1UHBA

Crystal structure of porcine alpha trypsin bound with auto catalyticaly produced native peptide at 2.15 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
125
structure length
125
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin activity reduced by an autocatalytically produced nonapeptide
pubmed rcsb
molecule tags Hydrolase
total genus 16
structure length 125
sequence length 125
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uhbA00
1E37B 1UO6A 4AB8A 1TB6H 1BBRE 1WBGB 2XC5A 1ZLRA 3GCTG 3MO6A 2FOCA 3MHWU 7KMEH 2ANWA 2ZPQA 3I77A 1BRUP 1SGDE 1YGCH 1QL9A 3PMBB 2F9BH 2JH6D 7GCHF 1HFDA 2EI8A 4GHQA 1E35B 1QRWA 1S6HA 2B9LA 1EPTC 3MU1A 1GBBA 2BHGA 2CF8H 2SGDE 4BAOB 1O3IA 2W5EA 1GI2A 3PLBA 5F8TA 3A84A 2QF0A 4CRAA 5A8ZA 3ZV8A 5C67A 3SV7A 1TQ0B 4KGAA 2BQ7B 2C4FH 1YCPH 3HKJB 1TX7A 1AE5A 2BD5A 1M9UA 2P3UB 1SGQE 2ZCHP 2AMQA 4YOIA 3QGJA 4NCYA 3UNRA 1O5CB 4YLUA 1UHBB 5GCHF 3SNEA 1QCPA 3PTBA 4CR9A 2RG3A 2XWBI 2ZU4A 5T3HA 4GCHF 4D7FA 3SNCA 3GY5A 3SJ8A 1V2ST 3KQEA 1UVUH 4BXSA 1T7CA 1YPJH 1TPAE 4NSYA 2TPIZ 4BNRA 1UTKA 2O8TA 3FP7E 3KEEA 5C5NA 4NIYA 3UOPA 2UWPA 1NFXA 4TY7A 1G37A 2BD8A 4X6PA 4Y71A 1CE5A 1TPOA 2HRVA 3E0PB 3BTME 4BANB 3QLPH 4UFDH 1O3PB 1NRQH 3UWJH 3RMNH 4X6MA 2F9NA 2A7CA 1C4Y2 3SU5A 2F9OA 3O8CA 3UY9A 1V2TT 1C2HA 2XXLA 4ASHA 4FUGA 1UTNA 1TA6A 4X6NA 4VGCC 2CHAC 3D49H 2QAAA 1NO9H 3RP2A 2CN0H 2CV3A 2AYWA 1IQLA 1Q31A 3K6ZA 2Z9KA 2J94A 2O8WA 3U8OH 1JRTA 1GHBF 3A85A 1Y5BT 2VVVA 1WSSH 5AFYH 1TX8A 4YT6H 1W3CA 4A1XA 4X1SU 3ZZ6A 5CE1A 1C2DA 3K9XB 1UK4A 5ETXA 4D9QA 2ODYB 5F8ZA 1C5YB 3AASA 5EQQA 3RXQA 4K1TA 1C5XB 1GMDG 1J17T 2GZ7A 1E0FD 3SGAE 4BAKB 1QNJA 4X8TH 3AW1A 3UNSA 1JXPA 3SI4H 1O3FA 1ANBA 2FM2A 1C1VH 1GJDB 2P93A 1GVZA 5EODA 5T6GA 3RXGA 1G9IE 1O3JA 5HMAA 3T28A 3TJOA 1GI5A 1NU9A 1S6FA 3R3GB 4X6OA 1LO6A 4Y0YE 1ORFA 3E1XB 6CHAC 3T29A 1J14A 3ZZ8A 1ELCA 1QQ4A 2GCTB 1AWHB 2BXUH 3PB1E 2R0LA 3GISB 2IOTA 1KLTA 4IMQA 1LPKB 1J15A 4K69A 2A45B 4Y11E 1BTYA 2GX4A 1B0EA 4Y7AA 2Y5GA 2BY6X 3VPKA 5AF9H 3LH1A 3A7VA 1RTKA 4K2YA 3TGJE 2AIQA 5JB9S 4RKOB 4IGDA 2GDEH 4ABDA 3MMGA 1DX5M 3ZVFA 2OINA 1UCYH 1XVOA 2ALVA 3SUGA 3SJOA 4PROA 5A0BA 5DP3A 5DO4H 1GHWH 1A5IA 4MPWA 4K1SA 3RUOA 2PW8H 1IAUA 7ESTE 3SJ9A 2FS9A 1D4PB 3MU4A 2RA3A 1AIXH 4CRGA 1O3CA 2OC7A 3M36A 1C1SA 5E0JA 1TBRH 2BLWA 1F92A 1ESBA 5FBIA 3RXUA 1C1PA 1EQ9A 1UCYE 1C2FA 1D9IA 3GYMA 3KQDA 4YESB 2FO9A 3P8GA 1QBOA 3RMOH 1G30B 1QFKH 1TQ7B 1O3MA 2F9VA 4TYDA 2BD9A 5FBEA 1S85A 1TPSA 3L3TA 2SGPE 5FCKA 2GDDA 1W13U 1P8VC 3ENSB 1TGSZ 3LH3A 2WPMS 5JBBS 1G2LA 1ELGA 1S81A 1G3BA 1BRCE 2ZTYA 4H42U 3RM0H 2SFAA 1W7GH 2TIOA 2VIVA 5H4IB 1VCQA 2KAIA 4HTCH 1MH0A 4NA8A 1WTHD 3GCHC 1LPZB 4ABIA 4ISOA 1ARCA 1HAVB 1LKBA 2FI4E 2GT7A 1BHXF 2ZGCA 1BJUA 2THFB 3DA9B 2ZG0H 1T8NA 3A8CA 3NKKA 1ZGVA 2FOGA 3NWUA 1J9CH 1V2LT 1CVWH 1SSXA 3T2NA 5DGJA 5ABWA 3ITIA 3SNBA 1SB1H 1MU8B 1YPEH 1ZZZA 4IC5A 4AG1A 4AOQA 1SG8B 1QQUA 1ZSJA 1O5AB 1IQHA 1FAKH 2BOKA 3NZIA 3OYPA 1GJBB 1XXDA 2UUFB 4TY6A 1BHXB 4NIWA 2IJOB 3N7OA 4HGCA 3V12A 1P12E 2VGCB 4LXBH 4X8SH 2HNTC 4GSOA 1Z7KA 4H6SB 1UVSH 3I29A 1CBWB 4ZUHA 3SHCH 3TJVA 1H8IH 1Y3YA 3ZZBA 3TLOA 2HVXA 1PPEE 1AZZA 5LGOA 1N6XA 3MI4A 1V6DA 1J16A 1D6RA 1W14U 2EI7A 3QX5H 1O2UA 1ZPZA 3F9EA 2AMDA 3ATIA 1WAYB 2FOFA 1A3EH 1GI1A 1YCPM 5DKMA 2OBOA 1V2MT 5CMXH 1Z1IA 1BMNH 5DP5A 3SQHE 1MKWH 1FZZA 1K1JA 1SGPE 1L4DA 2XTTB 2YOLA 2P59A 3T25A 1IHTH 3GY8A 3CENA 3S0NA 1HJ8A 1DWEH 3M3SA 3TH4H 2A4RA 1C9TA 3EDXB 1V2PT 3QO6A 4H6TA 3MH4A 2P95A 4I31A 2Y81A 2ZDLA 1EPTA 1MU6B 1O39A 3Q77A 3RXPA 3HK6B 1RTLA 1FUJA 3HKIB 3RXJA 2TGDA 1IQEA 2EI6A 3IG6B 3ZZDA 2G55A 3RXMA 2GMTC 3C1KA 5J4SA 1LHCH 9LPRA 5FPYA 1K1PA 4CBOA 3SV8A 1D3QB 1V2UT 3FP8E 1F5LA 1GBCA 1VITG 1SMFE 3QDZB 3I78A 8KME2 2BDBA 1KTTB 1O38A 3E16B 1H9HE 3TITA 4Z6AH 4AGKA 3SU0A 1DWBH 1QGFA 4JZDH 2HALA 2EC9H 1B5GH 2HNTE 3DD2H 9ESTA 1XUHA 1XKAC 2I6QA 1EJAA 3ODDA 4ZKNU 3MH6A 3F9HA 5FPSA 5EW1H 4MTBA 3T5FH 1KXDA 1EAIA 1XMNB 5CHAC 3VGCB 1PQ5A 1BIOA 2SGQE 1C5QA 1PYTC 1XUIA 4SGAE 2ZFRH 4Y7BA 1Y3XA 1MQ6A 1H4WA 4ZHAA 5AVDA 2VIPA 1EZXC 1K21H 5L6NH 1Z8JB 1GI3A 1ZHRA 1GI7B 1BTXA 1GBMA 1Y5UT 2BXTH 2WPKS 3P8FA 4WWYA 2Z9JA 1P01A 5I25A 1O5FH 3HK3B 5HYOA 2A5AA 1MCVA 2SGEE 2GT8A 1YBWA 4CR5A 1OWDA 1BBRK 1OOKB 3RXEA 1DY9A 2VVUA 1EJMA 1GMHF 1U6QA 3ZZ4A 3TH3H 1GI4A 1BOQA 2UUKB 1RD3B 1SGFA 1TNHA 2FIRH 5BPEA 1N8OB 1C5UA 4I8HA 2ANMH 1ZRKA 1W11U 3D65E 5A8XA 1QHRB 2ZTZA 5F6MA 2WUCA 5FX5A 2FODA 1UHBA 1AI8H 1UTOA 2ZECA 2BZ6H 4J1YA 3LKWA 1ZRBA 1SLXB 1QL7A 2FLBH 1ABJH 4FVDA 2Q6GA 2OQ5A 3NPSA 1NS3A 1W0YH 4ZMAH 2W7SA 1TNLA 1MBMA 1AUJA 1FAXA 3FP6E 1GI0A 1KXBA 2WPLS 1CQQA 1AVXA 3PMJA 5JDUB 1FY4A 2V3OH 1HGTH 3BTHE 2ODQA 1KDQB 5F8XA 2BDGA 2O8UA 2G8TA 1BJVA 1SHHB 4YLQH 1C4V2 3PO1C 2PUXB 4NIXA 1KXEA 3BF6H 4CH8B 1BQYA 1P03A 1NZQH 3BN9A 4WJG2 2QXGA 1INCA 1SGTA 1WQVH 1SLUB 3SNDA 2ZO3H 3FANA 1C5NH 1TMUH 3UWIA 2GV6A 3M5OA 4AYYB 4ZXYH 5TCCA 3HATH 1FJSA 2Y5FA 4B73A 4U2WA 2ZGXH 2NU4E 5AHGH 5EG4A 1S0RA 2STAE 4OS4A 1OWIA 1HUTH 2Z3DA 1AVWA 1OXGA 1TFXA 3MO9A 2XBYA 5GIBA 2Y7XA 5HM2A 1Z71A 3BTKE 1O5DH 1YF4A 3OX7U 4X2VA 1QJ6B 3RXFA 