1TGTA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgtA02
2QGRA 4OS2A 4ZROA 1W2KH 6CHAB 1QA7A 5AHGH 2A2XH 4CRGA 1DITH 1B0EA 2C8XB 1LVOA 2FOGA 2NU2E 5JPMH 2XBWA 1ZSLA 2ZHWH 2PWXA 5EU8A 4D76A 3RM2H 1FY3A 2PHBA 2QIQA 1QRZA 2BM2A 2BVRH 1FXYA 1A5GH 3NXPA 3ZZ6A 1WBGB 3EA9A 4IN2A 1BTWA 4AGKA 1OS8A 1O32A 1ELAA 3ESTA 5DKMA 3FANA 2BLVA 2ZQ2A 3U1JB 2VIPA 1DM4B 2ZCHP 1KXAA 1UCYE 1Z1JA 4XBBA 1C5WB 3SGQE 3OY6U 4BANB 3MO3A 1SMFE 3G01A 1A2CH 1GI1A 5EQQA 4OS1A 5T6DA 2KAIB 5L6NH 1AWHB 1YPLH 1ELVA 3E16B 2VIWA 4HGCA 1PQ5A 3RMLH 3QZQA 4X2XA 3RXSA 3ODFA 2GD4B 3H7OA 1ARCA 3GYMA 2C93B 3VGCB 3URCA 1C5XB 5LPRA 3TVJB 4MPXA 4MNVA 1Q3XA 1VITH 1C2IA 1QURH 4MDSA 3A7VA 1Y3YA 5GWZA 5A0CA 1NZQH 1CHOF 3PYHA 1IAUA 1NFYA 3Q77A 4WH6A 1PYTC 1C5NH 2RDLA 2GT7A 1LKBA 4HI3A 4X6OA 4I32A 1SLUB 1C1PA 1KLTA 1OWKA 1EJAA 4IBLH 1ZZZA 1L2EA 4CHAC 1KXEA 1X7AC 1MKWK 3BEFB 2FM2A 4ZXXH 6LPRA 3BTFE 1TALA 3QLPH 1KSNA 2CV3A 4A5TS 1TMTH 3RXCA 1V2NT 2SGAA 3EDXB 3T25A 1TBRH 1HXFH 2PFEA 3RXBA 2C4FH 1GCTB 3CP7A 3AAVA 4E06H 1BRAA 1TQ0B 2BOHB 3P8OA 4JK5A 4ABEA 2ZNKH 2ZKSA 5EQSA 4GCHG 3BF6H 1C1OA 4WY3A 1CSOE 1S5SA 7ESTE 3NCLA 3M36A 2ODQA 4K60A 3KL6A 1HAYB 1O5DH 1CA0C 1GI7B 2ZC9H 2CMYA 1ZLRA 3Q3XA 2WYJA 1L1NA 2G4UA 3PO1B 4M7GA 2PR3A 4BAHB 2FZZA 1YPHE 4CH2B 1WTGH 1BTPA 1AMHA 3KF2A 1FY1A 2VWMA 4YLUA 1XUIA 1DS2E 1T31A 3GY2A 5HYOA 1BQYA 1W0ZU 1C4V2 3P6ZB 2BVXH 1HAIH 4YOIA 2LNCA 3GY8A 1BBRH 1C4Y2 1O2OA 3U8RH 1FI8A 3GY7A 2BD9A 1PPGE 4KTSA 2JETB 3RXKA 1LPKB 1QJ6B 1A5HA 2SGDE 4NIYA 2GZ8A 1FAKH 3A82A 1GI9B 2QXIA 5GIBA 2Y80A 3I77A 4K8BA 1GMDF 4TPYA 3S69A 2B7DH 4YM9A 4DVAU 3A7WA 3LIWA 3SGBE 2Q6FA 4ABIA 5AF9H 1K1JA 1GBKA 3GCTF 1MTNB 4A92A 1C5TA 5JDUB 1LHDH 1C2EA 1Y5UT 1O2JA 1XKBC 2P95A 1BRCE 2ZP0H 3M5OA 4FUEA 2VIQA 2DE9A 2G51A 4BAKB 5FCRA 1EP5A 2BDGA 1FLEE 4UFDH 1BIOA 2OD3B 3I29A 1XKAC 1A0HB 1B5GH 4AB8A 2QA9E 2HLCA 4MPVA 3A8AA 1QBOA 5L2YH 5ESTE 1MBQA 1BOQA 3URDA 1T4UH 2Z3DA 5H4IB 2P94A 4A7IB 1RIWC 1O2NA 5BRRE 5I25A 1OYTH 3ZZDA 3D49H 3I78A 2ZFTA 1WQSA 1E36B 4FUDA 4GSOA 4AN7A 2ZFPH 3MYWA 1UVTH 1BMAA 5GJ4B 3STJA 1MU6B 2R3UA 1BDAA 3PMAB 1XXFA 5GXPA 2Q6GA 2QV1A 3A89A 3DD2H 1C2KA 1MTVA 2PKSC 2ZO3H 1SLVB 3P8NA 1PQAA 3K2UA 4AFSA 3A83A 4WMEA 1FNIA 1UK2A 2ULLA 5IYTA 1NFXA 1C1QA 1NRPH 1UK4A 3AASA 1PFXC 1RJXB 1DXPA 4KTUA 1EB1H 1KIGH 1D6RA 3KN2A 1OWHA 3UWJH 4J1YA 4RSPA 4QT8C 1C5RA 1EAUA 5ETXA 1AZ8A 1GDQA 6CHAC 2XCFA 8GCHG 2FLBH 1PYTD 2VJ1A 5HGGA 3SO3A 3RXLA 4GHQA 1LPZB 1MTSA 2ZPQA 3RMNH 3BTME 2AMDA 1D3DB 1HAGE 2BD5A 7GCHG 1ZJDA 3UNQA 2AFQB 1P04A 1OSSA 3BTTE 1NC6A 1PPHE 2A2QH 2O8LA 4KGAA 4LZ1H 3RXOA 3NWUA 1TA2A 1LTOA 1DT2A 1TGBA 1HFDA 2W26A 4CRDA 3Q00A 1A5IA 2VGCB 2HWLB 2P16A 1F5KU 5FBEA 2W3KA 1NFUA 1HCGA 1HDTH 4JZIA 1IQMA 2H5DA 1GDNA 1GBDA 1EJMA 2F9VA 1GMCG 2UUYA 1TGCA 1UVSH 9ESTA 2VIDA 4I33A 3SV6A 1T8OA 2JH5D 3IG6B 5L30H 2FEQH 1WYKA 4DOQA 1EOLA 3IWMA 3MI4A 1P03A 2HPPH 4WJG2 3VGCC 3MU0A 1BT7A 4FVBA 3D23A 3RXVA 3BTEE 2ANKH 1LDTT 3STIA 4MVNA 4U01A 1ZJKA 1SGDE 5EGMA 2ANYA 2BY8X 2OC7A 1ETSH 3F9GA 2AMQA 1YPHC 4X2YA 5FPTA 2LPRA 4AG2A 4LZ4B 2PUXB 1GI8B 1DUEA 3T5FH 1FPHH 2IOTA 1HXEH 1C1MA 1GPZA 2F91A 4KELA 3TGJE 3OX7U 1FY5A 2AERH 1YPKH 1C1NA 4MTBA 3SV2H 3GY5A 2ZZUH 4WMDA 3TGKE 3A7YA 3V12A 2Q1JA 1C1SA 3PB1E 1XVMA 1SQTA 1HNEE 3SI3H 3QGNB 1EB2A 2ZDAH 1H8DH 3U9AH 2VVUA 1GCTC 3UNSA 1O3DA 4MNYA 1OWEA 2ZFQH 2WPJS 1TX7A 2G5VA 1O38A 2WUBA 3TK6A 2EA3A 4X0WU 2BMGB 4AZ2B 2BDIA 1JRTA 2OQ5A 1K22H 2Y5GA 2THFB 1C2HA 4ZAEA 3DHKH 5FX6A 4IN1A 1V2VT 2GV7A 1S6HA 2V0BA 3TNSA 1ZPZA 2WPKS 4Y8XA 4OGYA 2TIOA 3PO1C 4BXSA 1C5PA 4CHAB 1GI2A 1ZGVA 2FS9A 1O2WA 1FAXA 4NIVA 2ZFFH 2WINI 1Z8RA 1V3XA 3MU4A 3SJOA 2B8OH 1FIZA 1SHYA 1ORFA 5IDKA 3GISB 1C5LH 1GMHF 5E2PA 3KHVA 1AZZA 8ESTE 3RXDA 1ZRBA 1ELCA 1VGCB 1O2HA 2G4TA 4LK4A 3SJKA 2I6QA 1EP6A 3MNCA 4INHA 1NU9A 3MFJA 1LPGB 4Y11E 2P59A 3KCGH 4Y7AA 3ZVDA 2VVCA 2JETC 1V6DA 4K69A 5C2ZA 1UTJA 1C5VA 1LCYA 2C8WB 1A0JA 5E8EH 3TJVA 2ZDMA 5TCCA 3LH3A 3ITIA 1O3BA 4NCYA 3Q3YA 1LVMA 1P2NA 2BQWB 5F8XA 1P12E 1TLDA 1ZPCA 4CRCA 1C2DA 5JBAS 4E05H 1N1LA 2FTLE 2ZTYA 2VH6A 3TK9A 1P10A 1UHBA 3SI4H 3HK6B 2ANMH 2R2MB 4AFUA 3TJUA 1AY6H 1MTNC 1C1RA 1W13U 1YGCH 2SNVA 2Z9GA 2ZIQH 2ZDKA 2Z7FE 2FMJA 1GHZA 2OXSA 5A8XA 4MLFB 8KME2 3S0NA 1S6FA 5FXLA 1V2OT 1O35A 2ZCKP 3FZDA 2QCYA 3VXFH 4AFQA 4B2AA 2BOKA 1DFPA 5E0GA 1ANCA 1YLDA 5C5OA 1GHWH 3BTHE 3A80A 1QQUA 2CXVA 5K7RA 1XUHA 1ZTLA 4MG3A 3M7QA 1G36A 1L4DA 2D8WA 1BMMH 1JIMA 1HRTH 3LC3A 2BZ6H 1CT4E 3ZZBA 1Y5AT 1PPCE 2P93A 1GBMA 1BBRK 3D65E 4ABAA 1QNJA 5F6MA 3TLOA 5BPEA 5EXLA 2BXUH 1DE7H 1O2TA 1UO6A 1C5QA 1NO9H 1DY9A 2SGEE 1T32A 1G3BA 2P8OB 5A2MH 3SUGA 1HAVA 4A1TA 4VGCB 1W7GH 1YP9A 1IQEA 4B2CA 2V35A 1KXDA 1E35B 1K1IA 3SU1A 4FU8A 3SBKA 5JYIA 3FP7E 1G32B 3N7OA 2ZU1A 1NRSH 1HV7A 2Z9KA 2QAAA 3QO6A 4KKDA 2A7HA 3PMBB 2WPHS 1V2QT 2GV6A 4TWYA 1O39A 4CR9A 2NU1E 4NA8A 1HIAB 1UCYH 4X6PA 1LO6A 2FOCA 4NSVA 3AW1A 1P06A 3SHCH 2J34A 1C9TA 1MU8B 3U8OH 1V2ST 1J15A 1LKAA 5TJXA 1QL8A 2A0QB 1GHAF 3PMHB 1GBLA 2O8UA 2HPQH 5DJ7A 1PPBH 3RMOH 1C5ZB 2VGCC 1BHXF 2XNIA 