3RXRA

Crystal structure of trypsin complexed with cycloheptanamine (f01 and f03, cocktail experiment)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxrA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxrA02
4DGJA 1W10U 1TPSA 1WYKA 4FU9A 3IG6B 3K2UA 4A7IB 1K1OA 2BD3A 3A8BA 3DFLA 1LMWB 4MDSA 3VB4A 1SVPA 3QLPH 4BTIB 3R0FA 1AUTC 1LPGB 1CGJE 3RM2H 3LJJA 1P11E 4ZHLU 4CRGA 5E2PA 4X8VH 1K21H 1GG6B 2BY5X 2Z7FE 4X8TH 1GJDB 1H9HE 1QL9A 1GJ5H 3ZVBA 2EI8A 1ETRH 3RP2A 1EKBB 4NFEA 4UD9H 3F9GA 1C1RA 1UVOA 1ZSLA 2AMDA 4CHAB 1BTWA 5EW2H 1T8LA 2BOHB 4AYYB 1SG8B 1D4PB 1GBJA 3DHKH 3MU5A 3G01A 1EPTC 4X1SU 4YESB 1DOJA 3A80A 3SO3A 1XKBC 1ESAA 3FP6E 2WYJA 3ESTA 1TNIA 2H9EH 1C2JA 2Z9JA 1QGFA 1WAYB 4I8HA 5T6GA 3BTHE 1HDTH 1KLTA 3LGYA 1GHBF 4WXVA 1NN6A 5DP4A 4YOJA 1PPCE 2A0QB 2IPHA 2W5EA 4UFGH 3VXEH 2FI3E 1C5MD 4JYVH 8GCHF 1VCQA 1HIAB 3JZ2B 2XW9A 1A61H 1RTKA 4PROA 3ZVDA 2ALPA 1Y3WA 1WOFA 2FI4E 1T4VH 5JYIA 1SGDE 1F5LA 1KIGH 1ZYOA 3BTGE 5SGAE 2CGAA 3N7OA 1DE7H 4JZEH 2YNBA 1DICA 1TOCB 4A1TA 3BTQE 4CRAA 3NXPA 3SW2B 1K1PA 4B1TA 1Z8JB 5A0CA 1ZJKA 1H4WA 1H9LB 3RMOH 2TRMA 4K1EA 1AI8H 1MD7A 3RXFA 5JDUB 2AMQA 3BTTE 2A4QA 4NZLA 1PPHE 1UVSH 5L6NH 2C90B 2BTCE 4I8GA 1GGDB 1SQOA 4UDWH 1C5UA 1E34B 1O2OA 1J14A 1HB0B 3P70B 3SV8A 3ZYEA 4YT6H 3SI3H 2AS9A 3PMHB 4ABDA 2G81E 1QCPA 1O34A 3SGQE 3WY8A 3A84A 1DITH 3LONA 5HYOA 5C67A 6CHAB 3T26A 1LQDB 2FOFA 3RU4D 1G3EA 3EE0B 4ABFA 1QB6A 4GSOA 2HNTE 2BQ6B 1SGCA 1D6WA 1CBWB 4RN6A 1C5VA 2PSYA 1O32A 1PJPA 1BBRH 1GVKB 5LPFA 1LHDH 2EEKA 5C1YA 2ALVA 3A7ZA 3PB1E 1O2ZA 3PROA 2PSXA 1OXGA 1O37A 5DO4H 1DX5M 2FOMB 3UNSA 3MU1A 3K65B 1TRNA 3F68H 1F0SA 3B8JA 1N6XA 1D3TB 4I31A 1OWIA 3LH3A 4OS1A 4U32A 1AU8A 1YF4A 1EAWA 1ZLRA 4NIVA 1O2MA 5LH8A 4HTCH 1GCTC 4IC6A 2FWWA 1O2TA 1SGEE 1AN1E 1ZOMA 4FUJA 1TNLA 2R3YA 2R9PA 4WF8A 4YOGA 4Y0ZE 1QBVH 4K2YA 1IQEA 1SGFA 1XMNB 3A89A 3UQOA 1O2HA 1F5KU 2FYRA 2HGTH 1TNGA 1GBTA 3KQCA 3C27B 4OS2A 3OTJE 1ZRKA 1GI8B 5HM9A 1O2NA 4DCDA 2QYIA 1FY3A 1O3IA 4Q7XA 2VB0A 1G36A 4JZIA 3HK3B 3CS0A 1QBOA 2XC0A 4WY3A 2BDAA 1K28D 3A8CA 4BXSA 1HAZB 3SJIA 1ETSH 4O97A 3NWUA 1GGDC 3Q3YA 1ORFA 1P2MA 1V2QT 3RMMH 1TA2A 1ID5H 3P95A 1QL7A 2A5AA 2PUQH 3NZIA 5HMAA 4A1VA 3UPEA 1TX8A 1EPTA 2F9BH 2HVXA 1C9TA 3RUOA 3MMGA 6CHAC 2FX6A 2G5NA 1GI6A 2OC7A 1PFXC 3NCLA 1VITH 5A8XA 3RMLH 1TB6H 3AW0A 1IAUA 3MO6A 4JK6A 3ZV8A 3DFJA 1IQGA 1EP5A 1C5RA 1MKWH 1RTFB 4GAWA 1UVUH 3HKIB 2AERH 3VGCB 5ESBA 1FAKH 4JK5A 5BRRE 1IQNA 1O2GH 3PO1C 2ZP0H 2VGCC 1C2EA 1GJ4H 5FPTA 2FMJA 1L4DA 2ZPSA 1U6QA 1ARBA 1QFKH 2BLOA 5J4SA 1AHTH 1GVLA 4NA7A 1EAUA 3TU7H 3LH1A 1HXEH 1WV7H 3RLWH 3FP7E 1BZXE 1UO6A 3PWCA 2ZGCA 4XBCA 3UNQA 1WTGH 4Y8YA 5LGOA 1E36B 2Y80A 1O39A 1LO6A 2BMGB 2R2WU 1UHBB 1AFQC 4ABGA 3MWIU 2J34A 3OY5U 4OS5A 5L30H 4A6LA 1WBGB 2VIPA 1LTOA 1C1TA 1P3CA 1YP9A 2Y5HA 5GIBA 1C5ZB 1YPLH 1O2JA 2SGAA 3EA9A 2THFB 4F49A 1DY8A 3LGIA 1O2VA 2GV7A 1IQFA 1CA8B 1QQ4A 1HAOH 1L4ZA 1FAXA 1UVTH 1AIXH 1C9PA 3PMAB 1NROH 3UNRA 3U8RH 1BIOA 5AF9H 1THSH 2BD2A 2SFAA 3HGPA 2XC4A 1NC6A 1VJAU 4NIWA 3PWBA 4BAHB 1O5CB 1O2XA 1D3PB 3GDSA 2WYGA 1BBRE 1C5LH 2OUAA 2PKAB 2P8OC 3A81A 1QJ1B 3SQEE 4JZ1A 1KXAA 1Z6JH 5FX6A 4YLQH 3ZV9A 5JBCS 4ABAA 4WXIA 3RXIA 5HM2A 3TITA 4AFUA 4OS6A 1SOTA 2WV5A 1C5PA 7ESTE 3URDA 5C5NA 1V3XA 1PPGE 3ATKA 1GBEA 1V2VT 1C1QA 3KCGH 1AVGH 2UWLA 1CGIE 3U8OH 1GBBA 2YNAA 2BVRH 2SGDE 4MPXA 2BOKA 2I6SA 3MO3A 2O8MA 1LHFH 2QA9E 1TMTH 1GBHA 1EZXC 5L2YH 2GZ8A 1RJXB 1YM0A 3M3SA 5TCAA 2BLWA 2G4UA 4R0IA 1AB9B 8GCHG 3KNXA 2KAIB 1QNJA 1X7AC 1S5SA 4WH8A 2F9NA 4FU8A 4IW4E 2BX4A 3BTFE 4KTUA 1MKXH 4Y10E 1BT7A 1C1PA 1C2DA 3M35A 3TPIZ 5CE1A 2Q6FA 2QY0B 2VNTA 2HRVA 5ABWA 5GDSH 4ZHAA 2A4GA 3M7QA 4Y79A 2J2UA 3E1XB 4TY6A 4CR9A 1V2PT 1YPEH 4B71A 4TPIZ 1CA0B 1P9UA 1UJ1A 1MQ6A 1HPGA 2JH5D 1W3CA 3A7XA 3QK1A 1YLDA 4CRCA 2C3SA 2HPPH 1C1MA 4GHTA 1MBQA 1L0ZA 1TPAE 1GJ9B 4YZUA 5FX5A 2AGIX 3VPKA 3U8TH 3A7TA 2ZC9H 1O0DH 2BD4A 1XUHA 3E0NB 1S81A 3RXSA 3O8CA 3IWMA 2PWXA 1MCTA 4AB8A 1KY9A 1ZPBA 3AAUA 1PQAA 2BDYA 1GI3A 4B74A 1T4UH 1TE0A 1GI4A 1AWHB 2C8YB 2ZNKH 5EW1H 4THNH 1NZQH 2IJOB 1DM4B 3ITIA 3QDZB 1JIMA 1DDJA 4GPGA 1BB0B 1TRYA 1C5SA 1V6DA 1O2PA 3ZYDA 1BMNH 1SI5H 5CHAC 2B7DH 1N8OB 3D49H 1DPOA 1S0RA 1TX7A 4CREA 1HGTH 4BTTB 2J38A 3BSQA 1O2QA 3T27A 1TX6A 2NU1E 1KTSB 2AIQA 3M7UA 3VB3A 2PUXB 3MTYA 1V2RT 1Y5BT 2ANYA 5EGMA 1SR5C 3ZZ5A 2O8WA 5EG4A 1E37B 2ULLA 1RXPA 4YO9A 2GKVE 1JRTA 1MZAA 1P2OA 5HGGA 2WINI 3SOSA 3KIDU 1AGJA 4I32A 1V2LT 2B9LA 2F9VA 1P2NA 2ZGXH 4LZ4B 3A7VA 2ZPQA 3TVJB 2Z9IA 1NRRH 1OWJA 1TBRH 3HATH 4Y8XA 2UWOA 5DKMA 3SNDA 1FN8A 2SGFE 3RU4E 2CJIA 2O9QA 4M7GA 3RXEA 4AFSA 1L2EA 1SFIA 4VGCC 4A5TS 3RDZA 4K5ZA 4UEHH 3ZZDA 4AZ2B 2ANKH 3U1JB 5DP5A 1N6YA 2VIWA 4CRBA 4K8BA 1OYQA 1AZZA 3QUMP 1W14U 4Y7BA 1BJVA 4JCNA 4O3TA 1O3CA 4UFEH 1SGNE 1FPHH 3S7HB 4UONA 3Q77A 1C4Y2 1UCYH 5K0HA 4WVPE 4ISIH 3TK9A 3ZZ3A 1GBIA 4BANB 1TYNA 3E8LA 3GCOA 1EXFA 2NU4E 3T25A 1B7XB 1Z71A 2Q6DA 2JETB 2D26C 4X8SH 3STIA 4K60A 4ZKOU 2D2DA 2NU2E 2R0LA 3LT3A 7GCHG 4ZXYH 1ELGA 5PTPA 2CF8H 2Z3CA 3ENSB 3A86A 2A2QH 1OP8A 3O8BA 