1TGTA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
molecule tags Hydrolase zymogen (serine proteinase)
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgtA02
1B0FA 1GJ9B 1XM1A 1L1NA 1C2MA 3GY4A 2FO9A 3MU4A 4NIWA 1A5GH 2OINA 3EAJA 2VVVA 1BMMH 5GIBA 3U9AH 3SHCH 2AEIH 1EPTB 1Z71A 2ZPSA 3P92A 2R3UA 3T62A 3M5NA 2WYGA 1C2FA 3BG8A 4NA8A 2ILNA 3A7XA 2AFQB 2A5AA 1LQDB 1Y5BT 2ZHFH 1CT4E 2WINI 4WY3A 3MNSA 3RXAA 2ASUB 1OP8A 2ZGXH 3QK1A 2BXUH 1XVOA 2NU1E 1NS3A 5GDSH 1QL9A 3GCOA 3RXGA 1V2WT 2BD8A 3KQEA 1VJ9U 1IOEA 1SFIA 2EC9H 4X1PU 3F9EA 2BDCA 5AF9H 4AORA 4AFQA 2AYWA 3F9FA 5DP8A 1FUJA 2CJIA 1SGTA 4FUEA 2G00A 4TYDA 3S9AA 1P2JA 1UTLM 4OGXA 3HKJB 1O3LA 2ZDVH 1AWFH 2BX4A 1AFQC 1BRCE 2C8WB 1BMLA 1FZZA 1GHBG 1Y3YA 2O8WA 1KY9A 3GCNA 3KHVA 1H9LB 1G3BA 1GMHG 1MAXA 2Z9LA 1CA8B 4IN1A 2ZDAH 4YOIA 1LDTT 2ZNKH 1FY4A 1JRSA 3DFLA 4FUGA 1Y5UT 1NRPH 3T28A 1CT2E 1THRH 5E0HA 1MZAA 4X2XA 1SMFE 1ETTH 2VIPA 3BTHE 4NWKA 3V3MA 1SQAA 2D26C 1O2WA 1DVAH 3B8JA 5JBCS 3A81A 3MNXA 2BD9A 2RCEA 1T32A 3FFGA 2B5TB 1V2RT 1WQVH 1L1GA 1ELCA 2G4TA 2P93A 3TGIE 1CHGA 1QY6A 4A1XA 3SHAH 1YKTA 4Y7BA 1S83A 1O2UA 1Z8JB 3S0NA 1MU6B 1OYQA 2G52A 4ZHMU 2JKHA 4Y7AA 1FY5A 1OWIA 4BANB 1SGFA 1O2JA 3SJKA 1QA7A 1XUHA 4CH8B 1LHFH 1O3MA 4CRFA 2P16A 1TWXB 3JZ2B 1C5QA 1KXAA 1GHBF 4OS2A 2A31A 3OY5U 1EJNA 2PSXA 1EP5A 1GMHF 1S0QA 1D9IA 1YPMH 4ABAA 1VITH 1DWEH 2BOHB 1MQ5A 1KTTB 1MQ6A 4OS6A 2P8OB 2PUXB 2VWLA 2Q6FA 4Y76A 1TPAE 2JETB 3VFEA 1AKSB 1O2XA 1O2RA 2QIQA 3EDXB 1GHWH 2AS9A 2XBWA 1BIOA 2A4QA 1IQGA 1BJVA 3ELAH 3UUZA 1GL0E 4AG2A 1HAOH 5EPNA 1O2YA 1PQ5A 1V2LT 3OYPA 1MKWH 1WTGH 2Y81A 3HGPA 2ZO3H 1KXBA 5E2OA 3NUMA 1P09A 3PO1C 5F8XA 2FESH 1O3GA 1YPKH 1C5OH 4YOGA 3M61U 4GHQA 1FI8A 3LONA 1O35A 1O3EA 2WPIS 5BPEA 1VCPA 1C4V2 2FI4E 2F9VA 1C1UH 4DIIH 2FOAA 3BEIB 2GZ9A 3SN8A 2ZECA 1THSH 5A0BA 1FN8A 3EGKH 1BTYA 1CBWB 1UHBA 2PWXA 3KL6A 1UTNA 3UNRA 4AFZA 1BHXF 1DLEA 4JYTA 1E38B 1L2EA 4ZXXH 4ZHAA 1AWHB 1E35B 1PYTD 1D6RA 1LVBA 2VJ1A 4OS5A 3RM0H 1ABIH 1ETRH 1HJ9A 1QL8A 4XE4A 1UVOA 3A8AA 5IYTA 1E36B 3TNSA 5L6NH 4X6PA 4FU9A 1O2KA 1OYTH 1ARCA 1MKWK 1O3PB 2VVCA 3LIWA 3B23B 3VXEH 1C5RA 3O8RA 1XKBC 3K6YA 4Q7ZA 2ZFFH 1AI8H 1LVYA 5A8XA 1K1LA 4AGJA 2BDIA 1GJAB 1SGCA 2SGFE 1NT1A 1GCTB 1AHTH 1P12E 3A7YA 1ZHMA 4X2WA 1NROH 3SGBE 3PWBA 1NN6A 2GT8A 1LKAA 3VB7A 1QRWA 1LPKB 2A0QB 1PFXC 3GY2A 3NPSA 2RA0A 1ARBA 4BTIB 2Y82A 5DG6A 1TFXA 2ZEBA 4D9QA 1OX1A 1MTWA 1A0LA 4XBDA 2P3TB 5HXFA 2TBSA 3STIA 3A7ZA 4NIVA 1W14U 2FODA 3MFJA 1YC0A 2A5IA 1P0SH 1GDQA 3QDZB 2CN0H 1XUGA 3M5OA 1IHTH 1PQAA 1ZGVA 1O2PA 3BIUH 2BY6X 1O2GH 1TE0A 3PYHA 5A0CA 3BSQA 1C5ZB 1W13U 4ZMAH 2BTCE 2BX3A 2P94A 3PM3A 3A87A 1P8VC 3SI4H 3ZYDA 2BB4A 2O9QA 1MKXK 1C1PA 1P2MA 2BXTH 1WTHD 3PB1E 1JXPA 3CENA 3TIUA 1V2UT 4WMFA 4AYYB 5CMXH 5E2PA 2GCHG 2EI8A 3BV9B 1MMJN 1SGFG 4ASHA 4A92A 1WOFA 1F7ZA 1MTUA 2GDEH 2BD2A 4B75A 1GDUA 1IQJA 3IWMA 3DT0H 2F83A 2NU0E 1CT0E 2QN5T 1SVPA 1S85A 9ESTA 1P3EA 4D9RA 3KGPA 3RXTA 1AFQB 5JYIA 4UFDH 3M7TA 1S6FA 1TNJA 2W3IA 1UTOA 5TCAA 1O3OA 1O5AB 1C1VH 3ZVCA 1K1JA 1DY8A 1FY8E 1T8MA 3F6UH 4YLQH 1QA0A 5F8TA 5I46H 4Q7YA 3UY9A 1O30A 3RC5A 3O8BA 1BMAA 2DUCA 1THPB 1NTPA 1MZDA 1C2LA 1DFPA 3TJOA 2Y80A 2PTCE 1SB1H 4LZ1H 1HBTH 1AGJA 1PPHE 4E7NA 3R3GB 1O2QA 1TABE 4I8GA 4DT7B 1H8IH 1NC6A 3FZDA 4OS4A 4IBLH 1SGRE 2Y5GA 1EPTC 1RRKA 3MH5A 3KIDU 3CS0A 4ISLA 1W11U 1BBRE 2A4OA 1DWBH 1ZJKA 3TJUA 1AO5A 2GCHF 2ZI2H 4IC5A 1F0TA 1Z8RA 1EZSC 1DT2A 3NXPA 3VEQB 1VR1H 1K28D 3MH7A 3GICB 5T6DA 1N1LA 3CP7A 4Y8XA 1TLDA 1UVTH 4IW4E 2GT7A 1YPEH 1CA0B 5ESBA 2W5EA 1PPEE 2ZFTA 4FUJA 2VVUA 1B7XB 1TGBA 5A0AE 2F9OA 4ZAEA 3T2NA 3Q3XA 1FPCH 1FV9A 1G2LA 1CE5A 3BN9A 1D3QB 5EXMA 1TONA 1N8OB 3AVZA 1EX3A 3O8DA 4UEHH 2VGCB 3SGAE 2VWOA 3UNQA 3ZV9A 2FLRH 4UDWH 2XC5A 1O2TA 2QY0B 4JZIA 1UTPA 5I25A 2FDAA 4FUDA 1BOQA 2ODYB 1ZR0A 3LJJA 1GJ7B 1GVKB 4U30A 5CHAB 2M5TA 1BT7A 1TYNA 4ISIH 3PMAB 3BG4B 2YOLA 2ZGJA 1ZSJA 2AGIX 2FS9A 1YGCH 3T5FH 1JIRA 1ANDA 1SOTA 3SZNA 4JYVH 1P11E 1VZQH 1E37B 1ZJDA 2Z9GA 1PPGE 1JBUH 5EGMA 1CHOG 2ZU4A 2HALA 4JZFH 5GWZA 3M7QA 3MWIU 3MNCA 3M3VA 4O9VA 5J4QA 2D2DA 2BQ6B 1UMAH 1GWAA 5FX6A 3ZVDA 3PROA 