3TK9A

Crystal structure of human granzyme h
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNNIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Granzyme H
publication title Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tk9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tk9A02
2XCFA 3NPSA 1DY9A 1XKAC 4AN7A 1TQ0B 2ZGJA 4K8YA 1H1BA 3KCGH 2PTNA 1C5LH 2OCVB 4HTCH 4A1VA 2Z9LA 2BDCA 2BQ6B 2G00A 2R2MB 1P03A 1Y3YA 3PMBB 1GHAG 2GX4A 1AFEH 2OTVA 4D8NA 1GGDC 3TK6A 1FAXA 1GJ7B 3ZZ3A 4FUHA 3U8TH 2ZDAH 2AH4X 1EPTC 1YCPH 3T62A 2A0QB 2PV9B 1J15A 4BTIB 1C5ZB 1D6WA 1MZAA 1W2KH 2ALPA 1INCA 2SGAA 2BD3A 8ESTE 3GDVA 3B23B 1LVBA 2RG3A 3DFLA 4FUCA 1TALA 3QZRA 1WAYB 3GY5A 1MU6B 1T8NA 3ATLA 2H5DA 1SQAA 2GCTC 2GCHG 4CHAC 3GY4A 3OX7U 5CMXH 1MBQA 2R0LA 1O32A 2BY5X 1G3EA 3FP7E 1THRH 2QF3A 1DDJA 4ZKOU 1AQ7A 1CSOE 1FXYA 1O3JA 1TGTA 4FVDA 4SGBE 3RMNH 1DWBH 1LPKB 1VCQA 4LXBH 4DJZB 1UVUH 1AN1E 1ZPZA 3CENA 4Q2KA 4Y10E 4AB9A 3RXLA 2ZHWH 1A3EH 2ZU1A 2VINA 3A8CA 4WH8A 1DM4B 2VU8E 1Z8GA 1TGNA 1GJ5H 3QK1A 2C93B 1SSXA 2ZDMA 1O2HA 4Q7ZA 7GCHG 2ZU2A 3P70B 4F4OC 3MU4A 4BXSA 2LNCA 5DPAA 2FIRH 1DSUA 1C5VA 4K60A 4J1YA 1V2TT 1RS0A 4CRAA 4X1QU 2WYJA 2FTLE 2JH6D 1P2MA 1CGHA 3LGWA 2ANYA 4Y6DA 1HDTH 1ZR0A 4RKOB 1SGNE 3EA9A 3S9AA 2ZECA 3HGPA 1UHBA 3UTUH 1C5PA 1XUHA 3A8DA 4UFEH 3SGAE 1O2QA 1P8VC 4I8LA 1UVTH 1HAXB 4K69A 2BOHB 5EOKA 1BQYA 1N1LA 3SU1A 1XM1A 3GYLB 4NZQA 2ODQA 1VITH 3UNSA 3T28A 1PPZA 3BTME 4CRFA 1ZZZA 4KTUA 1W14U 1ACBE 3RXTA 1O3AA 2DUCA 5JBTA 1W13U 2ZDNA 4CRGA 1GJ4H 4X0WU 1LHCH 2TGPZ 1OYQA 1P01A 3RXQA 1RIWB 1K1MA 1WBGB 3C1KA 1XX9A 1HAOH 3ZZCA 2XCNA 5I25A 1DS2E 1WQSA 2AYWA 5E2PA 4AFSA 2FOEA 4ZH8A 1AHTH 1AVWA 2W26A 1WTGH 1QGFA 2OP9A 2ZFTA 1P09A 1AE5A 3M3VA 1A46H 2P95A 1C1MA 1ELVA 1XUJA 4X2YA 1OWKA 2PKSC 1HNEE 1B5GH 2QAAA 2BB4A 3Q77A 2CJIA 2WV4A 4JZFH 1ETRH 3L3TA 1Y5UT 1T4VH 3TH2H 1UJ1A 4ZMAH 3EA8A 4HI3A 1TWXB 4GLYA 1CBWC 1C1UH 2ZFPH 4GVUA 3CS0A 1UTNA 3ZVDA 1GHAF 1HGTH 1V2WT 2TGDA 2CV3A 4JYUH 3TJVA 3RXIA 4UFDH 1P12E 1G30B 2ZDLA 1T7CA 3PMJA 5EODA 3A7XA 3A8AA 2Z6BD 5FX6A 5F8XA 1MAXA 1NFXA 2XWAA 2C4FH 1ESBA 2FM2A 3V0XA 3M5LA 2FYQA 1C5TA 2G4TA 3SUEA 1HAYB 1ELEE 4I8KA 3P8OA 1DICA 3LIWA 2VWLA 2ZI2H 1FQ3A 2FOHA 1ZOMA 3MH6A 2Q6GA 4NG9H 2GDDA 2JETB 1HBTH 2ODYB 5F03A 3F1SB 3F9FA 2VNTA 2GCHF 3NWUA 1AVGH 3TJOA 1GG6C 1JRTA 4OS6A 1CGJE 1NM6A 4KKDA 1AMHA 1HJ8A 1D6RA 4D7GA 2J92A 2PGBB 1A0HB 4KTSA 2QXGA 2VIOA 3SU5A 2BD5A 3PYHA 5GDSH 2HOBA 3ZZ6A 3A88A 5DK1A 1OYTH 5AVDA 1L0ZA 2ZDVH 1X7AC 1O5DH 4NA7A 1C1VH 1O30A 1OPHB 4CBOA 4Y11E 7ESTE 1ELDE 4UONA 4THNH 1A5GH 4BAMB 1FPCH 2ANWA 2Y5HA 2ZHDA 1FV9A 2GZ7A 4FUDA 1O5CB 7LPRA 2F9NA 4DW2U 1EP6A 4K8BA 3GCHB 3F9HA 4I8JA 4CBNA 7GCHF 1T31A 1ZMNA 4WF8A 4WXVA 1UMAH 2FLBH 2FS9A 1B7XB 1AB9B 1ZTKA 4DIIH 2P59A 1G36A 5AFYH 1GCTC 1O3CA 1F0SA 2G5VA 4NIXA 1TIOA 1C2MA 2GGVB 4Y71A 2ZTXA 1RD3B 1XVOA 1AZZA 1OP2A 2CF8H 3MNCA 1O2GH 1QY6A 1GPZA 3OSYA 1TBRH 1O37A 2PWXA 1EAUA 2UWLA 2VWMA 3F6UH 1GJCB 4JZ1A 1HLTH 4UFGH 4NIYA 4U30A 1O3IA 1O2SA 4NSVA 1DWCH 2PKAB 3QWCH 1QTFA 3RXFA 3EQ0H 3GOVB 2CN0H 3KIDU 1BBRE 2BX4A 3ZVFA 1MTWA 5FPTA 1AKSA 3BTKE 2W7SA 1UTKA 4Y79A 3URDA 1HAHH 3ZYDA 1VITF 3UQOA 3S9BA 5C1YA 4H42U 1O0DH 2F9OA 4ABJA 4GCHG 9LPRA 1TX8A 5HM2A 3BG8A 4XE4A 2STAE 5F8ZA 3GY2A 1ESTA 2VH0A 1NY22 4TWWA 1SGQE 3FFGA 1IQEA 1C5UA 3HKJB 1YCPK 1UCYE 2YNAA 1DWEH 3Q3YA 1XUFA 4LK4A 4AG1A 3FP8E 4IGDA 2C8XB 4Y7BA 3N7OA 5T6DA 5DP3A 1AFQC 1CGIE 1IQFA 1G3DA 4FUBA 1ELAA 3S7KB 4E05H 2SGFE 3OYPA 4JCNA 2EI7A 3I78A 1L1GA 2OD3B 3A84A 4Y0YE 4ISIH 3E3TA 1C5XB 2F9BH 1QL7A 1OKXA 4OS2A 1HAZB 1Y3XA 1HAVB 2F83A 1EASA 1TGCA 1TMUH 3S69A 2V35A 1GHZA 2IJOB 2EC9H 1TNKA 3FZZA 1GHWH 3RC4A 2D2DA 2WUBA 1F5LA 2Y5GA 5DJ7A 2HNTE 1TPOA 3AVZA 1TRNA 1T8MA 1C1SA 5JB9S 1BTXA 1VGCC 4JZEH 2QV1A 3V12A 1D3DB 1AIXH 2A4QA 3MH4A 5C1XA 1BTZA 3ESTA 5BPEA 4A7IB 3T26A 5DO4H 4MTBA 1EJNA 4MQAA 3UFAA 1C5OH 4DY7B 1P11E 4X1SU 1GBTA 3KEEA 4TPIZ 5CE1A 3BG4C 1F5RA 3UPEA 2Z9IA 3ZVCA 5FAHA 1TNHA 2BDIA 2I6QA 3SGQE 1PPHE 3A86A 3BTHE 2ZEBA 3A80A 4ISNA 3EA7A 4Y0ZE 5EPYA 6CHAC 5I46H 3AAVA 3GDUA 1NFWA 1JBUH 1OWEA 2PUQH 3TGJE 1P57B 1QL8A 3RP2A 3TH4H 5EXLA 3ENSB 2BHGA 1HV7A 1MD8A 2BVSH 1SOTA 1O2IA 2ZGBH 5BRRE 1SGFG 3STJA 1FONA 1GI9B 1Y5BT 1Q2WA 3DHKH 1SLWB 2AGEX 2GCTB 1N8OC 4WXIA 5FBEA 1BA8B 3TITA 1BTPA 4B74A 3T29A 2VIWA 3A7WA 3ELAH 1DVAH 1QQ4A 4AZ2B 1MBMA 1IQKA 3SHCH 2Z3CA 1IQJA 1K22H 1TQ7B 3MTYA 4TPYA 3GDSA 4AG2A 4XSKU 4WH6A 4CRCA 1NS3A 3PO1B 3SBKA 1YM0A 3M5MA 2A5AA 3HPTB 5ESTE 1P3CA 1EZXC 2BDYA 3LJOA 2WPIS 2UUYA 1NROH 2AMPA 2I6SA 1S84A 3TLOA 2C90B 2V3HH 1BBRH 4X6PA 4ZKNU 1E35B 2R2WU 4ZKRU 4CRBA 3OY6U 2Q6DA 5DP7A 3MFJA 1PPCE 2WPLS 1MCTA 6GCHG 1S0QA 3DFJA 1KXCA 3A81A 1CT4E 2BYAX 1AE8H 1C1RA 1QA0A 3AASA 4JK5A 3VGCC 3AW1A 1HRTH 1BT7A 1C2HA 4WVPE 5HMAA 1UTPA 1MMJN 4FXGH 2VIVA 2ZHFH 1AZ8A 2Q1JA 4IS5A 2WYGA 1XXFA 3RXDA 1HUTH 1E0FD 1LVOA 1KDQA 2ZCLP 3RMOH 4MDSA 3UOPA 1K1NA 1FY3A 4A92A 5HYOA 3A7VA 2OC1A 1YC0A 1BCUH 3U98H 1QL9A 1EB2A 1GHYH 1XKBC 1GBKA 4ZKSU 2FXRA 2G51A 1AUJA 2BQWB 5FX5A 1S81A 1T8OA 1A5HA 2GMTC 