2Z3EA 1H9IE 3SV9A 2ZHQH 3S7KB 1W0ZU 3P8OA 2Y82A 1EZUC 1DXPA 1OKXA 1T7CA 3RC6A 4K69A 3RC5A 3SNEA 1THRH 3RXCA 1OOKB 1K22H 2HWLB 3SU0A 9LPRA 1EPTB 3F9FA 4ZHMU 2ZTZA 1O3LA 1SL3A 3AW1A 2CHAB 1CHGA 2ZU3A 3NPSA 4MQAA 1GI0A 1L1NA 1IQKA 1V2WT 2J95A 1D3QB 4UFDH 1K1IA 4MNWA 2ZU4A 1G9IE 4AORA 1ZHRA 1KDQA 2ZU2A 1GHAF 1VR1H 4AB9A 3W94A 1GWAA 4X2XA 4B2CA 2GP9B 2PGQB 5F8ZA 1OYTH 3GCTF 2V0BA 3S69A 1QRWA 3HPTB 1NRSH 1W0YH 2PKSC 1ANDA 4TWWA 2AEIH 1A0HB 3PM3A 4MNYA 3V12A 4FUFA 1P05A 1C5NH 3SBKA 1FUJA 1GJ7B 1FIWA 5AFZH 1YPHC 2LPRA 4I8KA 4AGKA 3VB5A 1AY6H 4FUCA 1LQEA 1K1JA 1PQ5A 1T8MA 1HV7A 2ZGHA 2G52A 1O5EH 3BF6H 4U2WA 3ZVAA 1ANBA 4J1YA 3BTKE 1CHOF 1IQIA 4CR5A 1RD3B 3SJ8A 1MUEB 2ZO3H 1LHGH 4DW2U 1BTZA 5CMXH 1CO7E 3GY2A 2BYAX 3PMBB 3M3TA 2HNTC 2P3TB 2TIOA 3UUZA 2DUCA 1BDAA 1Q31A 1TMBH 1P57B 1A5IA 1SPJA 4GCHG 2A31A 5C1XA 1EATA 1HJ9A 1V2MT 4JZFH 1DLEA 2Y5FA 1ZTLA 4LXBH 1UCYK 1BUIA 1GBKA 1ZHMA 2SGPE 3PYHA 2C8WB 4ABBA 4CRDA 1O3GA 4VGCB 2JKHA 1XUGA 2Z3DA 3H5CB 1VGCB 1ELBA 1CSOE 1ZTKA 1P2IA 3L3TA 4JMYA 4XDEA 1YYY1 2GTBA 1T8NA 3EA8A 2FIRH 1KSNA 2WUBA 4HZHA 1K1NA 2VIOA 1GBCA 3VFEA 2OXSA 2Z6BD 1NU9A 5DP6A 1O31A 5FPSA 1O3HA 2HALA 2XBYA 4XE4A 5DJ7A 1MTUA 1GI7B 1P09A 2VWLA 1SGPE 1C2HA 4LOYH 2UWPA 3V0XA 3CP7A 5ETXA 3LC3A 1C2LA 4AYVB 2R3UA 3MNXA 1KXBA 3SUDA 1SGRE 4YT7H 1EP6A 3GCNA 1A46H 1JRSA 2H5CA 5C1UA 1M9UA 2ZDVH 1CGHA 5F8XA 2TPIZ 1O3NA 1AZ8A 1PPZA 1EZQA 4BAQB 2GZ9A 4NA9H 2FOEA 4X6PA 2VJ1A 3QGJA 1MQ5A 2Z9GA 3T28A 1ZMLA 3TK6A 1IOEA 1YPGH 1UVPA 2FESH 4WWYA 3BV9B 2PV9B 2QXGA 3RXOA 2D8WA 3BTDE 2YOLA 1EB2A 2G51A 2ZA5A 3TGIE 2F83A 1BCUH 3ZZAA 1MU6B 3P8NA 1GJ6A 1V2UT 4RKOB 2SNWA 2W3KA 4FUEA 1TALA 4D9RA 3QX5H 1Y5UT 1SC8U 4FUIA 1FDPA 1QJ6B 1GI2A 1MAYA 3KF2A 3SNBA 1RGQA 4QT8C 2A4RA 1GVZA 5GCHG 4LK4A 1W7XH 1UMAH 4DT7B 2WV4A 1FJSA 3V13A 2B0FA 3F9HA 4IGDA 1BTYA 4UE7H 3LIWA 1G3DA 4DOQA 1P2QA 2BX3A 1NY22 2IOTA 1MTNC 1F0UA 3SGBE 4H6SB 5LPRA 1EQ9A 3GCTG 1GBDA 1UTNA 1FMGA 3PLKA 3SU4A 1C1WH 4DG4A 2AFQB 1ETTH 1VJ9U 3PLBA 1G32B 1NT1A 3QTVH 2A32A 3SU3A 1KLJH 1S84A 2ZTYA 2PFEA 1S6FA 1W12U 3MHWU 4INHA 3SV6A 3RM0H 1ELTA 3ATIA 3A83A 4DVAU 2CMYA 3P6ZB 2G8TA 4GUXA 1LKBA 2UUJB 2A4OA 3LDXH 5JB9S 1Y59T 2P3FH 1CT2E 1OSSA 1OWKA 1W13U 1GMCF 1V2ST 1GBMA 2QC2A 1JMOH 3HKJB 3P8GA 1FI8A 3RXRA 1O3BA 3E16B 3GICB 1O3AA 1HAXB 2A7CA 1EB1H 1SSXA 3FP8E 3U9AH 2FTLE 2P8OB 1MD8A 4CBOA 1AUJA 1CU1A 2XBVA 2SGQE 5JBTA 4FU7A 4O9VA 4B76A 6LPRA 1V2KT 1C5YB 3A82A 1OS8A 2GVFA 2XCFA 4CRFA 1UCYE 3QN7A 1AKSA 1Z8IB 3KQDA 4NWLA 4BTUB 1O3JA 1TA6A 4ZKRU 3TNSA 3ATMA 5E0JA 1EASA 2A7HA 1P03A 1G2LA 9ESTA 5DP7A 1SMFE 1D3DB 1NFXA 4BNRA 4IBLH 3MH7A 3PLPA 1ZGIA 4IMQA 4O03A 3M3VA 3ZVEA 2W26A 1O5BB 1Z1IA 4FUDA 1IQMA 4MLFB 1MBMA 2OCVB 1ZPCA 4H6TA 4TPYA 3LGUA 2CF9H 1P10A 6ESTA 1LHEH 2ZGJA 2VH6A 3ZZ7A 4JZDH 5FBEA 1W11U 1ZTJA 2V6NA 4XFQA 4ABIA 1V2OT 1IQJA 3U69H 2PKAA 2ZCKP 2OINA 2XXLA 3UOPA 1GMCG 1THPB 1ZR0A 2H9HA 3EYDA 1A0JA 3QWCH 5DP3A 2I6QA 3GY4A 1AKSB 4DURA 4IMZA 2SGEE 1EAXA 2F3CE 2J94A 1O2IA 3E3TA 1SFQB 3BTWE 4B73A 3F1SB 4O3UA 1OX1A 2FDAA 1TBQH 3GCHB 5JBBS 2Y6TA 1YGCH 1O36A 5DK1A 1EOJA 1G37A 1MH0A 2XRCA 1HIAA 5EQRA 4Q2KA 2WPLS 4JYUH 1KXFA 3SU5A 5E2OA 1NU7B 1Y3YA 1PQ8A 5F8TA 1CQQA 1PPBH 1MTVA 2PKSB 1C1UH 1HNEE 1HXFH 2FODA 1S85A 4X2YA 2PW8H 4RSPA 2GMTB 1BRCE 3LJOA 2TGAA 1WTHD 3QZRA 5FCKA 2ANMH 1SGFG 3AASA 3RLYH 2HLCA 2SNVA 1O3PB 1O3FA 2K1QA 2V3HH 3A87A 3UQVA 1TFXA 2VH0A 2QXIA 4ZROA 1O30A 3UY9A 3GY8A 2BVXH 1J17T 4H4FA 1QJ7B 1QA0A 3ZZ9A 1CE5A 4YOIA 2FOBA 2ZEBA 4FXGH 1BHXF 5H4IB 3B23B 4IN1A 4YLUA 1BTHH 1ZSJA 4B75A 3FVFB 2GT7A 2XCNA 5DG6A 1EAIA 4J2YB 2STAE 2VVVA 4Y11E 1PYTD 1ZHPA 1VCWA 3PTNA 4AG2A 2ZFTA 1MMJN 2ZHWH 2Z9LA 1O38A 1EJNA 3PMJA 5EXNA 1WCZA 2G4TA 1BA8B 1WSSH 3SV2H 3TK5A 3SU1A 1GHBG 4NSVA 4ZAEA 1QQUA 1FY5A 3F6UH 1C2MA 1EJMA 2Z9KA 3T62A 1W7GH 1HBTH 2FXRA 3GY7A 5J4QA 4IS5A 1HAIH 3MH4A 2HNTF 2ZHEH 1E38B 1F92A 1G30B 2F91A 3ZVFA 3SHAH 1TNJA 1CBWC 1P0SH 3GDVA 1GPZA 4AG1A 4U30A 5HXFA 5B6OA 2EC9H 1TOMH 4NWKA 4X0WU 3SUFA 2V35A 2F9PA 3SI4H 3DD2H 1BBRK 3P92A 3M61U 1RS0A 1TLDA 5FHTA 4AFZA 1ELEE 2GZ7A 2P93A 2PLXA 4HGCA 1TONA 1SQTA 1C5QA 4Y71A 4NIXA 2W7UA 2ODQA 1O35A 1HAVA 2WPMS 3GYLB 3A7YA 3EGKH 3MU4A 1C2IA 2ZFPH 4ZKSU 3ODFA 3EAJA 3OX7U 2BHGA 1N1LA 3BIVH 3GY3A 3H7TA 8KME2 2TGPZ 2GGVB 3ZZ4A 2XBWA 4KKDA 1SLXB 2FX4A 2J4IA 1RIWC 7LPRA 3BG4B 4GCHF 5I46H 1XXFA 2VVCA 2RA0A 4Y0YE 5DPAA 4ZKNU 1QRZA 1QY6A 5ESTE 4D7FA 1NPMA 3LOXA 3OY6U 4KELA 1GCDA 4K8YA 1WU1A 1TNHA 1A3BH 5FPYA 1GMHF 1HFDA 1GI1A 1ZPZA 1S82A 3RXVA 1QURH 2ZDLA 2FS9A 4HFPB 3UR9A 1A2CH 4XOJA 2NU3E 2EI7A 2QXJA 4WJG2 2JH6D 2PGBB 4I33A 3MO9A 2BLQA 2QIQA 2QCYA 2W3IA 1ZMJA 4B2BA 1ELVA 1BRBE 5EPYA 3ZZCA 1YCPM 1C1OA 3U98H 2ZPRA 3M5MA 1XX9A 2ZHDA 5EPNA 3V7TA 3K6YA 1P12E 4KTSA 1AD8H 4CH2B 1TGSZ 5C2ZA 2AYWA 3KEEA 2GT8A 2XWBI 3RXKA 3LGVA 1C2FA 5I25A 1QA7A 2G55A 4FUBA 2O8LA 3KL6A 3RXQA 5A8ZA 5FAHA 1SQAA 5FBIA 5GWZA 3Q76A 2ZECA 3RXTA 4NG9H 1LKAA 2GCTC 1C4V2 1QHRB 1DLKB 4UFFH 1KXEA 2QGRA 2ZFRH 3V3MA 1GG6C 2XYAA 3TH3H 3GISB 1GDQA 3KQBA 1TABE 4Y6DA 3HK6B 5EQQA 1HJAB 2A7JA 