2V6NA 2G55A 1GI0A 2J4IA 2BDHA 1M9UA 1A0HB 2BD3A 3UOPA 3ZZ7A 4Z6AH 1DY9A 1AQ7A 1HLTH 4K2YA 1L0ZA 1RGQA 1YPHC 4MPWA 1RIWB 2FTMA 2ZQ1A 1ZZZA 1J16A 3EYDA 1HAGE 4I31A 2H9HA 2PKAA 4ISNA 2Z6BD 3TH2H 1GJDB 3BTQE 3MO6A 1OXGA 2D1JA 2XBYA 5FCRA 2P8OC 3L33A 1KDQA 2JETC 1MD7A 1NPMA 1QBNA 3A7WA 2TGAA 3FAOA 3HK3B 4B73A 2OBOA 1GHAG 1O5DH 1P2IA 3E0PB 1P9SA 3A89A 3AW1A 2BD7A 1ZYOA 5FBIA 2J2UA 1RD3B 3SUEA 2VIWA 3ENSB 4BXSA 1CHOF 3MU5A 6GCHG 4DOQA 4K1TA 1U6QA 3PMBB 2WUBA 1ZMLA 2UUFB 2D8WA 2SGDE 8ESTE 3TVJB 3SU2A 1GBFA 2YNBA 1P06A 2QAAA 3SUGA 2WPHS 2OD3B 2TRMA 1QJ1B 3NCLA 1P2KA 1K21H 3KQBA 1UTQA 1OOKB 2A7JA 5C5NA 2BOKA 1BHXB 1F0UA 3RC6A 1EJAA 1OWDA 2PKSC 3M3SA 3P6ZB 1K9OE 4O03A 2J94A 1A61H 1YF4A 3MYWA 1XXDA 2ANWA 3RXPA 3UFAA 4U32A 4ABJA 2P59A 2H2ZA 1HNEE 3RMOH 4D7GA 3SJ8A 3KQCA 1A7SA 4IS5A 4TY6A 3HKIB 4KKDA 4I8LA 3RXVA 2ALPA 4NSYA 3OY6U 4XBBA 4NIXA 3A80A 2BYAX 1AVXA 1XUKA 1GHAF 1Q31A 2ZKSA 3SO3A 4I8KA 1MBQA 2AGGX 3PMJA 3I29A 1GHYH 3M35A 3RDZA 1OWHA 3A86A 4AOQA 1GCTC 1UK4A 2ZDKA 1RTLA 3TK5A 1K1PA 4B71A 2ZGHA 1ZLRA 1C2GA 1QQ4A 1YPHE 4BAOB 1A1RA 1P01A 2UWOA 6GCHF 4OS1A 1EZXC 4D76A 3U69H 3V12A 2BMGB 4X6NA 1K22H 1GBCA 4IMQA 3UR9A 1XUJA 3Q00A 3PTBA 3A85A 3RLWH 1TX6A 4GPGA 3KQDA 3LKWA 4YZUA 1IAUA 2GTBA 4A1TA 1EAIA 3A82A 3RMNH 1FDPA 2CF9H 3W94A 1CQQA 1Z1IA 1Q3XA 4ZHLU 2QF3A 3PLBA 3QTOH 1GI8B 2WV4A 1G30B 1O38A 1QRZA 5L2ZH 1RJXB 1CGJE 3TJNA 1YP9A 1YBWA 1PPFE 2ZU2A 4QT8C 3RU4E 1FLEE 3UTUH 4MLFB 1P03A 1C1RA 1GBHA 4J2YB 3GCHB 2OC7A 3ITIA 5LPEA 1EZUC 1O2SA 1GVLA 1O3FA 2KAIB 4THNH 3ZYEA 1HUTH 2G8TA 4UE7H 3QO6A 1W8BH 3GYMA 1HJAC 1GG6B 4X6OA 1SPJA 1LHCH 1GHZA 3KEEA 4NIYA 4K1EA 1P04A 2XC0A 5AFYH 1BITA 1CU1A 3UNSA 1EPTA 3PMHB 2C93B 3V7TA 1KLJH 2Z9JA 1PQ8A 5DK1A 3SU5A 1IQMA 1IQIA 1GBEA 2Z9KA 1KXCA 1UK3A 4RKOB 1O31A 4WVPE 1KXDA 1NY22 3OU0A 4NZQA 2QXGA 4ABGA 3UIRA 1K1NA 2QYIA 4BAQB 2QV1A 4GAWA 4MPVA 1HXEH 5JBTA 1Y59T 3LGIA 4XBCA 3I78A 3L3TA 3KF2A 1SLUB 4GVUA 1NFXA 2FX6A 4BTTB 1DUAA 1TPSA 1AZ8A 1TNGA 2SGPE 2OXSA 1MTSA 1ZPBA 3ZV8A 2F9PA 1IQFA 4FU7A 1G2MA 2VB0A 1O5CB 1Q2WA 1HB0B 2TGDA 3M5LA 5EW1H 3WY8A 1EOLA 2GVFA 2ZGBH 4ABBA 5A2MH 1C5UA 5CE1A 3HATH 3QX5H 3T29A 4CHAB 3RU4T 1SHHB 1G3DA 4OS7A 1HPGA 2FI5E 1D3TB 5EW2H 1Y3WA 3P8OA 4Y11E 3A88A 4WJG2 2QF0A 1LQEA 4HGCA 1O3DA 3N7OA 1CA0C 1T4UH 1RFNA 1SGDE 4NCYA 4DJZB 1RS0A 1O5EH 1NESE 4NFFA 4TPYA 2PW8H 5DP7A 1FN6A 1F5RA 1CO7E 1S0RA 1H9IE 7LPRA 3RXKA 1ZMNA 1TGCA 4X1RU 4TWWA 2BVRH 4DURA 2FOGA 4B2CA 5H4IB 2TPIZ 3F68H 1N8OC 1Z8GA 2JH6D 4E06H 2VGCC 1V2MT 1BJUA 2H9TH 3EA8A 4X6MA 1BMNH 3DUXH 4CBOA 2HOBA 2W7SA 8KME2 3LGUA 2FWWA 1T8NA 1WCZA 2UWPA 1O5FH 1P3CA 4UFFH 1F0SA 1XKAC 5F03A 5CHAC 4K60A 1H4WA 3BG4C 2G81E 1HRTH 5DKMA 1ELFA 1GMDG 1F5KU 4A1VA 1SI5H 3SV8A 1HAHH 1PPZA 3VGCB 1O3KA 2GGVB 3U1JB 1EZQA 3FANA 2O8UA 2UUKB 3UWJH 1LVOA 3DA9B 1Y3XA 1WQSA 1Z6JH 1EB2A 3D62A 3E0NB 1GBDA 2ZHWH 4H6TA 1J8AA 1V3XA 1G9IE 1FIWA 3RXRA 4BTUB 1ANEA 5EXNA 4DW2U 1DSUA 4X2VA 1MCVA 5PTPA 5C20A 5HYOA 2PKSB 4AN7A 1NFWA 2A2XH 2XBXA 1KIGH 4E7RG 2TIOA 3TH3H 1OP2A 1JMOH 3SNBA 2Z7FE 2GCTB 1V2QT 3H7TA 1ELAA 4DIHH 1BTUA 1HDTH 3K9XB 4HI3A 2C8YB 1Z6EA 1RXPA 4JZDH 2WV5A 2OC8A 1INCA 1TQ0B 1RIWC 1EP6A 2V35A 3EE0B 3ZZ3A 5HM2A 1MKXH 1UTKA 4CH2B 3P8NA 1O3BA 1H8DH 4ABEA 1IQNA 3GY7A 2XW9A 4X1NU 4VGCB 1O3AA 2C8ZB 2UUJB 3SU6A 1QL7A 1X7AC 5B6OA 1O36A 1FIZA 1C2IA 1UVPA 1AMHA 3BTME 1DXPA 1BZXE 1GMDF 2FMJA 1J15A 1O3HA 1HCGA 2BQWB 3AAUA 2BQ7B 3E3TA 3SOSA 1GBMA 1DSTA 1BRUP 4O3UA 2BDAA 3E90B 1GI3A 1ZRKA 1SBWA 5EQSA 4IMZA 1MTVA 1GL1A 3MO3A 5DP4A 1A5IA 1BRAA 3BTTE 1TMUH 1ACBE 5L30H 1G37A 2IJOB 4MPUA 1W7GH 2SGEE 3LC5A 2F3CE 1SSXA 1P10A 1GJCB 4JMYA 1TRMA 4YT6H 2BLOA 5EOKA 1FAXA 2BM2A 1BTHH 1T8OA 4K69A 1C1WH 1HAZB 3RC4A 2W3KA 2H1UA 2HNTF 2VU8E 4B2AA 3U8RH 2J38A 1N6XA 1TMBH 4MG3A 4IGDA 3S9CA 4H4FA 1HJAB 1CGHA 1TX8A 2TGTA 1TBRH 1CGIE 4Q7XA 1V2VT 2XWAA 3P70B 4JK6A 1W0YH 1WUNH 1O33A 2BZAA 1HAYB 5EXLA 4R8TB 1V2ST 2ZDLA 2FYRA 1OSSA 3TNTA 1K1OA 3GYLB 3C27B 3R0FA 3TK9A 3T27A 2FTLE 1C5PA 2ZPQA 1LKBA 1IQKA 4JK5A 1FXYA 5FX5A 2HPQH 3RXUA 1S5SA 4YO9A 3VB3A 1C5WB 2HGTH 4DY7B 1GBBA 1NRSH 1HFDA 3MU8A 2OCVB 2AERH 1EAXA 5EQRA 1A5HA 