5EXMA 4E06H 1K2I1 1BZXE 1JRSA 2BTCE 1O2XA 1LQEA 3MHWU 1YPHC 1WV7H 1P06A 4INKA 1ELFA 3EGKH 5EGMA 1P9SA 1WCZA 4VGCC 1SGIB 2JH5D 1A5IA 2Z7FE 3EAJA 5A0BA 5TJXA 3RXBA 2V6NA 1SQTA 1V2PT 1C2JA 3HK6B 1FY8E 2GDEH 1GMCG 2WPJS 4QT8C 4MNWA 1EAXA 1F7ZA 1DWDH 4BAOB 1O38A 1MTVA 1FY1A 1KLTA 4AFZA 3LOXA 1TB6H 1YPJH 1YPKH 3A7ZA 4ZXYH 2ZWLH 3E91A 1LDTT 3RXKA 4WMDA 3ZZ8A 1DUEA 3SUGA 2AMQA 3KQBA 2ALVA 1DUAA 1CBWB 1QJ6B 4OS1A 1PQAA 1PPBH 3SOSA 1O2PA 4BAQB 1NRRH 1O3BA 1YBWA 3JZ2B 3SORA 1Z7KA 4NA8A 1KXBA 3V13A 3BIUH 4IC5A 1LKBA 5H4IB 1EUFA 1U6QA 2OC7A 1VJ9U 1A1RA 2PHBA 2FS8A 4D9RA 1V2JT 1NTPA 4I32A 1SMFE 3VB7A 1AUTC 3SNCA 2A7CA 2A45B 1F0RA 1VCWA 3DA9B 5DP5A 4K3JA 5DKMA 5EXNA 5EW1H 3BEFB 2HLCA 2XBYA 2EA3A 3MOCA 4O97A 1C4V2 1GBMA 4YTAA 1QIXB 1AWFH 1O33A 2WPKS 1GG6B 4FVBA 2HGTH 1QQUA 4ZAEA 1OSSA 4I8HA 3ZZAA 1SFQB 3KF2A 3SO3A 1BMMH 1ANEA 1ABJH 3BTTE 2XTTB 1UHBB 5A09A 4X8UH 3ZZ9A 1T8LA 1Q3XA 2H9TH 2ZGCA 2ZQ2A 1GJ9B 3VB3A 3K6YA 1SPJA 1GI6A 1TABE 1SGYE 1CVWH 6ESTA 1EP5A 4MNYA 2J95A 3LGIA 2V3OH 2XWBI 1LVMA 1UTQA 3MWIU 5C67A 3E16B 1NPMA 4TWYA 3BN9A 4ABIA 4RKJB 2TRMA 4DIHH 4NFEA 1PPGE 4ZHLU 1V2OT 2Y6TA 5JBCS 6GCHF 1TAWA 4ABBA 3UQVA 1NU9A 2RCEA 2QY0B 1QFKH 4J2YB 4BANB 7KMEH 2PW8H 1O3GA 2C8ZB 1DFPA 2ZPQA 3ZVBA 1OOKB 1W10U 4YT7H 2XC5A 3S9CA 3SGBE 3A7TA 1O3LA 3A85A 1SLUB 2ZNKH 1GMHG 5ABWA 1MAYA 5K0HA 2W3IA 1KXAA 2VVUA 5C1UA 3O8CA 1XVMA 2QXIA 1S6FA 1ZLRA 1O2OA 2D26C 3BTEE 1ZHMA 1K1LA 4MNVA 2QXHA 1GVLA 1QRWA 2CF9H 4LOYH 1KXEA 1FUJA 1D4PB 3QX5H 1YYY1 4ABDA 3RU4T 5LPRA 5L2YH 3RXMA 3SQEE 1GDUA 4B2AA 3UR6A 1EKBB 3C27B 2CMYA 3GCNA 1TBZH 3MNXA 2H9EH 4NIVA 3SV8A 4O3UA 1HJAC 3FANA 1SI5H 2P94A 1ZRKA 2QCYA 4XBBA 4DCDA 1C2GA 1YGCH 1MD7A 4I31A 2R3YA 1BRUP 1GMCF 2FOMB 3ZZ7A 2Z3DA 5AF9H 2BLVA 1TYNA 4IC6A 1EZQA 1NRSH 1C5SA 3QTOH 1MTNB 2VJ1A 2FOAA 1P2KA 3FZDA 1QRZA 3GISB 1BJUA 2PSXA 1TE0A 2GT7A 3E8LA 3LH3A 1HYLA 4D9QA 2YNBA 3LC5A 5L2ZH 3TNTA 1DXPA 3RM2H 4B76A 1E34B 1O39A 4ISHH 4X6MA 5K7RA 3P8NA 1GBFA 2ZTYA 1C1NA 2F9PA 2BLWA 1AGJA 2KAIA 1QCPA 2H1UA 3MU5A 1SB1H 5A8ZA 3RXCA 1EAIA 2H5CA 4CRDA 1OXGA 2BY7X 1VGCB 1GBHA 1W0ZU 5JPMH 4X1PU 4HFPB 1FIZA 1SG8B 3M5OA 1BBRK 3T2NA 4B75A 4AFQA 6LPRA 1O5EH 5E0GA 3UR9A 2XBWA 1TA2A 2BZAA 4TY6A 1S83A 3ZZ5A 1Y3VA 1RTKA 3OY5U 3SN8A 4XDEA 5A0CA 3MH5A 4MPWA 1AVXA 1L2EA 1NFUA 4NFFA 1WOFA 3MU0A 5JB8S 1TMBH 1YPGH 1SOZA 2C8WB 4FUIA 1E36B 5C3NA 1GBDA 5A2MH 3ZV8A 5JYIA 4A1TA 1EATA 2ULLA 3KGPA 4YOJA 4O03A 4DVAU 6CHAB 1HIAA 1SBWA 3HGNA 3PWBA 2AS9A 3SJ8A 3OU0A 1TX7A 3BF6H 1OWHA 4H6SB 2ANMH 4B2CA 1F2SE 2V0BA 3MO9A 3RC5A 2RA0A 1C5QA 2Y7XA 4K1TA 1O3NA 2ZIQH 3QGNB 3UIRA 4O9VA 5TCCA 1AKSB 3WY8A 1H9LB 3S7HB 1EJMA 2XXLA 2A2XH 2ZF0H 4FUGA 1D9IA 2OQUA 3M7TA 1OWIA 3HATH 1IQIA 3RM0H 1VJAU 4CR5A 1GMHF 1B0EA 1TPPA 1W0YH 2ZFRH 1TGSZ 2GP9B 1YLDA 2HPQH 2FO9A 2A5IA 1ID5H 2FEQH 2ZU3A 4XBDA 1C9PA 1QNJA 3LGUA 5C2ZA 3DT0H 3QDZB 3QLPH 1V2RT 1RRKA 4NWKA 2NU4E 2WPMS 3RDZA 2VGCC 3L6PA 1GBEA 4H6TA 1THSH 1GJAB 1SGCA 1ZMJA 3UOUA 3SJ9A 2SGEE 8KME2 5T6GA 1TBQH 1O31A 3UY9A 2BD7A 2XW9A 1BMNH 1ABIH 2QIQA 1SC8U 3LONA 1GI3A 1BMAA 1OWDA 2GTBA 4YT6H 1KIGH 2A4GA 3Q3XA 3RXOA 4D76A 2GV6A 4X1RU 1P9UA 2JKHA 3D65E 2GZ9A 2OLGA 3SU6A 1Z8RA 1C1PA 2A1DB 1ZSLA 4RN6A 2YOLA 3M7QA 1J8AA 5PTPA 2WV5A 2A31A 3VB4A 1OWJA 2NU3E 1O5BB 3LGYA 2AERH 4DT7B 3F9EA 1SGTA 1FLEE 2GD4B 1DE7H 3GICB 3VEQB 1RGQA 1GBBA 1Y3UA 3U1IB 1GBCA 1HB0B 1C2FA 1CO7E 4ZUHA 1SLXB 4ASHA 1W8BH 1UTOA 3ZVGA 1C2LA 5FPSA 1BRBE 1IHSH 1G3CA 4U2WA 3SV2H 3GCOA 2BXTH 2WPHS 2J38A 4YZUA 2BVRH 3E0PB 4ABHA 8GCHG 1GVKB 1PQ7A 8LPRA 2ZPSA 4MG3A 2FI4E 4VGCB 3PROA 1Y8TA 1ZGVA 2BMGB 1BTHH 1MTUA 4X6OA 2ZC9H 4AORA 2PKAA 5E0HA 2XYAA 3NK8A 1MCVA 2GKVE 3H5CB 3TVJB 1NN6A 1AO5A 4NA9H 2ZZUH 2OXSA 1BJVA 1GJ8B 3GYMA 3RU4D 1QB9A 2AMDA 3K9XB 1KXDA 3SNBA 1BMLA 3P8FA 1RXPA 3RUOA 3VFEA 1GWAA 3A82A 1OX1A 1SVPA 2FESH 1V2QT 1ZSJA 1LO6A 3TH3H 3U69H 3AW0A 4BXWA 4Z0KA 2GV7A 1QBVH 1SGDE 2JETC 2K1QA 1XUKA 1GGDB 2PFEA 1EQ9A 2BD4A 2ZFFH 2BD9A 4MPUA 3V3MA 1EPTB 4F49A 2QXJA 3TPIZ 5C5NA 2AFQB 1K1JA 5AHGH 4YLUA 4IBLH 5AFZH 1HCGA 1GBIA 3MNBA 1C1QA 1ZYOA 1CU1A 3P95A 1YP9A 4R0IA 4BAHB 3MMGA 3IITA 2HPPH 2PSYA 3GCTG 2SNVA 3RLYH 2PR3A 4FU9A 1FNIA 3M37A 1Y3WA 2BY8X 3O8DA 3UWIA 5FBIA 4CHAB 3RMMH 1S85A 2VIQA 1GJ6A 1LPGB 2SGDE 5ETXA 1H4WA 3VPKA 3PLKA 5FHTA 2AIQA 1D3TB 1Y59T 2FX4A 1DY8A 5E0JA 3BIVH 1KDQB 2ZDKA 1BRAA 1UK2A 4YOGA 3SU3A 1IQGA 2B7DH 2XBVA 1V2ST 1W7XH 4UE7H 1H8IH 5JBBS 3U9AH 3A87A 4X2XA 1HXFH 2XBXA 1A61H 3SI3H 5EPNA 3SNEA 1SL3A 2FLRH 1V6DA 3SW2B 3A7YA 1CT0E 2A5KA 2UUJB 3RLWH 3LGTA 1YPEH 4ZHMU 1FAKH 2DE9A 2HALA 2NWNA 2O8UA 2ZA5A 5FCRA 1NU7B 3KQDA 3SUDA 1ETSH 1SR5C 1HXEH 2ESTE 1L4DA 3QO6A 1WUNH 1YKTA 3ODDA 1C1WH 1UVOA 1RJXB 3W94A 4UDWH 4GCHF 4GSOA 5GWZA 4TY7A 4X8SH 1KTSB 4I8GA 5C20A 1QRXA 3M61U 1TRMA 4OS5A 4ESTE 4INLA 2P3FH 1N6XA 4FUFA 1ZPCA 3LU9B 1J9CH 1ZGIA 1SGPE 1UCYH 2BDGA 2IPHA 5L30H 3RXPA 3UNRA 1LTOA 3KHVA 2AGIX 2XNIA 2CGAA 4GHTA 3O8RA 1P2QA 1EZSC 1O2JA 1H9HE 3SJKA 3U8RH 4NIWA 1FZZA 4O3TA 1G2MA 4Z6AH 3FP6E 1LHDH 4XFQA 4Y8XA 2SFAA 1O5FH 4YESB 2Y5FA 1O2MA 1V2LT 1C1TA 