3ODDA 1O2RA 1FZZA 2OC8A 1UK3A 3D23A 1VCPA 1O3DA 4ISHH 2GCHF 1BQYA 3VGCC 1ELFA 2BQWB 1BMLA 1FPCH 3SJKA 4X6OA 1L1JA 5E8EH 1SGIB 2VWMA 1YCPH 4GHQA 1FQ3A 2GMTC 5EOKA 7GCHF 1TPOA 5L2ZH 1O3KA 3UTUH 3EDXB 4B2AA 3TIUA 1AE8H 2ODPA 2ZCLP 1Y3XA 3E90B 3A8AA 1DFPA 2OQUA 3SU6A 1MTSA 1BTUA 2GCHG 3M37A 1O5DH 1TGBA 1AQ7A 3TH4H 3UWJH 1W2KH 3RXPA 4XSKU 3NUMA 1C1VH 4R8TB 3K6ZA 1TGCA 3ZVCA 5EXLA 2WPIS 3ATLA 1O5AB 1O33A 3GDUA 2HPQH 2GCTB 1GBLA 1ANEA 2A5IA 2B5TB 3AVZA 2A5KA 1DVAH 2OTVA 1BTXA 1TRMA 3O8RA 1JIRA 2UUKB 1J16A 1LPZB 3MYWA 4NFFA 3AAVA 4TYDA 4D76A 1ELCA 1IHSH 1JOUB 2PHBA 2A1DB 2WUCA 4SGBE 2VWNA 4SGAE 4NCYA 1XUKA 2FI5E 1BOQA 2QXHA 4D9QA 2ZU1A 2Y81A 1A5GH 2H5DA 4WMDA 6GCHF 1AB9C 1LPKB 5IYTA 4I8LA 1Z6EA 1GJ8B 3FFGA 1ACBE 1NRQH 1AVXA 1P8VC 5EU8A 3VXFH 4X1QU 2QAAA 1P2JA 2WPKS 3OSYA 4CHAC 1UTKA 3KN2A 1Y3UA 2B8OH 2VVUA 3NKKA 1XXDA 3BEIB 5GJ4B 2P95A 1OWDA 1DY9A 1RRKA 1A1RA 2BXUH 2FZZA 3JZ1B 1GMDG 3PTBA 1V2JT 2R2MB 1QR3E 1TMUH 2FEQH 1A5HA 4WMEA 5A0BA 4Q80A 5T6DA 2ZFQH 1NFYA 1KYNA 5GCHF 1VITF 2BDGA 3QZQA 1YKTA 2HOBA 2J92A 1EUFA 4K1SA 2XBXA 2VWOA 3BN9A 1HJ8A 3RC4A 1DUAA 2H1UA 3A7WA 1C1NA 1S83A 3LKWA 5JPMH 3UIRA 1O2UA 4Z0KA 2ZGBH 2OBOA 3STJA 1A7SA 2A45B 4BAKB 1ELDE 3SU2A 1LVBA 2BZ6H 1CA0C 2QN5T 1TAWA 1Y3VA 1AE5A 5TJXA 4ZH8A 4CBNA 1BITA 5E0HA 1QBNA 1MAXA 1MKXK 2OC1A 2KAIA 1IQLA 1LHCH 2PTNA 3M5NA 4Q7YA 1DSUA 2Z94A 1FONA 3RXAA 1GHZA 1C2GA 1OPHB 3MNCA 2Y5GA 4E06H 3RXGA 3MNSA 5DGJA 1FV9A 5EXMA 1OWHA 1O3EA 1ELAA 2ZTXA 1P3EA 3R3GB 3UREA 2C93B 2ZF0H 5A09A 1SGTA 2TGDA 2OLGA 4MPVA 3SNCA 2BZAA 2ESTE 4DIIH 3SGAE 5F6MA 2FOGA 3MOCA 4KP0A 1NTPA 3QO6A 2F9UA 1GI5A 3SUGA 4AFQA 1SHYA 2OBQA 3RXLA 5GPIB 2XNIA 1TGNA 1N8OC 1E35B 3RU4T 1KXCA 3SJ9A 1IQHA 1EJAA 1OP2A 2WPJS 3I78A 3TNTA 3M5OA 3SQHE 3MH5A 1HAVB 1ANCA 2A2XH 1EOLA 3VEQB 2UUYA 5FXLA 1JBUH 2GDDA 1W8BH 2ZHFH 1AO5A 2C8XB 2O8UA 1O3MA 1TIOA 1H1BA 1VGCC 3ZZ8A 3SNAA 1BMAA 1A4WH 1GL1A 3A85A 5A0AE 1YCPK 4DIHH 5F03A 4DJZB 2FOAA 3BTEE 5IDKA 1NO9H 1HUTH 1B5GH 1UK2A 5C5OA 5T3HA 3ZZ6A 1ZMNA 1NRPH 2RG3A 1HRTH 3UR6A 2FLBH 1UTQA 3ZZBA 1GL0E 1YPMH 5C3NA 1QL8A 1BRUP 1PPFE 1RIWB 1SBWA 2JETC 4LZ1H 3PO1B 1P02A 2CN0H 4GLYA 4Y8ZA 1VITG 3ELAH 3VB6A 2QV1A 2BD9A 1JXPA 3DUXH 1TBZH 1YLCA 1UTOA 2FLRH 1C5XB 4BXWA 5FCRA 1XUIA 4YTAA 4X1NU 4OS4A 3GCHC 1C4U2 3D65E 2F9OA 3D62A 3E6PH 1G3BA 1NFWA 1INCA 1J8AA 2AGEX 2VU8E 4HI3A 1S0QA 4NZQA 3U1IB 4ESTE 1GBAA 2RDLA 2C8ZB 1AVWA 4RKJB 3LU9B 1F0TA 1GHWH 1GMHG 2OP9A 4X1PU 1ZJDA 1DWBH 6GCHG 4FUHA 1FIZA 1K9OE 2RA3A 3P17H 4Y76A 4XBDA 1J15A 2VIQA 1O2YA 1Q2WA 3OU0A 1G2MA 4OGXA 3TJNA 4TY7A 1YBWA 1ARCA 1CT0E 1H8IH 3SHCH 1FY1A 1SOZA 1NESE 2H6MA 4K3JA 2BY7X 1ABJH 3LPRA 1LVOA 2EI6A 3ATWA 1LVYA 5C20A 1OP0A 1FLEE 4WH6A 1DWDH 2VINA 2BLVA 4INLA 5TCCA 3NK8A 3TLOA 3BEFB 3LGTA 4MNVA 2NWNA 4X1RU 4E05H 2CV3A 4ISOA 1C1SA 4Q7ZA 4Z6AH 1ESBA 1YC0A 2FTMA 4KTCA 1O2WA 4FVDA 2P94A 4X8UH 1UHBA 4FVBA 2ZKSA 3DA9B 3RXMA 1L1GA 3BIUH 1ABIH 1BTPA 1BHXB 1JWTA 1ZGVA 1TQ7B 2GD4B 1P2KA 2G5VA 1GDNA 3MU0A 3A88A 3Q3KA 4I7YH 5A8YA 3I29A 3FZDA 3KQEA 1TWXB 1OWEA 2BD5A 2OQ5A 1KDQB 1SB1H 4NIYA 2PR3A 3RXDA 3Q00A 4I8JA 3TH2H 3GYMA 8LPRA 1GHXH 3MI4A 3EA7A 4AN7A 5K7RA 2GX4A 4IC5A 1QIXB 1UK4A 2BXTH 1QB1A 2TGTA 1B0FA 1DUEA 2ZU5A 2VGCB 3M36A 5JB8S 5G4BA 2ZCHP 4AGJA 2GDEH 5E0GA 4AX9H 4XBBA 3E91A 4X6NA 2AH4X 1BMMH 3L33A 3RXUA 1ESTA 1MZDA 3SORA 1EZSC 1QB9A 3T29A 1MU8B 2VIDA 1H8DH 3M7TA 4X2VA 1HJAC 1ZZZA 1CVWH 3RXHA 1B0EA 1NM6A 1BRAA 1F2SE 5BPEA 2BQ7B 4ABJA 2DE9A 1Z1JA 2H2ZA 2BD7A 1SLWB 3UFAA 2FO9A 4YM9A 3VB7A 1D6RA 1SGYE 2ZFFH 4ISLA 1Z8GA 1HCGA 2VIVA 1GJCB 3MNBA 1DT2A 3OYPA 1O3OA 1TQ0B 1HAGE 1F7ZA 1G3CA 3QGNB 2BDHA 4JYTA 1LVMA 1HLTH 1Y5AT 4A92A 1SLVB 2P59A 2ZQ2A 1Z8RA 3H7OA 1QRXA 1BJUA 2ILNA 2FOHA 4ZXXH 1VZQH 1QTFA 3S9BA 4MG3A 3O8DA 3T5FH 2P16A 1P9SA 4MTBA 4ASHA 1AWFH 4NGAH 4BAOB 1F0RA 3P8FA 4GVUA 3HGNA 4U01A 3F9EA 4A1XA 1HAPH 5A2MH 1PQ7A 1UTLM 1GCTB 1A3EH 1RFNA 1S6HA 3B9FH 1XM1A 1K1LA 3TJOA 2DE8A 3CENA 4D8NA 2ZG0H 4NSYA 1J9CH 1Q3XA 5EQSA 4D7GA 1GJBB 1HYLA 5JBAS 4E7NA 3I77A 2C4FH 2BM2A 5EODA 3KGPA 5DP9A 1TPPA 1WUNH 1O2KA 3BG4C 2ZDNA 3BEUA 1P01A 2ZQ1A 2BY9X 2NU0E 4Y7AA 3C1KA 3GY6A 2BY6X 1XVOA 4OGYA 2ZIQH 1GBFA 3MH6A 1UTMA 1TNKA 3GOVB 3ZVGA 2UUFB 1ZRBA 3BTME 1FN6A 1DANH 2FPZA 2TBSA 2ZDMA 2BDBA 4BOHA 1KTTB 4OS7A 4ISNA 1YPJH 2Q1JA 2BDCA 3MFJA 1Z7KA 1GHVH 4ZUHA 4E7RG 2J9NA 3L6PA 3M5LA 1GJAB 1AMHA 1GDUA 1T8OA 2AMPA 2WPHS 1LDTT 2Y7ZA 4X6MA 3TGKE 3LC5A 3SUEA 1C5WB 1O5GH 4F4OC 2PTCE 3FAOA 4MNXA 1MCVA 3Q3XA 3UOUA 2G00A 2BD8A 2XWAA 1P04A 3EQ0H 3MU8A 3SN8A 2ZZUH 4ZMAH 1YPHE 3SZNA 1V2TT 4ABEA 2W7SA 5AHGH 1F5RA 2ASUB 1HAYB 1A0LA 2BB4A 1MTNB 2ODYB 3K9XB 1FY8E 3FANA 3PV4A 1NRNH 1O2LA 1WQVH 2AGGX 3CS7A 3SJOA 2QF0A 1Y8TA 1IHTH 2M5TA 1XKAC 2V3OH 2FM2A 1DWCH 4KGAA 1SHHB 4X2WA 1LCYA 1E0FD 1CT4E 1C2KA 2CHAC 1XUFA 5GXPA 2ZDAH 1FXYA 2ANWA 1MKWK 1DWEH 4IN2A 2STBE 2IN2A 1DSTA 1TGTA 3S0NA 2RCEA 1NFUA 1WQSA 1MTWA 2P3UB 5CHAB 1CHOG 2GV6A 2ZFSA 4AOQA 2BVSH 3A8DA 4MPWA 3W95A 4CH8B 1XUJA 4MVNA 1O2SA 2LNCA 2JH0D 1AFEH 3T2NA 1UTJA 1SGQE 1XVMA 2XC5A 3URCA 4ABHA 3TJUA 1PPEE 2ZDKA 2CXVA 1K1MA 1T31A 8ESTE 3RXBA 4NA8A 3FZZA 2AIPA 1ZSKA 4DY7B 2O8TA 1GMDF 5AFYH 3RMNH 2FYQA 1SLUB 3LGWA 5DP8A 3IITA 3BG8A 3S9AA 2ZI2H 2EA3A 1PYTC 2BY8X 1GI9B 4TWYA 2Q6GA 2QF3A 2XTTB 3E0PB 1C5OH 1KLIH 1AFQB 1O5FH 3RXJA 1FY4A 1EX3A 4H42U 1GHAG 3KHVA 1GHYH 2R0KA 4WMFA 3UWIA 1RTLA 1T32A 1DXWA 5T6FA 2OD3B 3S9CA 1KXDA 1NS3A 3TJVA 1C5TA 1D9IA 1YPKH 3QTOH 2BDIA 2H9TH 1UTPA 1FNIA 2FP7B 4BAMB 2ZWLH 7KMEH 3GY5A 3TGJE 3DT0H 1HAHH 2Y7XA 1V2NT 2FS8A 1P06A 2D1JA 4K1TA 3SV7A 4FUGA 4INKA 5AVDA 5LPEA 1K2I1 2FOCA 1DS2E 2OC0A 4MPUA