3SW2B 1P3EA 1SHYA 4B74A 4X1QU 1RRKA 2SGAA 2ZDVH 1FY5A 1BT7A 4B2AA 1AY6H 1ZHPA 1CT2E 1L2EA 1Z6EA 2PKSB 5C3NA 1HV7A 1LVOA 2WPIS 1UTMA 4XBBA 3QZRA 1ZYOA 1LCYA 1O3LA 2G00A 3RLWH 3TNTA 1VZQH 1A0JA 3BTGE 2Z3EA 1P2OA 3PYHA 3KCGH 1ZTLA 4AB9A 1HIAB 1O2YA 3PROA 1JIMA 4OS1A 3SU3A 3V13A 1C5OH 1T8OA 4LOYH 4D76A 1TWXB 1BITA 1ETSH 1IQJA 1TOMH 3A89A 5EPNA 1O5EH 5G4BA 1B7XB 3A7YA 1DWCH 1NESE 1DXPA 4CRDA 5EXNA 2FX6A 3ZVGA 1FMGA 2A32A 3D62A 2OUAA 2Z9GA 4JZFH 4NG9H 2GV7A 1GHAF 5DJ7A 1FI8A 1AFQB 1K22H 3KF2A 1K1MA 2FOEA 1DS2E 2IN2A 2FOBA 3TJNA 1T32A 4UONA 5EXMA 2NU2E 3PMAB 1KY9A 4NGAH 1BMMH 1YLCA 2R2WU 5JBCS 3ATWA 4BAMB 2A4GA 4CRBA 3Q76A 4DGJA 2VH6A 1Y8TA 2BMGB 3U8TH 1K9OE 2J34A 2DE9A 2O8MA 3K6YA 1LVMA 1HAZB 3BTDE 5C5OA 1PQ7A 3BG4C 1TGNA 1DPOA 1SC8U 3C27B 4X0WU 2W26A 1TGTA 1OPHB 2QV1A 1EJNA 4LK4A 5FPTA 3QZQA 1CU1A 3A8BA 2XW9A 4K8YA 3CS7A 1LPGB 1NPMA 1BTUA 1F0RA 2ZI2H 5L2ZH 1SLVB 3RXSA 2C8ZB 1DVAH 4SGBE 1AB9C 3EA9A 3G01A 1CA8B 1UCYK 4FUIA 4IW4E 2J9NA 2WYJA 1PJPA 1EASA 1O2LA 2CJIA 5C1UA 5LPRA 4NZLA 3U98H 1A4WH 1A5GH 1CT4E 1HAVA 2H1UA 2VIDA 3F9FA 1C1NA 4I33A 1PPBH 3SBKA 5TCAA 3LGIA 3AAVA 3QUMP 1SBWA 2Y7ZA 5SGAE 1V2OT 4UD9H 2BM2A 1YPHE 2ZPRA 4NWKA 2H5DA 2ZDKA 2Q6FA 3Q00A 2VJ1A 3LJJA 1FXYA 5DP4A 2R0KA 1LMWB 2ZWLH 1S82A 3TJUA 3OU0A 3PLPA 1BB0B 1ZPBA 4ABAA 1GI8B 2ZGJA 4GLYA 4MVNA 2RA0A 4B2BA 5GWZA 1O3EA 2SNVA 3JZ1B 2ZFPH 1QIXB 3PMHB 2BDYA 5GJ4B 3UOUA 1BRBE 2JH5D 2H6MA 1VGCB 1O3NA 4NIVA 1SOZA 2ZGBH 1E38B 1K1LA 1GJ7B 4YTAA 2GGVB 1TA2A 5C1XA 2P3TB 3PLKA 4MNWA 5JB8S 1O36A 1GBTA 3E90B 2HOBA 2P8OB 2BY8X 1BCUH 1ZR0A 1GHAG 3TK9A 4CH2B 1OYQA 3F68H 4E7NA 5ESTE 2FI5E 1UTPA 5FAHA 1Y5AT 4Y0ZE 5JYIA 1GBIA 2F9PA 1ZMNA 2A31A 4MNXA 3U1IB 5HXFA 4ZAEA 1SGFG 3M37A 1WTGH 4O3TA 1V2WT 1PPCE 4GUXA 5L2YH 4ABHA 4BAHB 2G5NA 3B23B 1O2HA 1O3KA 3E8LA 1Z1JA 2WV4A 7GCHG 1HNEE 3W94A 1AHTH 1HCGA 2PWXA 3O8RA 4ZXXH 1ELBA 1ETTH 3MU8A 1T31A 4AGJA 5JBTA 4DOQA 4Y6DA 1OSSA 2ZFTA 1O2GH 3GY7A 5A09A 2AS9A 2CF9H 2B7DH 2GZ8A 5K7RA 1GI6A 1O2ZA 5K0HA 2AGEX 4BTTB 5LPFA 3S9BA 1HAPH 3FAOA 5GCHG 2BD7A 2Z9IA 1C5MD 3LJOA 4GCHG 5I46H 1NU7B 4E06H 5EOKA 1UTJA 2J38A 1G3DA 3PM3A 2FTMA 1O2WA 2VB0A 2J95A 3A83A 1KTSB 1P3CA 2GCHF 5IYTA 1C2IA 2PV9B 3TK5A 4ZKSU 3SGBE 1CGHA 3EYDA 5JBAS 1SQTA 2BVSH 1O2JA 2UUYA 1HAYB 2ZKSA 3UFAA 3GY3A 1F5RA 1OWJA 3KNXA 3SU1A 6GCHF 2QIQA 1HAIH 4I8LA 1K1IA 3TPIZ 4DCDA 1C1TA 4UDWH 3RXTA 1XVMA 1EUFA 1JRSA 1NC6A 3S7KB 4X2YA 4TWYA 2GCTC 1TALA 2C8WB 5A0CA 1ELAA 3B8JA 1GWAA 1QA0A 1ZHMA 1C5VA 1GHBG 3LGUA 2WPJS 1A1RA 1SLWB 2G52A 4OS7A 2RDLA 1LHFH 1DSTA 2ZHEH 1WYKA 1TE0A 4CRFA 2QC2A 1YC0A 3W95A 1DUEA 4CBNA 1JBUH 1NFUA 2FXRA 1EB2A 2AH4X 1X7AC 1SOTA 4THNH 1L1JA 4JZIA 2BD2A 2OQUA 3RXOA 1O3OA 2XBVA 3MNSA 3OSYA 4DJZB 1NRSH 2NU1E 3LGWA 3BTQE 3UQVA 2FESH 3LC3A 4FU8A 1Q3XA 4E05H 1P9SA 3DFLA 1FONA 1FLEE 2BLQA 1O5BB 1MMJN 3CS0A 1GBKA 2ZU3A 1C5LH 1IQFA 1QR3E 1GBFA 3D23A 1O2TA 2YNBA 1KDQA 3SNAA 2PKAB 3JZ2B 2V3HH 3P8OA 4INKA 5A8YA 2FMJA 3TGKE 1QBNA 1YPGH 1F7ZA 4NWLA 2HLCA 3A8DA 1ELFA 1F0TA 1C5SA 3S9AA 1THPB 3TIUA 1ID5H 1GBDA 3SOSA 2J2UA 2VIQA 4JCNA 4TPYA 2BVXH 3RXIA 4RSPA 3BEIB 1MUEB 1LHEH 2BX4A 3VXFH 3MH5A 2ZGHA 1P04A 1BTZA 4Q7XA 4Y79A 4AZ2B 1ELEE 4FUJA 1A5HA 1IOEA 5DK1A 2JETB 2DE8A 4ZROA 1A2CH 1O2NA 3LOXA 4OS5A 2VU8E 3LIWA 4INLA 2ZZUH 4XBDA 4ABFA 4RN6A 2GCHG 4IN2A 1UK3A 1FDPA 1V2VT 1WU1A 5L30H 1JWTA 1K1NA 1UVTH 1IQIA 1C1RA 2BQ6B 2PSXA 1NRPH 1Z6JH 1MTNB 2FOHA 1HAOH 8ESTE 1GHXH 3L6PA 4MG3A 1NFYA 2ZP0H 2ZDMA 2BYAX 1PQ8A 1P05A 1XKBC 3A82A 5EGMA 4LZ1H 2VGCC 1L1NA 3E91A 4A7IB 1SGNE 2QXIA 4I8GA 1C5TA 1GJ4H 3LGTA 2TBSA 1XXFA 1CBWC 3SN8A 1GCTB 1S5SA 4BTUB 8GCHF 2Y80A 4Q80A 1ZGIA 4WMFA 4Y8YA 4A1VA 1P2JA 1S84A 2VWNA 1DITH 3M7TA 4JK6A 1GVKB 4BXWA 3A81A 3SU4A 3RU4T 2D2DA 1HJAB 1A0LA 1L1GA 2BX3A 1VJAU 2ALPA 3MYWA 3TU7H 1SI5H 1LHDH 1WUNH 2QXJA 2GKVE 3DUXH 3RC6A 1HIAA 3RXKA 4H4FA 1DM4B 1KXCA 1MZAA 4WH8A 4X1RU 2QY0B 2B8OH 3DFJA 3S7HB 4YZUA 1W10U 3T26A 1VITH 3UIRA 2A7JA 2ANKH 2SNWA 3NXPA 1THRH 2A1DB 2VWLA 3GDSA 1P0SH 2VVCA 3O8DA 1DOJA 2BVRH 4A6LA 3ZZ5A 4WF8A 4WXVA 3VXEH 2AFQB 1CT0E 1EAUA 3LGYA 2FI3E 3ZVBA 1AD8H 1TRYA 3KIDU 1KLIH 4FVBA 3K2UA 1LHGH 1NN6A 3M3VA 5E0HA 3EAJA 1G3EA 1ZMLA 2PSYA 1G2MA 3KGPA 2QXHA 1EX3A 1P57B 2RCEA 4NFFA 1P9UA 1SGRE 1K1OA 3MNXA 4X8UH 3QK1A 1G3CA 1CA0B 3UR9A 3M5NA 3HGNA 1RIWB 1GJ6A 1NRNH 3MU0A 1GG6B 2ZU2A 1OWHA 2Z94A 1Z8GA 2FX4A 2JH0D 3ZZ7A 1WQSA 4GVUA 2FWWA 1KLJH 2VWOA 3STIA 2WPHS 2H2ZA 1P2IA 2BDIA 4KP0A 4GAWA 1TPPA 3MTYA 1A3BH 4AORA 1V2RT 3VGCC 3KL6A 2OD3B 2XYAA 4MLFB 3UR6A 1GGDB 2FS8A 1OX1A 3MNBA 3KQBA 1C2EA 1ANDA 4Q7YA 5JPMH 1TIOA 2A2XH 2ZU5A 1E36B 1GBJA 2BD3A 1YCPK 4JZ1A 3GCTF 3AVZA 1UTLM 3P17H 2R3YA 1GDUA 4O03A 1GI9B 3ODFA 2ZHWH 1CO7E 3RDZA 5B6OA 1UK2A 3SHAH 1HXEH 1QY6A 4JMYA 1O3HA 2WUBA 5A0AE 1C2LA 3Q3KA 2ZDNA 2G4TA 4M7GA 2ZEBA 3SI3H 1N8OC 4I8KA 2WYGA 1BMLA 1DDJA 1K28D 2FP7B 1K2I1 5DP6A 3ATLA 2BY5X 3EGKH 1MQ5A 2C8YB 1O2OA 1C2GA 1AWFH 1YKTA 3BG8A 1IHSH 2ZDAH 1C9PA 3NK8A 3LONA 3EA8A 1A46H 1YYY1 1NROH 2HGTH 1AN1E 3BIUH 3RXCA 4AFSA 5HM9A 1D6WA 1RTFB 4CHAB 1RS0A 1O37A 4FUFA 1O32A 1O2PA 2A5IA 1SR5C 3ZZ3A 