2G55A

Anomalous substructure of trypsin (p3121)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title On the routine use of soft X-rays in macromolecular crystallography. Part IV. Efficient determination of anomalous substructures in biomacromolecules using longer X-ray wavelengths.
pubmed doi rcsb
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g55A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g55A02
1O2VA 1RJXB 1HAVB 2AS9A 2H9HA 3SV6A 1WTGH 3P17H 2D26C 3SGAE 5EPYA 1QHRB 5C1XA 5JYIA 1KXDA 3SNCA 1TFXA 2ZIQH 2FS9A 3M7TA 1T8OA 1UVOA 1A61H 3ZZCA 2WV5A 3KQDA 3FFGA 3T27A 1C5OH 3SNAA 1Y3VA 3TNSA 4AOQA 1FJSA 3E90B 5T6FA 1L2EA 2TPIZ 4OS4A 2VWNA 3DT0H 4ZXYH 1HAGE 2HLCA 5E2PA 3BEIB 5C1YA 2ILNA 1U6QA 4D76A 1HPGA 1GHBF 3PLPA 3ENSB 1BRAA 1W2KH 1SGDE 3T26A 3RXGA 4X2WA 4FUFA 3ESTA 4I8HA 2PKSC 4WVPE 3ZVCA 1TWXB 1SB1H 1D3PB 1NTPA 2A2XH 3RXSA 2ASUB 3BTKE 2PKAA 3PYHA 1GCTC 1O2WA 3KCGH 1GDUA 2Y6TA 2W3IA 1T7CA 1TNHA 4FUJA 1DUEA 3MO9A 5AFZH 4VGCC 2P16A 4I32A 1GI9B 3MO6A 2A31A 2G5NA 1OPHB 1ZZZA 3RU4T 2BOKA 2OD3B 4TWWA 3SO3A 3F9GA 2ULLA 3Q76A 3U9AH 1GJAB 1BT7A 3SW2B 4FU8A 2C93B 4WXVA 3ZZBA 4MNXA 2GT8A 2ZA5A 2FX4A 2A2QH 2ZDMA 8KME2 3MU8A 1BTZA 2BZAA 3GYMA 1W0ZU 5A0BA 3RM2H 3LGIA 1MU6B 1QBNA 3RU4E 3MH6A 4ESTE 1KLJH 4FUGA 1SQAA 2V0BA 1T32A 3GCTG 1F5RA 3PMBB 1XXDA 2ALPA 2HRVA 2P59A 4ZAEA 1UCYH 3V12A 1Z1JA 4X8UH 2F9BH 2SFAA 3U8OH 2Y5GA 1VITH 1CBWB 2VWOA 1SGPE 4DGJA 3LC5A 1BIOA 1GG6B 1ZGVA 1W13U 2AMDA 1JXPA 1ETTH 4BNRA 2VH6A 1AO5A 1NRNH 3VGCB 1O2OA 3E16B 1YPKH 2A5AA 1Q2WA 1TGBA 1K2I1 5CHAC 4MPXA 1QJ1B 1CGJE 1DXPA 5K0HA 1GMCF 3A84A 2QC2A 2VIWA 4WF8A 1KXFA 1HLTH 3ELAH 1ESTA 5B6OA 4SGBE 1HJ9A 3ODFA 1HUTH 2PR3A 3GCHC 1PQ8A 4X2VA 1DFPA 2ZO3H 2FOBA 4DURA 5TJXA 3PWCA 3TU7H 2GTBA 4RKJB 1ABJH 3QZRA 1C5LH 2LNCA 2CHAC 1ZLRA 1TA2A 4ZKSU 3QN7A 1SGRE 1WBGB 2F3CE 3KN2A 3SQEE 4O03A 1BRBE 3S9CA 1O2ZA 4BXWA 1F0SA 3I77A 3ZYDA 4CRCA 1HRTH 1GI4A 3F9FA 3RP2A 2ANMH 2ZPQA 4THNH 2ZDAH 3F6UH 3M5MA 4ZHAA 3ZZ4A 1N8OC 2QF0A 2QYIA 1B5GH 4RKOB 1IQLA 4IC6A 5C3NA 1PPHE 2F91A 2D2DA 1H8DH 1GI1A 4DY7B 3SU6A 2PSYA 2GZ8A 2HNTF 1K1MA 3TGIE 2R9PA 1HCGA 2XBXA 4LZ4B 1UTPA 1KXEA 4HTCH 2A5IA 1PQ5A 1WTHD 1MTSA 1V2OT 2HOBA 4Q7ZA 1O2XA 2FYQA 2PKAB 3QZQA 3CP7A 1GI2A 3SV2H 4GLYA 1F0RA 1RTKA 1LVMA 4BAKB 4CBOA 1PYTD 4JZ1A 3P92A 1AU8A 1OKXA 1NN6A 3TNTA 4WY3A 5C5NA 1BA8B 3SHAH 4SGAE 2VGCC 1LHEH 1QRWA 2OXSA 1AFQB 3RXVA 1DT2A 1YPMH 2VVUA 1AVGH 4O97A 2FM2A 3Q77A 4JK6A 2H9EH 1PJPA 2J92A 1QRZA 1B0EA 3FP8E 3TJNA 4HI3A 2YNAA 5CE1A 4IN2A 4ABAA 5A8ZA 4Y8ZA 4A7IB 1WQSA 4CR5A 2Q6FA 1GHXH 1GI7B 5C5OA 3KF2A 1O2YA 3M7UA 1DITH 2W7UA 1LHGH 1FPHH 1IQKA 1SMFE 3A7TA 4WH8A 3RXLA 5AVDA 1Y5BT 2V3HH 3SV9A 3MU1A 3GDVA 1NRRH 2AH4X 1Y8TA 7LPRA 4ZKNU 1Y3XA 2BQ7B 1C1PA 1GBMA 1ESAA 1G3CA 2H9TH 2BDBA 1UK4A 5I25A 4ZXXH 1DX5M 2VWLA 2A7JA 5L30H 1ZMNA 1SGQE 1ZPCA 4RN6A 2G55A 4AGJA 2O8TA 3AASA 1CHOG 1RD3B 1KXAA 1SGYE 3MHWU 2AIQA 4XBCA 5LGOA 1ZPZA 2A45B 2OC8A 2STAE 2WUBA 1C2FA 4TPYA 1K1JA 4INKA 5F8ZA 1C1UH 3ATMA 4X6OA 4ASHA 2XC4A 1Z6JH 1HB0B 2HGTH 5SGAE 3RXRA 2BOHB 5EQSA 1CGHA 1EZSC 3RXOA 5J4QA 1L4ZA 1BMNH 3K65B 2JH6D 3FANA 1OYTH 2XNIA 1K21H 2PKSB 3M7QA 1MAYA 1OP2A 5IDKA 2FOGA 3UWIA 3SU5A 1SLWB 2FLRH 2DUCA 2ZNKH 3GDSA 3GISB 1E36B 2AGEX 8ESTE 3QTVH 3UFAA 4JK5A 4X6PA 1DVAH 1DWCH 1UTKA 5GJ4B 4VGCB 4BTUB 2EI6A 3SN8A 2A4OA 3P8NA 3LH3A 2C3SA 1CO7E 3PLKA 1G3DA 1DS2E 1LTOA 3PTBA 4O3UA 1O31A 1SPJA 4JZFH 4DJZB 1P9SA 1ZTKA 2VB0A 2ANKH 4AFUA 4OGXA 3PLBA 2Z94A 5DK1A 2GKVE 3IITA 3OTJE 1YCPK 3RC5A 2IPHA 2ZFTA 2AEIH 3H7TA 1K1PA 3SNEA 3F9EA 1K28D 2NU3E 2H6MA 1DXWA 3Q3XA 1BRUP 2OTVA 2OINA 1IQNA 2UUFB 1W10U 2NWNA 3BSQA 1TX8A 1HDTH 1SHHB 1XMNB 1KTSB 2Y5FA 2ZWLH 1DLKB 2FS8A 1G2LA 1FY1A 2OLGA 3RMLH 5FBIA 2ODQA 4I8KA 2IOTA 4I8JA 3GY2A 2XBVA 3QX5H 1O5DH 1QFKH 3KQBA 4NG9H 3BTDE 3NK8A 4BANB 5EXMA 4WMFA 3RXMA 2F9UA 2QAAA 3SHCH 3DUXH 3TITA 3RXFA 2Z9JA 4GHQA 1CBWC 2Z9LA 4NCYA 4D7GA 1GG6C 1TMBH 2J95A 1AE8H 1SG8B 2V6NA 4NZQA 4Q7YA 1ZJKA 3ZVBA 1Z1IA 3BTWE 1O3MA 3BTQE 2HNTE 1KXCA 1D6RA 1KY9A 1MCVA 4AGKA 4CRBA 1ZSLA 1LPGB 1IQHA 1TLDA 2VIPA 1ZSKA 1TNKA 2UWOA 5FX5A 2ZDVH 3URDA 2PV9B 1INCA 2A1DB 1QL8A 1BBRK 4NIVA 1DWBH 3LGWA 1QR3E 1BRCE 4E06H 3SJ8A 4AYYB 5E8EH 3BTTE 1GHZA 1CSOE 1PPBH 2A7HA 5L6NH 1S5SA 1K22H 4KKDA 1G36A 4KELA 4B2CA 1BTYA 1TMUH 2BD9A 2ZHWH 1P0SH 2ZPRA 1S6HA 2NU1E 3RU4D 1AUJA 3O8RA 2BVSH 1O3JA 5EPNA 1TAWA 3MNXA 2AFQB 4IBLH 4JZDH 2G51A 2ESTE 1N6YA 4Y7AA 4X2XA 1V2JT 5FCRA 1B7XB 3FAOA 3V3MA 1BDAA 1P04A 2ZTZA 2BXTH 2WUCA 2ZGHA 3N7OA 2BD3A 3QLPH 4AFZA 7GCHF 1LHFH 1AIXH 2CF8H 3S9BA 2O8UA 3SUDA 1AE5A 5GWZA 2B8OH 1IQGA 3KQEA 3WY8A 1MD7A 2XBWA 2XWAA 3SU2A 3SBKA 3E0NB 4HGCA 4MNVA 1OOKB 3LT3A 3GY7A 5AHGH 1ZTJA 3RXBA 2P95A 3H5CB 1FY8E 1F5LA 3ZVAA 4AB9A 1PYTC 3TJVA 1GBKA 3SI3H 2HNTC 1A5GH 1PQAA 4FUHA 4BAOB 1THRH 1VITG 5EXLA 1GJ5H 3E8LA 3GY5A 3LPRA 4TY7A 3UOPA 5A8XA 3BEFB 2QGRA 1AFQC 2JH0D 3PTNA 3U1IB 2BLQA 1NU9A 3E1XB 3SU4A 1GBFA 1BCUH 1XVOA 4A92A 1FQ3A 4B74A 4OS7A 1O39A 4DCDA 5A0AE 1XM1A 2ZKSA 3ZVGA 1UHBA 2BDIA 3LOXA 5GCHG 1GCDA 3ATWA 2BDHA 3ITIA 4WWYA 