3TK9A

Crystal structure of human granzyme h
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
226
structure length
226
Chain Sequence
IIGGHEAKPHSRPYMAFVQFLQEKSRKRCGGILVRKDFVLTAAHCQGSSINVTLGAHNIKEQERTQQFIPVKRPIPHPAYNPKNFSNNIMLLQLERKAKWTTAVRPLRLPSSKAQVKPGQLCSVAGWGYVSMSTLATTLQEVLLTVQKDCQCERLFHGNYSRATEICVGDPKKTQTGFKGDSGGPLVCKDVAQGILSYGNKKGTPPGVYIKVSHFLPWIKRTMKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Granzyme H
publication title Structural insights into the substrate specificity of human granzyme H: the functional roles of a novel RKR motif
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 226
sequence length 226
ec nomenclature ec 3.4.21.-:
pdb deposition date 2011-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tk9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tk9A02
1UTLM 2H2ZA 3KNXA 2WV4A 4CREA 4O3TA 2P8OC 3CP7A 3LOXA 2PV9B 2ZTZA 4BAHB 2PSXA 4FVDA 5LH8A 1EUFA 1GG6C 4MPWA 3RXIA 4CH2B 4AB8A 3M5LA 3ZZBA 1QA0A 1O2TA 2Y5HA 4YLQH 1GI6A 3T27A 3IWMA 1DX5M 3RLYH 1EP6A 7GCHF 1QNJA 2BLOA 3UOPA 4J2YB 3TK9A 1N6YA 3DFLA 2JH6D 3TJNA 1UCYE 1NT1A 4SGBE 3PTNA 4FVBA 3QGNB 1FUJA 2A0QB 2FTLE 1O3OA 3M37A 1AIXH 4NZLA 3SQEE 1AUJA 1EAIA 1PQ5A 1HV7A 1DITH 3TPIZ 4I8HA 4NWKA 3SBKA 1IQFA 3UQVA 3P17H 1SB1H 2XBWA 1JRTA 1QTFA 2C8ZB 1BB0B 1YPGH 2F3CE 2G52A 4NIXA 3B23B 5EXMA 3SZNA 5LGOA 2XBVA 3AW0A 1Z1IA 3BIUH 4BAQB 1GMDG 2Z6BD 4X8SH 6ESTA 4MNXA 3MH7A 4F4OC 3GOVB 4DCDA 1OPHB 1EPTC 1CA8B 4UE7H 1HAPH 4K8YA 1FIZA 3I29A 1IQGA 7ESTE 3M36A 5FPTA 1S84A 2M5TA 3EDXB 2ZGXH 4TPIZ 4XBDA 5EQSA 1TMTH 3PLKA 1OSSA 3HGNA 4X0WU 1HAVB 4M7GA 3A7VA 4GHQA 5G4BA 4TYDA 1OWKA 3AVZA 4CBNA 3CS7A 4X1PU 2JETB 1S85A 1VGCB 4BXSA 2B0FA 1ZHPA 1D4PB 3VB6A 1PPHE 3KHVA 1G2MA 2P3FH 1F0TA 3RC4A 4NIVA 4YOJA 1CA0C 3ODDA 1S6HA 1AGJA 1SGCA 3LGVA 2BLWA 3O8RA 1L1JA 1RTFB 1TOCB 2GT7A 1THRH 2ZKSA 3Q00A 5T6FA 4K2YA 4A6LA 1A1RA 1GJ6A 2GMTB 3ZVEA 5EQRA 3QWCH 1ARCA 1GHAG 2ULLA 1H8IH 1DWCH 3LKWA 1IQJA 3T5FH 1HAHH 1IQIA 1GBEA 2SFAA 1OP0A 3MH5A 2GKVE 3A87A 1RS0A 1WOFA 4KGAA 1LVBA 1K1LA 4HGCA 3MU5A 2DUCA 1C1PA 1MZAA 2AGEX 4A5TS 3LT3A 1ARBA 2C93B 4GHTA 2HVXA 2P8OB 4X1NU 5EW2H 5E8EH 1KXCA 1O3BA 5J4QA 5GDSH 4NA7A 3LC3A 1UTMA 3ZV9A 1C5WB 1EX3A 1C4U2 1HAVA 1JOUB 1JRSA 1N8OC 4NZQA 2VIOA 2Q6GA 2GT8A 3EA7A 1IQNA 2HLCA 4LZ4B 1TNHA 1AQ7A 4X8TH 4B76A 1AY6H 2P16A 1UK4A 1K1MA 1YM0A 1OX1A 3UFAA 3RMNH 3B9FH 1C9PA 1FY1A 1O2OA 4RKOB 2CV3A 2QY0B 3UPEA 3UTUH 1QJ7B 3VB5A 1TBQH 1G9IE 2J95A 1QHRB 2EI6A 3ATIA 1U6QA 1HLTH 3BTGE 3MH6A 3FZDA 1FAXA 1XMNB 1EATA 1MKXK 5FAHA 1SHYA 1K1IA 2ZGHA 2V3OH 4F49A 5SGAE 1TOMH 1VCWA 3E16B 2GTBA 1J9CH 1LVYA 2B8OH 3M5MA 1O2SA 2QA9E 2AH4X 2QF0A 2SGFE 3SNAA 5PTPA 2ZFPH 3U1JB 1E34B 2VIPA 3RXRA 3B8JA 2H5CA 1K22H 2R0LA 5TCAA 2FM2A 2OCVB 4RSPA 3SI4H 3ZZ4A 3GY2A 4GSOA 4E7NA 2ZF0H 5F8ZA 1F5KU 1O33A 5A8YA 6CHAC 1CBWB 3TH2H 2GCHG 4AYVB 1FV9A 1IOEA 1G3CA 5I46H 1GL1A 1GMDF 2C90B 1CT0E 1E37B 3QO6A 1DM4B 4LK4A 3RXUA 2KAIB 3M7UA 2C8WB 1GBAA 1QJ1B 5FX6A 1D6RA 1KIGH 3U8TH 1TNKA 2ZDLA 1DXWA 2ZIQH 1GPZA 5C1YA 4YTAA 3L33A 2A5IA 1E35B 1SVPA 3T25A 2V3HH 2GD4B 4Q7XA 1AB9B 2J9NA 2OQ5A 1ELEE 1MAXA 3LC5A 1V2RT 3SU3A 2FOFA 2VVCA 3A7TA 2YNBA 3LGUA 1ANCA 3T26A 4MPVA 4ZROA 1OWJA 2BD2A 4ZKNU 4BTUB 3BV9B 3QGJA 1Y5AT 1V2NT 2EEKA 2H9EH 4ABAA 1RTKA 1P06A 1Y3UA 5EU8A 3V0XA 3RXPA 1SGRE 2WPIS 1CVWH 3PMJA 4Y7AA 2F9BH 2G51A 3H7TA 1UVOA 1O3KA 3NK8A 5CHAB 3SN8A 4U2WA 1SOZA 1QGFA 1YKTA 5LPRA 2FESH 5DP6A 4PROA 3CENA 1GHAF 1PYTC 1C5ZB 1C4V2 1O2JA 1O3HA 2BDAA 3MU1A 1ZHRA 4NFFA 1P2OA 5E2PA 2G55A 4BOHA 4X6OA 3G01A 4BAOB 3PWCA 1OXGA 2O9QA 4CRFA 1GJBB 2KAIA 2VU8E 1GVKB 1OP2A 3F9FA 3LGYA 3KQCA 3URCA 1IAUA 3ZZ8A 3MWIU 1V2ST 2PKSB 1GJAB 1O3LA 2BD8A 4B2CA 2PTCE 4IC5A 1S81A 3GDUA 2BM2A 1ESTA 2ZCHP 5GXPA 2P93A 3UNQA 3BTEE 1AUTC 3TU7H 1FONA 4D9QA 1DY8A 2TIOA 4AGKA 1NU7B 3RMLH 4CH8B 4Z6AH 1ABJH 3U98H 2J4IA 2FO9A 3MTYA 4H6TA 3RXKA 1RFNA 4D9RA 1LQDB 1UVUH 3LGWA 3VB4A 4ASHA 4O03A 3HKIB 1T8NA 5C20A 5HXFA 3SJOA 1O5EH 1X7AC 1G30B 4YLUA 3KL6A 3VGCB 5GWZA 1A0HB 1GHXH 1P0SH 3RP2A 1GGDC 2FMJA 2Z9LA 1CQQA 1DT2A 1H9LB 1Y3WA 4XE4A 3T62A 1TIOA 1PPFE 1EJNA 3VFEA 2EC9H 1MD8A 3ZV8A 1GI1A 1DDJA 2P94A 2W7UA 4AG1A 6CHAB 1O3DA 4AB9A 2BQWB 1KSNA 1O2NA 3SOSA 1HXEH 4IMQA 3DHKH 1LHEH 5C5OA 3RU4D 1V2OT 2O8LA 2CF8H 1OWHA 1BIOA 1G2LA 3RXEA 1YLDA 2GCHF 1JXPA 1J8AA 1XVMA 3NUMA 1QL7A 2ZWLH 4NGAH 2O8UA 1K1PA 3GY5A 1HB0B 1KY9A 1IQHA 3ESTA 1PFXC 3GDVA 3LH1A 2ZGBH 3ZYDA 3S9BA 1CGIE 1W0ZU 1HCGA 1KXDA 4Q7YA 1P02A 2BD4A 1YPHC 3BEUA 4ZKRU 2ZFTA 3E8LA 4ABHA 1QBVH 3OYPA 1SLVB 4ZHAA 3RM0H 3RXDA 1BRAA 2QYIA 1J14A 4U30A 1O2VA 1KDQA 1ESAA 3KIDU 1QBOA 5L2YH 1TPOA 2F91A 4J1YA 1F5LA 1OWEA 4KTSA 1MKXH 3VXEH 5EGMA 2FZZA 2ANKH 1HPGA 1W11U 3V12A 1GI2A 5DP7A 4BTIB 4OS7A 2G5VA 2ZU3A 1ZOMA 1TGNA 2W26A 2HGTH 1AE5A 1C2MA 5LPFA 1JIRA 2ZTYA 1H4WA 1UJ1A 1GL0E 3SNCA 3M7QA 3A7WA 3M7TA 1O5DH 2PGQB 4UFDH 1J15A 1ACBE 1UTKA 2AMDA 3MNXA 2P3TB 1ABIH 3SU1A 1BA8B 1VITG 1ANEA 3ODFA 2D8WA 2FEQH 1CO7E 1SPJA 3LJOA 1IQEA 1BBRK 3KN2A 3GY4A 4MVNA 1P3EA 1AWFH 3FANA 1OYTH 2FX6A 2AS9A 1BHXF 2RG3A 2OC7A 3SV2H 1O2RA 1N6XA 1WTHD 1GJ4H 1O3FA 1GJ7B 2AYWA 