1C1OA 2V6NA 3DT0H 2HWLB 2UWLA 4DT7B 4XSKU 5DP9A 3TGIE 3SQEE 2ZHDA 1P06A 4AG2A 3SO3A 2C90B 1GMHG 1EPTB 1TOCB 2GZ9A 4O9VA 1QRXA 2Q1JA 3M7UA 1OYTH 1ELTA 1AFEH 3NCLA 3LPRA 2D26C 4Y10E 2F83A 4ISHH 1BZXE 4GPGA 5F03A 3ZV9A 4Z0KA 1GDQA 4UFEH 4AFUA 2EA3A 2SGFE 3RU4E 1P2NA 1JOUB 4O3UA 1SFQB 2FYQA 1MKXH 4IN1A 4WY3A 2ZU1A 1ARBA 2QA9E 2FZZA 1LQEA 4HI3A 5ESBA 1EZUC 1F5KU 3RMMH 2OXSA 2A4QA 2OC8A 3GCNA 1MZDA 3A88A 5LPEA 3BTEE 1BBRH 1PYTD 2WINI 1E34B 1LDTT 5EQRA 2NU3E 3RXAA 3V0XA 4UEHH 4A5TS 4LZ4B 1W8BH 4XE4A 3UTUH 1GHYH 1ZSLA 4IS5A 2JKHA 1UVOA 2J92A 1GMDF 1O3GA 2IPHA 2PKSC 3ZYDA 2H9TH 3M35A 1TBQH 4E7RG 4I32A 1EOJA 4UFFH 1IQNA 4K3JA 1ZJKA 2R2MB 2AERH 3A7TA 1HAHH 2D8WA 2BDHA 1FPCH 1BTPA 3GY4A 1P11E 5FX6A 1F0SA 3PWCA 2A2QH 3ATMA 2AIPA 4U30A 2TGTA 4VGCB 5T6DA 2CHAB 4B71A 3CP7A 4RKJB 4WH6A 5BRRE 1MD7A 2P3FH 3A86A 1MTWA 1CGJE 3LC5A 1XX9A 3RXHA 5AFZH 1FQ3A 2F91A 1SGEE 1C2JA 1IQMA 4KELA 2W3KA 2NWNA 2PTCE 4BOHA 4D9RA 4YO9A 2OC1A 1VCPA 1F2SE 1SGYE 2OCVB 2ZC9H 3M5LA 2WV5A 4A92A 4OGXA 3VB5A 2ZCLP 1LVYA 2ZTXA 1S0QA 4YOJA 3BTWE 1AFQC 2AGIX 1TABE 4YT7H 1TONA 2QGRA 1KSNA 2D1JA 4TPIZ 3ZVEA 3RU4D 2XCFA 1WOFA 4NZQA 3FZDA 3GY6A 1GJ5H 5E2PA 2XBWA 1CSOE 4FUEA 3T27A 1ZJDA 4FXGH 2VH0A 4MPUA 4R8TB 1AKSB 3WY8A 1HB0B 4MPXA 4FUDA 2BTCE 6CHAB 2PKAA 2FYRA 2ZQ1A 5GDSH 1P09A 1FIZA 1XM1A 3P95A 2LNCA 4Q2KA 4ZH8A 3AAUA 1AGJA 2Y6TA 1W12U 4IBLH 1D3PB 3EE0B 8LPRA 1GVLA 1SPJA 3VB3A 2BY9X 1C5PA 4KKDA 1D3DB 3RLYH 2B5TB 2XWAA 1YPLH 2ZHFH 1ESTA 2XNIA 3VB6A 1AVGH 1NRRH 1WV7H 1ACBE 3RM2H 1ZOMA 2ZCKP 3MU5A 1QJ1B 1CHOF 3V7TA 3V3MA 1T4VH 4WVPE 1BRAA 1W0ZU 1V2QT 4JK5A 3F1SB 2PHBA 3KQCA 1EB1H 2ZQ2A 3RC5A 6LPRA 1TX6A 2R9PA 3STJA 5E8EH 4WMEA 2V0BA 1PPFE 3HPTB 2BZAA 1HAXB 1HBTH 1AUTC 4KTSA 1OWKA 1JIRA 2R3UA 3ELAH 3ZZ9A 3EQ0H 1PFXC 2BDAA 4AN7A 1C4U2 3MFJA 1MAXA 5GPIB 3GY2A 1H9LB 5IDKA 1BUIA 1H9IE 1OWEA 4X2WA 1QRZA 1TGBA 1P10A 4B76A 1XUGA 1O30A 1HDTH 4I8JA 3LT3A 2AEIH 1PQAA 3GOVB 1CHGA 1MKWK 1VGCC 2CGAA 3SV6A 1MTUA 3S9CA 3BTFE 1SQOA 1WCZA 5EQSA 1ZTKA 1C1WH 2XCNA 4Y8ZA 3ZVAA 3GCHB 2ZPSA 4IMZA 1A0HB 1V3XA 2P8OC 3BTTE 3TH2H 1C2MA 1BMAA 2YNAA 1A7SA 1AZ8A 2G81E 2HNTF 1THSH 1HJ9A 3UUZA 1Z8IB 4ZHLU 1DANH 3U69H 2ILNA 2ZFFH 3SV2H 1SFIA 5FXLA 3SORA 2K1QA 2ULLA 4K8BA 1Q2WA 2ZHQH 2Q6DA 2H9EH 3A7ZA 3PV4A 2A5KA 1T8LA 1IQKA 2EEKA 1BTHH 3GYLB 3SU2A 1XUJA 1O35A 1KYNA 4NA9H 3VB7A 3QN7A 1MTVA 3RXLA 4U32A 4JYUH 2A4OA 1YPKH 2BB4A 3P92A 1DY8A 2CXVA 1VR1H 3QGNB 1TMBH 3ZYEA 1HLTH 3IWMA 5LH8A 1FIWA 3OY5U 3GICB 2VIOA 3GDVA 3O8BA 1Y3UA 3URDA 1O34A 2PR3A 1C1QA 1MAYA 2GD4B 2ZIQH 1GJ8B 4KTUA 2PFEA 1FNIA 1VITF 3SU6A 1EP5A 1PPHE 2AGGX 1CHOG 1O2XA 4DG4A 1V2KT 4BTIB 1SGIB 1OS8A 1FPHH 3SUFA 4F49A 4ABEA 1TAWA 3S69A 1DWDH 3SUEA 2M5TA 2NU0E 3UNQA 4FUCA 4AYVB 2ZNKH 1KXAA 2XRCA 2OP9A 4ZHMU 1EZQA 1EATA 2PUQH 4ISIH 3QWCH 2H5CA 4Y76A 2Z9LA 4KTCA 1S83A 2DUCA 1BA8B 2F9UA 4WMDA 1SGCA 1ZTJA 3P8NA 2OLGA 3U1JB 2GTBA 1HRTH 1C5RA 2H9HA 1QB1A 2GMTB 2BLOA 1LTOA 4YM9A 1VJ9U 2P16A 3BIVH 1GL1A 4CREA 1V2JT 1TNGA 3H5CB 4ESTE 5T6FA 1GPZA 2QYIA 1DXWA 4WXIA 3F6UH 4HZHA 2BOHB 1OP2A 3B9FH 6ESTA 4J2YB 4O97A 1PPZA 1O2KA 1QB9A 1Y3VA 1OP0A 1W7XH 3ZZAA 1OP8A 2STBE 3MH7A 1GBAA 2GVFA 4DVAU 4TWWA 1NM6A 1ESAA 2C3SA 1ZSKA 4IC6A 1SVPA 3SV9A 5DP8A 2OBQA 5FCRA 1YP9A 5CHAB 2GP9B 3A87A 6GCHG 4Q7ZA 4X8VH 4MNVA 3PWBA 4K1EA 4XFQA 4NFEA 5E0GA 1TNJA 2ANYA 1FN8A 3ZZCA 1GL0E 1FY8E 1GJ9B 4GHTA 1DT2A 2A0QB 3MO3A 1DFPA 2P94A 3OTJE 4X1NU 1ANEA 2QF3A 4XBCA 3SJIA 1B0FA 2C8XB 4DURA 3E0NB 3LGVA 4XDEA 2ODPA 1QB6A 3HGPA 4U01A 1O2IA 1AU8A 2BY7X 2QCYA 2XC0A 3FZZA 3RXBA 1LVBA 2ZF0H 2G51A 4K5ZA 1YLDA 2B0FA 3UPEA 1FY3A 3BV9B 3DHKH 4B2CA 2FDAA 4QT8C 4OS2A 1F0UA 1EP6A 1SQAA 2G4UA 3SZNA 1C2KA 1DLKB 1GBHA 2O8LA 4UFGH 4MDSA 2JETC 1MBQA 3FFGA 4FU7A 2Y82A 1LKAA 3GCOA 1GBEA 1HYLA 2FPZA 4ISLA 2FLRH 2PTNA 5GXPA 1EXFA 1GBLA 5TJXA 4DW2U 2VWMA 5EU8A 2VINA 4ABJA 4BAQB 1RJXB 4I7YH 1C1UH 1EOLA 4JZEH 2W3IA 4ABBA 1T4UH 4JYTA 4B75A 3F9GA 3U8RH 1O2SA 7LPRA 5DP7A 4F4OC 3ESTA 1ELDE 1QBVH 5HGGA 1MTNC 2I6SA 4A1TA 1XUFA 5C2ZA 4ISNA 3T62A 4MQAA 1TNKA 3PO1B 1T8MA 1GHVH 1O3DA 1GJCB 1HAGE 2G5VA 1MKXK 1P2KA 1YM0A 2HPPH 3A80A 4DIHH 5DG6A 4D8NA 1DLEA 5EW2H 4OGYA 1H1BA 3KHVA 1FY1A 1G32B 3BSQA 1O3AA 1CGIE 1GCTC 3P6ZB 1D3TB 1HPGA 1QL8A 1FN6A 3OY6U 1A61H 2KAIB 1W2KH 4ZKRU 1Y59T 2OC0A 3SGQE 3MWIU 3M5MA 1ETRH 2ZA5A 1P2QA 1HJAC 2VNTA 5EXLA 3AW0A 1TNIA 3QTVH 1PPGE 1O2MA 1UTQA 2VIWA 1H8DH 2HPQH 3IITA 3Q3YA 3P70B 3UQOA 1NT1A 2Z7FE 1GMCF 4UE7H 3KN2A 3MNCA 1QTFA 2XBXA 1ELVA 1OKXA 4NSVA 1ZMJA 3ZVCA 1IQGA 2ZFQH 1RGQA 1JMOH 2V35A 2FOMB 4AFQA 2F3CE 1C1MA 1AQ7A 2BLVA 2Y5HA 1AKSA 3GDUA 3RXVA 4HFPB 1NTPA 3VB4A 4X2XA 2PGBB 1Z8RA 2W7UA 3H7TA 3RC4A 3RXDA 4CRCA 2A7HA 2BD4A 2C93B 8GCHG 1O33A 1EKBB 4NA7A 1VCWA 3K65B 1O2QA 2BQWB 2BDCA 4Y8XA 3Q3XA 5EPYA 1NY22 4DIIH 1ABIH 3TNSA 4FUBA 2TRMA 3L33A 4FU9A 3UREA 1MTSA 2UWOA 3ZVDA 3QTOH 2UUJB 3VFEA 3A8AA 1TLDA 5C1YA 3RMLH 1AO5A 1RXPA 4B1TA 1O5GH 1TBZH 1LQDB 1TMTH 1GJAB 1C5WB 1CA0C 5FHTA 1GHZA 1P2MA 1RIWC 1TYNA 2LPRA 1GG6C 4YOGA 2FEQH 3E6PH 1BTWA 1C5ZB 3URCA 3H7OA 4MNYA 3R0FA 1DICA 2PLXA 2FTLE 2ASUB 1L0ZA 3M61U 4JYVH 3TK6A 2FOAA 1RFNA 3RXRA 5A2MH 4R0IA 3BEUA 1SL3A 3SJKA 1DSUA 1J8AA 2PGQB 1EZSC 5DPAA 1EAWA 4D7GA 1GGDC 2CMYA 4INHA 3BG4B 4FUHA 3U9AH 1KXFA 5PTPA 3MOCA 1QA7A 1O2VA 1HXFH 1QJ7B 3EA7A 3A7WA 3LDXH 1N1LA 5C20A 1FV9A 1EAXA 3E3TA 1KIGH 3PTNA 1NFWA 1L4ZA 1YPMH 1MCTA 2XC4A 3LU9B 1AB9B 1Y3WA 1ANCA 4AX9H 1V2NT 4OS6A 2O9QA 3A7XA 1ZPCA 2Z6BD 2ZFSA 2TGPZ 4DY7B 1YPHC 4MPVA 1AE8H 3M3TA 1O31A 3VEQB 2ESTE 1XUKA 5J4QA 4ZKOU 1TGCA 2TGAA 1AMHA 1GCDA 4K60A 3SUDA 3FVFB 1G36A 1UMAH 1O0DH 4X1PU 4ABGA 2AMPA 3TVJB 3NUMA 1O2RA 2Z3CA 1GMCG 1UJ1A 2J4IA 3ATKA 1N6YA 2OTVA 1GDNA 1DUAA 4AFZA 1TRNA 4XOJA 1P02A 1TRMA 1DE7H 1QURH 1UVPA 3BEFB 4CHAC 3M7QA 5E2OA 1MD8A 1O3BA 1BDAA 2QN5T
