3RXRA

Crystal structure of trypsin complexed with cycloheptanamine (f01 and f03, cocktail experiment)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxrA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxrA02
1OWHA 1QY6A 2GVFA 2OC1A 1ELGA 2HNTC 2WV5A 5T3HA 3MFJA 1MCVA 3UR6A 4ABHA 4A6LA 4U30A 3EA7A 1E34B 2GKVE 2G8TA 1TE0A 3BIUH 2GD4B 3K2UA 3SU4A 2A5KA 3PV4A 1QBVH 3ESTA 1BMMH 1Y3UA 1W11U 3GY4A 3RXRA 4KTSA 3UNQA 1MMJN 1O37A 2F9UA 1S6FA 1TGTA 5T6FA 5LPFA 1ANCA 1SPJA 1F2SE 6ESTA 9ESTA 4AFZA 1XUGA 5DPAA 3A8AA 3SJIA 1BT7A 5HM2A 4DIIH 3TGKE 2Y7ZA 3A8CA 3E3TA 1C2HA 1G36A 3TGJE 3GDUA 1GPZA 2Q1JA 3EAJA 3CP7A 1PYTC 4AG1A 3GDSA 1NRSH 4X8VH 4JYUH 3CENA 2BHGA 3SZNA 4DY7B 1EP6A 1BZXE 3TNSA 2BD5A 1LHCH 1RXPA 4NSYA 2J2UA 2R9PA 3MMGA 2DE8A 3SNBA 5JYIA 2WYGA 3RXGA 1GJ7B 3KQBA 1MU8B 5A0BA 3M5OA 4A92A 1SFQB 3U8TH 2LPRA 4WH8A 1DXPA 3EA9A 4INHA 3F9HA 4H42U 1TGBA 1C5WB 1OX1A 1KLIH 2ZFFH 3A89A 1SG8B 1ETRH 3P8GA 1ZR0A 1GDNA 2SGDE 1D3TB 4XBCA 1WOFA 2QY0B 1A4WH 1THSH 1YYY1 2BLQA 2OP9A 2JH0D 1WU1A 5BPEA 3LU9B 4X2XA 2J95A 1C2FA 4Q7YA 2AMDA 1WYKA 5HGGA 1MZAA 3TVJB 1K1NA 1CA0C 1GJAB 1U6QA 1QL8A 2C4FH 1C1QA 1W7XH 1HAYB 1Z8RA 1CHOF 2C8ZB 1SQTA 1GGDC 1KDQB 2B9LA 1NY22 3ATIA 2STBE 1V2UT 1W13U 1T8OA 4K2YA 3L3TA 1O3GA 1W0YH 6CHAC 4DOQA 5EW1H 1YPEH 1BJVA 1O35A 4HGCA 4B2AA 4CHAB 4E7RG 1O3EA 3BG8A 3W94A 2AEIH 5DP3A 1LDTT 1QRXA 4NZQA 3ZV9A 4I8GA 3SGQE 1AI8H 1A2CH 3QUMP 4Z0KA 4RSPA 3F6UH 4R8TB 4IC6A 1KYNA 2HOBA 3RDZA 2ZA5A 2ZGCA 3GDVA 5JBTA 3RXJA 2GMTB 3T2NA 4YLQH 3QTVH 1VITH 1AHTH 1G9IE 1FUJA 2A31A 1Z7KA 3EGKH 3PB1E 1C5UA 2A4OA 1O3PB 3M3SA 4UFGH 4CH2B 4K3JA 1TNIA 2CGAA 3Q3YA 1ARBA 1EPTC 1GI7B 4YT7H 2BOKA 1CSOE 1KXBA 2P3FH 2XYAA 3S9CA 3BV9B 2RA3A 1Z6JH 2Y82A 1DY8A 2Z6BD 2BDIA 3MU4A 2SGEE 3AW0A 4D76A 4WH6A 1DS2E 3Q76A 5E8EH 2XXLA 1BMLA 3CS7A 3HPTB 1O2MA 4AFUA 3EYDA 1QA0A 2HPQH 1LCYA 2FLBH 2XWBI 4LK4A 4CRAA 4DVAU 1E35B 1QJ7B 1EJMA 3GCTF 3QTOH 3VXFH 2EEKA 1ELTA 1HXFH 4GAWA 1V2RT 3O8DA 3TK5A 1TYNA 2FS8A 3C1KA 4ZXYH 1OWJA 1P05A 3M36A 1BRBE 1SB1H 4ABIA 4FUBA 1Z8IB 3E0PB 4B1TA 2OC0A 1J15A 1GI4A 2R2MB 1EUFA 3T28A 3P17H 3U8OH 2BYAX 5A0CA 3STJA 1XUIA 4FVDA 1ZHMA 2BD4A 3SV9A 1HV7A 1YCPK 2ZFQH 1L1NA 1HYLA 2VIDA 3PLBA 4WXIA 3FZDA 5DK1A 1C5QA 3ZV8A 4ZKSU 1DUEA 1BRCE 2XNIA 2KAIB 3BTFE 1TFXA 1PQAA 1AQ7A 2ZGXH 1ZZZA 3PLPA 1W8BH 1P2JA 3M61U 3FVFB 2A4GA 5AF9H 1GBAA 2TGTA 2C8YB 2GZ7A 1ANEA 1WBGB 2BXTH 1XKAC 3NWUA 4WWYA 1KXDA 4AYYB 3P8OA 4GCHF 1EAXA 1MH0A 3ELAH 4UEHH 4JZEH 1SGEE 4UONA 5E0JA 1K21H 3BIVH 2F9PA 4AGKA 3V12A 1XVOA 2F9NA 1GBMA 1WV7H 1Y3XA 2BY6X 1LHGH 1O32A 2HNTE 1F0SA 1V2TT 1QB9A 2BY5X 1MCTA 5I25A 2Z94A 3GY3A 5F8XA 3TK6A 1K1PA 1SLXB 5CHAC 3LT3A 2VIQA 5FPYA 4TYDA 2TGAA 1ELFA 1FI8A 2CMYA 2H2ZA 1LPKB 1NRQH 1Q3XA 2ZFTA 3KQDA 3SJKA 1ID5H 1XM1A 2ZHFH 3HKJB 3MNBA 1IAUA 4MPXA 1GL0E 4H6SB 1D6WA 1VCQA 5HMAA 2P3TB 2QN5T 1TA6A 2BM2A 4BXWA 5EW2H 3O8BA 2NU4E 2GMTC 1AO5A 4LOYH 1P0SH 5TCCA 1ZMNA 1YCPH 1C5MD 1TA2A 1BTUA 4J1YA 1HDTH 2A0QB 1F5LA 1F0RA 1BITA 1C1NA 1EZXC 4XBDA 4DJZB 1FAXA 3SO3A 1JXPA 2OUAA 1HAVB 4Y11E 2BOHB 1UVUH 1J17T 3ENSB 1QRWA 2ZZUH 4X8SH 1M9UA 3UNSA 1GVZA 1A0LA 1P01A 1T31A 1S6HA 2GDEH 1SQAA 1W10U 3P8NA 1S82A 2IN2A 4CR5A 3DD2H 1P3EA 2PSYA 4LZ4B 2JH6D 2YOLA 4WMDA 4B2BA 1LO6A 2FIRH 3MTYA 1ZMLA 1RFNA 4IMQA 4JZIA 3A7YA 1UVPA 2OC7A 1L4ZA 4H4FA 4FUIA 4X0WU 3ZZCA 3LGTA 3NXPA 1VITG 1C5NH 1DPOA 1T8NA 5GCHG 1V2JT 3RLWH 3KQCA 1AMHA 3KNXA 5ABWA 2ZU5A 2ZQ1A 3RXEA 1CBWC 4K1SA 1FZZA 5F8TA 1HCGA 4DG4A 1DE7H 1GHVH 1LVBA 2TBSA 3HKIB 4K1EA 2UWOA 1PJPA 3RU4T 4TY6A 3M7TA 3GICB 1VR1H 5FAHA 1YPLH 1YM0A 4NIWA 3SORA 1TOMH 1SLWB 1O5GH 1S84A 1BHXF 1IQGA 3M37A 3SUEA 2EC9H 2HWLB 1SGFA 5ETXA 1A0HB 2O9QA 1BJUA 3UFAA 1YPHE 4NCYA 1O2GH 1NFWA 2AYWA 4BTIB 2A4RA 1TLDA 1GI5A 2RDLA 3IITA 1BHXB 5EOKA 1GBEA 1QCPA 2UUKB 3ZYDA 5FCRA 1DLKB 1AIXH 1EX3A 1HJAB 4FUCA 4OGYA 1DUAA 4YTAA 1HJ8A 3A83A 1BRAA 1NU9A 2DUCA 1DM4B 3P92A 1O2PA 1XXFA 1F7ZA 1O3DA 1CT0E 2BDCA 3EE0B 1HRTH 3U69H 5JPMH 3B9FH 1A1RA 4CREA 1JBUH 2W7SA 1TQ0B 2HNTF 5CMXH 1K1OA 4X6MA 1EB2A 2HALA 4WVPE 1OYTH 1J14A 3QK1A 1VITF 1SLUB 4X8UH 3SU0A 5JB8S 4CR9A 2FLRH 2VGCB 1B0EA 2FOEA 1YP9A 1LHEH 1F5RA 1AGJA 3RXSA 3RXAA 1WCZA 2W3KA 1O2OA 3TH4H 1A0JA 3QN7A 1V2OT 1V2ST 1GBKA 5E0GA 2ODPA 2OBOA 4IGDA 1INCA 4ZKRU 3U1IB 2AFQB 1BBRE 2OXSA 3KIDU 1H9IE 4GPGA 2GX4A 1FY1A 1OPHB 1EB1H 1RGQA 1GHWH 1TABE 3KHVA 3TIUA 3RM0H 2R0KA 1GMHG 4ZROA 3SGAE 4YZUA 3LH1A 4UFDH 5C1YA 4MNXA 5A8YA 2R3YA 1NC6A 1TNGA 5K0HA 1KTSB 4E05H 1EAWA 2Y80A 2QF0A 4RN6A 5EGMA 3E90B 2Y5FA 3OYPA 4AYVB 1O2QA 1AY6H 2FOBA 4JK5A 4CBOA 3VEQB 1T8MA 3T25A 3LJJA 1GMDF 6GCHF 4JZDH 4AGJA 3LGWA 4XOJA 3K6YA 3M5LA 3NK8A 1TRMA 4XBBA 1EAIA 7KMEH 4MNVA 1CGJE 4FUDA 4KTCA 3U98H 3EQ0H 3I29A 1G2MA 5E2OA 3TU7H 4HFPB 2A5IA 3BEFB 1VZQH 2FPZA 4K8BA 5TJXA 1HAPH 3GCOA 2F83A 3O8RA 1C5PA 1UJ1A 3AAVA 1AE5A 3MOCA 3LDXH 1O34A 5EXLA 1A5IA 2ZP0H 1QB6A 1GHXH 2AMPA 1Z8GA 2Q6DA 3SJOA 3OU0A 4BAOB 3H5CB 4HZHA 1AUTC 1K1MA 3ATKA 3W95A 2F9OA 3ZZAA 1C1VH 1BOQA 4Y8ZA 1CA0B 1ZGVA 3K6ZA 3SQEE 1JIRA 1C4V2 1BA8B 7GCHF 1K1IA 