1HJ9A 4OS5A 1FMGA 1BRUP 1C2GA 2RA0A 1CHOG 1SGQE 2UWOA 1Z8GA 1AQ7A 1K1PA 1GJ5H 1IHSH 1Z6EA 2AH4X 3E6PH 1VZQH 4FUIA 2ZU2A 4K1SA 2ZTXA 1TRMA 2FLRH 1FQ3A 3RXMA 1O3NA 4X8VH 4CRAA 3LJOA 1GI4A 1MMJN 1HJ8A 2ODPA 3TGIE 3RMMH 1L0ZA 1S83A 3A8BA 2FYRA 5HXFA 4JYTA 2PGQB 2BY9X 3SOSA 3OSYA 1O0DH 1C5OH 2QXHA 3SQEE 1O5AB 4B71A 1CU1A 1TGTA 1YPMH 1UTMA 2HNTC 1DWEH 1CBWC 1SQOA 2VB0A 3S9CA 1IHTH 4ABBA 1MAYA 1DVAH 4YO9A 2ZTZA 1B7XB 1E37B 3RU4D 3TIUA 2ZHDA 1CE5A 3S9BA 3P95A 1Z8JB 3UQOA 3PTNA 2Z94A 5GCHF 2Y5HA 3VXEH 3B8JA 1JMOH 3HGPA 1FY8E 1SC8U 1SGPE 2CJIA 4IW4E 4Q2KA 1VJ9U 1OWDA 1RGQA 1LVYA 1A61H 5EXMA 1GHXH 2F83A 2HRVA 2HALA 4AB9A 6ESTA 3SNAA 1IQIA 1TNJA 1SQAA 1O2RA 1TAWA 3ZVBA 2BY5X 3BTDE 1ELBA 1G3EA 2PSXA 1JRSA 4FU7A 1DWDH 3C27B 3A86A 4U2WA 2A5IA 3M5MA 4O03A 2ZPSA 4XBDA 1LHGH 3KNXA 3NKKA 2NU4E 3KQEA 4PROA 3DT0H 1TOMH 1AN1E 2ZECA 3RXPA 5DG6A 4X8UH 1PQ7A 2EI8A 2OC1A 2R2WU 4H42U 3A85A 4NSYA 1ESAA 4RN6A 3LGUA 4HTCH 3ZYEA 2NWNA 1MKXK 3PWCA 1H9LB 4BTTB 2OINA 1GMDG 1FZZA 1K28D 3E91A 1VGCC 1KDQA 1NRNH 2VVVA 3MH7A 4NIXA 2UUJB 5I46H 2C8ZB 1ETTH 2STBE 3KQBA 4AYVB 2GTBA 3T27A 1O2YA 3GCTG 4ABJA 4K5ZA 1O3CA 2OCVB 1JBUH 1SSXA 2AGEX 3A7ZA 3TITA 3LKWA 1G37A 5JB8S 2Y82A 4J2YB 1QGFA 1TPPA 1GVLA 2TRMA 3A8DA 1HAPH 1A3EH 4JZFH 2FO9A 2BVSH 2B9LA 3PM3A 3RU4T 2A32A 4UD9H 2JKHA 1QJ1B 1JOUB 1GBIA 2WV5A 1IQHA 5LGOA 3E3TA 4NGAH 4CREA 1C5SA 3TJNA 1KXCA 1V2UT 4F49A 2WYGA 2H9TH 2AIQA 1KDQB 1QFKH 4ISNA 3SNBA 1RTFB 1UTPA 4DJZB 1BRBE 2J2UA 1F92A 1A46H 1ACBE 1Z71A 1IOEA 2J38A 2ASUB 2OP9A 1MD7A 1J14A 3GY3A 5DP8A 4Z6AH 1IQGA 4O9VA 4B2BA 2BDAA 2BZAA 3RXGA 1K1MA 1SLXB 3M3VA 1RTLA 1F5RA 2J94A 3V3MA 3RXAA 1GBTA 1QHRB 3OU0A 3PWBA 2TGPZ 1QB1A 4I8GA 2ZQ1A 4K1EA 1TX8A 4ABDA 3PTBA 1E0FD 2ZU4A 2XBXA 1QQ4A 2ILNA 5EQRA 3M37A 1O5BB 3W95A 2GGVB 2P8OC 5SGAE 3PMJA 4VGCC 4AFZA 2O8TA 2EEKA 3UWIA 2C8YB 1Y5BT 3EYDA 1G3CA 1HB0B 1DDJA 2ZDLA 5F8TA 1JWTA 1PQ8A 1VITF 4NFEA 5C3NA 1GVKB 1E34B 1VCWA 2ALPA 2W7UA 4TYDA 4RKOB 3RP2A 3CS7A 1J17T 4ZHLU 1HBTH 1MTWA 2XTTB 1GJ4H 1WUNH 3B23B 3DUXH 3SGAE 1GI5A 4BOHA 2F9BH 5T6FA 3BTQE 1IQLA 1LVBA 4AGJA 3K6ZA 1V2PT 3PLPA 1SGIB 2ZGCA 1AKSB 2PV9B 2GCHF 1EJNA 1V2MT 3SNEA 1V2LT 1BCUH 1D3PB 1AUTC 1O2VA 4B76A 3QN7A 2FOAA 4DW2U 3K9XB 1MCTA 4FUBA 1GI6A 1HUTH 2GT8A 3T2NA 1QR3E 3B9FH 2ZU5A 2ZDNA 2J92A 3O8DA 2XWAA 3RDZA 1UJ1A 3LGTA 3P8FA 1QBNA 4NA7A 2JH0D 1THRH 2ZFSA 2XC0A 2B0FA 1NT1A 1YC0A 4X8TH 1KLJH 1YPGH 2H1UA 2XBVA 3MU5A 1AVXA 1OXGA 1EQ9A 4FUHA 2GDEH 5DP4A 4Y76A 3SUDA 5GDSH 3A8CA 1GJ8B 3GY4A 4X2VA 1P2QA 1QY6A 2ZPRA 2QY0B 1HYLA 4ZKRU 4AX9H 1THPB 1P2IA 2VU8E 2ZHQH 1C1WH 4CH8B 1O2GH 1K1LA 1SOTA 3P70B 3QTVH 4DGJA 3FFGA 1GHYH 4YOGA 5E0HA 1XVOA 5FPYA 3P92A 1FJSA 1ELEE 1SI5H 1TRNA 3SU3A 1LHFH 1O33A 4MNWA 2QF0A 2VINA 4H6SB 4WXIA 1O2XA 3LC5A 4ZMAH 3R0FA 1XUKA 3ZZ8A 1V2KT 1BJVA 2SGFE 2BYAX 1CO7E 2V6NA 3KGPA 4O3UA 4WXVA 5FPSA 1HJAB 1DWCH 1CVWH 1Z7KA 4WVPE 4Q7YA 4H4FA 4U30A 1MBMA 3HATH 4WF8A 1Y3UA 1OKXA 1F5LA 2XRCA 3QX5H 1KYNA 2H9HA 1TNKA 2FYQA 2Z9JA 3SNCA 3T26A 1K2I1 2FWWA 5C5NA 2GCTC 3QTOH 4I31A 5C1YA 4ZH8A 3S9AA 5DGJA 1UTNA 1MD8A 2CHAC 3H5CB 1Y3WA 2G5NA 1XM1A 1XMNB 4K1TA 1NESE 1KXFA 1FN8A 1CQQA 2PW8H 5DP5A 2F9NA 1GBFA 1ANDA 1GMHG 1TMBH 1CBWB 1W11U 5CHAB 1UMAH 3HKJB 1BJUA 3E1XB 3ELAH 1BMLA 1P01A 3ZZ3A 1H8IH 2J95A 1J9CH 5G4BA 1SL3A 3V7TA 3GICB 3MNBA 4GPGA 2BLQA 1BA8B 4INKA 3RC6A 5EODA 2XYAA 5A09A 4IGDA 3GYLB 2FS8A 1C5UA 1TNIA 2H9EH 2VIVA 6GCHF 4A6LA 1HPGA 2YNAA 3UIRA 3L33A 1Q31A 1GHBF 1O2LA 3GCOA 1W14U 1K1OA 3V13A 2IN2A 3MOCA 2FIRH 1UTLM 4E7RG 2H5CA 3MO9A 4Y71A 2WPIS 3LJJA 1SB1H 5A0BA 4XDEA 1FPCH 4A1XA 1TYNA 1P8VC 1W12U 4SGBE 3RLYH 4FXGH 4BNRA 2Z3EA 3FP8E 1D6WA 1JIRA 1WCZA 2EI6A 1MZDA 3LT3A 2BD4A 3TH4H 5EW1H 4XE4A 2GVFA 4I8KA 5K0HA 4K8YA 1AWFH 3E90B 1GWAA 3KQCA 2G8TA 2M5TA 1YM0A 5C20A 2UUFB 2TGDA 1W8BH 4X8SH 4ZKNU 4JZDH 4UEHH 1AVGH 3ZYDA 1V2WT 3A81A 4Q7XA 2BX3A 1GJAB 1UVPA 4TPIZ 4ZKSU 2BY7X 1YCPH 1O2PA 3U98H 5B6OA 4Y0ZE 3DFLA 1AE5A 1QRWA 1EZUC 5EOKA 1VR1H 2ZGXH 1EKBB 1EXFA 1O2ZA 3LGVA 2F3CE 4CR5A 4ESTE 1O3OA 2VIOA 1F0RA 1QA0A 1EZSC 1AVWA 3F9FA 3RXHA 4FU9A 3V0XA 4JK6A 3F1SB 4DY7B 1RTKA 2OTVA 3UFAA 1INCA 1EATA 4B73A 4MQAA 1QTFA 3UNRA 3VB6A 1XUFA 4NIWA 1F7ZA 2XBYA 2FOEA 1NTPA 5DP7A 5AVDA 3F6UH 3GY6A 4FUJA 4YT6H 4Y8ZA 4INLA 3ZVEA 4R0IA 1QL9A 5A0AE 1ELFA 1WOFA 2YOLA 2GZ9A 1AUJA 1O2QA 4OS4A 3M61U 4JCNA 1O3HA 2PLXA 3ATMA 4CRFA 1P3CA 3ATIA 4F4OC 1H9HE 1EUFA 1TA6A 1G3DA 1OOKB 1NRQH 2V3OH 2QXGA 1FY4A 1M9UA 1FN6A 2PKAA 1VCQA 3ENSB 1O3FA 4H6TA 1BZXE 5DP9A 1DPOA 2ZFRH 2GX4A 1GHAG 1CA8B 4XFQA 4K2YA 2HNTF 4FVDA 2A4RA 5JBTA 1ZHPA 1GJ9B 1HIAA 4ZXYH 1OX1A 3VEQB 3O8RA 3AVZA 1TGNA 5T3HA 3UUZA 2P3FH 4GLYA 1PPFE 5T6GA 4I8JA 1Z8IB 2XC4A 2AEIH 3SHAH 3RXQA 1UVUH 1BITA 2W3IA 1EPTA 3BEIB 1G2MA 5PTPA 1D4PB 1GL1A 2BD3A 4IMQA 1FDPA 2ZGHA 2FXRA 2WPMS 1YYY1 2ZCLP 1GG6C 2P3TB 3RC4A 4CBOA 2PSYA 1BMNH 1XUGA 1GBJA 1LQDB 2FOBA 1C9PA 1YPEH 1E38B 2PKAB 3PROA 1O3GA 3F9EA 2GKVE 1TFXA 2FOHA 4ASHA 1NU7B 1IQFA 1YF4A 1MQ5A 1KXBA 1AIXH 1BTZA 1WTHD 1JXPA 1TPSA 2FI5E 3U1IB 5ESBA 1PPZA 