3UNRA

Bond length analysis of asp, glu and his residues in trypsin at 1.2a resolution
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Protonation-state determination in proteins using high-resolution X-ray crystallography: effects of resolution and completeness.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3unrA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3unrA02
1HJAB 1NO9H 1BBRH 2YNBA 3SU2A 4UEHH 2XTTB 1HFDA 1OYQA 2UWPA 3FAOA 4NCYA 1QRWA 4XDEA 5JB8S 1XMNB 2BQ7B 2GD4B 3SOSA 1AFEH 2XC0A 1VITF 1ORFA 3RXQA 1DANH 1KLJH 2V3HH 1S82A 1CT4E 1O3PB 4BOHA 4IN2A 3KIDU 3SJ9A 3UWIA 2Z3CA 1TGTA 3M5NA 3NUMA 7ESTE 2HNTE 2VWMA 4F49A 4K69A 1W10U 2PKSC 4I32A 4UFFH 1IQGA 1TX8A 3KHVA 1FN8A 3M7UA 2Q1JA 3D65E 2CMYA 2O8LA 2FI3E 3P8OA 4ZAEA 3VGCB 2DUCA 1GI4A 3ZYEA 1TMTH 3QX5H 5F8XA 1XUHA 3STJA 1T8LA 1YPGH 4AFZA 1XUIA 4FUHA 1HUTH 4JK6A 5A8ZA 1P2MA 4MNVA 3MNBA 4X6PA 4AGKA 1UTPA 2ZDMA 1NU9A 1ANDA 1RTLA 1TPAE 1NRQH 2ANWA 3A8DA 1Y59T 3NWUA 2BDGA 4X1RU 1Z7KA 4FUEA 1GHZA 3UQVA 3EE0B 3LDXH 1KDQA 1Y8TA 3JZ2B 3M3VA 1GI0A 1GCTC 4MVNA 4B2AA 2FOGA 3SJOA 2ZU3A 2A7HA 1UMAH 2BD7A 4TPYA 1C1NA 1QL7A 4BANB 1FDPA 2Y5HA 2VU8E 2NWNA 5C67A 3KEEA 1N8OB 3O8RA 1KYNA 4NA8A 1RTFB 3EA8A 1O3AA 3GCTF 1ZSJA 4WJG2 1BTZA 1T32A 3MFJA 3NXPA 1B0FA 2SGPE 1DM4B 3SU6A 1T8OA 2TPIZ 2QCYA 3KF2A 3BIVH 4DOQA 2QY0B 1QA0A 7GCHF 1CT2E 2RCEA 5LH8A 1TX6A 1W8BH 2WPHS 1HAVA 4DT7B 1NFWA 1NFXA 1P06A 4YESB 5FPTA 1BB0B 4CRGA 2ALPA 1FMGA 2VIVA 2HPPH 1KXFA 2SGFE 1DWCH 3KGPA 1GJ9B 2R2MB 2FOCA 1XUFA 3E16B 1SL3A 4YT6H 1YCPM 2TIOA 2W3KA 3RUOA 1O2UA 1EOJA 1OWKA 2VGCB 4WVPE 4INKA 5HM2A 2J92A 1P9SA 1V3XA 2ZDLA 3TNSA 1FJSA 1EZXC 1WSSH 2LPRA 3K2UA 1AY6H 2ODPA 4K1TA 1IOEA 2FI4E 1ZHPA 4Y71A 1VITH 2C8ZB 2J2UA 4ISIH 1FY5A 1Z1IA 3MH6A 2FP7B 4H6SB 1K1OA 1C1OA 3KQEA 1S85A 2PTNA 2SGDE 1EJMA 1WTGH 1O3BA 3MYWA 2C3SA 1GGDB 5DG6A 3E0NB 3RXKA 4UFEH 1B7XB 2AGGX 3RXEA 1W0ZU 1GJDB 8LPRA 3RXTA 2QXGA 2G8TA 1OWIA 1CGHA 1Q31A 1TNLA 1AI8H 1BRUP 1EATA 4ABHA 1RS0A 2A4QA 2CJIA 4WY3A 1BIOA 4OGXA 1O36A 4D76A 1RD3B 2JH6D 4DJZB 4NWKA 2B8OH 1CA8B 5TCAA 2ZCLP 1HLTH 4Q80A 5FCRA 1PYTD 3ZV9A 4M7GA 3EA7A 1ELDE 2PKAA 1O5CB 1ZZZA 3A82A 1OOKB 2PGQB 1S0QA 4K1EA 1HXEH 4B2CA 2VJ1A 1MZDA 1O34A 2P3TB 2QXHA 4K8YA 2D8WA 1G3DA 3S9CA 2ZFFH 2OTVA 5LPFA 1EAUA 1C2HA 1E38B 3SHCH 1PPGE 2GP9B 1OKXA 4LK4A 2W7SA 4JYTA 3S7HB 2ZTZA 1BDAA 2ZGJA 3NCLA 1BMAA 1JIRA 1EXFA 4DIHH 1MAYA 1O3FA 3RXIA 3MU0A 2GV7A 3CS0A 2ODQA 1IQIA 3H7OA 1C9PA 2BZAA 3EQ0H 2A5IA 2ZQ2A 1HIAA 3MNSA 3B8JA 1WTHD 5T6DA 1TRNA 1VJAU 1THRH 3MWIU 2TGAA 1GBHA 1NZQH 4A6LA 1O33A 3AW0A 3HPTB 1A5HA 2BD9A 2ZU5A 5TJXA 2P93A 5A0AE 1U6QA 1JOUB 3MOCA 4I8LA 4AYYB 1HYLA 1AUJA 4YLUA 1P2NA 4ZHMU 4DVAU 3SV9A 3ATMA 3HKJB 1ZGVA 3MU4A 3ODDA 5T3HA 5ETXA 1UCYE 1O2LA 2HGTH 1C1SA 1RJXB 1LDTT 4JZDH 1SBWA 4J1YA 2FOEA 1A1RA 1PPCE 1TB6H 3QN7A 1YPKH 3OX7U 3ZZDA 3PB1E 4X1NU 3E1XB 4XOJA 4ZKRU 2BY8X 4I33A 3RC4A 2J95A 1J17T 3E6PH 2XBYA 1ANCA 4NFFA 1PPEE 4FUIA 3GDSA 1MTSA 3IG6B 2A1DB 4DIIH 2NU3E 1F0UA 1W7XH 4IMQA 1DLKB 1K1LA 1GWAA 1C5OH 3VGCC 1J9CH 5G4BA 1EJNA 3GDUA 2O8MA 1V2TT 1SOZA 1HXFH 1IQEA 1P2OA 2IPHA 3VB4A 3P95A 2BDAA 1AE8H 1FPHH 4TY7A 1WQSA 1QY6A 3QDZB 1QTFA 4H4FA 2UUFB 1BMNH 2H2ZA 5DP3A 2ESTE 2ZGBH 1GHAG 4X8SH 2VWNA 3LGYA 1MZAA 2VVUA 4NSVA 2J38A 3ZZ7A 2NU4E 1D3PB 3PWCA 4NIVA 4WMDA 3EDXB 1YPHC 1AE5A 3VXEH 2BHGA 3V7TA 3KN2A 4GUXA 4ZHLU 4AGJA 3Q76A 4NZLA 4H6TA 4AN7A 2BZ6H 1IQFA 3V0XA 1AN1E 1UTOA 8GCHG 1BHXF 2D2DA 1K2I1 1QR3E 2RDLA 1ESAA 1AD8H 1CE5A 1UHBA 1V2OT 1OWDA 3BG4C 1SGYE 1IQLA 3UR9A 1QA7A 1O30A 1TOCB 2GCTB 1D3TB 3A89A 3BTQE 1LPKB 1GCDA 1P02A 1P0SH 4K60A 4X6NA 5DP6A 1QNJA 3SV7A 2OXSA 1Z8JB 1V2WT 3RXLA 9LPRA 1Y5BT 2HNTC 3VB7A 1LVMA 2WUCA 4X0WU 2LNCA 4ZKNU 1G2LA 3E90B 4FVDA 2BMGB 2JKHA 2VIDA 4KELA 2P8OC 4KKDA 3MNCA 1C1VH 5DP7A 1WBGB 4RSPA 1SFQB 5EG4A 1C5YB 5I25A 2BLWA 2VGCC 2A4OA 1ZRBA 1OYTH 4CH8B 3A7ZA 2ZDNA 3G01A 1LHGH 2A32A 1HB0B 2F9NA 5L6NH 4AOQA 1HAXB 2FZZA 1SR5C 1BMLA 2FPZA 1AKSA 3QGJA 3PYHA 3TJVA 5JDUB 1Z1JA 1T8MA 1BMMH 1OWEA 3BTEE 2HLCA 3HGPA 1L2EA 5ESBA 4MTBA 3TITA 5FAHA 4D7FA 4K8BA 1ZJDA 4JZ1A 1BTPA 2AERH 1W14U 4CH2B 2V3OH 1GHVH 1S81A 3SJ8A 1BTUA 1EAXA 1P2JA 1ELCA 4JK5A 1ZJKA 4UD9H 3F9EA 1W3CA 3ZVDA 1BUIA 4A7IB 3DT0H 1S5SA 1QL8A 2ZFSA 1MU6B 2FESH 2F9UA 2F9PA 3L3TA 1TPSA 3I78A 4X2WA 4X8UH 4RKJB 1UTNA 2VB0A 1O2NA 1GI6A 3HATH 1BTWA 4UFDH 1GHAF 2BD5A 3LJOA 2FDAA 1LQDB 3BEFB 2F9OA 2R3YA 5A0CA 2ZU4A 1KLTA 2Y80A 1GBTA 1XVMA 2CHAB 3U8TH 5GJ4B 2FXRA 8GCHF 1HNEE 3U8OH 1F5KU 1O39A 4OS6A 1OSSA 5J4SA 1A3BH 1WOFA 1G36A 1J8AA 3ATIA 3BF6H 4O3UA 2HNTF 2PR3A 2SGEE 4MPXA 4B1TA 3MI4A 1KY9A 1LQEA 1GMCG 2ZG0H 2F91A 2BOKA 1IAUA 2W7UA 2FOAA 1RIWB 1ARCA 5C5NA 1NU7B 4UONA 1XKAC 1QRXA 1RGQA 1TBZH 1GVLA 1NTPA 4ASHA 3F68H 1QB6A 1ZMJA 1TOMH 1YPMH 3GYMA 2NU1E 4TYDA 2M5TA 2GT7A 1UVUH 4ABAA 4YLQH 3LIWA 2XBWA 1C5ZB 3SU4A 1K21H 4KGAA 3MO3A 4FUFA 5L30H 1HAZB 3PWBA 2EC9H 3PM3A 2VIPA 2C4FH 4VGCB 4ESTE 3F6UH 4E7RG 4ZMAH 4INHA 2H6MA 3GY4A 3PTNA 2H5DA 3O8CA 3RU4D 5EPYA 4CBOA 1GDQA 3DA9B 4AG1A 6ESTA 3T25A 2A2XH 1GMDG 2ZFPH 1W11U 