1UHBA

Crystal structure of porcine alpha trypsin bound with auto catalyticaly produced native peptide at 2.15 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
125
structure length
125
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin activity reduced by an autocatalytically produced nonapeptide
pubmed rcsb
molecule tags Hydrolase
total genus 16
structure length 125
sequence length 125
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1uhbA00
4YT7H 4JYVH 1O3FA 1ESTA 1WCZA 4DG4A 3T27A 4B74A 3U98H 4IN1A 2IN2A 2WPJS 2P3UB 3BTTE 1GCDA 1F0TA 2THFB 4U2WA 1P09A 3F9HA 1D3DB 1CT4E 4X8TH 1B5GH 1SGDE 1O2GH 4D8NA 3NUMA 1HB0B 5EG4A 5F8ZA 3SUEA 3SOSA 1YGCH 4TWYA 1TPSA 4JYUH 3VB5A 1NFUA 1UVUH 1HAOH 2BXTH 2HALA 1TMUH 2AGGX 4FU7A 2A4RA 4ZUHA 1EAIA 4NIYA 3M35A 1O39A 4WH8A 3RLWH 2W5EA 1FNIA 1KLJH 1SFIA 4AB8A 3VB7A 3MU8A 1AZ8A 2WPIS 4A6LA 3B23B 5C20A 3E1XB 4AG2A 1THPB 4CHAB 1XKAC 6LPRA 2P16A 1RXPA 1YLDA 3DA9B 3U9AH 4OS7A 2GX4A 5C1YA 1PQ8A 1F5RA 5ESBA 3TJOA 3MU1A 3M36A 1LQEA 2VH6A 1AN1E 1HAPH 4WWYA 1K2I1 3OY5U 1BHXF 1TIOA 1EASA 5FBEA 3MO6A 1G32B 2GV6A 3A7ZA 1S5SA 1AVWA 1TNGA 2XYAA 1GI3A 1OWHA 4O3TA 1HAYB 2OC0A 4DIIH 1OYTH 2OCVB 4CRAA 5J4QA 5FCRA 5FX5A 1HAVA 1SGTA 1NT1A 2GCTC 4R8TB 1C1UH 1QBOA 2WPKS 1LVBA 2BD2A 3A87A 1BTPA 4BXWA 2C3SA 1Z8GA 3RXHA 3T2NA 4ISHH 4U30A 3KF2A 2F9NA 2HRVA 3TITA 1G2LA 2FTMA 4MNXA 1CBWB 3ZZAA 1NZQH 4XOJA 1XUJA 1Y3WA 2FLBH 2JETB 2Z6BD 1PPCE 3SNAA 2EEKA 1P2IA 2H9TH 2BM2A 2FEQH 4BAQB 4B76A 3EDXB 4E7RG 1BMLA 2QA9E 1G3EA 2J38A 1DY8A 1GBBA 7GCHF 1W12U 4XDEA 3M7QA 2ALPA 1RGQA 3TK9A 1BMMH 1GJBB 1O3BA 2EI8A 2BLVA 2GKVE 1T31A 1IOEA 1CVWH 1PPEE 5A2MH 4HTCH 1GPZA 1LO6A 2ZPRA 4NCYA 1NS3A 1P8VC 2J95A 5SGAE 4JMYA 1UVPA 3IG6B 4JZ1A 1M9UA 1KXAA 1TPPA 3LH1A 2OINA 1HPGA 1CHOG 1CQQA 1QB6A 1C9TA 4I7YH 2WV4A 2BD5A 2IPHA 1KXEA 3SV9A 1L2EA 5DO4H 1TPOA 1O3IA 1LPGB 1TGTA 2FOHA 1YPKH 4ISOA 3WY8A 1O2ZA 2NU2E 5GWZA 3GDVA 3U8RH 1MKXH 4ABDA 2A2QH 2Y7ZA 1AVGH 4A1VA 3SQEE 1YPHE 4KTUA 1ELAA 2BDCA 1HBTH 4K69A 1MCTA 1TGBA 1HIAB 3BTQE 2J4IA 2F9VA 3P8NA 4NWLA 3KQDA 5EQSA 4INKA 2BVSH 1HFDA 4TY7A 3SU6A 1QIXB 6GCHG 2ZDLA 1RIWC 2BTCE 1DM4B 5L2ZH 3EYDA 1P05A 5DP9A 2QCYA 1GL0E 1GBKA 3EGKH 1C2LA 3ZZBA 1EATA 1D9IA 3SU2A 1TYNA 1TB6H 4K3JA 1EPTC 1DDJA 1OSSA 5BPEA 1V3XA 2VVVA 1J8AA 1ORFA 4O03A 4AORA 4I8JA 3FVFB 1GI2A 4K1SA 3F68H 1MQ5A 3RXVA 5A0CA 3UOUA 1P0SH 4INHA 1T4UH 2GT7A 8ESTE 2BXUH 5B6OA 4ABBA 2P3FH 3RP2A 1BRAA 1DSUA 1E37B 1TFXA 3RLYH 1TE0A 1O2JA 4X6OA 1OPHB 2BX4A 1MQ6A 3VB3A 1YPJH 3RU4T 1YPHC 3LC5A 4LZ1H 2ANKH 3SUDA 4JZDH 3KQBA 3PMAB 4ZXXH 2PUXB 4AYVB 1DLEA 1L0ZA 1ZPBA 2EC9H 2ZEBA 6CHAB 1FUJA 4IMQA 1UTPA 1KDQA 4HI3A 4LOYH 3PMBB 1GBLA 1BOQA 2BVRH 4BAMB 3A8BA 1LTOA 4M7GA 1SLVB 1WAYB 1HUTH 1T8NA 3CP7A 4MQAA 2H6MA 1P2MA 3UQVA 1FY3A 2OC8A 2K1QA 5LPFA 5EQRA 1UVSH 1C2JA 1TNJA 5C3NA 3U8TH 1DPOA 1FY4A 2GT8A 3RXBA 5JPMH 4H6SB 1L4ZA 1SGQE 2CN0H 4R0IA 1RFNA 2EI7A 2VH0A 1C1WH 3MH4A 3UNRA 3A7YA 1T8OA 1GCTB 3NK8A 3JZ2B 1AVXA 1SGEE 5HXFA 3Q77A 1SLXB 1JBUH 2WINI 4E7NA 1C5RA 1K21H 1XUGA 3A7TA 1KXBA 2OUAA 1UTKA 1HAGE 2WYGA 2ZPSA 3SUGA 2QAAA 3SV7A 1DUAA 1O2XA 1BQYA 3P8OA 2OLGA 3UWIA 1TX6A 2A4QA 1CGHA 1O3NA 3BTME 3SV2H 2ZU3A 3LJOA 1CGIE 5DGJA 1NPMA 4GCHG 2Y82A 2F9BH 2QN5T 5JB8S 2R3YA 2ANWA 4FUHA 3T26A 3U1IB 2FP7B 1O3HA 5IDKA 2PGBB 3LOXA 4DURA 2OP9A 3ZZ3A 2A7HA 2ZHQH 1A0LA 1CSOE 1ETTH 1A5GH 1D3QB 5CMXH 1Z1IA 2D2DA 1C5PA 2CF8H 2FMJA 1P2QA 5L30H 1GBDA 1VITF 1O3KA 1TRYA 1IQEA 2ZO3H 1PQ7A 1L1JA 1PQAA 4E05H 1XUIA 1GJ4H 2ZKSA 3VFEA 1EX3A 2GDEH 5PTPA 4IN2A 1GBJA 2OXSA 4UFDH 2Z3EA 2OC1A 2B7DH 1ZGVA 3SNBA 5F03A 4ZMAH 3DHKH 1QGFA 2J94A 4X1QU 1G37A 2G51A 3F9EA 5A8ZA 3PTBA 8KME2 5C1UA 1Y8TA 2VWNA 4BTUB 4AX9H 1SI5H 1ZRKA 5JYIA 4XBBA 4Y76A 2VINA 2F9OA 1NN6A 4ABJA 4KTSA 1HDTH 8GCHG 1A5HA 4HFPB 4UE7H 4B71A 3TNSA 1S82A 3C27B 2Y5HA 5T6GA 1BMAA 3MOCA 1TBQH 4IC6A 3KQCA 2ZTXA 3HGPA 1ELVA 1J17T 1RJXB 1DOJA 2ESTE 4NSVA 1YPMH 3E16B 1OKXA 1IQIA 4YESB 1UTMA 4LXBH 4MLFB 1ZJDA 4I8HA 2G81E 3T5FH 2WUBA 1W0YH 1YYY1 3PTNA 2HGTH 1GI7B 1S6FA 4X8SH 1WV7H 2A0QB 4Q80A 4JCNA 5C1XA 4Q7YA 4AGKA 2R9PA 5T6FA 1J15A 3RMOH 4Y0ZE 5CHAC 1C2KA 1C4U2 2AIQA 3MHWU 3CENA 1EZQA 3V7TA 4K2YA 1YKTA 2OQ5A 2ZGCA 4ZXYH 1DS2E 3GCTG 4DIHH 1UK4A 1ZMJA 1RTKA 5T6DA 4A7IB 2BQ7B 3SHCH 1UTLM 1FJSA 3KN2A 4ZAEA 1FV9A 1SHHB 4JZEH 1UHBB 2FESH 2J2UA 5LGOA 4TYDA 2FTLE 2QGRA 3OU0A 4GLYA 4Z0KA 3RXEA 1Q31A 1GBFA 3A83A 2HWLB 2VGCB 1C2FA 1TPAE 3T28A 2V35A 1BA8B 3SHAH 1GJ7B 4AFQA 1C5OH 4FU9A 1G3BA 4D76A 2XBXA 3GDUA 1GJAB 1O3GA 1ZOMA 2BLQA 5DP7A 4MG3A 1Y3UA 3STJA 4YLQH 5LPEA 4VGCC 2XBYA 1C2EA 3VGCC 2Q1JA 1C2HA 1S0RA 1P9UA 1P57B 1LMWB 4ZROA 5JBBS 3RXOA 8GCHF 1O2MA 1S83A 1K1OA 4YTAA 3LDXH 1TMBH 2GV7A 2NU3E 4ZKOU 2C90B 2VB0A 3SNCA 2BDGA 3K6ZA 1AFEH 1MAXA 1FPHH 4CR9A 3RU4E 1NESE 1OYQA 1QR3E 1YPEH 3OYPA 2ZTYA 4X0WU 3UOPA 2W26A 4DW2U 1GJ8B 2FIRH 1C5VA 1AUJA 1GVLA 3DT0H 4PROA 2ZU5A 1IQHA 1TMTH 3M7UA 4DGJA 3AW1A 3MNBA 4A1XA 1ZHRA 1LVOA 2TIOA 1SSXA 3E91A 7ESTE 3S9AA 3RU4D 2OBOA 2XWAA 3SGAE 1EPTA 1Z6EA 1V2UT 1O30A 1RRKA 1NRQH 1UTOA 2FODA 1ELFA 1GHAF 2HPQH 1GHBF 1GHYH 