2EI8A 4AX9H 2O8TA 2XC0A 3LJJA 3SJIA 8GCHF 1UVPA 1GDQA 4A6LA 3ATWA 4SGAE 1GHVH 2WINI 1K21H 1TA6A 2ZFQH 1K28D 1A0JA 1HJAB 2Y81A 1JWTA 4NGAH 4ABAA 1W3CA 2Y82A 4X6NA 1SGEE 2A2QH 4GHQA 1ELBA 1KTTB 3Q76A 1Z6JH 3ZZ4A 4HGCA 1O2WA 3LKWA 2ZG0H 2D1JA 1GBLA 2A32A 2IOTA 2FODA 1CA0C 1G3BA 2Z9KA 2PKSB 2W5EA 3NUMA 3T25A 3KQCA 4CR9A 2TBSA 3M36A 4GPGA 3QN7A 3P92A 4WMFA 1O3EA 5C5OA 3ZVAA 1K1PA 2BDBA 1XUGA 2ASUB 4ISOA 3E6PH 4DURA 3DUXH 1LHEH 1UVSH 2BLQA 5GCHG 2G5NA 1GVZA 3S0NA 3PTBA 2C3SA 2BDHA 1LQDB 3A8BA 2CHAC 2SGQE 4JZDH 4AOQA 3PMHB 1L1JA 3QZQA 1JIMA 1MKXK 2HWLB 2PUXB 2H2ZA 3B8JA 1MQ6A 4LZ1H 1QHRB 1IOEA 1W12U 5CHAC 2UWPA 1BB0B 3GCTF 3K2UA 3M7UA 2R0KA 2NU0E 1CHGA 1QA7A 3SV9A 4MVNA 4B1TA 1TPSA 1O2YA 5DGJA 1G9IE 3ZZDA 2IN2A 2OQ5A 3DD2H 2STBE 2EEKA 5JBAS 1KLIH 1ANDA 1DSTA 1VZQH 3T5FH 1IAUA 1DITH 2UWOA 3QUMP 5DP6A 1TNLA 2R3UA 1GHXH 1V2MT 1JXPA 2A4RA 4TYDA 1TOMH 3P8GA 5EU8A 1HJ9A 4WWYA 1O2VA 5A8XA 5J4SA 1P0SH 1KLJH 2FP7B 4JYVH 4K1SA 2BDAA 1P2IA 4AYVB 1JOUB 1ELTA 2P3TB 1YPMH 2B5TB 1BHXB 1AI8H 1ZPBA 1GBAA 3B9FH 5HXFA 4JMYA 1C5RA 1CQQA 5GPIB 3T27A 1DPOA 1PQ5A 2Y7ZA 5GIBA 3TNSA 2Z9GA 1BTYA 4XOJA 3PO1C 3RXRA 1O34A 3E90B 3K65B 2R9PA 1GCTB 3MU8A 1O3KA 3PMAB 3ZZBA 3UREA 2TIOA 3MH7A 3NXPA 1BOQA 3STIA 3TJUA 2OINA 2F9VA 4K1EA 1TNJA 1C1OA 2VGCB 3GY6A 2ILNA 3K6ZA 4OS7A 5LGOA 3BTWE 3BTDE 1C5YB 1GI5A 1T4UH 1V2UT 2BQ7B 2ANKH 3P6ZB 2VWNA 4IMQA 3RXEA 4CH8B 2VVCA 1HAGE 1GHBG 3TK5A 1SLVB 1O2TA 2VWOA 3PLPA 5DP4A 3FVFB 3PM3A 2Z94A 1MH0A 4UFFH 1TPAE 1VCPA 4ZHAA 1TNIA 2QF0A 3PB1E 1D3QB 4KGAA 2QGRA 4CREA 3I29A 1BIOA 4YOIA 1IQMA 2KAIB 1EOJA 1LVYA 1M9UA 1S5SA 4YO9A 1HAPH 1NRPH 3ODFA 4Q7XA 1C5WB 1O2RA 3JZ1B 3TU7H 4JZIA 3EYDA 4ISLA 2O8MA 1FY4A 3Q00A 3NZIA 1AWHB 2F9UA 3U8OH 4NCYA 3AAUA 4GUXA 3BSQA 3H7TA 2ZTZA 2SGPE 2BX3A 1PFXC 5F6MA 4X8VH 2FOGA 2FDAA 2P8OC 1S0RA 1MUEB 1OP8A 1OP0A 1O3PB 3RU4E 1S6HA 1Z8JB 1LPZB 1MKWH 1N6YA 1WQVH 1AFQB 1CE5A 1JIRA 1MU8B 4AGJA 3LH1A 1VITG 4X2WA 5EQRA 3ATKA 4BAKB 1A4WH 2HNTF 3LC3A 1TGBA 1Z8IB 3LPRA 2BY9X 1PJPA 2ZQ1A 1HIAB 1K1IA 2XC4A 1L1NA 1GL1A 1MZDA 3M3TA 5EQQA 5GCHF 2OBOA 1O2KA 1NC6A 3P17H 1P04A 1K1OA 1NFYA 4FU8A 3RXHA 3RXJA 1E38B 1T32A 1ZJKA 2FPZA 1EB1H 3E1XB 2BVXH 5IDKA 2G8TA 4H4FA 1ZTJA 5LPFA 1O3HA 2Q6FA 3D62A 1FN6A 1JMOH 1J17T 1O2LA 4ABEA 3MNSA 4D7FA 1EXFA 2FX6A 1FMGA 1P02A 1HPGA 3SNDA 1OS8A 4AFUA 2ZU4A 1HAIH 4RSPA 1QBNA 1QJ7B 3U1JB 1H9IE 3EE0B 1C4U2 1DT2A 5EW2H 3HKIB 4CH2B 1Z1IA 4IMZA 4IN1A 3BG4B 1B0FA 2M5TA 4K5ZA 1QJ1B 1KSNA 1CT2E 1XMNB 1EZUC 3SU2A 3SI4H 1UCYK 4AB8A 1SGFA 3I77A 3GY8A 1EAWA 4E7RG 1QURH 3ATMA 1P10A 1ORFA 4Y8ZA 5DP8A 1TOCB 1H8DH 4AYYB 2OUAA 1L4ZA 1CHOG 3MO3A 4MLFB 3LT3A 1ARBA 4JYTA 1ZTLA 1EJAA 1LHGH 2C8YB 4OGYA 1C4Y2 1N8OB 1XXDA 3BTGE 3MI4A 1QB1A 3GY3A 1O2UA 2HRVA 4BOHA 2A7JA 3TJNA 5T6FA 3H7OA 1P3EA 2QN5T 1V2KT 1QBOA 1IQLA 1DLKB 1XUIA 1Q31A 5FPYA 3G01A 1Z71A 3UNQA 4DOQA 2P3UB 2BZ6H 1IQHA 2ZCHP 2VVVA 1MKXH 1GHBF 4NSYA 1PPEE 2P93A 2ZO3H 3MYWA 3L33A 1UTJA 1ELCA 1W7GH 1TX6A 1ARCA 1UK3A 1P2OA 1THPB 3SUFA 3ZV9A 3KN2A 5FCKA 3O8BA 1NRQH 1FIWA 1DX5M 3ATIA 1ELGA 3CP7A 3D49H 1ZRBA 2NU2E 5G4BA 4A5TS 4DG4A 1ZHRA 3F68H 1KYNA 2FMJA 2UUFB 1FJSA 1V2VT 1GI0A 1TONA 3VGCB 2AIPA 3VXFH 4FU7A 1F0UA 1LKAA 5HM9A 2GVFA 2ZKSA 1C2DA 1BRCE 1YCPM 4GAWA 4KP0A 2FZZA 1WYKA 1UK4A 3MU1A 5J4QA 2QYIA 5LH8A 1RIWC 3Q3KA 2TPIZ 1GL0E 1F0TA 1WSSH 3F9GA 4KTCA 2ZCKP 1LMWB 2PGQB 2BD2A 4KELA 2B8OH 1CA8B 3RXUA 2FOFA 2VIDA 2ZGHA 2ZP0H 1O35A 4WMEA 2FI3E 1LHFH 4YLQH 5EQSA 1V3XA 5IYTA 2B0FA 2FWWA 4U01A 4ABFA 3SNAA 2GMTB 5A8YA 2W3KA 1C5MD 1YF4A 2P16A 1UTMA 3NCLA 1P2NA 2H9HA 1MTNC 9ESTA 4FUEA 4DGJA 2NU1E 3HK3B 1WTHD 4FUJA 3KQEA 2Y80A 1A2CH 1TMTH 5L6NH 5LPEA 1O5AB 1DXWA 1ZSKA 3A89A 3M5NA 2VH6A 5T3HA 2AGGX 4BNRA 1C9TA 2VB0A 2FYRA 3RXAA 1CA0B 4UD9H 5FXLA 2BY6X 1BITA 4Q7YA 3BEUA 1SFIA 3SU0A 2PLXA 1GI2A 1ZMLA 1ZHPA 1EX3A 3M3SA 1GMDG 4E7NA 3VXEH 1GCDA 3IWMA 3ITIA 1W11U 1TNGA 1IQNA 2RDLA 3UWJH 4NZLA 2HVXA 1O3FA 2UUKB 1TRYA 3PWCA 1FY5A 2FOBA 4M7GA 3URCA 4AGKA 2ZPRA 1HFDA 1ETTH 2CHAB 3KNXA 3SHAH 4INHA 2ZU5A 2Z3EA 2ZFSA 5GXPA 1RFNA 2AEIH 1CHOF 4IN2A 1C2KA 1BUIA 3TK9A 2PTCE 1DLEA 4LZ4B 1PYTC 5CHAB 3VB6A 3R3GB 1ANCA 2BM2A 4WJG2 3BEIB 3OTJE 2J9NA 3GY7A 2ZHEH 1HAVA 3TGIE 1YPHE 1SQOA 3PTNA 2F91A 2FOCA 4R8TB 1KXFA 1UTLM 2BD8A 3RXSA 1K9OE 2WUCA 1FN8A 1GJDB 1RTLA 2SNWA 1C2EA 1YPLH 5DG6A 1TFXA 3PLBA 4I7YH 3GCHC 3UUZA 1Z1JA 2ODPA 1G32B 5B6OA 1GI7B 3KL6A 5JDUB 2TGTA 1O5GH 5SGAE 3SV6A 2G52A 1SHHB 1G2LA 3QTVH 1AB9C 4X1NU 4UEHH 4YM9A 1RTFB 1WU1A 3E0NB 3BTFE 2G55A 2RA3A 1MKWK 2CXVA 4HZHA 1AD8H 2BXUH 1ESAA 3PV4A 1O2ZA 2DE8A 2JH0D 1O3DA 3D23A 4ZXXH 1Z6EA 3SV7A 1SHYA 3ZVEA 2QA9E 1GJBB 2OC8A 3FAOA 1DANH 2GZ8A 1C5NH 2D8WA 1C2IA 4Y76A 2O8LA 4Y7AA 1BTUA 1FI8A 3IG6B 2J94A 3BTQE 1SGRE 3BV9B 1MTSA 2EI6A 4MPXA 3SZNA 4K2YA 1EPTA 4I33A 2H6MA 4B2BA 3V7TA 4JK6A 1J16A 2BOKA 1BDAA 2OC0A 3QGJA 4XBCA 2J34A 2HNTC 2TGAA 4MPVA 1S82A 4U32A 5ESBA 1O2NA 3W95A 4BTUB 1FPHH 1GI8B 5DP9A 3LGVA 3M35A 1P2JA 5E8EH 2J2UA 5A0AE 1A3BH 2FI5E 1A7SA 1BHXF 1G37A 3RMLH 4A1XA 1QB6A 3VB5A 1MQ5A 1NO9H 4NWLA 2GT8A 1FDPA 2O8WA 1V2NT 1F5KU 2ZGXH 4B73A 3ZYEA 2W7UA 3CS7A 4OGXA 1O3MA 4PROA 1KY9A 2F3CE 5F8TA 1A0LA 5E2OA 1YLCA 2THFB 2G81E 1O36A 1PQ8A 2ZHQH 1QR3E 2LPRA 3TIUA 1ANBA 2A7HA 1J14A 3SU4A 4IW4E 1EOLA 3SJOA 4X2VA 1IHTH 3LDXH 2O9QA 2OBQA 3R0FA 4BTTB 1PYTD 2B9LA 1VR1H 1TLDA 4B71A 1O3OA 1AY6H 1ZJDA 4Y8YA 3TGKE 2P8OB 3RXGA 1DOJA 4WY3A 4X8TH 1GBJA 4ZROA 1UO6A 1GI1A 3RC6A 2XRCA 5GJ4B 2BLOA 1GDNA 1GMDF 1D3PB 1BTWA 1LCYA 1NT1A 1PPFE 2Z9JA 5EG4A 3NKKA 2G4UA 3A83A 1F92A 1NZQH 1Y5AT 5TCAA 1GI4A 2J4IA 4OS4A 4MNXA 1P05A 3EDXB 1NRNH 2FTMA 3RXVA 3SQHE 3MO6A 2VIPA 1NESE 2QC2A 2A4OA 1AU8A 5HGGA 1E37B 4Q80A 4ABGA