1HAOH 3OY6U 3V12A 4E05H 1ZTKA 1FXYA 1V2KT 2BDHA 3HK3B 3U1IB 1GBKA 2OQUA 5IYTA 3ZVEA 2HVXA 3VPKA 2FWWA 1GJBB 2ZC9H 2FOBA 4U30A 3TJUA 2JH0D 5DPAA 3NPSA 3MH4A 4IW4E 1YYY1 3PO1B 4F4OC 3E3TA 6GCHG 2I6SA 5C3NA 1A61H 3KL6A 1EKBB 2HRVA 5K7RA 1GI2A 7LPRA 2NU2E 2IJOB 3ZVCA 1G9IE 1HAGE 1MKXK 2B0FA 1VR1H 1YF4A 1C5LH 1TLDA 1AB9B 1QJ7B 1MKXH 1FY8E 3D62A 3F9GA 1BQYA 2PWXA 1ZTLA 1E0FD 4XE4A 1AVGH 1EP6A 6CHAB 1W13U 2AIPA 3LT3A 1MQ6A 1AVWA 4ABFA 1JXPA 3FZZA 2GV6A 5FX5A 2STBE 1P11E 4Y6DA 2BM2A 2SGAA 1WAYB 1GL0E 3PMAB 3UR6A 1GL1A 3ZZAA 3TNTA 1HCGA 4OGYA 2FM2A 2GMTC 1GMCF 2PGBB 3SJKA 4K1SA 4X8TH 4X6OA 2ZA5A 1SQTA 1B0EA 2BVRH 2A45B 4DG4A 2XBXA 5LPEA 1CBWB 1GBIA 1B5GH 4WMEA 4KP0A 1ESBA 2Y5FA 4WH8A 3MO6A 2XBVA 4NIYA 1J14A 3QWCH 3SORA 1BCUH 4CR5A 1FNIA 5IDKA 1UTKA 1BBRE 1O38A 4Y76A 2G4TA 4LZ4B 1O2WA 3RXDA 1RFNA 1INCA 1GJ4H 4ABDA 1S6HA 2D1JA 2ZPQA 4TY6A 4Y11E 1SQAA 2A2QH 3A80A 4FVBA 3V13A 1NRSH 2BVSH 3ITIA 2CXVA 4KTCA 5EODA 2FLRH 1FONA 1Z8RA 2C8WB 2OBQA 1GHWH 3UNSA 1L4DA 5GCHG 1LKBA 1AFQB 4X2XA 1MKWK 3Q00A 1Y5UT 5FPYA 4BXWA 3T26A 1KXDA 4HFPB 4BAKB 1MKWH 4XBDA 1O5EH 4NWLA 2F9BH 5F8ZA 1QQUA 2ZF0H 5EXNA 1GHYH 3GY8A 1C4V2 1C5QA 3LH1A 4DCDA 4JYVH 2C90B 1XUKA 2SNVA 5F03A 5E2PA 2RA0A 1H9IE 3K9XB 1ACBE 3P70B 1TAWA 1QL9A 6GCHF 6LPRA 3MH5A 1ZLRA 1IQHA 3SU3A 4Q2KA 2PSYA 4XFQA 5EXLA 1E34B 1SGFA 1MTNC 3SQHE 2A4GA 2ZGXH 1P05A 3R0FA 1K1JA 3I77A 1EB1H 3SUGA 1A0HB 2O8WA 3UREA 5B6OA 1L0ZA 4R8TB 1VCQA 1SGTA 4B2BA 2VIQA 1SI5H 1N1LA 2PHBA 1O3IA 4Q7XA 3A84A 3MNXA 5JB9S 3A7XA 4AG2A 1EAWA 2I6QA 1ELTA 1TIOA 1QIXB 2Y5GA 3MMGA 1V2ST 1GVZA 4X6MA 5EPNA 4D9QA 5CHAB 1SLWB 2JETC 3FVFB 2FS9A 4UE7H 2R9PA 2UWOA 1UTQA 1MBQA 1YPJH 3FZDA 2W5EA 1FLEE 4O9VA 1KXAA 2GTBA 1RIWC 2AIQA 3RXVA 1W0YH 2Q6FA 3EGKH 3TK6A 5EU8A 1GJ5H 3R3GB 1W7GH 1EQ9A 3ENSB 4NG9H 2ZEBA 1BRBE 3ZV8A 1UTJA 1WUNH 4ISOA 1DT2A 2F9VA 3VEQB 3RU4T 2B5TB 4CREA 1DSUA 1C2DA 3UNRA 1T31A 4NFEA 4FUBA 4SGAE 1ANEA 2YOLA 5DP4A 1Y5AT 2P94A 3GOVB 1TABE 3QTOH 2CF9H 4E7NA 1LMWB 1FV9A 1FAKH 2Q6GA 3ZZCA 2QV1A 5C1XA 1BOQA 1O2ZA 4JMYA 1O3CA 1O2RA 4ZH8A 1QBVH 1UO6A 1O5BB 3F1SB 2Y81A 1AIXH 3TGJE 4CRBA 5A09A 3FP7E 3A85A 3BIUH 2QF0A 2ANMH 3LC3A 1CGJE 5FHTA 1O3JA 3BTHE 3M61U 1D4PB 2J34A 2TGDA 1TNIA 3GCNA 1LO6A 3RXAA 4KTSA 2BX3A 2BVXH 2Y82A 1F5LA 3GYLB 3DFJA 1GMHG 1F92A 1N6YA 1Z6JH 2HWLB 1THPB 2R3UA 5EOKA 2BD3A 4CHAB 2A5KA 1V2JT 1DPOA 4NIXA 2WPLS 5LPRA 4JZFH 4YOIA 1VZQH 5DP8A 3MU1A 1AUTC 4A1VA 3SJIA 4A1TA 3KQBA 5T6FA 4U01A 2ZTYA 3BTKE 3A8CA 3UTUH 1WQVH 2H1UA 5EW2H 4RN6A 1O0DH 1AO5A 1JRSA 1GG6B 2TGPZ 4OS1A 1ABIH 4GAWA 4ISHH 1CHOG 1FUJA 2BDIA 1K22H 2ZHWH 2Y7ZA 4TPIZ 1SGQE 1ESTA 2P95A 4Y0YE 3PLPA 1DITH 1JMOH 2PFEA 3RXPA 1UCYH 2J4IA 2VVCA 1MU8B 3OYPA 1XKBC 4Y79A 2ODYB 3M5LA 1HJAC 3UFAA 2FOFA 1HJ8A 4XSKU 2ZFQH 1O2QA 1CGIE 3FANA 1D3QB 1V2UT 3T27A 3SV2H 3DFLA 1MTWA 1DY8A 5FCKA 3Q3XA 3K65B 3RLWH 2ZHFH 1N6XA 2FYQA 3LONA 1EPTB 1P10A 4Z0KA 5DGJA 4ZROA 1O2HA 5EW1H 3ODFA 3JZ1B 1PYTC 1A2CH 3RU4E 3F9FA 2KAIB 1AWFH 4Y0ZE 1P2IA 3P8NA 2QGRA 4MPWA 1C9TA 1DSTA 1EX3A 4IMZA 1WU1A 4K2YA 3ZYDA 1ZYOA 1TFXA 1VCWA 1TGNA 3STIA 1FQ3A 2BY7X 1EB2A 2WYGA 5EQQA 2WINI 1A46H 5C2ZA 3RC5A 1ETTH 1HIAB 3SNAA 1FIWA 2UUJB 2AFQB 2XW9A 3ZZ4A 1SGRE 2BD2A 2AGEX 4PROA 1SGNE 4BAHB 4IS5A 3Q3KA 1PPZA 1XUGA 1DX5M 1KTSB 1P04A 1C1PA 4NZQA 2R0KA 1FPCH 1G37A 3I29A 5DKMA 1S6FA 1EZQA 1O3HA 1HBTH 1L1JA 2ZDAH 4NA9H 2IN2A 1GMHF 1GHBG 1AZZA 1CVWH 1DFPA 4H42U 4X2YA 3LU9B 2WV4A 3OSYA 1FY3A 1H1BA 3A83A 4CRAA 1BJVA 3GCHB 1MTVA 3T5FH 3GICB 3D23A 2BX4A 1N8OC 5ESTE 2ANKH 3S9BA 2GCHG 1YLDA 1LHCH 3ATWA 1MMJN 1TA2A 3ZVAA 3SNDA 1K28D 3KQDA 4GCHG 2G5VA 1PQAA 1CHOF 1S83A 2Q6DA 2ZPSA 2AMQA 2BD8A 1C5SA 3H7TA 3ELAH 3PV4A 1TBQH 1GVKB 3TH2H 2C93B 1GDUA 2ZU1A 2ZDKA 3AAVA 1GPZA 1Y3XA 2ALVA 2Z3EA 4X1SU 1ZRKA 3M5MA 3PMJA 4O03A 5EXMA 3ATKA 1T7CA 1KTTB 3L33A 1GBJA 3M36A 5L2ZH 3BTTE 4CRFA 1ZSKA 1JIMA 2PKSB 3TK5A 3M5OA 1FIZA 3ZZ3A 5H4IB 4MPVA 1P2QA 1UVPA 4HZHA 5E8EH 4LZ1H 3LH3A 1C2IA 3SV8A 1SVPA 4MG3A 1RRKA 1ETSH 1CO7E 1NS3A 1EAIA 3A87A 1O3EA 2PLXA 2J9NA 2QC2A 4BNRA 4WH6A 1PQ5A 3EYDA 3U1JB 3OY5U 1DXPA 1EJAA 3QK1A 3SUFA 3GISB 1HJ9A 3KCGH 1PPFE 1H8IH 1DUAA 1NPMA 1AZ8A 1TX7A 1GGDC 3A86A 4KTUA 2W26A 1D9IA 5SGAE 3SNBA 1O2YA 5HYOA 2BQWB 1P9UA 2V35A 3FP8E 4HTCH 1GCTB 1OXGA 3TK9A 2Z9JA 5EQSA 3A7VA 3RM0H 5BPEA 5I46H 5JYIA 1ZPZA 4Y7BA 2H9TH 1C2KA 3RXJA 3SQEE 2Z9LA 5AF9H 1TNKA 2OQ5A 1QBOA 4FUCA 2ZNKH 1AWHB 1MCTA 2G00A 1K1MA 1F5RA 5EQRA 4ABJA 5F6MA 1A0JA 1O2KA 2GDEH 4ZXYH 2ANYA 5F8TA 1SGIB 2ZHQH 3BSQA 4MNXA 1UVSH 2OC1A 3SHAH 4XBBA 4AX9H 2GCHF 4OS5A 2Z7FE 4LOYH 2FO9A 3ATLA 1RTKA 3QGNB 4CHAC 4B76A 4I8KA 4ABIA 3QO6A 2XYAA 1G32B 1QB9A 1AKSB 2V0BA 2V6NA 3SO3A 1SB1H 2ZCKP 1NN6A 2BOHB 3S7KB 3GY6A 1LHDH 1MTUA 1AGJA 1J16A 1OX1A 1GBBA 3A7TA 3LGUA 1O2IA 2JH5D 1WCZA 1C5VA 1SG8B 2FEQH 2OBOA 5FBIA 3FP6E 3T28A 1VITG 1ETRH 5HM9A 3TH3H 3UWJH 3LGIA 3M35A 1QFKH 1C4U2 3RM2H 1S84A 2QXIA 1F0TA 3UY9A 3UOPA 2QF3A 4FXGH 1HAIH 1L1NA 3RXOA 1GI5A 5L2YH 2ZFRH 4THNH 4IN1A 4WXIA 3ZZ6A 4NA7A 7KMEH 1TBRH 2TGTA 1LVOA 5HXFA 1Z8IB 3GY7A 5TCCA 5AVDA 3RMMH 2ZP0H 1O2PA 2CN0H 