4NA8A 2SGDE 1BBRE 4GLYA 4Y0ZE 1TMBH 3QLPH 2QXHA 4X2WA 8GCHG 1GBDA 1HNEE 3SV9A 2BY7X 1SR5C 1SGDE 1QCPA 3MNBA 5B6OA 5GJ4B 4NFEA 1TBZH 3S69A 1GGDB 1KYNA 2AFQB 1RRKA 2EA3A 1MMJN 4MLFB 3PLBA 2ZDKA 2FYQA 3BTDE 3Q3YA 1DUEA 5JYIA 2Z9KA 1ZTKA 2VGCB 1LHCH 3MNCA 3RDZA 3U1IB 1BMNH 1ELDE 3GICB 3A86A 1C5UA 3F6UH 3M3SA 1UTPA 2NU1E 3SNEA 4Y6DA 2RCEA 1W7GH 1VGCC 3TVJB 1C1MA 1YCPM 2QXJA 1HJ9A 1D6WA 4ABFA 2BD7A 3SUGA 1PQ7A 1V2QT 3M61U 2ZQ2A 1DWEH 2ZDVH 4FUGA 1BMMH 1INCA 3JZ2B 3E0NB 3I78A 1ZJDA 3ELAH 5E0JA 1P2IA 4I8KA 1NFWA 4DJZB 2OD3B 5C1XA 5DP9A 5AF9H 1XUFA 1BDAA 1O3IA 1MAYA 2VJ1A 1QA7A 2PUXB 2A4QA 5EXNA 1GDQA 3UWIA 2WPKS 1TFXA 1MH0A 1AO5A 3ITIA 1TALA 3SU2A 1GVZA 1E36B 2RA3A 1O5GH 2BXTH 2UUJB 3A81A 4OS2A 3RMOH 4OS6A 2PGBB 3PWBA 3LH3A 3HKJB 2ZZUH 4WVPE 1F0UA 3EA8A 3BG8A 2GVFA 5EG4A 2BYAX 3OY5U 1HGTH 2VVVA 1V2KT 3NPSA 4TPYA 2FXRA 5HGGA 5HM9A 2ZDAH 5DP5A 1GBLA 2ZCKP 2QC2A 3HPTB 1O2LA 1D3DB 3BEIB 4OGYA 1NFYA 4YM9A 1GI7B 1SGTA 1FNIA 2WPJS 1ANDA 3DFJA 1B7XB 1UVSH 2SNVA 1BITA 1LPKB 1HBTH 5EW1H 1QJ6B 1V2MT 3F68H 4LOYH 1PPEE 2BB4A 3A89A 2WUCA 4A92A 2W3IA 1C1SA 2W7SA 2ALPA 2UUFB 1F5RA 2J38A 1HAXB 2ZU1A 1BT7A 5L6NH 1UTQA 1FQ3A 1QQ4A 2A4OA 2H1UA 1LVOA 4Y7BA 1NRPH 1K21H 4WMFA 1NRSH 3PYHA 2CMYA 1P2QA 2XNIA 2D1JA 3QZQA 2FX4A 1HAZB 1VJAU 5A8XA 1XX9A 3RXBA 2WPLS 4IMZA 3TITA 1L1NA 3ZVFA 2ANMH 2HWLB 2J94A 1KTTB 2I6SA 3RXFA 3W94A 1O5BB 2OP9A 1BRUP 3GYMA 1VITF 2PLXA 1RIWC 3SNDA 1LHDH 4FU9A 2VWOA 2BX4A 1XXFA 2FLBH 4X6MA 1MD7A 1C5SA 1G37A 3SHCH 1TA6A 4INKA 4BAMB 1T31A 2FI5E 3SORA 1NRRH 3D23A 2B5TB 3SW2B 4X6PA 3TJOA 1CBWC 3HGPA 2A2XH 1CGJE 3URDA 3P95A 2OUAA 4IW4E 1QY6A 3JZ1B 2J92A 4HI3A 3HK6B 1KLJH 2PUQH 2G4UA 3A8BA 1UTNA 8GCHF 1LKBA 5E0GA 3O8BA 2ZPQA 2XYAA 3ZVAA 1GWAA 4INHA 4XOJA 1O31A 2FYRA 2QF3A 5DP4A 1EZXC 1GI3A 1G36A 2PR3A 3NWUA 1DFPA 3S7KB 4Y0YE 4H42U 3M35A 1A3BH 1A5IA 4XBCA 3MH4A 2ZFQH 5C5NA 2Y81A 1NZQH 1AB9C 3PO1C 3KGPA 4HZHA 3QTOH 4FU7A 3BSQA 4UDWH 1QIXB 2A7CA 2WPMS 2H5DA 1DICA 3D65E 1ZTJA 2ZFRH 4K1EA 3RM2H 3ENSB 2ESTE 3PB1E 1BJUA 2CHAB 2R3UA 1C1OA 4IS5A 1TX6A 4ISHH 4MPXA 1YPLH 2ZHFH 1LPZB 1AE8H 1Y59T 2TBSA 3UREA 5T6DA 2G5NA 3UY9A 6LPRA 1AWHB 1B0EA 5CHAC 4FUCA 1C2LA 3LIWA 1O3EA 5HYOA 3RLWH 4RN6A 1BBRH 2P59A 3TNTA 3SV7A 4KP0A 1DLKB 2AGIX 4CHAC 1FAKH 4YT7H 1A46H 2AMPA 4I33A 2QN5T 1TONA 1THPB 4XDEA 1LPGB 1O2PA 4WWYA 1YBWA 1O2QA 4WH8A 1FY8E 2GZ8A 2P95A 1UVPA 3FZZA 4JZDH 2EI7A 2BZ6H 5FXLA 1FPCH 1V2LT 3GY7A 2PKSC 3V7TA 1GCTB 4A1VA 4JK5A 1TRYA 2Q6FA 3U9AH 3VB7A 1CE5A 2Z7FE 3F9EA 2WINI 4Y8XA 3ZZDA 1GDUA 5F6MA 1C9TA 3RXOA 1W8BH 2ZNKH 3TH4H 4FUFA 2CXVA 4JZ1A 5GCHG 1GBBA 1S0QA 2AGGX 3MOCA 1O2UA 1PJPA 2TRMA 1LO6A 3UOUA 2FOCA 4XFQA 1V2TT 4CR5A 2FIRH 2BY9X 3MI4A 4AFUA 2OC1A 1XM1A 2ZO3H 5EOKA 5ABWA 1C2JA 2BY5X 3VGCC 3E90B 4X1QU 1RIWB 3OY6U 2GX4A 2WYGA 2TPIZ 4DURA 4JYVH 4Y10E 2R2WU 2GCTC 3LPRA 2H9HA 5EXLA 2B9LA 1O5CB 3S7HB 2R2MB 1K1NA 2F9VA 1LHFH 1WCZA 2ZFFH 1HXFH 1CSOE 3PMBB 3PMAB 2F9UA 3RXAA 1TA2A 2HNTC 4ZHMU 1C4Y2 2VNTA 3A8AA 5AFYH 2RA0A 3FFGA 4TY6A 1P8VC 1FY5A 1XXDA 4Y79A 1FPHH 2BLVA 2HNTE 2ZHDA 1Y5UT 1Z6JH 5A8ZA 1TNJA 1RXPA 5K0HA 3PMHB 4WJG2 2ZGJA 2VIQA 4O97A 5CMXH 4ABGA 2ZFSA 3R3GB 1T8OA 1SC8U 3PO1B 2FP7B 3ZZ7A 1NU9A 4ABDA 4K8BA 4OGXA 3OX7U 2BQ6B 5E2OA 2XCNA 2UWOA 3E91A 1A7SA 1ETSH 1ZMJA 2VWNA 1TNIA 1ZTLA 1MBMA 5ETXA 3SUDA 1GBTA 3MU4A 2FLRH 1JMOH 2PFEA 1RTLA 3K9XB 3M3VA 2F9NA 3SUEA 4BTTB 1EOJA 2PKAA 4ZAEA 2FTMA 1C1NA 3K65B 1ELBA 1NTPA 3QDZB 5F8XA 1EB2A 4CRGA 3BTQE 1TGSZ 3LGIA 4JK6A 4ISLA 3KCGH 3F9GA 3A82A 1NY22 1FMGA 3LJJA 3FAOA 3PV4A 4CHAB 3ZVDA 4ZKOU 2BDIA 1O32A 3GYLB 3I77A 3L3TA 3BIVH 2Y7XA 4IC6A 4UEHH 1FDPA 3P92A 1MU6B 1ELTA 1M9UA 5AFZH 1C5OH 4FXGH 1TPSA 1RD3B 3ATWA 1QL8A 1JWTA 1P2KA 1AVWA 1P10A 2Y82A 1GBMA 3P6ZB 1IQKA 1C2IA 4NG9H 3FP7E 1SGPE 1BMAA 1Y5BT 1LDTT 2Q1JA 1GI0A 2ZP0H 3FP8E 4MNWA 4JMYA 1QRWA 3WY8A 4JZFH 4X1RU 2VIWA 2FS8A 2Y5FA 3TK6A 1ANBA 3S9CA 3QTVH 3DT0H 1C1UH 1IQLA 5JB9S 1LHGH 1TLDA 2A31A 2JH5D 4WF8A 1KDQB 2G8TA 2V35A 3PTBA 5EPNA 1O2HA 4HFPB 1ZR0A 3TNSA 1HAIH 2OBQA 4MG3A 2BHGA 4IBLH 3UUZA 6GCHG 5GCHF 1MTWA 3AAUA 4ZH8A 3RXLA 1CT2E 3RU4T 1HRTH 1V2PT 1PPCE 1TNLA 2VB0A 4THNH 1TB6H 1EXFA 5DGJA 2A5AA 2QIQA 1V2JT 3Q76A 1G3DA 2HPQH 4I31A 4D8NA 2GCTB 2VGCC 4VGCB 1RJXB 1NS3A 3RXVA 4ZXYH 1GBHA 5FCKA 1L0ZA 4Y11E 1XUKA 3ZZCA 4I8LA 1EJAA 2A1DB 4AFQA 5GPIB 1ZRBA 1ZPZA 4K3JA 5IDKA 4B2BA 4I8JA 1WUNH 1C1RA 5ESTE 4ABIA 5C3NA 1VZQH 2C4FH 3MNSA 1SLUB 1A5HA 4MTBA 5DP8A 1W2KH 2C3SA 2OC0A 2ZA5A 2BVXH 4NA9H 1O38A 2Y7ZA 2OXSA 4WMDA 2ZECA 4Z0KA 1ZSKA 5TCCA 4X2YA 3O8CA 4I7YH 4INLA 2A32A 2CF9H 1QB6A 2GZ7A 1A3EH 1C5XB 1UHBA 2Y80A 1O2YA 1DANH 2Z9JA 4YT6H 4ABBA 2JH0D 1WYKA 8KME2 1C5VA 4TY7A 5K7RA 1QQUA 2XWBI 1MTNC 1P04A 2XBXA 1Y3VA 3RXGA 1ID5H 8ESTE 1KLIH 4DVAU 1GHWH 4Y8ZA 1MBQA 4AG2A 1EP5A 1C5MD 2AIQA 2ZU2A 3ZZAA 2OLGA 1W0YH 4WY3A 4AFZA 1O3GA 3OU0A 4MPUA 1O2GH 1BTXA 2JKHA 1MCTA 1RGQA 5C1UA 1C2EA 1MTUA 1CT4E 3QUMP 3H7OA 1A5GH 3ZVCA 5IYTA 3KQDA 4MNVA 3M5OA 4WXVA 1O2ZA 2STAE 4E7RG 1O35A 2G81E 1SFIA 1UVTH 1KXFA 3T28A 4WXIA 1QL9A 3KQBA 2B7DH 1QRZA 1A0JA 3BEFB 1H9IE 1DPOA 2ZGCA 2GV6A 1TX8A 1PPBH 2BD9A 2ZHEH 4R0IA 1F0SA 3LU9B 