSA 2FTMA 1HIAB 3FP8E 3QO6A 2YOLA 5FCRA 1QR3E 3OFND 2PSYA 3N7OA 1ETTH 1BZXE 1JWTA 2SGAA 1GMCF 3W94A 1UO6A 5DP8A 1FI8A 1UTLM 2FZZA 1UTQA 4BTTB 3DFJA 3T5FH 5T6DA 3FP7E 1W0KD 2H9TH 1W2KH 1GCDA 1ESBA 1RTKA 2OC0A 1C5XB 2O8WA 2A5AA 3CS0A 1SGFG 1GBAA 1AY6H 4I8HA 1YPHE 4ZHLU 1EP6A 4ABDA 5C20A 1K1NA 1XUHA 2Y82A 1ZOMA 1SLVB 1V2LT 1C2EA 2O8MA 4Q80A 4D8NA 3A7ZA 3QZRA 3NZIA 2OK5A 4UONA 3RXRA 4QT8C 2ZPRA 3SZEA 1HAPH 2XW9A 2ZQ1A 4IMQA 1TPPA 2V35A 1IQEA 1HIAA 4Y8XA 3ZZ6A 2BX3A 3UR6A 1DT2A 1P0SH 5C1XA 1BT7A 5BRRE 5I25A 4FVBA 5FHTA 2DE9A 4WF8A 1C1OA 1YY3A 4IC5A 1QBOA 4ISNA 1A0JA 3KCGH 1FN8A 1F7ZA 3PRDA 5DO4H 1G32B 1BBRH 1GDNA 5TJXA 4D9QA 2F4LA 3HK3B 2A45B 3FKSD 3BTME 3D65E 1H9LB 3LGWA 3BTTE 4KTCA 5DK1A 1XKBC 3SI4H 1OP0A 1GBKA 4UD9H 3ZVFA 1BMNH 4FUCA 1O2GH 1D3TB 4MNYA 4YO9A 4ZUHA 1YF4A 2BQ6B 1OWJA 1DY8A 3T62A 1ZHMA 2YMSC 3SN8A 2QYIA 3F68H 2J2UA 3FVFB 1N8OC 1VITF 2QF0A 4DW2U 1TNLA 3EDXB 1A5GH 1AQ7A 2VJ1A 1C5VA 1OS8A 4A7IB 1MCVA 1GHBF 1W12U 1FUJA 2FOAA 5IYTA 1MKWK 2WPKS 1GHBG 5KECA 3I29A 5AVDA 1EOLA 3ZYDA 2OBOA 4ISLA 4OS1A 2FOCA 2ZKSA 2OTVA 2ZG0H 3E16B 3DFLA 2TPIZ 2PHBA 2GJGA 2GT7A 1CA0C 3FOAA 3IITA 1S84A 4F49A 4NIYA 5EPNA 3ZV9A 1VCWA 3RU4D 4BTIB 2R3UA 1PPZA 1SGRE 8LPRA 1EPTB 3H5CB 2ZU4A 2A2XH 4XFQA 1C5OH 2UWLA 1QL9A 1E1RD 2PUXB 2JH6D 2FESH 2F9OA 3A7TA 2D1JA 5DP9A 1C5RA 2BDGA 1GI6A 1P09A 3F9EA 4LOYH 4Y6DA 4OS5A 1WQVH 1D3DB 1SLUB 1T8MA 2GCHF 2XBWA 1XUGA 2JH5D 1O3DA 3RP2A 2Y7ZA 1QCPA 2GCHG 1HJ8A 3SJ9A 4BNRA 1GI2A 1WYKA 4MLFB 1NFUA 2J5UA 3RC4A 3S9CA 3EE7A 1TPOA 1FIWA 3ZZ5A 1MQ5A 2ESTE 2XYAA 3FANA 3TITA 3BTEE 3MH5A 1BTUA 2HWLB 1LPKB 1XX9A 2W7SA 3UFAA 1C1QA 4DIHH 4JMYA 4I8GA 3E3TA 3MU8A 3WW7A 2ZFFH 1C2FA 1GHAG 2PKAB 3GICB 3K9XB 1A4WH 1F5LA 3EA8A 4FOUC 4Y71A 1MTWA 2Z9GA 3UNSA 4Y10E 2ZU3A 2NU2E 2H9EH 1WSSH 2P93A 3A85A 1O2JA 1PPBH 1FPCH 1KXAA 3KNXA 1O3NA 1CHOG 3GY7A 3KGPA 3VGCC 2B8OH 4O9VA 1PYTC 4JZ1A 3SGBE 1KSNA 1QY6A 3KYFA 1EZSC 2BD7A 3S9AA 4OS2A 1TBQH 4F55A 1P05A 1O2IA 3MNXA 2HPQH 2OINA 3SORA 4K2YA 1UTNA 4FUGA 2AGGX 3RXJA 1NROH 4AZ2B 5JB9S 1GVLA 1G3DA 1ZSJA 4A92A 1MUEB 2H5CA 4ZROA 3A8DA 1EZUC 1QA0A 4P00A 4U01A 3T29A 3BEFB 2WUCA 5E0JA 2BB4A 3TGKE 3RC5A 2ZC9H 3A7VA 3PMJA 5CHAC 1O38A 1GBMA 1FLEE 1GI9B 1WBGB 2R0LA 1C5ZB 1E37B 2G81E 2NWNA 3EAJA 4YM9A 2HVXA 3MO3A 3TH2H 3RC6A 3UWIA 5EODA 3M35A 1AB9C 2V6NA 4XDEA 3H09A 2FXRA 2XCNA 3P8OA 4ABAA 1GJ5H 1BTYA 2A7HA 1THPB 1HAVA 7KMEH 3BG4C 3BV9B 1T7CA 1SQTA 2GVFA 3SU6A 1XVMA 3MH6A 1D6WA 3FO8D 3FZZA 4CH8B 5BPEA 1AKSA 2NU0E 2PW8H 1SHHB 3ODDA 3RM2H 2H1UA 1B0FA 2WV9A 3FP6E 1ZR0A 1FXYA 2KM0A 3U9AH 1FDPA 2ASUB 3EQ0H 2KCAA 2FO9A 1ARBA 4FU8A 1S6LA 4O3UA 5T6FA 1OPHB 2LP6A 1NBME 2C8ZB 1GJ8B 4A5TS 1IQGA 2XRCA 4BAKB 5AFYH 1OP8A 4ZHMU 5JYIA 1Y5UT 1L0ZA 4D7GA 1BMFD 3LPRA 3RMNH 4XE4A 4DCDA 2AYWA 