chains in the Genus database with same CATH superfamily
1E37B 1UO6A 4AB8A 1TB6H 1BBRE 1WBGB 2XC5A 1ZLRA 3GCTG 3MO6A 2FOCA 3MHWU 7KMEH 2ANWA 2ZPQA 3I77A 1BRUP 1SGDE 1YGCH 1QL9A 2L74A 3PMBB 2F9BH 2JH6D 7GCHF 1HFDA 2EI8A 4GHQA 1E35B 1QRWA 1S6HA 2B9LA 4I86A 1EPTC 3MU1A 1GBBA 2BHGA 2CF8H 2SGDE 4BAOB 1O3IA 2W5EA 1GI2A 3PLBA 5F8TA 3A84A 2QF0A 4CRAA 5A8ZA 3ZV8A 5C67A 3SV7A 1TQ0B 3DSPA 4KGAA 2BQ7B 2C4FH 1YCPH 3HKJB 1TX7A 5CHBA 1AE5A 2BD5A 1M9UA 2P3UB 1SGQE 2ZCHP 2AMQA 4YOIA 3QGJA 4NCYA 3UNRA 1O5CB 4YLUA 1UHBB 5GCHF 3SNEA 1QCPA 3PTBA 2XNDD 4CR9A 2RG3A 2XWBI 2ZU4A 2KR7A 5T3HA 4GCHF 4D7FA 3SNCA 3GY5A 3SJ8A 1V2ST 3KQEA 1UVUH 4BXSA 1T7CA 1YPJH 1TPAE 4NSYA 2TPIZ 4BNRA 1UTKA 2O8TA 3FP7E 3KEEA 5C5NA 4NIYA 3UOPA 2UWPA 1NFXA 4TY7A 1G37A 2BD8A 4X6PA 4Y71A 1CE5A 1TPOA 2HRVA 3E0PB 3BTME 4BANB 3N99A 3QLPH 4UFDH 1O3PB 1NRQH 3UWJH 3RMNH 4X6MA 2F9NA 2A7CA 1C4Y2 3SU5A 2F9OA 3O8CA 3UY9A 1V2TT 1C2HA 2XXLA 4ASHA 4FUGA 1UTNA 1TA6A 4X6NA 4VGCC 2CHAC 4Q63A 3D49H 2QAAA 1NO9H 3RP2A 2CN0H 2YMSC 2CV3A 2AYWA 1IQLA 2WZQA 1Q31A 3K6ZA 2Z9KA 2J94A 1YY3A 2O8WA 3U8OH 1JRTA 1GHBF 3A85A 1Y5BT 2VVVA 1WSSH 5AFYH 1TX8A 4YT6H 1W3CA 4A1XA 4X1SU 3ZZ6A 5CE1A 1C2DA 3K9XB 1UK4A 5ETXA 4D9QA 2ODYB 5F8ZA 1C5YB 3AASA 5EQQA 3RXQA 4K1TA 1C5XB 5C94A 1GMDG 1J17T 2GZ7A 1E0FD 3SGAE 4BAKB 1QNJA 4X8TH 1W0JD 3AW1A 3UNSA 1JXPA 3SI4H 1O3FA 3FKSD 1ANBA 2FM2A 1C1VH 1GJDB 2P93A 1GVZA 5EODA 5T6GA 3RXGA 1G9IE 1O3JA 5HMAA 3T28A 3TJOA 1GI5A 1NU9A 1S6FA 3R3GB 4X6OA 1LO6A 4Y0YE 1ORFA 3E1XB 6CHAC 3T29A 1J14A 3ZZ8A 1ELCA 5FL7D 1QQ4A 2GCTB 1AWHB 2BXUH 3PB1E 2R0LA 3GISB 2IOTA 1KLTA 5HIYA 4IMQA 1LPKB 1KMHB 1J15A 4K69A 2A45B 4Y11E 1BTYA 2GX4A 1B0EA 4Y7AA 4OM9A 2Y5GA 2BY6X 3VPKA 5AF9H 3LH1A 3A7VA 1RTKA 4K2YA 3TGJE 2AIQA 5JB9S 4RKOB 4IGDA 2GDEH 4ABDA 3MMGA 1DX5M 3ZVFA 2OINA 1UCYH 1XVOA 2ALVA 3SUGA 3SJOA 4PROA 5A0BA 5DP3A 5DO4H 1GHWH 1A5IA 4MPWA 4K1SA 3RUOA 2PW8H 1IAUA 7ESTE 3SJ9A 2FS9A 1D4PB 3MU4A 2RA3A 1AIXH 4CRGA 1O3CA 2OC7A 2QF5A 3M36A 1C1SA 5E0JA 1TBRH 2BLWA 1F92A 1ESBA 5FBIA 3RXUA 1C1PA 1EQ9A 1UCYE 1C2FA 1D9IA 3GYMA 3KQDA 4YESB 2FO9A 3P8GA 1QBOA 3RMOH 1G30B 1QFKH 1TQ7B 1O3MA 2F9VA 4TYDA 2BD9A 5FBEA 1S85A 1TPSA 3L3TA 2SGPE 5FCKA 2GDDA 1W13U 1P8VC 3ENSB 1TGSZ 3LH3A 2WPMS 5JBBS 1G2LA 1ELGA 1S81A 1G3BA 1BRCE 2ZTYA 4H42U 3RM0H 2SFAA 1W7GH 2TIOA 2VIVA 5H4IB 2WV9A 1VCQA 2KAIA 4HTCH 1MH0A 4NA8A 4DT4A 1WTHD 3GCHC 1LPZB 4ABIA 4ISOA 1ARCA 1HAVB 1LKBA 2FI4E 2GT7A 1BHXF 2ZGCA 4XD7D 1BJUA 2THFB 3DA9B 2ZG0H 1T8NA 3A8CA 3NKKA 1ZGVA 2FOGA 3NWUA 1J9CH 1V2LT 4TT3D 1CVWH 1SSXA 3T2NA 5DGJA 5ABWA 3ITIA 3SNBA 1SB1H 1MU8B 1YPEH 1ZZZA 4IC5A 4AG1A 4AOQA 1SG8B 1QQUA 1ZSJA 1O5AB 1IQHA 1FAKH 2BOKA 3NZIA 2WHXA 3OYPA 4RT0A 1GJBB 1XXDA 2UUFB 4TY6A 1BHXB 4NIWA 2IJOB 3N7OA 4HGCA 3V12A 3FO8D 1P12E 2VGCB 4LXBH 4X8SH 2HNTC 4GSOA 1Z7KA 4H6SB 1UVSH 3I29A 1CBWB 4F55A 2YMSD 4ZUHA 3SHCH 3TJVA 1E79D 1H8IH 1Y3YA 3ZZBA 3TLOA 2HVXA 1PPEE 1AZZA 5LGOA 1N6XA 3MI4A 1V6DA 1J16A 1D6RA 1W14U 2EI7A 3QX5H 1O2UA 1ZPZA 3F9EA 2AMDA 3ATIA 1WAYB 2FOFA 1A3EH 1GI1A 1YCPM 5DKMA 1WXRA 2OBOA 1V2MT 5CMXH 1Z1IA 1BMNH 5DP5A 3SQHE 1MKWH 1FZZA 1K1JA 1SGPE 1L4DA 2KCPA 2XTTB 2YOLA 2P59A 3T25A 1IHTH 3GY8A 3CENA 3S0NA 1HJ8A 1DWEH 3M3SA 3TH4H 2KCYA 2A4RA 1C9TA 3EDXB 1V2PT 3QO6A 4H6TA 3MH4A 2P95A 4I31A 2Y81A 2ZDLA 1EPTA 1MU6B 1O39A 3Q77A 3RXPA 3HK6B 1RTLA 1FUJA 3HKIB 3RXJA 2TGDA 1IQEA 2EI6A 2L6OA 3IG6B 2IJD1 3ZZDA 2G55A 3RXMA 2GMTC 3C1KA 5J4SA 1LHCH 9LPRA 5FPYA 3WWBA 1K1PA 4CBOA 3SV8A 1D3QB 1V2UT 3FP8E 1F5LA 1GBCA 1VITG 1SMFE 3QDZB 3I78A 8KME2 2BDBA 1KTTB 1O38A 3E16B 1H9HE 3TITA 4Z6AH 4AGKA 3SU0A 1DWBH 1QGFA 4JZDH 2HALA 2EC9H 1B5GH 2HNTE 3DD2H 9ESTA 1XUHA 1XKAC 2I6QA 1EJAA 3ODDA 4ZKNU 3MH6A 3F9HA 5FPSA 5EW1H 2JDID 4MTBA 3T5FH 1KXDA 1EAIA 1XMNB 5CHAC 1COWD 1PQ5A 1BIOA 3VGCB 2SGQE 1C5QA 1PYTC 1XUIA 4SGAE 2ZFRH 4Y7BA 1Y3XA 1MQ6A 1H4WA 4ZHAA 5AVDA 2VIPA 1EZXC 1K21H 5L6NH 1Z8JB 1GI3A 1ZHRA 1GI7B 1BTXA 1GBMA 1Y5UT 2BXTH 2WPKS 3P8FA 4WWYA 2Z9JA 1P01A 5I25A 1O5FH 3HK3B 5HYOA 2A5AA 1MCVA 2SGEE 2GT8A 1YBWA 4CR5A 1OWDA 1BBRK 1OOKB 3RXEA 1DY9A 2VVUA 1EJMA 1GMHF 1U6QA 3ZZ4A 3TH3H 1GI4A 1BOQA 2UUKB 1EFRD 1RD3B 1SGFA 1TNHA 2FIRH 5BPEA 1N8OB 3OAAD 1OHHD 1C5UA 4I8HA 2ANMH 1ZRKA 1W11U 3D65E 5A8XA 3FN8A 1QHRB 2ZTZA 5F6MA 2WUCA 5FX5A 2FODA 1UHBA 1AI8H 1UTOA 2ZECA 2BZ6H 4J1YA 3LKWA 1ZRBA 1SLXB 1QL7A 2FLBH 1ABJH 4FVDA 2Q6GA 2OQ5A 3NPSA 1NS3A 1W0YH 4ZMAH 2W7SA 1TNLA 