3GCTF 1TA2A 4MVNA 1EOLA 1K1NA 3QLPH 1EP6A 3K65B 2WV5A 3GY8A 1P03A 3VPKA 4CBNA 3GISB 4BAOB 1TBZH 3RXMA 4YZUA 1MZAA 2R0LA 3LGIA 4FVDA 1C5NH 1ID5H 1AKSA 2ZCHP 1O3AA 3BG4C 4JZFH 5DP6A 1P2OA 2FOEA 5TCAA 3BTGE 1GHXH 4GSOA 2BOKA 1OOKB 2IOTA 4X2XA 1O5BB 1EOJA 1Z8JB 1OS8A 1QHRB 3ATMA 1K1JA 4CREA 2H9HA 5JBTA 3TPIZ 2G55A 1H9IE 1SBWA 4ZKRU 1GJDB 1KXDA 2XBVA 3QZRA 4K60A 4X2VA 4AOQA 1O34A 4Y11E 3S9CA 2KAIA 3UREA 2D8WA 4AZ2B 5AHGH 4B75A 5DJ7A 4YOJA 2CJIA 1FPCH 9LPRA 3ODDA 1T8LA 3Q76A 3B9FH 2V3OH 2ZDAH 1HAHH 2PLXA 5DP3A 3QTOH 3E8LA 4X8UH 2JH0D 4A5TS 4WF8A 1TBRH 1P3CA 4A1TA 1HJ8A 1ELTA 2J34A 2M5TA 2CHAC 1RIWB 5EU8A 1O3DA 1V2RT 1GHWH 3M61U 1GBAA 1DVAH 1SFQB 3A89A 3QK1A 3GY5A 1HYLA 4ABFA 3QTVH 5FCKA 4IMZA 1RD3B 4D9QA 4D7FA 1EPTB 1LDTT 3GYMA 4ISNA 1IHTH 1NROH 2ZGBH 3DD2H 1DICA 4FUDA 3PROA 4X6PA 1AD8H 1HAZB 4KELA 1EQ9A 1HCGA 1QL8A 2D1JA 1QL7A 1K22H 2HNTF 4FUEA 4X8VH 3BG8A 2GZ9A 2A7JA 2UWLA 1PYTD 2FYQA 4FU8A 1TGSZ 3Q3XA 4HZHA 1QA7A 2OBQA 1HJAC 1BBRK 2TGTA 1AWHB 1UO6A 1FAXA 2QXGA 3IITA 1GI4A 2GGVB 2TGAA 1CA0C 2ULLA 1W0ZU 3P70B 1GG6C 1MTNC 1AKSB 2ZZUH 3RXKA 5HGGA 3TH4H 1CT0E 4H4FA 2G4UA 3H5CB 3HK6B 5GJ4B 1VGCC 3QGNB 1K1PA 4Q7XA 1DWCH 2ZFSA 5C5NA 1OWDA 2PSYA 1Q3XA 2RG3A 2Z3CA 4WVPE 4CRBA 1O3JA 1GJ9B 4CBOA 2ODPA 1UCYH 2GVFA 9ESTA 1YM0A 1O0DH 3PO1C 2UUKB 4AGJA 1B0EA 1MU6B 1XVOA 1WQSA 4GHQA 1V6DA 4JZIA 4KTCA 3QX5H 3ZVCA 2W3KA 4RKJB 1ANEA 1TLDA 2RCEA 1IQMA 2BD7A 3A84A 3KHVA 1FY8E 1PYTC 4X6NA 1PFXC 1H4WA 1AFQC 2GCHG 2XW9A 3P6ZB 2BMGB 3M7TA 3SBKA 1MCVA 1TAWA 1LHEH 1YCPH 1MUEB 3O8BA 1KLTA 2I6SA 2F9PA 1O2KA 3TNTA 1AUTC 1IQNA 2H2ZA 1KY9A 3QZQA 1IQKA 1GJCB 4AN7A 1W3CA 4KP0A 2ZHFH 2PFEA 2Y80A 3L6PA 3P92A 1SGFA 2P94A 1HXEH 5E8EH 4BAHB 1NFWA 2JH5D 1G30B 2AERH 3PWCA 4ZKNU 5DP4A 2HLCA 3MWIU 2FOGA 3ELAH 2QC2A 2WYJA 2QF0A 2HPPH 3QDZB 3AVZA 1A1RA 1E36B 1N8OB 4YOGA 1UTNA 2ZU1A 1WUNH 3Q3KA 1P01A 1J14A 2XCFA 1PPZA 4K1EA 1ELBA 2VIPA 1F2SE 1HAVB 1QJ7B 1GHZA 4CH8B 4Y79A 2P3TB 3UUZA 2VIDA 2ZFFH 1E38B 1H9HE 1MU8B 2B9LA 1KSNA 1SGIB 1LVYA 1P2NA 2VIOA 2GMTC 1FI8A 3SZNA 4KGAA 1VJ9U 4CRGA 2NU0E 3FZZA 3K9XB 1RTFB 1BBRH 1FMGA 2W7UA 4BTTB 2AYWA 2ZCKP 1SQAA 1O35A 1Y59T 1BIOA 4MDSA 2QXJA 4Y71A 3RXUA 2UWPA 3SJIA 1V2WT 3QUMP 4OS6A 1SG8B 1SC8U 1HV7A 1A5IA 5ABWA 3RMNH 1O33A 1ABIH 2IJOB 3RXGA 3PLKA 1JIMA 2BDIA 5I25A 3A80A 2P8OC 4TPIZ 1P12E 1ZRBA 1QY6A 2P59A 3OX7U 2H9EH 3SU1A 4I8LA 3TK6A 2FOAA 3HK3B 4MPVA 2GZ8A 1GMHG 2XC5A 2NWNA 1C5LH 3A85A 1EZSC 2ZU4A 3TIUA 1V2PT 2FX4A 1CHOF 1MZDA 4ASHA 2QXHA 3A8DA 4FUGA 2I6QA 5JBCS 2VIVA 2XTTB 1S0QA 1BTUA 1V2MT 1W2KH 3A86A 5A8YA 1EJNA 2VU8E 7LPRA 3NXPA 3U69H 1EJAA 3GCHC 1BDAA 4CRFA 4FUFA 2Z7FE 1T7CA 1C1VH 2FYRA 4LK4A 2ZU2A 4B1TA 2AFQB 1NO9H 5DP5A 4Q2KA 3O8RA 2BD9A 3A88A 3A82A 5CHAB 1KLIH 1SGRE 2BDHA 1QRZA 1V2TT 1P04A 1V2OT 1UVOA 1ZMLA 1SQOA 2DE9A 1T8MA 2G5VA 1BTXA 3PM3A 6GCHF 2PTCE 4INLA 3SV6A 1WU1A 1ZTKA 1THRH 1ZSKA 1C1PA 1W13U 2A45B 3RXPA 1FXYA 2ZIQH 4NIWA 1YC0A 1G3DA 1XX9A 4F49A 2FDAA 2Z3DA 1QB1A 1SB1H 2ZQ1A 3QWCH 4SGAE 1O2SA 1Z1JA 5C2ZA 1UCYE 4I8KA 1EJMA 2CXVA 1BT7A 3RDZA 4A92A 1QB9A 3M5MA 1TNLA 1NRSH 5C67A 1QCPA 1C1QA 2AGEX 3FZDA 5A09A 2PKSB 1AWFH 3TGKE 3ZV8A 2ODQA 3V3MA 1B0FA 1A4WH 4U01A 5GXPA 1A3BH 1J9CH 3PMHB 1GJ5H 4VGCB 3UY9A 3VGCB 1UK3A 5GCHG 1PPFE 4WY3A 1TNHA 1CGJE 3RXRA 3GY6A 4O97A 3DFLA 2R0KA 1DITH 1VITH 3KIDU 3OTJE 3TJNA 1EKBB 1GDNA 5AFYH 1TWXB 2WPHS 1VZQH 3P8FA 1ZTJA 4JYTA 4E06H 4Y0YE 3LGUA 1S81A 1N6YA 1BB0B 3K2UA 3KEEA 1AB9B 1O5CB 3UR9A 2BD4A 3SGBE 2PGQB 1PPHE 4YLUA 1FY5A 1D3TB 2OD3B 3RC5A 4NIXA 4UFFH 3GDSA 3IWMA 1LHFH 1GL1A 4MPUA 1KXFA 2AH4X 3KNXA 1KDQB 1GGDB 1V2NT 3LU9B 1TQ7B 1NU7B 4BNRA 3SU0A 5E2PA 2Q6GA 2A5AA 2OC7A 4ABGA 1TRNA 3A7XA 3MH5A 1LHCH 4AFSA 1LHGH 1ZR0A 5FX6A 1L4DA 2TGPZ 1H9LB 1DANH 2YNAA 1C1OA 1C1RA 2PKAA 4TY6A 1AO5A 1JRTA 1TABE 2WPLS 4YOIA 2AMQA 1TQ0B 3L33A 3UNQA 4ZH8A 3FP8E 3S7HB 1KTSB 3BG4B 1K1IA 5JDUB 1UJ1A 1XMNB 2FLRH 1AGJA 1F5KU 1D4PB 1XXDA 1EAWA 8LPRA 1A7SA 3ATKA 1X7AC 1RTLA 1E34B 1A61H 2ZC9H 3LONA 5EPYA 5F8TA 1O3CA 3LPRA 3ZZ7A 1F0UA 1MTUA 3RXSA 5ETXA 2HVXA 3LJJA 2SGEE 5EOKA 3TGIE 1ZYOA 4IGDA 4ZHAA 3SGQE 2FWWA 1SR5C 2OTVA 1BCUH 1G3CA 2XC0A 1S84A 3ODFA 1TX7A 2BDBA 1T4VH 1IAUA 3LKWA 4GCHF 3UNSA 1C9PA 3ZZ4A 1EAUA 1O2IA 2A7CA 2C8WB 2ZA5A 1ZGIA 3E0NB 2BVXH 1MBMA 1SGPE 3C1KA 2J92A 1Y5AT 2QF3A 2A1DB 3PLBA 6CHAC 3FFGA 5HM2A 4GAWA 1Y5UT 2O8WA 3VB6A 3MO3A 1GHVH 2VIQA 1ETSH 2SGPE 1ABJH 1E0FD 2BOHB 1B7XB 2PHBA 2ZDMA 3UTUH 3PMJA 1G2MA 4IBLH 2BD8A 3F9FA 3UPEA 2C8ZB 4WXVA 3BF6H 1DE7H 2ZTZA 3ATIA 4RN6A 3URDA 1DT2A 1THSH 4I8GA 1WOFA 1FONA 1EZXC 4WXIA 6ESTA 5E2OA 4NFEA 3VXFH 3ZVDA 3ZYEA 1YLCA 4NWKA 2O8LA 3HPTB 4DJZB 2H5CA 1WBGB 3ZVAA 4I32A 5CE1A 1GCTC 1FIZA 1MBQA 1O38A 3ZZCA 1O3OA 3ZYDA 1OP0A 1AQ7A 1Z8IB 1DX5M 2ILNA 1GI1A 2AEIH 3GY3A 3GY7A 4AG1A 1A46H 2R3UA 3KCGH 1NRRH 3A8CA 4Z6AH 1SGCA 2FI5E 1S6HA 3SW2B 1GBIA 3SV8A 1PQ5A 2ZWLH 3MU4A 1FIWA 2BB4A 2VJ1A 3M37A 1GG6B 3BTDE 4SGBE 3KL6A 2GCTB 1XUFA 1K1LA 1OX1A 1P06A 3RXAA 3M5NA 1GMDG 1ZMNA 1GBTA 4U32A 3Q00A 1YPGH 2Y7XA 1P2JA 1YF4A 4XBCA 3T62A 3STIA 1O2PA 2O9QA 3URCA 2XWBI 1P3EA 3MNCA 1O2TA 1O2NA 