3RC6A 2FOBA 1FXYA 3A8CA 3A84A 1HAYB 2ZI2H 4JZEH 5A0CA 1PQ8A 2Y6TA 1WV7H 3SU0A 1D3PB 3LGTA 1LVMA 3K2UA 4IN2A 3A83A 2TGAA 1FN8A 1PPZA 4Q80A 2SNWA 2XBYA 1SGEE 1S82A 4AYYB 1C5LH 1QB9A 3BTTE 3SGBE 1SGFG 5FPSA 3EA9A 2BLQA 1O2XA 4AX9H 1SBWA 2BMGB 2CJIA 4X8VH 4UFGH 1JIMA 3QN7A 2FODA 3ZYEA 1ETRH 2BDCA 1BOQA 1P57B 3ZZ6A 2Z94A 1ELFA 4FU8A 2TGTA 4JCNA 1TWXB 3A88A 1AVGH 5JBTA 2FPZA 1EAWA 1XUHA 3F9HA 1SGQE 4XSKU 4B75A 1V3XA 6GCHF 2VH6A 4UFEH 1ZZZA 4DG4A 4RKJB 1BTUA 1O30A 3W95A 4CRDA 1SI5H 3IG6B 2A4GA 1TMUH 4JYTA 4UFFH 1SOTA 3E3TA 4WH6A 1Z6EA 5EPYA 1Z71A 4DY7B 3RUOA 4AOQA 3V13A 1GMCG 2UUYA 4ZUHA 1AMHA 3P8FA 2PHBA 3SJKA 1EKBB 2CHAC 4GVUA 4X2VA 2IN2A 2OINA 1KLTA 2LPRA 3GCTG 5EODA 1WTGH 4GPGA 3Q3XA 1E38B 1Q3XA 1CGHA 4B2AA 1YF4A 1K2I1 3O8DA 2P3UB 2ZDNA 2C8XB 5FHTA 1MTNB 2O8MA 1F2SE 1P09A 1P2JA 3A7ZA 1W12U 1E0FD 1GHVH 2W3KA 1YYY1 2IJOB 2OBOA 3ZVGA 1SQAA 3ATLA 4K5ZA 4KTCA 4Y76A 1O39A 1ZSJA 1ZPCA 1EAUA 1BCUH 4OS4A 1GI9B 5C67A 1QRXA 1SLWB 4D76A 1O5FH 3LDXH 5JBCS 1AU8A 2BX3A 1SFQB 3RXMA 3T2NA 3UNRA 3K6ZA 3UNSA 5HMAA 1A61H 2XC4A 3SV6A 2BDGA 2R0KA 3D49H 1C2HA 4UD9H 1GCTC 4Y71A 1L2EA 4NIYA 4IN1A 1AI8H 3Q77A 4FUBA 1OS8A 1LQEA 1F92A 1BRCE 1YC0A 1HIAA 3GCHC 1Z8IB 3SJ9A 1VCQA 3GY3A 3MHWU 1CU1A 1P11E 1UCYK 1XUGA 2I6QA 1GDNA 2WV5A 2VINA 4KKDA 4JYUH 2A5KA 1TNGA 1TYNA 1ZMLA 1TGBA 1TPAE 2SGPE 3UQOA 1BTHH 4O9VA 9ESTA 2XC0A 1PYTD 1NPMA 1YPMH 3D62A 1GHYH 4I32A 4FUJA 1TGCA 1Z8GA 3NXPA 3UWJH 3RXQA 1WQSA 1QR3E 2SGEE 1O2IA 1VCPA 1V6DA 3N7OA 1K28D 2OC8A 1GJ5H 1WAYB 4FUEA 2GZ9A 1ELCA 2XRCA 3U69H 2ZDMA 3V3MA 3TIUA 3MO6A 1EAXA 1O2WA 1H1BA 2UWLA 5L30H 1G32B 4CR9A 2AMQA 1O5AB 5TJXA 1C1WH 3OTJE 2ZHQH 1LMWB 3MU0A 1KXEA 1GHZA 1O3MA 4ZXXH 1O3AA 2BD5A 1YP9A 3BG4B 2DE8A 3RU4E 2NU4E 1P3CA 1THSH 4Q7ZA 2QCYA 1BZXE 1S6FA 1GI8B 1BTWA 1SQOA 5DO4H 2OQUA 1ELAA 1O3CA 1SGYE 2ZQ1A 1TGTA 4TWWA 2HNTF 2LNCA 3RXSA 2D2DA 5DG6A 1XKAC 3P70B 4NSYA 1AZZA 1XVOA 1GBCA 2F9OA 3EQ0H 2AERH 2BXUH 2VH0A 1OYQA 1BTZA 1GI5A 5BPEA 3QK1A 1MKWK 4DT7B 1HJ8A 1Z7KA 1S5SA 1GMCF 1KTSB 1L4DA 3HK3B 3OSYA 5JDUB 1WU1A 1O36A 4NWLA 1JBUH 2WPHS 3SGQE 1AFQB 1P2NA 1V2WT 2Y5GA 4NIWA 3SHAH 2BDBA 2ODYB 1FI8A 1SGIB 1XKBC 2Z9IA 4WMEA 1DSTA 1OKXA 2K1QA 3GCTF 2FOAA 2PTNA 4DW2U 1DLEA 4A1XA 4A1TA 1SMFE 3LONA 4GCHG 3A85A 4U01A 3STJA 3C27B 1WSSH 1MCVA 1J16A 1DY9A 2WYJA 3PROA 5JBBS 3GCNA 3TJUA 2YNAA 1SG8B 1Q31A 1ZHMA 1V2VT 1AHTH 2NU0E 5DJ7A 1AKSB 2HPPH 1C5RA 3H5CB 4K1TA 4X2XA 4CRBA 4AN7A 3TGKE 1P9UA 1PPGE 1W10U 2ASUB 1D9IA 1K9OE 1FLEE 2Q6DA 3PM3A 1SL3A 1ELGA 3DD2H 5A0AE 1EZQA 4YOGA 2V0BA 3GCHB 3GCOA 1EOLA 2ZPRA 1GG6B 1O0DH 2GV7A 1NFUA 5JPMH 1QB1A 3RC5A 2IPHA 2PSYA 4MQAA 1ZLRA 3A7YA 3STIA 1C5NH 3BTFE 1CHOG 1BTPA 1MQ5A 2QXGA 1WQVH 2BY6X 2J2UA 1HAOH 1F0RA 5A0BA 2A7JA 1NRNH 2XCFA 3BN9A 3NZIA 1MZDA 4HTCH 5FPYA 1UO6A 3VXFH 1P12E 1NRQH 2GP9B 2G00A 1P2MA 1DUAA 2PKAB 3GDSA 1HUTH 1A4WH 1BHXB 3ZZ3A 3BTWE 1A2CH 1C5QA 1LCYA 3SV8A 2BDYA 3FP6E 1ZRKA 3GISB 3EGKH 1V2UT 1NN6A 1O3PB 4VGCC 1YLCA 2ZCLP 4ZKSU 1P9SA 1WBGB 2XWAA 3ATMA 4ISOA 2BOKA 1NROH 2ZTXA 3TGJE 3U8RH 4ZMAH 4YO9A 1YPEH 1K1OA 1TE0A 2DE9A 3VEQB 4BANB 1KXBA 2FOGA 3IITA 1W14U 3TGIE 1FY4A 1GJDB 1SGNE 1AKSA 1UTOA 1NESE 1DSUA 2UWPA 1EPTB 3GY6A 3Q3KA 3KQEA 1NO9H 3MMGA 4CRAA 3SI3H 4B74A 3MO3A 3E0PB 2XW9A 4K60A 3GY8A 1BUIA 4E06H 2CN0H 4I8GA 3BTKE 2STBE 2F83A 3SU4A 5E0HA 3EE0B 1G3EA 4FUIA 1OWIA 2VIVA 2H6MA 1EZUC 3SJ8A 1BTYA 3RXHA 1GVLA 1YPKH 2W5EA 2QV1A 2NWNA 5T6GA 1OOKB 1C1QA 4NCYA 1IHSH 5CE1A 2NU2E 3BF6H 5JB8S 1N1LA 2OTVA 2PW8H 3SGAE 1UCYH 1YCPK 4X6NA 9LPRA 1AD8H 4DIHH 1D3TB 1CA0B 4KELA 4FUDA 4YZUA 4LZ1H 1EASA 1GJCB 3TJVA 1S83A 5ESBA 5AVDA 2TGDA 2BZAA 5DP3A 3U8OH 1DE7H 4ZHLU 3EYDA 4B73A 2NU3E 1TPPA 1XUIA 3SQHE 1DS2E 1H8DH 4YESB 4DIIH 4FUHA 2R3YA 1O2MA 1W7XH 3P8OA 1DXPA 3ZZ5A 1Q2WA 4K69A 1SQTA 1VR1H 2GGVB 3DA9B 3ZZ9A 1TRNA 3BTME 2FS9A 3ATKA 4GCHF 1EPTA 3PLPA 4B1TA 5JBAS 2ZHWH 2BVRH 1EB1H 1Z1JA 1DWDH 1ESBA 1C5PA 1ZGIA 2BY8X 4DOQA 3P8GA 1TRMA 3T29A 1P05A 2GDEH 1EJMA 1C2DA 4TWYA 1A0LA 1GBKA 3UR6A 1GHBG 5FBIA 2O8TA 4YOIA 2H9TH 2SGAA 2GDDA 5H4IB 1N8OB 1UHBB 2ZPSA 3BTHE 4H4FA 1SHHB 1J17T 2ANWA 1EQ9A 2VIDA 4U32A 4H6SB 1PQAA 4ISIH 1MUEB 1C2GA 3E1XB 2FI4E 2QAAA 3RMMH 5J4SA 1AZ8A 1CHOF 4A7IB 1BJVA 1Y3XA 2XXLA 1H9HE 1GMHG 1C1TA 4ISNA 4JZIA 1OWDA 1GI4A 1GJ9B 3KEEA 4X1SU 1MKWH 5C2ZA 4AZ2B 1FY3A 1GJ8B 4K1SA 4QT8C 3RXCA 1L1GA 1OP8A 3NCLA 2Z3DA 3SU6A 2BVSH 1F7ZA 1FIWA 1MTSA 4NSVA 1ZYOA 1B0FA 5EQQA 2R9PA 1SLXB 1HJAC 3TK5A 3SO3A 4BXWA 1O3JA 1TAWA 1C1VH 1O37A 2FDAA 2FOEA 4BAKB 3VPKA 3RXTA 3K6YA 1NFXA 2XTTB 3AAVA 4Q2KA 2ZU5A 2A45B 3SU5A 1W3CA 2A7HA 2QXIA 3A8DA 1T7CA 2ZG0H 5L2ZH 2THFB 1YGCH 2ILNA 3SJIA 1UK3A 2O8WA 1AN1E 3TH3H 4MDSA 3S9AA 1TBRH 1DWBH 1ETTH 1T32A 2A4RA 2J34A 4Y8YA 1ZSLA 4OS5A 1G3BA 4BNRA 4MNYA 4CBOA 4UONA 1IQMA 1D3QB 4OS1A 3SUFA 2HRVA 4ABJA 1W13U 2EI8A 1HDTH 1YPHE 8LPRA 2VWMA 2A2QH 2FWWA 1VITH 3TLOA 1T4UH 2ZEBA 1B5GH 2ODPA 2ZU4A 5DPAA 3F1SB 1CHGA 3QX5H 4GUXA 7KMEH 2IOTA 1ORFA 1LTOA 1TQ0B 7LPRA 2V6NA 1ZPBA 1SGFA 7GCHG 1GBIA 2BOHB 3SNBA 3ZVBA 5T3HA 3MO9A 1T8MA 5HM2A 2G4TA 3KF2A 1TX7A 3RXJA 3UIRA 1L4ZA 2SGQE 3FVFB 1BQYA 5GIBA 2Z3EA 1SSXA 5F03A 4SGAE 