1P57B 3GY6A 5TCAA 2ANKH 1OP8A 5LGOA 2WUCA 1TONA 1NM6A 3L33A 1HJAC 5EG4A 1ETTH 4DGJA 3ZZ7A 4QT8C 2BMGB 4X2YA 1JIMA 5EPYA 6CHAB 1PPEE 1SGPE 1FNIA 1O2ZA 3MYWA 1OWEA 2G4UA 2Z9IA 1SGDE 3ZZ3A 1L1GA 1GHAF 2Z7FE 5I46H 1H8DH 5L30H 1L2EA 2XCFA 2BY7X 3K65B 2PR3A 3ZVFA 4YM9A 3RM2H 5AVDA 3RP2A 1IQMA 5C2ZA 4OS1A 1X7AC 2VGCC 4TPYA 3CS0A 1SGCA 3A82A 1P8VC 4INKA 3P8FA 4M7GA 2BB4A 1V2LT 4HTCH 4FVBA 1UTLM 1LQEA 3PLKA 1BTZA 1CT2E 4ISHH 3VFEA 1LHDH 1XUFA 1SOTA 5DP4A 1EJAA 2ZO3H 2V3OH 5JDUB 2QXJA 3E0NB 1CHOG 2FWWA 3A81A 2WPJS 1P9UA 4IBLH 3TK9A 1C5OH 1EPTB 2UUFB 3P95A 3QWCH 1EP5A 4FU7A 1OSSA 2SGFE 2ZU1A 1UCYE 5FBEA 2PGQB 1Z1JA 2GCHF 2PKAB 5L2YH 4YLUA 3SOSA 1RS0A 1DDJA 1MQ6A 2FI3E 4NA7A 1SC8U 4Y71A 3RMNH 1LKAA 3NCLA 3JZ2B 1O39A 1FDPA 3M35A 8LPRA 2HVXA 1HNEE 3R0FA 5F6MA 2ZCHP 1RIWC 1TRYA 2BD3A 2FYRA 3BEUA 2ANMH 1H1BA 1P12E 3SGBE 4E06H 2PUQH 2Z9KA 2C8WB 1NN6A 2D2DA 3SV6A 5DO4H 1P2QA 4AFQA 2ANWA 1SLVB 1JMOH 2BX3A 3LC3A 1GJ9B 1VGCB 3DFJA 2A7CA 2VNTA 1UK2A 5FBIA 4NFEA 1Y59T 1AFQC 3F1SB 1FLEE 4AG2A 2ULLA 2EI7A 4A5TS 1FXYA 1W3CA 4B71A 1QB1A 2Z3DA 3TH2H 3LIWA 3TLOA 2ZDVH 2W26A 2ZU2A 3SN8A 4UDWH 4R0IA 1TGNA 1O36A 1EKBB 4WMFA 1KIGH 1IQEA 5A8XA 3GCTG 1AKSA 3O8CA 2HGTH 1ELEE 2VVCA 1C1RA 1MBMA 3SW2B 2G81E 4KP0A 2QAAA 5FCKA 4K8YA 1UK3A 5DP9A 5CHAB 3M5NA 4XE4A 3EDXB 5J4QA 3K9XB 3RXBA 3BTME 4Y0ZE 3MHWU 1A3BH 1YPHC 2XW9A 5DKMA 2P8OB 1UTKA 4NIXA 1ZPBA 2O8WA 4TWYA 5JBBS 4BXSA 3AASA 1ESAA 2G52A 4UD9H 1O2WA 2ZDMA 1RD3B 1SFIA 1THRH 1MTNC 1V6DA 2FOMB 4MQAA 2FESH 1DT2A 1GI0A 2AS9A 3AVZA 2EI6A 3RXUA 2PKSB 3KN2A 2ZTZA 4UFEH 2H9HA 4A1XA 1E0FD 4IC5A 1GCTC 1DANH 4GCHG 1RJXB 4AZ2B 3WY8A 1P2OA 3ATWA 1IQHA 4WMEA 1GBCA 1Q31A 2O8MA 1XKBC 1W7GH 1V2PT 2V3HH 1ACBE 1GJDB 1Y3VA 3VB5A 1C5XB 2ZECA 3LJOA 4Y8XA 4NWKA 1MTSA 1TALA 2QYIA 4B76A 3BTKE 1GHYH 3HGNA 1O2VA 5C1XA 2VJ1A 1MU6B 3BTEE 3T5FH 1TBZH 2OQUA 2QF3A 5HM9A 2GCTB 5FX6A 1OS8A 3DA9B 3A7ZA 1K22H 3D23A 3QDZB 1MTWA 1SL3A 2TIOA 1D9IA 5EXMA 5T6DA 2FP7B 1FPCH 2WINI 4Y10E 1CGHA 1GI2A 4E7NA 3D62A 4FUJA 4LXBH 1YF4A 2P93A 3PROA 2V35A 4X8TH 1BB0B 4Y8YA 4MNWA 3S7HB 2FI4E 4OS6A 4O3TA 2BY9X 2AGGX 3LGVA 4ZAEA 2VH0A 2XC4A 3QGJA 1GWAA 4ZUHA 1CBWB 1Z1IA 1TQ7B 1G2LA 1E36B 1ELAA 1AWFH 2P3UB 1IHTH 1Y8TA 2NU2E 5EXNA 1VGCC 4NA9H 4ISIH 3HATH 1CT4E 4U01A 1W12U 1YPKH 3SV8A 1C5ZB 1ZTKA 3NPSA 2XWAA 1ZSLA 1XMNB 1C5VA 3G01A 3I78A 5EQQA 2WPIS 1QNJA 1D3QB 5FX5A 4XDEA 4I7YH 3BTQE 3GOVB 2FOCA 1V2KT 1F5KU 1N1LA 3LGYA 2YNAA 1JOUB 1DSTA 2UWPA 1IQJA 4ISLA 1FN8A 1TBQH 2V6NA 5DP7A 1FV9A 1MAXA 5C5OA 1CHGA 1DVAH 1TIOA 5DP8A 4Y76A 1E37B 4AB9A 1BTWA 3MH5A 4Q80A 4A1TA 4IMZA 1C5TA 3S0NA 2ZU4A 5PTPA 1W2KH 2ODYB 1NTPA 1B7XB 1HAXB 3QO6A 4ZXXH 2FX4A 4Q7ZA 4VGCB 1TX6A 3EA8A 1LMWB 1IQKA 1YGCH 2Q6GA 1QBOA 2ZC9H 1HIAA 4YT6H 3Q00A 4IN2A 3A80A 3BSQA 1D6RA 3OX7U 2ZPQA 2BTCE 4OGXA 1TX8A 2FX6A 2P8OC 5A2MH 3Q77A 4X6PA 1H9HE 1UTMA 2XBVA 1GVLA 4MVNA 1GDUA 2PFEA 3UQOA 3RC6A 3KQEA 3BTWE 1O38A 1XVMA 2O8UA 2Z3EA 3M7UA 4WF8A 3SNEA 2PKSC 2VIWA 1XUKA 2WPHS 2W5EA 1NU7B 2P94A 2P95A 1HFDA 1NRPH 3ODFA 3E8LA 1TNKA 4YO9A 1EZSC 2Y7XA 3RXFA 2PLXA 2OLGA 1VCPA 4F4OC 4X6NA 1P2NA 1NO9H 1IQFA 1GVKB 3PM3A 1ANBA 2A45B 2GCTC 1A3EH 2OC8A 1FAKH 1LTOA 1KTTB 1YLCA 4YESB 4ABDA 1THPB 3A8DA 2P16A 4GHQA 2VH6A 5ESTE 1BBRH 1O31A 1SBWA 4ABAA 1C5SA 1AKSB 1N8OC 2J92A 1D4PB 2ZHWH 1C2EA 1CGIE 1MKWH 1UHBA 1DLEA 4K5ZA 8ESTE 1O3MA 1A46H 3N7OA 3LKWA 1G30B 4XSKU 1QQUA 5EQRA 1F0TA 5DGJA 3LPRA 1QTFA 2BLVA 2FEQH 5IYTA 4X6OA 1C1WH 1MZDA 1T4VH 2BDHA 3RXDA 5LPRA 2ILNA 4IN1A 3IWMA 2FTLE 5DG6A 9LPRA 1NFUA 1ZJKA 2VB0A 1UO6A 2ZCKP 1BQYA 5JBCS 4I8JA 1BMNH 1DWCH 1NROH 3ZVBA 1AVGH 2A2QH 2WUBA 1SOZA 3RMLH 1BCUH 5T6GA 5HXFA 4Y7AA 1O2NA 2AMQA 3PTNA 2QXIA 1GDQA 2ZKSA 2ZHQH 2TGDA 1QL7A 3P6ZB 1GMDG 2BD9A 2FYQA 3B8JA 6GCHG 1KXEA 3MH4A 1SR5C 1BIOA 1GBJA 4KELA 4Q2KA 5AFYH 1ZTLA 3U9AH 1P3CA 3V13A 1FMGA 3URDA 4I8KA 4VGCC 3ZZ8A 4A1VA 3AAUA 1ZSJA 4BNRA 1UCYK 5L6NH 1A7SA 4AX9H 3MH7A 4TWWA 4O97A 3SNAA 3T62A 1S85A 3TGIE 4GVUA 3FP7E 2ZWLH 2H1UA 3OY6U 5BRRE 1SVPA 2J94A 1O3OA 4BAMB 1B0FA 1ABJH 4JYTA 3TH3H 2VINA 1G32B 3PO1B 4OS2A 4Q7XA 4NWLA 3OSYA 4ISNA 2VWMA 2ZPSA 4O3UA 2GDDA 2ZU3A 3BTHE 1WTGH 1V2NT 3F9GA 3NUMA 3ATMA 3UQVA 4X2VA 1UTJA 4DIHH 1HPGA 3KGPA 1O2XA 4J2YB 2QC2A 7GCHG 4LZ1H 3ZZDA 4CRFA 1DWEH 1ZHRA 1PFXC 3A84A 1RRKA 3HK3B 2Z9GA 3SJ8A 1NRNH 1N6XA 2SGPE 3RXLA 3R3GB 4A7IB 4SGAE 2SFAA 2XC5A 1V3XA 3IG6B 2AGEX 1A5GH 1IHSH 4I8LA 1UTOA 3MU1A 1JRSA 3M5MA 1AE8H 5GJ4B 1JRTA 1EQ9A 1VJAU 3LGIA 1BUIA 1GHAG 1KDQA 1TPAE 2UWLA 1QGFA 1FJSA 3GY8A 3PYHA 5FXLA 3RXPA 3KF2A 5C1UA 1BMAA 1K2I1 1V2MT 2C8XB 4CRGA 4D9QA 1C5YB 1HJ9A 3HK6B 4K60A 3T27A 4NIVA 2HPPH 1RIWB 3GISB 4MTBA 2VWNA 3ZYEA 1O3JA 1UCYH 2A1DB 2QA9E 3UTUH 7LPRA 1GJBB 4CBNA 2FI5E 3GY5A 3D49H 6LPRA 1EOLA 1H4WA 2NU3E 3SNDA 2OBQA 4FUGA 1HAOH 3DT0H 1LPZB 1RTFB 2CHAB 4ZHMU 2JETB 3MU5A 4JYVH 1QQ4A 4DCDA 1DXWA 1VCWA 1ZLRA 2ZEBA 1OP0A 1AFQB 1Z6EA 1PPFE 1TNLA 3QLPH 4GLYA 1IOEA 3A8BA 3TJVA 2TRMA 3A85A 1EZQA 1MUEB 3UR9A 1TPSA 1FPHH 1HXEH 4Y0YE 1LVOA 2R0LA 2ZDKA 3UREA 1DY9A 2GCHG 1LVMA 3OY5U 1J16A 5GXPA 