1Z6EA 1T8NA 1E35B 3TPIZ 2PTCE 3UOUA 5BRRE 1IQNA 1C2GA 3ZVBA 2P16A 2ZGHA 2FODA 3SBKA 2VWOA 1LPGB 1BZXE 4AB8A 2ZFTA 1OP8A 1G30B 1VJ9U 1LPZB 2SGQE 1CA0B 2RG3A 3TIUA 1GHXH 2ZU2A 2WYJA 2WPMS 2AEIH 4WF8A 1EOLA 1TYNA 2G52A 1IHSH 3RXCA 3OTJE 4YOGA 4FU7A 3F9HA 1KLIH 1C2LA 4BAOB 1UK4A 1K1IA 2IOTA 4CRDA 1VGCB 2XXLA 4TWYA 1SMFE 3PMHB 4X2VA 1ZHMA 1P09A 1NFUA 1V2VT 1L1GA 1HV7A 5DO4H 1F7ZA 3TGKE 1ANBA 1MBMA 3RDZA 3RLYH 1TONA 1G3EA 1CSOE 1DICA 2THFB 3P6ZB 1YCPK 1O3OA 1YCPH 4U32A 1DLEA 1ELAA 5A0BA 5C5OA 1EASA 5FPSA 3ZVFA 1JWTA 3SUEA 5EGMA 2FTMA 1XVOA 2GGVB 3GY5A 1TWXB 1EP5A 2BQ6B 1NRPH 1QJ6B 4IBLH 1BHXB 2VWLA 1UJ1A 5CMXH 2QXJA 1TA6A 1C5PA 1K9OE 1GI3A 4SGBE 2VH0A 2BY6X 1GJ7B 5GWZA 3RXBA 2Y7XA 3SZNA 2GCTC 1O2MA 1KSNA 1O5AB 3KQCA 4A1XA 4MQAA 1GBAA 5AFZH 5LGOA 1DOJA 4D7GA 4DY7B 1HRTH 2AGIX 1KXCA 1NESE 4U2WA 1BA8B 1LCYA 1O31A 1BT7A 2FOHA 4GPGA 1QURH 1A5GH 1K1PA 1AMHA 1KIGH 3E0PB 1DWDH 2NU0E 1A4WH 1ELVA 2A0QB 2XC5A 4FUGA 2HPQH 1ZGIA 1O3GA 2R2WU 4MNYA 1EZUC 1GBCA 3LKWA 2GZ7A 3HGNA 3GCOA 1GMDF 2C8XB 1O32A 3BTWE 2PW8H 3RXSA 5E0JA 2OUAA 1OWHA 1SGCA 1TE0A 3QLPH 3LC5A 2Z3DA 3PTBA 4MDSA 1O2GH 1SOTA 3SN8A 5C1UA 3WY8A 3SU0A 1C1TA 1T4UH 5AHGH 3SUDA 2Z9GA 4Y8ZA 1SLVB 4ABBA 4NGAH 3CS7A 4I8HA 1ELGA 1TMBH 1SHHB 1ZR0A 4XBCA 2ZECA 1GJCB 1GBLA 1GI7B 1ZTJA 1O5DH 3SI4H 4A5TS 1O2XA 4BAQB 1S0RA 3RP2A 2BTCE 2FLBH 1E37B 2WPKS 2BD4A 2BB4A 3MO9A 1PPHE 3BG4B 1Q3XA 1MAXA 2CHAC 4MPUA 2H9HA 3ZZ9A 1V2LT 2A5AA 3RXFA 1G3BA 3C1KA 1BRCE 2ZGCA 1YKTA 3SW2B 4GLYA 5JPMH 1SPJA 1TNGA 1XXFA 2FMJA 3QZQA 5JBCS 2GZ8A 4AFSA 3TU7H 3SGBE 2FS8A 3A81A 3RXMA 1V2MT 3BTDE 2BDYA 1IQMA 2EEKA 5C1YA 4B74A 1HAPH 2OC7A 3TH4H 1Q2WA 2ILNA 1PQ8A 2ULLA 2P8OB 1KDQB 3URCA 1YM0A 4TWWA 1ELEE 1FN6A 3U8RH 1DWBH 1BTXA 1BJUA 2BDCA 2WV5A 1MQ5A 1GBMA 4ZKOU 4J2YB 4IGDA 2ASUB 3M37A 1Y3VA 3IWMA 1BTYA 1HGTH 3VB5A 1YBWA 3UPEA 5GXPA 3TGIE 2ZI2H 2WPIS 5GCHF 3VFEA 4WXVA 5FXLA 1EZSC 1TPOA 3D49H 2RA3A 1OS8A 1D3DB 4OS2A 3UIRA 1A7SA 3PMBB 1HAVB 1MUEB 1K1NA 1NC6A 1CT0E 1ZMLA 4VGCC 3O8DA 1TGBA 5AFYH 1QB1A 2FI5E 2FX6A 2XNIA 1SGEE 4IC6A 3S0NA 3P92A 5GPIB 2AMPA 2ZPRA 1C2MA 2WUBA 1C1RA 1DY9A 2ZTXA 4K5ZA 3MU8A 1IQJA 2F83A 2HALA 3BTGE 3VB3A 3LGVA 3S69A 1XX9A 2TRMA 1CA0C 3GDVA 3RMLH 4MLFB 3RXGA 1ID5H 1WYKA 2PSXA 2OD3B 2Z9IA 3A8AA 3PO1C 2GDDA 4AB9A 8ESTE 2QA9E 3SU5A 1YC0A 3QZRA 2PV9B 1BTHH 3A88A 3A8BA 3BTME 1EPTA 1Z71A 3RC6A 4Y7AA 1H4WA 3BEUA 1V6DA 5K0HA 1HDTH 1VGCC 1AB9C 2XCNA 2BXTH 2KAIA 4Y8XA 1ZPBA 3CP7A 1W12U 4B75A 3DUXH 3SGAE 4A92A 1M9UA 2G5NA 9ESTA 3W95A 1MCVA 6CHAC 2Z6BD 2XWAA 1O35A 1UCYK 2G51A 1L4ZA 1C2EA 4GHQA 1ZOMA 4B71A 1DE7H 3QUMP 1T4VH 2HOBA 3K6ZA 4D8NA 4BTIB 3W94A 1O3MA 1LVBA 4AFQA 2FOMB 4NIWA 1Y3WA 2PKAB 1GJAB 3MHWU 5E0HA 3SNEA 1C2JA 2OP9A 5PTPA 3TJOA 1YLCA 3GY2A 4JZEH 1CBWC 3AW1A 2J94A 2ZKSA 2ZHDA 5HGGA 1GJ6A 2OC0A 1DXWA 4B73A 1XUJA 3U98H 2CV3A 4FUDA 2VIOA 1H9LB 5GIBA 1LHFH 3BEIB 2A4RA 2FX4A 2F3CE 3B9FH 4I8JA 1DWEH 4I7YH 2EI6A 4GVUA 1LVYA 3MU5A 1C5WB 4YTAA 5A8XA 4YOJA 1KXBA 3L6PA 3SI3H 1DUEA 4BTTB 2CGAA 4Q7YA 1ELFA 1C1WH 1O2TA 2BY5X 1QJ1B 4BTUB 2STAE 4E06H 1AHTH 3RXHA 3T2NA 3DHKH 2G55A 3SV6A 1AFQC 3ESTA 1GI9B 4AZ2B 1LHEH 1XXDA 3T62A 1GBDA 1CHGA 1F0SA 1OPHB 4ZUHA 3IITA 1GI1A 2FIRH 1O2VA 4R0IA 1C5XB 5FBEA 3U9AH 2SFAA 3ZVGA 1QRZA 5FX6A 2QYIA 5DP9A 2GT8A 3K6YA 1UTLM 4YM9A 3SNCA 2UUKB 1SQOA 2BLQA 1F2SE 4MNWA 1Z8GA 1FAXA 3NKKA 4JZIA 1NRNH 1NT1A 2GKVE 4CRCA 3V3MA 4D9RA 4YT7H 4Z6AH 4UFGH 1GJ8B 1OWJA 3C27B 1O3DA 4K3JA 1TQ0B 3UQOA 1YPEH 2TBSA 3H5CB 1LKAA 3HK6B 1F0RA 2OINA 3LGTA 3O8BA 3PLKA 2EI8A 1V2RT 1MH0A 4DW2U 2G81E 4OS7A 2GMTB 1O2SA 1SLXB 3RXRA 1UVOA 3LPRA 1P57B 5JBBS 5JBAS 2P3UB 4QT8C 1C5UA 4CBNA 4INLA 3N7OA 2ZHEH 1O5GH 1WV7H 5ABWA 1SLUB 5E2OA 1UTMA 5CHAC 3RXUA 1C1UH 1NROH 3BN9A 5DP5A 4Y10E 3LJJA 4AORA 1NY22 2BYAX 3PROA 3S9AA 2OLGA 3T29A 3RMNH 1J15A 3DD2H 2BY9X 4JYUH 1THSH 1C4Y2 1V2PT 3TLOA 3UUZA 1TQ7B 4JCNA 1QGFA 5A2MH 1O3LA 3E91A 1SGFG 1Y3YA 3ZZ5A 3VXFH 3ZZ8A 1P3EA 1BRAA 3A7WA 2XRCA 2H9EH 4X1PU 4RKOB 4ISNA 1MD7A 1A5IA 1TRYA 3UNQA 2Y6TA 1H8DH 2BXUH 3GY3A 4YO9A 1UHBB 1GBEA 1OP2A 3LOXA 2VINA 1GDNA 3M7TA 2AS9A 1D6RA 1TRMA 2EI7A 3RMOH 4DGJA 2ZQ1A 4HI3A 4ABGA 1V2NT 1C1MA 1G3CA 2D26C 2ZIQH 4ISLA 4UDWH 2Z94A 2R0LA 1LTOA 1PQ7A 1SHYA 1C5TA 1O3NA 1V2QT 2DE8A 3Q77A 1MTNB 1FI8A 3URDA 1SSXA 2XC4A 4DURA 3TJNA 1JBUH 1PPBH 2A31A 1A3EH 2BLOA 1UK3A 2G4UA 3Q3YA 1GHBF 3EA9A 3KNXA 4FU9A 2QN5T 1UVTH 1TNJA 1C2FA 1VCPA 4AYVB 1IQKA 3FFGA 5T6GA 1ARBA 4FUJA 4AFUA 4WWYA 4YZUA 5DK1A 2ZDVH 4GHTA 3TVJB 1DDJA 2B9LA 1QBNA 1SC8U 1NFYA 1OP0A 2K1QA 3AVZA 2OCVB 1TPPA 2BLVA 8KME2 4IC5A 1DVAH 1Y3UA 2O8UA 4GCHF 3B23B 1C5MD 1AQ7A 2ZO3H 1JRTA 1H9HE 1EUFA 2JETB 1QCPA 1XM1A 1YP9A 5J4QA 5C20A 5JBTA 3QTVH 4WMFA 1HAYB 4BAMB 3BG8A 1HPGA 2P59A 2O9QA 1GG6C 3U69H 2OC8A 1E36B 3P8GA 2YNAA 2FTLE 2WPJS 1MD8A 2SNWA 4GSOA 1TGSZ 5HMAA 3VB6A 1TALA 1ZPCA 4CR9A 1ZHRA 1PFXC 3ZZBA 3AAUA 1UK2A 1C5NH 3OU0A 4HGCA 4Q7ZA 1FY1A 5DJ7A 4OS4A 2VIWA 1IHTH 2C8YB 1A0LA 1O2OA 5GDSH 1O37A 2A7CA 1ELBA 2XWBI 1QQ4A 2W3IA 1AVXA 1NM6A 3P17H 5CE1A 2FYRA 4O3TA 1EPTC 4NSYA 4X1QU 2BDBA 2XCFA 3MTYA 2A7JA 1BITA 5A8YA 3BTFE 1TNHA 1CQQA 2ZWLH 1GI8B 4FU8A 2PUQH 2B7DH 1O2JA 1SGDE 1TGCA 1ZSLA 3PLBA 1ABJH 1O3KA 2ZZUH 1FZZA 4I8GA 4ZXXH 1DS2E 1O5FH 2VVVA 2QIQA 1NRRH 1P8VC 4LXBH 4ABEA 1P03A 1TMUH 1ZMNA 2ZCHP 3M7QA 4O97A 2EA3A 2GVFA 3P8FA 4ZHAA 4BXSA 1P12E 1C5RA 1QHRB 3HKIB 3SGQE 2GZ9A 1GBFA 3E8LA 2DE9A 2GX4A 2QAAA 3LGWA 2UUYA 2PUXB 1YGCH 1CU1A 1SFIA 2UWLA 4Y8YA 1AU8A 4X8VH 2AH4X 3BV9B 3NZIA 3AASA 4ZKSU 3M3TA 2AYWA 1YPLH 4I31A 2VH6A 2CF8H 3CENA 1HAHH 2H5CA 3NK8A 3A7YA 3GCTG 2O8TA 1G2MA 3EAJA 1PJPA 1D6WA 3SU1A 1RXPA 3M3SA 3MH7A 2Z9KA 3GCHC 1P3CA 2AMDA 1C1QA 1SGPE 7GCHG 1X7AC 1W2KH 5E0GA 2P3FH 1KXEA 1FY4A 1BBRK 1YPHE 1P2KA 1P01A 2VNTA