2AGIX 1W7GH 2BLOA 1O3EA 1HRTH 1QNJA 1AY6H 4YT6H 2V3HH 1DUEA 1SLUB 1WTGH 1C5WB 3ZZ5A 4X2WA 1N1LA 2YOLA 2QYIA 4NA9H 2OQUA 1OWIA 2F3CE 1O5AB 4AYYB 2BY7X 1O5DH 2ZDNA 2BZ6H 1HXFH 1H8DH 1O36A 1ZHPA 2Y81A 1AI8H 1PPGE 4JK5A 4UFGH 1AFQB 1NFXA 2BQ6B 1JXPA 2ANMH 4X1RU 1BZXE 4Y8YA 4MPXA 3RC6A 2FOBA 2ZFPH 3PWBA 4NG9H 2A5IA 3SJ9A 1BJVA 1QJ6B 2PW8H 1EP5A 1W7XH 1Y3VA 1XKBC 3E90B 1JWTA 1W10U 3BIVH 5T3HA 1DSTA 3M5LA 1P11E 1ELEE 1LHDH 3RMLH 3H7TA 1P10A 3MNSA 2Y6TA 1UVTH 2WPMS 3E3TA 2NU4E 2BDYA 4OGYA 4TWWA 4MPWA 2FM2A 1LKBA 4Y10E 2EA3A 4O9VA 4CRCA 3LC3A 1XXFA 2O8UA 5AVDA 5K0HA 4F4OC 2ZGJA 1MKWK 4J2YB 4GPGA 3TGJE 1P9SA 1O5EH 1QL9A 3LH3A 1J16A 2LNCA 1O3PB 1O5FH 3BEUA 3SU3A 5GDSH 3RUOA 2XBWA 2Y5GA 3GICB 2FI4E 1RS0A 3MI4A 5EXMA 4ABAA 3S69A 3LIWA 4NSYA 4ISIH 1GMDF 1OWEA 4AB9A 1BMNH 1C2DA 3MH7A 1GVZA 2F91A 2LPRA 1V2ST 3M3TA 2SGFE 3SI4H 1XM1A 5HMAA 1G9IE 1LPKB 2B8OH 2NU1E 3SO3A 3F9GA 3UIRA 5FAHA 2XRCA 2B5TB 2VNTA 2QIQA 5J4SA 2UUYA 2GMTB 2STAE 4OS5A 7GCHG 3MTYA 3N7OA 4JK6A 3MH6A 3ZVFA 3Q3YA 2A32A 1MKXK 2ZHDA 3BTKE 1SOTA 2TGDA 4ZHLU 5F8XA 4AFUA 3S0NA 3LGWA 2BDAA 3RXDA 2UUFB 1XUKA 1VCPA 1NRNH 2FOMB 1BTZA 2P8OB 3FP7E 2VGCC 2FS8A 4FVBA 2XNIA 3SU5A 1TNIA 2Z9JA 5AF9H 3U1JB 5LH8A 1ARBA 1O3MA 1SQTA 3D62A 3HATH 2RDLA 3LGYA 3MO9A 1W11U 2VVCA 2FO9A 5F6MA 2ZGHA 1SGFG 2BY6X 2RA0A 1IQGA 3GY4A 3MU5A 2VWOA 1IQJA 5TCCA 4X1NU 2STBE 4NA8A 3GCHB 4I31A 2ZECA 4IS5A 4GVUA 1HIAA 4B73A 3QN7A 1HNEE 2XC4A 3ZZ8A 4Y8XA 1QTFA 3RXLA 4H42U 1NM6A 4Y8ZA 1PJPA 1TX8A 2KAIB 1O2RA 4XBDA 1AHTH 1L1GA 3SU4A 2GZ7A 2BD3A 5FPYA 4RSPA 1ETRH 3GYLB 2CGAA 4WMDA 1GI6A 4NGAH 4X1PU 3D49H 3R0FA 3FP6E 4AFZA 3SJOA 3MU0A 3ZVEA 3KGPA 1A3EH 1QJ1B 1MKWH 2R2WU 3LGVA 4ABIA 1DXWA 2A31A 2C8YB 4O3UA 2A4GA 1ZZZA 3I78A 2JH6D 5L6NH 1YBWA 2ZG0H 1SOZA 1A2CH 1DWBH 2UUJB 4MNWA 5FPSA 5HYOA 1V2KT 2BHGA 1KIGH 1WSSH 1AIXH 4XFQA 5DG6A 4HGCA 3SJ8A 3AAUA 4ZKSU 1HLTH 1BUIA 2BY8X 3L3TA 3RXCA 1BHXB 2CV3A 1C2GA 2R2MB 3TLOA 1MTSA 2FXRA 1EB1H 3V12A 3AASA 3P8GA 5I46H 1O31A 3E0PB 2Z9LA 1O2OA 3U8OH 2Z9IA 2ZHEH 3ATWA 5FHTA 2TBSA 2ZPQA 1IQFA 4NZQA 1F92A 1DXPA 1A0HB 1C5XB 2W3IA 4D7GA 4UFEH 1C4V2 2BX3A 1Z6JH 3BEIB 3BN9A 1QFKH 3TK5A 2ZFQH 1GI5A 1VCQA 1MAYA 2JKHA 1Q2WA 1GI0A 1OP8A 1TA6A 4K5ZA 4ABEA 3RM0H 3CS7A 3TU7H 4Y7AA 1EUFA 4K8BA 3SJKA 1MH0A 1DY9A 2QXIA 2G8TA 1C4Y2 1V2QT 2G4TA 2PSXA 3O8DA 1C1NA 1CE5A 2FOCA 4FUIA 5DP8A 1C2IA 3NZIA 1Z71A 4Y7BA 4Y6DA 1VCWA 3QO6A 2CMYA 2ODYB 2VWLA 3ZV9A 2GCHF 1QRXA 5AFZH 2ZCLP 1ZTLA 3TJVA 1BTHH 1PPBH 1W8BH 1JOUB 3BTHE 3BEFB 3GCNA 1QQUA 1D6RA 1O2YA 4WMEA 1DWDH 2B0FA 4CHAC 1KXCA 3A7VA 1ZPZA 3BV9B 3HGNA 1C5QA 3D65E 2ZI2H 4IW4E 2QY0B 5EGMA 1NY22 4OS4A 1YPLH 1DWEH 2TRMA 4FXGH 2AS9A 2ASUB 1C1MA 4KKDA 4X6MA 4YM9A 2HNTE 5JBAS 2ANYA 1OWKA 3I29A 3S7KB 3D23A 1MTVA 3ITIA 4XSKU 1GI8B 3HKJB 4THNH 2P95A 3BIUH 2VVUA 1AE8H 3O8CA 2FPZA 3W94A 3UQOA 4BAKB 2UWOA 1H1BA 1O2LA 1QRWA 3EAJA 4BOHA 1TGNA 1FZZA 1U6QA 1ZPCA 3MYWA 4NA7A 1HJ9A 3ESTA 3TJUA 2G00A 2ZGXH 1Z7KA 5EPNA 3OSYA 3EE0B 2YNBA 3B8JA 4X2YA 5E0GA 3W95A 1WTHD 1VITG 3SI3H 1QURH 3SORA 1ZSJA 3BTWE 2Z9GA 1CBWC 2A5KA 2ZFRH 2JETC 5EXLA 3A8AA 4BXSA 1GDQA 7KMEH 1ELDE 1ZHMA 3M3VA 4MNYA 1ANDA 3DFJA 2ZF0H 2GDDA 3ZZ6A 4NFFA 3RM2H 4FUCA 1F5LA 2DUCA 2TPIZ 2AMPA 1GBMA 3MFJA 1AE5A 2O8MA 4WMFA 3NKKA 3SN8A 2FOFA 2Z9KA 1BRBE 3QGJA 1OP2A 2G5NA 2SNWA 2HNTC 1FAKH 1ELCA 1L1NA 3EA7A 2SGDE 4CR5A 1O2VA 1SPJA 1V2JT 5EQQA 1ESBA 1GMHF 1D6WA 1ACBE 1F0SA 2SFAA 1EAXA 1SVPA 3AW0A 2BYAX 5K7RA 1C5ZB 4FUJA 1Y5BT 1XUHA 4CRDA 4B2CA 1SMFE 3ATLA 4I33A 4CH2B 5JB9S 4ABHA 3PB1E 1NU9A 1A0JA 1C1TA 1GMCG 2FI3E 4B2BA 2GD4B 1GI9B 1CO7E 1ELGA 1NFYA 1ARCA 3ZVGA 1W14U 1LCYA 3RXIA 2EI6A 4ZHMU 1OWJA 1N8OC 1VR1H 4Q7ZA 4RKOB 1UK2A 3EA8A 1C1SA 4GHTA 1GVKB 1QBNA 5BRRE 4BANB 1INCA 1CHGA 1CU1A 4WH6A 4DVAU 2V6NA 2ZDVH 3SUFA 2WUCA 1V2LT 3LT3A 2GP9B 1IQLA 4NIVA 4ESTE 1UHBA 3M5OA 5FPTA 5L2YH 2Q6DA 1XVMA 4DCDA 1C2MA 2SGQE 1AMHA 1GBCA 3EA9A 3AAVA 1GBHA 4IC5A 1K28D 2BY5X 2ZNKH 1K1MA 3FAOA 1DLKB 2AMDA 1QA0A 2AIPA 3P95A 1KYNA 1IHSH 2PR3A 4BTIB 1OXGA 1CT2E 3MMGA 1FN6A 1S85A 1QBVH 2FS9A 1LQDB 2VWMA 5DK1A 1VJAU 1BRUP 2ALVA 3M3SA 4X1SU 1EXFA 1FDPA 1O2WA 4UDWH 1BBRE 4DY7B 4LZ4B 2PUQH 1JRSA 2BQWB 3F6UH 3CS0A 4FUBA 1FLEE 1GDUA 2J9NA 2O8TA 5GCHF 2ZQ2A 1N6XA 3MNXA 3GY2A 1LVMA 2D26C 3NPSA 3RXJA 3T29A 5C5OA 1AU8A 1UMAH 5H4IB 3I77A 4MTBA 3RXTA 4H6TA 5GPIB 1H8IH 1GMCF 5GIBA 1E35B 1SLWB 1NRPH 1O2QA 2GTBA 1O5GH 1SGNE 1BITA 3TH3H 1SGYE 2CHAB 5HM9A 1C5TA 3NWUA 3A7WA 1TOMH 1HGTH 3PV4A 4K1TA 3EQ0H 1BTWA 1GHAG 1QQ4A 3P17H 4QT8C 2F83A 3S9BA 1GHBG 3F1SB 5TJXA 2SNVA 3ZZ9A 1YP9A 1BJUA 1C5SA 2V0BA 2Y5FA 2BY9X 4OS1A 1TOCB 1CA8B 1Z8RA 3LGTA 1C5MD 2BZAA 3HKIB 3RXQA 3VXEH 1GJ6A 5ESTE 1D3PB 3BTFE 4WJG2 4ISLA 3RC4A 3A81A 4GUXA 3ZZDA 1TRMA 4DOQA 1GBEA 1HJAB 2PKAB 2PKSC 3E6PH 2XCNA 5EW2H 5DKMA 1MD8A 4YO9A 1CA0B 3PYHA 5E0HA 1MTNB 1O32A 1SHYA 1G36A 1ANBA 1F0RA 3PLPA 1VGCB 3FANA 1LKAA 4UD9H 2A2XH 4UONA 5EW1H 2ZP0H 2Z94A 3DUXH 4OS2A 2PTNA 5E0JA 1C5YB 1NTPA 3ZVBA 2A4OA 1SL3A 1YCPM 3SNDA 5FBIA 3RXFA 5A0AE 4B2AA 3SQHE 3K6YA 3H7OA 3PO1B 1DFPA 4XE4A 1GWAA 3UFAA 3ENSB 1HAXB 1JMOH 4OGXA 1AB9C 4DT7B 1TONA 5IYTA 1TNKA 1ESAA 1EB2A 1MD7A 2FZZA 1FY1A 1TGCA 3BTEE 5EXNA 1AZZA 1F7ZA 2P93A 2Q6FA 3UR6A 3V13A 2ZFTA 3KQEA 1GGDC 3V0XA 1O3LA 1TALA 1P2KA 1ANCA 2W7SA 1FQ3A 1Y3XA 3UWJH 3OY6U 1WQVH 2ZHWH 5DPAA 2PV9B 1BRCE 1O37A 1Y3YA 3VB4A 2PWXA 5LPRA 2C93B 3RMMH 1P02A 1UCYK 4J1YA 1FN8A 2FX6A 5G4BA 1T32A 3G01A 5A0BA 1BTYA 5EODA 1NC6A 1MMJN 4K8YA 5FXLA 3SNEA 4D9RA 1HAIH 2DE8A 2HOBA 2H5DA 3NCLA 1V2VT 1LPZB 1JIRA 2G52A 1O2HA 1KTTB 3BSQA 1EZUC 3VEQB 3T25A 1ZLRA 2QV1A 2ZDKA 1YCPK 2BLWA 2RA3A 3TH2H 1WYKA 1C5UA 2F9UA 4MNVA 2VIWA 3TVJB 1ZSLA 1O2UA 3GOVB 1MTWA 3JZ1B 4TPYA 2C4FH 1UTQA 4NZLA 4UEHH 2CF9H 3GCOA 2XXLA 1UTJA 2C8XB 1K9OE 2H1UA 2SGAA 1ZJKA 3R3GB 5A8XA