1LCYA 3MMGA 2PTNA 2J92A 3HGNA 1YLDA 1O3JA 2VIVA 3F9GA 1ESBA 5DGJA 2QCYA 3E91A 3T26A 2EI7A 5C1YA 4ABFA 1TBQH 3D23A 3OTJE 1DWCH 4AX9H 4SGBE 1DANH 1TB6H 4JYUH 4WH6A 3HPTB 4GUXA 1LVMA 3BTDE 4TWYA 2HVXA 7KMEH 1T4VH 1XXFA 1KXFA 2OBQA 4H42U 2Z3EA 3MU0A 5J4SA 2FOCA 3GCHC 1P2QA 2C90B 4YT7H 1UVUH 4DVAU 3ZZ9A 3ATMA 1ZMJA 2VIOA 1HAPH 4X8VH 2GZ8A 1GG6C 2QXHA 2JH5D 2OQ5A 1QBVH 4DCDA 4WWYA 2ZTYA 1BQYA 1GPZA 2FIRH 3QZQA 1Y5AT 4TPIZ 4BOHA 4LOYH 3UQVA 4YTAA 1ZTKA 2Z94A 4XSKU 3SV6A 3BIVH 4MNVA 5FBEA 2NU3E 3UREA 1AFEH 1GI5A 4ISOA 2K1QA 3UWIA 2PFEA 5T6GA 3SU1A 2GMTC 3ATWA 1C1MA 3KN2A 4A6LA 1KTSB 2BY5X 3DD2H 3ODFA 1DDJA 4F49A 2ANYA 2Z3DA 2B8OH 5T3HA 3RMMH 3JZ1B 1YPGH 4UONA 4Y8YA 3P8GA 1V6DA 2HLCA 1DUEA 1J14A 1ETSH 3LGYA 3BTKE 3LGVA 4FUBA 3SQEE 4K5ZA 3FP8E 2ZGCA 1SGEE 4R0IA 2Y5FA 2J95A 1O2NA 2NWNA 5GCHG 4MNYA 1BTPA 1VCWA 1TA6A 1GCDA 1SC8U 1TOMH 1UJ1A 2CV3A 1C1SA 1C4Y2 3K6ZA 5TCCA 1DWDH 1SLWB 4BAMB 4CHAC 4WMDA 1AB9C 1TNKA 4O3TA 3RXHA 1DE7H 1HIAB 2ZFRH 2W26A 1OWKA 1HAVB 1DITH 1VJAU 3RXIA 4A7IB 2QXJA 3AW0A 1Y3VA 1QB6A 2TGPZ 3ESTA 1O34A 2BLVA 1C1QA 2FXRA 4XOJA 3BTFE 4I8HA 4UFGH 5IDKA 3QZRA 5JB9S 4U01A 3A84A 4WH8A 1W12U 4H6SB 4AFSA 3QN7A 2BY8X 2AMPA 1O37A 3M36A 3MU1A 6CHAB 1IQLA 5LH8A 2Q1JA 2GD4B 1SQTA 1W10U 4CREA 1EXFA 1OWEA 3TGJE 5DP5A 1UCYH 1OS8A 1FJSA 1MD8A 2ZTXA 2A1DB 2A32A 5GCHF 3MO9A 3TLOA 3E8LA 2BDBA 3ZZAA 1BBRH 1BUIA 1BB0B 3BTWE 1JRTA 3GDUA 1QHRB 3VGCC 1GBIA 4KTSA 1IQHA 1TGTA 4CR5A 4CR9A 2ZHQH 4KP0A 1XX9A 2HRVA 1F92A 4FUCA 1C5XB 5A09A 3QLPH 5EQQA 3NZIA 5AVDA 1RTFB 1W2KH 1YYY1 1GI4A 3O8CA 2WPKS 2ZHDA 1SGQE 2QA9E 1EAWA 4NG9H 2R2MB 2OUAA 4K1SA 1GVZA 2G4UA 2ZC9H 3GOVB 5EODA 3UOUA 3SI3H 1AE5A 1DICA 1HAIH 1AIXH 1ANCA 2BY7X 3GY3A 3Q76A 2GCTC 3SNCA 3RU4D 3SNEA 3NKKA 3ZZ8A 1TX7A 2QGRA 2BZ6H 1GBTA 1E0FD 3RXEA 3ZZ4A 1B5GH 2ODQA 3A8BA 1GJ6A 3L6PA 5ESTE 1UCYK 5DP3A 2GV7A 3SNDA 1GDNA 1V2JT 1NU7B 1ZGIA 1C5TA 2RDLA 3E16B 1BBRK 4VGCC 4XFQA 1NFUA 2ZCLP 1GBAA 1GHVH 1NRNH 1E34B 2Y6TA 4X8SH 1EKBB 1C2JA 2P95A 4AB8A 1O2IA 3U1IB 2GV6A 3RMLH 1JOUB 1DLKB 5EPYA 3MOCA 1O2OA 5DO4H 2VNTA 2V3HH 1C5LH 1ZHRA 1Z1JA 1K2I1 4E05H 3GDVA 2ZFQH 3NK8A 2OP9A 1SGPE 2OQUA 1VGCB 3TGKE 3V13A 4ABIA 1VCQA 1W0ZU 5F8ZA 1DOJA 2P3FH 5GPIB 2ZG0H 4CRAA 4NZLA 2OLGA 4INHA 2R0KA 1A2CH 1ORFA 5E0JA 3TPIZ 4I32A 3UR6A 1NM6A 1WAYB 3QGNB 5FPYA 1GJ4H 1OP0A 3FZZA 5L2YH 4I8JA 2XXLA 3EA7A 5E8EH 1ELEE 2WPJS 2ZP0H 2Z3CA 4NGAH 1C2KA 2A5KA 4ZKOU 2ZTZA 1XVMA 3SW2B 2FZZA 3ATLA 3RXOA 1P2OA 1SHYA 3SJ9A 3EQ0H 3PLPA 1FY1A 5TJXA 2VWNA 3OSYA 2ZZUH 2HWLB 1TPPA 4CRCA 1J17T 4ISHH 4ZKRU 1UO6A 5G4BA 4LZ4B 4NA7A 4AGKA 3GISB 2C4FH 4B2BA 1P2NA 3RXMA 4IC6A 1A0JA 1C9TA 4X8TH 3VPKA 1O3NA 1LHGH 1UK2A 4MNXA 2SNVA 3LT3A 4KELA 3QGJA 1TBZH 5A8YA 4FUHA 3E1XB 1OWJA 2KAIA 5HMAA 1ZRBA 3VB4A 1MTNB 2BDYA 4FUFA 5C1UA 1AZZA 1C2DA 1MH0A 2GMTB 4Y6DA 2AMDA 4GLYA 3SU3A 2JH0D 4KGAA 1BTXA 1C5YB 1B0EA 2H6MA 2PHBA 2STAE 1QTFA 4HZHA 1NZQH 1D6WA 4J1YA 1SGYE 3U8TH 3M5MA 5E0GA 5GJ4B 3LGWA 1D3DB 4B76A 4YOJA 2OC0A 4CRBA 1ZHPA 2C8XB 3PLKA 2VINA 1C1TA 1ANBA 3LGTA 1C1OA 5AHGH 1A3BH 4Y0YE 1SR5C 1TRYA 2Y7XA 4BXWA 3MI4A 1ELBA 4JZ1A 2FI3E 1FQ3A 5DP6A 1TAWA 1XMNB 1F2SE 2ZHEH 2Q6GA 1L4ZA 1AB9B 5ABWA 1GI7B 2ZU1A 5JPMH 1MAYA 3NWUA 4FUIA 2I6SA 2WYJA 2BLWA 1SGIB 3K65B 3GDSA 3URDA 7GCHG 3ZZ5A 2CHAC 2F9BH 4NA9H 2PLXA 5FPTA 5DJ7A 1H9HE 4Y10E 5FXLA 1PPCE 1AU8A 3FVFB 1WU1A 3TH4H 1TIOA 2GKVE 3BTGE 2FOFA 2O8LA 4INKA 3SV9A 1EJMA 3RXBA 1KYNA 2ANKH 4RKJB 3TJVA 2NU4E 3D65E 3PWCA 1JIMA 3SNAA 5HGGA 3LU9B 6LPRA 5FCKA 2EA3A 4U2WA 2ZIQH 4D8NA 5LPFA 1T7CA 2XC4A 1C5MD 3SBKA 1KSNA 1DM4B 2FM2A 2B9LA 1P02A 1O2LA 2ULLA 3EA9A 3LJOA 3BEFB 2BHGA 1SLVB 1UTJA 1A3EH 2R3YA 1YCPH 1A4WH 2QC2A 5AFZH 4Z0KA 1BA8B 3RXDA 2FOHA 2EEKA 2WPMS 1PYTC 1IHSH 1AKSA 1ZPZA 1UHBB 2ZCHP 4OGYA 3S7KB 2A45B 2VIDA 3MNBA 2FS8A 4MVNA 1TQ7B 1TRNA 1F5LA 2A7CA 9LPRA 1NO9H 7GCHF 1GI9B 4YM9A 8GCHG 2GP9B 2AGEX 1HAXB 4AYVB 2BLQA 3F9HA 2VH0A 1NU9A 1Y8TA 1K1MA 1C2HA 3C1KA 4TY7A 1L1JA 4HTCH 2GX4A 1O39A 3SUFA 3V0XA 1KXEA 1JWTA 3ATKA 1HXFH 1F0RA 2ZDMA 3W95A 2XBVA 1MBMA 3BEUA 3GY6A 1EATA 3S69A 3U8OH 2STBE 3M3TA 3AASA 2H5DA 4CBNA 1SGNE 3Q77A 1QGFA 4GCHG 