2ALVA 2Z9GA 3A80A 2BD3A 1T8LA 3E6PH 3M3TA 1NM6A 4X8UH 4IGDA 3P8NA 1XUJA 4CRCA 1GHBF 1FZZA 2VVUA 1HFDA 3VB3A 4E05H 2AEIH 3AASA 2ODQA 1Z8RA 2HOBA 2WUBA 1EZSC 1P03A 1QURH 3BG4C 3S0NA 1BMLA 5FBEA 1HYLA 1TABE 1Y3YA 1P01A 5BRRE 3C1KA 1MQ6A 5AHGH 1Z8JB 2FOHA 1DOJA 1QFKH 3M5NA 1YCPH 1GMHF 2QGRA 4D7GA 4AORA 1C2KA 1O2KA 1BRBE 1FN6A 2FOMB 1VJ9U 2ANYA 2BDHA 5LPEA 2BTCE 5FX5A 2FI3E 4GAWA 1HIAB 4AGJA 1HJAB 2UUKB 3EAJA 1QBNA 2F9PA 2Z3CA 1C5YB 1FJSA 1K1JA 3MU8A 4XBBA 2TGPZ 1UMAH 2JETC 2RDLA 4KTUA 2YOLA 1AFEH 2ZC9H 3QZRA 3R0FA 3MYWA 1NC6A 2HALA 3CS0A 4ESTE 5F8TA 3HATH 1C5TA 3AW1A 1KXAA 1O34A 4D7FA 3MFJA 5DK1A 1AFQC 1ZGVA 1TQ7B 2D26C 1DVAH 3NKKA 3L6PA 1GBJA 1GCDA 1C2FA 3DUXH 4R8TB 1Y8TA 2VWLA 2C8YB 1MTVA 1IHTH 1GBFA 5A09A 1T4VH 1HAGE 1ZMNA 3A7XA 4LXBH 2GMTC 1AVXA 5I25A 1UK2A 4ABEA 4DGJA 2BQ7B 4O3UA 1ELVA 2AIPA 4B71A 5FCRA 4AFSA 1LKAA 1YPJH 2CGAA 1S0RA 3UR9A 1O3NA 5A2MH 1UTJA 5DKMA 2PWXA 1ZJKA 1MU8B 2XC5A
chains in the Genus database with same CATH superfamily
1UTLM 2H2ZA 3KNXA 2WV4A 2KM0A 4O3TA 4CREA 2P8OC 3CP7A 3LOXA 2PV9B 2ZTZA 4BAHB 2PSXA 4FVDA 5LH8A 1EUFA 1GG6C 4MPWA 3RXIA 4CH2B 4AB8A 3M5LA 3ZZBA 1QA0A 1O2TA 2Y5HA 4YLQH 1GI6A 3NRLA 3T27A 3IWMA 1DX5M 3RLYH 1EP6A 7GCHF 1QNJA 2BLOA 3UOPA 4J2YB 3TK9A 1N6YA 3DFLA 2JH6D 3TJNA 1UCYE 1NT1A 4SGBE 3PTNA 3GS9A 4FVBA 3QGNB 1FUJA 2A0QB 2FTLE 1O3OA 3M37A 4M9FA 1AIXH 4NZLA 3SQEE 1AUJA 1EAIA 1PQ5A 1HV7A 1DITH 3TPIZ 4I8HA 4NWKA 3SBKA 1IQFA 3UQVA 3P17H 2L6OA 1SB1H 2XBWA 3N7EA 1JRTA 1QTFA 2C8ZB 1BB0B 1YPGH 2F3CE 2G52A 4NIXA 3B23B 5EXMA 3SZNA 3DCLA 5LGOA 2XBVA 3AW0A 1Z1IA 3BIUH 5DSFA 4BAQB 1GMDG 2Z6BD 4X8SH 6ESTA 4MNXA 3MH7A 4F4OC 3GOVB 4DCDA 1OPHB 1EPTC 1CA8B 4UE7H 1HAPH 4K8YA 1FIZA 3I29A 1IQGA 7ESTE 3M36A 5FPTA 1S84A 2M5TA 3EDXB 2WPDD 2ZGXH 4TPIZ 4XBDA 5EQSA 1TMTH 3PLKA 1OSSA 3HGNA 4X0WU 1HAVB 4M7GA 3A7VA 4GHQA 5G4BA 4TYDA 1OWKA 3AVZA 4CBNA 3CS7A 4X1PU 2JETB 1S85A 1VGCB 4BXSA 2B0FA 1ZHPA 1D4PB 3VB6A 1PPHE 3KHVA 1G2MA 2P3FH 1F0TA 3RC4A 4NIVA 4YOJA 1CA0C 3ODDA 1S6HA 1AGJA 1SGCA 3LGVA 2BLWA 3O8RA 1L1JA 1RTFB 1TOCB 2GT7A 1THRH 2ZKSA 3Q00A 5T6FA 4K2YA 4A6LA 1A1RA 1GJ6A 2GMTB 3ZVEA 5EQRA 3QWCH 1ARCA 1GHAG 2ULLA 1H8IH 1DWCH 3LKWA 1IQJA 3T5FH 1HAHH 1IQIA 1GBEA 2SFAA 1OP0A 3MH5A 2GKVE 3A87A 1RS0A 1WOFA 4KGAA 1LVBA 1K1LA 4HGCA 3MU5A 2DUCA 1K0HA 1C1PA 1MZAA 2AGEX 4A5TS 3LT3A 1ARBA 2C93B 4GHTA 2HVXA 2P8OB 4X1NU 5EW2H 5E8EH 1KXCA 1O3BA 5J4QA 5GDSH 4NA7A 3LC3A 1UTMA 3ZV9A 1C5WB 1EX3A 1C4U2 1HAVA 1JOUB 2YMSB 2IJD1 1JRSA 1N8OC 4NZQA 2VIOA 2Q6GA 2GT8A 3EA7A 1IQNA 2HLCA 4LZ4B 1TNHA 1AQ7A 4X8TH 4B76A 1AY6H 2P16A 1UK4A 1K1MA 1YM0A 1OX1A 3UFAA 3RMNH 3B9FH 1C9PA 1FY1A 1O2OA 4RKOB 2CV3A 2QY0B 3UPEA 3UTUH 1QJ7B 3VB5A 1TBQH 1G9IE 2J95A 1QHRB 2EI6A 3ATIA 1U6QA 1HLTH 2KZ4A 3BTGE 3MH6A 3FZDA 1FAXA 1XMNB 1EATA 1MKXK 5FAHA 1SHYA 1K1IA 2ZGHA 2V3OH 4F49A 1YY3A 5SGAE 1TOMH 1VCWA 3E16B 2GTBA 1J9CH 1LVYA 2B8OH 3M5MA 1O2SA 2QA9E 2AH4X 2QF0A 2SGFE 3SNAA 5PTPA 2ZFPH 3U1JB 1E34B 2VIPA 3RXRA 3B8JA 2H5CA 1K22H 2R0LA 5TCAA 2FM2A 2OCVB 4RSPA 3SI4H 3ZZ4A 3GY2A 4GSOA 4E7NA 3FOAA 2ZF0H 5F8ZA 1F5KU 1O33A 5A8YA 6CHAC 1CBWB 3TH2H 2GCHG 4AYVB 1FV9A 1IOEA 1G3CA 5I46H 1GL1A 1GMDF 2C90B 1CT0E 1E37B 3QO6A 3UB0A 3OEED 1DM4B 4LK4A 3RXUA 2KAIB 4ASUD 3M7UA 2C8WB 2VBCA 3OAAD 1GBAA 1QJ1B 5FX6A 1D6RA 3AK5A 1KIGH 3U8TH 1TNKA 2ZDLA 1DXWA 2ZIQH 1GPZA 4ZCNA 5C1YA 1KMHB 4YTAA 3L33A 2A5IA 1E35B 1SVPA 3T25A 2V3HH 2GD4B 4Q7XA 2OK5A 1AB9B 2J9NA 2OQ5A 1ELEE 1MAXA 3LC5A 1V2RT 3SU3A 2FOFA 2VVCA 3A7TA 2YNBA 3LGUA 1ANCA 3T26A 4MPVA 4ZROA 1OWJA 2BD2A 2GJGA 4ZKNU 4BTUB 3BV9B 3QGJA 1Y5AT 1V2NT 2EEKA 2H9EH 4ABAA 1RTKA 1P06A 1Y3UA 5EU8A 3V0XA 3RXPA 1SGRE 2WPIS 1CVWH 3PMJA 4Y7AA 2F9BH 2G51A 3H7TA 1UVOA 1O3KA 3NK8A 5CHAB 3SN8A 4U2WA 1SOZA 1QGFA 1YKTA 5LPRA 2FESH 5DP6A 4PROA 3CENA 1GHAF 1PYTC 1C5ZB 1C4V2 1O2JA 1O3HA 2BDAA 3MU1A 1ZHRA 4NFFA 1P2OA 5E2PA 2G55A 4BOHA 4X6OA 3G01A 4BAOB 3PWCA 1OXGA 2O9QA 4CRFA 3U28C 1GJBB 2KAIA 2VU8E 1GVKB 1OP2A 3F9FA 3LGYA 3OTPA 3KQCA 3URCA 1IAUA 3ZZ8A 3MWIU 1V2ST 2PKSB 1GJAB 1O3LA 2BD8A 4B2CA 2PTCE 2LELA 4IC5A 1S81A 3GDUA 3KQ5A 2BM2A 1ESTA 2ZCHP 5GXPA 2P93A 3UNQA 3BTEE 1AUTC 3TU7H 1FONA 4D9QA 1DY8A 2TIOA 4AGKA 1NU7B 3RMLH 4CH8B 4Z6AH 1ABJH 3U98H 2J4IA 2FO9A 3MTYA 4H6TA 3RXKA 1RFNA 4D9RA 1LQDB 1UVUH 3LGWA 3VB4A 4ASHA 4O03A 3HKIB 1T8NA 5C20A 5HXFA 3F2GA 1O5EH 1X7AC 1G30B 4YLUA 3KL6A 3SJOA 3VGCB 5GWZA 1A0HB 1GHXH 1P0SH 3UAIC 3RP2A 1GGDC 4TSFD 2FMJA 2Z9LA 1CQQA 1DT2A 1H9LB 1Y3WA 4XE4A 3T62A 1TIOA 1PPFE 1EJNA 3VFEA 2EC9H 1MD8A 3ZV8A 1GI1A 1DDJA 2P94A 2W7UA 4AG1A 6CHAB 5KEDA 1O3DA 4AB9A 2BQWB 1KSNA 1O2NA 3SOSA 1HXEH 4IMQA 3DHKH 5DN6D 1LHEH 5C5OA 3RU4D 1V2OT 2O8LA 2CF8H 4B6EA 1OWHA 1BIOA 1G2LA 3RXEA 1YLDA 2GCHF 1JXPA 1J8AA 1XVMA 2WV9A 3NUMA 1QL7A 2ZWLH 4NGAH 2O8UA 1K1PA 3GY5A 1HB0B 1KY9A 1IQHA 3ESTA 1PFXC 3GDVA 3LH1A 2ZGBH 3ZYDA 3S9BA 2QF5A 1CGIE 2K0QA 1W0ZU 1HCGA 5FL7D 1KXDA 4Q7YA 1P02A 2BD4A 1YPHC 3BEUA 4ZKRU 2ZFTA 3SYJA 3E8LA 4ABHA 1QBVH 3OYPA 1SLVB 4ZHAA 3RM0H 3RXDA 1BRAA 2WZQA 2QYIA 1J14A 3F2HA 4U30A 1O2VA 3VG8A 1KDQA 1ESAA 3KIDU 5HIYA 1QBOA 4B6FA 5L2YH 3OEHD 1TPOA 2F91A 4J1YA 1F5LA 1OWEA 4KTSA 1MKXH 