3PTBA 2UUJB 4AFSA 1UK4A 2Y6TA 4INLA 1IQNA 3DUXH 1ZPCA 8GCHF 3KEEA 1GMCF 2OD3B 1ANDA 3RXIA 1O3AA 2G51A 2RG3A 4RKOB 1RTLA 2ZTXA 1QURH 1OOKB 2BDAA 1WQVH 3VPKA 5C20A 4AN7A 1EZUC 4X1RU 3P70B 1TMUH 1W14U 1FIZA 1ORFA 1T8LA 3E91A 5LH8A 1GBBA 3A7TA 4ZH8A 1P10A 3ZVDA 2J38A 1O5BB 4JZ1A 3PO1C 4AORA 1XUHA 4DT7B 1AD8H 5DP5A 3E1XB 1MBQA 3KL6A 1MTNB 2PV9B 3SU1A 1H9LB 3UY9A 1GI6A 2OCVB 1AWHB 4X2WA 1AN1E 1NESE 2ZCLP 1A5HA 2D1JA 2BVRH 3SJ9A 2HRVA 1GCTB 3BG4B 3KCGH 2KAIA 1CE5A 1BRUP 1RTKA 1ZSKA 2O8TA 4BANB 3GCHB 1FY4A 1OWKA 1GBLA 3VGCB 2Y81A 1QR3E 1LQDB 1GHBF 1WTHD 2R3UA 1TAWA 1FY8E 1S0QA 1ZHPA 4I32A 2EI8A 2ZDAH 1ESTA 1P11E 1BTYA 2PGBB 1EXFA 1ZMJA 3UWIA 1TNJA 1YBWA 5H4IB 4OS4A 2ZHDA 1FN6A 3A7XA 3ZVGA 3BEIB 3SQHE 4ZHLU 1IQIA 2QCYA 3UPEA 2VVUA 1Y5BT 1DX5M 3V0XA 3GCNA 3HGPA 4OS5A 1F92A 4OS7A 2R2WU 3OTJE 2O8LA 1XXDA 3BN9A 1GBIA 3SHAH 4PROA 1KXFA 2ZQ2A 1AFEH 2OINA 5DP6A 2ZFSA 2ESTE 1C1PA 3SU3A 3SU5A 1MAYA 3RLYH 4I33A 3F9EA 1O2LA 1NPMA 1O3KA 4BTTB 4XFQA 1YCPM 2CHAC 2JETC 3L6PA 1C1MA 2THFB 1WQSA 1O5FH 5F8ZA 3JZ1B 3BTDE 4ABEA 1AUJA 1P2KA 4ESTE 1ZJDA 1K1JA 4CRBA 2QGRA 5C5NA 1L4DA 2M5TA 1QJ1B 2PW8H 4MPUA 3VB3A 3S9AA 2FOAA 1HAVA 4MPVA 4X1NU 5EODA 1YPMH 2XC0A 2ZTYA 1C2MA 2CJIA 4CRDA 1K28D 2BVSH 1ELBA 1HB0B 2W3IA 1HLTH 2BQ6B 4CH8B 2G4TA 3SUDA 4D7GA 1P9SA 3SBKA 4O03A 1K1LA 4MLFB 1NS3A 1SGRE 4X1QU 3F9FA 1HUTH 3PMAB 1TGSZ 5CE1A 3VB7A 1QL9A 2RA0A 2BVXH 3MO9A 4NFFA 2NU1E 5IDKA 1MTVA 2V0BA 1SGYE 1C2DA 2F9BH 3E16B 2NWNA 3RXKA 3RU4E 1UTPA 1P2IA 1T32A 3C27B 4JZFH 3TJUA 1O5EH 1FQ3A 3FP8E 5DJ7A 4IW4E 3M3TA 1SSXA 1ARCA 1XX9A 1O5DH 3MU8A 5F03A 2J34A 2BD2A 2C93B 4B74A 3E6PH 2XRCA 2LNCA 3BG4C 3I77A 3UIRA 1P04A 4GSOA 3ZVCA 2FOFA 1O2TA 4JMYA 2ZFRH 2WV4A 1O2UA 1GG6B 3GCHC 3VGCC 3VXEH 4DW2U 3SNCA 1Z71A 2PWXA 1PQ8A 2TPIZ 4U32A 4B2CA 3VB6A 1OP2A 1C2JA 4FUEA 5L2ZH 2GZ8A 1GI3A 2ZFPH 5FHTA 1Z8JB 3A87A 2OTVA 2NU0E 1NZQH 2JH5D 3H7OA 1QHRB 1J8AA 1AZ8A 1KLTA 1GJCB 3QZRA 5GDSH 3LOXA 2BZ6H 4ZKNU 3FP6E 1CQQA 3PMJA 2PSXA 1YPJH 3PMBB 2G55A 3QZQA 2I6QA 3RMOH 1ZYOA 3ZZ5A 1E38B 1O0DH 1N8OB 2B5TB 5GIBA 3MO3A 2PUXB 1G3CA 5AHGH 1SQOA 3NKKA 1O3BA 1D3PB 1V2WT 4WXVA 1F0UA 3RXOA 4ABFA 4K69A 3ZVEA 5GWZA 1YC0A 3TITA 1C2KA 3SI3H 1HAZB 1BTXA 3MNCA 2ZNKH 5E0HA 2SNVA 5JBAS 1AB9B 5C3NA 1O33A 2A2XH 2AH4X 1ABIH 4Y6DA 3A88A 4BAHB 1EATA 3V7TA 4O9VA 1T4UH 5FPTA 3ZVAA 1QBNA 1SGQE 3SI4H 1C4U2 1KXAA 2ZGHA 1V2VT 4JCNA 5JB9S 1TB6H 4B75A 1DWDH 4K1TA 1P06A 2BD8A 1C2LA 4NG9H 2GGVB 1OKXA 1O3LA 5HYOA 2A32A 3MU0A 1AVWA 2ODQA 2C90B 1G3EA 2AGIX 1BBRK 2IOTA 2CF9H 2G5NA 2STAE 1LKBA 3TJNA 2A4QA 4UFFH 2JKHA 4ABJA 1QA7A 2Y5HA 1EOJA 2BD7A 4MDSA 4D8NA 1MKWK 1EJNA 4KTUA 1V2QT 2A7HA 3SU6A 1B5GH 3M7QA 3MNSA 1C1TA 1O3IA 2BZAA 1YKTA 1AZZA 2K1QA 1O2JA 3UUZA 2QXGA 3RC5A 1D3DB 2CN0H 3ODDA 4RKJB 5EPNA 3Q3XA 3M3VA 2DE9A 1G3DA 1H8IH 1WAYB 4MPWA 4AB8A 1C9TA 1C5RA 4CHAC 3U1JB 1TX7A 4I31A 2QIQA 1O2SA 1C1UH 2ASUB 2BX4A 2GTBA 4YOGA 3A7VA 1FY3A 1GCDA 4AOQA 2VVVA 1ZTJA 4Y79A 1C4Y2 1UMAH 1TGCA 1S5SA 1FY5A 1EAUA 1TMBH 1GG6C 1O3NA 4X1SU 1QFKH 3S69A 5SGAE 2H5DA 3PWBA 2I6SA 3FZZA 2FDAA 2GZ9A 1DOJA 2WPLS 2YNBA 2B7DH 3F68H 4FU8A 2AIQA 1S83A 2FODA 3ZZ6A 3T29A 1HAGE 2VIPA 1QJ6B 2B8OH 2Z9LA 5GPIB 2FTMA 2FXRA 2ZDNA 2BDGA 5A09A 1AU8A 1GI9B 2XCNA 1TPOA 1MD8A 2WPMS 2FS9A 3RU4D 2J9NA 1ZRBA 1O30A 3GYMA 1DITH 3TJOA 2FOGA 4ZHAA 3URCA 3RC4A 3BF6H 3ZZ9A 2G5VA 2BY8X 4FU9A 1C9PA 1MD7A 1ZRKA 3S9BA 3FANA 2Q6FA 4ASHA 2ZGBH 2VIOA 4GUXA 1AB9C 1HAIH 1GBFA 1DICA 2D8WA 2FMJA 4YOJA 1UTNA 2Z3CA 4I8HA 1MTUA 1LVYA 1ZPZA 5J4SA 2RCEA 1KY9A 3DHKH 1ETSH 3FFGA 4Z6AH 1WSSH 2QXHA 1NT1A 3A86A 2F9VA 2CXVA 1NFYA 2XBWA 1O2YA 3BTGE 1FIWA 1GJ8B 4MNYA 2VWOA 3LC5A 1O2IA 2ZHEH 1EPTA 2A7JA 2XBYA 2Z9JA 4F49A 5EQSA 2FZZA 3AW1A 4UE7H 3RXVA 2ANYA 1J9CH 3UOUA 3UNRA 4ISOA 7ESTE 2WYJA 1WUNH 1G37A 2A5AA 1GI1A 4NA8A 1TRNA 3TNTA 4SGBE 1C5LH 1CA8B 3MH6A 4ZKOU 3D65E 2PKAA 2ZDLA 1SMFE 3MWIU 4BAKB 1C1OA 5A8ZA 2XTTB 1PPGE 1GBHA 3UOPA 4HI3A 2FOHA 4BTUB 3U8RH 1ELCA 3ITIA 4IS5A 5G4BA 1O2KA 3ATLA 1Y5UT 4TPIZ 3QX5H 1DSUA 1GJ6A 1MKXK 2IPHA 2FM2A 2C3SA 3MI4A 1C2GA 1QIXB 1W0ZU 2CV3A 2F91A 2ZPRA 2OQ5A 3GYLB 1A61H 1GJ4H 1OWIA 2BLWA 1G3BA 1JWTA 5FPSA 1SGTA 5B6OA 2BQ7B 2W7UA 4H6TA 3ZZBA 3SHCH 4CRCA 2UUYA 1GBTA 1CO7E 3RXCA 2ZF0H 2WPKS 4FUHA 2BDYA 1L1JA 3RXMA 5GCHF 2PTNA 3S7KB 1P09A 4TY7A 2GV7A 2GT8A 1LHFH 3RXTA 1S0RA 3H7TA 8GCHG 1T7CA 4DURA 1N6YA 1GI8B 4YOIA 1GMCG 4NZLA 4KGAA 1FONA 2SGQE 2HLCA 2GP9B 3SUGA 1UVSH 3SUFA 1IQLA 1CVWH 1GL1A 3GY7A 3A7WA 3QGNB 1O3HA 1SGIB 1BDAA 1UVTH 1O5CB 2AIPA 1ELVA 1TWXB 1BTPA 2GV6A 1SHHB 3MNXA 1AVXA 2F3CE 4B73A 1KXCA 1PPBH 4U2WA 1C1SA 1VJ9U 1UTQA 5LPEA 1YLDA 5K7RA 1PPZA 1NFXA 2H5CA 3PWCA 1TOCB 3SV2H 2H9TH 1BTHH 3MO6A 4FUFA 2VIVA 3RXHA 1HIAB 1MKXH 1TMTH 2J4IA 3T26A 4WY3A 1QRZA 1SGFG 2B0FA 2SNWA 1Y3YA 1LPGB 1L0ZA 2Y5GA 4WJG2 4JK6A 3RUOA 5A0AE 2H6MA 4NGAH 3SV7A 2XBXA 1GHZA 3STIA 4BOHA 1GHBG 4BAQB 1TPPA 1KLJH 2PHBA 4ABGA 4THNH 4Y7BA 1XUJA 1PQ7A 2P59A 1O2HA 1PPHE 1Y5AT 1ELDE 1PQ5A 1PYTD 1ZGIA 2GT7A 5E2PA 3V3MA 1TNHA 2IJOB 3ZZ4A 2ALPA 4MG3A 3VB4A 3TPIZ 2FO9A 3GY2A 1HGTH 2ZGJA 2ZG0H 1GBDA 1ZOMA 1KSNA 1Y3WA 5EU8A 3RMMH 2CF8H 3UWJH 3DFLA 1DFPA 4ABBA 4GHTA 1K9OE 1SHYA 2PTCE 1SI5H 4X1PU 2VWLA 2QV1A 4D7FA 2TGPZ 3B23B 3SU2A 2BXUH 1P02A 1DWBH 2G00A 1O3CA 5ESBA 2EA3A 4NIYA 1Q2WA 1MQ5A 2BDBA 1GGDB 3NZIA 3FAOA 1GMHF 2VU8E 2ALVA 4KKDA 1TBRH 2H9EH 1O2RA 2D26C 1PPCE 1O3FA 1HAHH 1OYQA 1OXGA 1UHBB 1HBTH 3Q3KA 3RXQA 2ZI2H 4D9RA 1P03A 3LGUA 3LH3A 1SGNE 2ZIQH 3PMHB 4FXGH 2SGAA 5C67A 1EASA 1P2MA 4ZMAH 2BLOA 4NSVA 8KME2 1ESBA 2BQWB 3BTTE 1C2IA 1O5AB 1GJ5H 5AFZH 1OWDA 3LONA 1NRRH 1UVOA 2AERH 1YPGH 1CU1A 1S81A