chains in the Genus database with same CATH superfamily
2XCFA 3NPSA 1DY9A 1XKAC 4AN7A 1TQ0B 2ZGJA 3F2HA 4K8YA 1H1BA 3KCGH 2PTNA 1C5LH 2OCVB 4HTCH 4A1VA 2Z9LA 2BDCA 2BQ6B 2G00A 2R2MB 1P03A 1Y3YA 3PMBB 1GHAG 2GX4A 1AFEH 2OTVA 4D8NA 4I86A 1GGDC 3TK6A 1FAXA 1GJ7B 3ZZ3A 4FUHA 3U8TH 2ZDAH 2AH4X 1EPTC 1YCPH 3T62A 2A0QB 2PV9B 1J15A 4BTIB 1C5ZB 1D6WA 1MZAA 1W2KH 2ALPA 1INCA 2SGAA 2BD3A 8ESTE 3GDVA 3B23B 1LVBA 2RG3A 3DFLA 4FUCA 1TALA 3QZRA 1WAYB 3GY5A 5DN6D 1MU6B 1T8NA 3ATLA 2H5DA 1SQAA 2GCTC 2GCHG 4CHAC 3GY4A 3OX7U 5CMXH 1MBQA 2R0LA 1O32A 2LELA 2BY5X 1G3EA 3FP7E 1THRH 2QF3A 1DDJA 4ZKOU 1AQ7A 1CSOE 1FXYA 1O3JA 1TGTA 4FVDA 4SGBE 3RMNH 1DWBH 1LPKB 1VCQA 4LXBH 4DJZB 1UVUH 1AN1E 1ZPZA 3CENA 4Q2KA 4Y10E 4AB9A 2EY4C 3RXLA 2ZHWH 1A3EH 2ZU1A 2VINA 3A8CA 4WH8A 1DM4B 2VU8E 1Z8GA 1TGNA 1GJ5H 3QK1A 2C93B 1SSXA 2ZDMA 1O2HA 4Q7ZA 7GCHG 2ZU2A 3P70B 4F4OC 3MU4A 4BXSA 2LNCA 5DPAA 2FIRH 1DSUA 1C5VA 4K60A 4J1YA 1V2TT 1RS0A 4CRAA 4X1QU 2WYJA 2FTLE 2JH6D 1P2MA 2QF5A 1CGHA 2WHXA 3LGWA 2ANYA 4Y6DA 1HDTH 1ZR0A 4RKOB 1SGNE 2K0QA 3EA9A 3S9AA 2ZECA 3HGPA 1UHBA 3UTUH 1C5PA 1XUHA 3A8DA 4UFEH 3SGAE 1O2QA 1P8VC 4I8LA 1UVTH 1HAXB 4K69A 2BOHB 5EOKA 1BQYA 2XNDD 1N1LA 3SU1A 1XM1A 3GYLB 4NZQA 2ODQA 1VITH 3UNSA 3T28A 1PPZA 3BTME 4CRFA 1ZZZA 4KTUA 1W14U 1ACBE 3RXTA 1O3AA 2DUCA 5JBTA 5C17A 1W13U 2ZDNA 4CRGA 1GJ4H 4X0WU 1LHCH 2TGPZ 1OYQA 1P01A 3RXQA 1RIWB 1K1MA 1WBGB 3C1KA 1XX9A 1W0JD 1HAOH 3ZZCA 2XCNA 5I25A 1DS2E 1WQSA 2AYWA 5E2PA 2W6JD 4AFSA 2FOEA 4ZH8A 1AHTH 1AVWA 3W1EA 2W26A 1WTGH 1W0KD 1QGFA 2OP9A 2ZFTA 3DCLA 1P09A 1AE5A 3M3VA 2HVYB 1A46H 2P95A 1C1MA 1ELVA 1XUJA 4X2YA 1OWKA 1HNEE 2PKSC 1B5GH 2QAAA 2BB4A 3Q77A 2CJIA 2WV4A 4JZFH 1ETRH 3L3TA 1Y5UT 1T4VH 3TH2H 1UJ1A 4ZMAH 3EA8A 4HI3A 1TWXB 4GLYA 1CBWC 1C1UH 2ZFPH 4GVUA 3CS0A 4M9FA 1UTNA 3ZVDA 1GHAF 1HGTH 1V2WT 2TGDA 2CV3A 4JYUH 3TJVA 3RXIA 4UFDH 4ASUD 1P12E 1G30B 2ZDLA 1T7CA 3PMJA 5EODA 3A7XA 3A8AA 2Z6BD 5FX6A 5F8XA 1MAXA 1NFXA 2XWAA 2C4FH 1ESBA 2FM2A 3V0XA 3M5LA 2FYQA 1C5TA 2G4TA 3SUEA 1HAYB 1ELEE 4I8KA 3P8OA 1DICA 3LIWA 2VWLA 2ZI2H 1FQ3A 2FOHA 1ZOMA 2J5UA 3MH6A 3OE7D 2Q6GA 4NG9H 2GDDA 2JETB 1HBTH 2ODYB 5F03A 3F1SB 3F9FA 2VNTA 2GCHF 3NWUA 1AVGH 3TJOA 1GG6C 1JRTA 4OS6A 1CGJE 1NM6A 1SQRA 4KKDA 1AMHA 1HJ8A 1D6RA 4D7GA 5DSFA 2J92A 2PGBB 1A0HB 4KTSA 2PP6A 2QXGA 2VIOA 3SU5A 2BD5A 3PYHA 3AK5A 3PV2A 5GDSH 2HOBA 3ZZ6A 3A88A 5DK1A 1OYTH 5AVDA 1L0ZA 2ZDVH 1X7AC 1O5DH 4NA7A 1C1VH 1O30A 1OPHB 4CBOA 4Y11E 1WDIA 7ESTE 1ELDE 4UONA 4THNH 1A5GH 4BAMB 1FPCH 2ANWA 2Y5HA 3OEED 2ZHDA 1FV9A 2GZ7A 3DSPA 1O5CB 4FUDA 7LPRA 2F9NA 4DW2U 1EP6A 4K8BA 3GCHB 3F9HA 4I8JA 4CBNA 7GCHF 1T31A 1ZMNA 4WF8A 4WXVA 3WW7A 1UMAH 2FLBH 2FS9A 1B7XB 1AB9B 1ZTKA 4DIIH 2P59A 1G36A 5AFYH 1GCTC 1O3CA 1F0SA 2G5VA 4NIXA 1TIOA 1C2MA 2GGVB 4Y71A 2ZTXA 1RD3B 1XVOA 1AZZA 1OP2A 2CF8H 3F0OA 3MNCA 1O2GH 1QY6A 1GPZA 3OSYA 1TBRH 1O37A 2PWXA 1EAUA 2UWLA 2VWMA 3F6UH 1GJCB 4JZ1A 1HLTH 4UFGH 4NIYA 4U30A 1O3IA 1O2SA 4NSVA 1DWCH 2PKAB 3QWCH 1QTFA 3RXFA 3EQ0H 3GOVB 3OAAD 2WPDD 2CN0H 3KIDU 5C0UA 1BBRE 2BX4A 3ZVFA 1MTWA 5FPTA 1AKSA 3BTKE 2W7SA 1UTKA 3KYFA 4Y79A 3URDA 1HAHH 3ZYDA 1VITF 3UQOA 3S9BA 5C1YA 4H42U 1O0DH 2F9OA 4ABJA 4GCHG 9LPRA 1TX8A 5HM2A 3BG8A 4XE4A 2STAE 5F8ZA 3GY2A 1ESTA 2VH0A 1NY22 4TWWA 1SGQE 3FFGA 1IQEA 1C5UA 3HKJB 1YCPK 1UCYE 2YNAA 1DWEH 3Q3YA 1XUFA 4LK4A 4AG1A 3FP8E 4IGDA 2C8XB 4ACAA 4Y7BA 3N7OA 5T6DA 5DP3A 1AFQC 1CGIE 1IQFA 1G3DA 4FUBA 1ELAA 3S7KB 4E05H 2SGFE 3OYPA 3OEHD 2EI7A 3I78A 4JCNA 1L1GA 2OD3B 3A84A 4Y0YE 4ISIH 3VG8A 3E3TA 1C5XB 2F9BH 1QL7A 1OKXA 4OS2A 1HAZB 1Y3XA 1HAVB 2F83A 1EASA 1TGCA 1UW7A 1TMUH 3S69A 2V35A 1GHZA 2IJOB 2EC9H 1TNKA 3FZZA 4F55A 1GHWH 3RC4A 2D2DA 2WUBA 1F5LA 2Y5GA 4P00A 5DJ7A 2HNTE 1TPOA 3AVZA 1TRNA 1T8MA 1C1SA 5JB9S 1BTXA 1VGCC 4JZEH 2QV1A 3V12A 1D3DB 1AIXH 2A4QA 3MH4A 5C1XA 1BTZA 3ESTA 5BPEA 4A7IB 3T26A 5DO4H 4MTBA 1EJNA 4MQAA 3UFAA 1C5OH 4DY7B 1P11E 4X1SU 1NBMD 1GBTA 3DSGA 3KEEA 4TPIZ 5CE1A 3BG4C 1F5RA 3UPEA 2Z9IA 3ZVCA 5FAHA 5IK2D 1TNHA 2BDIA 2I6QA 3SGQE 1PPHE 3A86A 3BTHE 2ZEBA 3A80A 4ISNA 3EA7A 4Y0ZE 5EPYA 6CHAC 5I46H 3AAVA 3GDUA 1NFWA 1JBUH 1OWEA 2PUQH 3TGJE 1P57B 1QL8A 3RP2A 3TH4H 5EXLA 3ENSB 2BHGA 1HV7A 1MD8A 2BVSH 4RT1A 1SOTA 1O2IA 4TT3D 2ZGBH 5BRRE 1SGFG 3STJA 5EJ1A 1FONA 1GI9B 1Y5BT 1Q2WA 3DHKH 1SLWB 2AGEX 2GCTB 1N8OC 4WXIA 5FBEA 1BA8B 3TITA 1BTPA 4B74A 3T29A 2VIWA 3A7WA 3ELAH 2KCAA 1DVAH 1QQ4A 4AZ2B 1MBMA 1IQKA 3SHCH 4DT4A 2Z3CA 1IQJA 1K22H 