1AUTC 4NSVA 3TIUA 3OEED 1CT4E 2JETB 3MO9A 3GY2A 1DUEA 5PTPA 1AZZA 1IQMA 1SLXB 3GDVA 1BOQA 2DUCA 1BMMH 2F91A 2W3IA 3LKWA 1DLKB 1NM6A 4X8TH 2O9QA 5HM9A 4HI3A 1FY3A 2QXJA 1ESAA 3ZZAA 4IC6A 1P10A 1UTKA 4ABEA 2STAE 1O37A 4CRDA 5GDSH 1B0EA 2AIQA 4GCHF 2BMGB 5JBCS 1HBTH 4KELA 4RSPA 2YMSB 3KL6A 3RXDA 1QJ6B 1CVWH 1EAUA 5GCHG 1N8OB 1E1QD 4GCHG 2F83A 1FQ3A 3E91A 1O5CB 1TGTA 1HJAC 1UVTH 1P02A 2ZGXH 1EFRD 5CE1A 3UAIC 2C4FH 1DXWA 2HRVA 2ALVA 4F48B 1PPCE 1Q2WA 1OSSA 1NFYA 2XC4A 3F2GA 1SQRA 4TY7A 2VH6A 1CGIE 1ELAA 1TABE 2M2AA 4CHAC 4JYUH 1O2UA 3A7WA 1V2UT 4ZKNU 1GG6C 1CA0B 1QL8A 1YCPH 3GY3A 4WJG2 4UFFH 2CK3D 2G5NA 1L1GA 1C1RA 3LGYA 4LZ4B 3D49H 4IBLH 1NRSH 1QQ4A 1O36A 2OUAA 2RDLA 3Q3KA 4PROA 3U1IB 4FU7A 3ZIAD 3KQBA 4SGBE 2AGIX 2V3HH 1YPGH 5J4QA 2R3YA 1QB1A 3TNTA 4GPGA 2RG3A 3LU9B 4XBBA 2FOGA 5A0CA 3SQEE 3M36A 1CQQA 1UTOA 1MTNB 4LXBH 1ID5H 3S7KB 1TQ7B 1ELEE 3A88A 2ZNKH 1O3HA 2ZGHA 2FPZA 3QWCH 1Z8GA 2G8TA 1LDTT 2XWAA 3UUZA 5FL7D 3SV2H 2ZO3H 1AHTH 1XUKA 2A1DB 1NZQH 1GBDA 3ZVCA 1FY1A 1TOMH 3MTYA 1YP9A 4ISIH 4GUXA 3LDXH 2BLVA 3MOCA 3L6PA 3F9HA 2AIPA 3ZVBA 4MVNA 1AWHB 1AZ8A 3SUFA 2JJ2D 3A80A 2F9NA 3M7TA 1TFXA 4MG3A 1V2OT 1LQDB 3F3BA 2IPHA 3QTVH 4RT0A 2J9NA 1C5SA 1OHHD 1TE0A 5ESBA 4BXSA 2ZU1A 1T8LA 3M3VA 1GI0A 2KAIB 2QXHA 1O32A 2B5TB 1IOEA 3ATLA 2WHXA 2A4GA 2PP6A 1V2ST 3SHAH 3SNEA 4MNXA 1THSH 1ZTLA 1YPHC 3S0NA 3RXVA 3U8TH 3RMLH 2QIQA 4K8BA 4YESB 2VIQA 4BAHB 2BY9X 1SFQB 1LHFH 4K69A 3RDZA 2Z9KA 1WUNH 1Q31A 3LGIA 4JZDH 3UOPA 3VEQB 4YOGA 3OY6U 1HPGA 1RXPA 4INLA 1F0UA 1GHWH 1AB9B 1YCPK 3LIWA 2VIWA 2B0FA 3E1XB 4X8SH 3EA9A 3RM0H 1SB1H 3ZZ7A 1QZ8A 1FMGA 3SJKA 4MNVA 3N7EA 1IQLA 3RXHA 1W7XH 1IQFA 1LVYA 2Z3DA 1EPTC 1GMHG 5DP3A 2BOKA 3CS7A 3MU4A 1L4DA 1T4UH 1AE8H 1KLTA 1LHEH 2FS9A 1V2JT 3TVJB 6LPRA 2J92A 1TNJA 3QUMP 1UVOA 1SGIB 2TIOA 2W5EA 3V13A 1V2VT 1B5GH 1A61H 1LVBA 3OSYA 1GHYH 2A31A 2Q6FA 3A81A 1UHBB 1HUTH 3K2UA 2A4OA 4TY6A 4R0IA 4GHTA 1V2NT 2GX4A 2BVSH 4IN2A 2RA3A 1SHYA 4TPYA 1GBBA 4H6SB 2Q6GA 1S5SA 4FUDA 1WQSA 1FZZA 1YPKH 1B7XB 4WMDA 1P04A 4JZEH 1TGNA 1S81A 1O3AA 4ZXYH 3A7YA 2UWOA 4XBDA 2G4UA 3TPIZ 1OKXA 1P8VC 4AFSA 1DE7H 3RXLA 2P3FH 1RGQA 4HG6A 1KDQA 4X2WA 3GOVB 3IG6B 3DUXH 1BMAA 1KIGH 1IQHA 4NIWA 1A46H 2R2WU 3JZ1B 1UTPA 1C5QA 2ZHFH 1S6FA 3BTWE 4H6TA 3SW2B 1FPHH 1IHTH 1ORFA 3GCHC 2AEIH 4Y8ZA 2PTNA 3UY9A 1S0RA 5HMAA 1GMDF 1H8IH 3MYWA 3A82A 1W0JD 4FUHA 5EU8A 5C5OA 1GHZA 2PUQH 3BTGE 4E7NA 3GYMA 1S6HA 1N6YA 3MNSA 4NFEA 1HJAB 1QQUA 1JOUB 2CV3A 4Q7YA 1XUIA 3C1KA 5T3HA 1GI3A 1MD8A 3AVZA 1KXBA 5C1UA 4UEHH 5A2MH 4WWYA 1C2IA 4OGXA 1DVAH 1D9IA 4INKA 4K3JA 1O2RA 2ZTYA 1P06A 4D7FA 1GJ4H 2SFAA 1MKWH 1FONA 2IJD1 3UNQA 1GG6B 3FN8A 1AMHA 3AASA 3MNCA 3E6PH 3RXSA 5SGAE 4D76A 3ATMA 4BAOB 1DWCH 1EJNA 1QGFA 2VU8E 2GCTC 3OU0A 1O2WA 5FCKA 1W11U 