chains in the Genus database with same CATH superfamily
1OWHA 1QY6A 2GVFA 5DSFA 2OC1A 1ELGA 2HNTC 2WV5A 5T3HA 2KR7A 3MFJA 1MCVA 3UR6A 4ABHA 4A6LA 3U28C 4U30A 3EA7A 1E34B 2GKVE 2G8TA 1TE0A 3BIUH 2GD4B 3K2UA 3SU4A 2A5KA 3PV4A 1QBVH 3ESTA 1BMMH 1Y3UA 1W11U 3GY4A 3RXRA 4KTSA 3UNQA 1MMJN 1O37A 2F9UA 1S6FA 1TGTA 5T6FA 5LPFA 1ANCA 1SPJA 1F2SE 3SZEA 2RFKC 6ESTA 9ESTA 1YY3A 4AFZA 1XUGA 5DPAA 3A8AA 3SJIA 1BT7A 5HM2A 4DIIH 3TGKE 2Y7ZA 3A8CA 3E3TA 1C2HA 1G36A 3TGJE 3GDUA 1GPZA 2Q1JA 3EAJA 3CP7A 1PYTC 4AG1A 3GDSA 1NRSH 4X8VH 4JYUH 3CENA 2BHGA 2K0QA 3SZNA 4DY7B 1EP6A 1BZXE 3TNSA 2BD5A 1LHCH 1RXPA 4NSYA 2J2UA 2R9PA 3MMGA 2DE8A 3SNBA 5JYIA 2WYGA 3RXGA 1GJ7B 3KQBA 1MU8B 5A0BA 3M5OA 4A92A 1SFQB 3U8TH 2LPRA 4WH8A 1DXPA 2F4LA 3EA9A 4INHA 3F9HA 4H42U 1TGBA 1C5WB 1OX1A 1KLIH 2ZFFH 3A89A 1SG8B 1ETRH 3P8GA 1ZR0A 1GDNA 2SGDE 5FL7D 1D3TB 4XBCA 1WOFA 2QY0B 1A4WH 1THSH 1YYY1 2BLQA 2OP9A 2JH0D 1WU1A 5BPEA 3LU9B 4X2XA 2J95A 1C2FA 4Q7YA 2AMDA 1WYKA 5HGGA 1MZAA 3TVJB 1K1NA 1CA0C 1GJAB 1U6QA 1QL8A 2C4FH 1C1QA 1W7XH 1HAYB 1Z8RA 1CHOF 2C8ZB 1SQTA 1GGDC 1KDQB 2B9LA 1NY22 3ATIA 2STBE 1V2UT 1W13U 1T8OA 4K2YA 3L3TA 3FO8D 1O3GA 1W0YH 6CHAC 4DOQA 4Q63A 5EW1H 1YPEH 1BJVA 1O35A 4HGCA 4B2AA 4CHAB 4E7RG 1O3EA 3BG8A 3W94A 2AEIH 5DP3A 1K0HA 1LDTT 1QRXA 4NZQA 3UB0A 4I8GA 3ZV9A 3SGQE 1AI8H 1A2CH 3QUMP 4Z0KA 4RSPA 3F6UH 4R8TB 4IC6A 1KYNA 2HOBA 3RDZA 2ZA5A 2ZGCA 3GDVA 5JBTA 3RXJA 2GMTB 3T2NA 4YLQH 3QTVH 1VITH 1AHTH 1G9IE 1FUJA 2A31A 1Z7KA 3EGKH 3PB1E 5DN6D 3N7EA 1C5UA 2A4OA 1O3PB 3M3SA 4UFGH 4CH2B 5C17A 4K3JA 1TNIA 2CGAA 3Q3YA 1ARBA 1EPTC 1GI7B 4YT7H 2BOKA 1CSOE 1KXBA 2P3FH 2XYAA 1NBME 3BV9B 3S9CA 2RA3A 1Z6JH 2Y82A 4YXWD 1DY8A 2Z6BD 2BDIA 3MU4A 2SGEE 3AW0A 4D76A 4WH6A 1DS2E 5C94A 3Q76A 5E8EH 2XXLA 1BMLA 3CS7A 3HPTB 1O2MA 4AFUA 3EYDA 1QA0A 2HPQH 1LCYA 2FLBH 2XWBI 4LK4A 4CRAA 4DVAU 1E35B 1QJ7B 1EJMA 3GCTF 3QTOH 4FETA 3VXFH 2EEKA 1ELTA 1HXFH 4GAWA 1V2RT 3O8DA 3TK5A 1TYNA 2FS8A 3C1KA 4ZXYH 1OWJA 1P05A 3M36A 1BRBE 1SB1H 4ABIA 4FUBA 1Z8IB 2M2AA 3E0PB 4B1TA 2OC0A 1J15A 1GI4A 2R2MB 1EUFA 3T28A 3P17H 3U8OH 2BYAX 5A0CA 3STJA 1XUIA 4FVDA 1ZHMA 2BD4A 3SV9A 1HV7A 1YCPK 2ZFQH 1L1NA 1HYLA 2VIDA 3PLBA 4WXIA 3FZDA 5DK1A 1C5QA 3ZV8A 4ZKSU 1DUEA 1BRCE 2XNIA 2KAIB 3BTFE 1TFXA 1PQAA 1AQ7A 2ZGXH 1ZZZA 3PLPA 1W8BH 1P2JA 3M61U 3FVFB 4ACBA 2A4GA 1E79D 5AF9H 1GBAA 2TGTA 2XOKD 2C8YB 2GZ7A 1ANEA 1WBGB 2BXTH 1XKAC 3NWUA 4WWYA 1KXDA 4AYYB 3P8OA 4GCHF 1EAXA 1MH0A 3ELAH 4UEHH 4JZEH 1SGEE 4UONA 5E0JA 1K21H 3BIVH 2F9PA 4AGKA 3V12A 1XVOA 2F9NA 1GBMA 1WV7H 1COWD 1Y3XA 2BY6X 1LHGH 1O32A 2HNTE 1F0SA 1V2TT 1QB9A 2BY5X 1MCTA 5I25A 2Z94A 3GY3A 5F8XA 3TK6A 1K1PA 1SLXB 3PRBA 5CHAC 3LT3A 2VIQA 5FPYA 4TYDA 1H8ED 2TGAA 1ELFA 1FI8A 2CMYA 2H2ZA 1LPKB 1NRQH 1Q3XA 2J98B 2ZFTA 3KQDA 3SJKA 1ID5H 1XM1A 2ZHFH 3HKJB 3MNBA 1IAUA 4MPXA 1GL0E 4H6SB 1D6WA 1VCQA 5HMAA 2P3TB 2QN5T 1TA6A 2OK5A 2BM2A 4BXWA 5EW2H 3O8BA 2NU4E 2GMTC 1AO5A 4LOYH 1P0SH 5TCCA 1ZMNA 1YCPH 4B6FA 1C5MD 1TA2A 1BTUA 4J1YA 1HDTH 2A0QB 5C0TA 1F5LA 1F0RA 1BITA 1C1NA 1W0KD 1EZXC 4XBDA 4DJZB 4TT3D 1FAXA 3SO3A 1JXPA 2OUAA 1HAVB 4Y11E 2BOHB 1UVUH 1J17T 3ENSB 1QRWA 2ZZUH 2HLDD 4X8SH 1M9UA 3UNSA 1GVZA 3F3BA 1A0LA 1P01A 1T31A 1S6HA 2GDEH 1SQAA 1W10U 3P8NA 1S82A 2IN2A 4CR5A 3DD2H 1P3EA 2PSYA 4LZ4B 2AHME 2JH6D 2YOLA 4WMDA 4B2BA 1LO6A 2FIRH 3MTYA 1ZMLA 1RFNA 4IMQA 4JZIA 3A7YA 1UVPA 2OC7A 1L4ZA 4H4FA 4FUIA 4X0WU 2IPQX 3ZZCA 3LGTA 3NXPA 1VITG 1C5NH 1DPOA 1T8NA 5GCHG 1V2JT 3RLWH 3KQCA 1AMHA 3KNXA 3NRLA 5ABWA 2ZU5A 2ZQ1A 3RXEA 1CBWC 4K1SA 1FZZA 5F8TA 1HCGA 4DG4A 1DE7H 1GHVH 1LVBA 2TBSA 3HKIB 4K1EA 2UWOA 1PJPA 4FOUC 3RU4T 4TY6A 3M7TA 3GICB 1VR1H 5FAHA 1YPLH 1YM0A 4NIWA 3SORA 1TOMH 1SLWB 1O5GH 2QE7D 1S84A 1BHXF 1IQGA 3M37A 3SUEA 2EC9H 2HWLB 1SGFA 5ETXA 1A0HB 2O9QA 1BJUA 3UFAA 1YPHE 4NCYA 1O2GH 1NFWA 2AYWA 4BTIB 2A4RA 1TLDA 1GI5A 2RDLA 3IITA 1BHXB 5EOKA 1GBEA 1QCPA 2UUKB 3ZYDA 5FCRA 3H09A 1DLKB 3N7DA 1AIXH 1EX3A 1HJAB 3DSOA 4FUCA 4OGYA 1DUAA 4YTAA 1HJ8A 1H8HD 3A83A 1BRAA 1NU9A 2DUCA 1DM4B 3P92A 1O2PA 1XXFA 1F7ZA 1O3DA 1CT0E 2BDCA 3OTPA 3EE0B 1HRTH 3U69H 5JPMH 3B9FH 1A1RA 4CREA 1JBUH 2W7SA 1TQ0B 2HNTF 5CMXH 1K1OA 4X6MA 1EB2A 2HALA 4WVPE 1OYTH 1J14A 3QK1A 1VITF 1SLUB 4X8UH 3SU0A 5JB8S 4CR9A 2FLRH 2VGCB 1VKYA 4RI0A 1B0EA 2FOEA 1YP9A 1LHEH 1F5RA 1AGJA 3RXSA 3RXAA 1WCZA 1YLNA 2W3KA 1O2OA 3TH4H 1A0JA 3QN7A 1V2OT 1V2ST 1GBKA 5E0GA 2ODPA 5HIZA 2OBOA 4IGDA 1INCA 3GS9A 4ZKRU 2LELA 3U1IB 2AFQB 1BBRE 2OXSA 3KIDU 1H9IE 4GPGA 2GX4A 1FY1A 1OPHB 1EB1H 1RGQA 