5EU8A 3UQOA 1FAKH 2H9EH 1FY3A 1YCPK 2XTTB 3CS7A 2C3SA 3A83A 2IOTA 6CHAC 1BTZA 1KLTA 1SOZA 1TNHA 1EAUA 3STJA 3B9FH 1YPJH 1QRXA 3A7VA 5LPRA 2XRCA 3IG6B 1HJ8A 4ABDA 3MTYA 2PGQB 6ESTA 2Z9IA 3A7TA 1G32B 1WYKA 1S6HA 3RXLA 1DXWA 3P8FA 1PPBH 1TNLA 2CF8H 3KCGH 2SFAA 3G01A 8GCHF 3URCA 1P9UA 2CXVA 1S82A 2QXIA 3PV4A 3Q3YA 1O5GH 2FLBH 4I7YH 1GGDB 5HM9A 1G3CA 1ELGA 1GJ5H 3ZZ6A 2G5VA 2PR3A 2XWBI 3ATIA 1W3CA 2G5NA 2RA3A 3RXSA 1LMWB 1CVWH 1AE8H 3LPRA 1WV7H 4X8UH 1G36A 3TK6A 1EASA 1YLCA 4ZROA 1LPZB 2UWLA 4MNWA 3GCTG 3ODDA 1AY6H 3Q3KA 3SORA 3SV7A 2R9PA 1UTMA 1NFYA 4GCHF 1MU8B 1T31A 1FONA 1P57B 1LHDH 1EB1H 2IN2A 2FOBA 2FOMB 2A2QH 2ZPRA 2CGAA 1QJ6B 2ANMH 2DE8A 1QBOA 3VB5A 2PUQH 2J9NA 1GHXH 1ZTLA 4RN6A 2V0BA 2R0LA 5EG4A 1BCUH 4GSOA 3RXCA 1DX5M 4AFUA 4FVDA 1QB9A 3H5CB 3IITA 3VB6A 1ZSLA 1FMGA 2FOEA 3SQHE 1LTOA 1O2VA 2AMQA 3QWCH 1UVSH 2BD4A 1O32A 2F9NA 4I33A 3OX7U 1XUIA 2O8MA 2G51A 4ZKSU 1H1BA 1VGCC 3A8DA 1DS2E 1OPHB 1C2EA 2WUCA 1D4PB 4Y71A 4Y8ZA 5ETXA 5JB8S 4X0WU 1OKXA 4FXGH 3QTVH 1C4U2 1LO6A 1AD8H 4Y0ZE 3K2UA 3S7HB 7ESTE 5F6MA 3LDXH 4CRDA 1VITG 2WPLS 2ZF0H 4WXVA 3GCTF 2FPZA 5C67A 1C5SA 3KNXA 2FEQH 4Q80A 1NRQH 4ZXYH 2FX4A 4BNRA 2HNTC 1UCYE 1D3PB 4AG1A 1O2ZA 5SGAE 3RM2H 3RLYH 1ESAA 3E6PH 3LH3A 2O8TA 2CHAB 2OC1A 3HK6B 1DPOA 1FPHH 3VXFH 1QJ7B 3PTNA 8LPRA 1N6YA 3FP6E 3P95A 4WF8A 1QURH 2DE9A 1QFKH 1WBGB 3MH4A 1QB1A 4A5TS 1ZSKA 3ZVAA 2AIQA 3ZVBA 5C1XA 4XDEA 1YM0A 4WMEA 4ESTE 3DFJA 2XYAA 4D7FA 1EUFA 1Y3UA 3LC3A 1MTNC 5JBAS 1ESTA 2BVSH 3GY5A 4X2YA 2GZ7A 1SFQB 2PSYA 1SQOA 4M7GA 4K8BA 3SV2H 2SNWA 3ZZDA 4IN2A 1GMCG 4F4OC 5GXPA 4YLUA 1C1NA 3MH6A 2B7DH 3ZVEA 1AUTC 1VITF 4BAHB 2I6QA 5JBBS 3SJIA 5BRRE 3LOXA 1MCTA 1AN1E 1AVWA 1S81A 3DHKH 1IQEA 4BAKB 4UD9H 1Z8IB 2YNAA 1O3CA 5DPAA 2VH6A 1BRBE 3PO1B 1TPOA 1C5NH 1GI1A 1ELTA 4AB9A 5C2ZA 1TGSZ 2BVXH 1J9CH 2P3UB 4DG4A 1AVGH 1TA2A 1EQ9A 1QCPA 1PJPA 2ZU3A 2ZA5A 3BTEE 4LXBH 2ZU5A 4KTUA 5JDUB 1T8LA 1TOCB 3M37A 1SG8B 2BD5A 2EI6A 1O0DH 1GJBB 1V2OT 1CSOE 2PKAB 3SGQE 4ABHA 2HPPH 3U98H 4FU8A 3AAVA 4NSVA 3D49H 1O2HA 2IPHA 4MTBA 1ELVA 1YPLH 1P05A 2A7HA 1ELDE 1ZTJA 2A4RA 1KDQB 4ZKNU 2HNTE 2CMYA 5FAHA 1C5VA 1V2NT 1GI2A 1KLIH 2XNIA 3ZVFA 2ZFSA 2ODPA 3LH1A 1O2MA 3SUDA 1K1IA 1GMCF 2W7UA 3UPEA 3RP2A 2SGQE 2R2WU 2UUYA 4K8YA 4X1SU 1O3IA 3T25A 4MDSA 4X1QU 1ZOMA 1HIAA 4NWLA 2ZQ2A 1NRRH 2Y7ZA 4YESB 5FHTA 2PGBB 4HFPB 1QNJA 1HGTH 1SL3A 1V2PT 1ID5H 1V2KT 2V3OH 1HAVA 1L4DA 1C9PA 5C3NA 2THFB 1TNIA 4MPXA 5DP9A 4ZUHA 4CRGA 3F1SB 3SU0A 2LNCA 4WXIA 1HYLA 1QIXB 1XUFA 3MHWU 2AIPA 1SLXB 3P17H 2RG3A 2AH4X 4RSPA 5T6FA 2NU2E 3BF6H 4SGAE 1TMTH 4KTCA 1ABJH 2J34A 2ZDNA 2ESTE 4B74A 3M7UA 2OTVA 2VIQA 2ZWLH 3QUMP 2F9UA 4AZ2B 5A8ZA 4Q2KA 1GBJA 2ZFPH 3SJOA 3SU4A 2Q6DA 1LHEH 2XCNA 2PV9B 1V2TT 4PROA 4MQAA 2ALVA 1Z7KA 3RXJA 1BTWA 1S84A 4ZH8A 4GHTA 1A46H 1RTKA 5K0HA 2BY9X 1CBWC 2XCFA 5C5OA 3ZVGA 4JCNA 1EOJA 3A8CA 5FPSA 1O5BB 3RUOA 4JZEH 2ZCKP 2BDGA 3GY8A 1G3EA 1AUJA 1YCPM 1TGNA 1FNIA 1TALA 1GJ8B 4Y79A 2VWMA 2F91A 1QQUA 3ZZCA 2A4GA 3FP7E 3TITA 2SGAA 5K7RA 2Y5HA 4INLA 4LK4A 1GBLA 2H5CA 2FYQA 1LPGB 4FVBA 1HV7A 1WSSH 3I77A 3RXFA 1MUEB 1BDAA 4O97A 3S9BA 4NFEA 1QR3E 3RXQA 1PQ7A 2B0FA 2FP7B 4B1TA 4DGJA 5LGOA 1W7XH 3ZZBA 3H7OA 1GI6A 4UFEH 1ZPCA 1GGDC 2LPRA 2GDDA 4K3JA 1GBKA 3TU7H
chains in the Genus database with same CATH superfamily
1B0FA 1GJ9B 1XM1A 1L1NA 1C2MA 3GY4A 2FO9A 3MU4A 4NIWA 1A5GH 2OINA 3EAJA 2YMSC 2VVVA 1BMMH 5GIBA 3U9AH 3SHCH 2AEIH 4YXWD 1EPTB 1Z71A 2ZPSA 1H8ED 3P92A 2R3UA 3T62A 3M5NA 2WYGA 1C2FA 3BG8A 4NA8A 2ILNA 4P02A 3A7XA 2AFQB 2A5AA 1LQDB 1Y5BT 2ZHFH 1CT4E 2WINI 4WY3A 3MNSA 3RXAA 2ASUB 1OP8A 2ZGXH 1COWD 3QK1A 2BXUH 1XVOA 2NU1E 1NS3A 5GDSH 1QL9A 3GCOA 3RXGA 1V2WT 2BD8A 3KQEA 1VJ9U 1IOEA 1SFIA 2EC9H 4X1PU 3F9EA 2BDCA 5AF9H 4AORA 4AFQA 2AYWA 3F9FA 5DP8A 1FUJA 2CJIA 1SGTA 4FUEA 2G00A 4TYDA 3S9AA 1P2JA 1UTLM 4OGXA 3HKJB 1O3LA 2ZDVH 1AWFH 2BX4A 1AFQC 1BRCE 2C8WB 1BMLA 1FZZA 1GHBG 1Y3YA 2O8WA 1KY9A 3GCNA 3KHVA 1H9LB 1G3BA 1GMHG 2IJD1 1MAXA 2Z9LA 1CA8B 4IN1A 2ZDAH 4YOIA 1LDTT 2ZNKH 1FY4A 1JRSA 3DFLA 4FUGA 1Y5UT 1NRPH 3T28A 1CT2E 1THRH 5E0HA 1MZAA 4X2XA 1SMFE 1ETTH 2VIPA 1SQRA 3BTHE 