2NU3E 1EZQA 5FPSA 2Q1JA 3PRBA 3T26A 1GI5A 4DURA 4GSOA 3EGKH 1WAYB 2BVXH 1ETRH 1BRBE 2OD3B 1LHGH 2ZGCA 2H5DA 2NU4E 2Q6DA 2ZHQH 2WPMS 4Y8YA 3R0FA 4ZHAA 3FFGA 4X1NU 1TB6H 1WDIA 2ANKH 5E8EH 2Z9LA 1EQ9A 2A0QB 3OEHD 3DSPA 1GMCG 5JBTA 1SFIA 2PFEA 2ZFRH 2EA3A 4NFFA 3F9GA 1GJBB 1G30B 1RIWC 1G37A 1QNJA 2VVUA 3M3SA 3LONA 4YTAA 3SV9A 1PFXC 2C8XB 2FYQA 3ITIA 5CDFE 4U30A 4B2AA 4TWYA 4MTBA 2QXIA 3HGPA 4A1XA 1C9TA 1Y5BT 3H7TA 1O3MA 1LO6A 1ZSKA 2FX6A 1C4V2 2ZFPH 1MU6B 4AGJA 2Z7FE 1EATA 3GISB 4X1PU 2XNDD 1C5MD 1FY5A 1TNGA 5EW2H 5HIYA 2FP7B 2H9HA 3NXPA 2JETC 2XWBI 1W0YH 4J2YB 4MPUA 2XBVA 2ODYB 1G2LA 2XXLA 1O3OA 4I86A 1TOCB 3BTFE 1O2PA 1BHXB 2C8YB 3S69A 2VBCA 3RXPA 2M5TA 1P3CA 2VB0A 2VWLA 2F9UA 1PQAA 4B2BA 2OC8A 2R2MB 4Z0KA 1BJVA 4ABBA 3TH3H 2CXVA 4Q63A 3NK8A 4AB8A 2EI7A 1SQAA 5DP7A 3RXTA 3PTNA 2ZCLP 1TMUH 2EY4C 1L1JA 1MAYA 1ESTA 4XD7D 2KCPA 2OXSA 5C3NA 2KR7A 2HOBA 2VIPA 1PPGE 3KQDA 1GBFA 1KXCA 1VITG 2AH4X 4YOIA 5FXLA 4KGAA 3SGAE 1X7AC 1Z8JB 4DIIH 1LKAA 2ZU5A 5F6MA 3A8AA 1SGFA 3PV2A 4ZKOU 5EIYA 1GI4A 1F92A 1ZYOA 2QA9E 1J9CH 2BD3A 2WYGA 2ZFQH 1CT0E 2ZDMA 1H9HE 3OYPA 5HKKD 1GJ9B 1TGCA 2PSXA 4TSFD 2HGTH 2KFWA 1GGDC 4AOQA 1EUFA 1YM0A 1G2MA 1EAWA 3N7DA 1SL3A 3P6ZB 4LK4A 2GT8A 2SNVA 3OAAD 4Z1MD 1O2OA 2B7DH 2BQ7B 4K5ZA 5HIZA 2SGFE 2ZIQH 4ASUD 1ZPZA 3W1EA 3SHCH 1FNIA 1O2SA 3VB5A 1K1OA 2ZP0H 4NZQA 4XRNA 4B73A 4I31A 1T8OA 3O8DA 2QY0B 1S85A 1MTNC 5IK2D 3LC5A 2XC0A 4K1EA 2RCEA 2BX4A 2QF4A 2TRMA 2ZDNA 1LKBA 2LELA 2AMQA 2A7CA 3NPSA 3T25A 1YC0A 2UUFB 1TGBA 2GMTB 2ALPA 3A87A 1S83A 1ZSLA 2SGPE 4ZAEA 2OCVB 5EXNA 1EJAA 3ZYEA 2PTCE 4A1TA 2VWOA 2Y5HA 2ZHEH 3CNRA 3G01A 2Y7XA 5FX6A 5A09A 1DPOA 4NGAH 1YPMH 1ETSH 2W26A 5C2ZA 1O3CA 3M5LA 1QB9A 3RXIA 5C5NA 1SGQE 3P8FA 1DDJA 1YBWA 1QHRB 2C93B 2ILNA 1C2HA 1Z1IA 1V2QT 4ISOA 2G00A 5JBAS 5LH8A 2XTTB 3GCHB 2FLRH 4H42U 4KKDA 2QAAA 3E90B 3F9FA 3DSGA 1C2LA 1HLTH 4Y7AA 1ZHPA 2VIOA 1HAVB 1VITH 3BF6H 1UCYK 2OLGA 1JXPA 1NO9H 3A83A 3EE0B 3T2NA 3SQHE 1HAOH 2G4TA 2UUKB 2Z94A 1O5BB 5LGOA 1GVKB 3GCTF 4NIVA 3PLKA 3HGNA 2FDAA 1O3EA 3QGJA 1AKSB 1THRH 3GS9A 5DN6D 7GCHF 3SI3H 4BAMB 5EJ1A 3ZZ3A 1BA8B 2ZCKP 2BY7X 7GCHG 1BJUA 2A32A 2THFB 2BLWA 3RXOA 1DUAA 2HVYB 2TBSA 4B2CA 1TPSA 5FBEA 1IQNA 3MO6A 1ZRBA 2GCTB 5ABWA 4AORA 1HDTH 1DWEH 3F2FA 1VR1H 1C1VH 2ZTZA 1ELDE 3KQCA 1EASA 4WH6A 1O2NA 4NG9H 1N6XA 4FETA 1UJ1A 3ZVEA 2BHGA 1SGCA 2J98A 2P59A 3UTUH 3SJOA 1U6QA 2F9PA 3SYJA 3ZVAA 3SO3A 3KN2A 2BXUH 2AFQB 3SU4A 1WCZA 2HLCA 1CU1A 3PMHB 1RIWB 3RXQA 1MD7A 1SQOA 1JIRA 2D2DA 4Y76A 1OWKA 5HXFA 1J16A 4YT6H 4OM9A 2BD4A 3KYGA 3KEEA 4GVUA 2BDYA 4AC9A 5B6LA 1P11E 1F5KU 1K1IA 1OYTH 2ZGBH 4NWLA 3TK6A 4JK6A 1EOJA 2WPDD 1HXEH 4IGDA 1JRSA 3O8RA 4CR9A 5FAHA 3PROA 5EOKA 3VB7A 3SUDA 5I46H 1SMFE 2PR3A 3TLOA 1KXDA 3S9BA 2JH0D 3HKJB 2JIZD 