1QJ7B 1V2LT 1EP6A 2BX3A 7KMEH 1H1BA 3LC3A 1P9UA 1GJ7B 2PW8H 1G30B 1O2SA 5EW1H 1D3QB 1W7XH 2A4QA 2BZ6H 3E0PB 2WPJS 4WJG2 1C4Y2 1HJAB 1NRQH 1O36A 1VGCB 1IQFA 1P3EA 4XBBA 1ZMLA 4MPUA 1MKWH 4B76A 1O3FA 2NU0E 1DM4B 2H2ZA 1GBHA 3SJKA 3A8CA 3MU4A 2ZDKA 1CU1A 2OUAA 1LVYA 1GJ6A 1TGNA 1GDQA 1K1IA 1AWHB 5ESBA 1QGFA 1FMGA 3OX7U 1C5MD 1S83A 4J2YB 5FPSA 1TPAE 1C1SA 2STBE 4DIIH 2C90B 1HGTH 1Y3UA 3OYPA 1MTVA 1O32A 5ETXA 1EB1H 3OY5U 1G3BA 1NFXA 1YGCH 5JB9S 2G52A 3T25A 1O5CB 2AMQA 1P2OA 1DSUA 4X6MA 1G37A 3PO1B 3ZVEA 4X2YA 2XXLA 4NSVA 1TBZH 2ZHQH 1GBBA 1O3HA 1J16A 3ATKA 3TGJE 1JWTA 3FP7E 1QURH 2R2MB 1WU1A 5HYOA 1DUAA 2ZTXA 4LXBH 1NT1A 1E37B 5AFYH 1K1NA 3BTME 2P94A 4NWLA 2VVVA 3BN9A 4YLQH 3UUZA 3BG4B 4NA8A 3U98H 1V2ST 3GCTF 3ZZ9A 1AZ8A 1TRNA 2V35A 5C2ZA 3ZZ8A 1KYNA 2ZQ1A 2QXHA 2HPQH 1Y5AT 1QB9A 4GSOA 5F8XA 3K6YA 3STJA 4YO9A 3UNQA 4BTIB 3M5LA 4JYUH 3A7WA 4ZHLU 4UD9H 1ZOMA 3TK5A 2VJ1A 2QN5T 1O3DA 3EGKH 1T31A 1GI3A 1LKBA 1C1VH 1EASA 4ABJA 2HALA 1O2HA 1KLTA 4AB8A 2NU2E 2XRCA 2ZP0H 1H9HE 2FZZA 2RDLA 1O3OA 5BPEA 1WOFA 1C5NH 4MTBA 1V2RT 5C67A 5FAHA 1ANBA 2O8LA 4K8BA 1O2UA 1ETRH 1EATA 5A09A 2J9NA 1LVOA 1C2KA 1KDQA 3A8DA 3KIDU 3SJ9A 1SGFG 2GZ9A 4K69A 1NPMA 5I46H 4I31A 3EA8A 1O2JA 3A83A 5JBCS 2A4RA 3ZVFA 1YPHE 2VNTA 5DP7A 2G4TA 1BTXA 4A6LA 2VIOA 1P01A 1H9LB 1OYQA 1MQ6A 2P3TB 2TGTA 3SQHE 4INHA 4HFPB 3ATLA 2Y7XA 3A7ZA 1YCPM 3A86A 5DJ7A 2F9PA 2PHBA 3ATIA 4D8NA 1P3CA 1UCYK 3HGPA 5HXFA 1UHBB 1LCYA 1XKBC 4Y8YA 1EPTA 2QV1A 3SNDA 1RTFB 1Q31A 3NCLA 2Y7ZA 1TPPA 3P8FA 4FXGH 5DP4A 4AZ2B 2ZFSA 2ZHEH 3LU9B 9LPRA 4YZUA 2FPZA 3SUGA 2EI8A 3EA9A 1G3EA 1GBEA 4Y10E 1QB1A 4ABBA 1EAXA 4IGDA 2BQ6B 3Q00A 2LPRA 4IMQA 5HMAA 2VU8E 1PPZA 3AVZA 4UE7H 1D3DB 1GBLA 2UUKB 3A85A 2AYWA 1Y5UT 1Y3WA 2C8ZB 1LKAA 2W26A 4U30A 4K8YA 1NM6A 4A1TA 3F1SB 2IJOB 1BMMH 1UJ1A 1ZRBA 4ZHMU 5ABWA 2GZ7A 2JETB 4XDEA 4B71A 1LQEA 2XTTB 2BM2A 4FVDA 1L1JA 3UNSA 4AYVB 2ZGBH 1O33A 2ZU3A 2R3UA 1LHDH 3RLWH 4ZKOU 4MLFB 3E91A 1A0HB 4JMYA 4K3JA 1MCTA 2THFB 1GMHG 2EC9H 3MFJA 5GPIB 4ZKRU 5FXLA 1TIOA 1BQYA 1JOUB 1XUJA 4O3TA 2ZG0H 1ANDA 1HAZB 2R2WU 1F0TA 1N6XA 1WYKA 4UEHH 3SJIA 4BAMB 1CT2E 1ID5H 4K1EA 3KHVA 1SGNE 4FUIA 2FOCA 1V2QT 4UONA 1QB6A 1W3CA 2C8WB 4YT7H 1O3EA 3DD2H 4A1XA 5L2YH 2DE9A 3MO3A 1JRTA 1ARCA 3RMNH 1P8VC 1BOQA 3TJUA 1ELAA 3UPEA 5F6MA 1BJUA 1CHOF 5DP5A 3KNXA 4DT7B 1CQQA 1VR1H 4B2AA 4MVNA 5IYTA 1THPB 1H4WA 3EE0B 3RXPA 4ISNA 2GDEH 2QXGA 1DOJA 1Z7KA 4U01A 7ESTE 1C5WB 1ELTA 1UK3A 1DICA 4FUDA 5JBAS 1F92A 1S81A 1ELCA 4NIYA 1HAOH 5T6GA 4ABIA 1BTHH 1KDQB 3Q3YA 3FZZA 1P02A 2OQ5A 1O3NA 1GJ8B 1OWIA 3A8BA 1GVKB 3EDXB 2WYJA 3K9XB 3A88A 1GBDA 1P2JA 1SC8U 1XXFA 4AG2A 2FOEA 2TIOA 2H5DA 4GUXA 4LK4A 1C4U2 1OWKA 1VJAU 1O34A 2A32A 5DP6A 1HJAC 1C1NA 1VGCC 3A8AA 3ZV8A 1TGCA 5HM9A 3VXEH 5A8YA 2EA3A 2XWBI 1A4WH 3LKWA 4YT6H 3GY8A 2AMPA 1O2GH 1MZAA 1TYNA 5A2MH 4Y76A 1QRXA 2ZZUH 2F9VA 2FLBH 1H9IE 3BIUH 4QT8C 1MBQA 3U1JB 1C1WH 3PMJA 4MDSA 3RXQA 1TPOA 3DFLA 4UFDH 1P10A 1D9IA 4UFEH 3NXPA 4B2BA 1V2WT 3A7XA 1KSNA 4FU9A 4Q2KA 2GX4A 1GHVH 3M3TA 1HIAA 3UR6A 1O3BA 2JH5D 1W0YH 3VB7A 2BTCE 2ODYB 3M3VA 1EAUA 2Y5HA 3M61U 1DPOA 1PPEE 1DDJA 2VIDA 1V2MT 5EOKA 3NPSA 3V0XA 1V2KT 1TX7A 2UWLA 1RTLA 1GDNA 3PO1C 3UR9A 4X6NA 1C1OA 4X1PU 3EAJA 2TGAA 1S82A 2BLOA 4XE4A 4TYDA 3RXHA 1ESBA 1P2NA 2BD4A 1G2MA 1TNJA 1VCQA 1C5RA 1YPJH 3IG6B 5TCAA 1A5HA 1GWAA 1UK2A 1IQEA 1O2PA 3EYDA 2FI3E 2HWLB 3BG4C 1GMDG 1D4PB 1FUJA 1IAUA 3S0NA 1WCZA 1PPGE 1QA7A 4O9VA 2BMGB 1GJ4H 1NRPH 4D9QA 3SU3A 1UVTH 1GL0E 3HPTB 3AAUA 4WMDA 2VIQA 5E0HA 1OP0A 1FIWA 1AD8H 3SGQE 2GP9B 3L33A 1WAYB 1YYY1 3RXIA 4FUCA 1LVBA 1Z8IB 1PPCE 1YM0A 2A5KA 1CA0B 3BTEE 1O0DH 2OC0A 1XUGA 1ACBE 2Y80A 1ETSH 1ZMJA 3CS0A 2CJIA 3MYWA 1HAXB 4AG1A 3C27B 3KEEA 1LO6A 2ALVA 3RUOA 2Z9KA 1OX1A 3B9FH 2SGDE 1C2MA 4E7RG 4NA7A 3MOCA 2BVXH 2QCYA 4DOQA 1O3LA 1Q3XA 2GCHG 4A1VA 1F5KU 3HK3B 1CT0E 1SR5C 2ZF0H 1YKTA 3GY6A 1FV9A 3QDZB 3DFJA 3UQOA 1O2IA 4R0IA 3KL6A 4GAWA 3W95A 5LPFA 1PPFE 5FPYA 2M5TA 3UNRA 4X1NU 4UDWH 1FXYA 1TMTH 1EUFA 3OU0A 4DVAU 1VZQH 4CRAA 1BBRE 3E3TA 3UIRA 1UVUH 3GY3A 1XKAC 1A7SA 9ESTA 1OXGA 4R8TB 1O2QA 2TRMA 4XSKU 4Z0KA 3QK1A 1C5QA 4ABEA 1XX9A 1XUIA 1ZHRA 3VB3A 1TNLA 2WV4A 1W14U 2FIRH 3FP6E 3TVJB 1OSSA 4H6SB 5G4BA 3RC6A 3D49H 2ZFPH 4H42U 1IOEA 1AVXA 1FPCH 1AWFH 2GGVB 3CENA 3SUFA 5CMXH 1FONA 4A5TS 4CHAB 2AGGX 4JYVH 1P2KA 4CH8B 1GHWH 3BIVH 2WPIS 3TK9A 3FVFB 1TONA 1AZZA 1K1OA 2OC7A 4AFQA 1ZHPA 2ZU2A 1P09A 4ABDA 1TRYA 2O8WA 1VITF 2PWXA 3RC4A 1TOMH 1HIAB 2WPKS 4H4FA 3SOSA 3A80A 3TLOA 2FOMB 2Q1JA 4HZHA 1ZJDA 2FOFA 2JETC 4OS6A 4ZH8A 2C4FH 2PGBB 4MQAA 1MKXH 4ISOA 5LH8A 2FOHA 2ZQ2A 4I7YH 3NWUA 1HXFH 1YPEH 2P3FH 5EODA 3SI4H 1EOLA 5GCHF 1AI8H 4ZMAH 1O2MA 3BTFE 1UVSH 1TGSZ 1P05A 3S7HB 1VCPA 5FBEA 1S84A 1EKBB 1ANCA 1S85A 2Z6BD 4BAQB 3OSYA 1TOCB 2ZTYA 3SV7A 1C5VA 2GDDA 4RSPA 1BTUA 3ZZ3A 1TNGA 4JZEH 4YM9A 2AIPA 5BRRE 2ZDLA 1T4VH 1O2TA 2H5CA 5DO4H 3LH1A 2UUYA 1SFQB 4LOYH 1NROH 3V7TA 2ZC9H 3W94A 1HAPH 1G32B 1AUTC 3RMMH 3M35A 1RXPA 3U8TH 1V2PT 5JB8S 4Z6AH 1LHCH 2ZEBA 3LJOA 3SJOA 1CA8B 1FI8A 2CXVA 3K6ZA 3TH2H 1O3GA 3F9HA 3S9AA 