4NWKA 3V3MA 1SQAA 2D26C 1O2WA 1DVAH 3B8JA 5JBCS 3A81A 3MNXA 2BD9A 2RCEA 2V7QD 1T32A 3FFGA 2B5TB 1V2RT 1WQVH 1L1GA 1ELCA 2G4TA 2P93A 3TGIE 1CHGA 1QY6A 4A1XA 3SHAH 1YKTA 2JJ1D 4Y7BA 1S83A 1O2UA 1Z8JB 3S0NA 4RT0A 1MU6B 1OYQA 2G52A 4ZHMU 2JKHA 4Y7AA 1FY5A 1OWIA 4BANB 1SGFA 1O2JA 3SJKA 5HIZA 1QA7A 1XUHA 4CH8B 1LHFH 1O3MA 4CRFA 2P16A 1TWXB 3JZ2B 1C5QA 1KXAA 1GHBF 4OS2A 2A31A 3OY5U 1EJNA 2PSXA 1EP5A 1GMHF 2J97A 1S0QA 1D9IA 1YPMH 4ABAA 1VITH 1DWEH 2BOHB 1MQ5A 1KTTB 1MQ6A 4OS6A 2P8OB 2PUXB 2VWLA 2Q6FA 4Y76A 1TPAE 2JETB 3VFEA 1AKSB 1O2XA 5DSFA 1O2RA 2QIQA 3EDXB 1GHWH 2AS9A 2XBWA 1BIOA 2A4QA 1IQGA 1BJVA 3ELAH 3UUZA 1GL0E 4AG2A 1HAOH 5EPNA 1O2YA 1PQ5A 1V2LT 3OYPA 1MKWH 1WTGH 2Y81A 3HGPA 2ZO3H 1KXBA 5E2OA 3NUMA 1P09A 3PO1C 5EJZA 5F8XA 2FESH 3F3BA 1O3GA 1YPKH 1C5OH 4YOGA 3M61U 1WXRA 4GHQA 1FI8A 3LONA 1O35A 1O3EA 2WPIS 5BPEA 1VCPA 1C4V2 2FI4E 2F9VA 1C1UH 4DIIH 2FOAA 3BEIB 2GZ9A 3SN8A 2ZECA 1THSH 5A0BA 1FN8A 3EGKH 1BTYA 1CBWB 1UHBA 2PWXA 3KL6A 1UTNA 3UNRA 4AFZA 1BHXF 1DLEA 4JYTA 1E38B 1L2EA 4ZXXH 4ZHAA 1AWHB 1E35B 1PYTD 1D6RA 1LVBA 5C0UA 2VJ1A 4OS5A 3RM0H 1ABIH 1ETRH 1HJ9A 1QL8A 4XE4A 1UVOA 3A8AA 5IYTA 1E36B 3TNSA 5L6NH 4X6PA 4FU9A 1O2KA 1OYTH 1ARCA 1MKWK 1O3PB 2VVCA 3LIWA 3B23B 3VXEH 1C5RA 3O8RA 1XKBC 3K6YA 4Q7ZA 2ZFFH 1AI8H 1LVYA 5A8XA 1K1LA 4AGJA 2BDIA 1GJAB 1SGCA 2SGFE 3OE7D 1NT1A 1GCTB 1AHTH 1P12E 3A7YA 1ZHMA 4X2WA 1NROH 3SGBE 3PWBA 1NN6A 2GT8A 1LKAA 3VB7A 1QRWA 3F0PA 1LPKB 2A0QB 1PFXC 3GY2A 3NPSA 2RA0A 1ARBA 4BTIB 2Y82A 5DG6A 1TFXA 2ZEBA 4D9QA 1OX1A 1MTWA 1A0LA 4XBDA 2P3TB 5HXFA 2TBSA 3STIA 3A7ZA 2EY4C 1W14U 2FODA 3MFJA 4NIVA 1YC0A 2A5IA 1P0SH 1GDQA 3QDZB 2CN0H 1XUGA 3M5OA 1IHTH 1PQAA 1ZGVA 1O2PA 3BIUH 2BY6X 1O2GH 1TE0A 3PYHA 5A0CA 3BSQA 1C5ZB 1W13U 4ZMAH 2BTCE 2BX3A 2P94A 3PM3A 4ACAA 3A87A 1P8VC 3SI4H 3ZYDA 2BB4A 2O9QA 1MKXK 1C1PA 1P2MA 2BXTH 1WTHD 3PB1E 1JXPA 4ASUD 3CENA 3TIUA 1V2UT 4WMFA 4AYYB 5CMXH 5E2PA 2GCHG 2EI8A 3BV9B 1MMJN 1SGFG 4ASHA 2RDEA 4A92A 1WOFA 1F7ZA 1MTUA 2GDEH 2BD2A 4B75A 1GDUA 1IQJA 3IWMA 3DT0H 2F83A 2NU0E 1CT0E 2QN5T 1SVPA 1S85A 9ESTA 1P3EA 4D9RA 3KGPA 3RXTA 1AFQB 5JYIA 4UFDH 3M7TA 1S6FA 1TNJA 2W3IA 1UTOA 5TCAA 1O3OA 1O5AB 5EJLA 1C1VH 3ZVCA 1K1JA 1DY8A 1FY8E 1T8MA 3F6UH 4YLQH 1QA0A 5F8TA 5I46H 4Q7YA 3UY9A 1O30A 3RC5A 3O8BA 1BMAA 2DUCA 1THPB 1NTPA 1MZDA 1C2LA 1DFPA 3TJOA 2VBCA 2Y80A 2PTCE 1SB1H 4LZ1H 1HBTH 1AGJA 1PPHE 4E7NA 3R3GB 1O2QA 1TABE 5B6LA 4I8GA 4DT7B 1H8IH 1NC6A 3FZDA 4OS4A 4IBLH 1SGRE 2Y5GA 1EPTC 1RRKA 3MH5A 3KIDU 3CS0A 4ISLA 1W11U 1BBRE 2KR7A 2A4OA 1DWBH 1ZJKA 3TJUA 1AO5A 2GCHF 2ZI2H 4IC5A 1F0TA 1Z8RA 1EZSC 1DT2A 3NXPA 3VEQB 1VR1H 1K28D 3MH7A 3GICB 5T6DA 1N1LA 3CP7A 4P00A 4Y8XA 1TLDA 1UVTH 4IW4E 2GT7A 2RFKC 1YPEH 1CA0B 5ESBA 2W5EA 1PPEE 2ZFTA 4FUJA 2VVUA 1B7XB 1TGBA 5A0AE 2F9OA 4ZAEA 3T2NA 3Q3XA 1FPCH 1FV9A 1G2LA 1CE5A 4Q63A 3BN9A 1D3QB 5EXMA 1TONA 1N8OB 1UW7A 3AVZA 1EX3A 3O8DA 4UEHH 2VGCB 3SGAE 2VWOA 3UNQA 3ZV9A 2FLRH 4UDWH 2XC5A 1O2TA 2QY0B 4JZIA 1UTPA 5I25A 2FDAA 4FUDA 1BOQA 2ODYB 1ZR0A 3WWFA 3LJJA 1GJ7B 1GVKB 2IPQX 4U30A 5CHAB 2M5TA 2JIZD 1BT7A 1TYNA 4ISIH 3PMAB 3BG4B 2YOLA 2ZGJA 2CK3D 1ZSJA 2AGIX 2FS9A 1YGCH 3T5FH 1JIRA 1ANDA 1SOTA 3SZNA 3SZEA 4JYVH 1P11E 1VZQH 1E37B 1ZJDA 2Z9GA 1PPGE 1JBUH 5EGMA 1CHOG 2ZU4A 2M2AA 2HALA 4JZFH 5GWZA 3M7QA 3MWIU 3MNCA 3M3VA 3NRLA 4O9VA 5J4QA 2D2DA 2BQ6B 1UMAH 1GWAA 5FX6A 3ZVDA 3PROA 2V6NA 2G55A 1GI0A 2J4IA 2BDHA 1M9UA 1A0HB 2BD3A 3UOPA 3ZZ7A 4Z6AH 1DY9A 1AQ7A 1HLTH 4K2YA 1L0ZA 1RGQA 1YPHC 4MPWA 5CDFE 1RIWB 2FTMA 2ZQ1A 1ZZZA 1J16A 3EYDA 1HAGE 4I31A 2H9HA 2PKAA 4ISNA 2Z6BD 3TH2H 1GJDB 3BTQE 3MO6A 1OXGA 2D1JA 2XBYA 5FCRA 2P8OC 3L33A 1KDQA 2JETC 1MD7A 1NPMA 1QBNA 3A7WA 2TGAA 3FAOA 3HK3B 4B73A 2OBOA 1GHAG 1O5DH 1P2IA 3E0PB 1P9SA 3A89A 3AW1A 2BD7A 1ZYOA 5FBIA 2J2UA 1RD3B 3SUEA 2VIWA 3ENSB 3H09A 4B6FA 4BXSA 1CHOF 3MU5A 6GCHG 4DOQA 4K1TA 1U6QA 3PMBB 5KEDA 2WUBA 1E79D 1MABB 1ZMLA 2D8WA 2UUFB 2SGDE 8ESTE 5KGOA 3TVJB 3SU2A 1GBFA 2YNBA 1P06A 2K0QA 2QAAA 3SUGA 3N99A 2WPHS 2OD3B 2TRMA 1QJ1B 3NCLA 1P2KA 1K21H 3KQBA 1UTQA 1OOKB 2A7JA 5CHBA 2QF4A 5C5NA 2BOKA 1BHXB 1F0UA 3RC6A 1EJAA 1OWDA 2PKSC 3M3SA 3P6ZB 