2BD5A 3QX5H 5CMXH 1SOTA 1WTHD 2VVCA 3PV4A 2XCFA 1HB0B 1A3EH 3RU4T 6CHAB 2ZTXA 3LJOA 1SGYE 2EEKA 2GKVE 1CE5A 1P2NA 3ZVDA 1YCPM 3W95A 2A7JA 5C1YA 6ESTA 2C8WB 1O0DH 2IOTA 4YOJA 1BTPA 4YT7H 1UW7A 1OXGA 4NCYA 3RXAA 2BDIA 1GBIA 1Y3XA 2BXTH 1O3GA 3T28A 3F0PA 3SUGA 1CSOE 2GD4B 1H4WA 1SOZA 2FM2A 1BRUP 3BIUH 1GBJA 3TJOA 1NRRH 2EQNA 3PWCA 5TCCA 2PKSC 3GCOA 1TMBH 1FAKH 2ZU2A 3QZQA 1HAYB 2VIVA 5LPRA 1GGDB 4I8KA 1ACBE 4AYVB 2FOEA 1LQEA 4MQAA 2BY8X 1A1RA 1BUIA 1J8AA 1TX6A 4OS6A 8GCHF 3P8GA 3KQEA 4TWWA 1TONA 3PM3A 2HNTC 2OBQA 1SC8U 1V6DA 2H6MA 3U28C 2BY6X 2J95A 3F6UH 4I7YH 4MPVA 3BTKE 5LPEA 1O34A 3A89A 2XBYA 2W7UA 3NCLA 1F2SE 1ANCA 4MPXA 2C90B 4ABFA 4Y79A 3RMOH 1ZMLA 1C1MA 2A2QH 1GJ6A 3CP7A 1P03A 1GJ7B 1ZGVA 1SGTA 3RLYH 2V3OH 8KME2 1CBWC 1TRNA 3MH4A 4WH8A 1AUJA 4NWKA 1MBQA 1P2MA 3SV6A 3TK5A 1IQIA 1P57B 3OX7U 3RXMA 4IW4E 1A5IA 4O03A 1DM4B 5C94A 5E2PA 2ZDAH 3K6YA 1CGHA 4Q2KA 5F03A 4FVDA 3SBKA 1FAXA 1EX3A 1NS3A 3HATH 1SVPA 1EAIA 1TMTH 3PYHA 4X6MA 1P2OA 5AF9H 3QLPH 4HFPB 2AGEX 3SNDA 1NY22 1NESE 1QB6A 1GBLA 1E0FD 5C67A 1MABB 2FX4A 2XBXA 3LOXA 1BTZA 2ZA5A 1DX5M 3RXUA 1YLDA 4UFEH 1GJDB 1FV9A 2ZWLH 2A4RA 4NSYA 2KCYA 4RN6A 2K1QA 1O2KA 3PO1C 1BMLA 4O3TA 3RXFA 1LMWB 4INHA 4UE7H 1QRXA 4AGKA 1UVUH 4X2XA 3ATIA 3HK6B 4BAQB 3SJIA 1TBZH 3VB3A 2TGDA 1XVOA 3H7OA 5B6OA 1OYQA 4ZKSU 3SU1A 1AE5A 4DOQA 1CA8B 2ZECA 4NA9H 1HRTH 2VINA 1D6RA 5DSFA 2ANWA 4B75A 1NFWA 3I77A 2K0QA 3RMMH 4FXGH 1GVZA 1HCGA 2G51A 1C5NH 1EXFA 2TGAA 1UTMA 3LJJA 1Z7KA 1OWIA 1C1NA 1MTUA 3AAVA 1NBMD 1TBRH 4ACBA 1C1PA 2RA0A 3R3GB 1T32A 2GGVB 1W0ZU 2UUYA 2G55A 5DP4A 4DT7B 1Y3VA 4XSKU 1KDQB 1QL7A 4P02A 5AFZH 2O8UA 1MCTA 1Y59T 3V12A 3RXCA 1S82A 4WVPE 7LPRA 2BYAX 5C17A 1C1SA 1DSUA 5K7RA 1TX7A 2F9VA 5FPTA 1AGJA 1P2IA 1QBVH 1EAXA 4MNWA 2EC9H 2F3CE 4Q7ZA 1O2VA 1G36A 1YLNA 2GMTC 3TU7H 1V2PT 2GTBA 2GV7A 5A8YA 3NWUA 1O3PB 4AFZA 5IDKA 2GZ9A 4J1YA 1Y3YA 4IMZA 1S0QA 3NKKA 1Y3UA 4I8LA 2I6QA 4FU9A 3PMBB 3JZ2B 5EJZA 1DWDH 2XOKD 2QF5A 1BQYA 6GCHF 2W6JD 3MWIU 4Q7XA 4Y7BA 1Z1JA 3TJUA 6GCHG 4X2VA 2J4IA 1HGTH 3ELAH 5DPAA 3RXKA 1Z8RA 2I6SA 3LC3A 4X6NA 5EQRA 1OWDA 1F0SA 2RFKC 1O2YA 4AX9H 1AVWA 5DG6A 4BTUB 4JCNA 5L6NH 4UFGH 1C5UA 4I33A 1GBEA 1DITH 1FX0B 2IPQX 3A8CA 5JB8S 2NU1E 5DKMA 1UCYE 2ZPSA 4WMEA 2WPHS 4JYTA 1ELBA 3BSQA 1NN6A 4CBOA 1GMDG 4CRFA 1XUFA 5LPFA 5C0TA 3V0XA 2GZ7A 3M5MA 1KLIH 1YPLH 2KX4A 1QJ1B 2FI5E 3FZDA 1G3EA 1NU9A 1PQ7A 1N1LA 2VH0A 1HAIH 2Y5FA 2WSSD 1KXEA 1MKXH 1O5EH 1K1JA 3GDSA 3PTBA 1C5TA 2PKSB 1W13U 4MPWA 3C27B 1O3KA 2HNTF 1C1WH 1Z6EA 2OP9A 2STBE 3GY5A 3MU0A 1AVGH 1SGEE 3TJNA 1AFQC 1AIXH 1DANH 1J15A 3U8RH 3MNBA 5A0AE 4FUIA 1WU1A 3SU2A 1SGNE 2PGBB 2B9LA 1IHSH 2P16A 1BDAA 3DD2H 1ZPBA 1E79D 3WY8A 3VG8A 2FLBH 3ZZ8A 4X1RU 1SR5C 2P3TB 3PMAB 1GBCA 4XOJA 4DT4A 1YGCH 1P3EA 2FWWA 