1MBMA 1AUJA 2IPQX 1FAXA 3FP6E 1GI0A 1KXBA 2WPLS 1CQQA 1AVXA 3PMJA 2F4LA 2KFWA 5JDUB 4YXWD 1FY4A 2W6ID 2V3OH 1HGTH 3BTHE 2ODQA 1KDQB 5F8XA 2BDGA 2O8UA 2G8TA 1BJVA 1SHHB 4YLQH 1C4V2 3PO1C 5C0UA 2PUXB 4NIXA 1KXEA 3BF6H 4CH8B 3OTPA 1BQYA 1P03A 1NZQH 3BN9A 4WJG2 2QXGA 1INCA 1SGTA 1WQVH 3OEED 1SLUB 3SNDA 2ZO3H 3FANA 1C5NH 1TMUH 3UWIA 2GV6A 3M5OA 4AYYB 4ZXYH 5TCCA 3HATH 1FJSA 2Y5FA 4B73A 4U2WA 2ZGXH 2NU4E 5AHGH 5EG4A 1S0RA 2STAE 4OS4A 1OWIA 2QF4A 1HUTH 2Z3DA 1AVWA 1OXGA 1TFXA 3MO9A 3DSGA 2XBYA 5GIBA 2Y7XA 5HM2A 1Z71A 3BTKE 1O5DH 1YF4A 3OX7U 4X2VA 1QJ6B 3RXFA 2J98B 3SW2B 1P3EA 1SHYA 2KCAA 4B74A 4X1QU 1RRKA 2SGAA 2ZDVH 1FY5A 1BT7A 4B2AA 1AY6H 1ZHPA 2RFKC 1CT2E 1L2EA 1Z6EA 2PKSB 5C3NA 1HV7A 1LVOA 2WPIS 1UTMA 4XBBA 3QZRA 1ZYOA 1LCYA 1O3LA 2G00A 3RLWH 3TNTA 1VZQH 1A0JA 4P00A 3BTGE 2Z3EA 1P2OA 3PYHA 3PV2A 3KCGH 1ZTLA 4AB9A 1HIAB 1O2YA 3PROA 1JIMA 4OS1A 3SU3A 5DN6D 3V13A 1C5OH 1T8OA 4LOYH 4D76A 1TWXB 1BITA 1ETSH 1IQJA 1TOMH 3A89A 5EPNA 3WWFA 1O5EH 5G4BA 1B7XB 3A7YA 1DWCH 1NESE 1DXPA 4CRDA 5EXNA 2FX6A 3ZVGA 1FMGA 2A32A 3D62A 2OUAA 2Z9GA 4JZFH 4NG9H 2GV7A 1GHAF 5DJ7A 1FI8A 1VKYA 1AFQB 1K22H 3KF2A 1K1MA 2FOEA 1DS2E 2IN2A 1H8HD 2FOBA 3TJNA 1T32A 4UONA 5EXMA 2NU2E 3PMAB 1KY9A 4NGAH 1BMMH 2W6JD 1WDIA 1YLCA 2R2WU 5JBCS 3ATWA 4BAMB 2A4GA 4CRBA 3Q76A 4DGJA 2VH6A 1Y8TA 2BMGB 3U8TH 1SQRA 1K9OE 2J34A 2DE9A 2O8MA 3K6YA 1LVMA 1HAZB 3BTDE 5C5OA 3N7DA 1PQ7A 3BG4C 1TGNA 4RT1A 1DPOA 1SC8U 3C27B 4X0WU 2W26A 1TGTA 1OPHB 2QV1A 3F2FA 1EJNA 4LK4A 5FPTA 3QZQA 1CU1A 3A8BA 2XW9A 4K8YA 3DCLA 3CS7A 1LPGB 1NPMA 1BTUA 1F0RA 2ZI2H 5L2ZH 1SLVB 3RXSA 2C8ZB 1DVAH 4SGBE 1AB9C 3EA9A 3G01A 1CA8B 1UCYK 4FUIA 4IW4E 2J9NA 2WYJA 1PJPA 1EASA 1O2LA 2CJIA 5C1UA 5LPRA 4NZLA 3U98H 1A4WH 1A5GH 1CT4E 1HAVA 2H1UA 2VIDA 3F9FA 1C1NA 4I33A 1PPBH 4Z1MD 3SBKA 5TCAA 3LGIA 3AAVA 3QUMP 1SBWA 2Y7ZA 5SGAE 1V2OT 4UD9H 2BM2A 1YPHE 2ZPRA 4NWKA 2H5DA 2V7QD 2ZDKA 2Q6FA 3Q00A 2VJ1A 3LJJA 1FXYA 5DP4A 2R0KA 1LMWB 2ZWLH 1S82A 3TJUA 3OU0A 3PLPA 1BB0B 1ZPBA 4ABAA 1GI8B 2ZGJA 4GLYA 4MVNA 2RA0A 4B2BA 3H09A 5GWZA 1O3EA 2SNVA 3JZ1B 2ZFPH 1QIXB 3PMHB 2BDYA 5GJ4B 3UOUA 1BRBE 2JH5D 2H6MA 1VGCB 1O3NA 4NIVA 1SOZA 2ZGBH 3DSOA 1E38B 1K1LA 1GJ7B 4YTAA 2GGVB 1TA2A 5C1XA 2P3TB 3PLKA 4MNWA 5JB8S 3EE7A 1O36A 1GBTA 3E90B 2HOBA 2P8OB 4Q4LA 2BY8X 1BCUH 1ZR0A 1GHAG 3TK9A 4CH2B 1OYQA 3F68H 4E7NA 5ESTE 2FI5E 1UTPA 3VG8A 1Y5AT 4Y0ZE 4B6EA 5FAHA 1GBIA 5JYIA 2F9PA 1ZMNA 2A31A 4MNXA 3U1IB 5HXFA 4ZAEA 1SGFG 3M37A 1WTGH 4O3TA 1V2WT 1PPCE 4GUXA 5L2YH 4ABHA 4BAHB 2G5NA 3B23B 1O2HA 5KEDA 1O3KA 2V3MA 3E8LA 1Z1JA 2WV4A 7GCHG 1HNEE 3W94A 1AHTH 1UW7A 2CK3D 1HCGA 2PWXA 3O8RA 4ZXXH 1ELBA 1ETTH 3PRDA 3MU8A 1T31A 4AGJA 5JBTA 4DOQA 4Y6DA 1OSSA 1YWUA 2ZFTA 1O2GH 3GY7A 5A09A 2AS9A 2CF9H 2B7DH 2GZ8A 5K7RA 1GI6A 1O2ZA 5K0HA 2AGEX 4BTTB 5LPFA 3S9BA 1HAPH 3FAOA 1W0KD 2BD7A 5GCHG 2Z9IA 1C5MD 3LJOA 4GCHG 5I46H 1NU7B 4E06H 5EOKA 1UTJA 2J38A 1G3DA 3PM3A 2FTMA 1O2WA 2RDEA 2VB0A 2J95A 3A83A 1KTSB 1P3CA 2GCHF 5IYTA 1C2IA 2PV9B 3TK5A 4ZKSU 3SGBE 1CGHA 3EYDA 5JBAS 1SQTA 2BVSH 1O2JA 2UUYA 1HAYB 2ZKSA 3UFAA 3GY3A 1F5RA 1OWJA 3KNXA 3SU1A 6GCHF 2QIQA 1HAIH 4I8LA 1K1IA 3TPIZ 4DCDA 1C1TA 4UDWH 3RXTA 1XVMA 1EUFA 1JRSA 1NC6A 3S7KB 4X2YA 4ACAA 4TWYA 2GCTC 1TALA 2C8WB 5A0CA 1ELAA 3B8JA 1GWAA 1QA0A 1ZHMA 4ASUD 1C5VA 1GHBG 3LGUA 2WPJS 1A1RA 1SLWB 2M2AA 2G52A 4OS7A 2RDLA 1LHFH 1DSTA 2ZHEH 1WYKA 1TE0A 4CRFA 2QC2A 1YC0A 3W95A 1DUEA 4CBNA 1JBUH 1NFUA 2FXRA 1EB2A 2AH4X 1X7AC 1SOTA 4THNH 1L1JA 4JZIA 2BD2A 2OQUA 3RXOA 5CDFE 1O3OA 2XBVA 3MNSA 2JJ2D 3OSYA 1NRSH 2NU1E 2QE7D 3LGWA 4DJZB 3GS9A 3BTQE 3UQVA 2FESH 3LC3A 4FU8A 1Q3XA 4E05H 1P9SA 3DFLA 1FONA 1FLEE 2BLQA 3OE7D 1O5BB 1MMJN 3CS0A 1GBKA 2ZU3A 1C5LH 1IQFA 1QR3E 1GBFA 3D23A 1O2TA 2YNBA 1KDQA 3SNAA 2PKAB 3JZ2B 2V3HH 3P8OA 4INKA 5A8YA 2FMJA 3TGKE 1QBNA 1YPGH 1F7ZA 4NWLA 2HLCA 3A8DA 1ELFA 1F0TA 1C5SA 3S9AA 1THPB 3TIUA 1ID5H 1GBDA 3SOSA 2J2UA 5B6LA 2VIQA 4JCNA 4TPYA 2BVXH 3RXIA 4RSPA 3BEIB 1MUEB 1LHEH 2BX4A 3VXFH 3MH5A 2ZGHA 1P04A 1BTZA 4Q7XA 4Y79A 4AZ2B 1ELEE 4FUJA 1A5HA 1IOEA 5DK1A 2HVYB 2JETB 2DE8A 4ZROA 1A2CH 1O2NA 3LOXA 4OS5A 2VU8E 2JJ1D 3LIWA 2J98A 4INLA 2ZZUH 4XBDA 4ABFA 4RN6A 2GCHG 4IN2A 1UK3A 1FDPA 1V2VT 1WU1A 5L30H 3OEHD 1JWTA 1K1NA 1UVTH 1IQIA 1C1RA 2BQ6B 2PSXA 1NRPH 1Z6JH 1MTNB 2FOHA 1HAOH 8ESTE 1GHXH 2KX4A 3L6PA 4MG3A 1NFYA 2ZP0H 2ZDMA 2BYAX 1PQ8A 1P05A 1XKBC 3A82A 5EGMA 2LELA 4LZ1H 2VGCC 1L1NA 3E91A 4A7IB 1SGNE 2QXIA 4I8GA 1C5TA 1GJ4H 3LGTA 2TBSA 1XXFA 1CBWC 2J97A 3SN8A 1GCTB 1S5SA 4BTUB 8GCHF 2Y80A 4Q80A 1ZGIA 2GJGA 4WMFA 4Y8YA 4A1VA 1P2JA 1S84A 2VWNA 1DITH 3M7TA 4JK6A 1GVKB 4BXWA 3A81A 5HKKD 3SU4A 3RU4T 2D2DA 1HJAB 1A0LA 1L1GA 2BX3A 1VJAU 2ALPA 3MYWA 3TU7H 1SI5H 1LHDH 1WUNH 2QXJA 2GKVE 3DUXH 3RC6A 1HIAA 3RXKA 4H4FA 1DM4B 1KXCA 1MZAA 4WH8A 4X1RU 2QY0B 2B8OH 3DFJA 3S7HB 4YZUA 1W10U 3T26A 1VITH 3UIRA 2A7JA 2ANKH 2SNWA 3NXPA 1THRH 2A1DB 2VWLA 3GDSA 1P0SH 2VVCA 3O8DA 1DOJA 2BVRH 1NBME 4A6LA 3ZZ5A 4WF8A 4WXVA 3VXEH 2AFQB 1CT0E 1EAUA 3LGYA 2FI3E 3ZVBA 3W1EA 1E1QD 1AD8H 1TRYA 3KIDU 1KLIH 4FVBA 3K2UA 1LHGH 1NN6A 3M3VA 5E0HA 3EAJA 