3VXEH 5EGMA 2FZZA 2ANKH 1HPGA 1W11U 3V12A 1GI2A 5DP7A 4BTIB 4OS7A 2G5VA 2ZU3A 1ZOMA 1TGNA 2W26A 2HGTH 1AE5A 1C2MA 5LPFA 1JIRA 2ZTYA 1H4WA 1UJ1A 1GL0E 3SNCA 2J98A 3M7QA 3A7WA 3M7TA 1O5DH 2PGQB 4UFDH 1J15A 1ACBE 1UTKA 2AMDA 3MNXA 2P3TB 4ACAA 1ABIH 3SU1A 1BA8B 1VITG 1ANEA 3ODFA 2D8WA 2FEQH 1CO7E 1SPJA 3LJOA 1IQEA 1BBRK 3DSGA 3KN2A 3GY4A 4MVNA 1P3EA 1AWFH 5KECA 3FANA 1OYTH 2FX6A 2AS9A 1BHXF 2RG3A 3F0OA 2OC7A 3SV2H 1O2RA 1N6XA 1WTHD 1GJ4H 3F0PA 1O3FA 1GJ7B 2AYWA 4NA8A 2SGDE 1BBRE 4GLYA 4Y0ZE 1TMBH 3QLPH 2QXHA 4X2WA 8GCHG 5GNDA 1GBDA 1HNEE 3SV9A 2BY7X 1SR5C 1SGDE 1QCPA 3MNBA 5B6OA 1UW7A 5GJ4B 4NFEA 1TBZH 3S69A 1GGDB 1KYNA 2AFQB 1RRKA 2EA3A 1MMJN 4MLFB 3PLBA 2ZDKA 2FYQA 3BTDE 3Q3YA 1DUEA 5JYIA 2Z9KA 1ZTKA 2VGCB 1LHCH 3MNCA 3RDZA 3U1IB 1BMNH 1ELDE 3GICB 3A86A 1C5UA 3F6UH 3M3SA 1UTPA 2NU1E 3SNEA 3N99A 4Y6DA 2RCEA 1W7GH 1VGCC 3TVJB 1C1MA 1YCPM 2QXJA 1HJ9A 3OFND 1D6WA 4ABFA 2BD7A 3SUGA 1PQ7A 1V2QT 3M61U 2ZQ2A 1DWEH 2ZDVH 4FUGA 1BMMH 1INCA 3JZ2B 3E0NB 3I78A 1ZJDA 3ELAH 5E0JA 1P2IA 4I8KA 1NFWA 4DJZB 2OD3B 5C1XA 5DP9A 5AF9H 1XUFA 1BDAA 1O3IA 1W0KD 1MAYA 2VJ1A 1QA7A 2PUXB 2A4QA 5EXNA 1GDQA 3UWIA 2WPKS 1COWD 1TFXA 1MH0A 1AO5A 3ITIA 3H09A 1TALA 3SU2A 2JIZD 1GVZA 5EIYA 1E36B 2RA3A 1O5GH 2BXTH 2UUJB 3A81A 4OS2A 3RMOH 4OS6A 2PGBB 3PWBA 3LH3A 3HKJB 2ZZUH 4WVPE 1F0UA 3EA8A 3BG8A 2GVFA 5EG4A 2BYAX 3OY5U 1HGTH 2VVVA 1V2KT 3NPSA 4TPYA 2FXRA 5HGGA 5HM9A 2ZDAH 5DP5A 1GBLA 2ZCKP 2QC2A 3HPTB 1O2LA 1D3DB 3BEIB 4OGYA 1NFYA 4YM9A 1GI7B 1SGTA 1EFRD 1FNIA 2WPJS 1ANDA 3DFJA 2YMSC 1B7XB 1UVSH 2SNVA 1BITA 1LPKB 1HBTH 5EW1H 1QJ6B 1V2MT 3F68H 4LOYH 1PPEE 2BB4A 3A89A 2WUCA 4A92A 2W3IA 1C1SA 2W7SA 2ALPA 2UUFB 1F5RA 2J38A 1HAXB 2ZU1A 1BT7A 5L6NH 1UTQA 1FQ3A 1OHHD 1QQ4A 2A4OA 2H1UA 1LVOA 4Y7BA 1NRPH 1K21H 4WMFA 1NRSH 3PYHA 2CMYA 1P2QA 2XNIA 2D1JA 3QZQA 4Z1MD 2FX4A 1HAZB 1VJAU 5A8XA 1XX9A 3RXBA 2WPLS 4IMZA 3PRDA 3TITA 2WHXA 1L1NA 1NBME 3ZVFA 2ANMH 2HWLB 2J94A 1KTTB 2I6SA 3RXFA 3W94A 3WW7A 1O5BB 2OP9A 1BRUP 3GYMA 1VITF 2PLXA 1RIWC 3SNDA 2W6JD 1LHDH 4FU9A 2VWOA 2BX4A 1XXFA 2FLBH 4X6MA 1MD7A 1C5SA 1G37A 3SHCH 1TA6A 4INKA 4BAMB 1T31A 2FI5E 4FETA 4XRNA 1NRRH 3SORA 3D23A 2B5TB 3SW2B 4X6PA 3TJOA 1CBWC 5T1VA 3HGPA 2A2XH 1CGJE 3URDA 3P95A 2QF4A 2OUAA 4IW4E 1QY6A 3JZ1B 2J92A 4HI3A 3HK6B 1KLJH 2PUQH 2G4UA 3A8BA 1UTNA 4DT4A 8GCHF 1LKBA 5E0GA 3O8BA 2ZPQA 2XYAA 3ZVAA 1GWAA 4INHA 4XOJA 1O31A 2FYRA 1BMFD 2QF3A 5DP4A 1EZXC 1GI3A 1G36A 2PR3A 3NWUA 1DFPA 3S7KB 2F4LA 4Y0YE 4H42U 3M35A 1A3BH 1A5IA 4XBCA 3MH4A 2ZFQH 5C5NA 2Y81A 1NZQH 1AB9C 3PO1C 3KGPA 4HZHA 3QTOH 4FU7A 3BSQA 4UDWH 1QIXB 2A7CA 2WPMS 2H5DA 1DICA 3D65E 1ZTJA 2ZFRH 4K1EA 3RM2H 3ENSB 2ESTE 3PB1E 1BJUA 2CHAB 2R3UA 1C1OA 4IS5A 1TX6A 2JJ2D 4ISHH 4MPXA 1YPLH 2ZHFH 1LPZB 1AE8H 1Y59T 2TBSA 3UREA 5T6DA 5C17A 2G5NA 3UY9A 6LPRA 1AWHB 1B0EA 5CHAC 4ACBA 4FUCA 1C2LA 3LIWA 1O3EA 5HYOA 3RLWH 4RN6A 3KYGA 1BBRH 2P59A 3TNTA 3WWBA 3SV7A 4KP0A 1DLKB 2AGIX 4CHAC 1FAKH 4YT7H 1A46H 2AMPA 4I33A 2QN5T 1TONA 2PP6A 1THPB 4XDEA 1LPGB 1O2PA 4WWYA 1YBWA 1O2QA 4FOUC 4WH8A 1FY8E 2GZ8A 2P95A 1UVPA 3FZZA 4JZDH 2EI7A 2BZ6H 5FXLA 1FPCH 4I86A 1V2LT 3GY7A 2PKSC 3V7TA 1GCTB 4A1VA 4JK5A 1TRYA 2Q6FA 3U9AH 3VB7A 1CE5A 2Z7FE 3F9EA 3PRBA 4AC9A 2WINI 4Y8XA 3ZZDA 1GDUA 5F6MA 1C9TA 3CNRA 3RXOA 1W8BH 2ZNKH 3TH4H 4FUFA 2CXVA 4JZ1A 5GCHG 1GBBA 1S0QA 2AGGX 3MOCA 1O2UA 1PJPA 2TRMA 1LO6A 1QZ8A 3UOUA 2FOCA 4XFQA 1V2TT 4CR5A 2FIRH 2BY9X 3MI4A 4AFUA 2OC1A 1XM1A 2ZO3H 5EOKA 5ABWA 1C2JA 2BY5X 3VGCC 3E90B 4X1QU 1H8HD 1RIWB 3OY6U 2GX4A 2WYGA 2TPIZ 4DURA 2W6ID 4JYVH 4Y10E 2R2WU 2GCTC 3LPRA 2H9HA 5EXLA 2F43B 2B9LA 1O5CB 3S7HB 2R2MB 1K1NA 2F9VA 1LHFH 1WCZA 2ZFFH 1HXFH 1CSOE 3PMBB 3PMAB 2F9UA 3RXAA 1TA2A 2HNTC 4ZHMU 1C4Y2 2VNTA 3A8AA 5AFYH 2RA0A 3FFGA 4TY6A 1P8VC 1FY5A 1XXDA 4Y79A 1FPHH 2BLVA 2HNTE 2ZHDA 1Y5UT 3FN8A 1Z6JH 5A8ZA 1TNJA 2K8IA 1RXPA 5K0HA 3PMHB 4WJG2 2ZGJA 2VIQA 4O97A 5CMXH 4ABGA 2ZFSA 3R3GB 1T8OA 1SC8U 3PO1B 2FP7B 3ZZ7A 1NU9A 4ABDA 4K8BA 4OGXA 3OX7U 2BQ6B 5E2OA 2XCNA 2UWOA 3E91A 1A7SA 1ETSH 2KCYA 1ZMJA 2VWNA 1TNIA 1ZTLA 1MBMA 5ETXA 3SUDA 1GBTA 3MU4A 2FLRH 1JMOH 2PFEA 1RTLA 3K9XB 3M3VA 2F9NA 3SUEA 4BTTB 1EOJA 2PKAA 4ZAEA 2FTMA 1C1NA 3K65B 1ELBA 1NTPA 3QDZB 5F8XA 1EB2A 4CRGA 3BTQE 1TGSZ 3LGIA 4JK6A 4ISLA 3KCGH 2HLDD 3F9GA 3A82A 1NY22 1FMGA 2WSSD 3LJJA 3FAOA 3PV4A 1SKYE 4RT1A 4CHAB 3ZVDA 4ZKOU 2BDIA 1E1RD 1O32A 3GYLB 4Q63A 3I77A 3L3TA 3BIVH 2Y7XA 4IC6A 4UEHH 1FDPA 3P92A 1MU6B 1ELTA 1M9UA 5AFZH 1C5OH 4FXGH 1TPSA 1RD3B 3ATWA 1QL8A 1JWTA 1P2KA 4F48B 1AVWA 1P10A 2Y82A 1GBMA 3P6ZB 1IQKA 1C2IA 4NG9H 3FP7E 1SGPE 1BMAA 1Y5BT 1LDTT 2Q1JA 1GI0A 2ZP0H 3FP8E 4MNWA 4YXWD 4JMYA 1QRWA 3WY8A 4JZFH 4X1RU 2VIWA 2FS8A 2Y5FA 3TK6A 1ANBA 3S9CA 3QTVH 2J5UA 3DT0H 1C1UH 1IQLA 5JB9S 1LHGH 1TLDA 2A31A 2JH5D 4WF8A 1KDQB 2G8TA 2V35A 3PTBA 5EPNA 1O2HA 4HFPB 1ZR0A 2HVYB 3TNSA 1HAIH 2OBQA 4MG3A 5C0UA 2BHGA 4IBLH 3UUZA 6GCHG 5GCHF 1MTWA 3AAUA 4ZH8A 3RXLA 1CT2E 3RU4T 1HRTH 1V2PT 1PPCE 1W0JD 1TNLA 2VB0A 4THNH 1TB6H 1EXFA 5DGJA 2A5AA 2QIQA 1V2JT 3Q76A 1G3DA 2HPQH 4I31A 2KR7A 4D8NA 2GCTB 2VGCC 4VGCB 1RJXB 5C0TA 1NS3A 2QE7D 3RXVA 4ZXYH 1GBHA 5FCKA 1L0ZA 