chains in the Genus database with same CATH superfamily
4DGJA 1W10U 1TPSA 1WYKA 4FU9A 3IG6B 3K2UA 4A7IB 1K1OA 2BD3A 3A8BA 3DFLA 1LMWB 5C0UA 4MDSA 3VB4A 1SVPA 4XD7D 3QLPH 4BTIB 3R0FA 1AUTC 1LPGB 1CGJE 3RM2H 3LJJA 1P11E 4ZHLU 4CRGA 5E2PA 4X8VH 2HVYB 1K21H 1GG6B 2BY5X 2Z7FE 4X8TH 1GJDB 3F2HA 1H9HE 1QL9A 1GJ5H 3ZVBA 2EI8A 1ETRH 3RP2A 1EKBB 4NFEA 4UD9H 3F9GA 2M2AA 1C1RA 1UVOA 1OHHD 1ZSLA 2AMDA 1BTWA 4CHAB 5EW2H 1T8LA 2BOHB 4HG6A 4AYYB 1SG8B 1D4PB 1GBJA 3DHKH 3MU5A 3G01A 1EPTC 4X1SU 4YESB 1DOJA 3A80A 3SO3A 1XKBC 1MABB 1ESAA 3FP6E 2WYJA 3ESTA 1TNIA 2H9EH 1C2JA 2Z9JA 1QGFA 1WAYB 4I8HA 5T6GA 3BTHE 1HDTH 1KLTA 3LGYA 1GHBF 4WXVA 1NN6A 5DP4A 4YOJA 1PPCE 1COWD 2A0QB 2IPHA 2W5EA 4UFGH 3VXEH 2FI3E 1C5MD 4JYVH 8GCHF 1VCQA 1HIAB 3JZ2B 2XW9A 1A61H 1RTKA 4PROA 3ZVDA 2ALPA 1Y3WA 1WOFA 1W0JD 2F43B 1T4VH 2FI4E 5JYIA 1SGDE 1F5LA 1KIGH 1ZYOA 3BTGE 5SGAE 2CGAA 3N7OA 1DE7H 4JZEH 2YNBA 1DICA 1TOCB 4A1TA 3BTQE 4CRAA 3NXPA 3SW2B 1K1PA 4B1TA 1Z8JB 5A0CA 1ZJKA 1H4WA 1H9LB 3RMOH 2TRMA 4K1EA 1AI8H 1MD7A 3RXFA 5JDUB 2AMQA 3BTTE 2A4QA 4RT0A 4NZLA 1PPHE 1UVSH 5L6NH 2C90B 2BTCE 4I8GA 1GGDB 1SQOA 4UDWH 1C5UA 1E34B 1O2OA 1J14A 1HB0B 3P70B 3SV8A 3ZYEA 4YT6H 3SI3H 2AS9A 3PMHB 4ABDA 2G81E 1QCPA 1O34A 3SGQE 3WY8A 3A84A 1DITH 3LONA 5HYOA 5C67A 6CHAB 3T26A 1LQDB 2FOFA 3RU4D 1G3EA 3EE0B 4ABFA 1QB6A 4GSOA 2HNTE 2BQ6B 1SGCA 1D6WA 1CBWB 4RN6A 1C5VA 2PSYA 1O32A 1PJPA 1BBRH 1GVKB 5LPFA 1LHDH 2EEKA 5C1YA 2ALVA 3A7ZA 3PB1E 1O2ZA 3PROA 2PSXA 1OXGA 1O37A 2WZQA 5DO4H 1DX5M 1WXRA 2FOMB 3UNSA 3MU1A 3K65B 1TRNA 3F68H 1F0SA 3B8JA 1N6XA 1D3TB 4I31A 5CHBA 1OWIA 3LH3A 4OS1A 4U32A 1AU8A 1YF4A 5EIYA 3EE7A 1EAWA 1ZLRA 2J97A 4NIVA 1O2MA 5LH8A 4HTCH 1GCTC 4IC6A 2FWWA 1O2TA 1SGEE 2YMSD 1AN1E 5HIZA 1ZOMA 4FUJA 1TNLA 2R3YA 2R9PA 4WF8A 4YOGA 4Y0ZE 1QBVH 4K2YA 1IQEA 1SGFA 1XMNB 3A89A 3UQOA 1O2HA 2HLDD 1F5KU 2FYRA 2WPDD 2HGTH 1TNGA 2CK3D 1GBTA 3KQCA 3C27B 4OS2A 3OTJE 1ZRKA 1GI8B 5HM9A 1O2NA 4DCDA 2QYIA 1FY3A 1O3IA 4Q7XA 2VB0A 3OE7D 1G36A 4JZIA 3HK3B 3CS0A 1QBOA 2XC0A 4WY3A 2BDAA 1K28D 2K8IA 3A8CA 4BXSA 1HAZB 3SJIA 1ETSH 4O97A 3NWUA 1GGDC 3Q3YA 1ORFA 1P2MA 1V2QT 3RMMH 1TA2A 1ID5H 3P95A 1QL7A 2A5AA 2EQNA 2PUQH 3NZIA 5HMAA 4A1VA 3UPEA 1TX8A 1EPTA 2F9BH 2HVXA 1C9TA 3RUOA 3MMGA 6CHAC 2FX6A 2G5NA 1GI6A 2OC7A 1PFXC 3NCLA 1VITH 5A8XA 3RMLH 1TB6H 3AW0A 1IAUA 3MO6A 4JK6A 3ZV8A 3OFND 3DFJA 1IQGA 1EP5A 1C5RA 1MKWH 1RTFB 4GAWA 1UVUH 3HKIB 2AERH 3VGCB 5ESBA 1FAKH 4JK5A 5BRRE 1IQNA 1O2GH 3PO1C 2ZP0H 2VGCC 1C2EA 1GJ4H 5FPTA 2FMJA 1L4DA 2ZPSA 1U6QA 1ARBA 1QFKH 2BLOA 5J4SA 1AHTH 1GVLA 4NA7A 1EAUA 3TU7H 3OEED 3DSOA 3LH1A 1HXEH 1WV7H 3RLWH 3FP7E 1BZXE 1UO6A 3PWCA 2ZGCA 4XBCA 3UNQA 1WTGH 4Y8YA 5LGOA 1E36B 2Y80A 1O39A 1LO6A 2BMGB 2R2WU 1UHBB 1AFQC 4ABGA 3MWIU 2J34A 3OY5U 4OS5A 5L30H 4A6LA 1WBGB 2VIPA 1LTOA 1C1TA 1P3CA 1YP9A 2Y5HA 5GIBA 1C5ZB 1YPLH 5HIYA 1O2JA 2SGAA 3EA9A 2THFB 4F49A 1DY8A 3LGIA 1O2VA 2GV7A 1IQFA 1CA8B 1QQ4A 1HAOH 1L4ZA 1FAXA 1UVTH 1AIXH 1C9PA 3PMAB 1NROH 3UNRA 3U8RH 1BIOA 5AF9H 1THSH 2BD2A 2SFAA 3HGPA 2XC4A 1NC6A 1VJAU 4NIWA 3PWBA 4BAHB 1O5CB 2F4LA 1O2XA 1D3PB 3GDSA 2WYGA 1BBRE 1C5LH 2OUAA 2PKAB 2P8OC 3A81A 1QJ1B 3SQEE 5KEDA 4JZ1A 1KXAA 1Z6JH 2WV9A 5FX6A 4YLQH 3ZV9A 3W1EA 5JBCS 4ABAA 4WXIA 3RXIA 5HM2A 3TITA 4AFUA 4OS6A 1SOTA 2WV5A 1C5PA 7ESTE 3URDA 5C5NA 1V3XA 1PPGE 3ATKA 1GBEA 1V2VT 1C1QA 3KCGH 1AVGH 2UWLA 1CGIE 3U8OH 1GBBA 2YNAA 2BVRH 2SGDE 4MPXA 2BOKA 2I6SA 3MO3A 2O8MA 1LHFH 2QA9E 1TMTH 1GBHA 1EZXC 5L2YH 2GZ8A 1RJXB 1YM0A 3M3SA 5TCAA 2BLWA 2G4UA 4R0IA 1AB9B 8GCHG 3KNXA 2KAIB 1QNJA 1X7AC 1S5SA 4WH8A 2F9NA 2AHME 4FU8A 4IW4E 2BX4A 3BTFE 1NBME 4KTUA 1MKXH 4Y10E 1BT7A 1C1PA 1C2DA 3M35A 3TPIZ 5CE1A 2Q6FA 2QY0B 2VNTA 2HRVA 5ABWA 5GDSH 4ZHAA 2A4GA 3M7QA 4Y79A 2J2UA 3E1XB 4TY6A 4CR9A 1V2PT 1YPEH 4B71A 4TPIZ 1CA0B 1P9UA 1UJ1A 3WWFA 1MQ6A 1HPGA 2JH5D 1W3CA 3A7XA 3QK1A 1YLDA 4CRCA 2C3SA 2HPPH 1C1MA 4GHTA 1MBQA 2PP6A 2VBCA 1L0ZA 1TPAE 1GJ9B 7GCHF 4YZUA 5FX5A 2AGIX 3VPKA 3U8TH 3A7TA 2ZC9H 1O0DH 2BD4A 1XUHA 3E0NB 1S81A 3RXSA 3O8CA 3IWMA 2PWXA 1MCTA 4AB8A 1KY9A 1ZPBA 3AAUA 1PQAA 2BDYA 1GI3A 4B74A 1T4UH 1TE0A 1GI4A 1AWHB 2C8YB 2ZNKH 5EW1H 4THNH 1NZQH 2IJOB 1DM4B 3ITIA 3QDZB 1JIMA 1DDJA 4GPGA 1BB0B 1TRYA 1C5SA 1V6DA 1O2PA 3ZYDA 5EJZA 1BMNH 1SI5H 5CHAC 2B7DH 1N8OB 3D49H 1DPOA 1S0RA 1TX7A 4CREA 1HGTH 4BTTB 2J38A 3BSQA 1O2QA 3T27A 1TX6A 2NU1E 1KTSB 2AIQA 3M7UA 3VB3A 2PUXB 3MTYA 1V2RT 1Y5BT 2ANYA 5EGMA 1SR5C 3ZZ5A 2O8WA 5EG4A 1E37B 2ULLA 1SQRA 1RXPA 4YO9A 2GKVE 1JRTA 1MZAA 1P2OA 