2A1DB 1KLIH 1QB9A 2SGPE 1GBEA 3MU1A 5GCHG 1W3CA 2BX4A 4MNXA 3D62A 4IC6A 4WWYA 4GVUA 1IQJA 3MMGA 3MNSA 4JYUH 1EPTB 2EI7A 1CGHA 2SNWA 5ABWA 5HM9A 4UFEH 1PJPA 4UDWH 2ZHEH 3VB7A 2PTNA 2UWLA 3HPTB 2G55A 1NS3A 5LPEA 1TONA 5TCAA 4IC5A 1HJAC 4IS5A 4OS7A 1OP2A 2NU3E 2HVXA 3BSQA 1KTTB 2WPLS 4ZHMU 4NWKA 4D7GA 3SUFA 3MH6A 2OBOA 1VJAU 1T7CA 7KMEH 5FBIA 1ZPBA 2FI4E 1Y59T 5F03A 3OY5U 3MH5A 4SGAE 1ID5H 2BY6X 3GCHC 1O2SA 5C1UA 4X1PU 1XX9A 2TPIZ 5CHAC 2PGBB 3ZZAA 2ZHFH 3W94A 1YPJH 1L4ZA 1P2KA 1EZQA 1G2LA 4BXWA 5J4QA 2TGAA 4JZEH 2VWLA 2ZF0H 3SJ9A 1O30A 4ZHAA 1SBWA 4GHTA 1YCPM 2ANWA 3M7UA 3SU5A 3H7TA 3M35A 1T8NA 1SGTA 2ZEBA 1D3QB 1D3TB 5JBCS 2OC0A 1O3LA 4ISHH 4X1NU 2GCTB 4YTAA 4GAWA 2CHAB 5JBBS 1LHCH 4Y79A 1SOZA 3PLKA 2BQ6B 3LONA 1TABE 1C5MD 1RD3B 1DSUA 1WSSH 1SR5C 4BTUB 5JB9S 2AGGX 4X1QU 1MAXA 4X1RU 1AU8A 3CENA 1GL0E 1ZRKA 3HK3B 3MWIU 1F0SA 1MZAA 2G81E 2BLOA 2RCEA 5EPNA 2K1QA 3A7TA 1AB9B 1K9OE 4LXBH 3RXIA 3TU7H 4D7FA 1J16A 3VB5A 2XXLA 3BIUH 1A1RA 3RXRA 3ZVFA 2O8WA 2IJOB 3LGIA 4DG4A 3BV9B 4RKJB 1YBWA 2JH6D 7LPRA 2OQUA 4Z0KA 1NPMA 1P2MA 1NROH 2BQ7B 2FTMA 1SGFG 2P3UB 1QJ7B 2R0KA 3A88A 2FX4A 3U69H 3F68H 1XUJA 3A7XA 1AFQB 1K1NA 1P11E 4AG1A 1GBCA 2ZG0H 3IITA 5DPAA 2OLGA 2FI3E 2CN0H 3HGNA 3KIDU 1AE8H 3UTUH 1T8LA 2GMTB 3AW0A 4AYYB 4Y8YA 2XC5A 4E7NA 5HM2A 4KTCA 1GDUA 1VITG 1HAZB 4XOJA 1TMUH 1MH0A 1N8OB 3SUEA 3SN8A 1G30B 3A87A 4WMFA 4JMYA 4WH8A 1Y8TA 2BXTH 1C2JA 1SLWB 3MTYA 3T29A 3ATWA 3E0NB 3UPEA 5J4SA 4Y7BA 2FP7B 4ZUHA 1GCDA 5FAHA 3EA8A 2Y81A 4OGXA 3S7KB 1GBBA 1O3IA 3ZV9A 5CE1A 1UK3A 1UVOA 1VCPA 3VB3A 2GCHG 1ABJH 3C1KA 1H4WA 3R3GB 1ESBA 5GPIB 4MPUA 3SU6A 2Z9IA 1CGIE 1A4WH 1ANEA 3RXFA 2QC2A 1O34A 1ELDE 1TE0A 2A4GA 1ETRH 1HGTH 1SVPA 1YCPK 1EOJA 4Q7ZA 1AKSA 1DLKB 3P17H 1P9UA 1YLCA 3TK5A 2ZI2H 1AHTH 1NFWA 5C1XA 1O2UA 1ZTKA 2BDHA 4JYVH 3ZVGA 2F9UA 3UOPA 1DX5M 1S84A 4MPWA 1ZMLA 2EC9H 2SFAA 2XCNA 4GCHF 4YZUA 1AGJA 3NUMA 3Q3KA 1GJCB 8LPRA 1S0QA 1WV7H 3LOXA 2QYIA 3SW2B 2VNTA 5A8YA 2A5AA 1TNHA 3JZ2B 4FUCA 1P0SH 1C1TA 3ATKA 1W10U 2W7SA 3UY9A 4ZKOU 1FIWA 1S0RA 3P8GA 3HKIB 3BIVH 1TX6A 1UTOA 2R3YA 1CT2E 3SZNA 1O2KA 4NG9H 1U6QA 2J9NA 1TBZH 1P57B 3GCNA 4XSKU 2O9QA 1ABIH 3RLWH 3BTWE 1O37A 2QN5T 1O31A 3SU0A 3RU4E 2F9OA 3T28A 3KQDA 4X2WA 1DICA 1GGDB 3OYPA 5E2OA 3BN9A 1L1GA 1TRYA 1BBRE 1EPTC 1P05A 4HFPB 2Z6BD 3EQ0H 2D26C 1GG6B 1BB0B 1ZSKA 1C2LA 3SV7A 5LPFA 1IQNA 1BTHH 3FP6E 2BLWA 5AFZH 2A31A 2UUKB 1TIOA 1O5CB 5DO4H 2A7CA 1B0FA 2ODYB 1W0YH 2ZGBH 1LQEA 3SNDA 5EG4A 2AIPA 1UTQA 2Y6TA 3BTKE 1F0UA 1MTUA 1P09A 1V2TT 3SJIA 4CRBA 1RXPA 1P2OA 1O3JA 1Z1IA 4ISIH 1ZTJA 4NZQA 4Y10E 1ANBA 2AYWA 1GI0A 3RXTA 5F8ZA 3UOUA 3AAUA 1DUAA 3M7TA 4DIHH 1MQ6A 2Q6DA 1Y3XA 3RXJA 3Q76A 6GCHG 1CGJE 2FPZA 2R0LA 2AGIX 2TBSA 1GHBG 1GJ7B 5EXNA 1AFEH 1SGRE 3TNTA 3QK1A 4UFGH 2A7JA 1GI3A 2FOFA 2DE8A 1SHHB 1TWXB 3BG4B 1OP8A 1FV9A 1SPJA 2YNBA 2ESTE 1UCYK 4DCDA 2I6SA 3MU8A 3T62A 2D1JA 3M3TA 1Z6JH 1NN6A 3M5LA 1ZGIA 4FUGA 3GDSA 2BD7A 4B75A 2BB4A 1MUEB 3ZZ9A 3GCHB 4A1VA 3ZV8A 5HMAA 1ESTA 1V2RT 1TPOA 2OC8A 1QL7A 2RA3A 3UREA 4TY6A 2QF3A 1P02A 4D8NA 3CS0A 1O3EA 1SGCA 3L3TA 1ZHMA 4ISLA 1MKWH 1HAXB 9LPRA 1AI8H 1UTKA 1K21H 5FCKA 1AB9C 2W5EA 1EASA 1GBAA 3SU4A 3OTJE 1O5EH 1F2SE 1O5GH 1SGYE 4I8LA 1MKXH 5L2ZH 3U8TH 2BDCA 3VB4A 2WUCA 1C5YB 2STAE 3MNXA 3LGYA 4UFFH 3LDXH 8GCHF 4LOYH 4X6MA 4OS6A 1TQ7B 4KP0A 3ZVAA 2NU0E 1C2MA 5CMXH 1KTSB 5LH8A 3TH3H 1O2IA 1A7SA 1DY8A 1O3PB 7GCHF 1H9IE 1EAIA 4I8HA 1HLTH 1RFNA 1RS0A 1CT0E 2F9PA 2Y5FA 3SV9A 1ARBA 1AFQC 2GDDA 1C1UH 3PV4A 2VWNA 3RXEA 4BAQB 3FZZA 1L1JA 3F9HA 2C90B 4AOQA 1CHGA 1Q2WA 2BD8A 3FAOA 1ZMNA 1XXDA 3BTGE 5C67A 2GMTC 5DP6A 1GMCF 1O3AA 1F0TA 3JZ1B 4R8TB 3K6YA 4TY7A 3UR6A 1O5FH 1ZMJA 1ZHRA 2OBQA 2CF8H 4NZLA 3VFEA 1TOCB 2Y7XA 5AFYH 3SORA 3ZVCA 1N8OC 2AS9A 1QRXA 3ZZ4A 1KY9A 5FHTA 3SJ8A 2VH0A 5DP3A 1TPAE 4ABGA 1DOJA 1V2JT 3ATLA 4AORA 1FUJA 1DXWA 1N6XA 3GDUA 1TBQH 3LU9B 1QIXB 3QUMP 2B5TB 2HNTE 2A4OA 1C1VH 3NZIA 1T8MA 3QWCH 3EA7A 4D9RA 1HAHH 1ZOMA 1BTYA 3TPIZ 1DANH 3DFJA 4Y0YE 1O2MA 4Q80A 1G9IE 3SQHE 1C4U2 2ZGJA 4THNH 2CF9H 1BHXB 3MH4A 1LHEH 1TGSZ 3ODDA 2R9PA 2ZA5A 2H2ZA 2H6MA 1OPHB 1OP0A 1ZSJA 2PTCE 4NFFA 3UQVA 1S85A 2IPHA 2FDAA 4JZ1A 4TWWA 1CA0B 1YKTA 4BAMB 4U32A 3O8BA 2A5KA 1ELGA 4UE7H 3O8CA 1IQKA 1TNGA 4ABHA 3E8LA 4IMZA 1DWBH 2C3SA 2Z3CA 1SGNE 1O3KA 4YOJA 2V3HH 2VWOA 5E0JA 1OWIA 2BHGA 1LMWB 1THSH 1EAWA 3M3SA 1BTUA 3LH1A 3E0PB 2FX6A 3BEUA 2OUAA 3SU2A 5A8ZA 4I7YH 3L6PA 3FVFB 1P3EA 2HOBA 3MHWU 1EX3A 2CGAA 2A45B 1WQVH 5FX5A 3BG8A 1TB6H 2QXJA 3RUOA 4NWLA 1DSTA 2ZDVH 2RG3A 2XWBI 1Y3VA 2ZWLH 2FESH 3NPSA 3ZZ7A 1A3BH 3KEEA 3RXUA 3QDZB 1P9SA 2Y7ZA 3LGWA 3PLBA 2A4QA 3EE0B 1GGDC 2FOMB 4Y6DA 4ABFA 4CBNA 1NRRH 3QGJA 3M5NA 2J4IA 1GVZA 4BAOB 2Z9LA 3UR9A 1AO5A 3SV8A 2BD2A 2SGQE 1WU1A 4X6NA 5DK1A 3RM0H 2ALVA 4B1TA 1BUIA 1GBHA 2UWPA 4YLQH 2G00A 1SFQB 3GOVB 1FONA 2GZ7A 2WV4A 1UHBB 2G52A 1A0LA 1PPEE 4FUFA 2XW9A 3ZZCA 3A84A 1BTXA 1QCPA 5EPYA 3RC5A 1DLEA 3DA9B 1SG8B 2FODA 1GJDB 1NY22 1T4VH 1EZXC 5EW2H 4GUXA 1GHVH 1H1BA 1O36A 3GDVA 3ZZ5A 1GJ6A 2D2DA 1ELTA 1HAOH 2DUCA 4HZHA 3EAJA 3EGKH 1C2FA 1RIWB 2PUQH 4O3TA 1O3MA 1EAXA 4B74A 4YT7H 1D9IA 4NA9H 1NM6A 4DT7B 3LPRA 1ZR0A 4ISOA 1SFIA 1P2JA 1SGEE 1TNLA 3MO6A 3TJOA 4BTIB 3QZRA 1W7XH 3S7HB 1N6YA 1S82A 1MCVA 2PKSB 3TH2H 3BG4C 2BDBA 1RRKA 4X1SU 4DIIH 2O8MA 1AD8H 1OYQA 2AMPA 2HGTH 1S81A 1WAYB 4XBCA 2TGTA 1SGFA 1QB6A 1QBVH 1OWJA 4O97A 2BDYA 3WY8A 4D9QA 1ZYOA 3K65B 4YESB 2ZU3A 4DURA 1HAVB 4UONA 1J8AA 3NK8A 4K3JA 2BTCE 3VPKA 2KAIA 2GP9B 1GJBB