1K9OE 4O03A 2J94A 1A61H 1YF4A 3MYWA 1XXDA 2ANWA 3RXPA 3UFAA 4U32A 4ABJA 2P59A 2H2ZA 1HNEE 3RMOH 4D7GA 3SJ8A 3KQCA 1A7SA 4IS5A 3MQKC 4TY6A 3HKIB 4KKDA 4I8LA 3RXVA 2ALPA 4NSYA 3OY6U 4XBBA 4NIXA 3A80A 2BYAX 1AVXA 1XUKA 1GHAF 1Q31A 2ZKSA 3SO3A 4I8KA 1MBQA 3DCLA 2AGGX 3PMJA 3I29A 1GHYH 3M35A 3RDZA 1OWHA 3A86A 2QE7D 4AOQA 1GCTC 1UK4A 2ZDKA 1RTLA 3TK5A 1K1PA 4B71A 2ZGHA 1ZLRA 1C2GA 1QQ4A 1YPHE 4BAOB 1A1RA 1P01A 2UWOA 4DT4A 6GCHF 4OS1A 1EZXC 4D76A 3U69H 3V12A 2BMGB 1YLNA 4X6NA 1K22H 1GBCA 1S6LA 4IMQA 3UR9A 1XUJA 3Q00A 3PTBA 3A85A 3RLWH 1TX6A 4GPGA 3KQDA 3LKWA 4YZUA 1IAUA 2GTBA 4A1TA 1EAIA 3A82A 3RMNH 1FDPA 2CF9H 3W94A 1CQQA 1Z1IA 1Q3XA 4ZHLU 4OM9A 2QF3A 3PLBA 3QTOH 1GI8B 2WV4A 1G30B 1O38A 1QRZA 5L2ZH 1RJXB 1CGJE 3TJNA 1YP9A 1YBWA 1PPFE 2ZU2A 4QT8C 3RU4E 1FLEE 3UTUH 4MLFB 1P03A 1C1RA 1GBHA 4J2YB 3GCHB 2OC7A 3ITIA 5LPEA 1EZUC 1O2SA 1GVLA 1O3FA 2KAIB 4THNH 3ZYEA 3UAIC 1HUTH 5F53A 2G8TA 4UE7H 3QO6A 1W8BH 3GYMA 4HG6A 1HJAC 1GG6B 4X6OA 1SPJA 1LHCH 1GHZA 3KEEA 4NIYA 2KCYA 4K1EA 1P04A 1OHHD 2XC0A 5AFYH 1BITA 1CU1A 3UNSA 1EPTA 3PMHB 2C93B 3V7TA 3SYJA 1KLJH 2Z9JA 1PQ8A 5DK1A 2YMSD 1IQMA 1IQIA 1GBEA 3SU5A 2Z9KA 1KXCA 1UK3A 2KCOA 4RKOB 1O31A 2JDID 4WVPE 1KXDA 1NY22 1K0HA 3OU0A 4NZQA 2HLDD 2QXGA 4ABGA 3UIRA 1K1NA 1QZ8A 2QYIA 4BAQB 2QV1A 4GAWA 4MPVA 1HXEH 5JBTA 1Y59T 3LGIA 3OEHD 3I78A 3L3TA 4XBCA 4F48B 3KF2A 1SLUB 4GVUA 1NFXA 2FX6A 4BTTB 1DUAA 1TPSA 3F2GA 1AZ8A 1TNGA 2SGPE 2OXSA 1MTSA 1ZPBA 3ZV8A 3DSGA 2F9PA 1IQFA 4FU7A 1G2MA 2VB0A 1O5CB 1Q2WA 1HB0B 2TGDA 3M5LA 5EW1H 3WY8A 1EOLA 2GVFA 2ZGBH 4ABBA 5A2MH 1C5UA 5CE1A 3HATH 3QX5H 3T29A 4CHAB 3RU4T 1SHHB 1G3DA 4OS7A 1HPGA 2FI5E 1D3TB 5EW2H 1Y3WA 3P8OA 4Y11E 3A88A 4WJG2 2QF0A 1LQEA 4HGCA 1O3DA 3N7OA 1CA0C 1T4UH 1RFNA 1SGDE 4NCYA 4DJZB 1RS0A 1O5EH 1NESE 4NFFA 4TPYA 2PW8H 5DP7A 1FN6A 1F5RA 1CO7E 1S0RA 1H9IE 7LPRA 3RXKA 1ZMNA 1TGCA 4X1RU 4TWWA 2BVRH 4DURA 2FOGA 4B2CA 5H4IB 2TPIZ 3F68H 1N8OC 1Z8GA 2JH6D 2V3MA 4E06H 2VGCC 1V2MT 1BJUA 2H9TH 3EA8A 4X6MA 1BMNH 3DUXH 1E1QD 1KMHB 4CBOA 2HOBA 2W7SA 8KME2 3LGUA 2FWWA 1T8NA 1WCZA 2UWPA 1O5FH 1P3CA 4UFFH 2J98A 1F0SA 1XKAC 5F03A 5CHAC 4K60A 1H4WA 3BG4C 2G81E 1HRTH 5DKMA 1ELFA 1GMDG 1F5KU 4A1VA 1SI5H 3SV8A 1HAHH 1PPZA 3VGCB 1O3KA 2GGVB 3U1JB 1EZQA 3FANA 2O8UA 2UUKB 3UWJH 1LVOA 3DA9B 3W1EA 1Y3XA 1WQSA 1Z6JH 1EB2A 3D62A 3E0NB 1GBDA 2ZHWH 4H6TA 1J8AA 1V3XA 1G9IE 1FIWA 3RXRA 4BTUB 1ANEA 5EXNA 2WHXA 4DW2U 1DSUA 4X2VA 1MCVA 5PTPA 5C20A 5HYOA 2PKSB 2KM0A 4AN7A 1YWUA 1NFWA 2A2XH 2XBXA 1KIGH 4E7RG 2TIOA 3TH3H 1OP2A 1JMOH 2KZ4A 5EJ1A 3SNBA 2Z7FE 2GCTB 1V2QT 3H7TA 1ELAA 4DIHH 1BTUA 1HDTH 3K9XB 3KYFA 4HI3A 3DSPA 2C8YB 1Z6EA 1RXPA 4JZDH 2WV5A 2OC8A 1INCA 1TQ0B 1RIWC 1EP6A 2V35A 3EE0B 3ZZ3A 5HM2A 1MKXH 1UTKA 4CH2B 3P8NA 1O3BA 1H8DH 4ABEA 1IQNA 3GY7A 2XW9A 4X1NU 4VGCB 1O3AA 2C8ZB 2UUJB 3SU6A 1QL7A 1X7AC 5B6OA 1O36A 1FIZA 1C2IA 1UVPA 1AMHA 3BTME 4ZCNA 1DXPA 1BZXE 1GMDF 2FMJA 1J15A 1O3HA 1HCGA 2BQWB 3AAUA 2BQ7B 3E3TA 3SOSA 1GBMA 1DSTA 1BRUP 3KQ5A 4O3UA 2BDAA 3E90B 1GI3A 1ZRKA 1SBWA 5EQSA 4IMZA 1MTVA 1GL1A 3MO3A 5DP4A 1A5IA 1BRAA 3BTTE 1TMUH 1ACBE 5L30H 1G37A 2IJOB 4MPUA 1W7GH 2SGEE 3LC5A 2F3CE 1SSXA 1P10A 1GJCB 4JMYA 1TRMA 4YT6H 2BLOA 5EOKA 1FAXA 2BM2A 1BTHH 1T8OA 2F4LA 4K69A 1C1WH 1HAZB 3RC4A 2W3KA 2H1UA 2HNTF 2VU8E 4B2AA 3U8RH 2J38A 1N6XA 1TMBH 4MG3A 4IGDA 3S9CA 4H4FA 1HJAB 1CGHA 1TX8A 2TGTA 1TBRH 1CGIE 4Q7XA 1V2VT 2XWAA 3P70B 4JK6A 1W0YH 4RI0A 1WUNH 1O33A 2BZAA 1HAYB 5EXLA 4R8TB 1V2ST 5DN6D 2ZDLA 2FYRA 2XOKD 1OSSA 3TNTA 1K1OA 3GYLB 3C27B 3R0FA 3TK9A 3T27A 2FTLE 1C5PA 2ZPQA 1LKBA 1IQKA 4JK5A 1FXYA 5FX5A 2HPQH 3RXUA 1S5SA 4YO9A 3VB3A 1C5WB 2HGTH 4DY7B 1GBBA 1NRSH 1HFDA 3MU8A 2OCVB 2AERH 1EAXA 5EQRA 1A5HA 1LCYA 3MMGA 2PTNA 2J92A 3HGNA 1YLDA 1O3JA 2VIVA 3F9GA 1ESBA 5DGJA 2QCYA 3E91A 3T26A 2EI7A 3WW7A 5C1YA 4ABFA 1TBQH 3D23A 2EQNA 3OTJE 1DWCH 4AX9H 4SGBE 1DANH 1TB6H 3KYGA 4JYUH 4WH6A 3HPTB 4GUXA 1LVMA 3BTDE 4TWYA 2HVXA 7KMEH 4M9FA 1T4VH 1XXFA 1KXFA 2OBQA 4H42U 2Z3EA 3MU0A 5J4SA 2FOCA 3GCHC 1P2QA 2C90B 3FO8D 4YT7H 3FN8A 1UVUH 4DVAU 3ZZ9A 3ATMA 1ZMJA 2VIOA 1HAPH 4X8VH 2GZ8A 1GG6C 2QXHA 2JH5D 2OQ5A 1QBVH 