chains in the Genus database with same CATH superfamily
4YT7H 5DSFA 4JYVH 1O3FA 5C17A 3OFND 1ESTA 1WCZA 4DG4A 3T27A 4B74A 5DN6D 3U98H 4IN1A 2IN2A 2WPJS 2P3UB 3BTTE 1GCDA 1F0TA 2THFB 4U2WA 1P09A 3F9HA 3OE7D 1D3DB 1CT4E 4X8TH 1B5GH 1SGDE 1O2GH 4D8NA 3NUMA 1HB0B 5EG4A 5F8ZA 3SUEA 3SOSA 1YGCH 4TWYA 1TPSA 4JYUH 3VB5A 1NFUA 1UVUH 1HAOH 2BXTH 2HALA 1TMUH 2AGGX 4FU7A 2A4RA 4ZUHA 1EAIA 4NIYA 3M35A 1O39A 4WH8A 2KFWA 2W5EA 3RLWH 1FNIA 1KLJH 1SFIA 4AB8A 3VB7A 3MU8A 1AZ8A 2WPIS 4A6LA 3B23B 5C20A 3E1XB 4AG2A 1THPB 4CHAB 1XKAC 6LPRA 1H8HD 2P16A 1RXPA 1YLDA 3DA9B 3U9AH 4OS7A 2GX4A 5C1YA 1PQ8A 1F5RA 5ESBA 3TJOA 3MU1A 3M36A 1LQEA 2VH6A 1AN1E 1HAPH 4WWYA 1K2I1 3OY5U 1BHXF 1TIOA 1EASA 5FBEA 3MO6A 1G32B 2GV6A 3A7ZA 1S5SA 1AVWA 1TNGA 2XYAA 1GI3A 1OWHA 4O3TA 1HAYB 2OC0A 4DIIH 1OYTH 2OCVB 4CRAA 5J4QA 5FCRA 5FX5A 1HAVA 1SGTA 1NT1A 2GCTC 4R8TB 1C1UH 1QBOA 2WPKS 1LVBA 2BD2A 3A87A 1BTPA 4BXWA 2C3SA 1Z8GA 3RXHA 3T2NA 4ISHH 4U30A 3KF2A 2F9NA 2HRVA 3TITA 1G2LA 2FTMA 4MNXA 2RDEA 1CBWB 3ZZAA 1NZQH 4XOJA 1XUJA 1Y3WA 2FLBH 2JETB 2Z6BD 1PPCE 3SNAA 2EEKA 1P2IA 2H9TH 2BM2A 2FEQH 4BAQB 4B76A 3EDXB 4E7RG 1BMLA 2QA9E 1G3EA 2J38A 1DY8A 1GBBA 7GCHF 1W12U 4XDEA 3M7QA 2ALPA 1RGQA 3TK9A 1BMMH 1GJBB 1O3BA 2EI8A 2BLVA 2GKVE 1T31A 1IOEA 1CVWH 1PPEE 5A2MH 4HTCH 5HIYA 1GPZA 1LO6A 2ZPRA 4NCYA 1NS3A 1P8VC 2J95A 4RI0A 3H09A 5SGAE 4JMYA 2QF4A 1UVPA 3IG6B 4JZ1A 1M9UA 1KXAA 1TPPA 3LH1A 2OINA 1HPGA 1CHOG 1CQQA 1QB6A 1C9TA 4I7YH 2WV4A 2BD5A 2IPHA 1KXEA 3SV9A 1L2EA 5DO4H 1TPOA 1O3IA 1LPGB 1TGTA 2FOHA 1YPKH 4ISOA 3WY8A 1O2ZA 2NU2E 5GWZA 3GDVA 3U8RH 1MKXH 4ABDA 2A2QH 2Y7ZA 1AVGH 3ZIAD 4A1VA 3SQEE 1YPHE 4KTUA 1ELAA 2BDCA 1HBTH 4K69A 3PRBA 1MCTA 1TGBA 1HIAB 1YY3A 3BTQE 2J4IA 2F9VA 3P8NA 4NWLA 3KQDA 5EQSA 4INKA 2BVSH 1HFDA 2KCPA 4TY7A 3SU6A 1QIXB 6GCHG 3DSOA 2ZDLA 1RIWC 2BTCE 1DM4B 3FOAA 5L2ZH 3EYDA 1P05A 5DP9A 2QCYA 1GL0E 1GBKA 3EGKH 1C2LA 3ZZBA 1EATA 3DCLA 1D9IA 2CK3D 3SU2A 1TYNA 1TB6H 4K3JA 1EPTC 1DDJA 1OSSA 2OK5A 5BPEA 1V3XA 1UW7A 2IJD1 2VVVA 1J8AA 1ORFA 4O03A 4AORA 4I8JA 3FVFB 1GI2A 4K1SA 3F68H 1MQ5A 3RXVA 5A0CA 3UOUA 1P0SH 4INHA 1T4UH 2GT7A 8ESTE 2BXUH 5B6OA 4ABBA 2P3FH 3RP2A 2YMSD 1BRAA 1DSUA 1E37B 1TFXA 3RLYH 1TE0A 1O2JA 4X6OA 1OPHB 3KYGA 2BX4A 1MQ6A 3VB3A 1YPJH 3RU4T 1YPHC 3LC5A 4LZ1H 2ANKH 3SUDA 4JZDH 3KQBA 3PMAB 4ZXXH 2PUXB 4AYVB 3VG8A 1DLEA 1L0ZA 1ZPBA 2EC9H 2ZEBA 6CHAB 3F3BA 1FUJA 4IMQA 1UTPA 3OEHD 1KDQA 4HI3A 4LOYH 3PMBB 1GBLA 1BOQA 2BVRH 4BAMB 3A8BA 1LTOA 4M7GA 1SLVB 1WAYB 1HUTH 1T8NA 3CP7A 4MQAA 2H6MA 1P2MA 3UQVA 1FY3A 2OC8A 4B6FA 2K1QA 5LPFA 5EQRA 1UVSH 1C2JA 1TNJA 5C3NA 3U8TH 3MQKC 1DPOA 1FY4A 2GT8A 3RXBA 5JPMH 4H6SB 1L4ZA 1SGQE 2CN0H 4R0IA 1RFNA 2EI7A 2VH0A 2YMSC 1C1WH 3MH4A 3UNRA 3A7YA 1W0KD 1T8OA 1GCTB 3NK8A 3JZ2B 1AVXA 1SGEE 5HXFA 3Q77A 1SLXB 1JBUH 2WINI 4E7NA 1FX0B 1C5RA 1K21H 1XUGA 3A7TA 1KXBA 2OUAA 5EJLA 1UTKA 1HAGE 2WYGA 2ZPSA 3SUGA 2QAAA 3SV7A 1DUAA 1O2XA 1BQYA 3P8OA 2OLGA 2WSSD 3UWIA 1TX6A 2A4QA 1CGHA 1O3NA 3BTME 3SV2H 4OM9A 3F2GA 2ZU3A 3LJOA 1CGIE 5DGJA 1NPMA 4GCHG 2Y82A 2F9BH 2QN5T 5JB8S 2R3YA 2ANWA 4FUHA 3T26A 3U1IB 2FP7B 1O3HA 5IDKA 2PGBB 3LOXA 4DURA 2OP9A 3ZZ3A 2A7HA 2ZHQH 1A0LA 1CSOE 1ETTH 1A5GH 1D3QB 2V7QD 5CMXH 1Z1IA 2D2DA 1C5PA 2CF8H 2FMJA 1P2QA 5L30H 1GBDA 1VITF 1O3KA 1TRYA 1IQEA 2ZO3H 1PQ7A 1L1JA 1PQAA 4E05H 1XUIA 1GJ4H 2ZKSA 3VFEA 1EX3A 2GDEH 5PTPA 4IN2A 1GBJA 2OXSA 4UFDH 2Z3EA 2OC1A 2B7DH 1ZGVA 3SNBA 5F03A 4ZMAH 3DHKH 1QGFA 2J94A 4X1QU 1G37A 2G51A 3F9EA 5A8ZA 3PTBA 3DSPA 8KME2 5C1UA 1Y8TA 2VWNA 4BTUB 4AX9H 1SI5H 1ZRKA 5JYIA 4XBBA 4Y76A 2VINA 2F9OA 1NN6A 4ABJA 4KTSA 1HDTH 8GCHG 1A5HA 4HFPB 4UE7H 4B71A 1E79D 3TNSA 1S82A 3C27B 2Y5HA 5T6GA 1BMAA 3MOCA 1TBQH 4IC6A 3KQCA 2ZTXA 3HGPA 1ELVA 1J17T 1RJXB 1DOJA 2ESTE 4NSVA 1YPMH 3E16B 1OKXA 1IQIA 4YESB 1UTMA 4LXBH 4MLFB 1ZJDA 4I8HA 2G81E 3T5FH 2WUBA 1W0YH 1YYY1 3PTNA 2HGTH 1GI7B 1S6FA 4X8SH 1WV7H 2A0QB 4Q80A 4JCNA 5C1XA 4Q7YA 4AGKA 2R9PA 5T6FA 4FETA 1J15A 3RMOH 4Y0ZE 5CHAC 1C2KA 1C4U2 1E1RD 2AIQA 3MHWU 3CENA 1EZQA 4TSFD 3V7TA 4K2YA 1YKTA 2OQ5A 2ZGCA 4ZXYH 1DS2E 3GCTG 4DIHH 1UK4A 1VKYA 1E1QD 1ZMJA 1RTKA 5T6DA 4A7IB 2BQ7B 3SHCH 1UTLM 1FJSA 3KN2A 4ZAEA 1FV9A 1SHHB 3CNRA 1UHBB 2FESH 2J2UA 4JZEH 5LGOA 4TYDA 2FTLE 2QGRA 3OU0A 4GLYA 4Z0KA 3RXEA 1Q31A 1GBFA 3A83A 2HWLB 2VGCB 1C2FA 1TPAE 3T28A 2V35A 1BA8B 3SHAH 1GJ7B 4AFQA 1C5OH 4FU9A 1G3BA 4XD7D 4D76A 2XBXA 3GDUA 1GJAB 1O3GA 1ZOMA 