5HGGA 2WINI 3SOSA 3KIDU 1AGJA 4I32A 1V2LT 2B9LA 2F9VA 1P2NA 2ZGXH 4LZ4B 3A7VA 2ZPQA 3TVJB 2Z9IA 1NRRH 1OWJA 1TBRH 3HATH 4Y8XA 2UWOA 5DKMA 3SNDA 1FN8A 2SGFE 3RU4E 2CJIA 2O9QA 4M7GA 3RXEA 4AFSA 1L2EA 1SFIA 4VGCC 4A5TS 3RDZA 4K5ZA 4UEHH 3ZZDA 4AZ2B 2ANKH 3U1JB 5DP5A 1N6YA 2VIWA 3WWBA 4CRBA 4K8BA 1OYQA 1AZZA 3QUMP 1W14U 4Y7BA 1BJVA 4JCNA 4O3TA 5KECA 4Q4LA 1O3CA 4UFEH 1SGNE 1FPHH 3S7HB 4UONA 3Q77A 1C4Y2 1UCYH 5K0HA 4WVPE 4ISIH 3TK9A 3ZZ3A 1GBIA 4BANB 1TYNA 3E8LA 3GCOA 1EXFA 2NU4E 3T25A 1B7XB 1Z71A 2Q6DA 2JETB 2D26C 4X8SH 2YMSC 3STIA 4K60A 4Q63A 4ZKOU 2D2DA 3F0PA 2NU2E 2R0LA 3LT3A 7GCHG 4ZXYH 1ELGA 5PTPA 2CF8H 2Z3CA 3ENSB 3A86A 2A2QH 1OP8A 3O8BA 2Z3EA 1H9IE 3SV9A 2ZHQH 3S7KB 1W0ZU 3P8OA 2Y82A 1EZUC 1DXPA 1OKXA 1T7CA 3RC6A 4K69A 3RC5A 3SNEA 1THRH 3RXCA 1OOKB 1K22H 2HWLB 3SU0A 9LPRA 1EPTB 3F9FA 4ZHMU 2ZTZA 1O3LA 1SL3A 3AW1A 1QZ8A 2CHAB 1CHGA 2ZU3A 3NPSA 4MQAA 1GI0A 1L1NA 1IQKA 1V2WT 2J95A 1D3QB 4UFDH 5FL7D 1K1IA 4MNWA 2ZU4A 1G9IE 4AORA 1ZHRA 1KDQA 2ZU2A 1GHAF 1VR1H 4AB9A 3W94A 1GWAA 4X2XA 4B2CA 2GP9B 2PGQB 3F0OA 5F8ZA 1OYTH 3GCTF 2V0BA 3S69A 1BMFD 1QRWA 3HPTB 3FOAA 1NRSH 1W0YH 2PKSC 1ANDA 4TWWA 2AEIH 1A0HB 3PM3A 4MNYA 3V12A 4FUFA 1P05A 3FKSD 1C5NH 3SBKA 1FUJA 1GJ7B 3F2FA 1FIWA 4FETA 3DSGA 5AFZH 1YPHC 2LPRA 4I8KA 1YY3A 4AGKA 3VB5A 1AY6H 4FUCA 1LQEA 1K1JA 1PQ5A 1T8MA 1HV7A 2ZGHA 2G52A 1O5EH 3BF6H 4U2WA 3ZVAA 1ANBA 4J1YA 3BTKE 1CHOF 1IQIA 4CR5A 1RD3B 3SJ8A 1MUEB 2ZO3H 1LHGH 4DW2U 1BTZA 5CMXH 3H09A 1CO7E 3GY2A 2BYAX 3PMBB 3M3TA 4ASUD 2HNTC 2P3TB 2TIOA 3UUZA 2DUCA 1BDAA 1Q31A 1TMBH 1P57B 1A5IA 1SPJA 4GCHG 2A31A 5C1XA 1EATA 1HJ9A 1V2MT 3N7DA 4JZFH 1DLEA 2Y5FA 1ZTLA 4LXBH 1UCYK 1BUIA 1GBKA 1ZHMA 2SGPE 3PYHA 2C8WB 4ABBA 4CRDA 1O3GA 4VGCB 2JKHA 1XUGA 2Z3DA 3H5CB 2KFWA 5GNDA 1VGCB 1ELBA 1CSOE 1ZTKA 3DSPA 1P2IA 3L3TA 4JMYA 4XDEA 1YYY1 2OK5A 3PRDA 2GTBA 1T8NA 3EA8A 1UW7A 2FIRH 1KSNA 2WUBA 4HZHA 1K1NA 2VIOA 1GBCA 2JJ1D 3VFEA 2XOKD 2OXSA 2Z6BD 1NU9A 4ZCNA 5DP6A 1O31A 5FPSA 1O3HA 2HALA 2J98A 2XBYA 1YLNA 4TT3D 4XE4A 5DJ7A 1MTUA 1GI7B 1P09A 2VWLA 1SGPE 1C2HA 4LOYH 3GS9A 2UWPA 3V0XA 3CP7A 5ETXA 3LC3A 1C2LA 4AYVB 2R3UA 3MNXA 1KXBA 3SUDA 1SGRE 4YT7H 1EP6A 3GCNA 1A46H 1JRSA 2H5CA 5C1UA 1M9UA 2ZDVH 4FOUC 1CGHA 5F8XA 2TPIZ 1O3NA 1AZ8A 1PPZA 1EZQA 4BAQB 2GZ9A 4NA9H 2FOEA 4X6PA 2KX4A 2VJ1A 3QGJA 1MQ5A 2Z9GA 3T28A 1ZMLA 3TK6A 1IOEA 1YPGH 1UVPA 2FESH 2LELA 4WWYA 3BV9B 2PV9B 2QXGA 3RXOA 2D8WA 3BTDE 2YOLA 1EB2A 2G51A 2ZA5A 3TGIE 2F83A 1BCUH 3ZZAA 1MU6B 3P8NA 1GJ6A 1V2UT 4RKOB 2SNWA 2W3KA 4FUEA 1TALA 4D9RA 5HKKD 3QX5H 1Y5UT 1SC8U 2QF5A 4FUIA 1FDPA 1QJ6B 1GI2A 1MAYA 3KF2A 3SNBA 1RGQA 4M9FA 4QT8C 2A4RA 1GVZA 2JIZD 5GCHG 4LK4A 1W7XH 1UMAH 4DT7B 2WV4A 1FJSA 3V13A 2B0FA 3F9HA 4IGDA 1BTYA 1WDIA 3LIWA 4UE7H 1G3DA 4DOQA 1P2QA 2BX3A 1NY22 2IOTA 1MTNC 1F0UA 3SGBE 4H6SB 5LPRA 1EQ9A 3GCTG 1GBDA 1UTNA 1FMGA 5C0TA 3PLKA 3SU4A 1C1WH 4DG4A 2AFQB 1ETTH 1VJ9U 3PLBA 4F48B 1G32B 1NT1A 3QTVH 2A32A 3SU3A 1KLJH 1S84A 2ZTYA 3SZEA 2PFEA 1S6FA 1W12U 2W6ID 3MHWU 4INHA 3RM0H 3SV6A 1ELTA 3ATIA 3A83A 4DVAU 2CMYA 3P6ZB 2G8TA 4GUXA 1LKBA 2UUJB 2A4OA 3LDXH 5JB9S 1Y59T 2P3FH 1CT2E 1OSSA 1OWKA 1W13U 1GMCF 1V2ST 1GBMA 2QC2A 1JMOH 3HKJB 3P8GA 1FI8A 3RXRA 1O3BA 3E16B 3GICB 1O3AA 1HAXB 2A7CA 1EB1H 1SSXA 3FP8E 3U9AH 1W0KD 2FTLE 2P8OB 1MD8A 4CBOA 1AUJA 1CU1A 2XBVA 2SGQE 5JBTA 4FU7A 4O9VA 4B76A 6LPRA 1V2KT 1C5YB 3A82A 1OS8A 2GVFA 2XCFA 4CRFA 1UCYE 3QN7A 1AKSA 1Z8IB 3KQDA 4NWLA 4BTUB 1O3JA 1TA6A 4ZKRU 3TNSA 3ATMA 5E0JA 1EASA 2A7HA 1P03A 1G2LA 9ESTA 5DP7A 1SMFE 1D3DB 1NFXA 4BNRA 4IBLH 3MH7A 3PLPA 1ZGIA 4IMQA 4O03A 3M3VA 3ZVEA 2W26A 1O5BB 1Z1IA 4FUDA 1IQMA 4MLFB 1MBMA 2OCVB 1ZPCA 2IJD1 4H6TA 4TPYA 3LGUA 2CF9H 1P10A 6ESTA 1LHEH 2ZGJA 2VH6A 3ZZ7A 4JZDH 5FBEA 1W11U 1ZTJA 2V6NA 4XFQA 4ABIA 1V2OT 1IQJA 3U69H 2PKAA 5IK2D 2ZCKP 2OINA 2XXLA 3UOPA 1GMCG 1THPB 1ZR0A 2H9HA 3EYDA 1A0JA 3QWCH 5DP3A 2I6QA 3GY4A 1AKSB 4DURA 4IMZA 2SGEE 1EAXA 2F3CE 2LP6A 2J94A 1O2IA 3E3TA 1SFQB 3BTWE 4B73A 3F1SB 4O3UA 1OX1A 2FDAA 5B6LA 1TBQH 3GCHB 5JBBS 2Y6TA 1YGCH 1O36A 3CNRA 5DK1A 1EOJA 1G37A 1MH0A 2XRCA 1HIAA 5EQRA 4Q2KA 2WPLS 4JYUH 1KXFA 3SU5A 5E2OA 1NU7B 1Y3YA 1PQ8A 5F8TA 1CQQA 1PPBH 1MTVA 2PKSB 3MQKC 1C1UH 1HNEE 1HXFH 2FODA 3KYFA 1S85A 4X2YA 1SKYE 2PW8H 4RSPA 3NRLA 2GMTB 1BRCE 3LJOA 2TGAA 1WTHD 3KQ5A 3QZRA 5FCKA 2ANMH 1SGFG 3AASA 3RLYH 2HLCA 2SNVA 1O3PB 4AC9A 2JDID 1O3FA 2K1QA 2V3HH 3A87A 3UQVA 5DN6D 1TFXA 2VH0A 2QXIA 4ZROA 1O30A 3UY9A 3GY8A 2BVXH 1J17T 4H4FA 1QJ7B 1QA0A 3ZZ9A 1CE5A 4YOIA 2FOBA 2ZEBA 4FXGH 1BHXF 5H4IB 1FX0B 3B23B 4IN1A 4YLUA 1BTHH 1ZSJA 2V3MA 4B75A 3FVFB 2GT7A 2XCNA 5DG6A 1EAIA 4J2YB 2STAE 2VVVA 4Y11E 1PYTD 1ZHPA 1VCWA 3PTNA 4AG2A 5EJLA 2ZFTA 1MMJN 3ZIAD 2ZHWH 2Z9LA 1O38A 1EJNA 3PMJA 5EXNA 1WCZA 2G4TA 1BA8B 1WSSH 3SV2H 3TK5A 2QE7D 3SU1A 1GHBG 4NSVA 4ZAEA 1QQUA 3WW7A 1FY5A 3F6UH 1C2MA 1EJMA 2Z9KA 3T62A 5EJ1A 1W7GH 1HBTH 2FXRA 3GY7A 5J4QA 4IS5A 1HAIH 3MH4A 2HNTF 2ZHEH 1E38B 1F92A 1G30B 1VKYA 2F91A 3FN8A 3ZVFA 3SHAH 1TNJA 1CBWC 2KCYA 1P0SH 3GDVA 1GPZA 4AG1A 4U30A 5HXFA 5B6OA 2EC9H 1TOMH 