1G3EA 1ZMLA 2PSYA 1G2MA 3KGPA 2EY4C 2QXHA 1EX3A 1P57B 2RCEA 4NFFA 1P9UA 1SGRE 1K1OA 3MNXA 4X8UH 3QK1A 1G3CA 1CA0B 3UR9A 4ZCNA 3M5NA 3HGNA 1RIWB 1GJ6A 1NRNH 3MU0A 1GG6B 2ZU2A 1OWHA 2Z94A 1Z8GA 2FX4A 2JH0D 3ZZ7A 1WQSA 4GVUA 2FWWA 1KLJH 2VWOA 3STIA 2WPHS 2H2ZA 1P2IA 2BDIA 4KP0A 4GAWA 1TPPA 3MTYA 1A3BH 4AORA 1V2RT 3VGCC 2KZ4A 3KL6A 2OD3B 2XYAA 4MLFB 3UR6A 1GGDB 2FS8A 1OX1A 3MNBA 3KQBA 1C2EA 1ANDA 4Q7YA 5JPMH 1TIOA 2A2XH 2ZU5A 1E36B 1GBJA 2BD3A 1YCPK 4JZ1A 1QZ8A 1MABB 3GCTF 3AVZA 1UTLM 3P17H 2R3YA 3F0OA 1GDUA 4O03A 1GI9B 3ODFA 2ZHWH 1CO7E 3RDZA 5B6OA 1UK2A 3SHAH 1HXEH 1QY6A 4JMYA 1O3HA 2WUBA 5A0AE 1C2LA 3Q3KA 2ZDNA 2G4TA 4M7GA 2ZEBA 3SI3H 1N8OC 4I8KA 2WYGA 1BMLA 1DDJA 1K28D 2FP7B 1K2I1 5DP6A 3ATLA 2BY5X 3EGKH 1NBMD 1MQ5A 4HG6A 2C8YB 1O2OA 1C2GA 1AWFH 1YKTA 3BG8A 1IHSH 2ZDAH 1C9PA 3NK8A 3LONA 3EA8A 1A46H 1YYY1 1NROH 3KQ5A 2HGTH 1AN1E 3BIUH 3RXCA 4AFSA 5HM9A 1D6WA 1RTFB 1H8ED 4CHAB 1RS0A 1O37A 4FUFA 1O32A 1O2PA 2A5IA 1SR5C 3ZZ3A 1C1OA 2V6NA 3DT0H 2HWLB 5EJLA 1YLNA 2UWLA 4DT7B 4XSKU 5DP9A 3TGIE 3SQEE 2ZHDA 1P06A 4AG2A 3F2GA 3SO3A 2C90B 1GMHG 1EPTB 1TOCB 2GZ9A 4O9VA 1QRXA 2Q1JA 3M7UA 4FOUC 1OYTH 1ELTA 1AFEH 3NCLA 3LPRA 2D26C 3CNRA 2F83A 4ISHH 1BZXE 4Y10E 4GPGA 5F03A 3ZV9A 4Z0KA 1GDQA 4UFEH 4AFUA 2EA3A 2SGFE 3RU4E 1P2NA 1JOUB 4O3UA 1SFQB 2FYQA 1MKXH 4IN1A 4WY3A 2ZU1A 1ARBA 2QA9E 2K8IA 2FZZA 1LQEA 4HI3A 5ESBA 1EZUC 1F5KU 3RMMH 2OXSA 2A4QA 2OC8A 3GCNA 2KM0A 1MZDA 3A88A 5LPEA 3BTEE 1BBRH 2LP6A 1PYTD 2WINI 1E34B 1LDTT 5EQRA 2NU3E 3RXAA 3V0XA 4UEHH 4A5TS 2WPDD 1W8BH 4LZ4B 4XE4A 3UTUH 1GHYH 1ZSLA 4IS5A 2JKHA 1UVOA 2J92A 1GMDF 1O3GA 2IPHA 2PKSC 3ZYDA 2H9TH 3M35A 1TBQH 4E7RG 4I32A 3N7EA 1EOJA 4UFFH 3OFND 1IQNA 4K3JA 1ZJKA 3KYGA 2R2MB 2WSSD 2AERH 2XOKD 3A7TA 1HAHH 2D8WA 2BDHA 1FPCH 1BTPA 3GY4A 1P11E 5FX6A 1F0SA 3PWCA 2A2QH 3ATMA 2AIPA 4U30A 2TGTA 4VGCB 5T6DA 2CHAB 4B71A 3CP7A 4RKJB 4WH6A 5BRRE 1MD7A 2YMSB 2P3FH 3A86A 1MTWA 1CGJE 3LC5A 1XX9A 3UAIC 3RXHA 5AFZH 1FQ3A 2F91A 1SGEE 1C2JA 1IQMA 4KELA 2W3KA 2NWNA 2PTCE 4BOHA 4D9RA 4YO9A 2OC1A 1VCPA 1F2SE 1SGYE 2OCVB 2ZC9H 3M5LA 2WV5A 4A92A 4OGXA 3VB5A 2J5UA 2ZCLP 1LVYA 2ZTXA 1S0QA 4YOJA 3BTWE 1AFQC 2AGIX 1TABE 4YT7H 1TONA 2QGRA 1KSNA 2D1JA 4TPIZ 3ZVEA 3RU4D 2XCFA 1WOFA 4NZQA 2JIZD 3FZDA 3GY6A 1GJ5H 5E2PA 2XBWA 1CSOE 4FUEA 3T27A 1ZJDA 4FXGH 2VH0A 4MPUA 4R8TB 1AKSB 3WY8A 1HB0B 4MPXA 4FUDA 2BTCE 6CHAB 2PKAA 2FYRA 2ZQ1A 5GDSH 1P09A 1FIZA 1XM1A 3P95A 2LNCA 4Q2KA 4ZH8A 3AAUA 4M9FA 1AGJA 2Y6TA 1W12U 4IBLH 1D3PB 3EE0B 8LPRA 1GVLA 1SPJA 5T1VA 2OK5A 2BY9X 1C5PA 4KKDA 3VB3A 1D3DB 3RLYH 2B5TB 2XWAA 1YPLH 2ZHFH 1ESTA 2K0QA 2XNIA 3VB6A 1AVGH 1NRRH 1WV7H 1ACBE 3RM2H 1ZOMA 2ZCKP 3MU5A 1QJ1B 1CHOF 3V7TA 3V3MA 1SKYE 1T4VH 4WVPE 1BRAA 1W0ZU 1V2QT 4P02A 4JK5A 3F1SB 2PHBA 3KQCA 1EB1H 2ZQ2A 3RC5A 6LPRA 1TX6A 2R9PA 3STJA 5E8EH 4WMEA 2V0BA 1PPFE 3HPTB 2BZAA 1HAXB 4FETA 1HBTH 1AUTC 4KTSA 1OWKA 1JIRA 2R3UA 2HLDD 3ELAH 3ZZ9A 1BMFD 3EQ0H 1PFXC 2BDAA 4AN7A 1C4U2 3MFJA 1MAXA 5F53A 3F0PA 5GPIB 3GY2A 1H9LB 5IDKA 1BUIA 1H9IE 1OWEA 4X2WA 1QRZA 1TGBA 1P10A 4B76A 1XUGA 1O30A 1HDTH 4I8JA 3LT3A 2AEIH 1PQAA 3GOVB 5DSFA 1CHGA 1MKWK 1VGCC 2CGAA 3SV6A 1MTUA 3S9CA 3BTFE 1SQOA 1WCZA 5EQSA 1ZTKA 1C1WH 2XCNA 4Y8ZA 3ZVAA 3GCHB 2ZPSA 4IMZA 1A0HB 1V3XA 2P8OC 3BTTE 3TH2H 3KYFA 1C2MA 1BMAA 2YNAA 4XRNA 1A7SA 1AZ8A 2G81E 2HNTF 1THSH 1HJ9A 3UUZA 1Z8IB 4ZHLU 1DANH 3U69H 2ILNA 2ZFFH 3SV2H 1SFIA 5FXLA 3SORA 2K1QA 2ULLA 4K8BA 1Q2WA 2ZHQH 2Q6DA 2H9EH 3A7ZA 3PV4A 2A5KA 1T8LA 1IQKA 2EEKA 1BTHH 3GYLB 3SU2A 1XUJA 1O35A 1KYNA 4NA9H 3VB7A 3QN7A 1MTVA 3RXLA 4U32A 4JYUH 2A4OA 1FX0B 1YPKH 2BB4A 3P92A 1DY8A 2CXVA 1E1RD 1VR1H 3QGNB 1TMBH 3ZYEA 5EIYA 1HLTH 3SYJA 3IWMA 5LH8A 1FIWA 3OY5U 3GICB 2VIOA 3GDVA 3O8BA 1Y3UA 3URDA 1O34A 2PR3A 1C1QA 1MAYA 2GD4B 2ZIQH 1GJ8B 4KTUA 2PFEA 1FNIA 3UB0A 2PP6A 5KECA 1VITF 3SU6A 1EP5A 1PPHE 2AGGX 1CHOG 1O2XA 4DG4A 1V2KT 4BTIB 1SGIB 1OS8A 1FPHH 3SUFA 4F49A 4ABEA 1TAWA 3S69A 1DWDH 3SUEA 2M5TA 2NU0E 3UNQA 4FUCA 4AYVB 2ZNKH 1KXAA 2XRCA 2OP9A 4ZHMU 1EZQA 1EATA 2PUQH 4ISIH 3QWCH 2H5CA 4Y76A 2Z9LA 4KTCA 1S83A 2DUCA 1BA8B 4ACBA 2F9UA 4WMDA 1SGCA 1ZTJA 3P8NA 2OLGA 3U1JB 2GTBA 1HRTH 1C5RA 2H9HA 1QB1A 2GMTB 2BLOA 1LTOA 4YM9A 1VJ9U 2P16A 3BIVH 3F2HA 1GL1A 4CREA 1V2JT 1TNGA 3H5CB 4ESTE 5T6FA 1GPZA 2QYIA 1DXWA 4WXIA 3F6UH 4HZHA 2BOHB 1OP2A 3B9FH 6ESTA 4J2YB 4O97A 1PPZA 1O2KA 2KCOA 1QB9A 1Y3VA 1OP0A 1W7XH 3ZZAA 1OP8A 2STBE 3MH7A 1GBAA 2GVFA 4DVAU 4TWWA 1NM6A 1ESAA 2C3SA 3ZIAD 1ZSKA 4IC6A 1SVPA 3FOAA 3SV9A 5DP8A 4AC9A 2OBQA 5FCRA 1YP9A 5CHAB 2GP9B 3A87A 6GCHG 4Q7ZA 4X8VH 4MNVA 3PWBA 4K1EA 4XFQA 4NFEA 5E0GA 1TNJA 2ANYA 1FN8A 3ZZCA 1GL0E 1FY8E 1GJ9B 5GNDA 4GHTA 1DT2A 2A0QB 3MO3A 1DFPA 2P94A 3OTJE 4X1NU 1ANEA 2QF3A 3PV5A 4XBCA 3SJIA 1B0FA 2C8XB 4DURA 3E0NB 3LGVA 4XDEA 5C0TA 2ODPA 1QB6A 3HGPA 4U01A 1O2IA 1AU8A 2BY7X 2QCYA 2XC0A 3FZZA 3RXBA 1LVBA 2ZF0H 2G51A 4K5ZA 1YLDA 2B0FA 2AHME 3UPEA 1FY3A 3BV9B 3DHKH 4B2CA 2FDAA 4QT8C 4OS2A 1F0UA 1K0HA 4F48B 1EP6A 1SQAA 2G4UA 3SZNA 1C2KA 1DLKB 1GBHA 2O8LA 4UFGH 4MDSA 2JETC 1MBQA 5HIZA 3FFGA 4FU7A 2VBCA 3U28C 2Y82A 1LKAA 3GCOA 1GBEA 