1GHWH 1TABE 3KHVA 3TIUA 3RM0H 2R0KA 1GMHG 4ZROA 3PRDA 3SGAE 4YZUA 3LH1A 4UFDH 5C1YA 4MNXA 5A8YA 2R3YA 1NC6A 1TNGA 5K0HA 1KTSB 4E05H 1EAWA 2Y80A 2QF0A 4RN6A 5EGMA 3E90B 5IK2D 2Y5FA 3OYPA 4AYVB 1O2QA 1AY6H 2FOBA 4JK5A 4CBOA 3VEQB 1T8MA 3T25A 3LJJA 1GMDF 6GCHF 4JZDH 4AGJA 3LGWA 4XOJA 3K6YA 3M5LA 3NK8A 1TRMA 4XBBA 1EAIA 7KMEH 4MNVA 1CGJE 4FUDA 4KTCA 3U98H 3EQ0H 3I29A 1G2MA 5E2OA 3TU7H 4HG6A 4HFPB 2A5IA 3BEFB 1VZQH 2FPZA 4K8BA 5TJXA 1HAPH 3GCOA 2F83A 3O8RA 1C5PA 1UJ1A 3AAVA 1AE5A 3MOCA 3LDXH 1O34A 5EXLA 1A5IA 2ZP0H 1QB6A 1GHXH 2AMPA 1Z8GA 2Q6DA 3SJOA 3OU0A 4BAOB 3H5CB 4HZHA 1AUTC 1K1MA 3ATKA 3W95A 2F9OA 3ZZAA 1C1VH 1BOQA 4Y8ZA 1CA0B 1ZGVA 3K6ZA 3SQEE 1JIRA 1C4V2 2J97A 1BA8B 7GCHF 1K1IA 1P57B 3GY6A 5TCAA 2ANKH 1OP8A 5LGOA 2WUCA 1TONA 1NM6A 3L33A 1HJAC 5EG4A 1ETTH 4M9FA 4DGJA 3ZZ7A 4QT8C 2BMGB 4X2YA 1JIMA 5EPYA 6CHAB 1PPEE 1SGPE 1FNIA 1O2ZA 4XRNA 2W6ID 3MYWA 1OWEA 2G4UA 2Z9IA 1SGDE 3ZZ3A 1L1GA 1GHAF 2Z7FE 5I46H 1H8DH 5L30H 1L2EA 2XCFA 2BY7X 3K65B 2PR3A 3ZVFA 4YM9A 3RM2H 5AVDA 3RP2A 1IQMA 3OE7D 2V7QD 4OS1A 5C2ZA 1X7AC 2VGCC 4TPYA 3CS0A 1SGCA 3A82A 1P8VC 4INKA 3P8FA 2VBCA 4M7GA 2BB4A 1V2LT 4HTCH 4FVBA 1UTLM 1LQEA 3PLKA 1BTZA 1CT2E 4ISHH 3VFEA 1LHDH 1XUFA 1SOTA 5DP4A 1EJAA 2ZO3H 2V3OH 5JDUB 2QXJA 3E0NB 1CHOG 2FWWA 3A81A 2WPJS 1P9UA 4IBLH 2WV9A 3TK9A 1C5OH 1EPTB 2UUFB 3P95A 3QWCH 1SQRA 1EP5A 4FU7A 1OSSA 2SGFE 2ZU1A 1UCYE 5FBEA 2PGQB 1Z1JA 2GCHF 2PKAB 5L2YH 4YLUA 3SOSA 1RS0A 1DDJA 1MQ6A 2FI3E 4NA7A 1SC8U 4Y71A 3RMNH 1LKAA 3NCLA 3JZ2B 1O39A 1FDPA 3M35A 8LPRA 2HVXA 1HNEE 3R0FA 5F6MA 2ZCHP 1RIWC 1TRYA 2BD3A 2FYRA 3BEUA 2ANMH 1H1BA 1P12E 3SGBE 4E06H 2PUQH 2Z9KA 2C8WB 1NN6A 2D2DA 3SV6A 5DO4H 1P2QA 4AFQA 2ANWA 1SLVB 1JMOH 2BX3A 3LC3A 1GJ9B 2K8IA 1VGCB 3DFJA 2A7CA 2VNTA 1UK2A 5FBIA 4NFEA 1Y59T 3PV5A 1YWUA 1AFQC 3F1SB 1FLEE 4AG2A 2ULLA 2EI7A 4A5TS 1FXYA 1W3CA 4B71A 1QB1A 2Z3DA 3TH2H 3LIWA 3TLOA 3ZIAD 2ZDVH 2W26A 2ZU2A 3SN8A 4UDWH 4R0IA 1TGNA 1WXRA 1O36A 1EKBB 4WMFA 1KIGH 1IQEA 5A8XA 3GCTG 1AKSA 2KFWA 3O8CA 2HGTH 1ELEE 2VVCA 1C1RA 1MBMA 3SW2B 2G81E 4KP0A 2QAAA 5FCKA 3KYFA 4K8YA 1UK3A 5DP9A 5CHAB 3M5NA 4XE4A 3EDXB 5J4QA 4Q4LA 3K9XB 3RXBA 3BTME 4Y0ZE 3WW7A 3MHWU 1A3BH 1YPHC 2XW9A 5DKMA 2P8OB 3WWBA 1UTKA 4NIXA 1ZPBA 2O8WA 4TWYA 5F53A 5JBBS 4BXSA 3AASA 5EIYA 1ESAA 2G52A 4UD9H 1O2WA 2ZDMA 1RD3B 1SFIA 1THRH 1MTNC 1V6DA 2FOMB 4MQAA 2FESH 1DT2A 1GI0A 2AS9A 3AVZA 2EI6A 3RXUA 2PKSB 4F55A 3KN2A 2ZTZA 4UFEH 2H9HA 4A1XA 1E0FD 4IC5A 1GCTC 1DANH 4GCHG 1RJXB 4AZ2B 3WY8A 1P2OA 3ATWA 1IQHA 4WMEA 1GBCA 1Q31A 2O8MA 1XKBC 1W7GH 1V2PT 2V3HH 1ACBE 1GJDB 1Y3VA 3VB5A 1C5XB 2ZECA 3LJOA 4Y8XA 4NWKA 1MTSA 1TALA 2QYIA 4B76A 3BTKE 1GHYH 3HGNA 1O2VA 5C1XA 2VJ1A 1MU6B 3BTEE 3T5FH 1TBZH 2OQUA 2QF3A 5HM9A 2GCTB 5FX6A 1OS8A 3DA9B 3A7ZA 1K22H 3D23A 3QDZB 1MTWA 1SL3A 2TIOA 1D9IA 5EXMA 5T6DA 2FP7B 1FPCH 2WINI 4Y10E 1CGHA 2JIZD 1GI2A 4E7NA 3D62A 4FUJA 4LXBH 5HKKD 1YF4A 2P93A 3PROA 2V35A 4X8TH 1BB0B 4Y8YA 4MNWA 3S7HB 2FI4E 4OS6A 4O3TA 2BY9X 2AGGX 3LGVA 4ZAEA 3F2GA 3PV2A 2VH0A 2XC4A 3QGJA 1GWAA 4ZUHA 1CBWB 1Z1IA 1TQ7B 1G2LA 1E36B 1ELAA 1AWFH 2P3UB 1IHTH 1Y8TA 2NU2E 5EXNA 1VGCC 5GNDA 4NA9H 4ISIH 3HATH 1CT4E 4U01A 1W12U 1YPKH 3SV8A 1C5ZB 1ZTKA 3NPSA 2XWAA 1ZSLA 2JJ2D 1XMNB 1C5VA 3G01A 3I78A 5EQQA 2WPIS 1QNJA 1D3QB 5FX5A 4XDEA 4I7YH 3BTQE 3GOVB 2FOCA 4RT1A 1V2KT 1F5KU 1N1LA 2JJ1D 3LGYA 2YNAA 1JOUB 1DSTA 2UWPA 1IQJA 4ISLA 1FN8A 2J5UA 1TBQH 2V6NA 5DP7A 1FV9A 1MAXA 5C5OA 1CHGA 1DVAH 1TIOA 5DP8A 4Y76A 1E37B 4AB9A 1BTWA 3MH5A 4Q80A 4A1TA 4IMZA 1C5TA 3S0NA 2ZU4A 5PTPA 1W2KH 2V3MA 2ODYB 1NTPA 1B7XB 1HAXB 3QO6A 4ZXXH 2FX4A 4Q7ZA 4VGCB 1TX6A 3EA8A 1LMWB 1IQKA 1YGCH 2Q6GA 1QBOA 5EJLA 2ZC9H 1HIAA 4YT6H 3Q00A 4IN2A 3A80A 3BSQA 1D6RA 3OX7U 2ZPQA 2BTCE 4OGXA 1TX8A 1MABB 2FX6A 2P8OC 5A2MH 3Q77A 4X6PA 1H9HE 1UTMA 2XBVA 1GVLA 4MVNA 1GDUA 2PFEA 3UQOA 3RC6A 3KQEA 3BTWE 1O38A 1XVMA 2O8UA 2Z3EA 3M7UA 4WF8A 3SNEA 2PKSC 2VIWA 1XUKA 1E1QD 2WPHS 2W5EA 1NU7B 2P94A 2P95A 1HFDA 1NRPH 3ODFA 3E8LA 1TNKA 4YO9A 1EZSC 2Y7XA 3RXFA 2PLXA 2OLGA 1VCPA 4F4OC 4X6NA 1P2NA 1NO9H 1IQFA 1GVKB 3PM3A 1ANBA 2A45B 2GCTC 1A3EH 2OC8A 1FAKH 1LTOA 1KTTB 1YLCA 4YESB 4ABDA 1THPB 3A8DA 2P16A 4GHQA 2EQNA 2VH6A 5ESTE 1BBRH 1O31A 1SBWA 4ABAA 1C5SA 1AKSB 1N8OC 2J92A 1D4PB 2ZHWH 1C2EA 1CGIE 1MKWH 1UHBA 1DLEA 4K5ZA 8ESTE 1O3MA 1A46H 2YMSB 3N7OA 3LKWA 1G30B 3WWFA 4XSKU 1QQUA 2KCYA 5EQRA 1F0TA 5DGJA 3LPRA 1QTFA 2BLVA 2FEQH 2PP6A 4P02A 3OEHD 5IYTA 2CK3D 4X6OA 1C1WH 1MZDA 1T4VH 2BDHA 3EE7A 3RXDA 5LPRA 2ILNA 2YMSD 1NBMD 4IN1A 3IWMA 2FTLE 5DG6A 9LPRA 1NFUA 1ZJKA 2VB0A 1UO6A 2ZCKP 1BQYA 4ZCNA 5JBCS 4I8JA 1BMNH 1DWCH 1NROH 3ZVBA 1AVGH 2A2QH 2WUBA 1SOZA 3RMLH 1BCUH 5T6GA 5HXFA 4Y7AA 1O2NA 2AMQA 4ACAA 3PTNA 2QXIA 1GDQA 2ZKSA 2ZHQH 2TGDA 1QL7A 4Z1MD 3P6ZB 1GMDG 2BD9A 2FYQA 3B8JA 6GCHG 2KCAA 1KXEA 3MH4A 1SR5C 1BIOA 1GBJA 4KELA 4Q2KA 5AFYH 1ZTLA 3U9AH 1P3CA 3V13A 1FMGA 3URDA 4I8KA 4VGCC 3ZZ8A 4A1VA 3AAUA 1ZSJA 4BNRA 1UCYK 5L6NH 1A7SA 5T1VA 4AX9H 3MH7A 4TWWA 4O97A 3SNAA 3T62A 1S85A 3TGIE 4GVUA 3FP7E 2ZWLH 2H1UA 3OY6U 5BRRE 1SVPA 