4NWKA 4X0WU 3SUFA 2V35A 2F9PA 3SI4H 3DD2H 1BBRK 3P92A 3M61U 1RS0A 1TLDA 5FHTA 4AFZA 1ELEE 2GZ7A 2P93A 2PLXA 4HGCA 1TONA 1SQTA 1C5QA 4Y71A 4NIXA 2W7UA 3PV2A 2ODQA 1O35A 1HAVA 2WPMS 3GYLB 3A7YA 3EGKH 3MU4A 1C2IA 2ZFPH 4ZKSU 3ODFA 2GJGA 3EAJA 3OX7U 2BHGA 1N1LA 3BIVH 3GY3A 3H7TA 8KME2 2TGPZ 2GGVB 3ZZ4A 2XBWA 4Z1MD 2IPQX 4KKDA 1SLXB 2FX4A 2J4IA 1RIWC 7LPRA 3BG4B 4GCHF 5I46H 1XXFA 2VVCA 2RA0A 4Y0YE 5DPAA 4ZKNU 1QRZA 1QY6A 5ESTE 4D7FA 1NPMA 3LOXA 3OY6U 4KELA 1GCDA 4K8YA 1WU1A 1TNHA 1A3BH 5FPYA 1GMHF 1HFDA 1GI1A 1ZPZA 1S82A 3RXVA 1QURH 2ZDLA 2FS9A 4HFPB 3UR9A 1A2CH 4XOJA 2NU3E 2EI7A 2QXJA 4WJG2 2JH6D 2PGBB 4I33A 3MO9A 2BLQA 2QIQA 2QCYA 2W3IA 1ZMJA 4B2BA 1ELVA 1BRBE 3PV5A 5EPYA 2KM0A 3ZZCA 1YCPM 1C1OA 3U98H 2ZPRA 3M5MA 1XX9A 2ZHDA 5EPNA 3V7TA 3K6YA 1P12E 4ACAA 4KTSA 1AD8H 4CH2B 1TGSZ 5C2ZA 2AYWA 3KEEA 2GT8A 2XWBI 3RXKA 3LGVA 1C2FA 5I25A 1QA7A 2G55A 4FUBA 2O8LA 3KL6A 3RXQA 5A8ZA 5FAHA 1SQAA 5FBIA 5CDFE 5GWZA 3Q76A 2ZECA 3RXTA 4NG9H 1LKAA 2GCTC 1C4V2 1QHRB 1DLKB 4UFFH 1KXEA 2QGRA 2ZFRH 3V3MA 1GG6C 2XYAA 3TH3H 3GISB 1GDQA 3KQBA 1TABE 4Y6DA 3HK6B 5EQQA 1HJAB 2A7JA 3ODDA 1O2RA 1FZZA 2OC8A 1UK3A 3D23A 1VCPA 1O3DA 4ISHH 2GCHF 1BQYA 3VGCC 1ELFA 2BQWB 1BMLA 1FPCH 3SJKA 4X6OA 1L1JA 5E8EH 1SGIB 2RDEA 1YCPH 2VWMA 1FQ3A 2GMTC 4GHQA 5EOKA 1TPOA 5L2ZH 1O3KA 3UTUH 3EDXB 4B2AA 3TIUA 1AE8H 2ODPA 2ZCLP 1Y3XA 3E90B 3A8AA 1DFPA 2OQUA 3SU6A 1MTSA 1BTUA 2GCHG 3M37A 1O5DH 1TGBA 1AQ7A 3TH4H 3UWJH 1W2KH 3RXPA 4XSKU 2V7QD 3NUMA 1C1VH 4R8TB 3K6ZA 1TGCA 3ZVCA 5EXLA 2WPIS 3ATLA 1O5AB 1O33A 3GDUA 2HPQH 2GCTB 1GBLA 1ANEA 2A5IA 2B5TB 3AVZA 2A5KA 1DVAH 5KGOA 2OTVA 1BTXA 1TRMA 5C17A 3O8RA 2J5UA 1JIRA 2UUKB 1J16A 1LPZB 3MYWA 4NFFA 3AAVA 4TYDA 4D76A 3KYGA 1ELCA 1IHSH 1JOUB 2PHBA 2A1DB 2WUCA 4SGBE 2VWNA 4SGAE 4NCYA 1XUKA 2FI5E 1BOQA 2QXHA 4D9QA 2ZU1A 2Y81A 1A5GH 2H5DA 4WMDA 6GCHF 1AB9C 1LPKB 5IYTA 4I8LA 1Z6EA 1GJ8B 3FFGA 1ACBE 1NRQH 1AVXA 1P8VC 5EU8A 3VXFH 4X1QU 2QAAA 1P2JA 2WPKS 3OSYA 4CHAC 1UTKA 3KN2A 1Y3UA 2B8OH 2VVUA 3NKKA 1XXDA 3BEIB 5GJ4B 2P95A 1OWDA 1DY9A 1RRKA 1A1RA 2BXUH 2FZZA 3JZ1B 1GMDG 3PTBA 1V2JT 2KZ4A 2R2MB 1QR3E 1TMUH 2FEQH 1A5HA 4WMEA 5A0BA 4Q80A 5T6DA 2ZFQH 1NFYA 3N7EA 1KYNA 5GCHF 2KCOA 1VITF 2BDGA 3QZQA 1YKTA 2HOBA 2J92A 1EUFA 4K1SA 2XBXA 2VWOA 3BN9A 1HJ8A 3RC4A 1DUAA 2H1UA 3A7WA 1C1NA 1S83A 3LKWA 5JPMH 1EFRD 3UIRA 1O2UA 4Z0KA 2ZGBH 2OBOA 3STJA 1A7SA 2A45B 4BAKB 1ELDE 3SU2A 1LVBA 2BZ6H 1CA0C 2QN5T 1TAWA 1Y3VA 1AE5A 5TJXA 4ZH8A 4CBNA 1BITA 5E0HA 1QBNA 1MAXA 1MKXK 2OC1A 2KAIA 1IQLA 1LHCH 2L6OA 1K0HA 2K0QA 2PTNA 3F3BA 3M5NA 4Q7YA 1DSUA 2Z94A 1FONA 3RXAA 1GHZA 3VG8A 1C2GA 2WHXA 1OPHB 3MNCA 2Y5GA 4E06H 3RXGA 3MNSA 5DGJA 1FV9A 5EXMA 1OWHA 1O3EA 1ELAA 2ZTXA 1P3EA 3R3GB 3UREA 2C93B 2ZF0H 4RI0A 5A09A 1SGTA 2TGDA 2OLGA 4MPVA 3SNCA 2BZAA 2ESTE 4DIIH 3SGAE 5F6MA 2FOGA 3MOCA 4KP0A 1NTPA 3QO6A 2F9UA 1GI5A 3SUGA 4AFQA 1SHYA 2OBQA 3RXLA 5GPIB 2XNIA 4XRNA 1TGNA 1N8OC 1E35B 3RU4T 1KXCA 3SJ9A 1IQHA 1EJAA 1OP2A 2WPJS 3I78A 3TNTA 3M5OA 3SQHE 3MH5A 4F55A 1HAVB 1ANCA 2A2XH 1EOLA 3VEQB 2UUYA 5FXLA 1JBUH 2GDDA 1W8BH 2ZHFH 1AO5A 2C8XB 2O8UA 1O3MA 1TIOA 1H1BA 1VGCC 3ZZ8A 3SNAA 1BMAA 1A4WH 1GL1A 3A85A 5A0AE 1YCPK 4DIHH 5F03A 4DJZB 2FOAA 4ACBA 3BTEE 5IDKA 1NO9H 1HUTH 1B5GH 1UK2A 5C5OA 5T3HA 3ZZ6A 3AK5A 1ZMNA 1NRPH 2RG3A 1HRTH 3UR6A 2FLBH 2QF4A 1UTQA 3ZZBA 1GL0E 1YPMH 5C3NA 1QL8A 1BRUP 1PPFE 1RIWB 3U28C 1SBWA 5F53A 2JETC 4LZ1H 3PO1B 1P02A 2CN0H 4GLYA 4Y8ZA 1VITG 3ELAH 3VB6A 2QV1A 2BD9A 1JXPA 3DUXH 1TBZH 1YLCA 1UTOA 2FLRH 1C5XB 4BXWA 5FCRA 1XUIA 4YTAA 4X1NU 4OS4A 3GCHC 1C4U2 1E79D 2F9OA 3D62A 3D65E 1G3BA 3E6PH 2L74A 1NFWA 1INCA 1J8AA 2AGEX 2VU8E 4HI3A 1S0QA 4NZQA 3U1IB 4ESTE 1GBAA 2RDLA 2C8ZB 1AVWA 4RKJB 3LU9B 1F0TA 1GHWH 1GMHG 2OP9A 4X1PU 1ZJDA 1DWBH 6GCHG 4FUHA 1FIZA 1K9OE 2RA3A 3P17H 4Y76A 4XBDA 1J15A 2VIQA 1O2YA 1Q2WA 2KCAA 1G2MA 3OU0A 4RT1A 4YXWD 4OGXA 3TJNA 4TY7A 1H8HD 1YBWA 1ARCA 1CT0E 1H8IH 3SHCH 1FY1A 1SOZA 1NESE 2H6MA 4K3JA 2BY7X 1ABJH 3LPRA 1LVOA 2EI6A 3ATWA 1LVYA 5C20A 1OP0A 1FLEE 4WH6A 1DWDH 2VINA 1KMHB 2BLVA 4INLA 5TCCA 2W6JD 3NK8A 3TLOA 3BEFB 3LGTA 3PRBA 4MNVA 2NWNA 4X1RU 4E05H 2CV3A 4ISOA 1C1SA 4Q7ZA 4Z6AH 1ESBA 1YC0A 2FTMA 4KTCA 1O2WA 4FVDA 2P94A 4X8UH 1UHBA 4FVBA 2ZKSA 3DA9B 3RXMA 2EY4C 1L1GA 3BIUH 1ABIH 1BTPA 1BHXB 1JWTA 1ZGVA 1TQ7B 2GD4B 1P2KA 2G5VA 1GDNA 3MU0A 3A88A 3Q3KA 4I7YH 5A8YA 3I29A 3FZDA 3KQEA 1TWXB 1OWEA 2BD5A 2OQ5A 1KDQB 1SB1H 4NIYA 2PR3A 3RXDA 3DCLA 3Q00A 4I8JA 4OM9A 3TH2H 3GYMA 8LPRA 1GHXH 3MI4A 3EA7A 4AN7A 5K7RA 2GX4A 4IC5A 1QIXB 1UK4A 2BXTH 1QB1A 2TGTA 1B0FA 1DUEA 2ZU5A 2RFKC 2VGCB 3M36A 4B6EA 5JB8S 5G4BA 2ZCHP 4AGJA 2GDEH 5E0GA 4AX9H 4XBBA 3E91A 4X6NA 2AH4X 4P02A 1BMMH 3L33A 3RXUA 1ESTA 1MZDA 3SORA 1EZSC 1QB9A 3T29A 1MU8B 2VIDA 1H8DH 3M7TA 4X2VA 1HJAC 1ZZZA 1CVWH 3RXHA 1B0EA 1NM6A 1BRAA 1F2SE 5BPEA 2BQ7B 4ABJA 2DE9A 1Z1JA 2H2ZA 2BD7A 3UB0A 1SLWB 3UFAA 2FO9A 4YM9A 3VB7A 1D6RA 2JJ2D 1SGYE 2ZFFH 4ISLA 5C94A 1Z8GA 1HCGA 2WSSD 2VIVA 1GJCB 3MNBA 1DT2A 3OYPA 1O3OA 1TQ0B 1HAGE 1F7ZA 1G3CA 3QGNB 2BDHA 4JYTA 1LVMA 1HLTH 1Y5AT 