2BLQA 5DP7A 4MG3A 1Y3UA 3STJA 4YLQH 5LPEA 4VGCC 2XBYA 2J98A 1C2EA 3VGCC 2Q1JA 1C2HA 1S0RA 1P9UA 1P57B 1LMWB 4ZROA 5JBBS 3RXOA 8GCHF 1O2MA 1S83A 1K1OA 4YTAA 3LDXH 1TMBH 2GV7A 2NU3E 3UAIC 4ZKOU 2C90B 2VB0A 3SNCA 2BDGA 4I86A 2L74A 3K6ZA 1AFEH 1MAXA 1FPHH 4CR9A 3PV2A 3RU4E 1NESE 1OYQA 1QR3E 1YPEH 5IK2D 3OYPA 2ZTYA 4M9FA 4X0WU 3UOPA 4XRNA 2W26A 4DW2U 1GJ8B 2FIRH 1C5VA 1AUJA 3KYFA 1GVLA 3DT0H 4PROA 2ZU5A 1IQHA 1TMTH 3M7UA 4DGJA 3AW1A 3MNBA 4A1XA 1ZHRA 1LVOA 2TIOA 1SSXA 3E91A 7ESTE 3S9AA 3RU4D 2OBOA 2XWAA 3SGAE 1EPTA 1Z6EA 1V2UT 1O30A 1RRKA 1NRQH 1UTOA 2M2AA 2JJ2D 2FODA 2LP6A 1ELFA 1GHAF 2HPQH 1GHBF 1GHYH 3GCTF 1TA2A 4MVNA 1EOLA 1K1NA 5F53A 3QLPH 1EP6A 3K65B 2WV5A 3GY8A 4P00A 1P03A 3VPKA 4CBNA 3GISB 4BAOB 1TBZH 3RXMA 4YZUA 1MZAA 2R0LA 3LGIA 4FVDA 1C5NH 1ID5H 1AKSA 2ZCHP 1O3AA 3BG4C 4JZFH 5DP6A 1P2OA 2FOEA 5TCAA 3BTGE 1GHXH 5C0TA 4GSOA 2BOKA 1OOKB 2IOTA 4X2XA 1O5BB 1EOJA 1Z8JB 1OS8A 1QHRB 4F55A 3ATMA 1K1JA 4CREA 2H9HA 5JBTA 3TPIZ 2G55A 1H9IE 1SBWA 4ZKRU 1GJDB 1KXDA 2XBVA 3QZRA 4K60A 4X2VA 4AOQA 1O34A 2VBCA 4Y11E 3S9CA 2KAIA 3UREA 2D8WA 4AZ2B 5AHGH 2J98B 4B75A 5DJ7A 4YOJA 2CJIA 1FPCH 9LPRA 3ODDA 1T8LA 3Q76A 3B9FH 2KCAA 2V3OH 2ZDAH 1HAHH 2PLXA 5DP3A 3QTOH 3E8LA 2GJGA 4X8UH 2JH0D 4A5TS 4WF8A 1TBRH 1P3CA 4A1TA 1HJ8A 1ELTA 2J34A 2M5TA 2CHAC 4RT0A 1RIWB 5EU8A 1O3DA 1V2RT 1GHWH 3M61U 1GBAA 1DVAH 1SFQB 3A89A 3QK1A 3GY5A 1HYLA 4ABFA 3QTVH 5FCKA 4IMZA 1RD3B 4D9QA 4D7FA 1EPTB 1LDTT 3GYMA 4ISNA 1IHTH 1NROH 2ZGBH 3DD2H 1DICA 4FUDA 3PROA 4X6PA 1AD8H 1HAZB 4KELA 2WZQA 1EQ9A 1HCGA 1QL8A 2D1JA 1QL7A 1K22H 2HNTF 4FUEA 4X8VH 3BG8A 2GZ9A 2A7JA 2UWLA 1PYTD 2FYQA 4FU8A 1TGSZ 3Q3XA 4HZHA 1QA7A 2OBQA 1HJAC 1BBRK 2TGTA 1AWHB 1UO6A 1FAXA 2QXGA 3IITA 1GI4A 2GGVB 2TGAA 1CA0C 2ULLA 1W0ZU 3P70B 1GG6C 1MTNC 1AKSB 2ZZUH 3RXKA 5HGGA 3TH4H 1CT0E 4H4FA 2G4UA 3H5CB 3HK6B 5GJ4B 1VGCC 3QGNB 1K1PA 4Q7XA 1DWCH 2ZFSA 5C5NA 5KECA 1OWDA 2PSYA 1Q3XA 3N7DA 2RG3A 2Z3CA 4WVPE 5KGOA 3OAAD 4CRBA 1O3JA 2WHXA 1GJ9B 4CBOA 2ODPA 1UCYH 2GVFA 9ESTA 1YM0A 1O0DH 3PO1C 2UUKB 4AGJA 1B0EA 1MU6B 1XVOA 1WQSA 2J97A 4GHQA 1V6DA 4JZIA 4KTCA 3QX5H 3ZVCA 2W3KA 4RKJB 1ANEA 3DSGA 1TLDA 2WV9A 2RCEA 1IQMA 2BD7A 3A84A 3KHVA 1FY8E 1PYTC 4X6NA 1PFXC 1H4WA 1AFQC 2GCHG 2XW9A 3P6ZB 2BMGB 3M7TA 3SBKA 1MCVA 2YMSB 1TAWA 1LHEH 1YCPH 1MUEB 3O8BA 1KLTA 2I6SA 1EFRD 2F9PA 1O2KA 3TNTA 1AUTC 3KQ5A 2V3MA 1IQNA 5CHBA 1WDIA 2H2ZA 1KY9A 3QZQA 1IQKA 1GJCB 4AN7A 1W3CA 4KP0A 1NBMD 2ZHFH 2PFEA 2Y80A 3L6PA 3P92A 1SGFA 2P94A 1HXEH 5E8EH 4BAHB 2KX4A 1NFWA 2JH5D 1G30B 2AERH 3PWCA 4ZKNU 5DP4A 2HLCA 3MWIU 2FOGA 3ELAH 2QC2A 2WYJA 2QF0A 2HPPH 3QDZB 3AVZA 1A1RA 1E36B 1N8OB 4YOGA 1UTNA 2ZU1A 1WUNH 3Q3KA 1P01A 1J14A 2XCFA 1PPZA 4K1EA 1ELBA 2VIPA 1F2SE 1HAVB 1QJ7B 1GHZA 4CH8B 4Y79A 2P3TB 3UUZA 2VIDA 1MABB 2ZFFH 1E38B 1H9HE 1MU8B 2B9LA 1KSNA 1SGIB 1LVYA 1P2NA 2VIOA 2GMTC 1FI8A 3SZNA 4F48B 4KGAA 1VJ9U 4CRGA 2NU0E 3FZZA 3K9XB 1RTFB 1BBRH 1FMGA 2W7UA 4BTTB 2AYWA 2ZCKP 1SQAA 1O35A 1Y59T 1BIOA 4MDSA 2QXJA 4Y71A 3RXUA 2UWPA 3SJIA 1V2WT 3QUMP 4OS6A 1SG8B 1SC8U 1HV7A 1A5IA 5ABWA 3RMNH 1O33A 1ABIH 2IJOB 3RXGA 3PLKA 1JIMA 2BDIA 5I25A 3A80A 2P8OC 4TPIZ 1P12E 1ZRBA 1QY6A 2P59A 3OX7U 2H9EH 3SU1A 4I8LA 3TK6A 2FOAA 3HK3B 4ZCNA 4MPVA 2GZ8A 1GMHG 2XC5A 2NWNA 1C5LH 3A85A 3OTPA 1EZSC 2ZU4A 3TIUA 1V2PT 2FX4A 1CHOF 1MZDA 4ASHA 2QXHA 3A8DA 4FUGA 3UB0A 2I6QA 5JBCS 2VIVA 2XTTB 1S0QA 1BTUA 1OHHD 1V2MT 1W2KH 3A86A 5A8YA 1EJNA 2VU8E 7LPRA 3NXPA 3SYJA 3U69H 1EJAA 3GCHC 1BDAA 4CRFA 4FUFA 2Z7FE 1T7CA 1C1VH 2FYRA 4LK4A 2ZU2A 4B1TA 2AFQB 1NO9H 5DP5A 4Q2KA 3O8RA 2BD9A 3A88A 2EQNA 3A82A 2JDID 5CHAB 1KLIH 1SGRE 2BDHA 1QRZA 1V2TT 1P04A 1V2OT 1UVOA 1ZMLA 1SQOA 2DE9A 1T8MA 2G5VA 1BTXA 3PM3A 5C94A 6GCHF 2PTCE 4INLA 3SV6A 1WU1A 1ZTKA 1THRH 1ZSKA 1C1PA 1W13U 2A45B 3RXPA 1FXYA 2EY4C 2ZIQH 4NIWA 1YC0A 1G3DA 1XX9A 4F49A 2FDAA 2Z3DA 1QB1A 4P02A 1WXRA 1SB1H 2ZQ1A 3QWCH 2K8IA 4SGAE 1O2SA 1Z1JA 5C2ZA 1UCYE 4I8KA 1EJMA 2CXVA 1BT7A 3RDZA 4A92A 1QB9A 2W6ID 3M5MA 1TNLA 1NRSH 2PP6A 5C67A 1QCPA 1C1QA 2AGEX 3FZDA 5A09A 2PKSB 1AWFH 3TGKE 3W1EA 4Q4LA 3ZV8A 2ODQA 3V3MA 1B0FA 1A4WH 4U01A 2AHME 5GXPA 1A3BH 1J9CH 3PMHB 1GJ5H 4VGCB 3UY9A 3VGCB 1UK3A 5GCHG 1PPFE 4WY3A 1TNHA 1CGJE 3RXRA 3GY6A 4O97A 3DFLA 2R0KA 1DITH 1VITH 3KIDU 3OTJE 3TJNA 5HKKD 1EKBB 1GDNA 5AFYH 1TWXB 2WPHS 1VZQH 3P8FA 1ZTJA 4JYTA 5EIYA 4E06H 4Y0YE 3LGUA 1S81A 1N6YA 1BB0B 3K2UA 3KEEA 1AB9B 1O5CB 3UR9A 2BD4A 3SGBE 2PGQB 1PPHE 4YLUA 1FY5A 1D3TB 2OD3B 3RC5A 4NIXA 4UFFH 3GDSA 3IWMA 1LHFH 1GL1A 4MPUA 1KXFA 2AH4X 3KNXA 1KDQB 3SZEA 1GGDB 1V2NT 2KCYA 3LU9B 1TQ7B 1NU7B 4BNRA 3SU0A 5E2PA 2IPQX 2Q6GA 2A5AA 2OC7A 4ABGA 1TRNA 4TT3D 3A7XA 3MH5A 1LHCH 4AFSA 1LHGH 1ZR0A 5FX6A 1L4DA 2TGPZ 1H9LB 1DANH 2YNAA 1C1OA 1C1RA 2PKAA 4TY6A 1AO5A 1JRTA 1TABE 2WPLS 4YOIA 2AMQA 1TQ0B 3L33A 3UNQA 4ZH8A 3FP8E 3S7HB 1KTSB 3BG4B 1K1IA 5JDUB 1UJ1A 1XMNB 2FLRH 1AGJA 1F5KU 1D4PB 1XXDA 1EAWA 8LPRA 1A7SA 3ATKA 1X7AC 1RTLA 1E34B 1A61H 2ZC9H 3LONA 5EPYA 5F8TA 1O3CA 3LPRA 3ZZ7A 1F0UA 1MTUA 3RXSA 5ETXA 2HVXA 3LJJA 2SGEE 5EOKA 3TGIE 1ZYOA 4IGDA 3AK5A 4ZHAA 3U28C 3SGQE 2FWWA 1SR5C 