1TQ7B 3MTYA 4TPYA 3GDSA 4AG2A 4XSKU 4WH6A 4CRCA 2KFWA 1NS3A 3PO1B 3SBKA 1YM0A 3M5MA 2A5AA 3HPTB 5ESTE 1P3CA 1EZXC 2BDYA 3LJOA 2WPIS 2UUYA 1NROH 2RFKC 2AMPA 2I6SA 2XOKD 1S84A 3TLOA 2C90B 2V3HH 1BBRH 4X6PA 4ZKNU 1E35B 2R2WU 4ZKRU 4CRBA 3OY6U 4ZCNA 2Q6DA 5DP7A 3MFJA 1PPCE 2WPLS 1MCTA 6GCHG 1S0QA 1YY3A 3DFJA 1KXCA 3A81A 1CT4E 2BYAX 1AE8H 1C1RA 1QA0A 3AASA 4JK5A 3VGCC 3AW1A 1HRTH 1BT7A 1C2HA 4WVPE 5HMAA 1UTPA 1MMJN 4FXGH 2VIVA 2ZHFH 2OK5A 1AZ8A 2Q1JA 4IS5A 2JIZD 2WYGA 1XXFA 3RXDA 1HUTH 1E0FD 1LVOA 1KDQA 2ZCLP 3RMOH 4MDSA 3UOPA 1BMFD 1K1NA 1FY3A 4A92A 5HYOA 3A7VA 2OC1A 1YC0A 1BCUH 3U98H 1QL9A 1EB2A 1GHYH 1XKBC 1GBKA 4ZKSU 2FXRA 2G51A 1AUJA 2BQWB 5FX5A 1S81A 1T8OA 1A5HA 2GMTC 5EXMA 4E06H 1K2I1 1BZXE 1JRSA 2BTCE 1O2XA 1LQEA 3MHWU 1YPHC 1WV7H 1P06A 4INKA 1ELFA 3EGKH 5EGMA 1P9SA 1WCZA 4VGCC 1SGIB 2JH5D 1A5IA 2Z7FE 3EAJA 5A0BA 5TJXA 3RXBA 2V6NA 1WXRA 1SQTA 1V2PT 1C2JA 3HK6B 1FY8E 1FX0B 1GMCG 2GDEH 2WPJS 4QT8C 4MNWA 1EAXA 1F7ZA 1DWDH 4BAOB 1O38A 1MTVA 1FY1A 1KLTA 4AFZA 3LOXA 1TB6H 1YPJH 1YPKH 3A7ZA 4ZXYH 2ZWLH 3E91A 3WWBA 1LDTT 3RXKA 4WMDA 3ZZ8A 1DUEA 3SUGA 2AMQA 3KQBA 2ALVA 1DUAA 1CBWB 1QJ6B 4OS1A 1PQAA 4YXWD 1PPBH 3SOSA 1O2PA 4BAQB 2QF4A 1NRRH 1O3BA 1YBWA 3JZ2B 5T1VA 1Z7KA 3SORA 4NA8A 1KXBA 3V13A 3BIUH 4IC5A 1LKBA 5H4IB 1EUFA 1U6QA 2OC7A 1VJ9U 1A1RA 2PHBA 2FS8A 4D9RA 1V2JT 1NTPA 4I32A 1SMFE 3VB7A 1AUTC 3SNCA 2A7CA 2A45B 1F0RA 1VCWA 3DA9B 4RI0A 5DP5A 4K3JA 5DKMA 5EXNA 5EW1H 3BEFB 2HLCA 2XBYA 2EA3A 3MOCA 4O97A 1C4V2 1GBMA 4YTAA 1QIXB 1AWFH 2IJD1 1O33A 2WPKS 2RDEA 5CDFE 1GG6B 4FVBA 2HGTH 1QQUA 4ZAEA 1OSSA 4I8HA 3ZZAA 1SFQB 3KF2A 3SO3A 1BMMH 1ANEA 1ABJH 3BTTE 2XTTB 1UHBB 5A09A 4X8UH 3ZZ9A 1T8LA 1Q3XA 2H9TH 2ZGCA 2ZQ2A 1GJ9B 3VB3A 2CK3D 3K6YA 1SPJA 1GI6A 1TABE 1SGYE 1CVWH 6ESTA 1EP5A 4MNYA 2GJGA 2J95A 3LGIA 2V3OH 2XWBI 1LVMA 1UTQA 3MWIU 5C67A 3FN8A 3E16B 1QZ8A 1NPMA 4TWYA 3BN9A 4ABIA 4RKJB 2TRMA 4DIHH 4NFEA 1PPGE 4ZHLU 1V2OT 2Y6TA 5JBCS 6GCHF 1TAWA 4ABBA 3UQVA 1NU9A 2RCEA 2QY0B 1QFKH 3OTPA 4J2YB 4BANB 7KMEH 2PW8H 4Q4LA 1O3GA 2C8ZB 1DFPA 2ZPQA 3ZVBA 1OOKB 1W10U 4YT7H 2XC5A 3S9CA 3SGBE 3A7TA 1O3LA 3A85A 1SLUB 2ZNKH 1GMHG 5ABWA 1MAYA 5K0HA 2W3IA 1KXAA 2VVUA 2J98A 5C1UA 3O8CA 1XVMA 2QXIA 1S6FA 1ZLRA 1O2OA 2D26C 3BTEE 1ZHMA 1K1LA 4MNVA 2QXHA 2JJ1D 1GVLA 5KECA 1QRWA 2CF9H 4LOYH 1KXEA 1FUJA 1D4PB 3QX5H 1YYY1 4ABDA 3RU4T 5LPRA 5L2YH 2F4LA 3RXMA 3SQEE 2KCPA 1GDUA 4B2AA 3UR6A 1EKBB 3C27B 2CMYA 3GCNA 1TBZH 3MNXA 2H9EH 4NIVA 3SV8A 4O3UA 1HJAC 2F43B 3FANA 1SI5H 2P94A 1ZRKA 2QCYA 2L6OA 4XBBA 4DCDA 1C2GA 1YGCH 1MD7A 4I31A 2R3YA 3N7DA 1BRUP 1GMCF 2FOMB 3ZZ7A 2Z3DA 5AF9H 2BLVA 1TYNA 4IC6A 1EZQA 1NRSH 1C5SA 3QTOH 1MTNB 2VJ1A 2FOAA 3KYGA 1P2KA 2WV9A 3FZDA 1QRZA 3GISB 1BJUA 2PSXA 1TE0A 2GT7A 3E8LA 3LH3A 1NBME 1HYLA 3FKSD 4D9QA 2YNBA 3LC5A 5L2ZH 3TNTA 1DXPA 4B6FA 3RM2H 4B76A 1E34B 1O39A 4ISHH 4X6MA 5K7RA 3P8NA 1GBFA 2ZTYA 1C1NA 2F9PA 2BLWA 1AGJA 2KAIA 3GS9A 1QCPA 2H1UA 3MU5A 1SB1H 5A8ZA 3RXCA 1EAIA 3MQKC 2H5CA 4CRDA 1OXGA 2BY7X 1COWD 1VGCB 1GBHA 1W0ZU 5JPMH 4X1PU 4HFPB 1FIZA 1SG8B 3M5OA 1BBRK 3T2NA 4B75A 4AFQA 6LPRA 1O5EH 5E0GA 3UR9A 2XBWA 4XRNA 1TA2A 2BZAA 4TY6A 1S83A 3ZZ5A 1Y3VA 1RTKA 3OY5U 3SN8A 4XDEA 5A0CA 3MH5A 4MPWA 1AVXA 1L2EA 1NFUA 4NFFA 1WOFA 3MU0A 5JB8S 1TMBH 1YPGH 1SOZA 2C8WB 4FUIA 1E36B 5C3NA 1GBDA 5A2MH 3ZV8A 5JYIA 4A1TA 1EATA 2ULLA 3KGPA 4YOJA 4O03A 4DVAU 6CHAB 1HIAA 2V7QD 1SBWA 3HGNA 2KZ4A 3PWBA 2AS9A 3SJ8A 3OU0A 1TX7A 3BF6H 1OWHA 4H6SB 2ANMH 4B2CA 1F2SE 2V0BA 3MO9A 4TSFD 2RA0A 3RC5A 1C5QA 2Y7XA 4K1TA 1O3NA 2ZIQH 3QGNB 3UIRA 4O9VA 3UB0A 5TCCA 1AKSB 3WY8A 1H9LB 3S7HB 1EJMA 2XXLA 3PRBA 2A2XH 2ZF0H 4Z1MD 5CHBA 4FUGA 1D9IA 2OQUA 3M7TA 3U28C 1OWIA 3HATH 1IQIA 3RM0H 1VJAU 4CR5A 1GMHF 1B0EA 1TPPA 1W0YH 2ZFRH 1TGSZ 2J97A 4RT0A 2GP9B 1YLDA 2HPQH 2FO9A 2A5IA 1ID5H 2FEQH 2ZU3A 4XBDA 1C9PA 1QNJA 3LGUA 5C2ZA 3DT0H 3QDZB 3QLPH 1V2RT 1RRKA 3OFND 4NWKA 1YWUA 2NU4E 2WPMS 3RDZA 2VGCC 3L6PA 1YLNA 1GBEA 4H6TA 1THSH 1GJAB 1SGCA 1ZMJA 3UOUA 3SJ9A 2SGEE 8KME2 5T6GA 1TBQH 1O31A 3UY9A 2BD7A 2XW9A 1BMNH 1ABIH 2QIQA 1SC8U 3LONA 1GI3A 1BMAA 1OWDA 2GTBA 4YT6H 1KIGH 2A4GA 3Q3XA 3RXOA 4D76A 4F48B 2GV6A 4X1RU 1P9UA 2JKHA 3D65E 2GZ9A 2OLGA 3SU6A 1Z8RA 1C1PA 2A1DB 1ZSLA 4RN6A 2YOLA 3M7QA 1J8AA 5PTPA 2WV5A 2A31A 3VB4A 1OWJA 2NU3E 1O5BB 3LGYA 2AERH 4DT7B 3F9EA 1SGTA 1FLEE 2GD4B 1DE7H 3GICB 3VEQB 5C94A 1RGQA 1GBBA 1Y3UA 3U1IB 1GBCA 1HB0B 1C2FA 1CO7E 4ZUHA 1SLXB 4ASHA 1W8BH 1UTOA 2AHME 3ZVGA 1C2LA 5FPSA 1BRBE 1IHSH 1G3CA 4U2WA 3SV2H 3GCOA 2BXTH 2WPHS 2J38A 4YZUA 2BVRH 3E0PB 4ABHA 8GCHG 1GVKB 1PQ7A 8LPRA 2ZPSA 4MG3A 2M2AA 2FI4E 4VGCB 3PROA 1Y8TA 1ZGVA 2BMGB 1BTHH 1MTUA 4X6OA 2ZC9H 4AORA 2PKAA 5E0HA 2XYAA 3NK8A 1MCVA 2GKVE 3H5CB 2KCYA 3TVJB 1NN6A 1AO5A 4NA9H 2ZZUH 2QE7D 1BJVA 1GJ8B 2OXSA 3GYMA 3RU4D 1QB9A 2AMDA 3K9XB 1KXDA 3SNBA 1BMLA 3P8FA 1RXPA 3RUOA 3VFEA 1GWAA 3A82A 1OX1A 1SVPA 2FESH 1V2QT 1ZSJA 1LO6A 3TH3H 3U69H 3AW0A 4BXWA 4Z0KA 2GV7A 1QBVH 1SGDE 2WZQA 2JETC 2K1QA 3KQ5A 1XUKA 1GGDB 2PFEA 1EQ9A 5GNDA 2BD4A 4P02A 2ZFFH 2BD9A 4MPUA 3V3MA 1EPTB 4F49A 2QXJA 3TPIZ 