2J94A 1O3OA 4BAMB 1B0FA 1ABJH 4JYTA 3TH3H 2VINA 1G32B 3PO1B 4OS2A 4Q7XA 4NWLA 3OSYA 4ISNA 2VWMA 2ZPSA 1FX0B 4O3UA 3MQKC 2GDDA 2ZU3A 3BTHE 1WTGH 1V2NT 3W1EA 3F9GA 3NUMA 3ATMA 3UQVA 4X2VA 1UTJA 4DIHH 1HPGA 3KGPA 1O2XA 4J2YB 2QC2A 7GCHG 4LZ1H 3ZZDA 4CRFA 1DWEH 1ZHRA 1PFXC 3A84A 1RRKA 3HK3B 2Z9GA 1EFRD 3SJ8A 1NRNH 1N6XA 2SGPE 3RXLA 3R3GB 4A7IB 4SGAE 2SFAA 2XC5A 1V3XA 3IG6B 2AGEX 1A5GH 1KMHB 1IHSH 4I8LA 1UTOA 3MU1A 1JRSA 3M5MA 1AE8H 5GJ4B 1JRTA 1EQ9A 1VJAU 2WPDD 1BUIA 1GHAG 1KDQA 1TPAE 2UWLA 1QGFA 1FJSA 3GY8A 3LGIA 3PYHA 5FXLA 5HIYA 3RXPA 3KF2A 5C1UA 1BMAA 1K2I1 1V2MT 2C8XB 4CRGA 4D9QA 1C5YB 1HJ9A 3HK6B 4K60A 2L74A 3T27A 4NIVA 2HPPH 1RIWB 3GISB 1WDIA 4MTBA 2VWNA 3ZYEA 1O3JA 1UCYH 2A1DB 5KEDA 2YMSC 2QA9E 3F0PA 2XNDD 3UTUH 7LPRA 1GJBB 4CBNA 2FI5E 3GY5A 3D49H 6LPRA 1EOLA 1H4WA 2NU3E 3SNDA 2OBQA 4FUGA 1HAOH 3DT0H 1LPZB 1RTFB 2CHAB 4ZHMU 2JETB 3MU5A 4JYVH 1QQ4A 4DCDA 1DXWA 3AK5A 1VCWA 1ZLRA 2ZEBA 1OP0A 1AFQB 1Z6EA 1PPFE 1TNLA 3QLPH 4GLYA 1IOEA 3A8BA 3TJVA 2TRMA 3A85A 4P00A 1EZQA 2QF5A 1MUEB 3UR9A 1TPSA 1FPHH 1HXEH 4Y0YE 3VG8A 2IJD1 1LVOA 2R0LA 2ZDKA 3UREA 1DY9A 2GCHG 1LVMA 3OY5U 1J16A 5GXPA 2KCPA 3PTBA 2UUJB 4AFSA 1UK4A 2Y6TA 2RDEA 4INLA 1IQNA 4B6EA 3DUXH 1ZPCA 8GCHF 3KEEA 1GMCF 2OD3B 1ANDA 3RXIA 1O3AA 2G51A 2RG3A 4RKOB 1RTLA 2ZTXA 1BMFD 1QURH 1OOKB 2BDAA 1WQVH 3VPKA 5C20A 3OAAD 4AN7A 1EZUC 4X1RU 3P70B 1TMUH 3DSGA 1W14U 3FKSD 1FIZA 1ORFA 1T8LA 3E91A 5LH8A 1GBBA 3A7TA 4ZH8A 1P10A 3ZVDA 2J38A 1O5BB 4JZ1A 3PO1C 4AORA 1XUHA 4DT7B 1AD8H 5DP5A 3E1XB 1MBQA 3KL6A 1MTNB 2PV9B 3SU1A 1H9LB 3UY9A 1GI6A 2OCVB 1AWHB 4X2WA 4TSFD 1AN1E 1NESE 2ZCLP 1A5HA 2D1JA 2BVRH 3SJ9A 2HRVA 1GCTB 3BG4B 3KCGH 2KAIA 1CE5A 2W6JD 1BRUP 1RTKA 1ZSKA 2O8TA 4BANB 2LP6A 3GCHB 1FY4A 1OWKA 1GBLA 3VGCB 2Y81A 1QR3E 1LQDB 1GHBF 1WTHD 2R3UA 1TAWA 1FY8E 1S0QA 1ZHPA 4I32A 2EI8A 2ZDAH 1ESTA 1P11E 1BTYA 2PGBB 1EXFA 1ZMJA 3UWIA 1TNJA 1YBWA 5H4IB 4OS4A 2ZHDA 1FN6A 3A7XA 3ZVGA 3BEIB 3SQHE 4ZHLU 2KM0A 1IQIA 2QCYA 3UPEA 2VVUA 1Y5BT 1DX5M 3V0XA 3GCNA 3HGPA 4OS5A 1F92A 4OS7A 2R2WU 3OTJE 2O8LA 1XXDA 3BN9A 1GBIA 3SHAH 4PROA 1KXFA 2ZQ2A 1AFEH 2OINA 5DP6A 2ZFSA 2ESTE 1C1PA 1UW7A 3SU3A 3SU5A 1MAYA 3RLYH 4I33A 3F9EA 1O2LA 1NPMA 1O3KA 4BTTB 4XFQA 1YCPM 2CHAC 2J98A 2JETC 3L6PA 1C1MA 2THFB 1WQSA 1O5FH 5F8ZA 3JZ1B 3BTDE 4ABEA 1AUJA 1P2KA 4ESTE 1ZJDA 1K1JA 4CRBA 2QGRA 5C5NA 1L4DA 2M5TA 1QJ1B 2PW8H 4MPUA 3VB3A 3S9AA 2FOAA 1HAVA 4MPVA 4X1NU 5EODA 1YPMH 2XC0A 2ZTYA 1C2MA 2CJIA 4CRDA 1K28D 2BVSH 1ELBA 1HB0B 2W3IA 1HLTH 2BQ6B 4CH8B 2G4TA 3SUDA 4D7GA 1P9SA 3SBKA 4O03A 1K1LA 4MLFB 1NS3A 1SGRE 4X1QU 3F9FA 1HUTH 3PMAB 1TGSZ 5CE1A 3VB7A 1QL9A 5KECA 2RA0A 2BVXH 3F0OA 3MO9A 4NFFA 2NU1E 5IDKA 1MTVA 2V0BA 1SGYE 1C2DA 2F9BH 3E16B 2NWNA 3RXKA 3RU4E 1UTPA 1P2IA 1T32A 3C27B 4JZFH 5B6LA 3TJUA 2JDID 1O5EH 1FQ3A 3FP8E 5DJ7A 4IW4E 3M3TA 1SSXA 1ARCA 1XX9A 1O5DH 3MU8A 5F03A 2J34A 2BD2A 2C93B 4B74A 3E6PH 2XRCA 2LNCA 3BG4C 3I77A 3UIRA 1P04A 4GSOA 3ZVCA 2FOFA 1O2TA 4JMYA 2ZFRH 2WV4A 1O2UA 1GG6B 3GCHC 3VGCC 3VXEH 4DW2U 3SNCA 1Z71A 2PWXA 1PQ8A 2TPIZ 4U32A 4B2CA 3VB6A 1OP2A 1C2JA 3F2FA 4FUEA 5L2ZH 2GZ8A 1GI3A 2ZFPH 5FHTA 1Z8JB 1S6LA 3A87A 2OTVA 2NU0E 1NZQH 2JH5D 3H7OA 3DCLA 1QHRB 1J8AA 1AZ8A 1KLTA 1GJCB 3QZRA 5GDSH 3LOXA 3KQ5A 2BZ6H 4ZKNU 3FP6E 1CQQA 3PMJA 2PSXA 1YPJH 3PMBB 2G55A 3QZQA 2I6QA 3RMOH 1ZYOA 3ZZ5A 1E38B 1O0DH 4ASUD 1N8OB 2B5TB 5GIBA 3MO3A 3SYJA 2PUXB 1G3CA 2EY4C 5AHGH 5EJ1A 1SQOA 3NKKA 1O3BA 1D3PB 1V2WT 4WXVA 1F0UA 3RXOA 4ABFA 4K69A 3ZVEA 2WZQA 5GWZA 1YC0A 4AC9A 3TITA 1C2KA 3SI3H 1HAZB 1BTXA 3MNCA 2ZNKH 5E0HA 2SNVA 5JBAS 1AB9B 5C3NA 1O33A 2A2XH 2AH4X 1ABIH 4Y6DA 3A88A 4BAHB 1EATA 3V7TA 4O9VA 1T4UH 5FPTA 5KGOA 3ZVAA 1QBNA 1SGQE 3SI4H 1C4U2 1KXAA 3N99A 2ZGHA 1V2VT 4JCNA 5JB9S 1TB6H 4B75A 1DWDH 4DT4A 4K1TA 1P06A 2BD8A 1C2LA 4NG9H 2GGVB 1OKXA 1O3LA 5HYOA 2A32A 3MU0A 1AVWA 2ODQA 2C90B 1G3EA 2AGIX 2WHXA 1BBRK 2IOTA 2CF9H 2G5NA 2STAE 1LKBA 3TJNA 2A4QA 4UFFH 2JKHA 4ABJA 1QA7A 2Y5HA 1EOJA 2BD7A 4MDSA 4D8NA 5C0UA 1MKWK 1EJNA 4KTUA 1V2QT 2A7HA 3SU6A 1B5GH 3M7QA 3MNSA 1C1TA 1O3IA 2BZAA 1W0JD 1AZZA 1YKTA 2K1QA 1O2JA 3UUZA 2QXGA 3RC5A 1D3DB 3CNRA 2CN0H 3ODDA 4RKJB 5EPNA 3Q3XA 2QF4A 2DE9A 1G3DA 3M3VA 1H8IH 1WAYB 4MPWA 4AB8A 1C9TA 1C5RA 4CHAC 3U1JB 1TX7A 4I31A 2QIQA 1O2SA 1C1UH 2ASUB 2BX4A 2GTBA 4XD7D 4YOGA 3A7VA 1FY3A 1GCDA 4AOQA 5EJZA 3OFND 2VVVA 1ZTJA 4Y79A 1C4Y2 1UMAH 1TGCA 1S5SA 1FY5A 1EAUA 1TMBH 1GG6C 1O3NA 4X1SU 1QFKH 3S69A 5SGAE 2H5DA 3PWBA 2I6SA 3FZZA 2FDAA 2GZ9A 1DOJA 2WPLS 2YNBA 2B7DH 3F68H 4FU8A 2AIQA 1S83A 2FODA 3ZZ6A 3T29A 1HAGE 2VIPA 1QJ6B 2B8OH 2Z9LA 5GPIB 2FTMA 2FXRA 2KX4A 2ZDNA 2BDGA 5A09A 1AU8A 1GI9B 2XCNA 1TPOA 1MD8A 2WPMS 2FS9A 3RU4D 2J9NA 1ZRBA 1O30A 3GYMA 1DITH 3TJOA 2FOGA 1OHHD 4ZHAA 3URCA 3RC4A 3BF6H 3ZZ9A 2G5VA 5CHBA 2BY8X 4FU9A 1C9PA 1MD7A 1ZRKA 3S9BA 2L6OA 5CDFE 3FANA 2Q6FA 4ASHA 2ZGBH 2VIOA 4GUXA 1AB9C 1HAIH 1GBFA 1DICA 2D8WA 2FMJA 4YOJA 1UTNA 2Z3CA 4I8HA 1MTUA 1LVYA 1ZPZA 5J4SA 2RCEA 1KY9A 3DHKH 1ETSH 3FFGA 4Z6AH 1WSSH 2QXHA 1NT1A 3A86A 2F9VA 2CXVA 1NFYA 2KCOA 2XBWA 1O2YA 