chains in the Genus database with same CATH superfamily
1HJAB 1NO9H 1BBRH 2YNBA 3SU2A 4UEHH 2XTTB 1HFDA 1OYQA 2UWPA 3FAOA 4NCYA 1QRWA 4XDEA 5JB8S 1XMNB 2BQ7B 2GD4B 3SOSA 1AFEH 2XC0A 1VITF 4I86A 1ORFA 3RXQA 1DANH 1KLJH 1WDIA 2V3HH 1S82A 1W0JD 1CT4E 1O3PB 4BOHA 2YMSD 4IN2A 3KIDU 3SJ9A 3UWIA 2Z3CA 1TGTA 3M5NA 3NUMA 7ESTE 2HNTE 2VWMA 4F49A 4K69A 1W10U 2PKSC 4I32A 4UFFH 1IQGA 1TX8A 3KHVA 1FN8A 3M7UA 2Q1JA 3D65E 2CMYA 2O8LA 2FI3E 3P8OA 4ZAEA 3PV5A 3VGCB 2DUCA 1GI4A 3ZYEA 1TMTH 3QX5H 5F8XA 1XUHA 3STJA 1T8LA 1YPGH 4AFZA 1XUIA 4FUHA 4OM9A 1HUTH 4JK6A 5A8ZA 1P2MA 4MNVA 3MNBA 4X6PA 4AGKA 1UTPA 2ZDMA 1NU9A 1ANDA 1RTLA 5KEDA 1TPAE 1NRQH 2ANWA 3A8DA 1Y59T 3NWUA 2BDGA 4X1RU 1Z7KA 4FUEA 1GHZA 3UQVA 3EE0B 3LDXH 1KDQA 1Y8TA 3JZ2B 3M3VA 3UAIC 5C17A 1GI0A 1GCTC 4MVNA 4B2AA 4ZCNA 2FOGA 3SJOA 2ZU3A 2A7HA 1UMAH 2BD7A 4TPYA 1C1NA 1QL7A 2J5UA 4BANB 1FDPA 2Y5HA 2VU8E 2NWNA 5C67A 3KEEA 1N8OB 3O8RA 1KYNA 4NA8A 1RTFB 3EA8A 1O3AA 3GCTF 1ZSJA 4WJG2 1BTZA 1T32A 3MFJA 3NXPA 1B0FA 2SGPE 1DM4B 3SU6A 4M9FA 1T8OA 2TPIZ 2QCYA 3KF2A 3BIVH 3F0PA 4DOQA 2QY0B 1QA0A 7GCHF 1CT2E 2RCEA 5LH8A 1TX6A 1W8BH 2WPHS 1HAVA 4ACAA 4DT7B 1NFWA 1NFXA 1P06A 4YESB 5FPTA 1BB0B 4CRGA 2ALPA 1FMGA 2VIVA 2HPPH 1KXFA 5F53A 2SGFE 1DWCH 3KGPA 1GJ9B 1YWUA 2R2MB 2FOCA 1XUFA 3E16B 1SL3A 4YT6H 1YCPM 2TIOA 2W3KA 3RUOA 1O2UA 1EOJA 1OWKA 2VGCB 4WVPE 4INKA 5HM2A 2J92A 1P9SA 1V3XA 2ZDLA 3TNSA 1K0HA 1FJSA 1EZXC 1WSSH 2LPRA 3K2UA 1AY6H 2ODPA 1YY3A 4K1TA 1IOEA 2FI4E 1ZHPA 4Y71A 1VITH 2C8ZB 2J2UA 4ISIH 1FY5A 1Z1IA 3MH6A 2FP7B 4H6SB 1K1OA 1C1OA 3KQEA 1S85A 2PTNA 2SGDE 1EJMA 3MQKC 1WTGH 1O3BA 3MYWA 2C3SA 3PRDA 1GGDB 5DG6A 3E0NB 4HG6A 4UFEH 1B7XB 2AGGX 4FOUC 3RXEA 3RXKA 1W0ZU 4RI0A 1GJDB 8LPRA 3RXTA 2QXGA 2G8TA 1OWIA 1CGHA 1Q31A 1TNLA 1AI8H 1BRUP 1EATA 4ABHA 1RS0A 2A4QA 2CJIA 4WY3A 1BIOA 4OGXA 1O36A 4D76A 1RD3B 2JH6D 4DJZB 4NWKA 2B8OH 1CA8B 5TCAA 2ZCLP 1HLTH 4Q80A 5FCRA 1PYTD 3ZV9A 4M7GA 3EA7A 1ELDE 2PKAA 1O5CB 1ZZZA 2LP6A 3A82A 1OOKB 2PGQB 1S0QA 4K1EA 1HXEH 4B2CA 2VJ1A 1MZDA 1O34A 2P3TB 2QXHA 4K8YA 2D8WA 1G3DA 3S9CA 1E1QD 2ZFFH 2OTVA 5LPFA 1EAUA 1C2HA 1E38B 3SHCH 1PPGE 2GP9B 1OKXA 4LK4A 1H8ED 2W7SA 4JYTA 3S7HB 2ZTZA 1BDAA 2ZGJA 3NCLA 1BMAA 1JIRA 1EXFA 4DIHH 1MAYA 1O3FA 3RXIA 3MU0A 2GV7A 3CS0A 2ODQA 5T1VA 1IQIA 3H7OA 1C9PA 2BZAA 3EQ0H 3CNRA 2A5IA 2ZQ2A 1HIAA 3MNSA 3B8JA 1WTHD 5T6DA 1TRNA 1VJAU 1THRH 3MWIU 2TGAA 1GBHA 1NZQH 4A6LA 3WWFA 1O33A 3AW0A 3HPTB 1A5HA 2BD9A 2ZU5A 5TJXA 2P93A 5A0AE 1U6QA 1JOUB 3MOCA 4I8LA 4AYYB 1HYLA 1AUJA 4YLUA 1P2NA 4ZHMU 4DVAU 1S6LA 2L6OA 3ATMA 3SV9A 3HKJB 1ZGVA 3MU4A 3ODDA 5T3HA 5ETXA 1UCYE 1O2LA 2HGTH 1C1SA 1RJXB 1LDTT 4AC9A 4JZDH 1SBWA 4J1YA 2FOEA 1A1RA 1PPCE 3OEED 1TB6H 3QN7A 1YPKH 3FOAA 3OX7U 3ZZDA 3PB1E 4X1NU 5C94A 3E1XB 4XOJA 4ZKRU 1OHHD 2BY8X 3DCLA 4I33A 2J95A 3RC4A 1J17T 3E6PH 2XBYA 3F2GA 1ANCA 4NFFA 1PPEE 4FUIA 3GDSA 1MTSA 3IG6B 2A1DB 3FO8D 4DIIH 2NU3E 1F0UA 1W7XH 4IMQA 1DLKB 1K1LA 1GWAA 1C5OH 3VGCC 1J9CH 5G4BA 1EJNA 3GDUA 2O8MA 1V2TT 1SOZA 1HXFH 1IQEA 1P2OA 2IPHA 3VB4A 3P95A 2BDAA 1AE8H 5GNDA 1FPHH 4TY7A 1WQSA 1QY6A 3QDZB 3NRLA 1QTFA 4H4FA 2UUFB 1BMNH 2H2ZA 5DP3A 2ESTE 2ZGBH 1GHAG 4X8SH 2VWNA 3LGYA 1MZAA 2VVUA 4NSVA 2J38A 3ZZ7A 2NU4E 1D3PB 3PWCA 4NIVA 4WMDA 3EDXB 1YPHC 1AE5A 3VXEH 2BHGA 3V7TA 3KN2A 4GUXA 4ZHLU 4AGJA 3Q76A 4NZLA 5EJZA 4H6TA 4AN7A 2BZ6H 1IQFA 3V0XA 1AN1E 1UTOA 8GCHG 1BHXF 2D2DA 1K2I1 1QR3E 2RDLA 3N7DA 1ESAA 1AD8H 1CE5A 1UHBA 1V2OT 1OWDA 3BG4C 1SGYE 1IQLA 3UR9A 1QA7A 4B6EA 1O30A 1TOCB 2GCTB 1D3TB 3A89A 3BTQE 3F2HA 1LPKB 1GCDA 1P02A 1P0SH 1SQRA 4K60A 4X6NA 5DP6A 1QNJA 3SV7A 2OXSA 1Z8JB 1V2WT 3RXLA 9LPRA 1Y5BT 2HNTC 3VB7A 1LVMA 2WUCA 4X0WU 2LNCA 4ZKNU 1G2LA 3E90B 4FVDA 2BMGB 2JKHA 2VIDA 4KELA 2P8OC 4KKDA 3MNCA 1C1VH 5DP7A 1WBGB 4RSPA 1SFQB 5EG4A 1C5YB 5I25A 2BLWA 2VGCC 2A4OA 1ZRBA 1OYTH 4CH8B 3A7ZA 2ZDNA 3G01A 1LHGH 2A32A 1HB0B 3F3BA 2F9NA 5L6NH 4AOQA 1HAXB 3AK5A 2FZZA 1SR5C 1BMLA 2FPZA 1AKSA 3QGJA 3PYHA 3TJVA 5JDUB 1Z1JA 4RT0A 1T8MA 1BMMH 1OWEA 3BTEE 2HLCA 4P00A 3HGPA 1L2EA 1SKYE 5ESBA 4MTBA 3TITA 5FAHA 4D7FA 4K8BA 1ZJDA 4JZ1A 1BTPA 2AERH 1W14U 4CH2B 2V3OH 1GHVH 1S81A 3SJ8A 1BTUA 1EAXA 1P2JA 1ELCA 3OFND 4JK5A 1ZJKA 4UD9H 1FX0B 3F9EA 1W3CA 3ZVDA 1BUIA 2QF5A 4A7IB 3OAAD 3DT0H 1S5SA 1QL8A 2ZFSA 1MU6B 2FESH 2F9UA 2F9PA 3L3TA 1TPSA 3I78A 4X2WA 4X8UH 4RKJB 1UTNA 2VB0A 1O2NA 1GI6A 3HATH 1BTWA 4UFDH 1GHAF 2BD5A 3LJOA 2FDAA 1LQDB 3BEFB 