3SYJA 4A92A 1SLVB 2P59A 2ZQ2A 1Z8RA 3H7OA 1QRXA 1BJUA 2ILNA 2FOHA 4ZXXH 1VZQH 1QTFA 3S9BA 4MG3A 5T1VA 3O8DA 3OEHD 4DT4A 3T5FH 2P16A 1P9SA 4MTBA 4ASHA 1AWFH 4NGAH 4BAOB 1F0RA 3P8FA 4GVUA 3HGNA 3F2GA 3F9EA 4U01A 4A1XA 1HAPH 5A2MH 1PQ7A 1UTLM 1GCTB 1A3EH 1E1RD 1RFNA 1S6HA 3B9FH 1XM1A 1K1LA 3TJOA 2DE8A 3CENA 4D8NA 2ZG0H 4NSYA 1J9CH 1Q3XA 5EQSA 4D7GA 1GJBB 1HYLA 5JBAS 4E7NA 3I77A 2C4FH 2BM2A 5EODA 3KGPA 5DP9A 1TPPA 1WUNH 1O2KA 3BG4C 2ZDNA 3BEUA 1P01A 2ZQ1A 2BY9X 2J98B 2NU0E 4Y7AA 3C1KA 3GY6A 2BY6X 1XVOA 4OGYA 2ZIQH 1GBFA 3MH6A 1E1QD 3FO8D 1UTMA 1TNKA 3GOVB 3ZVGA 2UUFB 1ZRBA 3BTME 1FN6A 1DANH 2FPZA 2TBSA 2ZDMA 2BDBA 4BOHA 1KTTB 4OS7A 4ISNA 1YPJH 2Q1JA 4B6FA 2BDCA 3MFJA 1Z7KA 1GHVH 4ZUHA 4E7RG 2J9NA 3L6PA 3M5LA 1GJAB 1AMHA 1GDUA 1T8OA 2AMPA 2WPHS 1LDTT 2Y7ZA 4X6MA 3TGKE 3OAAD 3LC5A 3SUEA 1C5WB 1O5GH 4F4OC 2PTCE 3FAOA 4MNXA 1MCVA 3Q3XA 3UOUA 2G00A 2BD8A 2XWAA 1P04A 3EQ0H 3MU8A 3SN8A 2ZZUH 4ZMAH 1YPHE 3SZNA 1V2TT 4ABEA 2W7SA 5AHGH 1F5RA 2ASUB 3N99A 1HAYB 2KR7A 1A0LA 1H8ED 2BB4A 1MTNB 2ODYB 3K9XB 1FY8E 3FANA 3PV4A 1NRNH 1O2LA 1WQVH 2AGGX 3CS7A 1NBMD 2QF0A 3SJOA 1Y8TA 1IHTH 2M5TA 1XKAC 2V3OH 2FM2A 1DWCH 4KGAA 1SHHB 4X2WA 1LCYA 1E0FD 1CT4E 1C2KA 2CHAC 1XUFA 5GXPA 2ZDAH 1FXYA 2ANWA 1MKWK 1DWEH 4IN2A 2STBE 2IN2A 1DSTA 1TGTA 3S0NA 2RCEA 1NFUA 1WQSA 1MTWA 2P3UB 5CHAB 1CHOG 2GV6A 2ZFSA 4AOQA 2BVSH 3A8DA 4MPWA 3W95A 4CH8B 1XUJA 4MVNA 1O2SA 2LNCA 2JH0D 1AFEH 3T2NA 1UTJA 1SGQE 1XVMA 2XC5A 4TSFD 3URCA 2YMSB 4ABHA 3TJUA 1PPEE 3UAIC 2ZDKA 2CXVA 1K1MA 1T31A 8ESTE 3RXBA 4NA8A 3FZZA 2AIPA 1ZSKA 4DY7B 2O8TA 1GMDF 4I86A 5AFYH 3OTPA 2FYQA 3RMNH 1SLUB 3LGWA 5DP8A 3IITA 3BG8A 3S9AA 2ZI2H 2EA3A 1PYTC 2BY8X 1GI9B 4TWYA 2Q6GA 2QF3A 2XTTB 3E0PB 1C5OH 1KLIH 1AFQB 1O5FH 3RXJA 1FY4A 1EX3A 4H42U 1GHAG 3KHVA 1GHYH 2R0KA 4WMFA 2XNDD 3UWIA 1RTLA 1T32A 1DXWA 5T6FA 2OD3B 3S9CA 1YWUA 1KXDA 1NS3A 3TJVA 1C5TA 1D9IA 1YPKH 3QTOH 1S6LA 2BDIA 2H9TH 1UTPA 1FNIA 2FP7B 4BAMB 2ZWLH 2KCPA 7KMEH 3GY5A 3TGJE 3DT0H 1HAHH 2Y7XA 1V2NT 2FS8A 1P06A 2D1JA 4K1TA 5DSFA 3SV7A 4FUGA 4INKA 5AVDA 5LPEA 1K2I1 2FOCA 1DS2E 2OC0A 4P00A 4MPUA
chains in the Genus database with same CATH topology
4DGJA 1W10U 1TPSA 1WYKA 4FU9A 3IG6B 3K2UA 4A7IB 1K1OA 2BD3A 3A8BA 3DFLA 1LMWB 4MDSA 3VB4A 1SVPA 3QLPH 4BTIB 3R0FA 1AUTC 1LPGB 1CGJE 3RM2H 3LJJA 1P11E 4ZHLU 4CRGA 5E2PA 4X8VH 1K21H 1GG6B 2BY5X 2Z7FE 4X8TH 1GJDB 1H9HE 1QL9A 1GJ5H 3ZVBA 2EI8A 1ETRH 3RP2A 1EKBB 4NFEA 4UD9H 3F9GA 1C1RA 1UVOA 1ZSLA 2AMDA 4CHAB 1BTWA 5EW2H 1T8LA 2BOHB 4AYYB 1SG8B 1D4PB 1GBJA 3DHKH 3MU5A 3G01A 1EPTC 4X1SU 4YESB 1DOJA 3A80A 3SO3A 1XKBC 1ESAA 3FP6E 2WYJA 3ESTA 1TNIA 2H9EH 1C2JA 2Z9JA 1QGFA 1WAYB 4I8HA 5T6GA 3BTHE 1HDTH 1KLTA 3LGYA 1GHBF 4WXVA 1NN6A 5DP4A 4YOJA 1PPCE 2A0QB 2IPHA 2W5EA 4UFGH 3VXEH 2FI3E 1C5MD 4JYVH 8GCHF 1VCQA 1HIAB 3JZ2B 2XW9A 1A61H 1RTKA 4PROA 3ZVDA 2ALPA 1Y3WA 1WOFA 2FI4E 1T4VH 5JYIA 1SGDE 1F5LA 1KIGH 1ZYOA 3BTGE 5SGAE 2CGAA 3N7OA 1DE7H 4JZEH 2YNBA 1DICA 1TOCB 4A1TA 3BTQE 4CRAA 3NXPA 3SW2B 1K1PA 4B1TA 1Z8JB 5A0CA 1ZJKA 1H4WA 1H9LB 3RMOH 2TRMA 4K1EA 1AI8H 1MD7A 3RXFA 5JDUB 2AMQA 3BTTE 2A4QA 4NZLA 1PPHE 1UVSH 5L6NH 2C90B 2BTCE 4I8GA 1GGDB 1SQOA 4UDWH 1C5UA 1E34B 1O2OA 1J14A 1HB0B 3P70B 3SV8A 3ZYEA 4YT6H 3SI3H 2AS9A 3PMHB 4ABDA 2G81E 1QCPA 1O34A 3SGQE 3WY8A 3A84A 1DITH 3LONA 5HYOA 5C67A 6CHAB 3T26A 1LQDB 2FOFA 3RU4D 1G3EA 3EE0B 4ABFA 1QB6A 4GSOA 2HNTE 2BQ6B 1SGCA 1D6WA 1CBWB 4RN6A 1C5VA 2PSYA 1O32A 1PJPA 1BBRH 1GVKB 5LPFA 1LHDH 2EEKA 5C1YA 2ALVA 3A7ZA 3PB1E 1O2ZA 3PROA 2PSXA 1OXGA 1O37A 5DO4H 1DX5M 2FOMB 3UNSA 3MU1A 3K65B 1TRNA 3F68H 1F0SA 3B8JA 1N6XA 1D3TB 4I31A 1OWIA 3LH3A 4OS1A 4U32A 1AU8A 1YF4A 1EAWA 1ZLRA 4NIVA 1O2MA 5LH8A 4HTCH 1GCTC 4IC6A 2FWWA 1O2TA 1SGEE 1AN1E 1ZOMA 4FUJA 1TNLA 2R3YA 2R9PA 4WF8A 4YOGA 4Y0ZE 1QBVH 4K2YA 1IQEA 1SGFA 1XMNB 3A89A 3UQOA 1O2HA 1F5KU 2FYRA 2HGTH 1TNGA 1GBTA 3KQCA 3C27B 4OS2A 3OTJE 1ZRKA 1GI8B 5HM9A 1O2NA 4DCDA 2QYIA 1FY3A 1O3IA 4Q7XA 2VB0A 1G36A 4JZIA 3HK3B 3CS0A 1QBOA 2XC0A 4WY3A 2BDAA 1K28D 3A8CA 4BXSA 1HAZB 3SJIA 1ETSH 4O97A 3NWUA 1GGDC 3Q3YA 1ORFA 1P2MA 1V2QT 3RMMH 1TA2A 1ID5H 3P95A 1QL7A 2A5AA 2PUQH 3NZIA 5HMAA 4A1VA 3UPEA 1TX8A 1EPTA 2F9BH 2HVXA 1C9TA 3RUOA 3MMGA 6CHAC 2FX6A 2G5NA 1GI6A 2OC7A 1PFXC 3NCLA 1VITH 5A8XA 3RMLH 1TB6H 3AW0A 1IAUA 3MO6A 4JK6A 3ZV8A 3DFJA 1IQGA 1EP5A 1C5RA 1MKWH 1RTFB 4GAWA 1UVUH 3HKIB 2AERH 3VGCB 5ESBA 1FAKH 4JK5A 5BRRE 1IQNA 1O2GH 3PO1C 2ZP0H 2VGCC 1C2EA 1GJ4H 5FPTA 2FMJA 1L4DA 2ZPSA 1U6QA 1ARBA 1QFKH 2BLOA 5J4SA 1AHTH 1GVLA 4NA7A 1EAUA 3TU7H 3LH1A 1HXEH 1WV7H 3RLWH 3FP7E 1BZXE 1UO6A 3PWCA 2ZGCA 4XBCA 3UNQA 1WTGH 4Y8YA 5LGOA 1E36B 2Y80A 1O39A 1LO6A 2BMGB 2R2WU 1UHBB 1AFQC 4ABGA 3MWIU 2J34A 3OY5U 4OS5A 5L30H 4A6LA 1WBGB 2VIPA 1LTOA 1C1TA 1P3CA 1YP9A 2Y5HA 5GIBA 1C5ZB 1YPLH 1O2JA 2SGAA 3EA9A 2THFB 4F49A 1DY8A 3LGIA 1O2VA 2GV7A 1IQFA 1CA8B 1QQ4A 1HAOH 1L4ZA 1FAXA 1UVTH 1AIXH 1C9PA 3PMAB 1NROH 3UNRA 3U8RH 1BIOA 5AF9H 1THSH 2BD2A 2SFAA 3HGPA 2XC4A 1NC6A 1VJAU 4NIWA 3PWBA 4BAHB 1O5CB 1O2XA 1D3PB 3GDSA 2WYGA 1BBRE 1C5LH 2OUAA 2PKAB 