1MQ5A 3BV9B 3STIA 5AF9H 4MNYA 1MUEB 3RLYH 4TPIZ 3D65E 1P11E 1JMOH 5F03A 6GCHG 5FCKA 1ELGA 3B23B 4F49A 1C2JA 1C5PA 1YLCA 3F68H 1A0JA 2J38A 2GT7A 2PUQH 2ZECA 1SLVB 1TPSA 6ESTA 2G5VA 2UWPA 1HV7A 2RCEA 1HAYB 1GGDB 3MNBA 1P2QA 1IQJA 4K60A 1A2CH 3C1KA 2ZHDA 1MMJN 3GCNA 3MH4A 5EU8A 5T6DA 3S69A 2GD4B 3O8CA 5E0GA 1Z6EA 1QBOA 2W5EA 1HAHH 5F8TA 1AKSA 5FPTA 1FAXA 1TA6A 3ZZDA 2SGEE 1WSSH 1AMHA 1EOJA 4YOGA 3R0FA 3VXFH 2G81E 1SQTA 2FODA 5L2ZH 2WPMS 1MKWK 1YPGH 3B8JA 2G4UA 4ISLA 5EG4A 2BQWB 1Z8GA 3SV8A 1ZYOA 2I6QA 4OS5A 1CHGA 1GI5A 5H4IB 1TB6H 1EPTC 1GI8B 4IN1A 3T28A 4MPWA 1SOZA 2SGPE 1GBCA 1ZRKA 2BY5X 2AERH 3P95A 1CT4E 1SQOA 1NFYA 1RIWC 3M36A 8LPRA 1DY8A 2BB4A 1SLUB 3OY6U 2QF3A 1EB2A 4M7GA 2GVFA 1FN8A 4AX9H 3TK6A 1YC0A 2V3OH 2D8WA 2P8OB 2PUXB 3QWCH 1EJAA 1GHAG 3RXKA 1GJCB 1UTNA 2KAIA 2CF9H 4K1TA 1C1QA 3PMHB 4IW4E 1D3TB 8GCHG 2BXUH 1WUNH 1UMAH 2VWMA 1XUKA 1TALA 4DG4A 1P03A 1GBIA 3GICB 1DWEH 3TJOA 1SOTA 3VPKA 4GCHG 5EGMA 4MPVA 1GJDB 1O3PB 2Q6DA 3PROA 4PROA 2ZFQH 1RRKA 1IHSH 2JKHA 1TE0A 4Y0YE 5GDSH 5EQQA 1YBWA 3RMOH 1SLXB 3L6PA 1FY4A 2XW9A 3UOUA 1E35B 3K2UA 3MMGA 3HATH 2B7DH 3BG8A 3R3GB 2J34A 3RXUA 4AN7A 1E34B 1AFEH 3BTHE 3GOVB 5HM2A 1SGTA 1UTQA 1V2UT 2OC1A 3O8DA 4Y7BA 1CA0C 1QL7A 1QA0A 6CHAC 2XYAA 1AGJA 4B75A 4X0WU 3E6PH 2B9LA 1HJ8A 4ABFA 3TH4H 1E38B 4YLUA 2BYAX 2SGAA 1C2DA 1P2IA 1FLEE 2C8YB 1XUFA 1UCYE 1GHBG 2PTNA 4FUBA 1NU7B 4LZ1H 3RXCA 2GMTB 1DY9A 2XC5A 3A87A 1OWHA 1GPZA 3T29A 1MAXA 1Z71A 1OWEA 1W8BH 4U32A 5PTPA 3ZZ7A 1S0QA 3A82A 1O5FH 4INLA 2ZGXH 3GCOA 1BTWA 2CMYA 2R0LA 2FEQH 1GVLA 1Y59T 4CREA 4JCNA 1DWDH 1VCWA 3RDZA 2ZGJA 1TABE 4KTSA 2ZHFH 2BD2A 1O35A 1AVWA 2ZCLP 5K7RA 3PMAB 1C5XB 3TPIZ 1ZTLA 2BY7X 1GMHF 2QIQA 1LPZB 2P3UB 2Z9GA 1RS0A 4UFGH 1C1RA 1O5AB 1ZSJA 1QQUA 1LDTT 4JYTA 3QGJA 3I78A 4ABGA 3M5NA 1MTWA 3LIWA 3VB6A 1TBRH 1EZUC 1YPLH 5DP8A 3UY9A 1OS8A 1UVPA 1O30A 2Z7FE 5DP3A 1AKSB 1GBJA 4CHAC 1G9IE 2A0QB 4CRFA 2ZCHP 3A89A 1AB9B 1PFXC 2EEKA 1HAIH 2RA3A 2HPPH 2OBOA 2FI4E 1NZQH 1JBUH 1O2KA 4YESB 3HKIB 5EW2H 1O38A 1N1LA 1C5SA 4H6TA 3LGUA 3HKJB 2XCFA 3ODDA 4OS2A 1FDPA 2BY8X 3RXJA 3ZV9A 2F9NA 1YPHC 2ANYA 1ZPBA 1SBWA 1NO9H 3SU0A 2YOLA 1FN6A 5C1UA 1UTOA 2BHGA 3QGNB 3BEUA 1MZDA 2KAIB 1MBMA 2XC0A 2BDCA 1QCPA 1QQ4A 1TBQH 2QA9E 1JRSA 1GMCG 4J1YA 3TIUA 5FX6A 1O3CA 2EI7A 3BF6H 2ANWA 1C1TA 4ISIH 5EQRA 3T62A 3LGTA 2FOAA 1GHYH 1C9TA 1DLEA 2RG3A 1W7GH 1BITA 1C2EA 1EQ9A 1A3BH 1AQ7A 1T8MA 3A7YA 2SNVA 2G00A 5J4SA 2C8XB 1MD8A 1S6FA 2WINI 1L0ZA 4AFSA 5JBTA 3RXDA 1EP5A 2OBQA 1O5GH 1GI6A 1HXEH 1P57B 2W3KA 3MWIU 1V3XA 1NFUA 3LJJA 3HGNA 2BD5A 2BDYA 1O37A 2Z3DA 3VFEA 3JZ1B 4WMEA 4Q7XA 1ARBA 3LDXH 4BTTB 1VJ9U 1A5IA 1EAWA 4CBNA 2TGDA 2GV7A 4X8VH 3ZZ6A 3ZZ5A 1UTJA 1BTPA 1EJNA 1NS3A 4BXSA 1MTNC 4JZIA 3JZ2B 2ZDNA 3IWMA 2FX6A 5E2OA 1GL1A 1JIRA 3QO6A 5T3HA 4CR9A 2FWWA 3H7OA 5HGGA 1QBVH 3URCA 3M3SA 2W7SA 4CRDA 1A1RA 3G01A 4DW2U 3DA9B 1O2NA 1C5UA 1GMDF 1GGDC 3A81A 3P6ZB 4NIXA 2BLWA 2WPHS 3SZNA 4TY6A 1EX3A 3TH3H 1C5YB 4IC5A 2XBYA 2Z9IA 2NU4E 3T2NA 1SGEE 5LPRA 2BDGA 1C4V2 1GBAA 1EPTB 1V6DA 1ABIH 1GJ9B 2TBSA 2FXRA 1KXBA 1SL3A 1T8LA 2GCTC 1ELFA 4U2WA 4FU7A 1OWJA 1WV7H 1CGIE 2FTLE 1BMAA 1RIWB 1YLDA 2QY0B 2F83A 1EZXC 2FMJA 3S7KB 1F0UA 1E0FD 1S0RA 1TQ0B 1P12E 1T8NA 4NZLA 4B1TA 3PM3A 1V2TT 4Q80A 1ANEA 5C20A 1BZXE 4XFQA 1IQIA 2PGQB 3L3TA 4NA9H 2B0FA 3QUMP 1B0FA 1W12U 4BAHB 1NRSH 3O8BA 3MNCA 1TX6A 4K1SA 3DHKH 1BHXF 1JIMA 1L4DA 3LONA 5FHTA 1ELEE 3P70B 1AHTH 1C2IA 2P8OC 1NC6A 2OP9A 3M37A 2GCHF 2DE8A 3P8GA 1MH0A 3VB4A 2QXJA 1V2VT 1GCTB 1P2MA 1YCPH 1KTTB 5A0CA 3GDUA 1BHXB 1QNJA 1UO6A 2OQUA 1EZQA 1J14A 3NZIA 2Y82A 3EQ0H 3RXEA 1KIGH 1LPKB 3KGPA 3QTOH 1BMLA 3MTYA 2J94A 2BLVA 2BD8A 6CHAB 4I8LA 2GV6A 1TQ7B 1C2HA 1D6WA 5DKMA 2D1JA 4WH6A 1IQMA 5DGJA 2J2UA 1EAIA 2PSXA 1F7ZA 1J17T 1CE5A 2ZI2H 1XUHA 1HYLA 2BVRH 2TGPZ 2O8MA 3A7VA 4GHTA 1O2RA 2A4GA 2J4IA 4DIHH 4IS5A 1ELBA 2I6SA 1RGQA 1T4UH 5GXPA 2Z3CA 2BD7A 2PFEA 3MH5A 3BTGE 1NFWA 2YNBA 4Y71A 3RXAA 2ZCKP 1K9OE 3UQVA 4NWKA 1O3AA 2R0KA 3NKKA 1M9UA 5DG6A 4BOHA 2SGFE 4Y0ZE 2GMTC 1TGTA 4CRGA 4CH2B 1QL9A 1AY6H 2BY6X 3TGKE 3LGYA 1A0LA 3SU1A 2VH0A 1ZHMA 1O3IA 1KLIH 1TNIA 3PB1E 3SNBA 1K1LA 1J15A 4X1SU 1DE7H 5ESTE 2R3YA 4KTCA 2BDAA 1NESE 1OWDA 5EXNA 5CHAB 1F2SE 1OP8A 4X1QU 1DSTA 5E0JA 4K2YA 4Y11E 1BBRH 1HAVA 2CN0H 3M5OA 4WXIA 3SORA 2ZU4A 1SGIB 3VGCC 2VVCA 3NUMA 2P93A 4YTAA 1O3KA 3MU0A 1C9PA 1THSH 3UTUH 2QXIA 2HVXA 5JBBS 2FO9A 1Z8RA 3GCHB 1ZR0A 1FY3A 3PWBA 1C2GA 4X8TH 1QIXB 3RM0H 4D7FA 4MNWA 2FI5E 1C1MA 4ZUHA 4GPGA 4D9RA 4E05H 2CHAB 1XVMA 1MU8B 1ZGIA 3MH7A 1AB9C 1EJMA 1LQDB 1ELVA 1SGFA 4FUEA 3GYLB 2F9OA 2FDAA 3I29A 4KP0A 2SGQE 3MNSA 1W11U 4YOIA 5DPAA 4I33A 1P06A 2A7CA 4NGAH 4B73A 4ISHH 1QTFA 1UTLM 1BUIA 2ZU1A 5JPMH 3U8RH 1SGCA 4KGAA 1N8OB 3UREA 4ABHA 1O5EH 3U69H 5DP9A 4NSYA 1HNEE 2FYRA 2RA0A 2BY9X 3HK6B 6GCHF 3GY4A 1MTUA 1H8IH 4IMZA 1GI0A 2VIVA 4ZROA 1MKXK 1LMWB 1C5TA 1NY22 2PLXA 3UWJH 4NIWA 4I8GA 1SI5H 1PQ7A 3LGVA 4K5ZA 4NFFA 1L1NA 3D23A 1AN1E 4AORA 3VEQB 3Q3KA 1ELDE 2AGIX 5GIBA 2K1QA 3SGBE 3EA7A 3PV4A 3AW1A 1EXFA 2FTMA 5JDUB 4NFEA 1QJ6B 1IHTH 3D62A 2VGCB 2BX4A 3ZVDA 1RFNA 3CS7A 1YF4A 1Y3YA 1SHYA 1UTMA 2B5TB 4XBDA 2ODPA 4TWYA 4KTUA 1FNIA 4X8SH 2O9QA 2Z3EA 2VINA 2OCVB 4X1RU 1SSXA 2SNWA 2FESH 1DANH 6LPRA 1GJBB 3FZDA 1SFIA 2IN2A 1MTNB 1QY6A 1FIZA 1J9CH 3MU5A 3ZZAA 2ZFFH 1L1GA 4OGYA 2Q6GA 1Z8JB 3SUEA 1BJVA 2CGAA 2UUJB 2ZGCA 3VB5A 4MG3A 1V2NT 3V13A 1O2LA 7GCHG 4F4OC 3ZYEA 1CVWH 1C2LA 4UFFH 1FY5A 4Y79A 1FZZA 1WQVH 1GHAF 1HBTH 4FVBA 2H1UA 2FP7B 2PTCE 4Y8XA 2ZU5A 1SVPA 4YOJA 2WYGA 3RXTA 2CV3A 1TRMA 2ZPSA 3AW0A 1FAKH 4GVUA 1J8AA 8GCHF 4Y6DA 5LPEA 1BB0B 2G8TA 3AAVA 1GBTA 1A46H 4XOJA 1O5BB 4OS1A 1GVZA 1YP9A 1ORFA 2GCTB 4GCHF 2WPLS 2XCNA 2Y81A 5TCCA 1HFDA 1X7AC 2ZFRH 4E7NA 3T5FH 3KQCA 1A3EH 3MI4A 1C5ZB 3P8OA