2OTVA 1BCUH 1G3CA 2XC0A 1S84A 3ODFA 1TX7A 2BDBA 1T4VH 1IAUA 3LKWA 4GCHF 3UNSA 1C9PA 3ZZ4A 1EAUA 1O2IA 2A7CA 2C8WB 2ZA5A 1ZGIA 3E0NB 2BVXH 1MBMA 1SGPE 3C1KA 2J92A 1Y5AT 2QF3A 2A1DB 3PLBA 6CHAC 3FFGA 5HM2A 4GAWA 1Y5UT 2O8WA 3VB6A 2KM0A 3MO3A 1GHVH 2VIQA 1ETSH 2SGPE 1ABJH 1E0FD 2KR7A 2BOHB 1B7XB 2PHBA 2ZDMA 3UTUH 3PMJA 1G2MA 4IBLH 2BD8A 3F9FA 3UPEA 2C8ZB 4WXVA 3BF6H 1DE7H 2ZTZA 3ATIA 4RN6A 3URDA 1DT2A 1THSH 4I8GA 1WOFA 1FONA 1EZXC 4WXIA 6ESTA 5E2OA 4NFEA 3VXFH 3ZVDA 2J5UA 3ZYEA 1YLCA 4NWKA 2O8LA 3HPTB 4DJZB 2H5CA 1WBGB 3ZVAA 4I32A 5CE1A 1GCTC 1FIZA 1MBQA 1O38A 3ZZCA 1O3OA 3ZYDA 1OP0A 1AQ7A 1Z8IB 1DX5M 2ILNA 1GI1A 2AEIH 3GY3A 3GY7A 4AG1A 1A46H 2R3UA 3KCGH 1NRRH 3A8CA 4Z6AH 1SGCA 2FI5E 1S6HA 3SW2B 1GBIA 3SV8A 1PQ5A 2ZWLH 3MU4A 1FIWA 2BB4A 2VJ1A 3M37A 1GG6B 3BTDE 4SGBE 3KL6A 2GCTB 1XUFA 1K1LA 1OX1A 1P06A 3RXAA 5B6LA 3M5NA 1GMDG 1ZMNA 1GBTA 4U32A 3Q00A 1YPGH 2Y7XA 1P2JA 1YF4A 4XBCA 3T62A 3STIA 1O2PA 2O9QA 3URCA 2XWBI 1P3EA 3MNCA 1O2TA 1O2NA 2AGIX 1W7GH 2BLOA 1O3EA 1HRTH 1QNJA 1AY6H 4YT6H 2V3HH 1DUEA 3GS9A 1SLUB 1WTGH 1C5WB 3ZZ5A 4X2WA 1N1LA 2YOLA 2QYIA 4NA9H 2OQUA 1OWIA 2F3CE 1O5AB 4AYYB 2BY7X 1O5DH 2ZDNA 2BZ6H 1HXFH 1H8DH 1O36A 1ZHPA 2Y81A 1AI8H 1PPGE 4JK5A 4UFGH 1AFQB 1NFXA 3FO8D 2BQ6B 1JXPA 2ANMH 4X1RU 1BZXE 4Y8YA 4MPXA 3RC6A 5GNDA 2FOBA 2ZFPH 3PWBA 4NG9H 2A5IA 2RFKC 3SJ9A 1BJVA 1QJ6B 3FN8A 2PW8H 1EP5A 1W7XH 1Y3VA 1XKBC 2KCOA 3E90B 1JWTA 1W10U 3BIVH 5T3HA 1DSTA 3M5LA 1P11E 1ELEE 1LHDH 3RMLH 3H7TA 1P10A 3MNSA 2Y6TA 1UVTH 2WPMS 3E3TA 2NU4E 2BDYA 4OGYA 4TWWA 4MPWA 2FM2A 1LKBA 4Y10E 2EA3A 3N7EA 4O9VA 4CRCA 3LC3A 1XXFA 2O8UA 5AVDA 5K0HA 4F4OC 2ZGJA 1MKWK 4J2YB 4GPGA 3TGJE 1P9SA 1O5EH 1QL9A 3LH3A 1J16A 2LNCA 1O3PB 1O5FH 3BEUA 1K0HA 3SU3A 5GDSH 3RUOA 2XBWA 2Y5GA 3GICB 2FI4E 5KEDA 2F43B 1RS0A 3MI4A 5EXMA 4YXWD 4ABAA 3S69A 3LIWA 4NSYA 4ISIH 1GMDF 1OWEA 4AB9A 2QE7D 1BMNH 1C2DA 3MH7A 1GVZA 2F91A 2LPRA 1V2ST 3M3TA 2SGFE 3SI4H 1XM1A 5HMAA 1G9IE 1LPKB 2B8OH 2NU1E 3PV5A 3SO3A 3F9GA 3UIRA 5FAHA 2XRCA 2HVYB 2B5TB 2VNTA 2QIQA 5J4SA 2UUYA 2GMTB 1KMHB 2STAE 4OS5A 7GCHG 3MTYA 4Z1MD 3N7OA 4JK6A 3MH6A 3ZVFA 3Q3YA 2A32A 1MKXK 2ZHDA 3BTKE 1SOTA 2TGDA 4ZHLU 5F8XA 5FL7D 4AFUA 3S0NA 3LGWA 2BDAA 3RXDA 2UUFB 1XUKA 1VCPA 1NRNH 2FOMB 1BTZA 2P8OB 3FP7E 2VGCC 2FS8A 4FVBA 2XNIA 3SU5A 1TNIA 2Z9JA 5AF9H 3U1JB 5LH8A 1ARBA 1O3MA 1SQTA 3D62A 3HATH 2RDLA 3LGYA 3MO9A 3F2FA 1W11U 2VVCA 2FO9A 5F6MA 2ZGHA 1SGFG 2BY6X 2RA0A 1IQGA 3GY4A 3MU5A 2VWOA 1IQJA 5TCCA 4X1NU 2STBE 4NA8A 3GCHB 4I31A 2ZECA 4AC9A 4IS5A 4GVUA 1HIAA 4B73A 3QN7A 1HNEE 2XC4A 3ZZ8A 4Y8XA 1QTFA 3RXLA 4H42U 1NM6A 3FKSD 4Y8ZA 5T1VA 1PJPA 1TX8A 2KAIB 1O2RA 4XBDA 1AHTH 1L1GA 3SU4A 2GZ7A 2BD3A 5FPYA 4RSPA 1ETRH 3GYLB 2CGAA 4WMDA 1GI6A 4NGAH 4X1PU 3D49H 3R0FA 3FP6E 3OEED 1NBME 4AFZA 3SJOA 3MU0A 3ZVEA 3KGPA 1A3EH 1QJ1B 1MKWH 2R2WU 3LGVA 4ABIA 1DXWA 2A31A 2C8YB 4O3UA 2A4GA 1ZZZA 3I78A 2JH6D 5L6NH 1YBWA 2ZG0H 1SOZA 1A2CH 1DWBH 2UUJB 4MNWA 5FPSA 5HYOA 1V2KT 2BHGA 1KIGH 1WSSH 1AIXH 4XFQA 5DG6A 4HGCA 3SJ8A 3AAUA 4ZKSU 2JIZD 1HLTH 1BUIA 2BY8X 5CDFE 3L3TA 3RXCA 1BHXB 2CV3A 1C2GA 2R2MB 3TLOA 1MTSA 2FXRA 1EB1H 3V12A 1QZ8A 3AASA 3P8GA 5I46H 1O31A 3E0PB 2Z9LA 1O2OA 3U8OH 2Z9IA 2ZHEH 3ATWA 5FHTA 2TBSA 2ZPQA 1IQFA 4NZQA 1F92A 1DXPA 1A0HB 1C5XB 2W3IA 4D7GA 4UFEH 1C4V2 2BX3A 1Z6JH 3BEIB 3BN9A 1QFKH 3PRDA 3TK5A 2ZFQH 1GI5A 1COWD 1VCQA 1MAYA 2JKHA 1Q2WA 1GI0A 1OP8A 1TA6A 4K5ZA 4ABEA 3RM0H 3CS7A 3TU7H 4Y7AA 1EUFA 4K8BA 3SJKA 1MH0A 1DY9A 2QXIA 2G8TA 1C4Y2 1V2QT 2G4TA 2PSXA 3O8DA 1C1NA 1CE5A 2FOCA 4FUIA 5DP8A 1C2IA 3NZIA 1Z71A 4Y7BA 4Y6DA 1VCWA 3QO6A 2CMYA 2ODYB 2VWLA 3ZV9A 3EE7A 2GCHF 4HG6A 1QRXA 5AFZH 2ZCLP 1ZTLA 3TJVA 1BTHH 1PPBH 1W8BH 1JOUB 3BTHE 3BEFB 3GCNA 1QQUA 1D6RA 1O2YA 4WMEA 1DWDH 2B0FA 4CHAC 1KXCA 3A7VA 1ZPZA 3BV9B 3HGNA 1C5QA 3D65E 2ZI2H 4IW4E 2QY0B 5EGMA 1NY22 4RT1A 4OS4A 1YPLH 1DWEH 2TRMA 4FXGH 2AS9A 2ASUB 1C1MA 4KKDA 4X6MA 4YM9A 2HNTE 5JBAS 2ANYA 1OWKA 3I29A 3S7KB 3D23A 1MTVA 3ITIA 4XSKU 1GI8B 3HKJB 4THNH 2P95A 3BIUH 2VVUA 1AE8H 3O8CA 2L6OA 2FPZA 3W94A 3UQOA 4BAKB 2UWOA 1H1BA 1O2LA 1QRWA 3EAJA 3F0PA 1TGNA 4BOHA 5EJZA 1FZZA 1U6QA 1ZPCA 3MYWA 4NA7A 1HJ9A 3ESTA 3TJUA 2G00A 2ZGXH 1Z7KA 1YWUA 5EPNA 1S6LA 3OSYA 3EE0B 2YNBA 3B8JA 4X2YA 5E0GA 3W95A 1WTHD 1VITG 2LELA 3SI3H 1QURH 3SORA 1ZSJA 3BTWE 2Z9GA 1CBWC 2A5KA 2ZFRH 2JETC 5EXLA 3A8AA 4BXSA 1GDQA 7KMEH 1ELDE 1ZHMA 3M3VA 4MNYA 1ANDA 3DFJA 2ZF0H 2GDDA 3ZZ6A 4NFFA 3WWFA 3RM2H 4FUCA 1F5LA 2DUCA 2TPIZ 2AMPA 1GBMA 3MFJA 1AE5A 2O8MA 4WMFA 3NKKA 3SN8A 2FOFA 2K0QA 2Z9KA 1BRBE 3QGJA 1OP2A 2G5NA 2SNWA 2HNTC 1FAKH 1ELCA 1L1NA 3EA7A 2SGDE 4CR5A 1O2VA 1SPJA 1V2JT 5EQQA 1ESBA 1GMHF 2JJ1D 1D6WA 1ACBE 1F0SA 2SFAA 1EAXA 1SVPA 3AW0A 2BYAX 5K7RA 1C5ZB 4FUJA 1Y5BT 1XUHA 4CRDA 4FOUC 4B2CA 2WPDD 1SMFE 3ATLA 4I33A 4CH2B 5JB9S 4ABHA 3PB1E 1NU9A 1A0JA 1C1TA 1GMCG 2FI3E 4B2BA 2GD4B 1GI9B 1CO7E 4B6EA 1ELGA 1NFYA 1ARCA 3ZVGA 2W6JD 1W14U 1LCYA 3RXIA 2EI6A 4ZHMU 1OWJA 1N8OC 1VR1H 4Q7ZA 4ASUD 4RKOB 1UK2A 3EA8A 1C1SA 4GHTA 1GVKB 1QBNA 5BRRE 4BANB 1INCA 1CHGA 1CU1A 4WH6A 4DVAU 2V6NA 2ZDVH 3SUFA 2WUCA 1V2LT 3LT3A 2GP9B 