chains in the Genus database with same CATH superfamily
2QGRA 4OS2A 4ZROA 1W2KH 6CHAB 1QA7A 5AHGH 2A2XH 4CRGA 1DITH 1B0EA 2C8XB 1LVOA 2FOGA 2NU2E 5JPMH 2XBWA 3UB0A 1ZSLA 2ZHWH 2PWXA 5EU8A 4D76A 3RM2H 1FY3A 2PHBA 2QIQA 1QRZA 2BM2A 2BVRH 1FXYA 1A5GH 3NXPA 3ZZ6A 1WBGB 3EA9A 4IN2A 1BTWA 4AGKA 1OS8A 1O32A 1ELAA 3ESTA 5DKMA 3FANA 2BLVA 2ZQ2A 3U1JB 2VIPA 1DM4B 2ZCHP 1KXAA 1UCYE 1Z1JA 4XBBA 1C5WB 3SGQE 3OY6U 4BANB 3MO3A 3F2FA 1SMFE 3G01A 1A2CH 1GI1A 5EQQA 4OS1A 5T6DA 2KAIB 5L6NH 1AWHB 1YPLH 3PV5A 1ELVA 3E16B 2VIWA 4HGCA 1PQ5A 3RMLH 3QZQA 4X2XA 3RXSA 3ODFA 2GD4B 3H7OA 1ARCA 3GYMA 2C93B 3VGCB 3URCA 1C5XB 5LPRA 3TVJB 4MPXA 4MNVA 1Q3XA 1VITH 3F2HA 1C2IA 1QURH 4MDSA 3A7VA 1Y3YA 5GWZA 5A0CA 1NZQH 1CHOF 3PYHA 1IAUA 1NFYA 3Q77A 4WH6A 1PYTC 1C5NH 2J98B 2RDLA 2GT7A 1LKBA 4HI3A 4X6OA 4I32A 1SLUB 3AK5A 1UW7A 1C1PA 1KLTA 1OWKA 1EJAA 4IBLH 5F53A 1ZZZA 1L2EA 4CHAC 1WXRA 1KXEA 1X7AC 1MKWK 3BEFB 2FM2A 4ZXXH 4XRNA 6LPRA 3BTFE 1TALA 3QLPH 1KSNA 2CV3A 4A5TS 1TMTH 3RXCA 1V2NT 2SGAA 3EDXB 3T25A 1TBRH 1HXFH 2PFEA 3RXBA 2C4FH 1GCTB 3CP7A 3AAVA 4E06H 1BRAA 1TQ0B 2BOHB 3KYFA 3P8OA 4JK5A 4ABEA 2EY4C 2ZNKH 2ZKSA 5EQSA 4GCHG 3BF6H 1C1OA 4WY3A 1CSOE 1S5SA 7ESTE 3NCLA 3M36A 2ODQA 4K60A 3KL6A 1HAYB 1O5DH 1CA0C 1GI7B 2ZC9H 2CMYA 1ZLRA 2JJ1D 3Q3XA 2WYJA 1L1NA 2G4UA 3PO1B 4M7GA 2PR3A 2J5UA 4BAHB 2FZZA 1YPHE 4CH2B 1WTGH 1BTPA 1AMHA 3KF2A 1FY1A 2VWMA 4YLUA 2K0QA 1XUIA 1DS2E 1T31A 3GY2A 5HYOA 1BQYA 1W0ZU 1C4V2 3P6ZB 2L6OA 2BVXH 1HAIH 4YOIA 2LNCA 3GY8A 1K0HA 1BBRH 1C4Y2 1O2OA 3U8RH 1FI8A 3GY7A 2BD9A 1PPGE 4KTSA 2JETB 3RXKA 1LPKB 1QJ6B 1A5HA 2SGDE 2XNDD 4NIYA 2GZ8A 1FAKH 3A82A 1GI9B 2QXIA 5GIBA 2Y80A 3I77A 4K8BA 1GMDF 4TPYA 3S69A 2B7DH 4YM9A 4DVAU 3A7WA 3LIWA 3SGBE 5KECA 2Q6FA 4ABIA 5AF9H 1K1JA 1GBKA 3GCTF 1MTNB 4A92A 1C5TA 5JDUB 1LHDH 1C2EA 1Y5UT 1O2JA 1XKBC 2JDID 2P95A 1BRCE 2ZP0H 3M5OA 4FUEA 2VIQA 2DE9A 2G51A 4BAKB 1QZ8A 3F0OA 5FCRA 1EP5A 2BDGA 1FLEE 4UFDH 1BIOA 2OD3B 3I29A 1XKAC 1A0HB 1B5GH 4AB8A 2WPDD 2QA9E 2HLCA 4MPVA 3A8AA 1QBOA 5L2YH 5ESTE 2F43B 1MBQA 1BOQA 3URDA 1T4UH 2Z3DA 5H4IB 4ACBA 2P94A 4A7IB 1RIWC 1O2NA 5BRRE 5I25A 1OYTH 2QE7D 3ZZDA 3D49H 3I78A 2ZFTA 1WQSA 1E36B 4FUDA 4GSOA 4AN7A 2ZFPH 3MYWA 1UVTH 1BMAA 2XOKD 5GJ4B 3STJA 1MU6B 2R3UA 1BDAA 3PMAB 1XXFA 5GXPA 2Q6GA 2QV1A 3A89A 3DD2H 1C2KA 1MTVA 2PKSC 2ZO3H 1SLVB 3P8NA 1PQAA 3K2UA 4AFSA 3A83A 4WMEA 1FNIA 1UK2A 2ULLA 5IYTA 1NFXA 1C1QA 1NRPH 1UK4A 3AASA 1PFXC 1RJXB 1DXPA 4KTUA 1EB1H 1KIGH 1D6RA 3KN2A 1OWHA 3UWJH 4J1YA 4RSPA 4QT8C 1C5RA 1EAUA 5ETXA 1AZ8A 1GDQA 3SZEA 6CHAC 2XCFA 8GCHG 2FLBH 1PYTD 2VJ1A 5HGGA 3SO3A 3RXLA 4GHQA 1LPZB 4M9FA 1MTSA 2ZPQA 3RMNH 3BTME 2AMDA 1D3DB 1HAGE 2BD5A 7GCHG 1ZJDA 3UNQA 2AFQB 1P04A 1OSSA 3EE7A 3BTTE 1NC6A 1PPHE 2A2QH 2O8LA 4KGAA 4LZ1H 5EIYA 3RXOA 3NWUA 1TA2A 1LTOA 1DT2A 1TGBA 1HFDA 2W26A 4CRDA 3Q00A 1A5IA 2VGCB 2HWLB 2P16A 1F5KU 2V3MA 5FBEA 2W3KA 1NFUA 1HCGA 1HDTH 4JZIA 1IQMA 2H5DA 1GDNA 2L74A 1GBDA 1EJMA 2F9VA 1GMCG 2UUYA 1TGCA 1UVSH 9ESTA 2VIDA 1BMFD 4I33A 3SV6A 2AHME 1T8OA 2JH5D 3IG6B 1COWD 5L30H 2FEQH 1WYKA 4DOQA 1EOLA 3IWMA 3MI4A 1P03A 2HPPH 4WJG2 3VGCC 3MU0A 1BT7A 4FVBA 3D23A 3RXVA 3BTEE 2ANKH 1LDTT 3STIA 4MVNA 4U01A 1ZJKA 1SGDE 5EGMA 2ANYA 2BY8X 1ETSH 2OC7A 3F9GA 2AMQA 1YPHC 4X2YA 5FPTA 2LPRA 4AG2A 4LZ4B 2PUXB 1GI8B 1DUEA 3T5FH 1FPHH 2IOTA 1HXEH 1C1MA 1GPZA 2F91A 4KELA 3TGJE 3OX7U 1FY5A 2AERH 1YPKH 1C1NA 4MTBA 3SV2H 3GY5A 2ZZUH 4WMDA 3TGKE 3A7YA 3V12A 2Q1JA 1C1SA 3PB1E 1XVMA 1SQTA 1HNEE 3SI3H 3QGNB 1EB2A 2ZDAH 1H8DH 3U9AH 2VVUA 1GCTC 3UNSA 1O3DA 4MNYA 1OHHD 1OWEA 2ZFQH 2WPJS 1TX7A 2G5VA 1O38A 2WUBA 3TK6A 2EA3A 4X0WU 3DCLA 2BMGB 4AZ2B 2BDIA 1JRTA 2OQ5A 4HG6A 1K22H 2Y5GA 2THFB 1C2HA 4ZAEA 3DHKH 5EJZA 4IN1A 5FX6A 1V2VT 2GV7A 1S6HA 2V0BA 3TNSA 1ZPZA 4FOUC 2WPKS 4Y8XA 4OGYA 2TIOA 3PO1C 4BXSA 1C5PA 4CHAB 1GI2A 1ZGVA 2FS9A 1O2WA 1FAXA 4NIVA 2ZFFH 2WINI 1Z8RA 1V3XA 3MU4A 3SJOA 2B8OH 1FIZA 1SHYA 1ORFA 5IDKA 3GISB 1C5LH 1GMHF 5E2PA 3KHVA 1AZZA 8ESTE 3RXDA 2CK3D 1ZRBA 1ELCA 1VGCB 1O2HA 2G4TA 4LK4A 3SJKA 2I6QA 1EP6A 3MNCA 4INHA 1NU9A 3MFJA 1LPGB 2YMSC 4Y11E 2P59A 3KCGH 4Y7AA 3ZVDA 2VVCA 2JETC 1V6DA 4K69A 5C2ZA 1UTJA 1C5VA 1LCYA 2C8WB 1A0JA 5E8EH 3TJVA 2ZDMA 5TCCA 3LH3A 3ITIA 1O3BA 4NCYA 3Q3YA 1LVMA 1P2NA 2BQWB 5F8XA 1P12E 1TLDA 1ZPCA 4CRCA 1C2DA 5JBAS 4E05H 1N1LA 2FTLE 2ZTYA 2VH6A 3TK9A 1P10A 1UHBA 3SI4H 3HK6B 2ANMH 2R2MB 4AFUA 3TJUA 4TT3D 1AY6H 1MTNC 1C1RA 1W13U 1YGCH 2SNVA 2Z9GA 2ZIQH 2ZDKA 2Z7FE 2FMJA 1GHZA 2OXSA 1E1QD 5A8XA 4MLFB 8KME2 3S0NA 1S6FA 5FXLA 1V2OT 1O35A 2ZCKP 3FZDA 2QCYA 5KGOA 3VXFH 4AFQA 4B2AA 