chains in the Genus database with same CATH superfamily
1O2VA 1RJXB 1HAVB 2AS9A 2H9HA 3SV6A 1WTGH 3H09A 3P17H 2D26C 3SGAE 5EPYA 1QHRB 1FX0B 5C1XA 5JYIA 1KXDA 3SNCA 1TFXA 5CHBA 2ZIQH 2FS9A 3M7TA 1T8OA 1UVOA 1A61H 3ZZCA 2WV5A 3KQDA 3FFGA 3T27A 3SZEA 1C5OH 3SNAA 2KX4A 1Y3VA 3TNSA 4AOQA 1FJSA 3E90B 5T6FA 1L2EA 2TPIZ 4OS4A 2VWNA 3ZIAD 3DT0H 4ZXYH 1HAGE 2HLCA 5E2PA 3BEIB 5C1YA 2ILNA 1U6QA 4D76A 1HPGA 1GHBF 3PLPA 3ENSB 1BRAA 1W2KH 1SGDE 3T26A 3RXGA 4X2WA 4FUFA 3ESTA 4I8HA 2PKSC 4WVPE 3ZVCA 1TWXB 1SB1H 1D3PB 1NTPA 2A2XH 3RXSA 2ASUB 3BTKE 2PKAA 3PYHA 1GCTC 1O2WA 3KCGH 1GDUA 2Y6TA 2W3IA 1T7CA 1TNHA 4FUJA 1DUEA 3EE7A 3MO9A 4VGCC 2P16A 4I32A 5AFZH 1GI9B 3MO6A 2A31A 4AC9A 2G5NA 1OPHB 1ZZZA 3RU4T 2BOKA 2OD3B 4TWWA 3SO3A 3F9GA 2ULLA 3Q76A 3U9AH 1GJAB 1BT7A 3SW2B 4FU8A 3N7DA 2C93B 4WXVA 3ZZBA 4MNXA 2GT8A 2IPQX 2ZA5A 2FX4A 2A2QH 2ZDMA 8KME2 3MU8A 1BTZA 2BZAA 3GYMA 1W0ZU 5A0BA 3RM2H 3LGIA 1MU6B 1QBNA 3RU4E 3MH6A 4XD7D 4ESTE 1KLJH 4FUGA 1SQAA 2V0BA 1T32A 3GCTG 1F5RA 3PMBB 1XXDA 2ALPA 2HRVA 2P59A 4ZAEA 1UCYH 3V12A 1Z1JA 4X8UH 2F9BH 2SFAA 3U8OH 2Y5GA 2RFKC 1VITH 1CBWB 2VWOA 1SGPE 4DGJA 2HLDD 3LC5A 1BIOA 1GG6B 1ZGVA 1W13U 2AMDA 1JXPA 1ETTH 4BNRA 2VH6A 1AO5A 1NRNH 3VGCB 1O2OA 3E16B 1YPKH 2A5AA 1Q2WA 1TGBA 1K2I1 5CHAC 4MPXA 1QJ1B 1CGJE 2F4LA 1DXPA 5K0HA 1GMCF 3A84A 2QC2A 2VIWA 4WF8A 1KXFA 1HLTH 3ELAH 5DSFA 1ESTA 5B6OA 4SGBE 1HJ9A 3KYFA 3ODFA 1HUTH 2PR3A 3GCHC 1PQ8A 4X2VA 1DFPA 2ZO3H 2FOBA 4DURA 5TJXA 3PWCA 3TU7H 2GTBA 4RKJB 1ABJH 3QZRA 1C5LH 2LNCA 2CHAC 1ZLRA 1TA2A 3WWFA 4ZKSU 3QN7A 1SGRE 1WBGB 2F3CE 3KN2A 3SQEE 4O03A 1BRBE 3S9CA 1O2ZA 4BXWA 1F0SA 3I77A 3NRLA 4YXWD 3ZYDA 4CRCA 1HRTH 1GI4A 3F9FA 3RP2A 2ANMH 2ZPQA 4THNH 2ZDAH 3F6UH 3M5MA 4ZHAA 3ZZ4A 1N8OC 2QF0A 2QYIA 1B5GH 2XOKD 4RKOB 1IQLA 4IC6A 5C3NA 1PPHE 2F91A 2D2DA 1H8DH 1GI1A 4DY7B 3SU6A 2PSYA 2GZ8A 2HNTF 1K1MA 3TGIE 2R9PA 1HCGA 2XBXA 4LZ4B 1UTPA 1KXEA 4HTCH 2A5IA 1PQ5A 1WTHD 1MTSA 1V2OT 2HOBA 1H8ED 2WPDD 1O2XA 2FYQA 4Q7ZA 2PKAB 3QZQA 3CP7A 1GI2A 3SV2H 4RT1A 4GLYA 1F0RA 1RTKA 2HVYB 1LVMA 4BAKB 4CBOA 1PYTD 4JZ1A 3P92A 1AU8A 3N7EA 1OKXA 1NN6A 3TNTA 4WY3A 5C5NA 1BA8B 3SHAH 4SGAE 2VGCC 1LHEH 1QRWA 2OXSA 1AFQB 3RXVA 1DT2A 1YPMH 2VVUA 1AVGH 4O97A 2FM2A 3Q77A 4JK6A 2H9EH 1PJPA 2J92A 2KCAA 1QRZA 1B0EA 3FP8E 3TJNA 4HI3A 2YNAA 5CE1A 2W6ID 4IN2A 4ABAA 5A8ZA 4Y8ZA 4A7IB 1WQSA 4CR5A 2Q6FA 1GHXH 1GI7B 5C5OA 3KF2A 1O2YA 3M7UA 1DITH 2W7UA 1LHGH 1FPHH 1IQKA 1SMFE 2JIZD 3A7TA 4WH8A 1H8HD 3RXLA 5AVDA 1Y5BT 2V3HH 3SV9A 3MU1A 3GDVA 1NRRH 2AH4X 1Y8TA 7LPRA 4ZKNU 1Y3XA 2BQ7B 5T1VA 1C1PA 1GBMA 1ESAA 1G3CA 2H9TH 2BDBA 1UK4A 5I25A 4ZXXH 1DX5M 2VWLA 2A7JA 2WV9A 5L30H 1ZMNA 1SGQE 1ZPCA 4RN6A 2G55A 4AGJA 2O8TA 3AASA 1CHOG 1RD3B 1KXAA 1SGYE 3MHWU 2AIQA 4XBCA 5LGOA 1ZPZA 2A45B 2OC8A 2STAE 2WUBA 1C2FA 4TPYA 1K1JA 4INKA 5F8ZA 1C1UH 3ATMA 4X6OA 4ASHA 2XC4A 1Z6JH 1HB0B 2HGTH 5SGAE 3RXRA 2BOHB 5EQSA 1CGHA 1EZSC 3RXOA 5J4QA 1L4ZA 1BMNH 3K65B 2JH6D 4Q63A 3FANA 1OYTH 2XNIA 1K21H 2PKSB 3M7QA 1MAYA 1OP2A 5IDKA 2FOGA 3UWIA 3SU5A 1SLWB 2FLRH 2DUCA 2ZNKH 3GDSA 3GISB 1E36B 2AGEX 8ESTE 3QTVH 1WXRA 3UFAA 4JK5A 4X6PA 1DVAH 1DWCH 1UTKA 5GJ4B 4VGCB 4BTUB 2JDID 2EI6A 3SN8A 1K0HA 2A4OA 3P8NA 3LH3A 2C3SA 1CO7E 3PLKA 1G3DA 1DS2E 1LTOA 3PTBA 4O3UA 1O31A 1SPJA 4JZFH 4DJZB 1P9SA 1ZTKA 2VB0A 2K0QA 2ANKH 4AFUA 4OGXA 3PLBA 2Z94A 5DK1A 2GKVE 3IITA 3OTJE 1YCPK 3RC5A 2IPHA 2ZFTA 2AEIH 3H7TA 1K1PA 2J5UA 3SNEA 3F9EA 1K28D 2NU3E 2H6MA 1DXWA 3Q3XA 1BRUP 2OTVA 2OINA 1IQNA 2UUFB 1W10U 2NWNA 3BSQA 1TX8A 1HDTH 1SHHB 1XMNB 1KTSB 2Y5FA 2ZWLH 1DLKB 2FS8A 2WSSD 1G2LA 1FY1A 2OLGA 3RMLH 5FBIA 2ODQA 4I8KA 2IOTA 4XRNA 4I8JA 3GY2A 2XBVA 3QX5H 1O5DH 1QFKH 3KQBA 4NG9H 3BTDE 3NK8A 4BANB 5EXMA 4WMFA 3RXMA 2F9UA 2QAAA 3SHCH 3DUXH 3TITA 3RXFA 2Z9JA 4ZCNA 4GHQA 1CBWC 2Z9LA 4NCYA 4D7GA 1GG6C 1TMBH 2J95A 1AE8H 1SG8B 2V6NA 4NZQA 4Q7YA 1ZJKA 3ZVBA 1Z1IA 3BTWE 1O3MA 3BTQE 2HNTE 1KXCA 1D6RA 1KY9A 1MCVA 4AGKA 4CRBA 1ZSLA 1LPGB 1IQHA 1TLDA 2VIPA 1ZSKA 1TNKA 2UWOA 5FX5A 5KEDA 2ZDVH 3URDA 2PV9B 1INCA 2A1DB 1QL8A 1BBRK 4NIVA 1DWBH 3LGWA 1QR3E 1BRCE 4E06H 3SJ8A 4AYYB 5E8EH 3BTTE 1GHZA 1CSOE 1PPBH 2A7HA 5L6NH 3SYJA 1S5SA 3OTPA 1K22H 3FKSD 4KKDA 1G36A 4KELA 4B2CA 1BTYA 1TMUH 2BD9A 2ZHWH 1P0SH 2ZPRA 1S6HA 5HKKD 2NU1E 3RU4D 1AUJA 3O8RA 2BVSH 1O3JA 5EPNA 1TAWA 3MNXA 2AFQB 4IBLH 4JZDH 2G51A 2ESTE 1N6YA 4Y7AA 4X2XA 1V2JT 5FCRA 1B7XB 3FAOA 3V3MA 1BDAA 