4DCDA 2W6JD 2ZTYA 1BQYA 2QF5A 4WWYA 1GPZA 2FIRH 3QZQA 1Y5AT 4TPIZ 4BOHA 2LELA 4LOYH 3UQVA 4YTAA 1ZTKA 2Z94A 3PRBA 4XSKU 3SV6A 3BIVH 4MNVA 5FBEA 2NU3E 3UREA 1AFEH 1GI5A 4ISOA 2K1QA 3UWIA 2PFEA 5T6GA 3SU1A 2GMTC 3ATWA 1C1MA 3KN2A 4A6LA 1KTSB 2BY5X 3DD2H 3ODFA 1DDJA 4F49A 2WPDD 3FKSD 2ANYA 2Z3DA 2B8OH 5T3HA 3RMMH 3JZ1B 1YPGH 4UONA 4Y8YA 3P8GA 1V6DA 2HLCA 1DUEA 1J14A 1ETSH 3LGYA 3BTKE 3LGVA 4FUBA 3SQEE 4K5ZA 3FP8E 2ZGCA 1SGEE 4R0IA 2Y5FA 2J95A 1O2NA 2NWNA 5GCHG 4MNYA 1BTPA 1VCWA 1TA6A 1GCDA 1SC8U 1TOMH 1UJ1A 2CV3A 1C1SA 1C4Y2 3K6ZA 5TCCA 1DWDH 1SLWB 4BAMB 4CHAC 4WMDA 1AB9C 1TNKA 4O3TA 3RXHA 1DE7H 1HIAB 2ZFRH 2W26A 1OWKA 1HAVB 1DITH 1VJAU 3RXIA 4A7IB 2QXJA 3AW0A 1Y3VA 1QB6A 2TGPZ 3ESTA 1O34A 2BLVA 1C1QA 2FXRA 4XOJA 3BTFE 4I8HA 4UFGH 5IDKA 3QZRA 5JB9S 5C17A 4U01A 3A84A 3ZIAD 4WH8A 1W12U 4H6SB 4AFSA 3QN7A 2BY8X 2AMPA 1O37A 5C94A 3M36A 3MU1A 6CHAB 1IQLA 5LH8A 2Q1JA 2GD4B 1SQTA 2XNDD 1W10U 5HKKD 4CREA 1EXFA 1OWEA 3TGJE 5DP5A 1UCYH 1OS8A 1FJSA 1MD8A 3PV2A 2ZTXA 2A1DB 1SKYE 2A32A 5GCHF 3MO9A 3TLOA 3E8LA 2BDBA 3ZZAA 1BBRH 1BUIA 1BB0B 3BTWE 1JRTA 3GDUA 1QHRB 3VGCC 1GBIA 4KTSA 1IQHA 1TGTA 4CR5A 4CR9A 2ZHQH 4KP0A 4AC9A 1XX9A 2HRVA 1F92A 4FUCA 1C5XB 5A09A 3QLPH 5EQQA 3NZIA 5AVDA 1RTFB 1W2KH 1YYY1 1GI4A 3O8CA 2WPKS 2ZHDA 1SGQE 2QA9E 1EAWA 4I86A 4NG9H 2R2MB 2OUAA 2KX4A 4K1SA 1GVZA 2G4UA 2ZC9H 3GOVB 5EODA 3UOUA 3SI3H 1AE5A 1DICA 1HAIH 1AIXH 1ANCA 2BY7X 3GY3A 3Q76A 2GCTC 3SNCA 3RU4D 3SNEA 3NKKA 3ZZ8A 1TX7A 2QGRA 2BZ6H 1GBTA 1E0FD 3RXEA 3ZZ4A 1B5GH 1NBME 2ODQA 3A8BA 1GJ6A 3L6PA 5ESTE 1UCYK 5DP3A 2GV7A 3SNDA 1GDNA 1V2JT 1NU7B 1VKYA 1C5TA 1ZGIA 2RDLA 3E16B 1BBRK 3WWBA 4VGCC 4XFQA 4Q4LA 1NFUA 2ZCLP 1GBAA 1GHVH 1NRNH 1E34B 2Y6TA 4X8SH 1EKBB 1C2JA 2P95A 4AB8A 1O2IA 3U1IB 2GV6A 1EFRD 3RMLH 1JOUB 1DLKB 5EPYA 3MOCA 1O2OA 5DO4H 2VNTA 2V3HH 1C5LH 1ZHRA 1Z1JA 1K2I1 4E05H 3GDVA 2ZFQH 3F0OA 3NK8A 1SGPE 2OP9A 2OQUA 1VGCB 3TGKE 3V13A 4ABIA 1VCQA 1W0ZU 5F8ZA 1DOJA 2P3FH 5GPIB 2GJGA 2ZG0H 4CRAA 4NZLA 2OLGA 4INHA 2R0KA 1A2CH 1ORFA 5E0JA 3TPIZ 4I32A 3UR6A 1NM6A 1WAYB 1W0KD 3QGNB 5FPYA 1GJ4H 1OP0A 3FZZA 5L2YH 4I8JA 2XXLA 3EA7A 5E8EH 1ELEE 2WPJS 1YY3A 2ZP0H 2Z3CA 4NGAH 1C2KA 2A5KA 4ZKOU 2ZTZA 1XVMA 3SW2B 2FZZA 3ATLA 3RXOA 1P2OA 1SHYA 3SJ9A 3EQ0H 2W6ID 3PLPA 1FY1A 5TJXA 2VWNA 3OSYA 2ZZUH 2HWLB 1TPPA 4CRCA 1J17T 4ISHH 4ZKRU 1UO6A 5G4BA 4LZ4B 4NA7A 4AGKA 3GISB 2C4FH 4B2BA 1P2NA 3RXMA 4IC6A 1A0JA 1C9TA 4X8TH 3VPKA 1O3NA 2LP6A 1LHGH 1UK2A 4MNXA 2SNVA 3LT3A 4KELA 3QGJA 1TBZH 5A8YA 4FUHA 3F2HA 3E1XB 1OWJA 2KAIA 5HMAA 1ZRBA 3VB4A 1MTNB 2BDYA 4FUFA 5C1UA 1AZZA 1C2DA 1MH0A 2GMTB 4Y6DA 2AMDA 4GLYA 3SU3A 2JH0D 4KGAA 1BTXA 1C5YB 1B0EA 2H6MA 2PHBA 2STAE 1QTFA 2AHME 4HZHA 1NZQH 1D6WA 4J1YA 1SGYE 3U8TH 3M5MA 5E0GA 5GJ4B 3LGWA 1D3DB 4B76A 4YOJA 2OC0A 4CRBA 1ZHPA 2C8XB 3PLKA 2VINA 1C1TA 1ANBA 3LGTA 4F55A 1C1OA 5KECA 5AHGH 1A3BH 4Y0YE 1SR5C 1TRYA 2Y7XA 4BXWA 3MI4A 1ELBA 4JZ1A 2FI3E 1FQ3A 5DP6A 1TAWA 1XMNB 1F2SE 2ZHEH 2Q6GA 1L4ZA 1AB9B 5ABWA 1GI7B 2ZU1A 5JPMH 2PP6A 1MAYA 3NWUA 4FUIA 2I6SA 2WYJA 1W0JD 1SGIB 2BLWA 3K65B 3GDSA 3URDA 7GCHG 3ZZ5A 2CHAC 2F9BH 4NA9H 2PLXA 5FPTA 3OEED 5DJ7A 1H9HE 4Y10E 5FXLA 1PPCE 1AU8A 3FVFB 1WU1A 3TH4H 2L6OA 1TIOA 2GKVE 3BTGE 2FOFA 2O8LA 4INKA 5FL7D 3SV9A 1EJMA 3UB0A 3RXBA 1KYNA 2ANKH 4RKJB 3TJVA 2NU4E 3D65E 3PWCA 2KCAA 1JIMA 3SNAA 5HGGA 3LU9B 2KCPA 6LPRA 2WSSD 5FCKA 2WV9A 2EA3A 4U2WA 2ZIQH 2J98B 4D8NA 5LPFA 1T7CA 2XC4A 1C5MD 3SBKA 1KSNA 1DM4B 2FM2A 2B9LA 1P02A 1O2LA 2ULLA 3EA9A 3LJOA 3BEFB 2BHGA 1SLVB 1UTJA 1A3EH 2R3YA 1YCPH 1A4WH 2QC2A 5AFZH 4Z0KA 1BA8B 3RXDA 2FOHA 2EEKA 2WPMS 1PYTC 1IHSH 1AKSA 1ZPZA 5HIYA 1UHBB 2ZCHP 4OGYA 3S7KB 2A45B 2VIDA 3MNBA 2FS8A 4MVNA 1TQ7B 1TRNA 1F5LA 2A7CA 2JJ2D 1NO9H 9LPRA 4TSFD 7GCHF 1GI9B 4YM9A 8GCHG 2GP9B 2AGEX 1HAXB 4AYVB 2BLQA 3F9HA 2VH0A 1NU9A 1Y8TA 4FOUC 1K1MA 1C2HA 3C1KA 4TY7A 1L1JA 4HTCH 2GX4A 1O39A 5GNDA 3SUFA 3V0XA 1KXEA 3PRDA 1JWTA 3ATKA 1HXFH 1F0RA 2ZDMA 3W95A 2XBVA 1MBMA 3BEUA 3GY6A 1EATA 3S69A 3N7DA 3U8OH 2STBE 3M3TA 3AASA 2H5DA 4CBNA 1SGNE 3Q77A 1QGFA 4GCHG 5EU8A 3UQOA 1FAKH 2H9EH 1FY3A 1YCPK 2XTTB 3CS7A 2C3SA 3A83A 2IOTA 6CHAC 1BTZA 