5C5NA 2AFQB 1K1JA 5AHGH 4YLUA 4IBLH 5AFZH 1HCGA 1GBIA 3MNBA 1C1QA 1ZYOA 1CU1A 3P95A 1SKYE 1KMHB 1YP9A 4R0IA 4BAHB 3MMGA 4ACBA 3IITA 2HPPH 2PSYA 3GCTG 2SNVA 3RLYH 2PR3A 4FU9A 5KEDA 4B6EA 1FNIA 3M37A 1Y3WA 2BY8X 3O8DA 3UWIA 5FBIA 4CHAB 3RMMH 1S85A 2VIQA 1GJ6A 1LPGB 2SGDE 5ETXA 1H4WA 3VPKA 3PLKA 5FHTA 2AIQA 1D3TB 1Y59T 2FX4A 1DY8A 5E0JA 3BIVH 1KDQB 2ZDKA 1BRAA 1UK2A 4YOGA 3SU3A 1IQGA 2B7DH 2XBVA 1V2ST 1W7XH 4UE7H 1H8IH 5JBBS 3U9AH 3A87A 4X2XA 1HXFH 2XBXA 1A61H 3SI3H 5HKKD 5EPNA 3SNEA 1SL3A 2FLRH 1V6DA 3SW2B 3A7YA 1CT0E 2A5KA 2UUJB 3RLWH 3LGTA 1YPEH 4ZHMU 1FAKH 2DE9A 2HALA 2NWNA 2O8UA 2ZA5A 5FCRA 1NU7B 3KQDA 3SUDA 1ETSH 1SR5C 1HXEH 2ESTE 1L4DA 3QO6A 1WUNH 1YKTA 3ODDA 1C1WH 1UVOA 5KGOA 1RJXB 3W94A 4UDWH 4GCHF 4GSOA 5F53A 5GWZA 4TY7A 4X8SH 1KTSB 3DSOA 4I8GA 1QRXA 3M61U 1TRMA 4OS5A 5C20A 4ESTE 4INLA 2P3FH 1N6XA 1H8ED 4FUFA 1ZPCA 3LU9B 1J9CH 1ZGIA 1SGPE 1UCYH 2BDGA 2IPHA 5L30H 3RXPA 3UNRA 1LTOA 3KHVA 2AGIX 2XNIA 2CGAA 4GHTA 3O8RA 1P2QA 1EZSC 1O2JA 1H9HE 3SJKA 3U8RH 4NIWA 1FZZA 4O3TA 1G2MA 4Z6AH 3FP6E 1LHDH 4XFQA 4Y8XA 2SFAA 1O5FH 4YESB 2Y5FA 1O2MA 1VKYA 1V2LT 1C1TA 2EI8A 4AX9H 2O8TA 2XC0A 3LJJA 3SJIA 8GCHF 1UVPA 1GDQA 4A6LA 3ATWA 4SGAE 1GHVH 2WINI 1K21H 1TA6A 2ZFQH 1K28D 1A0JA 1HJAB 2Y81A 1JWTA 4NGAH 4ABAA 1W3CA 2Y82A 4X6NA 1SGEE 2A2QH 4GHQA 3SYJA 1ELBA 1KTTB 3Q76A 1Z6JH 3ZZ4A 4HGCA 1O2WA 3LKWA 2ZG0H 2D1JA 1GBLA 2A32A 2IOTA 2FODA 1CA0C 1G3BA 2Z9KA 2PKSB 2W5EA 3NUMA 3T25A 3KQCA 4CR9A 2TBSA 3M36A 4GPGA 3QN7A 3P92A 4WMFA 1O3EA 5C5OA 3ZVAA 1K1PA 2BDBA 1XUGA 2ASUB 4ISOA 3E6PH 4DURA 3DUXH 1LHEH 1UVSH 2BLQA 5GCHG 2G5NA 1GVZA 3S0NA 3PTBA 2C3SA 2BDHA 1LQDB 3A8BA 2CHAC 2SGQE 4JZDH 4AOQA 3PMHB 1L1JA 3QZQA 1JIMA 1MKXK 2HWLB 2PUXB 2H2ZA 3B8JA 1MQ6A 4LZ1H 1QHRB 1IOEA 1W12U 5CHAC 2UWPA 1BB0B 1MABB 3GCTF 3K2UA 3M7UA 2R0KA 2NU0E 1CHGA 1QA7A 3SV9A 1E79D 4MVNA 2JJ2D 4B1TA 1TPSA 1O2YA 5DGJA 1G9IE 3ZZDA 2IN2A 2OQ5A 5EIYA 2J98B 2STBE 3DD2H 2EEKA 5JBAS 1KLIH 1ANDA 1DSTA 1VZQH 3T5FH 1IAUA 1DITH 2UWOA 3QUMP 5DP6A 1TNLA 2R3UA 1GHXH 1V2MT 1JXPA 2A4RA 2EQNA 4TYDA 1TOMH 3P8GA 5EU8A 1HJ9A 4WWYA 1O2VA 5A8XA 5J4SA 1P0SH 1KLJH 2FP7B 4JYVH 4K1SA 2BDAA 1P2IA 4AYVB 1JOUB 4OM9A 1ELTA 2P3TB 4FETA 1YPMH 2B5TB 1BHXB 1AI8H 1ZPBA 1GBAA 3B9FH 5HXFA 2HLDD 4JMYA 1C5RA 1CQQA 5GPIB 3T27A 1DPOA 1PQ5A 2Y7ZA 5GIBA 3TNSA 2Z9GA 1BTYA 4XOJA 2YMSC 1E1QD 3PO1C 3RXRA 1O34A 3E90B 3K65B 2R9PA 1GCTB 3MU8A 1O3KA 3PMAB 3ZZBA 3UREA 2TIOA 3MH7A 3NXPA 1BOQA 3STIA 3TJUA 2OINA 2F9VA 4K1EA 1TNJA 1C1OA 2VGCB 3GY6A 2ILNA 3K6ZA 4OS7A 5LGOA 3BTWE 3BTDE 1C5YB 1GI5A 1T4UH 1V2UT 2BQ7B 2ANKH 3P6ZB 2VWNA 4IMQA 5EJLA 3RXEA 4CH8B 2VVCA 1HAGE 1GHBG 3TK5A 1SLVB 1O2TA 2VWOA 3PLPA 5DP4A 3FVFB 3PM3A 2Z94A 1MH0A 4UFFH 1TPAE 1VCPA 4ZHAA 3N7EA 1TNIA 2QF0A 3PB1E 1D3QB 4KGAA 2QGRA 4CREA 3I29A 1BIOA 4YOIA 1IQMA 2KAIB 1EOJA 1LVYA 1M9UA 1S5SA 4YO9A 1HAPH 1NRPH 3ODFA 4Q7XA 1C5WB 1O2RA 2K8IA 3JZ1B 3TU7H 4JZIA 3EYDA 4ISLA 2O8MA 1FY4A 3Q00A 3NZIA 1AWHB 2F9UA 3U8OH 4NCYA 3AAUA 4GUXA 3BSQA 3H7TA 2ZTZA 2SGPE 2BX3A 1PFXC 5F6MA 4X8VH 2FOGA 2FDAA 2P8OC 1S0RA 1MUEB 1OP8A 1OP0A 1O3PB 3RU4E 1S6HA 1Z8JB 1LPZB 1MKWH 1N6YA 1WQVH 1AFQB 1CE5A 1JIRA 1MU8B 4AGJA 3LH1A 1VITG 4X2WA 5EQRA 3ATKA 4BAKB 1A4WH 2HNTF 3LC3A 1TGBA 1Z8IB 3LPRA 4Q63A 2BY9X 1PJPA 2ZQ1A 1HIAB 1K1IA 2XC4A 1L1NA 1GL1A 1MZDA 3M3TA 5EQQA 5GCHF 2OBOA 1O2KA 1NC6A 3P17H 1P04A 1K1OA 1NFYA 4FU8A 3RXHA 3RXJA 3F2GA 1E38B 1T32A 1ZJKA 2FPZA 3N99A 1EB1H 3E1XB 2BVXH 5IDKA 2G8TA 4H4FA 1ZTJA 5LPFA 1O3HA 3H09A 2WSSD 2Q6FA 3D62A 1FN6A 1JMOH 1J17T 1O2LA 4ABEA 3MNSA 4D7FA 1EXFA 2FX6A 1FMGA 2YMSD 1P02A 1HPGA 3SNDA 1OS8A 4AFUA 2KM0A 2ZU4A 1HAIH 4RSPA 1QBNA 1QJ7B 3U1JB 1H9IE 3EE0B 1C4U2 1DT2A 5EW2H 3HKIB 4CH2B 1Z1IA 4IMZA 4IN1A 3BG4B 1B0FA 3FO8D 2M5TA 4K5ZA 1QJ1B 1KSNA 1CT2E 5FL7D 1XMNB 1EZUC 5EJZA 3SU2A 3SI4H 1UCYK 4AB8A 1SGFA 3I77A 3GY8A 1EAWA 4E7RG 1QURH 3ATMA 3ZIAD 1P10A 1ORFA 4Y8ZA 5DP8A 1TOCB 1H8DH 4AYYB 2OUAA 1L4ZA 1CHOG 3MO3A 2W6ID 5B6LA 4MLFB 3LT3A 1ARBA 4JYTA 1ZTLA 1EJAA 1LHGH 2C8YB 4OGYA 1C4Y2 1N8OB 1XXDA 3BTGE 3MI4A 1QB1A 3GY3A 1O2UA 2HRVA 4BOHA 2A7JA 3TJNA 5T6FA 3H7OA 1P3EA 2QN5T 3PRDA 1V2KT 1QBOA 1IQLA 1DLKB 1XUIA 1Q31A 5HIYA 5FPYA 3G01A 1Z71A 3UNQA 4DOQA 2P3UB 2BZ6H 1IQHA 2ZCHP 2KCOA 2VVVA 2IPQX 1MKXH 1GHBF 4NSYA 1PPEE 2P93A 2ZO3H 3NRLA 3MYWA 2KR7A 3L33A 1UTJA 1ELCA 1W7GH 1TX6A 1ARCA 1UK3A 1P2OA 1THPB 3SUFA 3ZV9A 3KN2A 5FCKA 3O8BA 1NRQH 1FIWA 1DX5M 3ATIA 1ELGA 3CP7A 3D49H 5C0TA 1ZRBA 2NU2E 5G4BA 4A5TS 4DG4A 1ZHRA 3F68H 1KYNA 2FMJA 2UUFB 1FJSA 1V2VT 1GI0A 1TONA 3VGCB 2AIPA 3VXFH 3UAIC 4FU7A 1F0UA 1LKAA 1K0HA 5HM9A 2GVFA 2ZKSA 1C2DA 1BRCE 1YCPM 4GAWA 4KP0A 3FOAA 2FZZA 1WYKA 1UK4A 3MU1A 5J4QA 2QYIA 5LH8A 1RIWC 1EFRD 3Q3KA 2TPIZ 1GL0E 1F0TA 1WSSH 3F9GA 4KTCA 2ZCKP 1LMWB 2PGQB 2BD2A 4KELA 2B8OH 1CA8B 3RXUA 2FOFA 2VIDA 2ZGHA 2ZP0H 1O35A 4WMEA 2FI3E 3F2FA 3WWFA 1LHFH 4YLQH 5EQSA 1V3XA 5IYTA 2B0FA 2KX4A 2FWWA 4HG6A 4U01A 4ABFA 3SNAA 2GMTB 5A8YA 2W3KA 1C5MD 1YF4A 2P16A 1UTMA 3NCLA 1P2NA 2H9HA 1MTNC 9ESTA 4FUEA 4DGJA 2NU1E 3HK3B 1WTHD 4FUJA 3KQEA 2Y80A 1A2CH 1TMTH 