1P04A 2ZTZA 2BXTH 4Z1MD 2WUCA 2ZGHA 3N7OA 1E1RD 2BD3A 3QLPH 4AFZA 7GCHF 1LHFH 1AIXH 2CF8H 1E1QD 3S9BA 2O8UA 3SUDA 1AE5A 5DN6D 2B8OH 5GWZA 1IQGA 3KQEA 3WY8A 1MD7A 2XBWA 2XWAA 3SU2A 3SBKA 3E0NB 4HGCA 4MNVA 1OOKB 3LT3A 3GY7A 5AHGH 1ZTJA 3RXBA 2P95A 3H5CB 1FY8E 1NBME 1F5LA 3ZVAA 4AB9A 1PYTC 3TJVA 1GBKA 3SI3H 2HNTC 1A5GH 1PQAA 4FUHA 4BAOB 1THRH 2OK5A 1VITG 5EXLA 1GJ5H 3E8LA 3GY5A 3LPRA 4TY7A 3UOPA 5A8XA 3BEFB 2QGRA 1AFQC 2JH0D 3PTNA 2KZ4A 3F2HA 3U1IB 2BLQA 1NU9A 3E1XB 3SU4A 1GBFA 1BCUH 1XVOA 2L6OA 4A92A 1FQ3A 4B74A 4OS7A 1O39A 4DCDA 5A0AE 1XM1A 2ZKSA 3ZVGA 1UHBA 2BDIA 3LOXA 5GCHG 1GCDA 3ATWA 2BDHA 3ITIA 4WWYA 1QJ7B 1V2LT 1EP6A 2BX3A 7KMEH 1H1BA 4ACBA 3LC3A 1P9UA 1GJ7B 2PW8H 1G30B 1O2SA 5EW1H 1D3QB 1W7XH 2A4QA 2BZ6H 3E0PB 2WPJS 4WJG2 1C4Y2 1HJAB 1NRQH 1O36A 1VGCB 1IQFA 1P3EA 4XBBA 1ZMLA 4MPUA 1MKWH 4B76A 1O3FA 2NU0E 1DM4B 2H2ZA 4M9FA 1GBHA 3SJKA 3A8CA 4FETA 3MU4A 2ZDKA 1CU1A 2OUAA 1LVYA 1GJ6A 1TGNA 1GDQA 1K1IA 1AWHB 5ESBA 1QGFA 1FMGA 3UB0A 3OX7U 1C5MD 1S83A 4J2YB 5FPSA 1TPAE 1C1SA 2STBE 4DIIH 2C90B 1HGTH 1Y3UA 3OYPA 1MTVA 1O32A 5ETXA 1EB1H 3OY5U 1G3BA 1NFXA 1YGCH 5JB9S 2G52A 3T25A 1O5CB 2AMQA 1P2OA 1DSUA 4X6MA 1G37A 3PO1B 3ZVEA 4X2YA 2XXLA 4NSVA 1TBZH 2ZHQH 1GBBA 1O3HA 1J16A 3ATKA 3TGJE 1JWTA 3FP7E 1QURH 2R2MB 1WU1A 5HYOA 1MABB 1DUAA 2ZTXA 4LXBH 1NT1A 1E37B 5AFYH 1K1NA 3BTME 2P94A 4NWLA 2VVVA 3BN9A 4ACAA 4YLQH 3UUZA 3BG4B 4NA8A 3U98H 1V2ST 3GCTF 3ZZ9A 1AZ8A 1TRNA 2V35A 5C2ZA 3ZZ8A 3U28C 1KYNA 2ZQ1A 2QXHA 2HPQH 1Y5AT 1QB9A 4GSOA 5F8XA 3K6YA 3STJA 4YO9A 3UNQA 4BTIB 3M5LA 4JYUH 3A7WA 4ZHLU 4UD9H 1ZOMA 3TK5A 2VJ1A 2QN5T 1O3DA 3EGKH 1T31A 1GI3A 1LKBA 1C1VH 1EASA 4ABJA 2HALA 1O2HA 1KLTA 4AB8A 5CDFE 2NU2E 2XRCA 2ZP0H 1H9HE 3PV5A 2FZZA 2RDLA 1O3OA 5BPEA 1WOFA 1C5NH 4MTBA 1V2RT 5C67A 5FAHA 1ANBA 2O8LA 4K8BA 1O2UA 1ETRH 1EATA 5A09A 2J9NA 1LVOA 1C2KA 3DSGA 1BMFD 1KDQA 3A8DA 3KIDU 3SJ9A 1SGFG 2GZ9A 4K69A 1NPMA 5I46H 4I31A 3EA8A 1O2JA 3A83A 5JBCS 2A4RA 3ZVFA 1YPHE 2VNTA 5DP7A 2G4TA 1BTXA 4A6LA 2VIOA 1P01A 1H9LB 1OYQA 1MQ6A 2P3TB 2TGTA 3SQHE 4INHA 4HFPB 3ATLA 2Y7XA 3A7ZA 1YCPM 3A86A 1VKYA 3OAAD 5DJ7A 2F9PA 2PHBA 3OE7D 3ATIA 4D8NA 1P3CA 1UCYK 3HGPA 5HXFA 1UHBB 1LCYA 1XKBC 1COWD 4Y8YA 1EPTA 2QF4A 2QV1A 3SNDA 1RTFB 1Q31A 3NCLA 2Y7ZA 3DCLA 1TPPA 3P8FA 4FXGH 5DP4A 4AZ2B 2ZFSA 2ZHEH 3LU9B 9LPRA 4YZUA 2FPZA 3SUGA 2EI8A 3EA9A 1G3EA 1GBEA 4Y10E 1QB1A 4ABBA 1EAXA 4IGDA 2BQ6B 3F3BA 3Q00A 2LPRA 4IMQA 5HMAA 2VU8E 1PPZA 3AVZA 2LELA 1D3DB 1GBLA 2UUKB 4UE7H 3A85A 2AYWA 1Y5UT 1Y3WA 2C8ZB 2K8IA 1LKAA 2W26A 4U30A 4K8YA 1NM6A 4A1TA 3F1SB 2IJOB 1BMMH 1UJ1A 1ZRBA 4ZHMU 5ABWA 2GZ7A 1WDIA 2JETB 4XDEA 4B71A 1LQEA 2XTTB 2BM2A 4FVDA 1L1JA 3UNSA 5KGOA 2ZGBH 1O33A 2ZU3A 4AYVB 2R3UA 1LHDH 3RLWH 4ZKOU 4MLFB 3E91A 1A0HB 4JMYA 4K3JA 1MCTA 2THFB 1GMHG 2EC9H 3MFJA 5GPIB 4ZKRU 5FXLA 1TIOA 1BQYA 1JOUB 1XUJA 4O3TA 2ZG0H 1ANDA 1HAZB 2R2WU 1F0TA 1N6XA 1WYKA 4UEHH 3SJIA 4BAMB 1CT2E 1ID5H 4K1EA 3KHVA 1SGNE 1SKYE 2FOCA 4FUIA 1V2QT 4UONA 1QB6A 1W3CA 2C8WB 4YT7H 1O3EA 3KQ5A 4A1XA 3DD2H 5L2YH 2DE9A 3MO3A 1JRTA 1ARCA 3RMNH 1P8VC 1BOQA 3TJUA 1ELAA 3UPEA 5F6MA 1BJUA 1CHOF 5DP5A 2F43B 3KNXA 1W0KD 4DT7B 1CQQA 1VR1H 4B2AA 5EJZA 5IK2D 4MVNA 5IYTA 1THPB 1H4WA 3EE0B 3RXPA 4ISNA 2GDEH 2QXGA 1DOJA 1Z7KA 4U01A 7ESTE 1C5WB 1ELTA 1UK3A 2WHXA 1DICA 4FUDA 5JBAS 1F92A 1S81A 1ELCA 4NIYA 1HAOH 5T6GA 4ABIA 5HIZA 1BTHH 1KDQB 3Q3YA 3VG8A 3FZZA 1P02A 2OQ5A 1O3NA 1GJ8B 1OWIA 3A8BA 1GVKB 3EDXB 2WYJA 3K9XB 3A88A 1GBDA 1P2JA 1SC8U 1XXFA 4AG2A 2FOEA 2TIOA 2H5DA 4GUXA 4LK4A 1C4U2 1OWKA 1VJAU 1O34A 2A32A 5DP6A 1HJAC 1C1NA 1VGCC 3A8AA 3ZV8A 1TGCA 5HM9A 3VXEH 5A8YA 2EA3A 2XWBI 1A4WH 3LKWA 4YT6H 3GY8A 2AMPA 1O2GH 1MZAA 1TYNA 5A2MH 4Y76A 1QRXA 2ZZUH 2F9VA 2FLBH 1H9IE 3BIUH 4QT8C 1MBQA 3U1JB 1C1WH 3PMJA 4MDSA 3RXQA 1TPOA 3DFLA 4UFDH 1P10A 1D9IA 4UFEH 3NXPA 5KECA 4B2BA 1V2WT 3A7XA 1KSNA 4FU9A 4Q2KA 2GX4A 1GHVH 3M3TA 1HIAA 3UR6A 1O3BA 2JH5D 1W0YH 3VB7A 1NBMD 2BTCE 2ODYB 3M3VA 1EAUA 2Y5HA 3M61U 1DPOA 1PPEE 1DDJA 2VIDA 1V2MT 5EOKA 3NPSA 3V0XA 1V2KT 4Q4LA 1TX7A 2UWLA 1RTLA 1GDNA 3PO1C 3UR9A 4X6NA 1C1OA 4X1PU 3EAJA 2TGAA 1S82A 2BLOA 4XE4A 4TYDA 3RXHA 4B6EA 1ESBA 1P2NA 2BD4A 1G2MA 1TNJA 1VCQA 1C5RA 1YPJH 3IG6B 2EQNA 5TCAA 1A5HA 1GWAA 2VBCA 1UK2A 1IQEA 1O2PA 3EYDA 2FI3E 2HWLB 3BG4C 1GMDG 1D4PB 1FUJA 1IAUA 3S0NA 1WCZA 1PPGE 1QA7A 4O9VA 2BMGB 1GJ4H 1NRPH 5EIYA 4D9QA 1SQRA 3SU3A 1UVTH 1GL0E 3HPTB 3AAUA 4WMDA 2VIQA 5E0HA 1OP0A 1FIWA 1AD8H 3SGQE 2GP9B 3L33A 1WAYB 3F2FA 3OFND 1YYY1 3RXIA 4FUCA 1LVBA 1Z8IB 3OEHD 1PPCE 1YM0A 2A5KA 1CA0B 3BTEE 1O0DH 2OC0A 1XUGA 1ACBE 2Y80A 1ETSH 1ZMJA 3CS0A 2CJIA 3MYWA 1HAXB 4AG1A 3C27B 3KEEA 1LO6A 2ALVA 3RUOA 2Z9KA 1OX1A 3B9FH 2SGDE 1C2MA 4E7RG 4NA7A 3MOCA 4RT0A 2BVXH 2QCYA 4DOQA 1O3LA 1Q3XA 2GCHG 4A1VA 1F5KU 3HK3B 1CT0E 1SR5C 2ZF0H 1YKTA 3GY6A 1YLNA 3OEED 1FV9A 3QDZB 3DFJA 3UQOA 1O2IA 4R0IA 3KL6A 4GAWA 3W95A 5LPFA 1PPFE 5FPYA 2M5TA 3UNRA 4X1NU 2J98A 4UDWH 1FXYA 1TMTH 1EUFA 3OU0A 4DVAU 1VZQH 4CRAA 1BBRE 3E3TA 3UIRA 1UVUH 3GY3A 1XKAC 1A7SA 9ESTA 1OXGA 3F2GA 4R8TB 1O2QA 2TRMA 4XSKU 4Z0KA 3QK1A 1C5QA 