1IQLA 4NIVA 4ESTE 1UHBA 3M5OA 5FPTA 5L2YH 2Q6DA 1XVMA 4DCDA 1C2MA 2SGQE 1AMHA 1GBCA 3EA9A 3AAVA 1GBHA 4IC5A 1K28D 2BY5X 3N99A 2XOKD 1K1MA 2ZNKH 1DLKB 3FAOA 1W0JD 1H8ED 2AMDA 1QA0A 2AIPA 3P95A 1KYNA 1IHSH 2PR3A 4BTIB 1OXGA 1CT2E 3MMGA 1FN6A 1S85A 1QBVH 3WWBA 2FS9A 1LQDB 2VWMA 5DK1A 1VJAU 1BRUP 2ALVA 3M3SA 4X1SU 1EXFA 1FDPA 1O2WA 2QF5A 4UDWH 1BBRE 4DY7B 4LZ4B 2PUQH 1JRSA 2BQWB 3F6UH 3CS0A 4FUBA 1FLEE 1GDUA 2J9NA 2O8TA 2KZ4A 5GCHF 2ZQ2A 1N6XA 3MNXA 3GY2A 1LVMA 2D26C 3NPSA 3RXJA 3T29A 5C5OA 1AU8A 1UMAH 5H4IB 3I77A 4MTBA 3RXTA 4H6TA 5GPIB 1H8IH 1GMCF 5GIBA 1E35B 1SLWB 1NRPH 1O2QA 2GTBA 1O5GH 1SGNE 4Q63A 1BITA 3TH3H 1SGYE 2CHAB 5HM9A 1C5TA 3NWUA 3A7WA 1TOMH 1HGTH 3PV4A 4K1TA 3EQ0H 1BTWA 1GHAG 2F4LA 1QQ4A 3F2HA 3P17H 4QT8C 2F83A 3S9BA 1GHBG 3F1SB 5TJXA 2SNVA 3ZZ9A 1YP9A 1BJUA 1C5SA 2V0BA 2Y5FA 2BY9X 4OS1A 1TOCB 1CA8B 1Z8RA 3LGTA 1C5MD 2BZAA 3HKIB 3RXQA 3VXEH 1GJ6A 5ESTE 1D3PB 3BTFE 4WJG2 4ISLA 2HLDD 3RC4A 3A81A 4GUXA 3ZZDA 1TRMA 4DOQA 1GBEA 1HJAB 2PKAB 2PKSC 3E6PH 2XCNA 5EJ1A 5EW2H 5DKMA 5HIZA 1MD8A 4YO9A 1CA0B 3PYHA 5E0HA 4ACAA 1MTNB 1O32A 1SHYA 1G36A 1ANBA 1F0RA 3PLPA 1VGCB 1SKYE 1LKAA 3FANA 4UD9H 2A2XH 4UONA 5EW1H 2ZP0H 2Z94A 3DUXH 4OS2A 2PTNA 5E0JA 1C5YB 1NTPA 3ZVBA 2A4OA 1SL3A 1YCPM 3SNDA 5FBIA 3RXFA 5A0AE 4B2AA 3SQHE 3K6YA 3H7OA 3PO1B 1DFPA 4XE4A 1GWAA 3NRLA 3UFAA 3ENSB 1HAXB 1BMFD 1JMOH 1AB9C 4OGXA 4DT7B 1TONA 5IYTA 1TNKA 1ESAA 1EB2A 1MD7A 2FZZA 1FY1A 1TGCA 3BTEE 5EXNA 1AZZA 1F7ZA 2P93A 2Q6FA 3UR6A 3V13A 2ZFTA 3KQEA 1GGDC 3V0XA 1O3LA 1TALA 1P2KA 1ANCA 2W7SA 3WW7A 1FQ3A 1Y3XA 3UWJH 3OY6U 1WQVH 2ZHWH 5DPAA 2PV9B 1BRCE 1O37A 1Y3YA 3VB4A 2PWXA 5LPRA 2C93B 3RMMH 1P02A 1UCYK 4J1YA 1FN8A 4DT4A 2FX6A 5G4BA 1SQRA 1T32A 3G01A 5A0BA 1BTYA 5EODA 1NC6A 1MMJN 4K8YA 5FXLA 3SNEA 4D9RA 1HAIH 2DE8A 1YLNA 2HOBA 2H5DA 3NCLA 1V2VT 1LPZB 1JIRA 2G52A 1O2HA 1KTTB 3BSQA 4ACBA 1EZUC 3VEQB 3T25A 2XNDD 1ZLRA 2QV1A 2ZDKA 1YCPK 5C0UA 2BLWA 2RA3A 3TH2H 1WYKA 1C5UA 2F9UA 4MNVA 2VIWA 3TVJB 1ZSLA 1O2UA 3GOVB 1MTWA 3F0OA 3JZ1B 4TPYA 2C4FH 1UTQA 4NZLA 4UEHH 2CF9H 3GCOA 2XXLA 1UTJA 2C8XB 1K9OE 2H1UA 2SGAA 1ZJKA 3R3GB 5A8XA
chains in the Genus database with same CATH topology
4YT7H 4JYVH 1O3FA 1ESTA 1WCZA 4DG4A 3T27A 4B74A 3U98H 4IN1A 2IN2A 2WPJS 2P3UB 3BTTE 1GCDA 1F0TA 2THFB 4U2WA 1P09A 3F9HA 1D3DB 1CT4E 4X8TH 1B5GH 1SGDE 1O2GH 4D8NA 3NUMA 1HB0B 5EG4A 5F8ZA 3SUEA 3SOSA 1YGCH 4TWYA 1TPSA 4JYUH 3VB5A 1NFUA 1UVUH 1HAOH 2BXTH 2HALA 1TMUH 2AGGX 4FU7A 2A4RA 4ZUHA 1EAIA 4NIYA 3M35A 1O39A 4WH8A 3RLWH 2W5EA 1FNIA 1KLJH 1SFIA 4AB8A 3VB7A 3MU8A 1AZ8A 2WPIS 4A6LA 3B23B 5C20A 3E1XB 4AG2A 1THPB 4CHAB 1XKAC 6LPRA 2P16A 1RXPA 1YLDA 3DA9B 3U9AH 4OS7A 2GX4A 5C1YA 1PQ8A 1F5RA 5ESBA 3TJOA 3MU1A 3M36A 1LQEA 2VH6A 1AN1E 1HAPH 4WWYA 1K2I1 3OY5U 1BHXF 1TIOA 1EASA 5FBEA 3MO6A 1G32B 2GV6A 3A7ZA 1S5SA 1AVWA 1TNGA 2XYAA 1GI3A 1OWHA 4O3TA 1HAYB 2OC0A 4DIIH 1OYTH 2OCVB 4CRAA 5J4QA 5FCRA 5FX5A 1HAVA 1SGTA 1NT1A 2GCTC 4R8TB 1C1UH 1QBOA 2WPKS 1LVBA 2BD2A 3A87A 1BTPA 4BXWA 2C3SA 1Z8GA 3RXHA 3T2NA 4ISHH 4U30A 3KF2A 2F9NA 2HRVA 3TITA 1G2LA 2FTMA 4MNXA 1CBWB 3ZZAA 1NZQH 4XOJA 1XUJA 1Y3WA 2FLBH 2JETB 2Z6BD 1PPCE 3SNAA 2EEKA 1P2IA 2H9TH 2BM2A 2FEQH 4BAQB 4B76A 3EDXB 4E7RG 1BMLA 2QA9E 1G3EA 2J38A 1DY8A 1GBBA 7GCHF 1W12U 4XDEA 3M7QA 2ALPA 1RGQA 3TK9A 1BMMH 1GJBB 1O3BA 2EI8A 2BLVA 2GKVE 1T31A 1IOEA 1CVWH 1PPEE 5A2MH 4HTCH 1GPZA 1LO6A 2ZPRA 4NCYA 1NS3A 1P8VC 2J95A 5SGAE 4JMYA 1UVPA 3IG6B 4JZ1A 1M9UA 1KXAA 1TPPA 3LH1A 2OINA 1HPGA 1CHOG 1CQQA 1QB6A 1C9TA 4I7YH 2WV4A 2BD5A 2IPHA 1KXEA 3SV9A 1L2EA 5DO4H 1TPOA 1O3IA 1LPGB 1TGTA 2FOHA 1YPKH 4ISOA 3WY8A 1O2ZA 2NU2E 5GWZA 3GDVA 3U8RH 1MKXH 4ABDA 2A2QH 2Y7ZA 1AVGH 4A1VA 3SQEE 1YPHE 4KTUA 1ELAA 2BDCA 1HBTH 4K69A 1MCTA 1TGBA 1HIAB 3BTQE 2J4IA 2F9VA 3P8NA 4NWLA 3KQDA 5EQSA 4INKA 2BVSH 1HFDA 4TY7A 3SU6A 1QIXB 6GCHG 2ZDLA 1RIWC 2BTCE 1DM4B 5L2ZH 3EYDA 1P05A 5DP9A 2QCYA 1GL0E 1GBKA 3EGKH 1C2LA 3ZZBA 1EATA 1D9IA 3SU2A 1TYNA 1TB6H 4K3JA 1EPTC 1DDJA 1OSSA 5BPEA 1V3XA 2VVVA 1J8AA 1ORFA 4O03A 4AORA 4I8JA 3FVFB 1GI2A 4K1SA 3F68H 1MQ5A 3RXVA 5A0CA 3UOUA 1P0SH 4INHA 1T4UH 2GT7A 8ESTE 2BXUH 5B6OA 4ABBA 2P3FH 3RP2A 1BRAA 1DSUA 1E37B 1TFXA 3RLYH 1TE0A 1O2JA 4X6OA 1OPHB 2BX4A 1MQ6A 3VB3A 1YPJH 3RU4T 1YPHC 3LC5A 4LZ1H 2ANKH 3SUDA 4JZDH 3KQBA 3PMAB 4ZXXH 2PUXB 4AYVB 1DLEA 1L0ZA 1ZPBA 2EC9H 2ZEBA 6CHAB 1FUJA 4IMQA 1UTPA 1KDQA 4HI3A 4LOYH 3PMBB 1GBLA 1BOQA 2BVRH 4BAMB 3A8BA 1LTOA 4M7GA 1SLVB 1WAYB 1HUTH 1T8NA 3CP7A 4MQAA 2H6MA 1P2MA 3UQVA 1FY3A 2OC8A 2K1QA 5LPFA 5EQRA 1UVSH 1C2JA 1TNJA 5C3NA 3U8TH 1DPOA 1FY4A 2GT8A 3RXBA 5JPMH 4H6SB 1L4ZA 1SGQE 2CN0H 4R0IA 1RFNA 2EI7A 2VH0A 1C1WH 3MH4A 3UNRA 3A7YA 1T8OA 1GCTB 3NK8A 3JZ2B 1AVXA 1SGEE 5HXFA 3Q77A 1SLXB 1JBUH 2WINI 4E7NA 1C5RA 1K21H 1XUGA 3A7TA 1KXBA 2OUAA 1UTKA 1HAGE 2WYGA 2ZPSA 3SUGA 2QAAA 3SV7A 1DUAA 1O2XA 1BQYA 3P8OA 2OLGA 3UWIA 1TX6A 2A4QA 1CGHA 1O3NA 3BTME 3SV2H 2ZU3A 3LJOA 1CGIE 5DGJA 1NPMA 4GCHG 2Y82A 2F9BH 2QN5T 5JB8S 2R3YA 2ANWA 4FUHA 3T26A 3U1IB 2FP7B 1O3HA 5IDKA 2PGBB 3LOXA 4DURA 2OP9A 3ZZ3A 2A7HA 2ZHQH 1A0LA 1CSOE 1ETTH 1A5GH 