5L6NH 5LPEA 1O5AB 1H8HD 1DXWA 1ZSKA 3A89A 3M5NA 2VH6A 4XD7D 5T3HA 2AGGX 4BNRA 1C9TA 2VB0A 2FYRA 3RXAA 1CA0B 4UD9H 5FXLA 2BY6X 1BITA 4Q7YA 3BEUA 1SFIA 3SU0A 2PLXA 1GI2A 1ZMLA 1ZHPA 1EX3A 3M3SA 1GMDG 4E7NA 3VXEH 1GCDA 3IWMA 3ITIA 1W11U 1TNGA 1IQNA 2RDLA 3UWJH 4NZLA 2HVXA 1O3FA 2UUKB 1TRYA 3PWCA 1FY5A 2FOBA 4M7GA 3URCA 4AGKA 2ZPRA 1HFDA 1ETTH 2CHAB 3KNXA 3SHAH 1E1RD 4INHA 2ZU5A 2Z3EA 2ZFSA 5GXPA 1RFNA 2AEIH 1CHOF 4IN2A 1C2KA 1BUIA 3TK9A 2PTCE 1DLEA 4LZ4B 1PYTC 5CHAB 3VB6A 3R3GB 1ANCA 2BM2A 2V3MA 4WJG2 3BEIB 3OTJE 2J9NA 3GY7A 5HIZA 2ZHEH 1HAVA 3TGIE 1YPHE 1SQOA 3PTNA 2F91A 1OHHD 2FOCA 4R8TB 1KXFA 1UTLM 2BD8A 3RXSA 1K9OE 2WUCA 1FN8A 1GJDB 1RTLA 2SNWA 1C2EA 1YPLH 5DG6A 1TFXA 3PLBA 4I7YH 3GCHC 3UUZA 1Z1JA 2ODPA 1G32B 5B6OA 1GI7B 3KL6A 5JDUB 2TGTA 1O5GH 5SGAE 3SV6A 2G52A 1SHHB 1G2LA 3QTVH 1AB9C 4X1NU 4UEHH 4YM9A 1RTFB 1WU1A 3E0NB 3BTFE 2G55A 2RA3A 1MKWK 4AC9A 2CXVA 4HZHA 1AD8H 2BXUH 1ESAA 3PV4A 1O2ZA 2DE8A 2JH0D 1O3DA 3D23A 4ZXXH 1Z6EA 2VBCA 3SV7A 1SHYA 3ZVEA 2YMSB 2QA9E 1GJBB 2OC8A 1S6LA 1DANH 2GZ8A 3FAOA 1C5NH 2D8WA 1C2IA 4Y76A 2O8LA 4Y7AA 1BTUA 1FI8A 2LP6A 3IG6B 2J94A 3BTQE 1SGRE 3BV9B 1MTSA 2EI6A 4MPXA 3SZNA 4K2YA 1EPTA 4I33A 2H6MA 4B2BA 3V7TA 4JK6A 1J16A 2BOKA 1BDAA 2OC0A 3QGJA 4XBCA 2J34A 2HNTC 4FOUC 2TGAA 4MPVA 3PV5A 1S82A 4U32A 5ESBA 1O2NA 3W95A 4BTUB 1FPHH 1GI8B 3EE7A 5DP9A 3LGVA 3M35A 1P2JA 5E8EH 2J2UA 5A0AE 1A3BH 2FI5E 1A7SA 1BHXF 1G37A 3RMLH 4A1XA 1QB6A 3VB5A 1MQ5A 1NO9H 4NWLA 2GT8A 1FDPA 2O8WA 1V2NT 1F5KU 2ZGXH 4B73A 3ZYEA 2W7UA 3CS7A 4OGXA 1O3MA 4PROA 1KY9A 2L74A 2F3CE 5F8TA 1A0LA 5E2OA 3CNRA 1YLCA 2THFB 2G81E 1O36A 1PQ8A 2ZHQH 1QR3E 2LPRA 3TIUA 1ANBA 2A7HA 1J14A 3F3BA 3SU4A 4IW4E 1EOLA 3SJOA 4X2VA 1IHTH 3LDXH 2O9QA 2OBQA 3R0FA 4BTTB 1PYTD 2B9LA 1VR1H 1TLDA 4B71A 1O3OA 1AY6H 1ZJDA 4Y8YA 3TGKE 2P8OB 3RXGA 1DOJA 4WY3A 4X8TH 1GBJA 4ZROA 1UO6A 1GI1A 3RC6A 2XRCA 5GJ4B 2BLOA 1GDNA 1GMDF 1D3PB 1BTWA 1LCYA 1NT1A 1PPFE 2Z9JA 5EG4A 3NKKA 2G4UA 3A83A 1F92A 1NZQH 1Y5AT 5TCAA 1GI4A 2J4IA 4OS4A 4MNXA 1P05A 3EDXB 1NRNH 2FTMA 3RXVA 3SQHE 3MO6A 2VIPA 1NESE 2QC2A 2A4OA 3F0PA 1AU8A 5HGGA 3SZEA 1E37B 4Q80A 2JDID 4ABGA
chains in the Genus database with same CATH topology
2XCFA 3NPSA 1DY9A 1XKAC 4AN7A 1TQ0B 2ZGJA 4K8YA 1H1BA 3KCGH 2PTNA 1C5LH 2OCVB 4HTCH 4A1VA 2Z9LA 2BDCA 2BQ6B 2G00A 2R2MB 1P03A 1Y3YA 3PMBB 1GHAG 2GX4A 1AFEH 2OTVA 4D8NA 1GGDC 3TK6A 1FAXA 1GJ7B 3ZZ3A 4FUHA 3U8TH 2ZDAH 2AH4X 1EPTC 1YCPH 3T62A 2A0QB 2PV9B 1J15A 4BTIB 1C5ZB 1D6WA 1MZAA 1W2KH 2ALPA 1INCA 2SGAA 2BD3A 8ESTE 3GDVA 3B23B 1LVBA 2RG3A 3DFLA 4FUCA 1TALA 3QZRA 1WAYB 3GY5A 1MU6B 1T8NA 3ATLA 2H5DA 1SQAA 2GCTC 2GCHG 4CHAC 3GY4A 3OX7U 5CMXH 1MBQA 2R0LA 1O32A 2BY5X 1G3EA 3FP7E 1THRH 2QF3A 1DDJA 4ZKOU 1AQ7A 1CSOE 1FXYA 1O3JA 1TGTA 4FVDA 4SGBE 3RMNH 1DWBH 1LPKB 1VCQA 4LXBH 4DJZB 1UVUH 1AN1E 1ZPZA 3CENA 4Q2KA 4Y10E 4AB9A 3RXLA 2ZHWH 1A3EH 2ZU1A 2VINA 3A8CA 4WH8A 1DM4B 2VU8E 1Z8GA 1TGNA 1GJ5H 3QK1A 2C93B 1SSXA 2ZDMA 1O2HA 4Q7ZA 7GCHG 2ZU2A 3P70B 4F4OC 3MU4A 4BXSA 2LNCA 5DPAA 2FIRH 1DSUA 1C5VA 4K60A 4J1YA 1V2TT 1RS0A 4CRAA 4X1QU 2WYJA 2FTLE 2JH6D 1P2MA 1CGHA 3LGWA 2ANYA 4Y6DA 1HDTH 1ZR0A 4RKOB 1SGNE 3EA9A 3S9AA 2ZECA 3HGPA 1UHBA 3UTUH 1C5PA 1XUHA 3A8DA 4UFEH 3SGAE 1O2QA 1P8VC 4I8LA 1UVTH 1HAXB 4K69A 2BOHB 5EOKA 1BQYA 1N1LA 3SU1A 1XM1A 3GYLB 4NZQA 2ODQA 1VITH 3UNSA 3T28A 1PPZA 3BTME 4CRFA 1ZZZA 4KTUA 1W14U 1ACBE 3RXTA 1O3AA 2DUCA 5JBTA 1W13U 2ZDNA 4CRGA 1GJ4H 4X0WU 1LHCH 2TGPZ 1OYQA 1P01A 3RXQA 1RIWB 1K1MA 1WBGB 3C1KA 1XX9A 1HAOH 3ZZCA 2XCNA 5I25A 1DS2E 1WQSA 2AYWA 5E2PA 4AFSA 2FOEA 4ZH8A 1AHTH 1AVWA 2W26A 1WTGH 1QGFA 2OP9A 2ZFTA 1P09A 1AE5A 3M3VA 1A46H 2P95A 1C1MA 1ELVA 1XUJA 4X2YA 1OWKA 2PKSC 1HNEE 1B5GH 2QAAA 2BB4A 3Q77A 2CJIA 2WV4A 4JZFH 1ETRH 3L3TA 1Y5UT 1T4VH 3TH2H 1UJ1A 4ZMAH 3EA8A 4HI3A 1TWXB 4GLYA 1CBWC 1C1UH 2ZFPH 4GVUA 3CS0A 1UTNA 3ZVDA 1GHAF 1HGTH 1V2WT 2TGDA 2CV3A 4JYUH 3TJVA 3RXIA 4UFDH 1P12E 1G30B 2ZDLA 1T7CA 3PMJA 5EODA 3A7XA 3A8AA 2Z6BD 5FX6A 5F8XA 1MAXA 1NFXA 2XWAA 2C4FH 1ESBA 2FM2A 3V0XA 3M5LA 2FYQA 1C5TA 2G4TA 3SUEA 1HAYB 1ELEE 4I8KA 3P8OA 1DICA 3LIWA 2VWLA 2ZI2H 1FQ3A 2FOHA 1ZOMA 3MH6A 2Q6GA 4NG9H 2GDDA 2JETB 1HBTH 2ODYB 5F03A 3F1SB 3F9FA 2VNTA 2GCHF 3NWUA 1AVGH 3TJOA 1GG6C 1JRTA 4OS6A 1CGJE 1NM6A 4KKDA 1AMHA 1HJ8A 1D6RA 4D7GA 2J92A 2PGBB 1A0HB 4KTSA 2QXGA 2VIOA 3SU5A 2BD5A 3PYHA 5GDSH 2HOBA 3ZZ6A 3A88A 5DK1A 1OYTH 5AVDA 1L0ZA 2ZDVH 1X7AC 1O5DH 4NA7A 1C1VH 1O30A 1OPHB 4CBOA 4Y11E 7ESTE 1ELDE 4UONA 4THNH 1A5GH 4BAMB 1FPCH 2ANWA 2Y5HA 2ZHDA 1FV9A 2GZ7A 4FUDA 1O5CB 7LPRA 2F9NA 4DW2U 1EP6A 4K8BA 3GCHB 3F9HA 4I8JA 4CBNA 7GCHF 1T31A 1ZMNA 4WF8A 4WXVA 1UMAH 2FLBH 2FS9A 1B7XB 1AB9B 1ZTKA 4DIIH 2P59A 1G36A 5AFYH 1GCTC 1O3CA 1F0SA 2G5VA 4NIXA 1TIOA 1C2MA 2GGVB 4Y71A 2ZTXA 1RD3B 1XVOA 1AZZA 1OP2A 2CF8H 3MNCA 1O2GH 1QY6A 1GPZA 3OSYA 1TBRH 1O37A 2PWXA 1EAUA 2UWLA 2VWMA 3F6UH 1GJCB 4JZ1A 1HLTH 4UFGH 4NIYA 4U30A 1O3IA 1O2SA 4NSVA 1DWCH 2PKAB 3QWCH 1QTFA 3RXFA 3EQ0H 3GOVB 2CN0H 3KIDU 1BBRE 2BX4A 3ZVFA 1MTWA 5FPTA 1AKSA 3BTKE 2W7SA 1UTKA 4Y79A 3URDA 1HAHH 