2F9OA 2R3YA 5A0CA 2ZU4A 1KLTA 2Y80A 1GBTA 1XVMA 2CHAB 3U8TH 1VKYA 2FXRA 5GJ4B 8GCHF 1HNEE 3U8OH 1F5KU 1O39A 4OS6A 1OSSA 5J4SA 5CDFE 1A3BH 1WOFA 1G36A 1J8AA 3ATIA 3BF6H 4O3UA 2HNTF 2PR3A 2SGEE 4MPXA 4B1TA 3MI4A 1KY9A 1LQEA 1GMCG 2ZG0H 2F91A 2BOKA 1IAUA 2W7UA 2FOAA 1RIWB 1ARCA 5C5NA 1NU7B 2CK3D 4UONA 1XKAC 1QRXA 1RGQA 1TBZH 1GVLA 1NTPA 3DSPA 4ASHA 3F68H 1QB6A 1ZMJA 1TOMH 1YPMH 3GYMA 2NU1E 4TYDA 3F2FA 3OE7D 2M5TA 2GT7A 1UVUH 4ABAA 4YLQH 3LIWA 2XBWA 1C5ZB 3SU4A 1K21H 4KGAA 3MO3A 4FUFA 5L30H 1HAZB 3PWBA 2EC9H 3PM3A 2VIPA 2C4FH 4VGCB 4ESTE 3F6UH 4E7RG 5FL7D 4ZMAH 4INHA 2H6MA 2V7QD 3GY4A 3PTNA 2H5DA 3O8CA 3RU4D 5EPYA 4CBOA 1GDQA 3DA9B 4AG1A 6ESTA 3T25A 2A2XH 2KFWA 1GMDG 2ZFPH 1W11U 1HAOH 3OY6U 3V12A 4E05H 1ZTKA 1FXYA 1V2KT 2BDHA 3HK3B 3U1IB 1GBKA 2OQUA 5IYTA 3ZVEA 5HKKD 2HVXA 3VPKA 2FWWA 1GJBB 2ZC9H 2FOBA 4U30A 3TJUA 2JH0D 5DPAA 3U28C 3NPSA 3MH4A 4IW4E 1YYY1 3PO1B 3DSOA 3E3TA 4F4OC 6GCHG 2I6SA 5C3NA 1A61H 3KL6A 1EFRD 1EKBB 2HRVA 1GI2A 5K7RA 7LPRA 2NU2E 2IJOB 3ZVCA 1G9IE 1HAGE 1MKXK 2B0FA 1VR1H 1YF4A 1C5LH 1TLDA 1AB9B 1QJ7B 1MKXH 1FY8E 3D62A 3F9GA 1BQYA 2PWXA 1ZTLA 1E0FD 4XE4A 1AVGH 1EP6A 6CHAB 1W13U 2AIPA 3LT3A 1MQ6A 1AVWA 4ABFA 1JXPA 3FZZA 2GV6A 5FX5A 2STBE 1P11E 4Y6DA 2BM2A 2SGAA 1WAYB 1GL0E 3PMAB 3UR6A 1GL1A 3ZZAA 3TNTA 1HCGA 4OGYA 1E1RD 2FM2A 2GMTC 1GMCF 2PGBB 3SJKA 2RFKC 4K1SA 4X8TH 4X6OA 2ZA5A 1SQTA 1B0EA 2BVRH 2A45B 4DG4A 3WW7A 2XBXA 5LPEA 1CBWB 1GBIA 1B5GH 4WMEA 4KP0A 1ESBA 2Y5FA 4WH8A 3MO6A 2F4LA 2XBVA 3WWBA 4NIYA 1J14A 3QWCH 3SORA 1BCUH 4CR5A 1FNIA 5IDKA 1UTKA 2KCYA 1BBRE 1O38A 4Y76A 2G4TA 4LZ4B 1O2WA 3OTPA 3RXDA 1RFNA 1INCA 1GJ4H 4ABDA 1S6HA 2D1JA 2ZPQA 4TY6A 4Y11E 1SQAA 2A2QH 3A80A 4FVBA 3V13A 1NRSH 2BVSH 3ITIA 2CXVA 4KTCA 5EODA 2FLRH 1FONA 1Z8RA 2C8WB 2OBQA 1GHWH 3UNSA 1L4DA 5GCHG 1LKBA 1AFQB 4X2XA 1MKWK 3Q00A 1Y5UT 5FPYA 4BXWA 3T26A 1KXDA 4HFPB 4BAKB 1MKWH 4XBDA 1O5EH 4NWLA 2F9BH 5F8ZA 1QQUA 2ZF0H 5EXNA 1GHYH 3GY8A 1C4V2 1C5QA 3LH1A 4DCDA 4JYVH 2C90B 3OEHD 1XUKA 2SNVA 5F03A 5E2PA 2RA0A 1H9IE 3K9XB 1ACBE 3P70B 1TAWA 1QL9A 6GCHF 6LPRA 3MH5A 1ZLRA 1IQHA 3SU3A 4Q2KA 2PSYA 4XFQA 5EXLA 1E34B 1SGFA 1MTNC 3SQHE 2A4GA 2ZGXH 1P05A 3R0FA 1K1JA 3I77A 1EB1H 3SUGA 1A0HB 2O8WA 3UREA 5B6OA 1L0ZA 4R8TB 1VCQA 1SGTA 4B2BA 2VIQA 1SI5H 1N1LA 2PHBA 1O3IA 1NBME 3EE7A 4Q7XA 5EJLA 2WSSD 3A84A 3MNXA 5JB9S 2YMSC 3A7XA 4AG2A 1EAWA 2I6QA 1ELTA 1TIOA 1QIXB 2Y5GA 3MMGA 1V2ST 1GVZA 4X6MA 5EPNA 4D9QA 5CHAB 2WHXA 1SLWB 2JETC 3FVFB 2FS9A 4UE7H 4B6FA 2R9PA 2UWOA 1UTQA 1MBQA 1YPJH 3FZDA 2W5EA 1FLEE 2HVYB 4O9VA 1KXAA 2GTBA 1RIWC 2AIQA 3RXVA 1W0YH 2Q6FA 3EGKH 3TK6A 5EU8A 1GJ5H 3R3GB 1W7GH 1EQ9A 3ENSB 4NG9H 2ZEBA 1BRBE 3ZV8A 1UTJA 1WUNH 4ISOA 1DT2A 2F9VA 3VEQB 3RU4T 2B5TB 4CREA 1DSUA 1C2DA 3UNRA 1T31A 4NFEA 4FUBA 4SGAE 1ANEA 2YOLA 5DP4A 1Y5AT 2P94A 3GOVB 1TABE 3QTOH 2CF9H 5B6LA 4E7NA 1LMWB 1FV9A 1FAKH 2Q6GA 3ZZCA 2QV1A 4F55A 5C1XA 1BOQA 1O2ZA 4JMYA 1O3CA 1O2RA 4ZH8A 1QBVH 1UO6A 1O5BB 3F1SB 2Y81A 1AIXH 3TGJE 4CRBA 5A09A 3FP7E 4TSFD 3A85A 3BIUH 2QF0A 2ANMH 3LC3A 1CGJE 3N99A 5FHTA 1O3JA 3BTHE 3M61U 1D4PB 2J34A 2TGDA 1TNIA 3GCNA 2WZQA 1LO6A 3RXAA 4KTSA 2BX3A 5C0TA 2BVXH 2Y82A 1F5LA 3GYLB 3DFJA 1GMHG 1F92A 1N6YA 1Z6JH 2HWLB 1THPB 2R3UA 5EOKA 2BD3A 4CHAB 2A5KA 1V2JT 1DPOA 4NIXA 2WPLS 3PRBA 5LPRA 4JZFH 4YOIA 1VZQH 5DP8A 3MU1A 1AUTC 4A1VA 3SJIA 4A1TA 3KQBA 5T6FA 4U01A 2ZTYA 3BTKE 3A8CA 3UTUH 1WQVH 2H1UA 5EW2H 4RN6A 1O0DH 1AO5A 1JRSA 1GG6B 2TGPZ 4OS1A 1ABIH 4GAWA 4ISHH 1CHOG 1FUJA 2BDIA 1K22H 2ZHWH 2Y7ZA 4TPIZ 1SGQE 1ESTA 2P95A 4Y0YE 3PLPA 1DITH 1JMOH 2PFEA 3RXPA 1UCYH 2J4IA 2VVCA 1MU8B 3OYPA 1XKBC 4Y79A 2ODYB 3M5LA 1HJAC 2KCOA 2QE7D 3UFAA 2FOFA 1HJ8A 4XSKU 2ZFQH 2OK5A 1O2QA 1CGIE 3FANA 1D3QB 1V2UT 3T27A 3SV2H 3DFLA 1MTWA 1DY8A 5FCKA 3Q3XA 3K65B 3RLWH 2ZHFH 1N6XA 2FYQA 3LONA 1EPTB 1P10A 4Z0KA 5DGJA 4ZROA 1O2HA 5EW1H 3ODFA 3JZ1B 1PYTC 1A2CH 3RU4E 3F9FA 2KAIB 1AWFH 4Y0ZE 1P2IA 3P8NA 2QGRA 4MPWA 1C9TA 1DSTA 1EX3A 4IMZA 1WU1A 4K2YA 3ZYDA 1ZYOA 1TFXA 1VCWA 1TGNA 3STIA 1FQ3A 4YXWD 2BY7X 1EB2A 2WYGA 5EQQA 2WINI 1A46H 5C2ZA 3RC5A 1ETTH 1HIAB 3SNAA 1FIWA 2UUJB 2AFQB 2XW9A 3ZZ4A 2WPDD 1SGRE 2BD2A 1UW7A 2AGEX 4PROA 1SGNE 4BAHB 4IS5A 3Q3KA 1PPZA 1XUGA 1DX5M 1KTSB 1P04A 1C1PA 4NZQA 2R0KA 1FPCH 1G37A 3I29A 5DKMA 1S6FA 2WV9A 1EZQA 1O3HA 1HBTH 1L1JA 2ZDAH 4NA9H 2IN2A 1GMHF 1GHBG 1AZZA 1CVWH 1DFPA 4H42U 4X2YA 3LU9B 2WV4A 3OSYA 2V3MA 1FY3A 1H1BA 3A83A 4CRAA 1BJVA 4Q4LA 3GCHB 1MTVA 3T5FH 3GICB 1MABB 3D23A 2BX4A 1N8OC 5ESTE 2ANKH 3S9BA 2GCHG 1YLDA 2J97A 1LHCH 3ATWA 1MMJN 1TA2A 3ZVAA 3SNDA 1K28D 3KQDA 4GCHG 1NBMD 2G5VA 1PQAA 1CHOF 1S83A 2Q6DA 2ZPSA 2AMQA 2BD8A 1C5SA 3H7TA 3ELAH 3PV4A 1TBQH 1GVKB 3TH2H 2C93B 1GDUA 2ZU1A 2ZDKA 3KYFA 3AAVA 1GPZA 1Y3XA 2ALVA 2Z3EA 4X1SU 1ZRKA 2W6JD 3M5MA 3PMJA 4O03A 5EXMA 3ATKA 1T7CA 1KTTB 3L33A 1GBJA 3M36A 5L2ZH 3BTTE 4CRFA 1ZSKA 1JIMA 2PKSB 3TK5A 3M5OA 1FIZA 3ZZ3A 5H4IB 4MPVA 1P2QA 1UVPA 4HZHA 5E8EH 4LZ1H 3LH3A 1C2IA 3SV8A 1SVPA 4MG3A 1RRKA 1ETSH 1CO7E 1NS3A 1EAIA 3A87A 1O3EA 2PLXA 2J9NA 2KCPA 2J98A 2QC2A 4BNRA 4WH6A 1PQ5A 3EYDA 3U1JB 2XNDD 3OY5U 