4ABEA 1XX9A 1XUIA 1ZHRA 3VB3A 1TNLA 2WV4A 1W14U 2FIRH 3FP6E 3TVJB 1OSSA 4H6SB 5G4BA 3RC6A 3D49H 2ZFPH 4H42U 1IOEA 1AVXA 1FPCH 1AWFH 2GGVB 3CENA 3SUFA 5CMXH 1FONA 4A5TS 4CHAB 2AGGX 3FOAA 3PRDA 4JYVH 1P2KA 4CH8B 1GHWH 3BIVH 2WPIS 3TK9A 3FVFB 1TONA 1AZZA 1W0JD 1K1OA 2OC7A 4AFQA 1ZHPA 2ZU2A 1P09A 4ABDA 1TRYA 2O8WA 1VITF 2PWXA 5F53A 3RC4A 1TOMH 1HIAB 2WPKS 4H4FA 3SOSA 3A80A 3TLOA 2FOMB 2Q1JA 4HZHA 1ZJDA 2FOFA 2JETC 4OS6A 4ZH8A 2C4FH 2PGBB 4MQAA 1MKXH 4ISOA 5LH8A 2FOHA 4B6FA 2ZQ2A 4I7YH 3NWUA 1HXFH 1YPEH 2P3FH 5EODA 3SI4H 1EOLA 5GCHF 1AI8H 4ZMAH 1O2MA 3BTFE 1UVSH 1TGSZ 1P05A 3S7HB 1VCPA 5FBEA 1S84A 1EKBB 1ANCA 1S85A 2Z6BD 4BAQB 2KCOA 3OSYA 1TOCB 2ZTYA 3SV7A 1C5VA 2GDDA 4RSPA 1BTUA 3F0PA 3ZZ3A 1TNGA 4JZEH 4YM9A 2KCPA 2GJGA 2AIPA 5BRRE 4HG6A 2ZDLA 1T4VH 1O2TA 2H5CA 5DO4H 3LH1A 2UUYA 1SFQB 4LOYH 1NROH 3DSOA 3V7TA 2ZC9H 3W94A 1HAPH 1G32B 1AUTC 3RMMH 3M35A 1RXPA 3U8TH 1V2PT 5JB8S 4Z6AH 2PP6A 1LHCH 2ZEBA 4TT3D 3LJOA 3SJOA 1CA8B 1FI8A 2CXVA 3K6ZA 3TH2H 1O3GA 3F9HA 3S9AA 1MQ5A 3BV9B 3STIA 5AF9H 4MNYA 1MUEB 3UAIC 3RLYH 4TPIZ 3D65E 1P11E 4FOUC 1JMOH 5F03A 6GCHG 5FCKA 1ELGA 3B23B 4F49A 1C2JA 1C5PA 1YLCA 3F68H 1A0JA 2J38A 2GT7A 2PUQH 2ZECA 1SLVB 1TPSA 2M2AA 6ESTA 2G5VA 2UWPA 1HV7A 2RCEA 1HAYB 1GGDB 3MNBA 1P2QA 1IQJA 5EJLA 4K60A 1A2CH 3C1KA 2ZHDA 1MMJN 3GCNA 3MH4A 5EU8A 5T6DA 3S69A 2XNDD 2GD4B 2J98B 3O8CA 5E0GA 1Z6EA 1QBOA 2W5EA 1HAHH 5F8TA 1AKSA 5FPTA 1FAXA 1TA6A 3ZZDA 2SGEE 1WSSH 1AMHA 1EOJA 4YOGA 3R0FA 3VXFH 2G81E 1SQTA 2FODA 5L2ZH 2WPMS 1MKWK 1YPGH 3B8JA 2G4UA 4ISLA 5EG4A 1KMHB 2BQWB 1Z8GA 3SV8A 1ZYOA 2I6QA 4OS5A 1CHGA 3DSPA 1GI5A 5H4IB 1TB6H 1EPTC 1GI8B 4IN1A 3T28A 4MPWA 1SOZA 2SGPE 1GBCA 1ZRKA 2BY5X 2AERH 3P95A 3FO8D 1CT4E 1SQOA 1NFYA 1RIWC 3M36A 8LPRA 1DY8A 2BB4A 1SLUB 3OY6U 2QF3A 1EB2A 4M7GA 2GVFA 1FN8A 4AX9H 3TK6A 1YC0A 5C94A 2V3OH 1S6LA 2D8WA 2P8OB 2PUXB 3QWCH 1EJAA 1GHAG 3RXKA 1GJCB 1UTNA 2KAIA 2CF9H 4K1TA 1C1QA 3PMHB 4TSFD 4IW4E 1D3TB 8GCHG 2BXUH 3CNRA 1WUNH 1UMAH 2VWMA 1XUKA 1TALA 4DG4A 1P03A 1GBIA 3GICB 2L74A 1DWEH 3TJOA 1SOTA 3VPKA 4GCHG 5EGMA 5HIYA 4MPVA 1GJDB 1O3PB 2Q6DA 3PROA 4PROA 2ZFQH 1RRKA 1IHSH 2JKHA 1TE0A 4Y0YE 5GDSH 5EQQA 1YBWA 3RMOH 1SLXB 3L6PA 1FY4A 2XW9A 3UOUA 1E35B 3K2UA 3MMGA 3HATH 2B7DH 3BG8A 3R3GB 2J34A 3RXUA 4AN7A 1E34B 5FL7D 1AFEH 3BTHE 3GOVB 5HM2A 1SGTA 1UTQA 1V2UT 2OC1A 3O8DA 4Y7BA 1CA0C 1QL7A 1QA0A 6CHAC 2XYAA 1AGJA 4B75A 5C0UA 4X0WU 3E6PH 2B9LA 1HJ8A 1YWUA 4ABFA 3TH4H 1E38B 4YLUA 2BYAX 2SGAA 1C2DA 1P2IA 1FLEE 2KFWA 2C8YB 1XUFA 1UCYE 1GHBG 2PTNA 4FUBA 1NU7B 4LZ1H 3RXCA 2GMTB 1DY9A 2XC5A 3A87A 1OWHA 1GPZA 3T29A 1MAXA 1Z71A 1OWEA 1W8BH 4U32A 5PTPA 3ZZ7A 1S0QA 3A82A 1O5FH 4INLA 2ZGXH 3GCOA 1BTWA 2CMYA 2R0LA 4RI0A 1UW7A 2FEQH 1GVLA 1Y59T 4CREA 4JCNA 1DWDH 1VCWA 3RDZA 2ZGJA 1TABE 4KTSA 2ZHFH 2BD2A 1O35A 1AVWA 2ZCLP 5K7RA 3PMAB 1C5XB 3TPIZ 1ZTLA 2BY7X 1GMHF 2QIQA 1LPZB 2P3UB 2Z9GA 1RS0A 4UFGH 1C1RA 3GS9A 1O5AB 1ZSJA 1QQUA 1LDTT 4JYTA 3QGJA 3I78A 2YMSC 4ABGA 3M5NA 1MTWA 3LIWA 3VB6A 1TBRH 3PRBA 1EZUC 1YPLH 5DP8A 3UY9A 1OS8A 1UVPA 1O30A 2Z7FE 5DP3A 1AKSB 1GBJA 4CHAC 1G9IE 2A0QB 3W1EA 4CRFA 2ZCHP 3A89A 1AB9B 1PFXC 2EEKA 1HAIH 2RA3A 2HPPH 2OBOA 2FI4E 1NZQH 2V7QD 1JBUH 1O2KA 4YESB 3HKIB 5EW2H 1O38A 1N1LA 1C5SA 4H6TA 3LGUA 2IJD1 3HKJB 2XCFA 3ODDA 4OS2A 1FDPA 2BY8X 3RXJA 3ZV9A 2F9NA 1YPHC 2ANYA 1ZPBA 1SBWA 1NO9H 3SU0A 2YOLA 1FN6A 5C1UA 1UTOA 2BHGA 3QGNB 3BEUA 1MZDA 2KAIB 4F48B 1MBMA 2XC0A 2BDCA 1QCPA 4P02A 1QQ4A 1TBQH 2QA9E 1JRSA 1GMCG 4J1YA 3TIUA 5FX6A 1O3CA 2EI7A 3BF6H 2ANWA 1C1TA 4ISIH 5EQRA 4I86A 3T62A 2W6JD 3LGTA 2FOAA 1GHYH 1C9TA 1DLEA 2RG3A 1W7GH 1BITA 1C2EA 1EQ9A 3PV2A 2QF5A 1A3BH 1AQ7A 3KYGA 1T8MA 3A7YA 2SNVA 2G00A 5J4SA 2C8XB 1MD8A 1S6FA 2WINI 3FN8A 1L0ZA 4AFSA 5JBTA 3RXDA 1EP5A 2OBQA 1O5GH 1GI6A 1HXEH 1P57B 2W3KA 3MWIU 1V3XA 1NFUA 4ASUD 3LJJA 3HGNA 2BD5A 2BDYA 1O37A 2Z3DA 3VFEA 3JZ1B 4WMEA 4Q7XA 1ARBA 3LDXH 4BTTB 4F55A 1VJ9U 1A5IA 1EAWA 4CBNA 2TGDA 2GV7A 4X8VH 3ZZ6A 3ZZ5A 3AK5A 1UTJA 1BTPA 1EJNA 1NS3A 4BXSA 1MTNC 4JZIA 3JZ2B 2ZDNA 3IWMA 2FX6A 5E2OA 1GL1A 1JIRA 3QO6A 5T3HA 4CR9A 2FWWA 3H7OA 3MQKC 5HGGA 1QBVH 3URCA 3M3SA 2W7SA 4CRDA 1A1RA 3G01A 4DW2U 3DA9B 1O2NA 1C5UA 1GMDF 1GGDC 3A81A 3P6ZB 4NIXA 2BLWA 2WPHS 3SZNA 4TY6A 1EX3A 3TH3H 1C5YB 4IC5A 2XBYA 2Z9IA 2NU4E 3T2NA 3WW7A 1SGEE 5LPRA 2BDGA 1C4V2 1GBAA 1EPTB 1V6DA 1ABIH 1GJ9B 2TBSA 2FXRA 1KXBA 1SL3A 1T8LA 2GCTC 1ELFA 4U2WA 4FU7A 1OWJA 1WV7H 1CGIE 4OM9A 2FTLE 1BMAA 1RIWB 1YLDA 2QY0B 2F83A 1EZXC 2FMJA 3S7KB 1F0UA 1E0FD 1S0RA 1TQ0B 1P12E 1T8NA 4NZLA 4B1TA 3PM3A 1V2TT 4Q80A 1ANEA 5C20A 1BZXE 4XFQA 1IQIA 2PGQB 3L3TA 4NA9H 2B0FA 3QUMP 1B0FA 1W12U 4BAHB 1NRSH 3O8BA 3MNCA 1TX6A 4K1SA 3DHKH 1BHXF 1JIMA 1L4DA 3LONA 5FHTA 1ELEE 3P70B 5GNDA 1AHTH 1C2IA 2P8OC 1NC6A 2OP9A 3M37A 2GCHF 2DE8A 3P8GA 1MH0A 3VB4A 2QXJA 1V2VT 1GCTB 3WWBA 1P2MA 1YCPH 1KTTB 5A0CA 3GDUA 1BHXB 1QNJA 1UO6A 2OQUA 1EZQA 1J14A 3NZIA 2Y82A 3EQ0H 3RXEA 1KIGH 1LPKB 3KGPA 3QTOH 1BMLA 3MTYA 2J94A 2KM0A 2BLVA 2BD8A 6CHAB 5C0TA 4I8LA 2GV6A 1TQ7B 1C2HA 1D6WA 5DKMA 2D1JA 4WH6A 1IQMA 5DGJA 2J2UA 4P00A 1EAIA 2PSXA 