1HYLA 2FPZA 4ISLA 2FLRH 2PTNA 5GXPA 1EXFA 1GBLA 5TJXA 4DW2U 2VWMA 5EU8A 3PRBA 2VINA 4ABJA 4RI0A 4BAQB 1RJXB 4I7YH 1C1UH 1EOLA 4JZEH 2W3IA 4ABBA 4B6FA 1T4UH 4JYTA 4B75A 3F9GA 3U8RH 1O2SA 7LPRA 5DP7A 4F4OC 3ESTA 1ELDE 1QBVH 5HGGA 1MTNC 2I6SA 4A1TA 1XUFA 5C2ZA 4ISNA 3T62A 4MQAA 1TNKA 3F3BA 3PO1B 1T8MA 1GHVH 1O3DA 1GJCB 1HAGE 2G5VA 1MKXK 1P2KA 1YM0A 2HPPH 3A80A 4DIHH 3MQKC 5DG6A 4D8NA 1DLEA 5EJ1A 5EW2H 4OGYA 1H1BA 3KHVA 1FY1A 1G32B 3BSQA 1O3AA 1CGIE 1GCTC 3P6ZB 1D3TB 1HPGA 1QL8A 1FN6A 3OY6U 1A61H 2KAIB 1W2KH 4ZKRU 5C17A 1Y59T 2OC0A 3SGQE 3MWIU 3M5MA 1ETRH 2ZA5A 1P2QA 1HJAC 2VNTA 5EXLA 3AW0A 5IK2D 1TNIA 3QTVH 1PPGE 1O2MA 1UTQA 2VIWA 1H8DH 2HPQH 3IITA 3Q3YA 3P70B 3UQOA 1NT1A 2Z7FE 1GMCF 4UE7H 3KN2A 3MNCA 1QTFA 2XBXA 1ELVA 3SZEA 1OKXA 4NSVA 1ZMJA 3ZVCA 1IQGA 2ZFQH 1RGQA 1JMOH 2V35A 2FOMB 4AFQA 2F3CE 1C1MA 1AQ7A 2BLVA 2Y5HA 1AKSA 3GDUA 3RXVA 4HFPB 1NTPA 3VB4A 4X2XA 2PGBB 1Z8RA 2W7UA 3H7TA 3RC4A 3RXDA 4CRCA 2A7HA 2BD4A 2C93B 8GCHG 1O33A 1EKBB 4NA7A 1VCWA 3K65B 1O2QA 2BQWB 2BDCA 4Y8XA 3Q3XA 5EPYA 1NY22 4DIIH 1ABIH 3TNSA 4FUBA 2TRMA 3L33A 4FU9A 1S6LA 3UREA 1MTSA 2UWOA 3ZVDA 3QTOH 2UUJB 3VFEA 3A8AA 1TLDA 5C1YA 3RMLH 1AO5A 1RXPA 4B1TA 1O5GH 1TBZH 1LQDB 1TMTH 2EQNA 1GJAB 1C5WB 1CA0C 5FHTA 5KGOA 1GHZA 1P2MA 1RIWC 1TYNA 2LPRA 1GG6C 4YOGA 2FEQH 3E6PH 1BTWA 1C5ZB 3URCA 3H7OA 4MNYA 3R0FA 1DICA 2PLXA 2FTLE 2ASUB 1L0ZA 3M61U 4JYVH 3TK6A 2FOAA 1RFNA 3RXRA 5A2MH 4R0IA 3BEUA 1SL3A 4TSFD 3SJKA 1DSUA 1J8AA 2PGQB 1EZSC 5DPAA 1EAWA 4D7GA 1GGDC 2CMYA 4INHA 3BG4B 4FUHA 3U9AH 1KXFA 5PTPA 3MOCA 1QA7A 1O2VA 1HXFH 1QJ7B 3EA7A 3A7WA 3LDXH 1N1LA 5C20A 3AK5A 1FV9A 1EAXA 3E3TA 1KIGH 2F43B 3NRLA 3PTNA 1NFWA 1L4ZA 1YPMH 1MCTA 2XC4A 3LU9B 1AB9B 1Y3WA 1ANCA 4AX9H 1V2NT 4OS6A 2O9QA 3A7XA 1ZPCA 2Z6BD 2ZFSA 2TGPZ 4DY7B 1YPHC 4MPVA 1AE8H 3M3TA 1O31A 3VEQB 2ESTE 1XUKA 5J4QA 4ZKOU 1TGCA 2TGAA 1AMHA 1GCDA 4K60A 3SUDA 3FVFB 1G36A 1UMAH 1O0DH 4X1PU 4ABGA 2AMPA 3TVJB 5EJZA 3NUMA 1O2RA 2Z3CA 1GMCG 1UJ1A 2J4IA 3ATKA 3WW7A 1N6YA 2OTVA 1GDNA 1DUAA 4AFZA 1TRNA 4XOJA 1P02A 1TRMA 1DE7H 1QURH 1UVPA 3BEFB 4CHAC 3M7QA 5E2OA 1MD8A 1O3BA 1BDAA 2QN5T
chains in the Genus database with same CATH topology
1E37B 1UO6A 4AB8A 1TB6H 1BBRE 1WBGB 2XC5A 1ZLRA 3GCTG 3MO6A 2FOCA 3MHWU 7KMEH 2ANWA 2ZPQA 3I77A 1BRUP 1SGDE 1YGCH 1QL9A 3PMBB 2F9BH 2JH6D 7GCHF 1HFDA 2EI8A 4GHQA 1E35B 1QRWA 1S6HA 2B9LA 1EPTC 3MU1A 1GBBA 2BHGA 2CF8H 2SGDE 4BAOB 1O3IA 2W5EA 1GI2A 3PLBA 5F8TA 3A84A 2QF0A 4CRAA 5A8ZA 3ZV8A 5C67A 3SV7A 1TQ0B 4KGAA 2BQ7B 2C4FH 1YCPH 3HKJB 1TX7A 1AE5A 2BD5A 1M9UA 2P3UB 1SGQE 2ZCHP 2AMQA 4YOIA 3QGJA 4NCYA 3UNRA 1O5CB 4YLUA 1UHBB 5GCHF 3SNEA 1QCPA 3PTBA 4CR9A 2RG3A 2XWBI 2ZU4A 5T3HA 4GCHF 4D7FA 3SNCA 3GY5A 3SJ8A 1V2ST 3KQEA 1UVUH 4BXSA 1T7CA 1YPJH 1TPAE 4NSYA 2TPIZ 4BNRA 1UTKA 2O8TA 3FP7E 3KEEA 5C5NA 4NIYA 3UOPA 2UWPA 1NFXA 4TY7A 1G37A 2BD8A 4X6PA 4Y71A 1CE5A 1TPOA 2HRVA 3E0PB 3BTME 4BANB 3QLPH 4UFDH 1O3PB 1NRQH 3UWJH 3RMNH 4X6MA 2F9NA 2A7CA 1C4Y2 3SU5A 2F9OA 3O8CA 3UY9A 1V2TT 1C2HA 2XXLA 4ASHA 4FUGA 1UTNA 1TA6A 4X6NA 4VGCC 2CHAC 3D49H 2QAAA 1NO9H 3RP2A 2CN0H 2CV3A 2AYWA 1IQLA 1Q31A 3K6ZA 2Z9KA 2J94A 2O8WA 3U8OH 1JRTA 1GHBF 3A85A 1Y5BT 2VVVA 1WSSH 5AFYH 1TX8A 4YT6H 1W3CA 4A1XA 4X1SU 3ZZ6A 5CE1A 1C2DA 3K9XB 1UK4A 5ETXA 4D9QA 2ODYB 5F8ZA 1C5YB 3AASA 5EQQA 3RXQA 4K1TA 1C5XB 1GMDG 1J17T 2GZ7A 1E0FD 3SGAE 4BAKB 1QNJA 4X8TH 3AW1A 3UNSA 1JXPA 3SI4H 1O3FA 1ANBA 2FM2A 1C1VH 1GJDB 2P93A 1GVZA 5EODA 5T6GA 3RXGA 1G9IE 1O3JA 5HMAA 3T28A 3TJOA 1GI5A 1NU9A 1S6FA 3R3GB 4X6OA 1LO6A 4Y0YE 1ORFA 3E1XB 6CHAC 3T29A 1J14A 3ZZ8A 1ELCA 1QQ4A 2GCTB 1AWHB 2BXUH 3PB1E 2R0LA 3GISB 2IOTA 1KLTA 4IMQA 1LPKB 1J15A 4K69A 2A45B 4Y11E 1BTYA 2GX4A 1B0EA 4Y7AA 2Y5GA 2BY6X 3VPKA 5AF9H 3LH1A 3A7VA 1RTKA 4K2YA 3TGJE 2AIQA 5JB9S 4RKOB 4IGDA 2GDEH 4ABDA 3MMGA 1DX5M 3ZVFA 2OINA 1UCYH 1XVOA 2ALVA 3SUGA 3SJOA 4PROA 5A0BA 5DP3A 5DO4H 1GHWH 1A5IA 4MPWA 4K1SA 3RUOA 2PW8H 1IAUA 7ESTE 3SJ9A 2FS9A 1D4PB 3MU4A 2RA3A 1AIXH 4CRGA 1O3CA 2OC7A 3M36A 1C1SA 5E0JA 1TBRH 2BLWA 1F92A 1ESBA 5FBIA 3RXUA 1C1PA 1EQ9A 1UCYE 1C2FA 1D9IA 3GYMA 3KQDA 4YESB 2FO9A 3P8GA 1QBOA 3RMOH 1G30B 1QFKH 1TQ7B 1O3MA 2F9VA 4TYDA 2BD9A 5FBEA 1S85A 1TPSA 3L3TA 2SGPE 5FCKA 2GDDA 1W13U 1P8VC 3ENSB 1TGSZ 3LH3A 2WPMS 5JBBS 1G2LA 1ELGA 1S81A 1G3BA 1BRCE 2ZTYA 4H42U 3RM0H 2SFAA 1W7GH 2TIOA 2VIVA 5H4IB 1VCQA 2KAIA 4HTCH 1MH0A 4NA8A 1WTHD 3GCHC 1LPZB 4ABIA 4ISOA 1ARCA 1HAVB 1LKBA 2FI4E 2GT7A 1BHXF 2ZGCA 1BJUA 2THFB 3DA9B 2ZG0H 1T8NA 3A8CA 3NKKA 1ZGVA 2FOGA 3NWUA 1J9CH 1V2LT 1CVWH 1SSXA 3T2NA 5DGJA 5ABWA 3ITIA 3SNBA 1SB1H 1MU8B 1YPEH 1ZZZA 4IC5A 4AG1A 4AOQA 1SG8B 1QQUA 1ZSJA 1O5AB 1IQHA 1FAKH 2BOKA 3NZIA 3OYPA 1GJBB 1XXDA 2UUFB 4TY6A 1BHXB 4NIWA 2IJOB 3N7OA 4HGCA 3V12A 1P12E 2VGCB 4LXBH 4X8SH 2HNTC 4GSOA 1Z7KA 4H6SB 1UVSH 3I29A 1CBWB 4ZUHA 3SHCH 3TJVA 1H8IH 1Y3YA 3ZZBA 3TLOA 2HVXA 1PPEE 1AZZA 5LGOA 1N6XA 3MI4A 1V6DA 1J16A 1D6RA 1W14U 2EI7A 3QX5H 1O2UA 1ZPZA 3F9EA 2AMDA 3ATIA 1WAYB 2FOFA 1A3EH 1GI1A 1YCPM 5DKMA 2OBOA 1V2MT 5CMXH 1Z1IA 1BMNH 5DP5A 3SQHE 1MKWH 1FZZA 1K1JA 1SGPE 1L4DA 2XTTB 2YOLA 