3ZYDA 1VITF 3UQOA 3S9BA 5C1YA 4H42U 1O0DH 2F9OA 4ABJA 4GCHG 9LPRA 1TX8A 5HM2A 3BG8A 4XE4A 2STAE 5F8ZA 3GY2A 1ESTA 2VH0A 1NY22 4TWWA 1SGQE 3FFGA 1IQEA 1C5UA 3HKJB 1YCPK 1UCYE 2YNAA 1DWEH 3Q3YA 1XUFA 4LK4A 4AG1A 3FP8E 4IGDA 2C8XB 4Y7BA 3N7OA 5T6DA 5DP3A 1AFQC 1CGIE 1IQFA 1G3DA 4FUBA 1ELAA 3S7KB 4E05H 2SGFE 3OYPA 4JCNA 2EI7A 3I78A 1L1GA 2OD3B 3A84A 4Y0YE 4ISIH 3E3TA 1C5XB 2F9BH 1QL7A 1OKXA 4OS2A 1HAZB 1Y3XA 1HAVB 2F83A 1EASA 1TGCA 1TMUH 3S69A 2V35A 1GHZA 2IJOB 2EC9H 1TNKA 3FZZA 1GHWH 3RC4A 2D2DA 2WUBA 1F5LA 2Y5GA 5DJ7A 2HNTE 1TPOA 3AVZA 1TRNA 1T8MA 1C1SA 5JB9S 1BTXA 1VGCC 4JZEH 2QV1A 3V12A 1D3DB 1AIXH 2A4QA 3MH4A 5C1XA 1BTZA 3ESTA 5BPEA 4A7IB 3T26A 5DO4H 4MTBA 1EJNA 4MQAA 3UFAA 1C5OH 4DY7B 1P11E 4X1SU 1GBTA 3KEEA 4TPIZ 5CE1A 3BG4C 1F5RA 3UPEA 2Z9IA 3ZVCA 5FAHA 1TNHA 2BDIA 2I6QA 3SGQE 1PPHE 3A86A 3BTHE 2ZEBA 3A80A 4ISNA 3EA7A 4Y0ZE 5EPYA 6CHAC 5I46H 3AAVA 3GDUA 1NFWA 1JBUH 1OWEA 2PUQH 3TGJE 1P57B 1QL8A 3RP2A 3TH4H 5EXLA 3ENSB 2BHGA 1HV7A 1MD8A 2BVSH 1SOTA 1O2IA 2ZGBH 5BRRE 1SGFG 3STJA 1FONA 1GI9B 1Y5BT 1Q2WA 3DHKH 1SLWB 2AGEX 2GCTB 1N8OC 4WXIA 5FBEA 1BA8B 3TITA 1BTPA 4B74A 3T29A 2VIWA 3A7WA 3ELAH 1DVAH 1QQ4A 4AZ2B 1MBMA 1IQKA 3SHCH 2Z3CA 1IQJA 1K22H 1TQ7B 3MTYA 4TPYA 3GDSA 4AG2A 4XSKU 4WH6A 4CRCA 1NS3A 3PO1B 3SBKA 1YM0A 3M5MA 2A5AA 3HPTB 5ESTE 1P3CA 1EZXC 2BDYA 3LJOA 2WPIS 2UUYA 1NROH 2AMPA 2I6SA 1S84A 3TLOA 2C90B 2V3HH 1BBRH 4X6PA 4ZKNU 1E35B 2R2WU 4ZKRU 4CRBA 3OY6U 2Q6DA 5DP7A 3MFJA 1PPCE 2WPLS 1MCTA 6GCHG 1S0QA 3DFJA 1KXCA 3A81A 1CT4E 2BYAX 1AE8H 1C1RA 1QA0A 3AASA 4JK5A 3VGCC 3AW1A 1HRTH 1BT7A 1C2HA 4WVPE 5HMAA 1UTPA 1MMJN 4FXGH 2VIVA 2ZHFH 1AZ8A 2Q1JA 4IS5A 2WYGA 1XXFA 3RXDA 1HUTH 1E0FD 1LVOA 1KDQA 2ZCLP 3RMOH 4MDSA 3UOPA 1K1NA 1FY3A 4A92A 5HYOA 3A7VA 2OC1A 1YC0A 1BCUH 3U98H 1QL9A 1EB2A 1GHYH 1XKBC 1GBKA 4ZKSU 2FXRA 2G51A 1AUJA 2BQWB 5FX5A 1S81A 1T8OA 1A5HA 2GMTC 5EXMA 4E06H 1K2I1 1BZXE 1JRSA 2BTCE 1O2XA 1LQEA 3MHWU 1YPHC 1WV7H 1P06A 4INKA 1ELFA 3EGKH 5EGMA 1P9SA 1WCZA 4VGCC 1SGIB 2JH5D 1A5IA 2Z7FE 3EAJA 5A0BA 5TJXA 3RXBA 2V6NA 1SQTA 1V2PT 1C2JA 3HK6B 1FY8E 2GDEH 1GMCG 2WPJS 4QT8C 4MNWA 1EAXA 1F7ZA 1DWDH 4BAOB 1O38A 1MTVA 1FY1A 1KLTA 4AFZA 3LOXA 1TB6H 1YPJH 1YPKH 3A7ZA 4ZXYH 2ZWLH 3E91A 1LDTT 3RXKA 4WMDA 3ZZ8A 1DUEA 3SUGA 2AMQA 3KQBA 2ALVA 1DUAA 1CBWB 1QJ6B 4OS1A 1PQAA 1PPBH 3SOSA 1O2PA 4BAQB 1NRRH 1O3BA 1YBWA 3JZ2B 3SORA 1Z7KA 4NA8A 1KXBA 3V13A 3BIUH 4IC5A 1LKBA 5H4IB 1EUFA 1U6QA 2OC7A 1VJ9U 1A1RA 2PHBA 2FS8A 4D9RA 1V2JT 1NTPA 4I32A 1SMFE 3VB7A 1AUTC 3SNCA 2A7CA 2A45B 1F0RA 1VCWA 3DA9B 5DP5A 4K3JA 5DKMA 5EXNA 5EW1H 3BEFB 2HLCA 2XBYA 2EA3A 3MOCA 4O97A 1C4V2 1GBMA 4YTAA 1QIXB 1AWFH 1O33A 2WPKS 1GG6B 4FVBA 2HGTH 1QQUA 4ZAEA 1OSSA 4I8HA 3ZZAA 1SFQB 3KF2A 3SO3A 1BMMH 1ANEA 1ABJH 3BTTE 2XTTB 1UHBB 5A09A 4X8UH 3ZZ9A 1T8LA 1Q3XA 2H9TH 2ZGCA 2ZQ2A 1GJ9B 3VB3A 3K6YA 1SPJA 1GI6A 1TABE 1SGYE 1CVWH 6ESTA 1EP5A 4MNYA 2J95A 3LGIA 2V3OH 2XWBI 1LVMA 1UTQA 3MWIU 5C67A 3E16B 1NPMA 4TWYA 3BN9A 4ABIA 4RKJB 2TRMA 4DIHH 4NFEA 1PPGE 4ZHLU 1V2OT 2Y6TA 5JBCS 6GCHF 1TAWA 4ABBA 3UQVA 1NU9A 2RCEA 2QY0B 1QFKH 4J2YB 4BANB 7KMEH 2PW8H 1O3GA 2C8ZB 1DFPA 2ZPQA 3ZVBA 1OOKB 1W10U 4YT7H 2XC5A 3S9CA 3SGBE 3A7TA 1O3LA 3A85A 1SLUB 2ZNKH 1GMHG 5ABWA 1MAYA 5K0HA 2W3IA 1KXAA 2VVUA 5C1UA 3O8CA 1XVMA 2QXIA 1S6FA 1ZLRA 1O2OA 2D26C 3BTEE 1ZHMA 1K1LA 4MNVA 2QXHA 1GVLA 1QRWA 2CF9H 4LOYH 1KXEA 1FUJA 1D4PB 3QX5H 1YYY1 4ABDA 3RU4T 5LPRA 5L2YH 3RXMA 3SQEE 1GDUA 4B2AA 3UR6A 1EKBB 3C27B 2CMYA 3GCNA 1TBZH 3MNXA 2H9EH 4NIVA 3SV8A 4O3UA 1HJAC 3FANA 1SI5H 2P94A 1ZRKA 2QCYA 4XBBA 4DCDA 1C2GA 1YGCH 1MD7A 4I31A 2R3YA 1BRUP 1GMCF 2FOMB 3ZZ7A 2Z3DA 5AF9H 2BLVA 1TYNA 4IC6A 1EZQA 1NRSH 1C5SA 3QTOH 1MTNB 2VJ1A 2FOAA 1P2KA 3FZDA 1QRZA 3GISB 1BJUA 2PSXA 1TE0A 2GT7A 3E8LA 3LH3A 1HYLA 4D9QA 2YNBA 3LC5A 5L2ZH 3TNTA 1DXPA 3RM2H 4B76A 1E34B 1O39A 4ISHH 4X6MA 5K7RA 3P8NA 1GBFA 2ZTYA 1C1NA 2F9PA 2BLWA 1AGJA 2KAIA 1QCPA 2H1UA 3MU5A 1SB1H 5A8ZA 3RXCA 1EAIA 2H5CA 4CRDA 1OXGA 2BY7X 1VGCB 1GBHA 1W0ZU 5JPMH 4X1PU 4HFPB 1FIZA 1SG8B 3M5OA 1BBRK 3T2NA 4B75A 4AFQA 6LPRA 1O5EH 5E0GA 3UR9A 2XBWA 1TA2A 2BZAA 4TY6A 1S83A 3ZZ5A 1Y3VA 1RTKA 3OY5U 3SN8A 4XDEA 5A0CA 3MH5A 4MPWA 1AVXA 1L2EA 1NFUA 4NFFA 1WOFA 3MU0A 5JB8S 1TMBH 1YPGH 1SOZA 2C8WB 4FUIA 1E36B 5C3NA 1GBDA 5A2MH 3ZV8A 5JYIA 4A1TA 1EATA 2ULLA 3KGPA 4YOJA 4O03A 4DVAU 6CHAB 1HIAA 1SBWA 3HGNA 3PWBA 2AS9A 3SJ8A 3OU0A 1TX7A 3BF6H 1OWHA 4H6SB 2ANMH 4B2CA 1F2SE 2V0BA 3MO9A 3RC5A 2RA0A 1C5QA 2Y7XA 4K1TA 1O3NA 2ZIQH 3QGNB 3UIRA 4O9VA 5TCCA 1AKSB 3WY8A 1H9LB 3S7HB 1EJMA 2XXLA 2A2XH 2ZF0H 4FUGA 1D9IA 2OQUA 3M7TA 1OWIA 3HATH 1IQIA 3RM0H 1VJAU 4CR5A 1GMHF 1B0EA 1TPPA 1W0YH 2ZFRH 1TGSZ 2GP9B 1YLDA 2HPQH 2FO9A 2A5IA 1ID5H 2FEQH 2ZU3A 4XBDA 1C9PA 1QNJA 3LGUA 5C2ZA 3DT0H 3QDZB 3QLPH 1V2RT 1RRKA 4NWKA 2NU4E 2WPMS 3RDZA 2VGCC 3L6PA 1GBEA 4H6TA 1THSH 1GJAB 1SGCA 1ZMJA 3UOUA 3SJ9A 2SGEE 8KME2 5T6GA 1TBQH 1O31A 3UY9A 2BD7A 2XW9A 1BMNH 1ABIH 2QIQA 1SC8U 3LONA 1GI3A 1BMAA 1OWDA 2GTBA 4YT6H 1KIGH 2A4GA 3Q3XA 3RXOA 4D76A 2GV6A 4X1RU 1P9UA 2JKHA 3D65E 2GZ9A 2OLGA