2BOKA 1DFPA 5E0GA 1ANCA 1YLDA 5C5OA 1GHWH 2HLDD 3BTHE 3A80A 1E1RD 1QQUA 2CXVA 5K7RA 1XUHA 1ZTLA 4MG3A 3M7QA 1G36A 1L4DA 2D8WA 4ZCNA 1BMMH 1JIMA 1WDIA 1HRTH 3LC3A 2BZ6H 4B6EA 1CT4E 3ZZBA 1Y5AT 1PPCE 2P93A 1GBMA 1BBRK 3D65E 4ABAA 1QNJA 5F6MA 3TLOA 5BPEA 5EXLA 2BXUH 1DE7H 1O2TA 1UO6A 1C5QA 1NO9H 1DY9A 2SGEE 1T32A 1G3BA 2P8OB 5A2MH 3SUGA 1HAVA 4A1TA 4VGCB 1W7GH 1YP9A 1IQEA 4B2CA 3DSOA 2V35A 1KXDA 1E35B 1K1IA 3SU1A 4FU8A 3SBKA 5JYIA 3GS9A 3FP7E 1G32B 3N7OA 2ZU1A 1NRSH 1HV7A 2Z9KA 2QAAA 3QO6A 4KKDA 2A7HA 3PMBB 5C17A 2WPHS 3PRDA 1V2QT 2GV6A 4TWYA 1O39A 4CR9A 2NU1E 4NA8A 1HIAB 1UCYH 4X6PA 1LO6A 2FOCA 4NSVA 3AW1A 1VKYA 1P06A 3SHCH 2J34A 1C9TA 1MU8B 2PP6A 3U8OH 1V2ST 3SYJA 1J15A 1LKAA 5TJXA 1QL8A 2A0QB 3KQ5A 1GHAF 3PMHB 1GBLA 2O8UA 2HPQH 5DJ7A 1PPBH 3RMOH 4RI0A 1C5ZB 1W0JD 2VGCC 1BHXF 2XNIA 1HJ9A 4OS5A 1FMGA 1BRUP 1C2GA 2RA0A 1CHOG 1SGQE 2UWOA 1Z8GA 1AQ7A 1K1PA 1GJ5H 1IHSH 1Z6EA 2AH4X 3E6PH 1VZQH 4FUIA 2ZU2A 4K1SA 2ZTXA 1TRMA 2FLRH 1FQ3A 3RXMA 1O3NA 4X8VH 1YY3A 4CRAA 3LJOA 1NBME 1GI4A 1MMJN 1HJ8A 2ODPA 3TGIE 3RMMH 1L0ZA 1S83A 3A8BA 2FYRA 5HXFA 4JYTA 2PGQB 2BY9X 3SOSA 3OSYA 1O0DH 1C5OH 2QXHA 3SQEE 1O5AB 2J98A 4B71A 1CU1A 1TGTA 1YPMH 1UTMA 2HNTC 1DWEH 1CBWC 1SQOA 4RT1A 2VB0A 3S9CA 1IHTH 4ABBA 1MAYA 1DVAH 4YO9A 2ZTZA 1B7XB 5C0UA 1E37B 3RU4D 3TIUA 2ZHDA 1CE5A 3S9BA 3P95A 1Z8JB 3UQOA 3PTNA 2Z94A 3VG8A 5GCHF 2Y5HA 3VXEH 3B8JA 1JMOH 3HGPA 1FY8E 1SC8U 1SGPE 2CJIA 4IW4E 4Q2KA 1VJ9U 1OWDA 1RGQA 1LVYA 1A61H 5EXMA 1GHXH 2F83A 2HRVA 2HALA 4AB9A 6ESTA 3SNAA 1IQIA 1TNJA 1SQAA 1O2RA 1TAWA 3ZVBA 2BY5X 4ASUD 4F48B 3BTDE 1ELBA 1G3EA 2PSXA 1JRSA 2EQNA 2F4LA 4FU7A 1DWDH 3C27B 3A86A 4U2WA 2A5IA 3M5MA 4O03A 2ZPSA 4XBDA 1LHGH 3KNXA 3NKKA 2NU4E 3KQEA 4PROA 3DT0H 1TOMH 1AN1E 2ZECA 3RXPA 5DG6A 4X8UH 4OM9A 1PQ7A 2EI8A 2OC1A 2R2WU 4H42U 3A85A 4NSYA 1ESAA 4RN6A 3LGUA 4HTCH 3ZYEA 2NWNA 1MKXK 3PWCA 1H9LB 4BTTB 2OINA 1GMDG 1FZZA 1K28D 3E91A 1VGCC 1KDQA 1NRNH 2VVVA 3MH7A 4NIXA 2UUJB 5I46H 2C8ZB 1ETTH 2STBE 3KQBA 4AYVB 2GTBA 2RDEA 3T27A 1O2YA 3GCTG 4ABJA 4K5ZA 1O3CA 2OCVB 1JBUH 1SSXA 2AGEX 5T1VA 3A7ZA 3TITA 3LKWA 1G37A 5JB8S 2Y82A 4J2YB 1QGFA 1TPPA 1GVLA 2TRMA 3A8DA 1HAPH 3PRBA 1A3EH 4JZFH 2FO9A 2BVSH 2B9LA 3PM3A 3RU4T 2A32A 4UD9H 2JKHA 1QJ1B 1YLNA 1JOUB 3N99A 1GBIA 2WV5A 1IQHA 5LGOA 3E3TA 4NGAH 2LP6A 4CREA 1C5SA 3TJNA 1KXCA 1V2UT 4F49A 2WYGA 2H9TH 2AIQA 1KDQB 1QFKH 4ISNA 3SNBA 2KX4A 2YMSB 1RTFB 1UTPA 1MABB 4DJZB 1BRBE 2J2UA 5CHBA 1F92A 1A46H 1ACBE 1Z71A 1IOEA 2J38A 2ASUB 2OP9A 1MD7A 1J14A 3GY3A 5DP8A 4Z6AH 1IQGA 4O9VA 4B2BA 2BDAA 2BZAA 3RXGA 1K1MA 1SLXB 3M3VA 1RTLA 1F5RA 2J94A 3V3MA 3RXAA 1GBTA 1QHRB 5C94A 3OU0A 3PWBA 2TGPZ 1QB1A 4I8GA 2ZQ1A 4K1EA 1TX8A 4ABDA 3PTBA 1E0FD 2GJGA 2ZU4A 2XBXA 1QQ4A 2ILNA 5EQRA 3M37A 1O5BB 3W95A 2GGVB 2P8OC 5SGAE 3PMJA 4VGCC 4AFZA 2O8TA 2EEKA 3UWIA 2C8YB 1Y5BT 3EYDA 1G3CA 1HB0B 1DDJA 2ZDLA 5F8TA 1JWTA 1PQ8A 1VITF 4NFEA 5C3NA 3F0PA 1GVKB 1E34B 1VCWA 2ALPA 2W7UA 4TYDA 4RKOB 3RP2A 3CS7A 1J17T 4ZHLU 1HBTH 1MTWA 2XTTB 1GJ4H 1WUNH 3B23B 3DUXH 3SGAE 1GI5A 4BOHA 2F9BH 5T6FA 3BTQE 1IQLA 1LVBA 4AGJA 3K6ZA 1V2PT 3PLPA 1SGIB 2ZGCA 1AKSB 2PV9B 2GCHF 1EJNA 1V2MT 3SNEA 1V2LT 1YWUA 1BCUH 1D3PB 2RFKC 1AUTC 1O2VA 4B76A 3QN7A 2FOAA 4DW2U 3K9XB 1MCTA 4FUBA 1GI6A 1HUTH 2K8IA 2GT8A 3T2NA 1QR3E 3B9FH 2ZU5A 2ZDNA 2J92A 3O8DA 3DSPA 2XWAA 3RDZA 1UJ1A 3LGTA 3P8FA 1QBNA 4NA7A 2JH0D 1THRH 2ZFSA 2XC0A 2B0FA 1NT1A 1YC0A 4X8TH 1KLJH 1YPGH 2H1UA 2XBVA 3MU5A 1AVXA 1OXGA 1EQ9A 4FUHA 2GDEH 5DP4A 4Y76A 3SUDA 5GDSH 3A8CA 1GJ8B 1E79D 3GY4A 4X2VA 1P2QA 1QY6A 2ZPRA 2QY0B 1HYLA 4ZKRU 4AC9A 4AX9H 1THPB 1P2IA 2VU8E 2ZHQH 1C1WH 4CH8B 1O2GH 1K1LA 1SOTA 3P70B 4P02A 3QTVH 4DGJA 3FFGA 1GHYH 4YOGA 5E0HA 1XVOA 5FPYA 3P92A 1FJSA 1ELEE 3NRLA 1SI5H 1TRNA 3SU3A 1LHFH 4Q4LA 1O33A 3WWBA 4MNWA 2QF0A 2VINA 4H6SB 4WXIA 1O2XA 3LC5A 4ZMAH 3R0FA 5IK2D 1XUKA 3ZZ8A 1V2KT 1BJVA 2SGFE 2BYAX 1CO7E 2V6NA 3KGPA 4O3UA 4WXVA 5FPSA 1HJAB 1DWCH 1CVWH 1Z7KA 4P00A 4WVPE 4Q7YA 4H4FA 4U30A 1MBMA 3HATH 4WF8A 1Y3UA 1OKXA 1F5LA 2XRCA 3QX5H 1KYNA 2H9HA 1TNKA 2FYQA 2Z9JA 3SNCA 3T26A 1K2I1 2FWWA 5C5NA 2GCTC 3QTOH 4I31A 5C1YA 4ZH8A 3S9AA 5DGJA 1UTNA 1MD8A 2CHAC 2JJ2D 1SQRA 3H5CB 1Y3WA 2G5NA 1XM1A 5HIZA 1XMNB 4K1TA 1NESE 1KXFA 1FN8A 1CQQA 2PW8H 5DP5A 2F9NA 1GBFA 1ANDA 1GMHG 1TMBH 1CBWB 1W11U 5CHAB 5HKKD 1UMAH 3HKJB 1BJUA 3E1XB 3ELAH 1BMLA 1P01A 3ZZ3A 1H8IH 2J95A 2WV9A 1J9CH 5G4BA 1SL3A 3V7TA 3GICB 3MNBA 4GPGA 2BLQA 1BA8B 4INKA 3RC6A 5EODA 2XYAA 5A09A 4IGDA 3GYLB 2FS8A 1C5UA 1TNIA 2H9EH 2VIVA 6GCHF 4A6LA 1HPGA 2YNAA 3UIRA 3L33A 1Q31A 1GHBF 1O2LA 3GCOA 1W14U 1K1OA 3V13A 2IN2A 3MOCA 2FIRH 1UTLM 4E7RG 2H5CA 3MO9A 4FETA 2WPIS 4Y71A 3LJJA 1SB1H 5A0BA 4XDEA 1FPCH 4A1XA 1TYNA 1P8VC 1W12U 4SGBE 3RLYH 4FXGH 4BNRA 2QF5A 2Z3EA 3FP8E 1D6WA 1JIRA 1WCZA 2EI6A 1MZDA 3LT3A 2BD4A 3TH4H 5EW1H 4XE4A 2GVFA 4I8KA 5K0HA 4K8YA 1AWFH 3E90B 1GWAA 3KQCA 2G8TA 2M5TA 1YM0A 4RT0A 5C20A 2UUFB 2TGDA 1W8BH 4X8SH 4ZKNU 4JZDH 4UEHH 1AVGH 3ZYDA 1V2WT 3A81A 4Q7XA 2BX3A 1GJAB 1UVPA 4TPIZ 4ZKSU 2BY7X 1YCPH 1O2PA 