1F7ZA 1J17T 1CE5A 2ZI2H 1XUHA 1HYLA 2BVRH 2TGPZ 2O8MA 3A7VA 4GHTA 1O2RA 2A4GA 2J4IA 4DIHH 4IS5A 1ELBA 2I6SA 3F0OA 1RGQA 1T4UH 5GXPA 2Z3CA 2BD7A 2PFEA 3MH5A 3BTGE 1NFWA 2YNBA 4Y71A 3RXAA 2ZCKP 1K9OE 3UQVA 4NWKA 1O3AA 2R0KA 2AHME 3NKKA 1M9UA 5DG6A 4BOHA 2SGFE 4Y0ZE 2GMTC 1TGTA 4CRGA 4CH2B 1QL9A 1AY6H 2BY6X 3TGKE 3LGYA 1A0LA 3SU1A 2VH0A 1ZHMA 1O3IA 1KLIH 1TNIA 3PB1E 3SNBA 1K1LA 1J15A 4X1SU 1DE7H 5ESTE 1EFRD 2R3YA 4KTCA 2BDAA 1NESE 1OWDA 5EXNA 5CHAB 1F2SE 1OP8A 4X1QU 1DSTA 5E0JA 4K2YA 4Y11E 1BBRH 1HAVA 2CN0H 3M5OA 4WXIA 2YMSB 3SORA 2YMSD 2ZU4A 1SGIB 3VGCC 2VVCA 3NUMA 2P93A 4YTAA 2RDEA 1O3KA 3MU0A 2KCYA 1C9PA 1THSH 3UTUH 2QXIA 2HVXA 5JBBS 2FO9A 1Z8RA 3GCHB 1ZR0A 1FY3A 3PWBA 1C2GA 4X8TH 1QIXB 3RM0H 4D7FA 4MNWA 2FI5E 1C1MA 4ZUHA 4GPGA 4D9RA 4E05H 2CHAB 1XVMA 1MU8B 1ZGIA 3MH7A 1AB9C 2KR7A 1EJMA 1LQDB 1ELVA 1SGFA 4FUEA 3GYLB 2F9OA 2FDAA 3I29A 4KP0A 2SGQE 3MNSA 1W11U 4YOIA 5DPAA 4I33A 1P06A 2A7CA 4NGAH 4B73A 4ISHH 1QTFA 1UTLM 1BUIA 2ZU1A 5JPMH 3U8RH 1SGCA 4KGAA 1N8OB 3UREA 4ABHA 1O5EH 3U69H 5DP9A 4NSYA 2V3MA 5EJ1A 1HNEE 2FYRA 2RA0A 2WZQA 2BY9X 3HK6B 6GCHF 3GY4A 1MTUA 1H8IH 4IMZA 1GI0A 2VIVA 4ZROA 1MKXK 2LP6A 1LMWB 1C5TA 3N99A 1NY22 2PLXA 3UWJH 4NIWA 4I8GA 1SI5H 1PQ7A 1QZ8A 3LGVA 4K5ZA 4NFFA 1L1NA 3D23A 1AN1E 5B6LA 4AORA 3VEQB 3Q3KA 1ELDE 2AGIX 1OHHD 5GIBA 2K1QA 3SGBE 3EA7A 3PV4A 2QE7D 1EXFA 2FTMA 3AW1A 5JDUB 4NFEA 1QJ6B 1IHTH 3D62A 2VGCB 2BX4A 3ZVDA 1RFNA 3CS7A 1YF4A 1Y3YA 1SHYA 1UTMA 2B5TB 4XBDA 2ODPA 4TWYA 4DT4A 4KTUA 1FNIA 4X8SH 2O9QA 2Z3EA 2VINA 2OCVB 4X1RU 1SSXA 2SNWA 1YY3A 2FESH 1DANH 6LPRA 1GJBB 3FZDA 1SFIA 2IN2A 2EY4C 1MTNB 1QY6A 1FIZA 1J9CH 3MU5A 3ZZAA 2ZFFH 1L1GA 2J97A 4OGYA 2Q6GA 1Z8JB 3SUEA 1BJVA 2CGAA 2UUJB 2ZGCA 3VB5A 4MG3A 1V2NT 3V13A 1O2LA 7GCHG 4F4OC 3ZYEA 1CVWH 1C2LA 4UFFH 1FY5A 4Y79A 1FZZA 1WQVH 1GHAF 1HBTH 4FVBA 2H1UA 2FP7B 2PTCE 2JJ1D 4Y8XA 2ZU5A 1SVPA 4YOJA 2WYGA 3RXTA 2CV3A 1TRMA 2ZPSA 3AW0A 1FAKH 4GVUA 1J8AA 8GCHF 4Y6DA 5LPEA 1BB0B 2G8TA 3AAVA 1GBTA 1A46H 4XOJA 1E79D 1O5BB 4OS1A 1GVZA 1YP9A 1ORFA 5C17A 2GCTB 4GCHF 2WPLS 2XCNA 2CK3D 2Y81A 5TCCA 1HFDA 1X7AC 2ZFRH 4E7NA 3T5FH 3KQCA 1A3EH 2JJ2D 3MI4A 1C5ZB 3P8OA
chains in the Genus database with same CATH topology
1O2VA 1RJXB 1HAVB 2AS9A 2H9HA 3SV6A 1WTGH 3P17H 2D26C 3SGAE 5EPYA 1QHRB 5C1XA 5JYIA 1KXDA 3SNCA 1TFXA 2ZIQH 2FS9A 3M7TA 1T8OA 1UVOA 1A61H 3ZZCA 2WV5A 3KQDA 3FFGA 3T27A 1C5OH 3SNAA 1Y3VA 3TNSA 4AOQA 1FJSA 3E90B 5T6FA 1L2EA 2TPIZ 4OS4A 2VWNA 3DT0H 4ZXYH 1HAGE 2HLCA 5E2PA 3BEIB 5C1YA 2ILNA 1U6QA 4D76A 1HPGA 1GHBF 3PLPA 3ENSB 1BRAA 1W2KH 1SGDE 3T26A 3RXGA 4X2WA 4FUFA 3ESTA 4I8HA 2PKSC 4WVPE 3ZVCA 1TWXB 1SB1H 1D3PB 1NTPA 2A2XH 3RXSA 2ASUB 3BTKE 2PKAA 3PYHA 1GCTC 1O2WA 3KCGH 1GDUA 2Y6TA 2W3IA 1T7CA 1TNHA 4FUJA 1DUEA 3MO9A 5AFZH 4VGCC 2P16A 4I32A 1GI9B 3MO6A 2A31A 2G5NA 1OPHB 1ZZZA 3RU4T 2BOKA 2OD3B 4TWWA 3SO3A 3F9GA 2ULLA 3Q76A 3U9AH 1GJAB 1BT7A 3SW2B 4FU8A 2C93B 4WXVA 3ZZBA 4MNXA 2GT8A 2ZA5A 2FX4A 2A2QH 2ZDMA 8KME2 3MU8A 1BTZA 2BZAA 3GYMA 1W0ZU 5A0BA 3RM2H 3LGIA 1MU6B 1QBNA 3RU4E 3MH6A 4ESTE 1KLJH 4FUGA 1SQAA 2V0BA 1T32A 3GCTG 1F5RA 3PMBB 1XXDA 2ALPA 2HRVA 2P59A 4ZAEA 1UCYH 3V12A 1Z1JA 4X8UH 2F9BH 2SFAA 3U8OH 2Y5GA 1VITH 1CBWB 2VWOA 1SGPE 4DGJA 3LC5A 1BIOA 1GG6B 1ZGVA 1W13U 2AMDA 1JXPA 1ETTH 4BNRA 2VH6A 1AO5A 1NRNH 3VGCB 1O2OA 3E16B 1YPKH 2A5AA 1Q2WA 1TGBA 1K2I1 5CHAC 4MPXA 1QJ1B 1CGJE 1DXPA 5K0HA 1GMCF 3A84A 2QC2A 2VIWA 4WF8A 1KXFA 1HLTH 3ELAH 1ESTA 5B6OA 4SGBE 1HJ9A 3ODFA 1HUTH 2PR3A 3GCHC 1PQ8A 4X2VA 1DFPA 2ZO3H 2FOBA 4DURA 5TJXA 3PWCA 3TU7H 2GTBA 4RKJB 1ABJH 3QZRA 1C5LH 2LNCA 2CHAC 1ZLRA 1TA2A 4ZKSU 3QN7A 1SGRE 1WBGB 2F3CE 3KN2A 3SQEE 4O03A 1BRBE 3S9CA 1O2ZA 4BXWA 1F0SA 3I77A 3ZYDA 4CRCA 1HRTH 1GI4A 3F9FA 3RP2A 2ANMH 2ZPQA 4THNH 2ZDAH 3F6UH 3M5MA 4ZHAA 3ZZ4A 1N8OC 2QF0A 2QYIA 1B5GH 4RKOB 1IQLA 4IC6A 5C3NA 1PPHE 2F91A 2D2DA 1H8DH 1GI1A 4DY7B 3SU6A 2PSYA 2GZ8A 2HNTF 1K1MA 3TGIE 2R9PA 1HCGA 2XBXA 4LZ4B 1UTPA 1KXEA 4HTCH 2A5IA 1PQ5A 1WTHD 1MTSA 1V2OT 2HOBA 4Q7ZA 1O2XA 2FYQA 2PKAB 3QZQA 3CP7A 1GI2A 3SV2H 4GLYA 1F0RA 1RTKA 1LVMA 4BAKB 4CBOA 1PYTD 4JZ1A 3P92A 1AU8A 1OKXA 1NN6A 3TNTA 4WY3A 5C5NA 1BA8B 3SHAH 4SGAE 2VGCC 1LHEH 1QRWA 2OXSA 1AFQB 3RXVA 1DT2A 1YPMH 2VVUA 1AVGH 4O97A 2FM2A 3Q77A 4JK6A 2H9EH 1PJPA 2J92A 1QRZA 1B0EA 3FP8E 3TJNA 4HI3A 2YNAA 5CE1A 4IN2A 4ABAA 5A8ZA 4Y8ZA 4A7IB 1WQSA 4CR5A 2Q6FA 1GHXH 1GI7B 5C5OA 3KF2A 1O2YA 3M7UA 1DITH 2W7UA 1LHGH 1FPHH 1IQKA 1SMFE 3A7TA 4WH8A 3RXLA 5AVDA 1Y5BT 2V3HH 3SV9A 3MU1A 3GDVA 1NRRH 2AH4X 1Y8TA 7LPRA 4ZKNU 1Y3XA 2BQ7B 1C1PA 1GBMA 1ESAA 1G3CA 2H9TH 2BDBA 1UK4A 5I25A 4ZXXH 1DX5M 2VWLA 2A7JA 5L30H 1ZMNA 1SGQE 1ZPCA 4RN6A 2G55A 4AGJA 2O8TA 3AASA 1CHOG 1RD3B 1KXAA 1SGYE 3MHWU 2AIQA 4XBCA 5LGOA 1ZPZA 2A45B 2OC8A 2STAE 2WUBA 1C2FA 4TPYA 1K1JA 4INKA 5F8ZA 1C1UH 3ATMA 4X6OA 4ASHA 2XC4A 1Z6JH 1HB0B 2HGTH 5SGAE 3RXRA 2BOHB 5EQSA 1CGHA 1EZSC 3RXOA 5J4QA 1L4ZA 1BMNH 3K65B 2JH6D 3FANA 1OYTH 2XNIA 1K21H 2PKSB 3M7QA 1MAYA 1OP2A 5IDKA 2FOGA 3UWIA 3SU5A 1SLWB 2FLRH 2DUCA 2ZNKH 3GDSA 3GISB 1E36B 2AGEX 8ESTE 3QTVH 3UFAA 4JK5A 