1DXPA 1EJAA 3QK1A 3SUFA 3GISB 1HJ9A 3KYGA 3KCGH 1PPFE 1H8IH 1DUAA 1NPMA 1AZ8A 1TX7A 1GGDC 3A86A 4KTUA 2W26A 1D9IA 5SGAE 3SNBA 3SZEA 1O2YA 5HYOA 2BQWB 1P9UA 2V35A 3FP8E 4HTCH 1GCTB 1OXGA 3TK9A 2Z9JA 5EQSA 3A7VA 3RM0H 5BPEA 5I46H 5JYIA 1ZPZA 4Y7BA 2H9TH 4F48B 1C2KA 3RXJA 3SQEE 2Z9LA 5AF9H 1TNKA 2OQ5A 1QBOA 4FUCA 2ZNKH 1AWHB 1MCTA 2G00A 1K1MA 1F5RA 5EQRA 4ABJA 5F6MA 1A0JA 1O2KA 2GDEH 4ZXYH 2ANYA 5F8TA 1SGIB 2ZHQH 3BSQA 4MNXA 1UVSH 2OC1A 3SHAH 4XBBA 4AX9H 2GCHF 4OS5A 2Z7FE 4LOYH 2FO9A 3ATLA 1RTKA 3QGNB 4CHAC 2KCAA 4B76A 4I8KA 4ABIA 3QO6A 2XYAA 3VG8A 1G32B 1QB9A 1AKSB 2V0BA 2V6NA 3SO3A 1SB1H 2ZCKP 1NN6A 2BOHB 4TT3D 3S7KB 3GY6A 1LHDH 1MTUA 1AGJA 1J16A 5C0UA 1OX1A 1GBBA 3A7TA 3LGUA 1O2IA 2JH5D 1WCZA 1C5VA 1SG8B 2FEQH 2OBOA 5FBIA 3FP6E 3T28A 1VITG 1ETRH 5HM9A 3TH3H 3UWJH 2RDEA 3LGIA 3M35A 1QFKH 1W0KD 1BMFD 1C4U2 3RM2H 1S84A 2QXIA 1F0TA 3UY9A 3UOPA 2QF3A 4FXGH 1HAIH 1L1NA 3RXOA 1GI5A 5L2YH 2JJ2D 2ZFRH 4THNH 4IN1A 4WXIA 3ZZ6A 4NA7A 7KMEH 1TBRH 2TGTA 1LVOA 5HXFA 1Z8IB 3GY7A 5TCCA 5AVDA 3RMMH 2ZP0H 1O2PA 2CN0H 1Z6EA 1T8NA 1E35B 3TPIZ 2PTCE 3UOUA 5BRRE 1IQNA 1C2GA 3ZVBA 2P16A 2ZGHA 2FODA 3SBKA 2VWOA 1LPGB 1BZXE 4AB8A 2ZFTA 1OP8A 1G30B 1VJ9U 1LPZB 2SGQE 1CA0B 2RG3A 3TIUA 1GHXH 2ZU2A 2WYJA 3N7EA 2WPMS 2AEIH 4WF8A 1EOLA 1TYNA 2G52A 1IHSH 3RXCA 3OTJE 4YOGA 4FU7A 3F9HA 1KLIH 2W6ID 1C2LA 4BAOB 1UK4A 1K1IA 2IOTA 4CRDA 1VGCB 2XXLA 4TWYA 1SMFE 3PMHB 4X2VA 1ZHMA 1P09A 1NFUA 1V2VT 1L1GA 1HV7A 5DO4H 1F7ZA 3TGKE 1ANBA 1MBMA 3RDZA 3RLYH 1TONA 1G3EA 1CSOE 1DICA 2THFB 3P6ZB 1YCPK 1O3OA 1YCPH 4U32A 1DLEA 1ELAA 5A0BA 5C5OA 1EASA 5FPSA 3ZVFA 1JWTA 3SUEA 5EGMA 2FTMA 1XVOA 2GGVB 3GY5A 1TWXB 1EP5A 2BQ6B 1NRPH 1QJ6B 4IBLH 1BHXB 2VWLA 1UJ1A 2EY4C 5CMXH 2QXJA 1TA6A 1C5PA 1K9OE 1GI3A 4SGBE 3ZIAD 2VH0A 2BY6X 1GJ7B 5GWZA 3RXBA 3UB0A 2Y7XA 3SZNA 2GCTC 1O2MA 1WXRA 1KSNA 1O5AB 3KQCA 4A1XA 4MQAA 5DN6D 1GBAA 5AFZH 5LGOA 4FETA 1DOJA 4D7GA 4DY7B 1HRTH 2AGIX 1KXCA 1NESE 2QF4A 4U2WA 1BA8B 1LCYA 1O31A 1BT7A 2FOHA 2JIZD 4GPGA 1QURH 1A5GH 1K1PA 1AMHA 1KIGH 3E0PB 1DWDH 2NU0E 1A4WH 1ELVA 2A0QB 2XC5A 4FUGA 2K8IA 2HPQH 1ZGIA 1O3GA 2R2WU 4MNYA 2LELA 1EZUC 1GBCA 3LKWA 2GZ7A 3HGNA 2JDID 3GCOA 1GMDF 2C8XB 1O32A 3BTWE 2PW8H 5EJ1A 3RXSA 5E0JA 2OUAA 1OWHA 1SGCA 1TE0A 3QLPH 2KM0A 3LC5A 2Z3DA 3PTBA 4MDSA 1O2GH 1SOTA 3SN8A 5C1UA 3WY8A 3SU0A 5KECA 5CHBA 1C1TA 1T4UH 5AHGH 3SUDA 2Z9GA 4Y8ZA 1SLVB 4ABBA 4NGAH 3CS7A 4I8HA 1ELGA 1TMBH 2JJ1D 1SHHB 1ZR0A 4XBCA 2ZECA 1GJCB 1GBLA 1GI7B 1ZTJA 1O5DH 3SI4H 4A5TS 1O2XA 4BAQB 1S0RA 3RP2A 2BTCE 2FLBH 1E37B 4XD7D 2WPKS 2BD4A 2BB4A 3MO9A 1PPHE 2PP6A 3BG4B 1Q3XA 2XOKD 1MAXA 2CHAC 4MPUA 2H9HA 3ZZ9A 1V2LT 2A5AA 3RXFA 1G3BA 3C1KA 1BRCE 2ZGCA 1YKTA 2EQNA 3SW2B 4GLYA 5JPMH 1SPJA 1TNGA 1XXFA 2FMJA 3QZQA 5JBCS 2GZ8A 4AFSA 3TU7H 3SGBE 2FS8A 3A81A 3SYJA 3RXMA 1V2MT 3BTDE 2BDYA 1IQMA 2EEKA 5C1YA 4B74A 1HAPH 2OC7A 3TH4H 1Q2WA 2ILNA 1PQ8A 2ULLA 2P8OB 1KDQB 3URCA 1YM0A 4TWWA 1ELEE 1FN6A 3U8RH 1DWBH 1BTXA 1BJUA 2BDCA 2WV5A 1MQ5A 1GBMA 4ZKOU 4J2YB 4IGDA 2ASUB 3M37A 2VBCA 1Y3VA 3IWMA 1BTYA 1HGTH 3VB5A 1YBWA 3UPEA 5GXPA 4P02A 3TGIE 2ZI2H 2WPIS 5GCHF 3VFEA 4WXVA 5FXLA 1EZSC 1TPOA 3D49H 2RA3A 1OS8A 1D3DB 4OS2A 3UIRA 1A7SA 3PMBB 1HAVB 1MUEB 1K1NA 1NC6A 1CT0E 1ZMLA 4VGCC 3O8DA 1TGBA 5AFYH 1QB1A 2FI5E 2FX6A 2XNIA 1SGEE 4IC6A 3S0NA 3P92A 5GPIB 2AMPA 2ZPRA 1C2MA 2WUBA 1C1RA 1DY9A 2ZTXA 4K5ZA 3MU8A 1IQJA 2F83A 2HALA 3BTGE 3VB3A 3LGVA 3S69A 1XX9A 2TRMA 1CA0C 3GDVA 3RMLH 4MLFB 3RXGA 1ID5H 1WYKA 2PSXA 1KMHB 2OD3B 2Z9IA 3A8AA 3PO1C 2GDDA 4AB9A 8ESTE 2QA9E 3SU5A 4Z1MD 1YC0A 3QZRA 2PV9B 1BTHH 3A88A 3A8BA 3BTME 1EPTA 1Z71A 3RC6A 4Y7AA 1H4WA 3BEUA 1V6DA 5K0HA 1HDTH 1VGCC 1AB9C 2XCNA 2BXTH 2KAIA 4Y8XA 1ZPBA 3CP7A 1W12U 4B75A 3DUXH 3SGAE 4A92A 1M9UA 2G5NA 9ESTA 3W95A 1MCVA 6CHAC 2Z6BD 2XWAA 1O35A 1UCYK 2G51A 1L4ZA 1C2EA 4GHQA 1ZOMA 4B71A 1DE7H 3KQ5A 3QUMP 1T4VH 2HOBA 3K6ZA 4D8NA 4BTIB 3W94A 1O3MA 2KR7A 1LVBA 4AFQA 2FOMB 4NIWA 1Y3WA 2PKAB 1GJAB 4ASUD 3MHWU 5E0HA 3SNEA 1C2JA 2OP9A 5PTPA 5DSFA 3TJOA 1YLCA 3GY2A 4JZEH 1CBWC 3AW1A 2J94A 2ZKSA 5EIYA 2ZHDA 5HGGA 1GJ6A 2OC0A 1DXWA 4B73A 1XUJA 3U98H 2CV3A 4FUDA 2VIOA 1H9LB 5GIBA 1LHFH 3BEIB 2A4RA 2FX4A 2F3CE 3B9FH 4I8JA 1DWEH 4I7YH 2EI6A 4GVUA 1LVYA 3MU5A 1C5WB 4YTAA 5A8XA 4YOJA 1KXBA 3L6PA 3SI3H 1DUEA 4BTTB 2CGAA 4Q7YA 1ELFA 1C1WH 1O2TA 2BY5X 1QJ1B 4BTUB 2STAE 4E06H 5KGOA 1AHTH 3RXHA 3T2NA 3DHKH 2G55A 3SV6A 4DT4A 1AFQC 3ESTA 1GI9B 4AZ2B 1LHEH 1XXDA 3T62A 1GBDA 1CHGA 1F0SA 1OPHB 4ZUHA 3IITA 1GI1A 5HIYA 3PV2A 5HIZA 2FIRH 1O2VA 4R0IA 3W1EA 1C5XB 5FBEA 3U9AH 2SFAA 3ZVGA 1QRZA 5FX6A 2QYIA 5DP9A 2GT8A 3K6YA 1UTLM 4YM9A 3SNCA 2UUKB 1SQOA 2BLQA 1F2SE 4MNWA 1Z8GA 1FAXA 3NKKA 4JZIA 1NRNH 1NT1A 2GKVE 4CRCA 3V3MA 4D9RA 4YT7H 4Z6AH 4UFGH 1GJ8B 3H09A 1OWJA 3C27B 1O3DA 4K3JA 1TQ0B 3UQOA 1YPEH 2TBSA 1QZ8A 3H5CB 1LKAA 3HK6B 1F0RA 2OINA 3LGTA 3O8BA 3PLKA 2EI8A 1V2RT 1MH0A 4DW2U 2G81E 4OS7A 2GMTB 1O2SA 1SLXB 3RXRA 1UVOA 3LPRA 1P57B 5JBBS 5JBAS 2P3UB 4QT8C 1C5UA 4CBNA 4INLA 3N7OA 2ZHEH 1O5GH 1WV7H 5ABWA 1SLUB 5E2OA 1UTMA 5CHAC 2GJGA 3RXUA 1C1UH 1NROH 3BN9A 