1EZXC 1Y3WA 1OWEA 1YPJH 3OE7D 1C2JA 4WMFA 3KHVA 1A0LA 4B76A 3WWFA 4X1SU 1C2DA 4NZLA 1G3BA 3SV7A 1TYNA 3MU5A 1A7SA 2QXGA 3BTQE 1CBWB 4E05H 1GJAB 3RUOA 1O30A 3SNAA 3TGIE 2R9PA 1HAHH 1VCQA 3TNSA 2LNCA 1KY9A 4TT3D 2UWPA 1BHXF 2TGPZ 1MMJN 4U2WA 4D9RA 1T31A 5FBIA 3GYLB 2WPJS 1O3BA 3QTOH 2QGRA 4ZMAH 1Y5AT 5DP5A 1TGSZ 3PLBA 5K0HA 1O39A 1A5HA 2BLQA 2L6OA 1P9UA 1GJCB 3MMGA 1NRQH 6CHAC 1P01A 8ESTE 3SJ8A 2CGAA 3LH3A 4H4FA 1AN1E 1GPZA 1TLDA 3EYDA 3M7QA 4Y0ZE 3ZZCA 1KXFA 3PO1B 3QK1A 2Y6TA 1ZJDA 1G9IE 1D3QB 5L2YH 1PPEE 1SGDE 1GI8B 4YLUA 2BY5X 2SGEE 3ENSB 1KTSB 2CF8H 1FJSA 1UCYH 2BTCE 1O2MA 4JYVH 2FTLE 1NPMA 3RXGA 1MKXK 4ABJA 5A0BA 5FPYA 5JBBS 3BG8A 4VGCC 1TX8A 3K6ZA 3SUEA 2CF9H 3PLPA 1SKYE 1W3CA 3VXFH 4DVAU 5EW1H 5EXMA 1G3CA 3BIVH 1EJMA 1K1LA 3NUMA 5L30H 2PWXA 1ABIH 4CREA 3DCLA 1TAWA 4RKJB 4Y0YE 4CRCA 2GZ8A 3LGVA 3LGUA 1Q3XA 1HYLA 1F5RA 1DICA 2BD8A 2UUJB 1RRKA 1Y8TA 3GDUA 4CBNA 2GP9B 1XXDA 2WPLS 4FUJA 1MZAA 2G5VA 4FUFA 5E0HA 4CRBA 4K8YA 2FOBA 4E7RG 2H2ZA 1SI5H 1H8DH 2CHAC 2BVRH 2QF3A 2P8OC 4UDWH 1TA6A 2K8IA 1LHDH 4OGYA 2GDDA 1Z8IB 1V2WT 5KGOA 3UWJH 2CN0H 2SNWA 2JKHA 4BANB 4DG4A 1HAZB 2W6ID 1W10U 2FS8A 4ABHA 1C2GA 1GCTB 3Q3YA 2QC2A 5GJ4B 3M3TA 3L3TA 2ZQ2A 4Z6AH 1C5WB 2V7QD 3F0OA 1UK3A 2HALA 5EQQA 4JZIA 2JDID 9ESTA 1XMNB 4IN1A 3D23A 1DY9A 1RFNA 5JDUB 3K65B 2RDEA 1BRAA 4NIXA 5G4BA 1EB1H 3B8JA 2J97A 4OS7A 4HTCH 2A5IA 4RT1A 2VWNA 3RLWH 1DXPA 5EGMA 1ZPCA 1GHAF 1SLWB 1UVPA 1EPTA 1ZTJA 1AVXA 2WUBA 4ABIA 1TRMA 2VGCC 1O2HA 3LGTA 4YXWD 1C2KA 1BBRK 1P9SA 2OQ5A 3A7XA 1CHOF 1JRTA 2IN2A 1RJXB 2WV5A 2WPIS 2J98B 2PV9B 4ASHA 1O3JA 3GCTG 2XNIA 3S7HB 5ESTE 3PV5A 2P94A 1EKBB 5EJLA 2FIRH 2BDBA 3DT0H 1K2I1 1GBHA 5F53A 3MH7A 2FOMB 1XKAC 3P17H 2FEQH 2P95A 3Q77A 4ZXXH 1ABJH 5HM2A 4SGAE 1TWXB 2ANYA 1JBUH 1BIOA 4FUEA 1KYNA 1ZMNA 1LCYA 1DS2E 4X8VH 3GY4A 4I8JA 2EI8A 1EP5A 1TPAE 4AFUA 2FI4E 2ULLA 1AFQB 1BRCE 1JMOH 2PKAA 1YLCA 2ZDLA 2VNTA 1CO7E 4E06H 1P2QA 1K9OE 1HNEE 1RTFB 1EB2A 1O2QA 3A8BA 1GBTA 5J4SA 3U1JB 1C5YB 3UPEA 1W14U 1ANDA 1O3IA 3VB6A 3ATWA 3BTHE 1L2EA 1UK4A 2Z3EA 1NRPH 2ZEBA 4BXWA 1O2ZA 4X6OA 1O31A 1LHCH 3TJVA 4F4OC 2BLOA 3N99A 2OC1A 2BDCA 1D4PB 1K1PA 1C5PA 2XC5A 3SU5A 1KLJH 3OY5U 1A2CH 4UFDH 5H4IB 2PGQB 1LTOA 3GCNA 5JPMH 5EPYA 3NRLA 1C4Y2 1TIOA 2WYJA 3GY8A 2BD9A 1Z6JH 3PWBA 3UQOA 1V2RT 4OS4A 1OX1A 1O5AB 2FYRA 2AMDA 1F0RA 2J34A 1NFXA 2YNBA 1L4ZA 9LPRA 2O8LA 1IAUA 1MH0A 4B1TA 1RD3B 2D26C 2L74A 1ELFA 1FIZA 4KP0A 2ZZUH 3MU1A 3TK9A 3M37A 2HPPH 1IQKA 3GY6A 5FX5A 1ANEA 1FY8E 3AAUA 1COWD 1MTSA 2ZPQA 1J14A 1WXRA 5L2ZH 3ZZBA 4ZCNA 5DP6A 3P95A 2ZDVH 4LZ1H 3Q3XA 2SGQE 1F0TA 1TQ0B 2ZDKA 3SOSA 2BZ6H 7ESTE 1BTWA 2OQUA 4I32A 1K0HA 1H1BA 1HFDA 4GHQA 1JIMA 2FODA 5EG4A 4ACAA 3P70B 2QCYA 2J94A 3QGNB 3U69H 4O97A 4X2YA 1O5DH 4VGCB 3STIA 1VGCC 5DGJA 3SGQE 1T4VH 4DJZB 3FAOA 3QDZB 2VIDA 4ZKRU 2FOHA 5GCHF 4IS5A 1VJ9U 1O3FA 1ARCA 3ZZ4A 1LVOA 3SNCA 1XM1A 3ZV8A 4B6FA 2BDAA 2ZFSA 2ODPA 3HPTB 3DHKH 1TRYA 2FI3E 3SU0A 1MAXA 1V2KT 1UK2A 4KTSA 1O2XA 3O8CA 4A6LA 1A0HB 1W7GH 3B23B 2PLXA 1AI8H 4M7GA 4CR5A 1SGPE 1TNHA 3MFJA 5GPIB 2CHAB 1BTXA 1FY4A 3Q76A 1RTLA 1GI1A 2ZHDA 1AO5A 2Z9IA 1ZGIA 3AW0A 2P8OB 1P12E 1V3XA