3BTGE 1FIWA 1GJ8B 3FN8A 4MNYA 2VWOA 3LC5A 1O2IA 2ZHEH 1EPTA 2A7JA 2XBYA 2Z9JA 4F49A 5EQSA 2FZZA 3AW1A 4UE7H 3RXVA 2ANYA 1J9CH 3UOUA 3UNRA 4ISOA 7ESTE 2WYJA 1WUNH 1G37A 2A5AA 1GI1A 4NA8A 3UAIC 1TRNA 3TNTA 4SGBE 1C5LH 1CA8B 3MH6A 4ZKOU 3D65E 2PKAA 2ZDLA 1E1RD 1SMFE 3MWIU 4BAKB 1C1OA 5A8ZA 2XTTB 1PPGE 3OEED 1GBHA 3UOPA 1SKYE 4HI3A 2FOHA 4BTUB 3U8RH 1ELCA 3ITIA 4IS5A 5G4BA 1O2KA 3ATLA 1Y5UT 4TPIZ 2F43B 3QX5H 1DSUA 1GJ6A 1MKXK 2IPHA 2FM2A 3KYGA 2C3SA 3MI4A 1C2GA 1QIXB 1W0ZU 2CV3A 2F91A 2ZPRA 2OQ5A 3FOAA 3GYLB 1A61H 1GJ4H 1OWIA 2BLWA 1G3BA 1JWTA 5FPSA 1SGTA 5B6OA 2BQ7B 2W7UA 4H6TA 3ZZBA 3SHCH 4CRCA 2UUYA 1GBTA 1CO7E 3RXCA 2ZF0H 2KZ4A 2WPKS 4FUHA 2BDYA 1L1JA 3RXMA 5GCHF 2PTNA 3S7KB 1P09A 4TY7A 2GV7A 2GT8A 1LHFH 3RXTA 1S0RA 3H7TA 8GCHG 1T7CA 4DURA 1N6YA 1GI8B 4YOIA 1GMCG 4NZLA 4KGAA 1FONA 2SGQE 3DSPA 2HLCA 2GP9B 3SUGA 4RT0A 4OM9A 1UVSH 3SUFA 4I86A 1IQLA 1CVWH 2WSSD 1GL1A 3GY7A 3A7WA 3QGNB 1O3HA 1SGIB 1BDAA 1UVTH 1O5CB 2AIPA 1ELVA 1TWXB 1BTPA 2GV6A 1SHHB 3MNXA 1AVXA 2F3CE 4B73A 1KXCA 1PPBH 4U2WA 1C1SA 1VJ9U 1UTQA 5LPEA 1YLDA 5K7RA 1PPZA 1NFXA 2H5CA 3PWCA 1TOCB 3SV2H 2H9TH 1BTHH 3MO6A 4FUFA 2VIVA 3RXHA 1HIAB 1MKXH 1TMTH 2J4IA 3T26A 4WY3A 1QRZA 1SGFG 2B0FA 2SNWA 1Y3YA 1LPGB 1L0ZA 2Y5GA 3F2HA 4JK6A 4WJG2 3RUOA 2H6MA 4NGAH 5A0AE 3SV7A 2XBXA 1GHZA 3STIA 4BOHA 1GHBG 4BAQB 1TPPA 1KLJH 2PHBA 4ABGA 4THNH 4Y7BA 1XUJA 1PQ7A 2P59A 1O2HA 1PPHE 1Y5AT 1ELDE 1PQ5A 1PYTD 1ZGIA 2GT7A 5E2PA 3V3MA 1TNHA 2IJOB 3ZZ4A 2ALPA 4MG3A 3VB4A 3TPIZ 2FO9A 3GY2A 1HGTH 2ZGJA 2ZG0H 1GBDA 1ZOMA 1KSNA 1Y3WA 5EU8A 3RMMH 2CF8H 3UWJH 3DFLA 1DFPA 4ABBA 4GHTA 1K9OE 1SHYA 2PTCE 1SI5H 4X1PU 2VWLA 2QV1A 4D7FA 2TGPZ 3B23B 3SU2A 2BXUH 1P02A 1DWBH 2G00A 1O3CA 5ESBA 2EA3A 4NIYA 1Q2WA 1MQ5A 2BDBA 1GGDB 3NZIA 3FAOA 1GMHF 2VU8E 2ALVA 4KKDA 1TBRH 2H9EH 1O2RA 4F48B 2D26C 1PPCE 1O3FA 1HAHH 1OYQA 1OXGA 1UHBB 1HBTH 2GJGA 3Q3KA 3RXQA 2ZI2H 2HVYB 4D9RA 1P03A 3LGUA 3LH3A 1SGNE 2ZIQH 3PMHB 4FXGH 2SGAA 5C67A 1EASA 1P2MA 4ZMAH 2BLOA 4NSVA 1QZ8A 8KME2 1ESBA 2BQWB 3BTTE 1C2IA 1O5AB 1GJ5H 5AFZH 1OWDA 3LONA 1NRRH 1UVOA 2AERH 1YPGH 1CU1A 1S81A
chains in the Genus database with same CATH topology
1OWHA 1QY6A 2GVFA 2OC1A 1ELGA 2HNTC 2WV5A 5T3HA 3MFJA 1MCVA 3UR6A 4ABHA 4A6LA 4U30A 3EA7A 1E34B 2GKVE 2G8TA 1TE0A 3BIUH 2GD4B 3K2UA 3SU4A 2A5KA 3PV4A 1QBVH 3ESTA 1BMMH 1Y3UA 1W11U 3GY4A 3RXRA 4KTSA 3UNQA 1MMJN 1O37A 2F9UA 1S6FA 1TGTA 5T6FA 5LPFA 1ANCA 1SPJA 1F2SE 6ESTA 9ESTA 4AFZA 1XUGA 5DPAA 3A8AA 3SJIA 1BT7A 5HM2A 4DIIH 3TGKE 2Y7ZA 3A8CA 3E3TA 1C2HA 1G36A 3TGJE 3GDUA 1GPZA 2Q1JA 3EAJA 3CP7A 1PYTC 4AG1A 3GDSA 1NRSH 4X8VH 4JYUH 3CENA 2BHGA 3SZNA 4DY7B 1EP6A 1BZXE 3TNSA 2BD5A 1LHCH 1RXPA 4NSYA 2J2UA 2R9PA 3MMGA 2DE8A 3SNBA 5JYIA 2WYGA 3RXGA 1GJ7B 3KQBA 1MU8B 5A0BA 3M5OA 4A92A 1SFQB 3U8TH 2LPRA 4WH8A 1DXPA 3EA9A 4INHA 3F9HA 4H42U 1TGBA 1C5WB 1OX1A 1KLIH 2ZFFH 3A89A 1SG8B 1ETRH 3P8GA 1ZR0A 1GDNA 2SGDE 1D3TB 4XBCA 1WOFA 2QY0B 1A4WH 1THSH 1YYY1 2BLQA 2OP9A 2JH0D 1WU1A 5BPEA 3LU9B 4X2XA 2J95A 1C2FA 4Q7YA 2AMDA 1WYKA 5HGGA 1MZAA 3TVJB 1K1NA 1CA0C 1GJAB 1U6QA 1QL8A 2C4FH 1C1QA 1W7XH 1HAYB 1Z8RA 1CHOF 2C8ZB 1SQTA 1GGDC 1KDQB 2B9LA 1NY22 3ATIA 2STBE 1V2UT 1W13U 1T8OA 4K2YA 3L3TA 1O3GA 1W0YH 6CHAC 4DOQA 5EW1H 1YPEH 1BJVA 1O35A 4HGCA 4B2AA 4CHAB 4E7RG 1O3EA 3BG8A 3W94A 2AEIH 5DP3A 1LDTT 1QRXA 4NZQA 3ZV9A 4I8GA 3SGQE 1AI8H 1A2CH 3QUMP 4Z0KA 4RSPA 3F6UH 4R8TB 4IC6A 1KYNA 2HOBA 3RDZA 2ZA5A 2ZGCA 3GDVA 5JBTA 3RXJA 2GMTB 3T2NA 4YLQH 3QTVH 1VITH 1AHTH 1G9IE 1FUJA 2A31A 1Z7KA 3EGKH 3PB1E 1C5UA 2A4OA 1O3PB 3M3SA 4UFGH 4CH2B 4K3JA 1TNIA 2CGAA 3Q3YA 1ARBA 1EPTC 1GI7B 4YT7H 2BOKA 1CSOE 1KXBA 2P3FH 2XYAA 3S9CA 3BV9B 2RA3A 1Z6JH 2Y82A 1DY8A 2Z6BD 2BDIA 3MU4A 2SGEE 3AW0A 4D76A 4WH6A 1DS2E 3Q76A 5E8EH 2XXLA 1BMLA 3CS7A 3HPTB 1O2MA 4AFUA 3EYDA 1QA0A 2HPQH 1LCYA 2FLBH 2XWBI 4LK4A 4CRAA 4DVAU 1E35B 1QJ7B 1EJMA 3GCTF 3QTOH 3VXFH 2EEKA 1ELTA 1HXFH 4GAWA 1V2RT 3O8DA 3TK5A 1TYNA 2FS8A 3C1KA 4ZXYH 1OWJA 1P05A 3M36A 1BRBE 1SB1H 4ABIA 4FUBA 1Z8IB 3E0PB 4B1TA 2OC0A 1J15A 1GI4A 2R2MB 1EUFA 3T28A 3P17H 3U8OH 2BYAX 5A0CA 3STJA 1XUIA 4FVDA 1ZHMA 2BD4A 3SV9A 1HV7A 1YCPK 2ZFQH 1L1NA 1HYLA 2VIDA 3PLBA 4WXIA 3FZDA 5DK1A 1C5QA 3ZV8A 4ZKSU 1DUEA 1BRCE 2XNIA 2KAIB 3BTFE 1TFXA 1PQAA 1AQ7A 2ZGXH 1ZZZA 3PLPA 1W8BH 1P2JA 3M61U 3FVFB 2A4GA 5AF9H 1GBAA 2TGTA 2C8YB 2GZ7A 1ANEA 1WBGB 2BXTH 1XKAC 3NWUA 4WWYA 1KXDA 4AYYB 3P8OA 4GCHF 1EAXA 1MH0A 3ELAH 4UEHH 4JZEH 1SGEE 4UONA 5E0JA 1K21H 3BIVH 2F9PA 4AGKA 3V12A 1XVOA 2F9NA 1GBMA 1WV7H 1Y3XA 2BY6X 1LHGH 1O32A 2HNTE 1F0SA 1V2TT 1QB9A 2BY5X 1MCTA 5I25A 2Z94A 3GY3A 5F8XA 3TK6A 1K1PA 1SLXB 5CHAC 3LT3A 2VIQA 5FPYA 4TYDA 2TGAA 1ELFA 1FI8A 2CMYA 2H2ZA 1LPKB 1NRQH 1Q3XA 2ZFTA 3KQDA 3SJKA 1ID5H 1XM1A 2ZHFH 3HKJB 3MNBA 1IAUA 4MPXA 1GL0E 4H6SB 1D6WA 1VCQA 5HMAA 2P3TB 2QN5T 1TA6A 2BM2A 4BXWA 5EW2H 3O8BA 2NU4E 2GMTC 1AO5A 4LOYH 1P0SH 5TCCA 1ZMNA 1YCPH 1C5MD 1TA2A 1BTUA 4J1YA 1HDTH 2A0QB 1F5LA 1F0RA 1BITA 1C1NA 1EZXC 4XBDA 4DJZB 1FAXA 3SO3A 1JXPA 2OUAA 1HAVB 4Y11E 2BOHB 1UVUH 1J17T 3ENSB 1QRWA 2ZZUH 4X8SH 