5DP5A 4Y10E 3LJJA 4AORA 1NY22 2BYAX 3PROA 3S9AA 2OLGA 3T29A 3RMNH 1J15A 3DD2H 2BY9X 4JYUH 1THSH 1C4Y2 1V2PT 3TLOA 3UUZA 1TQ7B 4JCNA 1QGFA 5A2MH 1O3LA 3E91A 1SGFG 1Y3YA 3ZZ5A 3VXFH 3ZZ8A 1P3EA 1BRAA 3A7WA 2XRCA 3FN8A 2H9EH 4X1PU 4RKOB 4ISNA 1MD7A 1A5IA 1TRYA 3UNQA 2Y6TA 1H8DH 2BXUH 3GY3A 4YO9A 1UHBB 2HLDD 1GBEA 1OP2A 3LOXA 2VINA 1GDNA 3M7TA 2AS9A 1D6RA 1TRMA 2EI7A 3RMOH 4DGJA 2ZQ1A 4HI3A 4ABGA 1V2NT 1C1MA 1G3CA 2D26C 2ZIQH 4ISLA 4UDWH 2Z94A 2K0QA 2R0LA 1LTOA 1PQ7A 1SHYA 1C5TA 1O3NA 1V2QT 2DE8A 3Q77A 1MTNB 1FI8A 3URDA 2M2AA 1SSXA 2XC4A 4DURA 3TJNA 1JBUH 1PPBH 2A31A 1A3EH 2BLOA 1UK3A 2G4UA 3Q3YA 1GHBF 3EA9A 3KNXA 4FU9A 2QN5T 1UVTH 1TNJA 1C2FA 1VCPA 3F0OA 4AYVB 1IQKA 3FFGA 5T6GA 1ARBA 4FUJA 4AFUA 4WWYA 4YZUA 2KZ4A 5DK1A 2ZDVH 4GHTA 3TVJB 1DDJA 2B9LA 1QBNA 1SC8U 1NFYA 1OP0A 2K1QA 3AVZA 3FKSD 2OCVB 1TPPA 2BLVA 8KME2 2KX4A 2YMSB 4IC5A 1DVAH 1Y3UA 2O8UA 4GCHF 3B23B 1C5MD 1AQ7A 1COWD 2ZO3H 1JRTA 1H9HE 1EUFA 2F43B 2J98B 2JETB 4Q63A 1QCPA 1XM1A 1E79D 1YP9A 5J4QA 5IK2D 5C20A 5JBTA 3QTVH 4WMFA 1HAYB 4BAMB 3DSGA 3BG8A 1HPGA 2P59A 2O9QA 1GG6C 3U69H 2OC8A 1E36B 3P8GA 2YNAA 2FTLE 2WPJS 1MD8A 2SNWA 4GSOA 1TGSZ 5HMAA 3VB6A 1TALA 1ZPCA 4CR9A 1ZHRA 1PFXC 3ZZBA 3AAUA 1UK2A 1C5NH 3OU0A 4HGCA 4Q7ZA 1FY1A 5DJ7A 4ACBA 4OS4A 2VIWA 1IHTH 2C8YB 1A0LA 1O2OA 5GDSH 1O37A 2A7CA 1ELBA 2XWBI 2AHME 1QQ4A 2W3IA 1AVXA 1NM6A 2L74A 3P17H 5CE1A 2FYRA 4O3TA 1EPTC 4NSYA 4X1QU 2BDBA 2XCFA 3MTYA 2A7JA 1BITA 5A8YA 3BTFE 1TNHA 1CQQA 2ZWLH 1GI8B 4FU8A 2PUQH 2B7DH 1O2JA 1SGDE 1TGCA 1ZSLA 3PLBA 1ABJH 1O3KA 2ZZUH 1FZZA 4I8GA 4XRNA 4ZXXH 1DS2E 1O5FH 1H8HD 2VVVA 2QIQA 1NRRH 1YLNA 1P8VC 4LXBH 4ABEA 1P03A 1TMUH 1ZMNA 2ZCHP 3M7QA 4O97A 2EA3A 2GVFA 3P8FA 4ZHAA 4BXSA 1P12E 1C5RA 1QHRB 3HKIB 3SGQE 2GZ9A 1GBFA 3E8LA 2DE9A 2GX4A 2QAAA 3LGWA 2UUYA 2PUXB 1YGCH 1CU1A 1SFIA 2UWLA 4Y8YA 2IJD1 1AU8A 4X8VH 2AH4X 3BV9B 3NZIA 3AASA 4ZKSU 3M3TA 2AYWA 1YPLH 4I31A 2VH6A 2CF8H 2IPQX 3CENA 1HAHH 2H5CA 3NK8A 3A7YA 3GCTG 2O8TA 1G2MA 3EAJA 1PJPA 1D6WA 3SU1A 1RXPA 3M3SA 3MH7A 2Z9KA 3GCHC 1P3CA 2AMDA 1C1QA 1SGPE 7GCHG 1X7AC 1W2KH 5E0GA 2P3FH 1KXEA 1FY4A 1BBRK 1YPHE 3GS9A 1P2KA 4RT1A 1P01A 2VNTA
chains in the Genus database with same CATH topology
1HJAB 1NO9H 1BBRH 2YNBA 3SU2A 4UEHH 2XTTB 1HFDA 1OYQA 2UWPA 3FAOA 4NCYA 1QRWA 4XDEA 5JB8S 1XMNB 2BQ7B 2GD4B 3SOSA 1AFEH 2XC0A 1VITF 1ORFA 3RXQA 1DANH 1KLJH 2V3HH 1S82A 1CT4E 1O3PB 4BOHA 4IN2A 3KIDU 3SJ9A 3UWIA 2Z3CA 1TGTA 3M5NA 3NUMA 7ESTE 2HNTE 2VWMA 4F49A 4K69A 1W10U 2PKSC 4I32A 4UFFH 1IQGA 1TX8A 3KHVA 1FN8A 3M7UA 2Q1JA 3D65E 2CMYA 2O8LA 2FI3E 3P8OA 4ZAEA 3VGCB 2DUCA 1GI4A 3ZYEA 1TMTH 3QX5H 5F8XA 1XUHA 3STJA 1T8LA 1YPGH 4AFZA 1XUIA 4FUHA 1HUTH 4JK6A 5A8ZA 1P2MA 4MNVA 3MNBA 4X6PA 4AGKA 1UTPA 2ZDMA 1NU9A 1ANDA 1RTLA 1TPAE 1NRQH 2ANWA 3A8DA 1Y59T 3NWUA 2BDGA 4X1RU 1Z7KA 4FUEA 1GHZA 3UQVA 3EE0B 3LDXH 1KDQA 1Y8TA 3JZ2B 3M3VA 1GI0A 1GCTC 4MVNA 4B2AA 2FOGA 3SJOA 2ZU3A 2A7HA 1UMAH 2BD7A 4TPYA 1C1NA 1QL7A 4BANB 1FDPA 2Y5HA 2VU8E 2NWNA 5C67A 3KEEA 1N8OB 3O8RA 1KYNA 4NA8A 1RTFB 3EA8A 1O3AA 3GCTF 1ZSJA 4WJG2 1BTZA 1T32A 3MFJA 3NXPA 1B0FA 2SGPE 1DM4B 3SU6A 1T8OA 2TPIZ 2QCYA 3KF2A 3BIVH 4DOQA 2QY0B 1QA0A 7GCHF 1CT2E 2RCEA 5LH8A 1TX6A 1W8BH 2WPHS 1HAVA 4DT7B 1NFWA 1NFXA 1P06A 4YESB 5FPTA 1BB0B 4CRGA 2ALPA 1FMGA 2VIVA 2HPPH 1KXFA 2SGFE 1DWCH 3KGPA 1GJ9B 2R2MB 2FOCA 1XUFA 3E16B 1SL3A 4YT6H 1YCPM 2TIOA 2W3KA 3RUOA 1O2UA 1EOJA 1OWKA 2VGCB 4WVPE 4INKA 5HM2A 2J92A 1P9SA 1V3XA 2ZDLA 3TNSA 1FJSA 1EZXC 1WSSH 2LPRA 3K2UA 1AY6H 2ODPA 4K1TA 1IOEA 2FI4E 1ZHPA 4Y71A 1VITH 2C8ZB 2J2UA 4ISIH 1FY5A 1Z1IA 3MH6A 2FP7B 4H6SB 1K1OA 1C1OA 3KQEA 1S85A 2PTNA 2SGDE 1EJMA 1WTGH 1O3BA 3MYWA 2C3SA 1GGDB 5DG6A 3E0NB 3RXKA 4UFEH 1B7XB 2AGGX 3RXEA 1W0ZU 1GJDB 8LPRA 3RXTA 2QXGA 2G8TA 1OWIA 1CGHA 1Q31A 1TNLA 1AI8H 1BRUP 1EATA 4ABHA 1RS0A 2A4QA 2CJIA 4WY3A 1BIOA 4OGXA 1O36A 4D76A 1RD3B 2JH6D 4DJZB 4NWKA 2B8OH 1CA8B 5TCAA 2ZCLP 1HLTH 4Q80A 5FCRA 1PYTD 3ZV9A 4M7GA 3EA7A 1ELDE 2PKAA 1O5CB 1ZZZA 3A82A 1OOKB 2PGQB 1S0QA 4K1EA 1HXEH 4B2CA 2VJ1A 1MZDA 1O34A 2P3TB 2QXHA 4K8YA 2D8WA 1G3DA 3S9CA 2ZFFH 2OTVA 5LPFA 1EAUA 1C2HA 1E38B 3SHCH 1PPGE 2GP9B 1OKXA 4LK4A 2W7SA 4JYTA 3S7HB 2ZTZA 1BDAA 2ZGJA 3NCLA 1BMAA 1JIRA 1EXFA 4DIHH 1MAYA 1O3FA 3RXIA 3MU0A 2GV7A 3CS0A 2ODQA 1IQIA 3H7OA 1C9PA 2BZAA 3EQ0H 2A5IA 2ZQ2A 1HIAA 3MNSA 3B8JA 1WTHD 5T6DA 1TRNA 1VJAU 1THRH 3MWIU 2TGAA 1GBHA 1NZQH 4A6LA 1O33A 3AW0A 3HPTB 1A5HA 2BD9A 2ZU5A 5TJXA 2P93A 5A0AE 1U6QA 1JOUB 3MOCA 4I8LA 4AYYB 1HYLA 1AUJA 4YLUA 1P2NA 4ZHMU 4DVAU 3SV9A 3ATMA 3HKJB 1ZGVA 3MU4A 3ODDA 5T3HA 5ETXA 1UCYE 1O2LA 2HGTH 1C1SA 1RJXB 1LDTT 4JZDH 1SBWA 4J1YA 2FOEA 1A1RA 1PPCE 1TB6H 3QN7A 1YPKH 3OX7U 3ZZDA 3PB1E 4X1NU 3E1XB 4XOJA 4ZKRU 2BY8X 4I33A 3RC4A 2J95A 1J17T 3E6PH 2XBYA 1ANCA 4NFFA 1PPEE 4FUIA 3GDSA 1MTSA 3IG6B 2A1DB 4DIIH 2NU3E 1F0UA 1W7XH 4IMQA 1DLKB 1K1LA 1GWAA 1C5OH 3VGCC 1J9CH 5G4BA 1EJNA 3GDUA 2O8MA 1V2TT 1SOZA 1HXFH 1IQEA 1P2OA 2IPHA 3VB4A 3P95A 2BDAA 1AE8H 1FPHH 4TY7A 1WQSA 1QY6A 3QDZB 1QTFA 4H4FA 2UUFB 1BMNH 2H2ZA 5DP3A 2ESTE 2ZGBH 1GHAG 4X8SH 2VWNA 