chains in the Genus database with same CATH topology
8GCHG 1ZTKA 2ODQA 3BN9A 1PPHE 1ELVA 1NT1A 5HGGA 3UOUA 3UR9A 1MQ6A 1LPGB 3U98H 2Y81A 5AHGH 1E35B 3BEIB 1CGJE 1Z71A 3EA7A 1GDQA 1NTPA 4TYDA 2VWMA 4CH2B 3URDA 1C5LH 1UVSH 4THNH 2WV4A 1YYY1 1SBWA 1P2KA 3ODFA 4X1QU 4ZH8A 1GWAA 1QTFA 4FUBA 5A8XA 2ZGJA 5A8ZA 4Y11E 1DLEA 1C4U2 2R0KA 3A84A 3M5NA 2FOFA 2OC7A 4AN7A 3SV8A 1BTHH 1KTTB 1DFPA 1WTGH 3DA9B 4JZFH 1OOKB 1W8BH 1PJPA 2QN5T 5T6GA 3UREA 2O8TA 1OWHA 4CRAA 1O5GH 1AFEH 2ZHWH 1P2JA 4GLYA 4TPIZ 1MZDA 5TCAA 1GHVH 2QV1A 5GXPA 3URCA 1BITA 3BEUA 1C9PA 1VJAU 1ZZZA 5DJ7A 1QBNA 1QRWA 1DWBH 1ZHRA 1TA2A 2ANMH 2VGCB 5HYOA 4RKOB 5GIBA 3SNBA 4WXVA 1BB0B 1O3LA 2LPRA 4ABGA 1O2LA 1HV7A 4K1TA 1E34B 1SG8B 2Z3CA 2ZCHP 3B9FH 3CENA 3MHWU 5F8ZA 3U8OH 1RS0A 1ANBA 3VGCB 3TH4H 3VPKA 1VCPA 1ZRKA 1HJ9A 4X6PA 1C1TA 2VVVA 1DSTA 2WINI 1SPJA 1BCUH 2Z6BD 3M61U 3UNRA 3O8BA 1GHXH 4NA7A 1V2TT 3PB1E 3V3MA 4X0WU 1MTVA 4KTUA 3KF2A 4YZUA 2BM2A 2J38A 5EXLA 3UIRA 4A1VA 3V7TA 1O5FH 2EI6A 2ZI2H 3AW1A 4ISHH 5EQSA 3MI4A 4YLQH 4AG1A 3P8NA 1HAXB 1IQJA 1AU8A 1L1NA 2A4QA 4U32A 3SU3A 5CHAB 2AMPA 1QURH 1C2MA 4B71A 1CHGA 1D3PB 2GDEH 1QFKH 3L33A 2AS9A 3VXEH 1T8NA 4BOHA 1E38B 2ZFTA 1K21H 1GL0E 3VFEA 3RXBA 2P3UB 1FN6A 4DGJA 3A86A 3UQVA 4NA8A 4CRGA 1GMHF 3LH1A 3BG4B 1K28D 1A3BH 2KAIA 3RXEA 1ELCA 1MBMA 3QN7A 2BQWB 1AWFH 2V0BA 4K60A 2TGTA 1XUJA 5GWZA 3ZZDA 2F9BH 5ETXA 1GCTC 1GI7B 1H9IE 1TALA 3ATKA 1QRZA 3LT3A 1VZQH 1K1MA 1LPZB 2CMYA 2W3KA 4R8TB 3STJA 4AB9A 1YKTA 3ZVGA 3I78A 4K1SA 4AG2A 2BDHA 2BZAA 1J17T 2AERH 3F1SB 1WOFA 1HXFH 2C3SA 3RU4E 2Y80A 1NU7B 1O2TA 2Z9JA 4B74A 4XBCA 1CT2E 1K22H 1GDUA 1YPEH 3E0PB 5F8XA 1HAGE 2IJOB 3HKIB 1O35A 3D62A 3OTJE 4JK5A 1E36B 2A5KA 2SGDE 3KIDU 1O33A 1NC6A 2DE8A 3Q00A 1AD8H 1BBRE 4DY7B 1WV7H 3SZNA 1MU8B 1QIXB 1ELGA 1PQ8A 3VB4A 1M9UA 3ZZ9A 1VGCB 1UHBA 1ELTA 2HNTE 1TNIA 4AYYB 2CJIA 3ESTA 1V2MT 1LVMA 1PPFE 3E8LA 3P92A 1NRNH 1GL1A 1TNKA 2BOHB 2FMJA 4HGCA 4HZHA 3T27A 4GAWA 4WXIA 2Y5GA 3E0NB 3TGJE 3IWMA 1SSXA 1OP2A 1UMAH 1ZMJA 1PQ5A 4AFQA 1XXFA 1ZLRA 1PYTD 5E0GA 5E2OA 2D8WA 2BD2A 2ZF0H 1DOJA 4CHAB 1INCA 4X8UH 4WY3A 1QA7A 2G52A 1QJ7B 2YNAA 3M5OA 1UTJA 1C1UH 1ZJKA 2GV6A 3BTDE 4ESTE 5F8TA 3M7UA 4MDSA 2FTMA 1HIAB 3FP8E 3QO6A 2YOLA 5FCRA 1QR3E 2PSYA 3N7OA 1ETTH 1BZXE 1JWTA 2SGAA 1GMCF 3W94A 1UO6A 5DP8A 1FI8A 1UTLM 2FZZA 1UTQA 4BTTB 3DFJA 3T5FH 5T6DA 3FP7E 2H9TH 1W2KH 1GCDA 1ESBA 1RTKA 2OC0A 