4Y11E 1XUKA 3ZZCA 4I8LA 1EJAA 2A1DB 4AFQA 5GPIB 1ZRBA 1ZPZA 2J98B 4K3JA 5IDKA 4B2BA 4I8JA 1WUNH 1C1RA 5ESTE 4ABIA 5C3NA 1VZQH 2C4FH 3MNSA 1SLUB 1A5HA 4MTBA 5DP8A 1W2KH 2C3SA 2OC0A 2ZA5A 2BVXH 4NA9H 1O38A 2Y7ZA 2OXSA 4WMDA 2ZECA 4Z0KA 1ZSKA 5TCCA 4X2YA 1WDIA 3O8CA 4I7YH 4INLA 2A32A 2CF9H 1QB6A 2GZ7A 1A3EH 1C5XB 1UHBA 2Y80A 1O2YA 1DANH 2Z9JA 4YT6H 4ABBA 2JH0D 1WYKA 8KME2 1C5VA 4TY7A 5K7RA 1QQUA 2XWBI 1MTNC 1P04A 2XBXA 1Y3VA 3RXGA 1ID5H 8ESTE 1KLIH 4DVAU 1GHWH 4Y8ZA 1MBQA 1YLNA 4AG2A 1EP5A 1C5MD 2AIQA 2ZU2A 3ZZAA 2OLGA 1W0YH 4WY3A 4AFZA 1O3GA 3OU0A 4MPUA 1O2GH 1BTXA 2JKHA 1MCTA 1RGQA 5C1UA 1C2EA 1MTUA 1CT4E 3QUMP 3H7OA 1A5GH 3ZVCA 5IYTA 3KQDA 4MNVA 3M5OA 4WXVA 1O2ZA 2STAE 4E7RG 1O35A 2G81E 1SFIA 1UVTH 1KXFA 1FX0B 3T28A 4WXIA 1QL9A 3KQBA 2B7DH 1QRZA 1A0JA 3BEFB 1H9IE 1DPOA 2J97A 2ZGCA 2GV6A 1TX8A 1PPBH 2BD9A 2ZHEH 4R0IA 1F0SA 3LU9B 3RC6A 2FOBA 1FXYA 3A8CA 3A84A 1HAYB 2ZI2H 4JZEH 2KX4A 5A0CA 1PQ8A 2Y6TA 1WV7H 3SU0A 1D3PB 3LGTA 1LVMA 3K2UA 4IN2A 3A83A 2TGAA 1FN8A 1PPZA 4Q80A 2SNWA 5IK2D 2XBYA 1SGEE 1S82A 4AYYB 1C5LH 1QB9A 3BTTE 3SGBE 1SGFG 5FPSA 3EA9A 2BLQA 1O2XA 4AX9H 1SBWA 2BMGB 3FKSD 2CJIA 2CK3D 4RT0A 4X8VH 4UFGH 1JIMA 3QN7A 2FODA 3ZYEA 1ETRH 2BDCA 1BOQA 1P57B 3ZZ6A 2Z94A 1ELFA 4FU8A 2TGTA 4JCNA 1TWXB 3A88A 1AVGH 3FO8D 2FPZA 5JBTA 3F2FA 1EAWA 1XUHA 3F9HA 1SGQE 4XSKU 4B75A 1V3XA 6GCHF 2VH6A 4UFEH 1ZZZA 4DG4A 1MABB 4RKJB 1BTUA 1O30A 3W95A 4CRDA 1SI5H 3IG6B 2A4GA 2KCOA 1TMUH 4JYTA 4UFFH 1SOTA 3E3TA 4WH6A 1Z6EA 5EPYA 1Z71A 4DY7B 3RUOA 4AOQA 3V13A 1GMCG 2UUYA 2M2AA 4ZUHA 2V3MA 1AMHA 3P8FA 2PHBA 3SJKA 1EKBB 2CHAC 4GVUA 4X2VA 2IN2A 2OINA 1KLTA 2LPRA 3GCTG 5EODA 2KCAA 1WTGH 4GPGA 3Q3XA 1E38B 3EE7A 1Q3XA 2L74A 1CGHA 4B2AA 1YF4A 1K2I1 3O8DA 2P3UB 2ZDNA 2C8XB 5FHTA 1MTNB 1F2SE 2O8MA 1P09A 1P2JA 2KFWA 1W12U 1E0FD 1GHVH 2W3KA 3A7ZA 1YYY1 2IJOB 4P02A 5EJLA 2OBOA 3ZVGA 1SQAA 3ATLA 4K5ZA 4KTCA 4Y76A 1O39A 1ZSJA 1ZPCA 1EAUA 1BCUH 4OS4A 1GI9B 5C67A 5CDFE 1QRXA 1E1QD 1SLWB 4D76A 1O5FH 3LDXH 5JBCS 1AU8A 2BX3A 1SFQB 3RXMA 3T2NA 3UNRA 3K6ZA 3UNSA 5HMAA 1A61H 2XC4A 3SV6A 2BDGA 2R0KA 3D49H 1C2HA 4UD9H 1GCTC 4Y71A 1L2EA 4NIYA 4IN1A 1AI8H 3Q77A 3WWFA 4FUBA 1OS8A 1LQEA 1F92A 1BRCE 1YC0A 1HIAA 3GCHC 1Z8IB 3SJ9A 1VCQA 3GY3A 3MHWU 1CU1A 1P11E 1UCYK 1XUGA 2I6QA 1GDNA 2WV5A 2VINA 4KKDA 4JYUH 2A5KA 1TNGA 1TYNA 1ZMLA 1TGBA 1TPAE 2SGPE 3UQOA 1BTHH 4O9VA 9ESTA 2XC0A 1PYTD 1NPMA 1YPMH 3D62A 1GHYH 4I32A 4FUJA 1TGCA 1Z8GA 3NXPA 3UWJH 3RXQA 1WQSA 1QR3E 2SGEE 1O2IA 1VCPA 1V6DA 3N7OA 1K28D 2OC8A 1GJ5H 1WAYB 4FUEA 2GZ9A 1ELCA 2XRCA 3U69H 3PV2A 3MQKC 2ZDMA 3V3MA 3TIUA 3MO6A 3OE7D 1EAXA 1O2WA 1WXRA 1H1BA 2UWLA 5L30H 1G32B 4CR9A 2AMQA 1O5AB 5TJXA 1C1WH 3OTJE 2ZHQH 1LMWB 3MU0A 1KXEA 1GHZA 1O3MA 4ZXXH 1O3AA 2BD5A 1YP9A 3BG4B 2DE8A 3RU4E 2NU4E 1P3CA 1THSH 4Q7ZA 4HG6A 2QCYA 1BZXE 1S6FA 5F53A 1GI8B 1BTWA 1SQOA 5DO4H 2OQUA 1ELAA 1O3CA 1SGYE 2ZQ1A 1TGTA 4TWWA 2HNTF 2LNCA 3RXSA 2D2DA 5DG6A 1XKAC 3P70B 4NSYA 1AZZA 1XVOA 1GBCA 2F9OA 3EQ0H 2AERH 2BXUH 2VH0A 1OYQA 1BTZA 1GI5A 5BPEA 3QK1A 1MKWK 4DT7B 1HJ8A 1Z7KA 1S5SA 1GMCF 1KTSB 1L4DA 3HK3B 3OSYA 5JDUB 1WU1A 1O36A 4NWLA 1JBUH 2WPHS 3SGQE 1AFQB 1P2NA 1V2WT 2Y5GA 3F3BA 4NIWA 2BDBA 2ODYB 1FI8A 3SHAH 1SGIB 1XKBC 2Z9IA 4WMEA 1DSTA 1OKXA 2K1QA 3GCTF 2FOAA 2PTNA 4DW2U 1DLEA 4A1XA 4A1TA 3DSOA 1SMFE 3LONA 4GCHG 3A85A 4U01A 3STJA 3C27B 1WSSH 1MCVA 1J16A 1DY9A 2WYJA 3PROA 5JBBS 3GCNA 3TJUA 2YNAA 1SG8B 1Q31A 1ZHMA 1V2VT 1AHTH 2NU0E 5DJ7A 1AKSB 2HPPH 1C5RA 3H5CB 4K1TA 4X2XA 4CRBA 4AN7A 3TGKE 1P9UA 1PPGE 1W10U 2ASUB 1D9IA 1K9OE 1FLEE 2Q6DA 3PM3A 1SL3A 1ELGA 3DD2H 5A0AE 1EZQA 4YOGA 5HIZA 2V0BA 3GCHB 3GCOA 1EOLA 2ZPRA 1GG6B 1O0DH 2GV7A 1NFUA 5JPMH 1QB1A 3RC5A 2IPHA 2PSYA 4MQAA 1ZLRA 3A7YA 3STIA 1C5NH 3BTFE 1CHOG 1BTPA 1MQ5A 2QXGA 1WQVH 2BY6X 2J2UA 1HAOH 1F0RA 5A0BA 2A7JA 1NRNH 2XCFA 3BN9A 3NZIA 1MZDA 4HTCH 5FPYA 1UO6A 3VXFH 1P12E 1NRQH 2GP9B 2G00A 1P2MA 2JJ1D 1DUAA 2PKAB 3GDSA 1HUTH 1A4WH 1BHXB 3ZZ3A 3BTWE 1A2CH 1C5QA 1LCYA 3SV8A 2BDYA 3FP6E 1ZRKA 3GISB 3EGKH 1V2UT 1NN6A 1O3PB 4VGCC 1YLCA 3N7DA 2V7QD 2ZCLP 4ZKSU 1VKYA 1P9SA 1WBGB 2XWAA 3ATMA 4ISOA 2BOKA 1NROH 2ZTXA 3PV5A 3TGJE 3U8RH 4ZMAH 4YO9A 1YPEH 1K1OA 1TE0A 2DE9A 3VEQB 2EQNA 4BANB 1KXBA 2FOGA 3IITA 1W14U 3TGIE 1FY4A 1GJDB 1SGNE 1AKSA 1UTOA 1NESE 1DSUA 2UWPA 1EPTB 3GY6A 3Q3KA 3KQEA 4TT3D 1NO9H 3MMGA 4CRAA 3SI3H 4B74A 3MO3A 3E0PB 2XNDD 2XW9A 4K60A 3GY8A 1BUIA 4E06H 2CN0H 4I8GA 3BTKE 2STBE 5EJ1A 2F83A 3SU4A 5E0HA 3EE0B 1G3EA 4FUIA 1OWIA 2VIVA 2H6MA 1EZUC 3SJ8A 1BTYA 3RXHA 1GVLA 1YPKH 2W5EA 2QV1A 2NWNA 5T6GA 1OOKB 1C1QA 4NCYA 1IHSH 5CE1A 2NU2E 3BF6H 5JB8S 1N1LA 2OTVA 2PW8H 3SGAE 1UCYH 1YCPK 4X6NA 9LPRA 1AD8H 4DIHH 1D3TB 1CA0B 4KELA 4OM9A 4FUDA 4YZUA 4LZ1H 1EASA 1GJCB 3TJVA 1S83A 5ESBA 5AVDA 2TGDA 2BZAA 5DP3A 3U8OH 1DE7H 4ZHLU 3EYDA 4B73A 2NU3E 1TPPA 1XUIA 3SQHE 1DS2E 1H8DH 4YESB 4DIIH 4FUHA 2RFKC 2R3YA 1O2MA 2RDEA 1W7XH 3P8OA 1DXPA 5CHBA 3ZZ5A 1Q2WA 4K69A 1SQTA 1VR1H 2GGVB 3DA9B 3ZZ9A 1TRNA 3BTME 2FS9A 3ATKA 5B6LA 4GCHF 1EPTA 3PLPA 4B1TA 5JBAS 4Q4LA 2ZHWH 3DSPA 2BVRH 1EB1H 1Z1JA 1DWDH 1ESBA 1C5PA 1ZGIA 2BY8X 4DOQA 3P8GA 1TRMA 3T29A 1P05A 