4X6PA 1DVAH 1DWCH 1UTKA 5GJ4B 4VGCB 4BTUB 2EI6A 3SN8A 2A4OA 3P8NA 3LH3A 2C3SA 1CO7E 3PLKA 1G3DA 1DS2E 1LTOA 3PTBA 4O3UA 1O31A 1SPJA 4JZFH 4DJZB 1P9SA 1ZTKA 2VB0A 2ANKH 4AFUA 4OGXA 3PLBA 2Z94A 5DK1A 2GKVE 3IITA 3OTJE 1YCPK 3RC5A 2IPHA 2ZFTA 2AEIH 3H7TA 1K1PA 3SNEA 3F9EA 1K28D 2NU3E 2H6MA 1DXWA 3Q3XA 1BRUP 2OTVA 2OINA 1IQNA 2UUFB 1W10U 2NWNA 3BSQA 1TX8A 1HDTH 1SHHB 1XMNB 1KTSB 2Y5FA 2ZWLH 1DLKB 2FS8A 1G2LA 1FY1A 2OLGA 3RMLH 5FBIA 2ODQA 4I8KA 2IOTA 4I8JA 3GY2A 2XBVA 3QX5H 1O5DH 1QFKH 3KQBA 4NG9H 3BTDE 3NK8A 4BANB 5EXMA 4WMFA 3RXMA 2F9UA 2QAAA 3SHCH 3DUXH 3TITA 3RXFA 2Z9JA 4GHQA 1CBWC 2Z9LA 4NCYA 4D7GA 1GG6C 1TMBH 2J95A 1AE8H 1SG8B 2V6NA 4NZQA 4Q7YA 1ZJKA 3ZVBA 1Z1IA 3BTWE 1O3MA 3BTQE 2HNTE 1KXCA 1D6RA 1KY9A 1MCVA 4AGKA 4CRBA 1ZSLA 1LPGB 1IQHA 1TLDA 2VIPA 1ZSKA 1TNKA 2UWOA 5FX5A 2ZDVH 3URDA 2PV9B 1INCA 2A1DB 1QL8A 1BBRK 4NIVA 1DWBH 3LGWA 1QR3E 1BRCE 4E06H 3SJ8A 4AYYB 5E8EH 3BTTE 1GHZA 1CSOE 1PPBH 2A7HA 5L6NH 1S5SA 1K22H 4KKDA 1G36A 4KELA 4B2CA 1BTYA 1TMUH 2BD9A 2ZHWH 1P0SH 2ZPRA 1S6HA 2NU1E 3RU4D 1AUJA 3O8RA 2BVSH 1O3JA 5EPNA 1TAWA 3MNXA 2AFQB 4IBLH 4JZDH 2G51A 2ESTE 1N6YA 4Y7AA 4X2XA 1V2JT 5FCRA 1B7XB 3FAOA 3V3MA 1BDAA 1P04A 2ZTZA 2BXTH 2WUCA 2ZGHA 3N7OA 2BD3A 3QLPH 4AFZA 7GCHF 1LHFH 1AIXH 2CF8H 3S9BA 2O8UA 3SUDA 1AE5A 5GWZA 2B8OH 1IQGA 3KQEA 3WY8A 1MD7A 2XBWA 2XWAA 3SU2A 3SBKA 3E0NB 4HGCA 4MNVA 1OOKB 3LT3A 3GY7A 5AHGH 1ZTJA 3RXBA 2P95A 3H5CB 1FY8E 1F5LA 3ZVAA 4AB9A 1PYTC 3TJVA 1GBKA 3SI3H 2HNTC 1A5GH 1PQAA 4FUHA 4BAOB 1THRH 1VITG 5EXLA 1GJ5H 3E8LA 3GY5A 3LPRA 4TY7A 3UOPA 5A8XA 3BEFB 2QGRA 1AFQC 2JH0D 3PTNA 3U1IB 2BLQA 1NU9A 3E1XB 3SU4A 1GBFA 1BCUH 1XVOA 4A92A 1FQ3A 4B74A 4OS7A 1O39A 4DCDA 5A0AE 1XM1A 2ZKSA 3ZVGA 1UHBA 2BDIA 3LOXA 5GCHG 1GCDA 3ATWA 2BDHA 3ITIA 4WWYA 1QJ7B 1V2LT 1EP6A 2BX3A 7KMEH 1H1BA 3LC3A 1P9UA 1GJ7B 2PW8H 1G30B 1O2SA 5EW1H 1D3QB 1W7XH 2A4QA 2BZ6H 3E0PB 2WPJS 4WJG2 1C4Y2 1HJAB 1NRQH 1O36A 1VGCB 1IQFA 1P3EA 4XBBA 1ZMLA 4MPUA 1MKWH 4B76A 1O3FA 2NU0E 1DM4B 2H2ZA 1GBHA 3SJKA 3A8CA 3MU4A 2ZDKA 1CU1A 2OUAA 1LVYA 1GJ6A 1TGNA 1GDQA 1K1IA 1AWHB 5ESBA 1QGFA 1FMGA 3OX7U 1C5MD 1S83A 4J2YB 5FPSA 1TPAE 1C1SA 2STBE 4DIIH 2C90B 1HGTH 1Y3UA 3OYPA 1MTVA 1O32A 5ETXA 1EB1H 3OY5U 1G3BA 1NFXA 1YGCH 5JB9S 2G52A 3T25A 1O5CB 2AMQA 1P2OA 1DSUA 4X6MA 1G37A 3PO1B 3ZVEA 4X2YA 2XXLA 4NSVA 1TBZH 2ZHQH 1GBBA 1O3HA 1J16A 3ATKA 3TGJE 1JWTA 3FP7E 1QURH 2R2MB 1WU1A 5HYOA 1DUAA 2ZTXA 4LXBH 1NT1A 1E37B 5AFYH 1K1NA 3BTME 2P94A 4NWLA 2VVVA 3BN9A 4YLQH 3UUZA 3BG4B 4NA8A 3U98H 1V2ST 3GCTF 3ZZ9A 1AZ8A 1TRNA 2V35A 5C2ZA 3ZZ8A 1KYNA 2ZQ1A 2QXHA 2HPQH 1Y5AT 1QB9A 4GSOA 5F8XA 3K6YA 3STJA 4YO9A 3UNQA 4BTIB 3M5LA 4JYUH 3A7WA 4ZHLU 4UD9H 1ZOMA 3TK5A 2VJ1A 2QN5T 1O3DA 3EGKH 1T31A 1GI3A 1LKBA 1C1VH 1EASA 4ABJA 2HALA 1O2HA 1KLTA 4AB8A 2NU2E 2XRCA 2ZP0H 1H9HE 2FZZA 2RDLA 1O3OA 5BPEA 1WOFA 1C5NH 4MTBA 1V2RT 5C67A 5FAHA 1ANBA 2O8LA 4K8BA 1O2UA 1ETRH 1EATA 5A09A 2J9NA 1LVOA 1C2KA 1KDQA 3A8DA 3KIDU 3SJ9A 1SGFG 2GZ9A 4K69A 1NPMA 5I46H 4I31A 3EA8A 1O2JA 3A83A 5JBCS 2A4RA 3ZVFA 1YPHE 2VNTA 5DP7A 2G4TA 1BTXA 4A6LA 2VIOA 1P01A 1H9LB 1OYQA 1MQ6A 2P3TB 2TGTA 3SQHE 4INHA 4HFPB 3ATLA 2Y7XA 3A7ZA 1YCPM 3A86A 5DJ7A 2F9PA 2PHBA 3ATIA 4D8NA 1P3CA 1UCYK 3HGPA 5HXFA 1UHBB 1LCYA 1XKBC 4Y8YA 1EPTA 2QV1A 3SNDA 1RTFB 1Q31A 3NCLA 2Y7ZA 1TPPA 3P8FA 4FXGH 5DP4A 4AZ2B 2ZFSA 2ZHEH 3LU9B 9LPRA 4YZUA 2FPZA 3SUGA 2EI8A 3EA9A 1G3EA 1GBEA 4Y10E 1QB1A 4ABBA 1EAXA 4IGDA 2BQ6B 3Q00A 2LPRA 4IMQA 5HMAA 2VU8E 1PPZA 3AVZA 4UE7H 1D3DB 1GBLA 2UUKB 3A85A 2AYWA 1Y5UT 1Y3WA 2C8ZB 1LKAA 2W26A 4U30A 4K8YA 1NM6A 4A1TA 3F1SB 2IJOB 1BMMH 1UJ1A 1ZRBA 4ZHMU 5ABWA 2GZ7A 2JETB 4XDEA 4B71A 1LQEA 2XTTB 2BM2A 4FVDA 1L1JA 3UNSA 4AYVB 2ZGBH 1O33A 2ZU3A 2R3UA 1LHDH 3RLWH 4ZKOU 4MLFB 3E91A 1A0HB 4JMYA 4K3JA 1MCTA 2THFB 1GMHG 2EC9H 3MFJA 5GPIB 4ZKRU 5FXLA 1TIOA 1BQYA 1JOUB 1XUJA 4O3TA 2ZG0H 1ANDA 1HAZB 2R2WU 1F0TA 1N6XA 1WYKA 4UEHH 3SJIA 4BAMB 1CT2E 1ID5H 4K1EA 3KHVA 1SGNE 4FUIA 2FOCA 1V2QT 4UONA 1QB6A 1W3CA 2C8WB 4YT7H 1O3EA 3DD2H 4A1XA 5L2YH 2DE9A 3MO3A 1JRTA 1ARCA 3RMNH 1P8VC 1BOQA 3TJUA 1ELAA 3UPEA 5F6MA 1BJUA 1CHOF 5DP5A 3KNXA 4DT7B 1CQQA 1VR1H 4B2AA 4MVNA 5IYTA 1THPB 1H4WA 3EE0B 3RXPA 4ISNA 2GDEH 2QXGA 1DOJA 1Z7KA 4U01A 7ESTE 1C5WB 1ELTA 1UK3A 1DICA 4FUDA 5JBAS 1F92A 1S81A 1ELCA 4NIYA 1HAOH 5T6GA 4ABIA 1BTHH 1KDQB 3Q3YA 3FZZA 1P02A 2OQ5A 1O3NA 1GJ8B 1OWIA 3A8BA 1GVKB 3EDXB 2WYJA 3K9XB 3A88A 1GBDA 1P2JA 1SC8U 1XXFA 4AG2A 2FOEA 2TIOA 2H5DA 4GUXA 4LK4A 1C4U2 1OWKA 1VJAU 1O34A 2A32A 5DP6A 1HJAC 1C1NA 1VGCC 3A8AA 3ZV8A 1TGCA 5HM9A 3VXEH 5A8YA 2EA3A 2XWBI 1A4WH 3LKWA 4YT6H 3GY8A 2AMPA 1O2GH 1MZAA 1TYNA 5A2MH 4Y76A 1QRXA 2ZZUH 2F9VA 2FLBH 1H9IE 3BIUH 4QT8C 1MBQA 3U1JB 1C1WH 3PMJA 4MDSA 3RXQA 1TPOA 3DFLA 4UFDH 1P10A 1D9IA 4UFEH 3NXPA 4B2BA 1V2WT 3A7XA 1KSNA 4FU9A 4Q2KA 2GX4A 1GHVH 3M3TA 1HIAA 3UR6A 1O3BA 2JH5D 1W0YH 3VB7A 2BTCE 2ODYB 3M3VA 1EAUA 2Y5HA 3M61U 1DPOA 1PPEE 1DDJA 2VIDA 1V2MT 5EOKA 3NPSA 3V0XA 1V2KT 1TX7A 2UWLA 1RTLA 1GDNA 3PO1C 3UR9A 4X6NA 1C1OA 4X1PU 3EAJA 2TGAA 1S82A 2BLOA 4XE4A 4TYDA 3RXHA 1ESBA 1P2NA 2BD4A