1C5XB 2O8WA 2A5AA 3CS0A 1SGFG 1GBAA 1AY6H 4I8HA 1YPHE 4ZHLU 1EP6A 4ABDA 5C20A 1K1NA 1XUHA 2Y82A 1ZOMA 1SLVB 1V2LT 1C2EA 2O8MA 4Q80A 4D8NA 3A7ZA 3QZRA 3NZIA 4UONA 3RXRA 4QT8C 2ZPRA 1HAPH 2XW9A 2ZQ1A 4IMQA 1TPPA 2V35A 1IQEA 1HIAA 4Y8XA 3ZZ6A 2BX3A 3UR6A 1DT2A 1P0SH 5C1XA 1BT7A 5BRRE 5I25A 4FVBA 5FHTA 2DE9A 4WF8A 1C1OA 4IC5A 1QBOA 4ISNA 1A0JA 3KCGH 1FN8A 1F7ZA 5DO4H 1G32B 1BBRH 1GDNA 5TJXA 4D9QA 3HK3B 2A45B 3BTME 3D65E 1H9LB 3LGWA 3BTTE 4KTCA 5DK1A 1XKBC 3SI4H 1OP0A 1GBKA 4UD9H 3ZVFA 1BMNH 4FUCA 1O2GH 1D3TB 4MNYA 4YO9A 4ZUHA 1YF4A 2BQ6B 1OWJA 1DY8A 3T62A 1ZHMA 3SN8A 2QYIA 3F68H 2J2UA 3FVFB 1N8OC 1VITF 2QF0A 4DW2U 1TNLA 3EDXB 1A5GH 1AQ7A 2VJ1A 1C5VA 1OS8A 4A7IB 1MCVA 1GHBF 1W12U 1FUJA 2FOAA 5IYTA 1MKWK 2WPKS 1GHBG 3I29A 5AVDA 1EOLA 3ZYDA 2OBOA 4ISLA 4OS1A 2FOCA 2ZKSA 2OTVA 2ZG0H 3E16B 3DFLA 2TPIZ 2PHBA 2GT7A 1CA0C 3IITA 4F49A 1S84A 5EPNA 4NIYA 3ZV9A 1VCWA 3RU4D 4BTIB 2R3UA 1PPZA 1SGRE 8LPRA 1EPTB 3H5CB 2ZU4A 2A2XH 4XFQA 1C5OH 2UWLA 1QL9A 2PUXB 2JH6D 2FESH 2F9OA 3A7TA 2D1JA 5DP9A 1C5RA 2BDGA 1GI6A 1P09A 3F9EA 4LOYH 4Y6DA 4OS5A 1WQVH 1D3DB 1SLUB 1T8MA 2GCHF 2XBWA 1XUGA 2JH5D 1O3DA 3RP2A 2Y7ZA 1QCPA 2GCHG 1HJ8A 3SJ9A 4BNRA 1GI2A 1WYKA 4MLFB 1NFUA 3RC4A 3S9CA 1TPOA 1FIWA 3ZZ5A 1MQ5A 2ESTE 2XYAA 3FANA 3TITA 3BTEE 3MH5A 1BTUA 2HWLB 1LPKB 1XX9A 2W7SA 3UFAA 1C1QA 4DIHH 4JMYA 4I8GA 3E3TA 3MU8A 2ZFFH 1C2FA 1GHAG 2PKAB 3GICB 3K9XB 1A4WH 1F5LA 3EA8A 4Y71A 1MTWA 2Z9GA 3UNSA 4Y10E 2ZU3A 2NU2E 2H9EH 1WSSH 2P93A 3A85A 1O2JA 1PPBH 1FPCH 1KXAA 3KNXA 1O3NA 1CHOG 3GY7A 3KGPA 3VGCC 2B8OH 4O9VA 1PYTC 4JZ1A 3SGBE 1KSNA 1QY6A 1EZSC 2BD7A 3S9AA 4OS2A 1TBQH 1P05A 1O2IA 3MNXA 2HPQH 2OINA 3SORA 4K2YA 1UTNA 4FUGA 2AGGX 3RXJA 1NROH 4AZ2B 5JB9S 1GVLA 1G3DA 1ZSJA 4A92A 1MUEB 2H5CA 4ZROA 3A8DA 1EZUC 1QA0A 4U01A 3T29A 3BEFB 2WUCA 5E0JA 2BB4A 3TGKE 3RC5A 2ZC9H 3A7VA 3PMJA 5CHAC 1O38A 1GBMA 1FLEE 1GI9B 1WBGB 2R0LA 1C5ZB 1E37B 2G81E 2NWNA 3EAJA 4YM9A 2HVXA 3MO3A 3TH2H 3RC6A 3UWIA 5EODA 3M35A 1AB9C 2V6NA 4XDEA 2FXRA 2XCNA 3P8OA 4ABAA 1GJ5H 1BTYA 2A7HA 1THPB 1HAVA 7KMEH 3BG4C 3BV9B 1T7CA 1SQTA 2GVFA 3SU6A 1XVMA 3MH6A 1D6WA 3FZZA 4CH8B 5BPEA 1AKSA 2NU0E 2PW8H 1SHHB 3ODDA 3RM2H 2H1UA 1B0FA 3FP6E 1ZR0A 1FXYA 3U9AH 1FDPA 2ASUB 3EQ0H 2FO9A 1ARBA 4FU8A 4O3UA 5T6FA 1OPHB 2C8ZB 1GJ8B 4A5TS 1IQGA 2XRCA 4BAKB 5AFYH 1OP8A 4ZHMU 5JYIA 1Y5UT 1L0ZA 4D7GA 3LPRA 3RMNH 4XE4A 4DCDA 2AYWA 1AUTC 4NSVA 3TIUA 1CT4E 2JETB 3MO9A 3GY2A 1DUEA 5PTPA 1AZZA 1IQMA 1SLXB 3GDVA 1BOQA 2DUCA 1BMMH 2F91A 2W3IA 3LKWA 1DLKB 1NM6A 4X8TH 2O9QA 5HM9A 4HI3A 1FY3A 2QXJA 1ESAA 3ZZAA 4IC6A 1P10A 1UTKA 4ABEA 2STAE 1O37A 4CRDA 5GDSH 1B0EA 2AIQA 4GCHF 2BMGB 5JBCS 1HBTH 4KELA 4RSPA 3KL6A 3RXDA 1QJ6B 1CVWH 1EAUA 5GCHG 1N8OB 4GCHG 2F83A 1FQ3A 3E91A 1O5CB 1TGTA 1HJAC 1UVTH 1P02A 