2GDEH 1EJMA 1C2DA 4TWYA 1A0LA 1GBKA 3UR6A 1GHBG 5FBIA 2O8TA 2KCPA 4YOIA 2H9TH 2SGAA 2GDDA 5H4IB 1N8OB 1UHBB 2ZPSA 3BTHE 4H4FA 2IPQX 1SHHB 1J17T 3KYFA 2ANWA 1EQ9A 2YMSD 2VIDA 4U32A 1E79D 4H6SB 1PQAA 4ISIH 1MUEB 1C2GA 3E1XB 2FI4E 2QAAA 3RMMH 5J4SA 1AZ8A 1CHOF 2AHME 4A7IB 1BJVA 1Y3XA 2XXLA 1H9HE 1GMHG 1C1TA 5C94A 4ISNA 4JZIA 1OWDA 1GI4A 1GJ9B 3KEEA 4X1SU 1MKWH 5C2ZA 1NBMD 4AZ2B 1FY3A 1GJ8B 4K1SA 4QT8C 3RXCA 1L1GA 1OP8A 3NCLA 2Z3DA 3SU6A 2BVSH 2XOKD 1F7ZA 1FIWA 1MTSA 4NSVA 1ZYOA 1B0FA 5EQQA 2R9PA 1SLXB 1HJAC 3TK5A 3SO3A 4BXWA 1O3JA 1TAWA 1C1VH 1O37A 2FDAA 2FOEA 4BAKB 3VPKA 3RXTA 2JDID 3K6YA 1NFXA 2XTTB 3AAVA 4Q2KA 2ZU5A 2A45B 3SU5A 1W3CA 2A7HA 2QXIA 3A8DA 1T7CA 2ZG0H 5L2ZH 2THFB 1YGCH 2ILNA 3SJIA 1UK3A 4RI0A 2O8WA 3W1EA 1AN1E 3TH3H 4MDSA 3S9AA 1TBRH 1DWBH 1ETTH 1T32A 2A4RA 2J34A 4Y8YA 1ZSLA 4OS5A 1G3BA 4BNRA 4MNYA 4CBOA 4UONA 1YWUA 1IQMA 1D3QB 4OS1A 3SUFA 2HRVA 4ABJA 2LP6A 1W13U 2EI8A 1HDTH 1YPHE 8LPRA 2VWMA 2A2QH 2FWWA 4F55A 1VITH 3TLOA 1T4UH 2ZEBA 1B5GH 2ODPA 2ZU4A 5DPAA 3F1SB 1CHGA 3QX5H 4GUXA 7KMEH 2IOTA 1ORFA 1LTOA 1TQ0B 1S6LA 7LPRA 2V6NA 1ZPBA 1SGFA 7GCHG 1GBIA 2BOHB 3SNBA 1SQRA 5KGOA 3ZVBA 5T3HA 3MO9A 1T8MA 5HM2A 2G4TA 3KF2A 1TX7A 3RXJA 3UIRA 1L4ZA 2SGQE 3FVFB 3SZEA 1BQYA 5GIBA 2Z3EA 1SSXA 5F03A 4SGAE 2ALVA 4P00A 2Z9GA 3A80A 2BD3A 1T8LA 3E6PH 3M3TA 1NM6A 4X8UH 4IGDA 3P8NA 1XUJA 4CRCA 1GHBF 1H8ED 1FZZA 2VVUA 1HFDA 3VB3A 4E05H 2AEIH 3AASA 2ODQA 1Z8RA 2HOBA 2WUBA 1EZSC 1P03A 1QURH 3BG4C 3S0NA 3ZIAD 4XD7D 1BMLA 5FBEA 1HYLA 1TABE 1Y3YA 1P01A 5BRRE 3C1KA 1MQ6A 5AHGH 1Z8JB 2FOHA 1DOJA 1QFKH 3M5NA 1YCPH 1GMHF 2QGRA 4D7GA 4AORA 1C2KA 1O2KA 1BRBE 1FN6A 2FOMB 1VJ9U 2ANYA 2BDHA 5LPEA 2BTCE 5FX5A 2FI3E 4GAWA 1HIAB 4AGJA 1HJAB 2UUKB 3EAJA 1QBNA 2F9PA 2Z3CA 1C5YB 1FJSA 1K1JA 3MU8A 4XBBA 2TGPZ 1UMAH 2JETC 2RDLA 4KTUA 2YOLA 1AFEH 2ZC9H 3QZRA 3R0FA 5HKKD 3MYWA 1NC6A 2HALA 3CS0A 4ESTE 5F8TA 3HATH 1C5TA 3AW1A 1KXAA 1O34A 4D7FA 3MFJA 5DK1A 1AFQC 1ZGVA 1TQ7B 2D26C 1DVAH 3NKKA 5EJZA 3L6PA 2EY4C 1GBJA 1GCDA 1C2FA 3DUXH 4R8TB 1Y8TA 2VWLA 2C8YB 1MTVA 1IHTH 1GBFA 5A09A 1T4VH 1HAGE 1ZMNA 3A7XA 4LXBH 2GMTC 1AVXA 5I25A 1UK2A 4ABEA 4DGJA 2BQ7B 4O3UA 1ELVA 2AIPA 4B71A 5FCRA 4AFSA 1LKAA 1YPJH 2CGAA 1S0RA 3UR9A 1O3NA 5A2MH 1UTJA 5DKMA 2PWXA 1ZJKA 1MU8B 2XC5A
chains in the Genus database with same CATH topology
1UTLM 2H2ZA 3KNXA 2WV4A 4CREA 4O3TA 2P8OC 3CP7A 3LOXA 2PV9B 2ZTZA 4BAHB 2PSXA 4FVDA 5LH8A 1EUFA 1GG6C 4MPWA 3RXIA 4CH2B 4AB8A 3M5LA 3ZZBA 1QA0A 1O2TA 2Y5HA 4YLQH 1GI6A 3T27A 3IWMA 1DX5M 3RLYH 1EP6A 7GCHF 1QNJA 2BLOA 3UOPA 4J2YB 3TK9A 1N6YA 3DFLA 2JH6D 3TJNA 1UCYE 1NT1A 4SGBE 3PTNA 4FVBA 3QGNB 1FUJA 2A0QB 2FTLE 1O3OA 3M37A 1AIXH 4NZLA 3SQEE 1AUJA 1EAIA 1PQ5A 1HV7A 1DITH 3TPIZ 4I8HA 4NWKA 3SBKA 1IQFA 3UQVA 3P17H 1SB1H 2XBWA 1JRTA 1QTFA 2C8ZB 1BB0B 1YPGH 2F3CE 2G52A 4NIXA 3B23B 5EXMA 3SZNA 5LGOA 2XBVA 3AW0A 1Z1IA 3BIUH 4BAQB 1GMDG 2Z6BD 4X8SH 6ESTA 4MNXA 3MH7A 4F4OC 3GOVB 4DCDA 1OPHB 1EPTC 1CA8B 4UE7H 1HAPH 4K8YA 1FIZA 3I29A 1IQGA 7ESTE 3M36A 5FPTA 1S84A 2M5TA 3EDXB 2ZGXH 4TPIZ 4XBDA 5EQSA 1TMTH 3PLKA 1OSSA 3HGNA 4X0WU 1HAVB 4M7GA 3A7VA 4GHQA 5G4BA 4TYDA 1OWKA 3AVZA 4CBNA 3CS7A 4X1PU 2JETB 1S85A 1VGCB 4BXSA 2B0FA 1ZHPA 1D4PB 3VB6A 1PPHE 3KHVA 1G2MA 2P3FH 1F0TA 3RC4A 4NIVA 4YOJA 1CA0C 3ODDA 1S6HA 1AGJA 1SGCA 3LGVA 2BLWA 3O8RA 1L1JA 1RTFB 1TOCB 2GT7A 1THRH 2ZKSA 3Q00A 5T6FA 4K2YA 4A6LA 1A1RA 1GJ6A 2GMTB 3ZVEA 5EQRA 3QWCH 1ARCA 1GHAG 2ULLA 1H8IH 1DWCH 3LKWA 1IQJA 3T5FH 1HAHH 1IQIA 1GBEA 2SFAA 1OP0A 3MH5A 2GKVE 3A87A 1RS0A 1WOFA 4KGAA 1LVBA 1K1LA 4HGCA 3MU5A 2DUCA 1C1PA 1MZAA 2AGEX 4A5TS 3LT3A 1ARBA 2C93B 4GHTA 2HVXA 2P8OB 4X1NU 5EW2H 5E8EH 1KXCA 1O3BA 5J4QA 5GDSH 4NA7A 3LC3A 1UTMA 3ZV9A 1C5WB 1EX3A 1C4U2 1HAVA 1JOUB 1JRSA 1N8OC 4NZQA 2VIOA 2Q6GA 2GT8A 3EA7A 1IQNA 2HLCA 4LZ4B 1TNHA 1AQ7A 4X8TH 4B76A 1AY6H 2P16A 1UK4A 1K1MA 1YM0A 1OX1A 3UFAA 3RMNH 3B9FH 1C9PA 1FY1A 1O2OA 4RKOB 2CV3A 2QY0B 3UPEA 3UTUH 1QJ7B 3VB5A 1TBQH 1G9IE 2J95A 1QHRB 2EI6A 3ATIA 1U6QA 1HLTH 3BTGE 3MH6A 3FZDA 1FAXA 1XMNB 1EATA 1MKXK 5FAHA 1SHYA 1K1IA 2ZGHA 2V3OH 4F49A 5SGAE 1TOMH 1VCWA 3E16B 2GTBA 1J9CH 1LVYA 2B8OH 3M5MA 1O2SA 2QA9E 2AH4X 2QF0A 2SGFE 3SNAA 5PTPA 2ZFPH 3U1JB 1E34B 2VIPA 3RXRA 3B8JA 2H5CA 1K22H 2R0LA 5TCAA 2FM2A 2OCVB 4RSPA 3SI4H 3ZZ4A 3GY2A 4GSOA 4E7NA 2ZF0H 5F8ZA 1F5KU 1O33A 5A8YA 6CHAC 1CBWB 3TH2H 2GCHG 4AYVB 1FV9A 1IOEA 1G3CA 5I46H 1GL1A 1GMDF 2C90B 1CT0E 1E37B 3QO6A 1DM4B 4LK4A 3RXUA 2KAIB 3M7UA 2C8WB 1GBAA 1QJ1B 5FX6A 1D6RA 1KIGH 3U8TH 1TNKA 2ZDLA 1DXWA 2ZIQH 1GPZA 5C1YA 4YTAA 3L33A 2A5IA 1E35B 1SVPA 3T25A 2V3HH 2GD4B 4Q7XA 1AB9B 2J9NA 2OQ5A 1ELEE 1MAXA 3LC5A 1V2RT 3SU3A 2FOFA 2VVCA 3A7TA 2YNBA 3LGUA 1ANCA 3T26A 4MPVA 4ZROA 1OWJA 2BD2A 4ZKNU 4BTUB 3BV9B 3QGJA 1Y5AT 1V2NT 2EEKA 2H9EH 4ABAA 1RTKA 1P06A 1Y3UA 5EU8A 3V0XA 3RXPA 1SGRE 2WPIS 1CVWH 3PMJA 4Y7AA 2F9BH 2G51A 3H7TA 1UVOA 1O3KA 3NK8A 5CHAB 3SN8A 4U2WA 1SOZA 1QGFA 1YKTA 5LPRA 2FESH 5DP6A 4PROA 3CENA 1GHAF 1PYTC 1C5ZB 1C4V2 1O2JA 1O3HA 2BDAA 3MU1A 1ZHRA 4NFFA 1P2OA 5E2PA 2G55A 4BOHA 4X6OA 3G01A 4BAOB 3PWCA 1OXGA 2O9QA 4CRFA 1GJBB 2KAIA 2VU8E 1GVKB 1OP2A 3F9FA 