2P8OC 3A81A 1QJ1B 3SQEE 4JZ1A 1KXAA 1Z6JH 5FX6A 4YLQH 3ZV9A 5JBCS 4ABAA 4WXIA 3RXIA 5HM2A 3TITA 4AFUA 4OS6A 1SOTA 2WV5A 1C5PA 7ESTE 3URDA 5C5NA 1V3XA 1PPGE 3ATKA 1GBEA 1V2VT 1C1QA 3KCGH 1AVGH 2UWLA 1CGIE 3U8OH 1GBBA 2YNAA 2BVRH 2SGDE 4MPXA 2BOKA 2I6SA 3MO3A 2O8MA 1LHFH 2QA9E 1TMTH 1GBHA 1EZXC 5L2YH 2GZ8A 1RJXB 1YM0A 3M3SA 5TCAA 2BLWA 2G4UA 4R0IA 1AB9B 8GCHG 3KNXA 2KAIB 1QNJA 1X7AC 1S5SA 4WH8A 2F9NA 4FU8A 4IW4E 2BX4A 3BTFE 4KTUA 1MKXH 4Y10E 1BT7A 1C1PA 1C2DA 3M35A 3TPIZ 5CE1A 2Q6FA 2QY0B 2VNTA 2HRVA 5ABWA 5GDSH 4ZHAA 2A4GA 3M7QA 4Y79A 2J2UA 3E1XB 4TY6A 4CR9A 1V2PT 1YPEH 4B71A 4TPIZ 1CA0B 1P9UA 1UJ1A 1MQ6A 1HPGA 2JH5D 1W3CA 3A7XA 3QK1A 1YLDA 4CRCA 2C3SA 2HPPH 1C1MA 4GHTA 1MBQA 1L0ZA 1TPAE 1GJ9B 4YZUA 5FX5A 2AGIX 3VPKA 3U8TH 3A7TA 2ZC9H 1O0DH 2BD4A 1XUHA 3E0NB 1S81A 3RXSA 3O8CA 3IWMA 2PWXA 1MCTA 4AB8A 1KY9A 1ZPBA 3AAUA 1PQAA 2BDYA 1GI3A 4B74A 1T4UH 1TE0A 1GI4A 1AWHB 2C8YB 2ZNKH 5EW1H 4THNH 1NZQH 2IJOB 1DM4B 3ITIA 3QDZB 1JIMA 1DDJA 4GPGA 1BB0B 1TRYA 1C5SA 1V6DA 1O2PA 3ZYDA 1BMNH 1SI5H 5CHAC 2B7DH 1N8OB 3D49H 1DPOA 1S0RA 1TX7A 4CREA 1HGTH 4BTTB 2J38A 3BSQA 1O2QA 3T27A 1TX6A 2NU1E 1KTSB 2AIQA 3M7UA 3VB3A 2PUXB 3MTYA 1V2RT 1Y5BT 2ANYA 5EGMA 1SR5C 3ZZ5A 2O8WA 5EG4A 1E37B 2ULLA 1RXPA 4YO9A 2GKVE 1JRTA 1MZAA 1P2OA 5HGGA 2WINI 3SOSA 3KIDU 1AGJA 4I32A 1V2LT 2B9LA 2F9VA 1P2NA 2ZGXH 4LZ4B 3A7VA 2ZPQA 3TVJB 2Z9IA 1NRRH 1OWJA 1TBRH 3HATH 4Y8XA 2UWOA 5DKMA 3SNDA 1FN8A 2SGFE 3RU4E 2CJIA 2O9QA 4M7GA 3RXEA 4AFSA 1L2EA 1SFIA 4VGCC 4A5TS 3RDZA 4K5ZA 4UEHH 3ZZDA 4AZ2B 2ANKH 3U1JB 5DP5A 1N6YA 2VIWA 4CRBA 4K8BA 1OYQA 1AZZA 3QUMP 1W14U 4Y7BA 1BJVA 4JCNA 4O3TA 1O3CA 4UFEH 1SGNE 1FPHH 3S7HB 4UONA 3Q77A 1C4Y2 1UCYH 5K0HA 4WVPE 4ISIH 3TK9A 3ZZ3A 1GBIA 4BANB 1TYNA 3E8LA 3GCOA 1EXFA 2NU4E 3T25A 1B7XB 1Z71A 2Q6DA 2JETB 2D26C 4X8SH 3STIA 4K60A 4ZKOU 2D2DA 2NU2E 2R0LA 3LT3A 7GCHG 4ZXYH 1ELGA 5PTPA 2CF8H 2Z3CA 3ENSB 3A86A 2A2QH 1OP8A 3O8BA 2Z3EA 1H9IE 3SV9A 2ZHQH 3S7KB 1W0ZU 3P8OA 2Y82A 1EZUC 1DXPA 1OKXA 1T7CA 3RC6A 4K69A 3RC5A 3SNEA 1THRH 3RXCA 1OOKB 1K22H 2HWLB 3SU0A 9LPRA 1EPTB 3F9FA 4ZHMU 2ZTZA 1O3LA 1SL3A 3AW1A 2CHAB 1CHGA 2ZU3A 3NPSA 4MQAA 1GI0A 1L1NA 1IQKA 1V2WT 2J95A 1D3QB 4UFDH 1K1IA 4MNWA 2ZU4A 1G9IE 4AORA 1ZHRA 1KDQA 2ZU2A 1GHAF 1VR1H 4AB9A 3W94A 1GWAA 4X2XA 4B2CA 2GP9B 2PGQB 5F8ZA 1OYTH 3GCTF 2V0BA 3S69A 1QRWA 3HPTB 1NRSH 1W0YH 2PKSC 1ANDA 4TWWA 2AEIH 1A0HB 3PM3A 4MNYA 3V12A 4FUFA 1P05A 1C5NH 3SBKA 1FUJA 1GJ7B 1FIWA 5AFZH 1YPHC 2LPRA 4I8KA 4AGKA 3VB5A 1AY6H 4FUCA 1LQEA 1K1JA 1PQ5A 1T8MA 1HV7A 2ZGHA 2G52A 1O5EH 3BF6H 4U2WA 3ZVAA 1ANBA 4J1YA 3BTKE 1CHOF 1IQIA 4CR5A 1RD3B 3SJ8A 1MUEB 2ZO3H 1LHGH 4DW2U 1BTZA 5CMXH 1CO7E 3GY2A 2BYAX 3PMBB 3M3TA 2HNTC 2P3TB 2TIOA 3UUZA 2DUCA 1BDAA 1Q31A 1TMBH 1P57B 1A5IA 1SPJA 4GCHG 2A31A 5C1XA 1EATA 1HJ9A 1V2MT 4JZFH 1DLEA 2Y5FA 1ZTLA 4LXBH 1UCYK 1BUIA 1GBKA 1ZHMA 2SGPE 3PYHA 2C8WB 4ABBA 4CRDA 1O3GA 4VGCB 2JKHA 1XUGA 2Z3DA 3H5CB 1VGCB 1ELBA 1CSOE 1ZTKA 1P2IA 3L3TA 4JMYA 4XDEA 1YYY1 2GTBA 1T8NA 3EA8A 2FIRH 1KSNA 2WUBA 4HZHA 1K1NA 2VIOA 1GBCA 3VFEA 2OXSA 2Z6BD 1NU9A 5DP6A 1O31A 5FPSA 1O3HA 2HALA 2XBYA 4XE4A 5DJ7A 1MTUA 1GI7B 1P09A 2VWLA 1SGPE 1C2HA 4LOYH 2UWPA 3V0XA 3CP7A 5ETXA 3LC3A 1C2LA 4AYVB 2R3UA 3MNXA 1KXBA 3SUDA 1SGRE 4YT7H 1EP6A 3GCNA 1A46H 1JRSA 2H5CA 5C1UA 1M9UA 2ZDVH 1CGHA 5F8XA 2TPIZ 1O3NA 1AZ8A 1PPZA 1EZQA 4BAQB 2GZ9A 4NA9H 2FOEA 4X6PA 2VJ1A 3QGJA 1MQ5A 2Z9GA 3T28A 1ZMLA 3TK6A 1IOEA 1YPGH 1UVPA 2FESH 4WWYA 3BV9B 2PV9B 2QXGA 3RXOA 2D8WA 3BTDE 2YOLA 1EB2A 2G51A 2ZA5A 3TGIE 2F83A 1BCUH 3ZZAA 1MU6B 3P8NA 1GJ6A 1V2UT 4RKOB 2SNWA 2W3KA 4FUEA 1TALA 4D9RA 3QX5H 1Y5UT 1SC8U 4FUIA 1FDPA 1QJ6B 1GI2A 1MAYA 3KF2A 3SNBA 1RGQA 4QT8C 2A4RA 1GVZA 5GCHG 4LK4A 1W7XH 1UMAH 4DT7B 2WV4A 1FJSA 3V13A 2B0FA 3F9HA 4IGDA 1BTYA 4UE7H 3LIWA 1G3DA 4DOQA 1P2QA 2BX3A 1NY22 2IOTA 1MTNC 1F0UA 3SGBE 4H6SB 5LPRA 1EQ9A 3GCTG 1GBDA 1UTNA 1FMGA 3PLKA 3SU4A 1C1WH 4DG4A 2AFQB 1ETTH 1VJ9U 3PLBA 1G32B 1NT1A 3QTVH 2A32A 3SU3A 1KLJH 1S84A 2ZTYA 2PFEA 1S6FA 1W12U 3MHWU 4INHA 3SV6A 3RM0H 1ELTA 3ATIA 3A83A 4DVAU 2CMYA 3P6ZB 2G8TA 4GUXA 1LKBA 2UUJB 2A4OA 3LDXH 5JB9S 1Y59T 2P3FH 1CT2E 1OSSA 1OWKA 1W13U 1GMCF 1V2ST 1GBMA 2QC2A 1JMOH 3HKJB 3P8GA 1FI8A 3RXRA 1O3BA 3E16B 3GICB 1O3AA 1HAXB 2A7CA 1EB1H 1SSXA 3FP8E 3U9AH 2FTLE 2P8OB 1MD8A 4CBOA 1AUJA 1CU1A 2XBVA 2SGQE 5JBTA 4FU7A 4O9VA 4B76A 6LPRA 1V2KT 1C5YB 3A82A 1OS8A 2GVFA 2XCFA 4CRFA 1UCYE 3QN7A 1AKSA 1Z8IB 3KQDA 4NWLA 4BTUB 1O3JA 1TA6A 4ZKRU 3TNSA 3ATMA 5E0JA 1EASA 2A7HA 1P03A 1G2LA 9ESTA 5DP7A 1SMFE 1D3DB 1NFXA 4BNRA 4IBLH 3MH7A 3PLPA 1ZGIA 4IMQA 4O03A 3M3VA 3ZVEA 2W26A 1O5BB 1Z1IA 4FUDA 1IQMA 4MLFB 1MBMA 2OCVB 1ZPCA 4H6TA 4TPYA 3LGUA 2CF9H 1P10A 6ESTA 1LHEH 2ZGJA 2VH6A 3ZZ7A 4JZDH 5FBEA 1W11U 1ZTJA 2V6NA 4XFQA 4ABIA 1V2OT 1IQJA 3U69H 2PKAA 2ZCKP 2OINA 2XXLA 3UOPA 1GMCG 1THPB 1ZR0A 2H9HA 3EYDA 1A0JA 3QWCH 5DP3A 2I6QA 3GY4A 1AKSB 4DURA 4IMZA 2SGEE 1EAXA 2F3CE 2J94A 1O2IA 3E3TA 1SFQB 3BTWE 4B73A 3F1SB 4O3UA 1OX1A 2FDAA 1TBQH 3GCHB 5JBBS 2Y6TA 1YGCH 1O36A 5DK1A 1EOJA 1G37A 1MH0A