3U98H 5B6OA 4Y0ZE 3WW7A 3DFLA 1AE5A 1QRWA 1EZUC 5EOKA 1VR1H 2ZGXH 1EKBB 1EXFA 3ZIAD 1O2ZA 3LGVA 2F3CE 4CR5A 4ESTE 1O3OA 2VIOA 1F0RA 1QA0A 1EZSC 1AVWA 3F9FA 3RXHA 4FU9A 3W1EA 3KYGA 3V0XA 4JK6A 3F1SB 4DY7B 1RTKA 2OTVA 3UFAA 1INCA 1EATA 2KZ4A 4B73A 4MQAA 1QTFA 3UNRA 3VB6A 1XUFA 4NIWA 1F7ZA 2XBYA 2FOEA 1NTPA 5DP7A 5AVDA 3F6UH 3GY6A 4FUJA 4YT6H 4Y8ZA 4INLA 3ZVEA 4R0IA 1QL9A 5A0AE 1SKYE 1ELFA 1WOFA 2YOLA 2GZ9A 1AUJA 1O2QA 4OS4A 3M61U 4JCNA 1O3HA 2PLXA 3ATMA 4CRFA 1P3CA 3ATIA 4F4OC 1H9HE 1EUFA 1TA6A 1G3DA 1OOKB 1NRQH 2V3OH 2QXGA 1FY4A 1M9UA 1FN6A 2PKAA 1VCQA 3ENSB 2KM0A 1O3FA 4H6TA 1BZXE 5DP9A 1DPOA 2ZFRH 2GX4A 1GHAG 1CA8B 4XFQA 4K2YA 2HNTF 4FVDA 2A4RA 5JBTA 5FL7D 1ZHPA 1GJ9B 1HIAA 4ZXYH 1H8ED 1OX1A 3VEQB 4F55A 3O8RA 3AVZA 1TGNA 5T3HA 5GNDA 3UUZA 2P3FH 4GLYA 1PPFE 5T6GA 4I8JA 1Z8IB 2XC4A 2AEIH 3SHAH 3RXQA 1UVUH 1BITA 2W3IA 1EPTA 3BEIB 1G2MA 5PTPA 1D4PB 1GL1A 2BD3A 4IMQA 1FDPA 2ZGHA 2FXRA 2WPMS 1YYY1 2ZCLP 1GG6C 2P3TB 3FO8D 3RC4A 4CBOA 2PSYA 1BMNH 1XUGA 1GBJA 1LQDB 2FOBA 1C9PA 1YPEH 1E38B 2PKAB 3PROA 1O3GA 2KCAA 3F9EA 2GKVE 1TFXA 2FOHA 4ASHA 1NU7B 1IQFA 3F3BA 1YF4A 1MQ5A 1KXBA 4B6FA 1AIXH 1BTZA 1WTHD 1JXPA 1TPSA 2FI5E 3U1IB 5ESBA 1PPZA 2A1DB 1KLIH 1QB9A 2SGPE 1GBEA 3MU1A 5GCHG 1W3CA 2BX4A 4MNXA 3D62A 4IC6A 4WWYA 4GVUA 1IQJA 3MMGA 3MNSA 4JYUH 1EPTB 2EI7A 1CGHA 2SNWA 5ABWA 5HM9A 4UFEH 1PJPA 4UDWH 2ZHEH 3VB7A 3PV2A 2PTNA 2UWLA 3HPTB 2G55A 1NS3A 5LPEA 1TONA 5TCAA 4IC5A 1HJAC 3DSGA 4IS5A 4OS7A 1OP2A 3N7EA 2NU3E 2HVXA 3BSQA 1KTTB 5DSFA 2WPLS 4ZHMU 4NWKA 4D7GA 3SUFA 3MH6A 2OBOA 1VJAU 1T7CA 7KMEH 5FBIA 1ZPBA 2FI4E 1Y59T 5F03A 3OY5U 3MH5A 4SGAE 1ID5H 2BY6X 3GCHC 1O2SA 5C1UA 4X1PU 1XX9A 2TPIZ 5CHAC 2PGBB 3ZZAA 2ZHFH 3W94A 1YPJH 1L4ZA 1P2KA 1EZQA 1G2LA 4BXWA 5J4QA 2TGAA 3OEED 4JZEH 2VWLA 2ZF0H 3SJ9A 1O30A 4ZHAA 1SBWA 4GHTA 1YCPM 2ANWA 3M7UA 2YMSD 3SU5A 3H7TA 3M35A 1T8NA 1SGTA 2ZEBA 1D3QB 1D3TB 5JBCS 2OC0A 1O3LA 4ISHH 4X1NU 2GCTB 4YTAA 4GAWA 1H8HD 2CHAB 5JBBS 1LHCH 4Y79A 1SOZA 3PLKA 2BQ6B 3LONA 1TABE 1C5MD 1RD3B 1DSUA 1WSSH 1SR5C 4BTUB 5JB9S 2AGGX 4X1QU 1MAXA 4X1RU 1AU8A 2W6JD 3CENA 1GL0E 1ZRKA 3HK3B 3MWIU 1F0SA 1MZAA 2G81E 2BLOA 2RCEA 5EPNA 3F2GA 2K1QA 3A7TA 1AB9B 1K9OE 4LXBH 3RXIA 3TU7H 4D7FA 1J16A 3WWFA 3VB5A 2XXLA 3BIUH 1A1RA 3RXRA 3ZVFA 2O8WA 2IJOB 3LGIA 4DG4A 3BV9B 4RKJB 1YBWA 5DN6D 2JH6D 7LPRA 2OQUA 4Z0KA 1NPMA 2V7QD 1P2MA 1NROH 2BQ7B 2FTMA 1SGFG 2P3UB 1QJ7B 1EFRD 2R0KA 3A88A 2FX4A 3U69H 3F68H 1XUJA 3A7XA 1AFQB 1K1NA 1P11E 4AG1A 1GBCA 2ZG0H 3IITA 5DPAA 2OLGA 2FI3E 2OK5A 2CN0H 3HGNA 3KIDU 1AE8H 3UTUH 1T8LA 2GMTB 3AW0A 4AYYB 4Y8YA 2W6ID 2XC5A 3FOAA 4E7NA 5HM2A 4KTCA 1GDUA 1VITG 1HAZB 4XOJA 1TMUH 1MH0A 1N8OB 3SUEA 3SN8A 5C0TA 1G30B 3A87A 4WMFA 4JMYA 4WH8A 1Y8TA 2BXTH 1C2JA 1SLWB 2JIZD 3MTYA 3T29A 3ATWA 3E0NB 3UPEA 5J4SA 3OFND 4Y7BA 2FP7B 4ZUHA 1GCDA 5FAHA 3EA8A 2Y81A 4OGXA 3S7KB 1GBBA 1O3IA 3ZV9A 5CE1A 1UK3A 1UVOA 1VCPA 3VB3A 2GCHG 1ABJH 3C1KA 1H4WA 3R3GB 1ESBA 5GPIB 4MPUA 3SU6A 2Z9IA 3OAAD 1CGIE 1A4WH 1ANEA 3RXFA 2QC2A 3H09A 1O34A 1ELDE 1TE0A 2A4GA 1ETRH 1HGTH 1SVPA 1YCPK 1EOJA 4Q7ZA 1AKSA 1DLKB 3P17H 1P9UA 1YLCA 3TK5A 2WHXA 2ZI2H 1AHTH 1NFWA 5C1XA 1O2UA 1ZTKA 2BDHA 4JYVH 3ZVGA 2F9UA 3UOPA 1DX5M 1S84A 4MPWA 1S6LA 1ZMLA 2QF4A 2EC9H 2HVYB 4DT4A 2SFAA 2XCNA 4GCHF 4YZUA 1AGJA 3NUMA 3Q3KA 1GJCB 8LPRA 1S0QA 1WV7H 3LOXA 2QYIA 3SW2B 2VNTA 5A8YA 2A5AA 1TNHA 3JZ2B 4FUCA 1P0SH 1C1TA 3ATKA 1W10U 2W7SA 3UY9A 4ZKOU 1FIWA 1S0RA 3P8GA 3HKIB 3BIVH 1TX6A 1UTOA 2R3YA 1CT2E 3SZNA 1O2KA 4NG9H 4YXWD 3FKSD 1U6QA 2J9NA 1TBZH 1P57B 3GCNA 4XSKU 2O9QA 1ABIH 3RLWH 3BTWE 1O37A 2QN5T 1O31A 3SU0A 3RU4E 2F9OA 3T28A 3KQDA 4X2WA 1DICA 1GGDB 3OYPA 4XD7D 5E2OA 3BN9A 1L1GA 1TRYA 1BBRE 1EPTC 1P05A 4HFPB 2Z6BD 3EQ0H 2D26C 1GG6B 1BB0B 1ZSKA 1C2LA 3SV7A 3U28C 5LPFA 1IQNA 1BTHH 3FP6E 2BLWA 5AFZH 2A31A 2UUKB 1TIOA 1O5CB 5DO4H 2A7CA 1B0FA 2ODYB 1W0YH 2ZGBH 1LQEA 3SNDA 5EG4A 2AIPA 1UTQA 2Y6TA 3BTKE 1F0UA 1MTUA 1P09A 1V2TT 3SJIA 1W0KD 4CRBA 1RXPA 1P2OA 1O3JA 1Z1IA 2KR7A 4ISIH 1ZTJA 2KFWA 4NZQA 4Y10E 1ANBA 2AYWA 1GI0A 3RXTA 5F8ZA 3UAIC 3UOUA 3AAUA 1DUAA 3M7TA 4DIHH 1MQ6A 2Q6DA 1Y3XA 3RXJA 5KEDA 3Q76A 6GCHG 1CGJE 2FPZA 2R0LA 2AGIX 2TBSA 1GHBG 1GJ7B 5EXNA 1AFEH 1SGRE 3TNTA 3QK1A 4UFGH 2A7JA 1GI3A 2FOFA 2DE8A 1SHHB 1TWXB 3BG4B 1OP8A 1FV9A 1SPJA 2YNBA 2ESTE 1UCYK 4DCDA 3OEHD 2I6SA 3MU8A 4Z1MD 3T62A 5HIYA 2D1JA 3M3TA 1Z6JH 1NN6A 3M5LA 1ZGIA 4FUGA 3GDSA 2BD7A 4B75A 2BB4A 1MUEB 3ZZ9A 3GCHB 4A1VA 3ZV8A 5HMAA 1ESTA 1V2RT 1TPOA 2OC8A 1QL7A 2RA3A 3UREA 3OTPA 4TY6A 2QF3A 1P02A 4D8NA 3CS0A 1O3EA 1SGCA 3L3TA 3FN8A 1ZHMA 2KCPA 4ISLA 1MKWH 1HAXB 2WZQA 9LPRA 1AI8H 1UTKA 2WSSD 1K21H 5FCKA 1AB9C 2W5EA 1EASA 1GBAA 3SU4A 3OTJE 1O5EH 1F2SE 1O5GH 1SGYE 4I8LA 2IJD1 1MKXH 5L2ZH 3U8TH 2BDCA 3VB4A 2WUCA 1C5YB 2STAE 3MNXA 3LGYA 4UFFH 3LDXH 8GCHF 4LOYH 4X6MA 4OS6A 1TQ7B 4KP0A 3ZVAA 2NU0E 1C2MA 2IPQX 5CMXH 1KTSB 5LH8A 3TH3H 1O2IA 1A7SA 1DY8A 1O3PB 7GCHF 1H9IE 1EAIA 4I8HA 1HLTH 1RFNA 1RS0A 1CT0E 2F9PA 2Y5FA 3SV9A 1ARBA 1AFQC 2GDDA 5CDFE 4TSFD 1C1UH 3PV4A 2VWNA 3RXEA 