3LGYA 3KQCA 3URCA 1IAUA 3ZZ8A 3MWIU 1V2ST 2PKSB 1GJAB 1O3LA 2BD8A 4B2CA 2PTCE 4IC5A 1S81A 3GDUA 2BM2A 1ESTA 2ZCHP 5GXPA 2P93A 3UNQA 3BTEE 1AUTC 3TU7H 1FONA 4D9QA 1DY8A 2TIOA 4AGKA 1NU7B 3RMLH 4CH8B 4Z6AH 1ABJH 3U98H 2J4IA 2FO9A 3MTYA 4H6TA 3RXKA 1RFNA 4D9RA 1LQDB 1UVUH 3LGWA 3VB4A 4ASHA 4O03A 3HKIB 1T8NA 5C20A 5HXFA 3SJOA 1O5EH 1X7AC 1G30B 4YLUA 3KL6A 3VGCB 5GWZA 1A0HB 1GHXH 1P0SH 3RP2A 1GGDC 2FMJA 2Z9LA 1CQQA 1DT2A 1H9LB 1Y3WA 4XE4A 3T62A 1TIOA 1PPFE 1EJNA 3VFEA 2EC9H 1MD8A 3ZV8A 1GI1A 1DDJA 2P94A 2W7UA 4AG1A 6CHAB 1O3DA 4AB9A 2BQWB 1KSNA 1O2NA 3SOSA 1HXEH 4IMQA 3DHKH 1LHEH 5C5OA 3RU4D 1V2OT 2O8LA 2CF8H 1OWHA 1BIOA 1G2LA 3RXEA 1YLDA 2GCHF 1JXPA 1J8AA 1XVMA 3NUMA 1QL7A 2ZWLH 4NGAH 2O8UA 1K1PA 3GY5A 1HB0B 1KY9A 1IQHA 3ESTA 1PFXC 3GDVA 3LH1A 2ZGBH 3ZYDA 3S9BA 1CGIE 1W0ZU 1HCGA 1KXDA 4Q7YA 1P02A 2BD4A 1YPHC 3BEUA 4ZKRU 2ZFTA 3E8LA 4ABHA 1QBVH 3OYPA 1SLVB 4ZHAA 3RM0H 3RXDA 1BRAA 2QYIA 1J14A 4U30A 1O2VA 1KDQA 1ESAA 3KIDU 1QBOA 5L2YH 1TPOA 2F91A 4J1YA 1F5LA 1OWEA 4KTSA 1MKXH 3VXEH 5EGMA 2FZZA 2ANKH 1HPGA 1W11U 3V12A 1GI2A 5DP7A 4BTIB 4OS7A 2G5VA 2ZU3A 1ZOMA 1TGNA 2W26A 2HGTH 1AE5A 1C2MA 5LPFA 1JIRA 2ZTYA 1H4WA 1UJ1A 1GL0E 3SNCA 3M7QA 3A7WA 3M7TA 1O5DH 2PGQB 4UFDH 1J15A 1ACBE 1UTKA 2AMDA 3MNXA 2P3TB 1ABIH 3SU1A 1BA8B 1VITG 1ANEA 3ODFA 2D8WA 2FEQH 1CO7E 1SPJA 3LJOA 1IQEA 1BBRK 3KN2A 3GY4A 4MVNA 1P3EA 1AWFH 3FANA 1OYTH 2FX6A 2AS9A 1BHXF 2RG3A 2OC7A 3SV2H 1O2RA 1N6XA 1WTHD 1GJ4H 1O3FA 1GJ7B 2AYWA 4NA8A 2SGDE 1BBRE 4GLYA 4Y0ZE 1TMBH 3QLPH 2QXHA 4X2WA 8GCHG 1GBDA 1HNEE 3SV9A 2BY7X 1SR5C 1SGDE 1QCPA 3MNBA 5B6OA 5GJ4B 4NFEA 1TBZH 3S69A 1GGDB 1KYNA 2AFQB 1RRKA 2EA3A 1MMJN 4MLFB 3PLBA 2ZDKA 2FYQA 3BTDE 3Q3YA 1DUEA 5JYIA 2Z9KA 1ZTKA 2VGCB 1LHCH 3MNCA 3RDZA 3U1IB 1BMNH 1ELDE 3GICB 3A86A 1C5UA 3F6UH 3M3SA 1UTPA 2NU1E 3SNEA 4Y6DA 2RCEA 1W7GH 1VGCC 3TVJB 1C1MA 1YCPM 2QXJA 1HJ9A 1D6WA 4ABFA 2BD7A 3SUGA 1PQ7A 1V2QT 3M61U 2ZQ2A 1DWEH 2ZDVH 4FUGA 1BMMH 1INCA 3JZ2B 3E0NB 3I78A 1ZJDA 3ELAH 5E0JA 1P2IA 4I8KA 1NFWA 4DJZB 2OD3B 5C1XA 5DP9A 5AF9H 1XUFA 1BDAA 1O3IA 1MAYA 2VJ1A 1QA7A 2PUXB 2A4QA 5EXNA 1GDQA 3UWIA 2WPKS 1TFXA 1MH0A 1AO5A 3ITIA 1TALA 3SU2A 1GVZA 1E36B 2RA3A 1O5GH 2BXTH 2UUJB 3A81A 4OS2A 3RMOH 4OS6A 2PGBB 3PWBA 3LH3A 3HKJB 2ZZUH 4WVPE 1F0UA 3EA8A 3BG8A 2GVFA 5EG4A 2BYAX 3OY5U 1HGTH 2VVVA 1V2KT 3NPSA 4TPYA 2FXRA 5HGGA 5HM9A 2ZDAH 5DP5A 1GBLA 2ZCKP 2QC2A 3HPTB 1O2LA 1D3DB 3BEIB 4OGYA 1NFYA 4YM9A 1GI7B 1SGTA 1FNIA 2WPJS 1ANDA 3DFJA 1B7XB 1UVSH 2SNVA 1BITA 1LPKB 1HBTH 5EW1H 1QJ6B 1V2MT 3F68H 4LOYH 1PPEE 2BB4A 3A89A 2WUCA 4A92A 2W3IA 1C1SA 2W7SA 2ALPA 2UUFB 1F5RA 2J38A 1HAXB 2ZU1A 1BT7A 5L6NH 1UTQA 1FQ3A 1QQ4A 2A4OA 2H1UA 1LVOA 4Y7BA 1NRPH 1K21H 4WMFA 1NRSH 3PYHA 2CMYA 1P2QA 2XNIA 2D1JA 3QZQA 2FX4A 1HAZB 1VJAU 5A8XA 1XX9A 3RXBA 2WPLS 4IMZA 3TITA 1L1NA 3ZVFA 2ANMH 2HWLB 2J94A 1KTTB 2I6SA 3RXFA 3W94A 1O5BB 2OP9A 1BRUP 3GYMA 1VITF 2PLXA 1RIWC 3SNDA 1LHDH 4FU9A 2VWOA 2BX4A 1XXFA 2FLBH 4X6MA 1MD7A 1C5SA 1G37A 3SHCH 1TA6A 4INKA 4BAMB 1T31A 2FI5E 3SORA 1NRRH 3D23A 2B5TB 3SW2B 4X6PA 3TJOA 1CBWC 3HGPA 2A2XH 1CGJE 3URDA 3P95A 2OUAA 4IW4E 1QY6A 3JZ1B 2J92A 4HI3A 3HK6B 1KLJH 2PUQH 2G4UA 3A8BA 1UTNA 8GCHF 1LKBA 5E0GA 3O8BA 2ZPQA 2XYAA 3ZVAA 1GWAA 4INHA 4XOJA 1O31A 2FYRA 2QF3A 5DP4A 1EZXC 1GI3A 1G36A 2PR3A 3NWUA 1DFPA 3S7KB 4Y0YE 4H42U 3M35A 1A3BH 1A5IA 4XBCA 3MH4A 2ZFQH 5C5NA 2Y81A 1NZQH 1AB9C 3PO1C 3KGPA 4HZHA 3QTOH 4FU7A 3BSQA 4UDWH 1QIXB 2A7CA 2WPMS 2H5DA 1DICA 3D65E 1ZTJA 2ZFRH 4K1EA 3RM2H 3ENSB 2ESTE 3PB1E 1BJUA 2CHAB 2R3UA 1C1OA 4IS5A 1TX6A 4ISHH 4MPXA 1YPLH 2ZHFH 1LPZB 1AE8H 1Y59T 2TBSA 3UREA 5T6DA 2G5NA 3UY9A 6LPRA 1AWHB 1B0EA 5CHAC 4FUCA 1C2LA 3LIWA 1O3EA 5HYOA 3RLWH 4RN6A 1BBRH 2P59A 3TNTA 3SV7A 4KP0A 1DLKB 2AGIX 4CHAC 1FAKH 4YT7H 1A46H 2AMPA 4I33A 2QN5T 1TONA 1THPB 4XDEA 1LPGB 1O2PA 4WWYA 1YBWA 1O2QA 4WH8A 1FY8E 2GZ8A 2P95A 1UVPA 3FZZA 4JZDH 2EI7A 2BZ6H 5FXLA 1FPCH 1V2LT 3GY7A 2PKSC 3V7TA 1GCTB 4A1VA 4JK5A 1TRYA 2Q6FA 3U9AH 3VB7A 1CE5A 2Z7FE 3F9EA 2WINI 4Y8XA 3ZZDA 1GDUA 5F6MA 1C9TA 3RXOA 1W8BH 2ZNKH 3TH4H 4FUFA 2CXVA 4JZ1A 5GCHG 1GBBA 1S0QA 2AGGX 3MOCA 1O2UA 1PJPA 2TRMA 1LO6A 3UOUA 2FOCA 4XFQA 1V2TT 4CR5A 2FIRH 2BY9X 3MI4A 4AFUA 2OC1A 1XM1A 2ZO3H 5EOKA 5ABWA 1C2JA 2BY5X 3VGCC 3E90B 4X1QU 1RIWB 3OY6U 2GX4A 2WYGA 2TPIZ 4DURA 4JYVH 4Y10E 2R2WU 2GCTC 3LPRA 2H9HA 5EXLA 2B9LA 1O5CB 3S7HB 2R2MB 1K1NA 2F9VA 1LHFH 1WCZA 2ZFFH 1HXFH 1CSOE 3PMBB 3PMAB 2F9UA 3RXAA 1TA2A 2HNTC 4ZHMU 1C4Y2 2VNTA 3A8AA 5AFYH 2RA0A 3FFGA 4TY6A 1P8VC 1FY5A 1XXDA 4Y79A 1FPHH 2BLVA 2HNTE 2ZHDA 1Y5UT 1Z6JH 5A8ZA 1TNJA 1RXPA 5K0HA 3PMHB 4WJG2 2ZGJA 2VIQA 4O97A 5CMXH 4ABGA 2ZFSA 3R3GB 1T8OA 1SC8U 3PO1B 2FP7B 3ZZ7A 1NU9A 4ABDA 4K8BA 4OGXA 3OX7U 2BQ6B 5E2OA 2XCNA 2UWOA 3E91A 1A7SA 1ETSH 1ZMJA 2VWNA 1TNIA 1ZTLA 1MBMA 5ETXA 3SUDA 1GBTA 3MU4A 2FLRH 1JMOH 2PFEA 1RTLA 3K9XB 3M3VA 2F9NA 3SUEA 4BTTB 1EOJA 2PKAA 4ZAEA 2FTMA 1C1NA 3K65B 1ELBA 1NTPA 3QDZB 5F8XA 1EB2A 4CRGA 3BTQE 1TGSZ 3LGIA 4JK6A 4ISLA 3KCGH 3F9GA 3A82A 1NY22 1FMGA 3LJJA 3FAOA 3PV4A 4CHAB 3ZVDA 4ZKOU 2BDIA 1O32A 3GYLB 3I77A 3L3TA 3BIVH 2Y7XA 4IC6A 4UEHH 1FDPA 3P92A 1MU6B