3LGYA 1MZAA 2VVUA 4NSVA 2J38A 3ZZ7A 2NU4E 1D3PB 3PWCA 4NIVA 4WMDA 3EDXB 1YPHC 1AE5A 3VXEH 2BHGA 3V7TA 3KN2A 4GUXA 4ZHLU 4AGJA 3Q76A 4NZLA 4H6TA 4AN7A 2BZ6H 1IQFA 3V0XA 1AN1E 1UTOA 8GCHG 1BHXF 2D2DA 1K2I1 1QR3E 2RDLA 1ESAA 1AD8H 1CE5A 1UHBA 1V2OT 1OWDA 3BG4C 1SGYE 1IQLA 3UR9A 1QA7A 1O30A 1TOCB 2GCTB 1D3TB 3A89A 3BTQE 1LPKB 1GCDA 1P02A 1P0SH 4K60A 4X6NA 5DP6A 1QNJA 3SV7A 2OXSA 1Z8JB 1V2WT 3RXLA 9LPRA 1Y5BT 2HNTC 3VB7A 1LVMA 2WUCA 4X0WU 2LNCA 4ZKNU 1G2LA 3E90B 4FVDA 2BMGB 2JKHA 2VIDA 4KELA 2P8OC 4KKDA 3MNCA 1C1VH 5DP7A 1WBGB 4RSPA 1SFQB 5EG4A 1C5YB 5I25A 2BLWA 2VGCC 2A4OA 1ZRBA 1OYTH 4CH8B 3A7ZA 2ZDNA 3G01A 1LHGH 2A32A 1HB0B 2F9NA 5L6NH 4AOQA 1HAXB 2FZZA 1SR5C 1BMLA 2FPZA 1AKSA 3QGJA 3PYHA 3TJVA 5JDUB 1Z1JA 1T8MA 1BMMH 1OWEA 3BTEE 2HLCA 3HGPA 1L2EA 5ESBA 4MTBA 3TITA 5FAHA 4D7FA 4K8BA 1ZJDA 4JZ1A 1BTPA 2AERH 1W14U 4CH2B 2V3OH 1GHVH 1S81A 3SJ8A 1BTUA 1EAXA 1P2JA 1ELCA 4JK5A 1ZJKA 4UD9H 3F9EA 1W3CA 3ZVDA 1BUIA 4A7IB 3DT0H 1S5SA 1QL8A 2ZFSA 1MU6B 2FESH 2F9UA 2F9PA 3L3TA 1TPSA 3I78A 4X2WA 4X8UH 4RKJB 1UTNA 2VB0A 1O2NA 1GI6A 3HATH 1BTWA 4UFDH 1GHAF 2BD5A 3LJOA 2FDAA 1LQDB 3BEFB 2F9OA 2R3YA 5A0CA 2ZU4A 1KLTA 2Y80A 1GBTA 1XVMA 2CHAB 3U8TH 5GJ4B 2FXRA 8GCHF 1HNEE 3U8OH 1F5KU 1O39A 4OS6A 1OSSA 5J4SA 1A3BH 1WOFA 1G36A 1J8AA 3ATIA 3BF6H 4O3UA 2HNTF 2PR3A 2SGEE 4MPXA 4B1TA 3MI4A 1KY9A 1LQEA 1GMCG 2ZG0H 2F91A 2BOKA 1IAUA 2W7UA 2FOAA 1RIWB 1ARCA 5C5NA 1NU7B 4UONA 1XKAC 1QRXA 1RGQA 1TBZH 1GVLA 1NTPA 4ASHA 3F68H 1QB6A 1ZMJA 1TOMH 1YPMH 3GYMA 2NU1E 4TYDA 2M5TA 2GT7A 1UVUH 4ABAA 4YLQH 3LIWA 2XBWA 1C5ZB 3SU4A 1K21H 4KGAA 3MO3A 4FUFA 5L30H 1HAZB 3PWBA 2EC9H 3PM3A 2VIPA 2C4FH 4VGCB 4ESTE 3F6UH 4E7RG 4ZMAH 4INHA 2H6MA 3GY4A 3PTNA 2H5DA 3O8CA 3RU4D 5EPYA 4CBOA 1GDQA 3DA9B 4AG1A 6ESTA 3T25A 2A2XH 1GMDG 2ZFPH 1W11U 1HAOH 3OY6U 3V12A 4E05H 1ZTKA 1FXYA 1V2KT 2BDHA 3HK3B 3U1IB 1GBKA 2OQUA 5IYTA 3ZVEA 2HVXA 3VPKA 2FWWA 1GJBB 2ZC9H 2FOBA 4U30A 3TJUA 2JH0D 5DPAA 3NPSA 3MH4A 4IW4E 1YYY1 3PO1B 4F4OC 3E3TA 6GCHG 2I6SA 5C3NA 1A61H 3KL6A 1EKBB 2HRVA 5K7RA 1GI2A 7LPRA 2NU2E 2IJOB 3ZVCA 1G9IE 1HAGE 1MKXK 2B0FA 1VR1H 1YF4A 1C5LH 1TLDA 1AB9B 1QJ7B 1MKXH 1FY8E 3D62A 3F9GA 1BQYA 2PWXA 1ZTLA 1E0FD 4XE4A 1AVGH 1EP6A 6CHAB 1W13U 2AIPA 3LT3A 1MQ6A 1AVWA 4ABFA 1JXPA 3FZZA 2GV6A 5FX5A 2STBE 1P11E 4Y6DA 2BM2A 2SGAA 1WAYB 1GL0E 3PMAB 3UR6A 1GL1A 3ZZAA 3TNTA 1HCGA 4OGYA 2FM2A 2GMTC 1GMCF 2PGBB 3SJKA 4K1SA 4X8TH 4X6OA 2ZA5A 1SQTA 1B0EA 2BVRH 2A45B 4DG4A 2XBXA 5LPEA 1CBWB 1GBIA 1B5GH 4WMEA 4KP0A 1ESBA 2Y5FA 4WH8A 3MO6A 2XBVA 4NIYA 1J14A 3QWCH 3SORA 1BCUH 4CR5A 1FNIA 5IDKA 1UTKA 1BBRE 1O38A 4Y76A 2G4TA 4LZ4B 1O2WA 3RXDA 1RFNA 1INCA 1GJ4H 4ABDA 1S6HA 2D1JA 2ZPQA 4TY6A 4Y11E 1SQAA 2A2QH 3A80A 4FVBA 3V13A 1NRSH 2BVSH 3ITIA 2CXVA 4KTCA 5EODA 2FLRH 1FONA 1Z8RA 2C8WB 2OBQA 1GHWH 3UNSA 1L4DA 5GCHG 1LKBA 1AFQB 4X2XA 1MKWK 3Q00A 1Y5UT 5FPYA 4BXWA 3T26A 1KXDA 4HFPB 4BAKB 1MKWH 4XBDA 1O5EH 4NWLA 2F9BH 5F8ZA 1QQUA 2ZF0H 5EXNA 1GHYH 3GY8A 1C4V2 1C5QA 3LH1A 4DCDA 4JYVH 2C90B 1XUKA 2SNVA 5F03A 5E2PA 2RA0A 1H9IE 3K9XB 1ACBE 3P70B 1TAWA 1QL9A 6GCHF 6LPRA 3MH5A 1ZLRA 1IQHA 3SU3A 4Q2KA 2PSYA 4XFQA 5EXLA 1E34B 1SGFA 1MTNC 3SQHE 2A4GA 2ZGXH 1P05A 3R0FA 1K1JA 3I77A 1EB1H 3SUGA 1A0HB 2O8WA 3UREA 5B6OA 1L0ZA 4R8TB 1VCQA 1SGTA 4B2BA 2VIQA 1SI5H 1N1LA 2PHBA 1O3IA 4Q7XA 3A84A 3MNXA 5JB9S 3A7XA 4AG2A 1EAWA 2I6QA 1ELTA 1TIOA 1QIXB 2Y5GA 3MMGA 1V2ST 1GVZA 4X6MA 5EPNA 4D9QA 5CHAB 1SLWB 2JETC 3FVFB 2FS9A 4UE7H 2R9PA 2UWOA 1UTQA 1MBQA 1YPJH 3FZDA 2W5EA 1FLEE 4O9VA 1KXAA 2GTBA 1RIWC 2AIQA 3RXVA 1W0YH 2Q6FA 3EGKH 3TK6A 5EU8A 1GJ5H 3R3GB 1W7GH 1EQ9A 3ENSB 4NG9H 2ZEBA 1BRBE 3ZV8A 1UTJA 1WUNH 4ISOA 1DT2A 2F9VA 3VEQB 3RU4T 2B5TB 4CREA 1DSUA 1C2DA 3UNRA 1T31A 4NFEA 4FUBA 4SGAE 1ANEA 2YOLA 5DP4A 1Y5AT 2P94A 3GOVB 1TABE 3QTOH 2CF9H 4E7NA 1LMWB 1FV9A 1FAKH 2Q6GA 3ZZCA 2QV1A 5C1XA 1BOQA 1O2ZA 4JMYA 1O3CA 1O2RA 4ZH8A 1QBVH 1UO6A 1O5BB 3F1SB 2Y81A 1AIXH 3TGJE 4CRBA 5A09A 3FP7E 3A85A 3BIUH 2QF0A 2ANMH 3LC3A 1CGJE 5FHTA 1O3JA 3BTHE 3M61U 1D4PB 2J34A 2TGDA 1TNIA 3GCNA 1LO6A 3RXAA 4KTSA 2BX3A 2BVXH 2Y82A 1F5LA 3GYLB 3DFJA 1GMHG 1F92A 1N6YA 1Z6JH 2HWLB 1THPB 2R3UA 5EOKA 2BD3A 4CHAB 2A5KA 1V2JT 1DPOA 4NIXA 2WPLS 5LPRA 4JZFH 4YOIA 1VZQH 5DP8A 3MU1A 1AUTC 4A1VA 3SJIA 4A1TA 3KQBA 5T6FA 4U01A 2ZTYA 3BTKE 3A8CA 3UTUH 1WQVH 2H1UA 5EW2H 4RN6A 1O0DH 1AO5A 1JRSA 1GG6B 2TGPZ 4OS1A 1ABIH 4GAWA 4ISHH 1CHOG 1FUJA 2BDIA 1K22H 2ZHWH 2Y7ZA 4TPIZ 1SGQE 1ESTA 2P95A 4Y0YE 3PLPA 1DITH 1JMOH 2PFEA 3RXPA 1UCYH 2J4IA 2VVCA 1MU8B 3OYPA 1XKBC 4Y79A 2ODYB 3M5LA 1HJAC 3UFAA 2FOFA 1HJ8A 4XSKU 2ZFQH 1O2QA 1CGIE 3FANA 1D3QB 1V2UT 3T27A 3SV2H 3DFLA 1MTWA 1DY8A 5FCKA 3Q3XA 3K65B 3RLWH 2ZHFH 1N6XA 2FYQA 3LONA 1EPTB 1P10A 4Z0KA 5DGJA 4ZROA 1O2HA 5EW1H 3ODFA 3JZ1B 1PYTC 1A2CH 3RU4E 3F9FA 2KAIB 1AWFH 4Y0ZE 1P2IA 3P8NA 2QGRA 4MPWA 1C9TA 1DSTA 1EX3A 4IMZA 1WU1A 4K2YA 3ZYDA 1ZYOA 1TFXA 1VCWA 1TGNA 3STIA 1FQ3A 2BY7X 1EB2A 2WYGA 5EQQA 2WINI 1A46H 5C2ZA 3RC5A 1ETTH 1HIAB 3SNAA 1FIWA 2UUJB 2AFQB 2XW9A 3ZZ4A 1SGRE 2BD2A 2AGEX 4PROA 1SGNE 4BAHB 4IS5A 3Q3KA 1PPZA 1XUGA