4BAQB 3FZZA 1L1JA 3F9HA 2C90B 4AOQA 1CHGA 1Q2WA 2BD8A 3FAOA 1ZMNA 1XXDA 3BTGE 5C67A 2GMTC 5DP6A 1GMCF 1O3AA 2M2AA 1F0TA 3JZ1B 4R8TB 3K6YA 4TY7A 3UR6A 1NBMD 1O5FH 1ZMJA 1ZHRA 2OBQA 2CF8H 4NZLA 3VFEA 1TOCB 2Y7XA 5AFYH 3SORA 3ZVCA 1N8OC 2AS9A 1QRXA 3ZZ4A 1KY9A 5FHTA 3SJ8A 2VH0A 5DP3A 1TPAE 4ABGA 1DOJA 1V2JT 2VBCA 3ATLA 4AORA 1FUJA 1DXWA 1N6XA 3GDUA 1TBQH 3LU9B 1QIXB 3QUMP 2B5TB 2HNTE 2A4OA 1C1VH 3NZIA 1T8MA 3QWCH 3EA7A 4D9RA 1HAHH 1ZOMA 1BTYA 3TPIZ 1DANH 3DFJA 4Y0YE 1O2MA 4Q80A 1G9IE 3SQHE 1C4U2 2ZGJA 4THNH 2CF9H 1BHXB 3MH4A 1LHEH 1TGSZ 3ODDA 3N7DA 2R9PA 2ZA5A 2H2ZA 2H6MA 1OPHB 1OP0A 1ZSJA 2PTCE 4NFFA 3UQVA 4I86A 1S85A 2IPHA 2FDAA 4JZ1A 4TWWA 1CA0B 1YKTA 2J97A 4BAMB 4U32A 3CNRA 3O8BA 2A5KA 1ELGA 4UE7H 3O8CA 1IQKA 1TNGA 4ABHA 3E8LA 4IMZA 1DWBH 2C3SA 2Z3CA 1SGNE 4Q63A 1KMHB 1O3KA 4YOJA 2V3HH 2VWOA 5E0JA 1OWIA 2BHGA 1LMWB 1THSH 1EAWA 3M3SA 1BTUA 3LH1A 3E0PB 2FX6A 3BEUA 2OUAA 3SU2A 5A8ZA 4I7YH 3L6PA 3FVFB 1P3EA 2HOBA 3MHWU 1EX3A 2CGAA 2A45B 2KCOA 1WQVH 5FX5A 3BG8A 1TB6H 2QXJA 3RUOA 5EJ1A 4NWLA 1DSTA 2KCYA 2ZDVH 2RG3A 2XWBI 1Y3VA 2ZWLH 2FESH 3NPSA 3ZZ7A 1A3BH 3KEEA 3RXUA 3QDZB 1P9SA 2Y7ZA 3LGWA 3PLBA 2A4QA 3EE0B 1GGDC 2FOMB 2LELA 4Y6DA 4ABFA 4CBNA 1NRRH 3QGJA 3M5NA 2J4IA 1GVZA 4BAOB 2Z9LA 3UR9A 1AO5A 3SV8A 2BD2A 2SGQE 1WU1A 4X6NA 5DK1A 3RM0H 2ALVA 4B1TA 1BUIA 1GBHA 4ACAA 2UWPA 4YLQH 2G00A 1SFQB 3GOVB 5EJLA 1FONA 2GZ7A 2WV4A 1UHBB 2G52A 1A0LA 1PPEE 4FUFA 2XW9A 3ZZCA 3A84A 1BTXA 1QCPA 5EPYA 3RC5A 1DLEA 3DA9B 1SG8B 2FODA 5B6LA 1GJDB 1NY22 1T4VH 1EZXC 5EW2H 4GUXA 1GHVH 1H1BA 1O36A 3GDVA 3ZZ5A 1GJ6A 2D2DA 1ELTA 1HAOH 2DUCA 4HZHA 3EAJA 3EGKH 1C2FA 1RIWB 2PUQH 4O3TA 3OE7D 1O3MA 1EAXA 4B74A 4YT7H 1D9IA 4NA9H 1NM6A 4DT7B 3LPRA 1ZR0A 4ISOA 1SFIA 1P2JA 1SGEE 1TNLA 1FX0B 3MO6A 3TJOA 4BTIB 3MQKC 3QZRA 1W7XH 3S7HB 1N6YA 1S82A 1MCVA 2PKSB 3TH2H 3BG4C 2BDBA 1RRKA 4X1SU 4DIIH 2O8MA 1AD8H 1OYQA 2AMPA 2HGTH 1S81A 1WAYB 4XBCA 2TGTA 1SGFA 1QB6A 1QBVH 1OWJA 4O97A 2BDYA 3WY8A 4D9QA 1ZYOA 3K65B 4YESB 2ZU3A 4DURA 1HAVB 4UONA 1J8AA 3NK8A 4K3JA 2BTCE 3VPKA 2KAIA 2GP9B 1GJBB
chains in the Genus database with same CATH topology
2QGRA 4OS2A 4ZROA 1W2KH 6CHAB 1QA7A 5AHGH 2A2XH 4CRGA 1DITH 1B0EA 2C8XB 1LVOA 2FOGA 2NU2E 5JPMH 2XBWA 1ZSLA 2ZHWH 2PWXA 5EU8A 4D76A 3RM2H 1FY3A 2PHBA 2QIQA 1QRZA 2BM2A 2BVRH 1FXYA 1A5GH 3NXPA 3ZZ6A 1WBGB 3EA9A 4IN2A 1BTWA 4AGKA 1OS8A 1O32A 1ELAA 3ESTA 5DKMA 3FANA 2BLVA 2ZQ2A 3U1JB 2VIPA 1DM4B 2ZCHP 1KXAA 1UCYE 1Z1JA 4XBBA 1C5WB 3SGQE 3OY6U 4BANB 3MO3A 1SMFE 3G01A 1A2CH 1GI1A 5EQQA 4OS1A 5T6DA 2KAIB 5L6NH 1AWHB 1YPLH 1ELVA 3E16B 2VIWA 4HGCA 1PQ5A 3RMLH 3QZQA 4X2XA 3RXSA 3ODFA 2GD4B 3H7OA 1ARCA 3GYMA 2C93B 3VGCB 3URCA 1C5XB 5LPRA 3TVJB 4MPXA 4MNVA 1Q3XA 1VITH 1C2IA 1QURH 4MDSA 3A7VA 1Y3YA 5GWZA 5A0CA 1NZQH 1CHOF 3PYHA 1IAUA 1NFYA 3Q77A 4WH6A 1PYTC 1C5NH 2RDLA 2GT7A 1LKBA 4HI3A 4X6OA 4I32A 1SLUB 1C1PA 1KLTA 1OWKA 1EJAA 4IBLH 1ZZZA 1L2EA 4CHAC 1KXEA 1X7AC 1MKWK 3BEFB 2FM2A 4ZXXH 6LPRA 3BTFE 1TALA 3QLPH 1KSNA 2CV3A 4A5TS 1TMTH 3RXCA 1V2NT 2SGAA 3EDXB 3T25A 1TBRH 1HXFH 2PFEA 3RXBA 2C4FH 1GCTB 3CP7A 3AAVA 4E06H 1BRAA 1TQ0B 2BOHB 3P8OA 4JK5A 4ABEA 2ZNKH 2ZKSA 5EQSA 4GCHG 3BF6H 1C1OA 4WY3A 1CSOE 1S5SA 7ESTE 3NCLA 3M36A 2ODQA 4K60A 3KL6A 1HAYB 1O5DH 1CA0C 1GI7B 2ZC9H 2CMYA 1ZLRA 3Q3XA 2WYJA 1L1NA 2G4UA 3PO1B 4M7GA 2PR3A 4BAHB 2FZZA 1YPHE 4CH2B 1WTGH 1BTPA 1AMHA 3KF2A 1FY1A 2VWMA 4YLUA 1XUIA 1DS2E 1T31A 3GY2A 5HYOA 1BQYA 1W0ZU 1C4V2 3P6ZB 2BVXH 1HAIH 4YOIA 2LNCA 3GY8A 1BBRH 1C4Y2 1O2OA 3U8RH 1FI8A 3GY7A 2BD9A 1PPGE 4KTSA 2JETB 3RXKA 1LPKB 1QJ6B 1A5HA 2SGDE 4NIYA 2GZ8A 1FAKH 3A82A 1GI9B 2QXIA 5GIBA 2Y80A 3I77A 4K8BA 1GMDF 4TPYA 3S69A 2B7DH 4YM9A 4DVAU 3A7WA 3LIWA 3SGBE 2Q6FA 4ABIA 5AF9H 1K1JA 1GBKA 3GCTF 1MTNB 4A92A 1C5TA 5JDUB 1LHDH 1C2EA 1Y5UT 1O2JA 1XKBC 2P95A 1BRCE 2ZP0H 3M5OA 4FUEA 2VIQA 2DE9A 2G51A 4BAKB 5FCRA 1EP5A 2BDGA 1FLEE 4UFDH 1BIOA 2OD3B 3I29A 1XKAC 1A0HB 1B5GH 4AB8A 2QA9E 2HLCA 4MPVA 3A8AA 1QBOA 5L2YH 5ESTE 1MBQA 1BOQA 3URDA 1T4UH 2Z3DA 5H4IB 2P94A 4A7IB 1RIWC 1O2NA 5BRRE 5I25A 1OYTH 3ZZDA 3D49H 3I78A 2ZFTA 1WQSA 1E36B 4FUDA 4GSOA 4AN7A 2ZFPH 3MYWA 1UVTH 1BMAA 5GJ4B 3STJA 1MU6B 2R3UA 1BDAA 3PMAB 1XXFA 5GXPA 2Q6GA 2QV1A 3A89A 3DD2H 1C2KA 1MTVA 2PKSC 2ZO3H 1SLVB 3P8NA 1PQAA 3K2UA 4AFSA 3A83A 4WMEA 1FNIA 1UK2A 2ULLA 5IYTA 1NFXA 1C1QA 1NRPH 1UK4A 3AASA 1PFXC 1RJXB 1DXPA 4KTUA 1EB1H 1KIGH 1D6RA 3KN2A 1OWHA 3UWJH 4J1YA 4RSPA 4QT8C 1C5RA 1EAUA 5ETXA 1AZ8A 1GDQA 6CHAC 2XCFA 8GCHG 2FLBH 1PYTD 2VJ1A 5HGGA 3SO3A 3RXLA 4GHQA 1LPZB 1MTSA 2ZPQA 3RMNH 3BTME 2AMDA 1D3DB 1HAGE 2BD5A 7GCHG 1ZJDA 3UNQA 2AFQB 1P04A 1OSSA 3BTTE 1NC6A 1PPHE 2A2QH 2O8LA 4KGAA 4LZ1H 3RXOA 3NWUA 1TA2A 1LTOA 1DT2A 1TGBA 1HFDA 2W26A 4CRDA 3Q00A 1A5IA 2VGCB 2HWLB 2P16A 1F5KU 5FBEA 2W3KA 1NFUA 1HCGA 1HDTH 4JZIA 1IQMA 2H5DA 1GDNA 1GBDA 1EJMA 2F9VA 1GMCG 2UUYA 1TGCA 1UVSH 9ESTA 2VIDA 4I33A 3SV6A 1T8OA 2JH5D 3IG6B 5L30H 2FEQH 1WYKA 4DOQA 1EOLA 3IWMA 3MI4A 1P03A 2HPPH 4WJG2 3VGCC 3MU0A 1BT7A 4FVBA 3D23A 3RXVA 3BTEE 2ANKH 1LDTT 3STIA 