2ZGXH 5CE1A 2C4FH 1DXWA 2HRVA 2ALVA 1PPCE 1Q2WA 1OSSA 1NFYA 2XC4A 4TY7A 2VH6A 1CGIE 1ELAA 1TABE 4CHAC 4JYUH 1O2UA 3A7WA 1V2UT 4ZKNU 1GG6C 1CA0B 1QL8A 1YCPH 3GY3A 4WJG2 4UFFH 2G5NA 1L1GA 1C1RA 3LGYA 4LZ4B 3D49H 4IBLH 1NRSH 1QQ4A 1O36A 2OUAA 2RDLA 3Q3KA 4PROA 3U1IB 4FU7A 3KQBA 4SGBE 2AGIX 2V3HH 1YPGH 5J4QA 2R3YA 1QB1A 3TNTA 4GPGA 2RG3A 3LU9B 4XBBA 2FOGA 5A0CA 3SQEE 3M36A 1CQQA 1UTOA 1MTNB 4LXBH 1ID5H 3S7KB 1TQ7B 1ELEE 3A88A 2ZNKH 1O3HA 2ZGHA 2FPZA 3QWCH 1Z8GA 2G8TA 1LDTT 2XWAA 3UUZA 3SV2H 2ZO3H 1AHTH 1XUKA 2A1DB 1NZQH 1GBDA 3ZVCA 1FY1A 1TOMH 3MTYA 1YP9A 4ISIH 4GUXA 3LDXH 2BLVA 3MOCA 3L6PA 3F9HA 2AIPA 3ZVBA 4MVNA 1AWHB 1AZ8A 3SUFA 3A80A 2F9NA 3M7TA 1TFXA 4MG3A 1V2OT 1LQDB 2IPHA 3QTVH 2J9NA 1C5SA 1TE0A 5ESBA 4BXSA 2ZU1A 1T8LA 3M3VA 1GI0A 2KAIB 2QXHA 1O32A 2B5TB 1IOEA 3ATLA 2A4GA 1V2ST 3SHAH 3SNEA 4MNXA 1THSH 1ZTLA 1YPHC 3S0NA 3RXVA 3U8TH 3RMLH 2QIQA 4K8BA 4YESB 2VIQA 4BAHB 2BY9X 1SFQB 1LHFH 4K69A 3RDZA 2Z9KA 1WUNH 1Q31A 3LGIA 4JZDH 3UOPA 3VEQB 4YOGA 3OY6U 1HPGA 1RXPA 4INLA 1F0UA 1GHWH 1AB9B 1YCPK 3LIWA 2VIWA 2B0FA 3E1XB 4X8SH 3EA9A 3RM0H 1SB1H 3ZZ7A 1FMGA 3SJKA 4MNVA 1IQLA 3RXHA 1W7XH 1IQFA 1LVYA 2Z3DA 1EPTC 1GMHG 5DP3A 2BOKA 3CS7A 3MU4A 1L4DA 1T4UH 1AE8H 1KLTA 1LHEH 2FS9A 1V2JT 3TVJB 6LPRA 2J92A 1TNJA 3QUMP 1UVOA 1SGIB 2TIOA 2W5EA 3V13A 1V2VT 1B5GH 1A61H 1LVBA 3OSYA 1GHYH 2A31A 2Q6FA 3A81A 1UHBB 1HUTH 3K2UA 2A4OA 4TY6A 4R0IA 4GHTA 1V2NT 2GX4A 2BVSH 4IN2A 2RA3A 1SHYA 4TPYA 1GBBA 4H6SB 2Q6GA 1S5SA 4FUDA 1WQSA 1FZZA 1YPKH 1B7XB 4WMDA 1P04A 4JZEH 1TGNA 1S81A 1O3AA 4ZXYH 3A7YA 2UWOA 4XBDA 2G4UA 3TPIZ 1OKXA 1P8VC 4AFSA 1DE7H 3RXLA 2P3FH 1RGQA 1KDQA 4X2WA 3GOVB 3IG6B 3DUXH 1BMAA 1KIGH 1IQHA 4NIWA 1A46H 2R2WU 3JZ1B 1UTPA 1C5QA 2ZHFH 1S6FA 3BTWE 4H6TA 3SW2B 1FPHH 1IHTH 1ORFA 3GCHC 2AEIH 4Y8ZA 2PTNA 3UY9A 1S0RA 5HMAA 1GMDF 1H8IH 3MYWA 3A82A 4FUHA 5EU8A 5C5OA 1GHZA 2PUQH 3BTGE 4E7NA 3GYMA 1S6HA 1N6YA 3MNSA 4NFEA 1HJAB 1QQUA 1JOUB 2CV3A 4Q7YA 1XUIA 3C1KA 5T3HA 1GI3A 1MD8A 3AVZA 1KXBA 5C1UA 4UEHH 5A2MH 4WWYA 1C2IA 4OGXA 1DVAH 1D9IA 4INKA 4K3JA 1O2RA 2ZTYA 1P06A 4D7FA 1GJ4H 2SFAA 1MKWH 1FONA 3UNQA 1GG6B 1AMHA 3AASA 3MNCA 3E6PH 3RXSA 5SGAE 4D76A 3ATMA 4BAOB 1DWCH 1EJNA 1QGFA 2VU8E 2GCTC 3OU0A 1O2WA 5FCKA 1W11U 2NU3E 1EZQA 5FPSA 2Q1JA 3T26A 4DURA 1GI5A 4GSOA 3EGKH 1WAYB 2BVXH 1ETRH 1BRBE 2OD3B 1LHGH 2ZGCA 2H5DA 2NU4E 2Q6DA 2ZHQH 2WPMS 4Y8YA 3R0FA 4ZHAA 3FFGA 4X1NU 1TB6H 2ANKH 5E8EH 2Z9LA 1EQ9A 2A0QB 1GMCG 5JBTA 1SFIA 2PFEA 2ZFRH 2EA3A 4NFFA 3F9GA 1GJBB 1G30B 1RIWC 1G37A 1QNJA 2VVUA 3M3SA 3LONA 4YTAA 3SV9A 1PFXC 2C8XB 2FYQA 3ITIA 4U30A 4B2AA 4TWYA 4MTBA 2QXIA 3HGPA 4A1XA 1C9TA 1Y5BT 3H7TA 1O3MA 1LO6A 1ZSKA 2FX6A 1C4V2 2ZFPH 1MU6B 4AGJA 2Z7FE 1EATA 3GISB 4X1PU 1C5MD 1FY5A 1TNGA 5EW2H 2FP7B 2H9HA 3NXPA 2JETC 2XWBI