1M9UA 3UNSA 1GVZA 1A0LA 1P01A 1T31A 1S6HA 2GDEH 1SQAA 1W10U 3P8NA 1S82A 2IN2A 4CR5A 3DD2H 1P3EA 2PSYA 4LZ4B 2JH6D 2YOLA 4WMDA 4B2BA 1LO6A 2FIRH 3MTYA 1ZMLA 1RFNA 4IMQA 4JZIA 3A7YA 1UVPA 2OC7A 1L4ZA 4H4FA 4FUIA 4X0WU 3ZZCA 3LGTA 3NXPA 1VITG 1C5NH 1DPOA 1T8NA 5GCHG 1V2JT 3RLWH 3KQCA 1AMHA 3KNXA 5ABWA 2ZU5A 2ZQ1A 3RXEA 1CBWC 4K1SA 1FZZA 5F8TA 1HCGA 4DG4A 1DE7H 1GHVH 1LVBA 2TBSA 3HKIB 4K1EA 2UWOA 1PJPA 3RU4T 4TY6A 3M7TA 3GICB 1VR1H 5FAHA 1YPLH 1YM0A 4NIWA 3SORA 1TOMH 1SLWB 1O5GH 1S84A 1BHXF 1IQGA 3M37A 3SUEA 2EC9H 2HWLB 1SGFA 5ETXA 1A0HB 2O9QA 1BJUA 3UFAA 1YPHE 4NCYA 1O2GH 1NFWA 2AYWA 4BTIB 2A4RA 1TLDA 1GI5A 2RDLA 3IITA 1BHXB 5EOKA 1GBEA 1QCPA 2UUKB 3ZYDA 5FCRA 1DLKB 1AIXH 1EX3A 1HJAB 4FUCA 4OGYA 1DUAA 4YTAA 1HJ8A 3A83A 1BRAA 1NU9A 2DUCA 1DM4B 3P92A 1O2PA 1XXFA 1F7ZA 1O3DA 1CT0E 2BDCA 3EE0B 1HRTH 3U69H 5JPMH 3B9FH 1A1RA 4CREA 1JBUH 2W7SA 1TQ0B 2HNTF 5CMXH 1K1OA 4X6MA 1EB2A 2HALA 4WVPE 1OYTH 1J14A 3QK1A 1VITF 1SLUB 4X8UH 3SU0A 5JB8S 4CR9A 2FLRH 2VGCB 1B0EA 2FOEA 1YP9A 1LHEH 1F5RA 1AGJA 3RXSA 3RXAA 1WCZA 2W3KA 1O2OA 3TH4H 1A0JA 3QN7A 1V2OT 1V2ST 1GBKA 5E0GA 2ODPA 2OBOA 4IGDA 1INCA 4ZKRU 3U1IB 2AFQB 1BBRE 2OXSA 3KIDU 1H9IE 4GPGA 2GX4A 1FY1A 1OPHB 1EB1H 1RGQA 1GHWH 1TABE 3KHVA 3TIUA 3RM0H 2R0KA 1GMHG 4ZROA 3SGAE 4YZUA 3LH1A 4UFDH 5C1YA 4MNXA 5A8YA 2R3YA 1NC6A 1TNGA 5K0HA 1KTSB 4E05H 1EAWA 2Y80A 2QF0A 4RN6A 5EGMA 3E90B 2Y5FA 3OYPA 4AYVB 1O2QA 1AY6H 2FOBA 4JK5A 4CBOA 3VEQB 1T8MA 3T25A 3LJJA 1GMDF 6GCHF 4JZDH 4AGJA 3LGWA 4XOJA 3K6YA 3M5LA 3NK8A 1TRMA 4XBBA 1EAIA 7KMEH 4MNVA 1CGJE 4FUDA 4KTCA 3U98H 3EQ0H 3I29A 1G2MA 5E2OA 3TU7H 4HFPB 2A5IA 3BEFB 1VZQH 2FPZA 4K8BA 5TJXA 1HAPH 3GCOA 2F83A 3O8RA 1C5PA 1UJ1A 3AAVA 1AE5A 3MOCA 3LDXH 1O34A 5EXLA 1A5IA 2ZP0H 1QB6A 1GHXH 2AMPA 1Z8GA 2Q6DA 3SJOA 3OU0A 4BAOB 3H5CB 4HZHA 1AUTC 1K1MA 3ATKA 3W95A 2F9OA 3ZZAA 1C1VH 1BOQA 4Y8ZA 1CA0B 1ZGVA 3K6ZA 3SQEE 1JIRA 1C4V2 1BA8B 7GCHF 1K1IA 1P57B 3GY6A 5TCAA 2ANKH 1OP8A 5LGOA 2WUCA 1TONA 1NM6A 3L33A 1HJAC 5EG4A 1ETTH 4DGJA 3ZZ7A 4QT8C 2BMGB 4X2YA 1JIMA 5EPYA 6CHAB 1PPEE 1SGPE 1FNIA 1O2ZA 3MYWA 1OWEA 2G4UA 2Z9IA 1SGDE 3ZZ3A 1L1GA 1GHAF 2Z7FE 5I46H 1H8DH 5L30H 1L2EA 2XCFA 2BY7X 3K65B 2PR3A 3ZVFA 4YM9A 3RM2H 5AVDA 3RP2A 1IQMA 5C2ZA 4OS1A 1X7AC 2VGCC 4TPYA 3CS0A 1SGCA 3A82A 1P8VC 4INKA 3P8FA 4M7GA 2BB4A 1V2LT 4HTCH 4FVBA 1UTLM 1LQEA 3PLKA 1BTZA 1CT2E 4ISHH 3VFEA 1LHDH 1XUFA 1SOTA 5DP4A 1EJAA 2ZO3H 2V3OH 5JDUB 2QXJA 3E0NB 1CHOG 2FWWA 3A81A 2WPJS 1P9UA 4IBLH 3TK9A 1C5OH 1EPTB 2UUFB 3P95A 3QWCH 1EP5A 4FU7A 1OSSA 2SGFE 2ZU1A 1UCYE 5FBEA 2PGQB 1Z1JA 2GCHF 2PKAB 5L2YH 4YLUA 3SOSA 1RS0A 1DDJA 1MQ6A 2FI3E 4NA7A 1SC8U 4Y71A 3RMNH 1LKAA 3NCLA 3JZ2B 1O39A 1FDPA 3M35A 8LPRA 2HVXA 1HNEE 3R0FA 5F6MA 2ZCHP 1RIWC 1TRYA 2BD3A 2FYRA 3BEUA 2ANMH 1H1BA 1P12E 3SGBE 4E06H 2PUQH 2Z9KA 2C8WB 1NN6A 2D2DA 3SV6A 5DO4H 1P2QA 4AFQA 2ANWA 1SLVB 1JMOH 2BX3A 3LC3A 1GJ9B 1VGCB 3DFJA 2A7CA 2VNTA 1UK2A 5FBIA 4NFEA 1Y59T 1AFQC 3F1SB 1FLEE 4AG2A 2ULLA 2EI7A 4A5TS 1FXYA 1W3CA 4B71A 1QB1A 2Z3DA 3TH2H 3LIWA 3TLOA 2ZDVH 2W26A 2ZU2A 3SN8A 4UDWH 4R0IA 1TGNA 1O36A 1EKBB 4WMFA 1KIGH 1IQEA 5A8XA 3GCTG 1AKSA 3O8CA 2HGTH 1ELEE 2VVCA 1C1RA 1MBMA 3SW2B 2G81E 4KP0A 2QAAA 5FCKA 4K8YA 1UK3A 5DP9A 5CHAB 3M5NA 4XE4A 3EDXB 5J4QA 3K9XB 3RXBA 3BTME 4Y0ZE 3MHWU 1A3BH 1YPHC 2XW9A 5DKMA 2P8OB 1UTKA 4NIXA 1ZPBA 2O8WA 4TWYA 5JBBS 4BXSA 3AASA 1ESAA 2G52A 4UD9H 1O2WA 2ZDMA 1RD3B 1SFIA 1THRH 1MTNC 1V6DA 2FOMB 4MQAA 2FESH 1DT2A 1GI0A 2AS9A 3AVZA 2EI6A 3RXUA 2PKSB 3KN2A 2ZTZA 4UFEH 2H9HA 4A1XA 1E0FD 4IC5A 1GCTC 1DANH 4GCHG 1RJXB 4AZ2B 3WY8A 1P2OA 3ATWA 1IQHA 4WMEA 1GBCA 1Q31A 2O8MA 1XKBC 1W7GH 1V2PT 2V3HH 1ACBE 1GJDB 1Y3VA 3VB5A 1C5XB 2ZECA 3LJOA 4Y8XA 4NWKA 1MTSA 1TALA 2QYIA 4B76A 3BTKE 1GHYH 3HGNA 1O2VA 5C1XA 2VJ1A 1MU6B 3BTEE 3T5FH 1TBZH 2OQUA 2QF3A 5HM9A 2GCTB 5FX6A 1OS8A 3DA9B 3A7ZA 1K22H 3D23A 3QDZB 1MTWA 1SL3A 2TIOA 1D9IA 5EXMA 5T6DA 2FP7B 1FPCH 2WINI 4Y10E 1CGHA 1GI2A 4E7NA 3D62A 4FUJA 4LXBH 1YF4A 2P93A 3PROA 2V35A 4X8TH 1BB0B 4Y8YA 4MNWA 3S7HB 2FI4E 4OS6A 4O3TA 2BY9X 2AGGX 3LGVA 4ZAEA 2VH0A 2XC4A 3QGJA 1GWAA 4ZUHA 1CBWB 1Z1IA 1TQ7B 1G2LA 1E36B 1ELAA 1AWFH 2P3UB 1IHTH 1Y8TA 2NU2E 5EXNA 1VGCC 4NA9H 4ISIH 3HATH 1CT4E 4U01A 1W12U 1YPKH 3SV8A 1C5ZB 1ZTKA 3NPSA 2XWAA 1ZSLA 1XMNB 1C5VA 3G01A 3I78A 5EQQA 2WPIS 1QNJA 1D3QB 5FX5A 4XDEA 4I7YH 3BTQE 3GOVB 2FOCA 1V2KT 1F5KU 1N1LA 3LGYA 2YNAA 1JOUB 1DSTA 2UWPA 1IQJA 4ISLA 1FN8A 1TBQH 2V6NA 5DP7A 1FV9A 1MAXA 5C5OA 1CHGA 1DVAH 1TIOA 5DP8A 4Y76A 1E37B 4AB9A 1BTWA 3MH5A 4Q80A 4A1TA 4IMZA 1C5TA 3S0NA 2ZU4A 5PTPA 1W2KH 2ODYB 1NTPA 1B7XB 1HAXB 3QO6A 4ZXXH 2FX4A 4Q7ZA 4VGCB 1TX6A 3EA8A 1LMWB 1IQKA 1YGCH 2Q6GA 1QBOA 2ZC9H 1HIAA 4YT6H 3Q00A 4IN2A 3A80A 3BSQA 1D6RA 3OX7U 2ZPQA 2BTCE 4OGXA 1TX8A 2FX6A 2P8OC 5A2MH 3Q77A 4X6PA 1H9HE 1UTMA 2XBVA 1GVLA 4MVNA 1GDUA 2PFEA 3UQOA 3RC6A 3KQEA 3BTWE 1O38A 1XVMA 2O8UA 2Z3EA 3M7UA 4WF8A 3SNEA 2PKSC 2VIWA 1XUKA 2WPHS 2W5EA 1NU7B 2P94A 2P95A 1HFDA 1NRPH 3ODFA 3E8LA 1TNKA 4YO9A 1EZSC 2Y7XA 3RXFA 2PLXA 2OLGA 1VCPA 4F4OC 4X6NA 1P2NA