4MVNA 4U01A 1ZJKA 1SGDE 5EGMA 2ANYA 2BY8X 2OC7A 1ETSH 3F9GA 2AMQA 1YPHC 4X2YA 5FPTA 2LPRA 4AG2A 4LZ4B 2PUXB 1GI8B 1DUEA 3T5FH 1FPHH 2IOTA 1HXEH 1C1MA 1GPZA 2F91A 4KELA 3TGJE 3OX7U 1FY5A 2AERH 1YPKH 1C1NA 4MTBA 3SV2H 3GY5A 2ZZUH 4WMDA 3TGKE 3A7YA 3V12A 2Q1JA 1C1SA 3PB1E 1XVMA 1SQTA 1HNEE 3SI3H 3QGNB 1EB2A 2ZDAH 1H8DH 3U9AH 2VVUA 1GCTC 3UNSA 1O3DA 4MNYA 1OWEA 2ZFQH 2WPJS 1TX7A 2G5VA 1O38A 2WUBA 3TK6A 2EA3A 4X0WU 2BMGB 4AZ2B 2BDIA 1JRTA 2OQ5A 1K22H 2Y5GA 2THFB 1C2HA 4ZAEA 3DHKH 5FX6A 4IN1A 1V2VT 2GV7A 1S6HA 2V0BA 3TNSA 1ZPZA 2WPKS 4Y8XA 4OGYA 2TIOA 3PO1C 4BXSA 1C5PA 4CHAB 1GI2A 1ZGVA 2FS9A 1O2WA 1FAXA 4NIVA 2ZFFH 2WINI 1Z8RA 1V3XA 3MU4A 3SJOA 2B8OH 1FIZA 1SHYA 1ORFA 5IDKA 3GISB 1C5LH 1GMHF 5E2PA 3KHVA 1AZZA 8ESTE 3RXDA 1ZRBA 1ELCA 1VGCB 1O2HA 2G4TA 4LK4A 3SJKA 2I6QA 1EP6A 3MNCA 4INHA 1NU9A 3MFJA 1LPGB 4Y11E 2P59A 3KCGH 4Y7AA 3ZVDA 2VVCA 2JETC 1V6DA 4K69A 5C2ZA 1UTJA 1C5VA 1LCYA 2C8WB 1A0JA 5E8EH 3TJVA 2ZDMA 5TCCA 3LH3A 3ITIA 1O3BA 4NCYA 3Q3YA 1LVMA 1P2NA 2BQWB 5F8XA 1P12E 1TLDA 1ZPCA 4CRCA 1C2DA 5JBAS 4E05H 1N1LA 2FTLE 2ZTYA 2VH6A 3TK9A 1P10A 1UHBA 3SI4H 3HK6B 2ANMH 2R2MB 4AFUA 3TJUA 1AY6H 1MTNC 1C1RA 1W13U 1YGCH 2SNVA 2Z9GA 2ZIQH 2ZDKA 2Z7FE 2FMJA 1GHZA 2OXSA 5A8XA 4MLFB 8KME2 3S0NA 1S6FA 5FXLA 1V2OT 1O35A 2ZCKP 3FZDA 2QCYA 3VXFH 4AFQA 4B2AA 2BOKA 1DFPA 5E0GA 1ANCA 1YLDA 5C5OA 1GHWH 3BTHE 3A80A 1QQUA 2CXVA 5K7RA 1XUHA 1ZTLA 4MG3A 3M7QA 1G36A 1L4DA 2D8WA 1BMMH 1JIMA 1HRTH 3LC3A 2BZ6H 1CT4E 3ZZBA 1Y5AT 1PPCE 2P93A 1GBMA 1BBRK 3D65E 4ABAA 1QNJA 5F6MA 3TLOA 5BPEA 5EXLA 2BXUH 1DE7H 1O2TA 1UO6A 1C5QA 1NO9H 1DY9A 2SGEE 1T32A 1G3BA 2P8OB 5A2MH 3SUGA 1HAVA 4A1TA 4VGCB 1W7GH 1YP9A 1IQEA 4B2CA 2V35A 1KXDA 1E35B 1K1IA 3SU1A 4FU8A 3SBKA 5JYIA 3FP7E 1G32B 3N7OA 2ZU1A 1NRSH 1HV7A 2Z9KA 2QAAA 3QO6A 4KKDA 2A7HA 3PMBB 2WPHS 1V2QT 2GV6A 4TWYA 1O39A 4CR9A 2NU1E 4NA8A 1HIAB 1UCYH 4X6PA 1LO6A 2FOCA 4NSVA 3AW1A 1P06A 3SHCH 2J34A 1C9TA 1MU8B 3U8OH 1V2ST 1J15A 1LKAA 5TJXA 1QL8A 2A0QB 1GHAF 3PMHB 1GBLA 2O8UA 2HPQH 5DJ7A 1PPBH 3RMOH 1C5ZB 2VGCC 1BHXF 2XNIA 1HJ9A 4OS5A 1FMGA 1BRUP 1C2GA 2RA0A 1CHOG 1SGQE 2UWOA 1Z8GA 1AQ7A 1K1PA 1GJ5H 1IHSH 1Z6EA 2AH4X 3E6PH 1VZQH 4FUIA 2ZU2A 4K1SA 2ZTXA 1TRMA 2FLRH 1FQ3A 3RXMA 1O3NA 4X8VH 4CRAA 3LJOA 1GI4A 1MMJN 1HJ8A 2ODPA 3TGIE 3RMMH 1L0ZA 1S83A 3A8BA 2FYRA 5HXFA 4JYTA 2PGQB 2BY9X 3SOSA 3OSYA 1O0DH 1C5OH 2QXHA 3SQEE 1O5AB 4B71A 1CU1A 1TGTA 1YPMH 1UTMA 2HNTC 1DWEH 1CBWC 1SQOA 2VB0A 3S9CA 1IHTH 4ABBA 1MAYA 1DVAH 4YO9A 2ZTZA 1B7XB 1E37B 3RU4D 3TIUA 2ZHDA 1CE5A 3S9BA 3P95A 1Z8JB 3UQOA 3PTNA 2Z94A 5GCHF 2Y5HA 3VXEH 3B8JA 1JMOH 3HGPA 1FY8E 1SC8U 1SGPE 2CJIA 4IW4E 4Q2KA 1VJ9U 1OWDA 1RGQA 1LVYA 1A61H 5EXMA 1GHXH 2F83A 2HRVA 2HALA 4AB9A 6ESTA 3SNAA 1IQIA 1TNJA 1SQAA 1O2RA 1TAWA 3ZVBA 2BY5X 3BTDE 1ELBA 1G3EA 2PSXA 1JRSA 4FU7A 1DWDH 3C27B 3A86A 4U2WA 2A5IA 3M5MA 4O03A 2ZPSA 4XBDA 1LHGH 3KNXA 3NKKA 2NU4E 3KQEA 4PROA 3DT0H 1TOMH 1AN1E 2ZECA 3RXPA 5DG6A 4X8UH 1PQ7A 2EI8A 2OC1A 2R2WU 4H42U 3A85A 4NSYA 1ESAA 4RN6A 3LGUA 4HTCH 3ZYEA 2NWNA 1MKXK 3PWCA 1H9LB 4BTTB 2OINA 1GMDG 1FZZA 1K28D 3E91A 1VGCC 1KDQA 1NRNH 2VVVA 3MH7A 4NIXA 2UUJB 5I46H 2C8ZB 1ETTH 2STBE 3KQBA 4AYVB 2GTBA 3T27A 1O2YA 3GCTG 4ABJA 4K5ZA 1O3CA 2OCVB 1JBUH 1SSXA 2AGEX 3A7ZA 3TITA 3LKWA 1G37A 5JB8S 2Y82A 4J2YB 1QGFA 1TPPA 1GVLA 2TRMA 3A8DA 1HAPH 1A3EH 4JZFH 2FO9A 2BVSH 2B9LA 3PM3A 3RU4T 2A32A 4UD9H 2JKHA 1QJ1B 1JOUB 1GBIA 2WV5A 1IQHA 5LGOA 3E3TA 4NGAH 4CREA 1C5SA 3TJNA 1KXCA 1V2UT 4F49A 2WYGA 2H9TH 2AIQA 1KDQB 1QFKH 4ISNA 3SNBA 1RTFB 1UTPA 4DJZB 1BRBE 2J2UA 1F92A 1A46H 1ACBE 1Z71A 1IOEA 2J38A 2ASUB 2OP9A 1MD7A 1J14A 3GY3A 5DP8A 4Z6AH 1IQGA 4O9VA 4B2BA 2BDAA 2BZAA 3RXGA 1K1MA 1SLXB 3M3VA 1RTLA 1F5RA 2J94A 3V3MA 3RXAA 1GBTA 1QHRB 3OU0A 3PWBA 2TGPZ 1QB1A 4I8GA 2ZQ1A 4K1EA 1TX8A 4ABDA 3PTBA 1E0FD 2ZU4A 2XBXA 1QQ4A 2ILNA 5EQRA 3M37A 1O5BB 3W95A 2GGVB 2P8OC 5SGAE 3PMJA 4VGCC 4AFZA 2O8TA 2EEKA 3UWIA 2C8YB 1Y5BT 3EYDA 1G3CA 1HB0B 1DDJA 2ZDLA 5F8TA 1JWTA 1PQ8A 1VITF 4NFEA 5C3NA 1GVKB 1E34B 1VCWA 2ALPA 2W7UA 4TYDA 4RKOB 3RP2A 3CS7A 1J17T 4ZHLU 1HBTH 1MTWA 2XTTB 1GJ4H 1WUNH 3B23B 3DUXH 3SGAE 1GI5A 4BOHA 2F9BH 5T6FA 3BTQE 1IQLA 1LVBA 4AGJA 3K6ZA 1V2PT 3PLPA 1SGIB 2ZGCA 1AKSB 2PV9B 2GCHF 1EJNA 1V2MT 3SNEA 1V2LT 1BCUH 1D3PB 1AUTC 1O2VA 4B76A 3QN7A 2FOAA 4DW2U 3K9XB 1MCTA 4FUBA 1GI6A 1HUTH 2GT8A 3T2NA 1QR3E 3B9FH 2ZU5A 2ZDNA 2J92A 3O8DA 2XWAA 3RDZA 1UJ1A 3LGTA 3P8FA 1QBNA 4NA7A 2JH0D 1THRH 2ZFSA 2XC0A 2B0FA 1NT1A 1YC0A 4X8TH 1KLJH 1YPGH 2H1UA 2XBVA 3MU5A 1AVXA 1OXGA 1EQ9A 4FUHA 2GDEH 5DP4A 4Y76A 3SUDA 5GDSH 3A8CA 1GJ8B 3GY4A 4X2VA 1P2QA 1QY6A 2ZPRA 2QY0B 1HYLA 4ZKRU 4AX9H 1THPB 1P2IA 2VU8E 2ZHQH 1C1WH 4CH8B 1O2GH 1K1LA 1SOTA 3P70B 3QTVH 4DGJA 3FFGA 1GHYH 4YOGA 5E0HA 1XVOA 5FPYA 3P92A 1FJSA 1ELEE 1SI5H 1TRNA 3SU3A 1LHFH 1O33A 4MNWA 2QF0A 2VINA 4H6SB 4WXIA 1O2XA 3LC5A 4ZMAH 3R0FA 1XUKA 3ZZ8A 1V2KT 1BJVA 2SGFE 2BYAX 1CO7E 2V6NA 3KGPA 4O3UA 4WXVA 5FPSA 1HJAB 1DWCH 1CVWH 1Z7KA 4WVPE 4Q7YA 4H4FA 4U30A 1MBMA 3HATH 4WF8A 1Y3UA 1OKXA 1F5LA 2XRC<