2P59A 3T25A 1IHTH 3GY8A 3CENA 3S0NA 1HJ8A 1DWEH 3M3SA 3TH4H 2A4RA 1C9TA 3EDXB 1V2PT 3QO6A 4H6TA 3MH4A 2P95A 4I31A 2Y81A 2ZDLA 1EPTA 1MU6B 1O39A 3Q77A 3RXPA 3HK6B 1RTLA 1FUJA 3HKIB 3RXJA 2TGDA 1IQEA 2EI6A 3IG6B 3ZZDA 2G55A 3RXMA 2GMTC 3C1KA 5J4SA 1LHCH 9LPRA 5FPYA 1K1PA 4CBOA 3SV8A 1D3QB 1V2UT 3FP8E 1F5LA 1GBCA 1VITG 1SMFE 3QDZB 3I78A 8KME2 2BDBA 1KTTB 1O38A 3E16B 1H9HE 3TITA 4Z6AH 4AGKA 3SU0A 1DWBH 1QGFA 4JZDH 2HALA 2EC9H 1B5GH 2HNTE 3DD2H 9ESTA 1XUHA 1XKAC 2I6QA 1EJAA 3ODDA 4ZKNU 3MH6A 3F9HA 5FPSA 5EW1H 4MTBA 3T5FH 1KXDA 1EAIA 1XMNB 5CHAC 3VGCB 1PQ5A 1BIOA 2SGQE 1C5QA 1PYTC 1XUIA 4SGAE 2ZFRH 4Y7BA 1Y3XA 1MQ6A 1H4WA 4ZHAA 5AVDA 2VIPA 1EZXC 1K21H 5L6NH 1Z8JB 1GI3A 1ZHRA 1GI7B 1BTXA 1GBMA 1Y5UT 2BXTH 2WPKS 3P8FA 4WWYA 2Z9JA 1P01A 5I25A 1O5FH 3HK3B 5HYOA 2A5AA 1MCVA 2SGEE 2GT8A 1YBWA 4CR5A 1OWDA 1BBRK 1OOKB 3RXEA 1DY9A 2VVUA 1EJMA 1GMHF 1U6QA 3ZZ4A 3TH3H 1GI4A 1BOQA 2UUKB 1RD3B 1SGFA 1TNHA 2FIRH 5BPEA 1N8OB 1C5UA 4I8HA 2ANMH 1ZRKA 1W11U 3D65E 5A8XA 1QHRB 2ZTZA 5F6MA 2WUCA 5FX5A 2FODA 1UHBA 1AI8H 1UTOA 2ZECA 2BZ6H 4J1YA 3LKWA 1ZRBA 1SLXB 1QL7A 2FLBH 1ABJH 4FVDA 2Q6GA 2OQ5A 3NPSA 1NS3A 1W0YH 4ZMAH 2W7SA 1TNLA 1MBMA 1AUJA 1FAXA 3FP6E 1GI0A 1KXBA 2WPLS 1CQQA 1AVXA 3PMJA 5JDUB 1FY4A 2V3OH 1HGTH 3BTHE 2ODQA 1KDQB 5F8XA 2BDGA 2O8UA 2G8TA 1BJVA 1SHHB 4YLQH 1C4V2 3PO1C 2PUXB 4NIXA 1KXEA 3BF6H 4CH8B 1BQYA 1P03A 1NZQH 3BN9A 4WJG2 2QXGA 1INCA 1SGTA 1WQVH 1SLUB 3SNDA 2ZO3H 3FANA 1C5NH 1TMUH 3UWIA 2GV6A 3M5OA 4AYYB 4ZXYH 5TCCA 3HATH 1FJSA 2Y5FA 4B73A 4U2WA 2ZGXH 2NU4E 5AHGH 5EG4A 1S0RA 2STAE 4OS4A 1OWIA 1HUTH 2Z3DA 1AVWA 1OXGA 1TFXA 3MO9A 2XBYA 5GIBA 2Y7XA 5HM2A 1Z71A 3BTKE 1O5DH 1YF4A 3OX7U 4X2VA 1QJ6B 3RXFA 3SW2B 1P3EA 1SHYA 4B74A 4X1QU 1RRKA 2SGAA 2ZDVH 1FY5A 1BT7A 4B2AA 1AY6H 1ZHPA 1CT2E 1L2EA 1Z6EA 2PKSB 5C3NA 1HV7A 1LVOA 2WPIS 1UTMA 4XBBA 3QZRA 1ZYOA 1LCYA 1O3LA 2G00A 3RLWH 3TNTA 1VZQH 1A0JA 3BTGE 2Z3EA 1P2OA 3PYHA 3KCGH 1ZTLA 4AB9A 1HIAB 1O2YA 3PROA 1JIMA 4OS1A 3SU3A 3V13A 1C5OH 1T8OA 4LOYH 4D76A 1TWXB 1BITA 1ETSH 1IQJA 1TOMH 3A89A 5EPNA 1O5EH 5G4BA 1B7XB 3A7YA 1DWCH 1NESE 1DXPA 4CRDA 5EXNA 2FX6A 3ZVGA 1FMGA 2A32A 3D62A 2OUAA 2Z9GA 4JZFH 4NG9H 2GV7A 1GHAF 5DJ7A 1FI8A 1AFQB 1K22H 3KF2A 1K1MA 2FOEA 1DS2E 2IN2A 2FOBA 3TJNA 1T32A 4UONA 5EXMA 2NU2E 3PMAB 1KY9A 4NGAH 1BMMH 1YLCA 2R2WU 5JBCS 3ATWA 4BAMB 2A4GA 4CRBA 3Q76A 4DGJA 2VH6A 1Y8TA 2BMGB 3U8TH 1K9OE 2J34A 2DE9A 2O8MA 3K6YA 1LVMA 1HAZB 3BTDE 5C5OA 1PQ7A 3BG4C 1TGNA 1DPOA 1SC8U 3C27B 4X0WU 2W26A 1TGTA 1OPHB 2QV1A 1EJNA 4LK4A 5FPTA 3QZQA 1CU1A 3A8BA 2XW9A 4K8YA 3CS7A 1LPGB 1NPMA 1BTUA 1F0RA 2ZI2H 5L2ZH 1SLVB 3RXSA 2C8ZB 1DVAH 4SGBE 1AB9C 3EA9A 3G01A 1CA8B 1UCYK 4FUIA 4IW4E 2J9NA 2WYJA 1PJPA 1EASA 1O2LA 2CJIA 5C1UA 5LPRA 4NZLA 3U98H 1A4WH 1A5GH 1CT4E 1HAVA 2H1UA 2VIDA 3F9FA 1C1NA 4I33A 1PPBH 3SBKA 5TCAA 3LGIA 3AAVA 3QUMP 1SBWA 2Y7ZA 5SGAE 1V2OT 4UD9H 2BM2A 1YPHE 2ZPRA 4NWKA 2H5DA 2ZDKA 2Q6FA 3Q00A 2VJ1A 3LJJA 1FXYA 5DP4A 2R0KA 1LMWB 2ZWLH 1S82A 3TJUA 3OU0A 3PLPA 1BB0B 1ZPBA 4ABAA 1GI8B 2ZGJA 4GLYA 4MVNA 2RA0A 4B2BA 5GWZA 1O3EA 2SNVA 3JZ1B 2ZFPH 1QIXB 3PMHB 2BDYA 5GJ4B 3UOUA 1BRBE 2JH5D 2H6MA 1VGCB 1O3NA 4NIVA 1SOZA 2ZGBH 1E38B 1K1LA 1GJ7B 4YTAA 2GGVB 1TA2A 5C1XA 2P3TB 3PLKA 4MNWA 5JB8S 1O36A 1GBTA 3E90B 2HOBA 2P8OB 2BY8X 1BCUH 1ZR0A 1GHAG 3TK9A 4CH2B 1OYQA 3F68H 4E7NA 5ESTE 2FI5E 1UTPA 5FAHA 1Y5AT 4Y0ZE 5JYIA 1GBIA 2F9PA 1ZMNA 2A31A 4MNXA 3U1IB 5HXFA 4ZAEA 1SGFG 3M37A 1WTGH 4O3TA 1V2WT 1PPCE 4GUXA 5L2YH 4ABHA 4BAHB 2G5NA 3B23B 1O2HA 1O3KA 3E8LA 1Z1JA 2WV4A 7GCHG 1HNEE 3W94A 1AHTH 1HCGA 2PWXA 3O8RA 4ZXXH 1ELBA 1ETTH 3MU8A 1T31A 4AGJA 5JBTA 4DOQA 4Y6DA 1OSSA 2ZFTA 1O2GH 3GY7A 5A09A 2AS9A 2CF9H 2B7DH 2GZ8A 5K7RA 1GI6A 1O2ZA 5K0HA 2AGEX 4BTTB 5LPFA 3S9BA 1HAPH 3FAOA 5GCHG 2BD7A 2Z9IA 1C5MD 3LJOA 4GCHG 5I46H 1NU7B 4E06H 5EOKA 1UTJA 2J38A 1G3DA 3PM3A 2FTMA 1O2WA 2VB0A 2J95A 3A83A 1KTSB 1P3CA 2GCHF 5IYTA 1C2IA 2PV9B 3TK5A 4ZKSU 3SGBE 1CGHA 3EYDA 5JBAS 1SQTA 2BVSH 1O2JA 2UUYA 1HAYB 2ZKSA 3UFAA 3GY3A 1F5RA 1OWJA 3KNXA 3SU1A 6GCHF 2QIQA 1HAIH 4I8LA 1K1IA 3TPIZ 4DCDA 1C1TA 4UDWH 3RXTA 1XVMA 1EUFA 1JRSA 1NC6A 3S7KB 4X2YA 4TWYA 2GCTC 1TALA 2C8WB 5A0CA 1ELAA 3B8JA 1GWAA 1QA0A 1ZHMA 1C5VA 1GHBG 3LGUA 2WPJS 1A1RA 1SLWB 2G52A 4OS7A 2RDLA 1LHFH 1DSTA 2ZHEH 1WYKA 1TE0A 4CRFA 2QC2A 1YC0A 3W95A 1DUEA 4CBNA 1JBUH 1NFUA 2FXRA 1EB2A 2AH4X 1X7AC 1SOTA 4THNH 1L1JA 4JZIA 2BD2A 2OQUA 3RXOA 1O3OA 2XBVA 3MNSA 3OSYA 4DJZB 1NRSH 2NU1E 3LGWA 3BTQE 3UQVA 2FESH 3LC3A 4FU8A 1Q3XA 4E05H 1P9SA 3DFLA 1FONA 1FLEE 2BLQA 1O5BB 1MMJN 3CS0A 1GBKA 2ZU3A 1C5LH 1IQFA 1QR3E 1GBFA 3D23A 1O2TA 2YNBA 1KDQA 3SNAA 2PKAB 3JZ2B 2V3HH 3P8OA 4INKA 5A8YA 2FMJA 3TGKE 1QBNA 1YPGH 1F7ZA 4NWLA 2HLCA 3A8DA 1ELFA 1F0TA 1C5SA 3S9AA 1THPB 3TIUA 1ID5H 1GBDA 3SOSA 2J2UA 2VIQA 4JCNA 4TPYA 2BVXH 3RXIA 4RSPA 3BEIB 1MUEB 1LHEH 2BX4A 3VXFH 3MH5A 2ZGHA 1P04A 1BTZA 4Q7XA 4Y79A 4AZ2B 1ELEE 4FUJA 1A5HA 1IOEA 5DK1A 2JETB 2DE8A 4ZROA 1A2CH 1O2NA 3LOXA 4OS5A 2VU8E 3LIWA 4INLA 2ZZUH 4XBDA 4ABFA 4RN6A 2GCHG 4IN2A 1UK3A 1FDPA 1V2VT 1WU1A 5L30H 1JWTA 1K1NA 1UVTH 1IQIA 1C1RA 2BQ6B