1D3QB 5CMXH 1Z1IA 2D2DA 1C5PA 2CF8H 2FMJA 1P2QA 5L30H 1GBDA 1VITF 1O3KA 1TRYA 1IQEA 2ZO3H 1PQ7A 1L1JA 1PQAA 4E05H 1XUIA 1GJ4H 2ZKSA 3VFEA 1EX3A 2GDEH 5PTPA 4IN2A 1GBJA 2OXSA 4UFDH 2Z3EA 2OC1A 2B7DH 1ZGVA 3SNBA 5F03A 4ZMAH 3DHKH 1QGFA 2J94A 4X1QU 1G37A 2G51A 3F9EA 5A8ZA 3PTBA 8KME2 5C1UA 1Y8TA 2VWNA 4BTUB 4AX9H 1SI5H 1ZRKA 5JYIA 4XBBA 4Y76A 2VINA 2F9OA 1NN6A 4ABJA 4KTSA 1HDTH 8GCHG 1A5HA 4HFPB 4UE7H 4B71A 3TNSA 1S82A 3C27B 2Y5HA 5T6GA 1BMAA 3MOCA 1TBQH 4IC6A 3KQCA 2ZTXA 3HGPA 1ELVA 1J17T 1RJXB 1DOJA 2ESTE 4NSVA 1YPMH 3E16B 1OKXA 1IQIA 4YESB 1UTMA 4LXBH 4MLFB 1ZJDA 4I8HA 2G81E 3T5FH 2WUBA 1W0YH 1YYY1 3PTNA 2HGTH 1GI7B 1S6FA 4X8SH 1WV7H 2A0QB 4Q80A 4JCNA 5C1XA 4Q7YA 4AGKA 2R9PA 5T6FA 1J15A 3RMOH 4Y0ZE 5CHAC 1C2KA 1C4U2 2AIQA 3MHWU 3CENA 1EZQA 3V7TA 4K2YA 1YKTA 2OQ5A 2ZGCA 4ZXYH 1DS2E 3GCTG 4DIHH 1UK4A 1ZMJA 1RTKA 5T6DA 4A7IB 2BQ7B 3SHCH 1UTLM 1FJSA 3KN2A 4ZAEA 1FV9A 1SHHB 4JZEH 1UHBB 2FESH 2J2UA 5LGOA 4TYDA 2FTLE 2QGRA 3OU0A 4GLYA 4Z0KA 3RXEA 1Q31A 1GBFA 3A83A 2HWLB 2VGCB 1C2FA 1TPAE 3T28A 2V35A 1BA8B 3SHAH 1GJ7B 4AFQA 1C5OH 4FU9A 1G3BA 4D76A 2XBXA 3GDUA 1GJAB 1O3GA 1ZOMA 2BLQA 5DP7A 4MG3A 1Y3UA 3STJA 4YLQH 5LPEA 4VGCC 2XBYA 1C2EA 3VGCC 2Q1JA 1C2HA 1S0RA 1P9UA 1P57B 1LMWB 4ZROA 5JBBS 3RXOA 8GCHF 1O2MA 1S83A 1K1OA 4YTAA 3LDXH 1TMBH 2GV7A 2NU3E 4ZKOU 2C90B 2VB0A 3SNCA 2BDGA 3K6ZA 1AFEH 1MAXA 1FPHH 4CR9A 3RU4E 1NESE 1OYQA 1QR3E 1YPEH 3OYPA 2ZTYA 4X0WU 3UOPA 2W26A 4DW2U 1GJ8B 2FIRH 1C5VA 1AUJA 1GVLA 3DT0H 4PROA 2ZU5A 1IQHA 1TMTH 3M7UA 4DGJA 3AW1A 3MNBA 4A1XA 1ZHRA 1LVOA 2TIOA 1SSXA 3E91A 7ESTE 3S9AA 3RU4D 2OBOA 2XWAA 3SGAE 1EPTA 1Z6EA 1V2UT 1O30A 1RRKA 1NRQH 1UTOA 2FODA 1ELFA 1GHAF 2HPQH 1GHBF 1GHYH 3GCTF 1TA2A 4MVNA 1EOLA 1K1NA 3QLPH 1EP6A 3K65B 2WV5A 3GY8A 1P03A 3VPKA 4CBNA 3GISB 4BAOB 1TBZH 3RXMA 4YZUA 1MZAA 2R0LA 3LGIA 4FVDA 1C5NH 1ID5H 1AKSA 2ZCHP 1O3AA 3BG4C 4JZFH 5DP6A 1P2OA 2FOEA 5TCAA 3BTGE 1GHXH 4GSOA 2BOKA 1OOKB 2IOTA 4X2XA 1O5BB 1EOJA 1Z8JB 1OS8A 1QHRB 3ATMA 1K1JA 4CREA 2H9HA 5JBTA 3TPIZ 2G55A 1H9IE 1SBWA 4ZKRU 1GJDB 1KXDA 2XBVA 3QZRA 4K60A 4X2VA 4AOQA 1O34A 4Y11E 3S9CA 2KAIA 3UREA 2D8WA 4AZ2B 5AHGH 4B75A 5DJ7A 4YOJA 2CJIA 1FPCH 9LPRA 3ODDA 1T8LA 3Q76A 3B9FH 2V3OH 2ZDAH 1HAHH 2PLXA 5DP3A 3QTOH 3E8LA 4X8UH 2JH0D 4A5TS 4WF8A 1TBRH 1P3CA 4A1TA 1HJ8A 1ELTA 2J34A 2M5TA 2CHAC 1RIWB 5EU8A 1O3DA 1V2RT 1GHWH 3M61U 1GBAA 1DVAH 1SFQB 3A89A 3QK1A 3GY5A 1HYLA 4ABFA 3QTVH 5FCKA 4IMZA 1RD3B 4D9QA 4D7FA 1EPTB 1LDTT 3GYMA 4ISNA 1IHTH 1NROH 2ZGBH 3DD2H 1DICA 4FUDA 3PROA 4X6PA 1AD8H 1HAZB 4KELA 1EQ9A 1HCGA 1QL8A 2D1JA 1QL7A 1K22H 2HNTF 4FUEA 4X8VH 3BG8A 2GZ9A 2A7JA 2UWLA 1PYTD 2FYQA 4FU8A 1TGSZ 3Q3XA 4HZHA 1QA7A 2OBQA 1HJAC 1BBRK 2TGTA 1AWHB 1UO6A 1FAXA 2QXGA 3IITA 1GI4A 2GGVB 2TGAA 1CA0C 2ULLA 1W0ZU 3P70B 1GG6C 1MTNC 1AKSB 2ZZUH 3RXKA 5HGGA 3TH4H 1CT0E 4H4FA 2G4UA 3H5CB 3HK6B 5GJ4B 1VGCC 3QGNB 1K1PA 4Q7XA 1DWCH 2ZFSA 5C5NA 1OWDA 2PSYA 1Q3XA 2RG3A 2Z3CA 4WVPE 4CRBA 1O3JA 1GJ9B 4CBOA 2ODPA 1UCYH 2GVFA 9ESTA 1YM0A 1O0DH 3PO1C 2UUKB 4AGJA 1B0EA 1MU6B 1XVOA 1WQSA 4GHQA 1V6DA 4JZIA 4KTCA 3QX5H 3ZVCA 2W3KA 4RKJB 1ANEA 1TLDA 2RCEA 1IQMA 2BD7A 3A84A 3KHVA 1FY8E 1PYTC 4X6NA 1PFXC 1H4WA 1AFQC 2GCHG 2XW9A 3P6ZB 2BMGB 3M7TA 3SBKA 1MCVA 1TAWA 1LHEH 1YCPH 1MUEB 3O8BA 1KLTA 2I6SA 2F9PA 1O2KA 3TNTA 1AUTC 1IQNA 2H2ZA 1KY9A 3QZQA 1IQKA 1GJCB 4AN7A 1W3CA 4KP0A 2ZHFH 2PFEA 2Y80A 3L6PA 3P92A 1SGFA 2P94A 1HXEH 5E8EH 4BAHB 1NFWA 2JH5D 1G30B 2AERH 3PWCA 4ZKNU 5DP4A 2HLCA 3MWIU 2FOGA 3ELAH 2QC2A 2WYJA 2QF0A 2HPPH 3QDZB 3AVZA 1A1RA 1E36B 1N8OB 4YOGA 1UTNA 2ZU1A 1WUNH 3Q3KA 1P01A 1J14A 2XCFA 1PPZA 4K1EA 1ELBA 2VIPA 1F2SE 1HAVB 1QJ7B 1GHZA 4CH8B 4Y79A 2P3TB 3UUZA 2VIDA 2ZFFH 1E38B 1H9HE 1MU8B 2B9LA 1KSNA 1SGIB 1LVYA 1P2NA 2VIOA 2GMTC 1FI8A 3SZNA 4KGAA 1VJ9U 4CRGA 2NU0E 3FZZA 3K9XB 1RTFB 1BBRH 1FMGA 2W7UA 4BTTB 2AYWA 2ZCKP 1SQAA 1O35A 1Y59T 1BIOA 4MDSA 2QXJA 4Y71A 3RXUA 2UWPA 3SJIA 1V2WT 3QUMP 4OS6A 1SG8B 1SC8U 1HV7A 1A5IA 5ABWA 3RMNH 1O33A 1ABIH 2IJOB 3RXGA 3PLKA 1JIMA 2BDIA 5I25A 3A80A 2P8OC 4TPIZ 1P12E 1ZRBA 1QY6A 2P59A 3OX7U 2H9EH 3SU1A 4I8LA 3TK6A 2FOAA 3HK3B 4MPVA 2GZ8A 1GMHG 2XC5A 2NWNA 1C5LH 3A85A 1EZSC 2ZU4A 3TIUA 1V2PT 2FX4A 1CHOF 1MZDA 4ASHA 2QXHA 3A8DA 4FUGA 2I6QA 5JBCS 2VIVA 2XTTB 1S0QA 1BTUA 1V2MT 1W2KH 3A86A 5A8YA 1EJNA 2VU8E 7LPRA 3NXPA 3U69H 1EJAA 3GCHC 1BDAA 4CRFA 4FUFA 2Z7FE 1T7CA 1C1VH 2FYRA 4LK4A 2ZU2A 4B1TA 2AFQB 1NO9H 5DP5A 4Q2KA 3O8RA 2BD9A 3A88A 3A82A 5CHAB 1KLIH 1SGRE 2BDHA 1QRZA 1V2TT 1P04A 1V2OT 1UVOA 1ZMLA 1SQOA 2DE9A 1T8MA 2G5VA 1BTXA 3PM3A 6GCHF 2PTCE 4INLA 3SV6A 1WU1A 1ZTKA 1THRH 1ZSKA 1C1PA 1W13U 2A45B 3RXPA 1FXYA 2ZIQH 4NIWA 1YC0A 1G3DA 1XX9A 4F49A 2FDAA 2Z3DA 1QB1A 1SB1H 2ZQ1A 3QWCH 4SGAE 1O2SA 1Z1JA 5C2ZA 1UCYE 4I8KA 1EJMA 2CXVA 1BT7A 3RDZA 4A92A 1QB9A 3M5MA 1TNLA 1NRSH 5C67A 1QCPA 1C1QA 2AGEX 3FZDA 5A09A 2PKSB 1AWFH 3TGKE 3ZV8A 2ODQA 3V3MA 1B0FA 1A4WH 4U01A 5GXPA 1A3BH 1J9CH 3PMHB 1GJ5H 4VGCB 3UY9A 3VGCB 1UK3A 5GCHG 1PPFE 4WY3A 1TNHA 1CGJE 3RXRA 3GY6A 4O97A 3DFLA 2R0KA 1DITH 1VITH 3KIDU 3OTJE 3TJNA 1EKBB 1GDNA 5AFYH 1TWXB 2WPHS 1VZQH 3P8FA