1KLTA 1SOZA 1TNHA 1EAUA 3STJA 3B9FH 1YPJH 1QRXA 3A7VA 5LPRA 2XRCA 3IG6B 1HJ8A 4ABDA 3MTYA 2PGQB 6ESTA 2Z9IA 3A7TA 1G32B 1WYKA 1S6HA 3RXLA 1DXWA 2WZQA 3P8FA 1PPBH 1TNLA 2CF8H 3KCGH 2SFAA 3G01A 8GCHF 3URCA 1P9UA 2CXVA 1S82A 2QXIA 3PV4A 3Q3YA 4TT3D 1O5GH 3OAAD 2FLBH 4I7YH 1GGDB 5HM9A 1G3CA 1ELGA 1GJ5H 3ZZ6A 2G5VA 2PR3A 2KFWA 2XWBI 3ATIA 3PV5A 1W3CA 2G5NA 2RA3A 3RXSA 4FETA 1LMWB 4XD7D 1CVWH 2YMSB 1AE8H 3LPRA 1WV7H 4X8UH 1G36A 3TK6A 1EASA 1YLCA 4ZROA 1LPZB 2UWLA 4MNWA 3GCTG 3ODDA 1AY6H 3Q3KA 3SORA 3SV7A 2R9PA 1UTMA 1NFYA 4GCHF 1MU8B 1T31A 1FONA 1P57B 1LHDH 1EB1H 2IN2A 3AK5A 2FOBA 2FOMB 2A2QH 2ZPRA 2CGAA 1QJ6B 2ANMH 2DE8A 1QBOA 3VB5A 2PUQH 3OTPA 2J9NA 1GHXH 1ZTLA 4RN6A 2V0BA 2R0LA 5EG4A 1BCUH 4GSOA 3RXCA 1DX5M 4AFUA 4FVDA 1QB9A 3H5CB 5EIYA 3IITA 3VB6A 3DSOA 1ZSLA 3F2FA 1FMGA 2FOEA 3SQHE 1LTOA 1O2VA 2AMQA 3QWCH 1UVSH 2BD4A 1O32A 2F9NA 4I33A 3OX7U 1XUIA 2O8MA 2G51A 4ZKSU 1H1BA 1VGCC 3A8DA 1DS2E 1OPHB 1C2EA 2WUCA 1D4PB 4Y71A 4Y8ZA 5ETXA 5JB8S 4X0WU 1OKXA 4FXGH 3FOAA 3QTVH 1C4U2 1LO6A 1AD8H 4Y0ZE 3K2UA 3S7HB 7ESTE 5F6MA 3LDXH 4CRDA 1VITG 2WPLS 5IK2D 2ZF0H 4WXVA 3GCTF 2FPZA 5C67A 1C5SA 3KNXA 2FEQH 4Q80A 1NRQH 4ZXYH 2FX4A 4BNRA 2HNTC 1UCYE 1D3PB 4AG1A 1O2ZA 5SGAE 3RM2H 3RLYH 1ESAA 3E6PH 3LH3A 2O8TA 2CHAB 2OC1A 3HK6B 1DPOA 1FPHH 4XRNA 1QJ7B 3PTNA 3VXFH 8LPRA 1N6YA 3FP6E 3P95A 4WF8A 1QURH 2DE9A 1QFKH 1WBGB 3MH4A 1QB1A 3N7EA 4A5TS 1ZSKA 3ZVAA 2AIQA 3ZVBA 5C1XA 4XDEA 3OFND 1YM0A 3U28C 4WMEA 4ESTE 3DFJA 2XYAA 4D7FA 1EUFA 1Y3UA 3LC3A 1MTNC 5JBAS 1ESTA 2BVSH 3GY5A 4X2YA 2GZ7A 1SFQB 2PSYA 1SQOA 4M7GA 4K8BA 1E1RD 3SV2H 2SNWA 4B6EA 3ZZDA 4IN2A 1GMCG 4F4OC 5GXPA 4YLUA 4Z1MD 1C1NA 3MH6A 2B7DH 3ZVEA 1AUTC 1VITF 4BAHB 2I6QA 5JBBS 3SJIA 5BRRE 3LOXA 1MCTA 1AN1E 1AVWA 1S81A 3DHKH 1IQEA 4BAKB 4UD9H 1Z8IB 2YNAA 1O3CA 5DPAA 2VH6A 1BRBE 1H8HD 3PO1B 1TPOA 1C5NH 1GI1A 1ELTA 4AB9A 3CNRA 5C2ZA 1TGSZ 1WDIA 1J9CH 2BVXH 2P3UB 4DG4A 1AVGH 1TA2A 1EQ9A 1QCPA 1PJPA 2ZU3A 2ZA5A 3BTEE 4LXBH 2ZU5A 4KTUA 5JDUB 1T8LA 1TOCB 1BMFD 3M37A 1SG8B 2BD5A 2EI6A 1O0DH 1GJBB 1V2OT 1CSOE 2PKAB 3SGQE 4ABHA 2HPPH 3U98H 4FU8A 3AAVA 4NSVA 3D49H 1O2HA 2IPHA 4MTBA 1ELVA 1YPLH 1P05A 2A7HA 1ELDE 1ZTJA 2A4RA 1KDQB 4ZKNU 2HNTE 2CMYA 5FAHA 1C5VA 1V2NT 1GI2A 1KLIH 2XNIA 3ZVFA 2ZFSA 2ODPA 3LH1A 1O2MA 3VG8A 3SUDA 1K1IA 1GMCF 2W7UA 3UPEA 3RP2A 2SGQE 2R2WU 2UUYA 4K8YA 4X1SU 1O3IA 3T25A 4MDSA 4X1QU 1ZOMA 1HIAA 4NWLA 2ZQ2A 1NRRH 2Y7ZA 4YESB 5FHTA 2PGBB 4HFPB 1QNJA 1NBMD 1HGTH 1SL3A 3EE7A 1V2PT 1ID5H 1V2KT 2V3OH 1HAVA 1L4DA 1C9PA 5C3NA 2THFB 1TNIA 4MPXA 5DP9A 4ZUHA 4CRGA 3F1SB 2HVYB 3SU0A 2LNCA 4WXIA 1HYLA 1QIXB 4ACBA 1XUFA 3MHWU 2AIPA 1SLXB 3P17H 4RT1A 2RG3A 2AH4X 4RSPA 5T6FA 2NU2E 3BF6H 1FX0B 4SGAE 1TMTH 4KTCA 1ABJH 2J34A 2ZDNA 2ESTE 4B74A 3M7UA 2OTVA 2VIQA 2ZWLH 3QUMP 2F9UA 4AZ2B 5A8ZA 4Q2KA 1GBJA 2ZFPH 3SJOA 3SU4A 2Q6DA 2OK5A 1LHEH 2XCNA 2PV9B 1V2TT 4PROA 4MQAA 2ALVA 1Z7KA 3RXJA 1BTWA 1S84A 2L74A 4ZH8A 4GHTA 1A46H 1RTKA 5T1VA 5K0HA 2BY9X 1CBWC 2K8IA 2XCFA 5C5OA 3ZVGA 4JCNA 1EOJA 2F43B 3A8CA 5FPSA 1O5BB 3RUOA 4JZEH 2ZCKP 2BDGA 3GY8A 1G3EA 1AUJA 1YCPM 1TGNA 1FNIA 1TALA 1GJ8B 4Y79A 2VWMA 2F91A 1QQUA 3ZZCA 2A4GA 3FP7E 3TITA 2SGAA 5K7RA 2Y5HA 4INLA 4LK4A 1GBLA 2H5CA 2FYQA 1LPGB 2J5UA 4FVBA 1HV7A 1WSSH 3I77A 3RXFA 1MUEB 1BDAA 4O97A 3S9BA 4NFEA 1QR3E 3RXQA 1PQ7A 2B0FA 2FP7B 4B1TA 4DGJA 5LGOA 1W7XH 3ZZBA 3H7OA 5C0TA 1GI6A 4UFEH 1ZPCA 1GGDC 2LPRA 3GS9A 2GDDA 4K3JA 1GBKA 3TU7H
chains in the Genus database with same CATH topology
1B0FA 1GJ9B 1XM1A 1L1NA 1C2MA 3GY4A 2FO9A 3MU4A 4NIWA 1A5GH 2OINA 3EAJA 2VVVA 1BMMH 5GIBA 3U9AH 3SHCH 2AEIH 1EPTB 1Z71A 2ZPSA 3P92A 2R3UA 3T62A 3M5NA 2WYGA 1C2FA 3BG8A 4NA8A 2ILNA 3A7XA 2AFQB 2A5AA 1LQDB 1Y5BT 2ZHFH 1CT4E 2WINI 4WY3A 3MNSA 3RXAA 2ASUB 1OP8A 2ZGXH 3QK1A 2BXUH 1XVOA 2NU1E 1NS3A 5GDSH 1QL9A 3GCOA 3RXGA 1V2WT 2BD8A 3KQEA 1VJ9U 1IOEA 1SFIA 2EC9H 4X1PU 3F9EA 2BDCA 5AF9H 4AORA 4AFQA 2AYWA 3F9FA 5DP8A 1FUJA 2CJIA 1SGTA 4FUEA 2G00A 4TYDA 3S9AA 1P2JA 1UTLM 4OGXA 3HKJB 1O3LA 2ZDVH 1AWFH 2BX4A 1AFQC 1BRCE 2C8WB 1BMLA 1FZZA 1GHBG 1Y3YA 2O8WA 1KY9A 3GCNA 3KHVA 1H9LB 1G3BA 1GMHG 1MAXA 2Z9LA 1CA8B 4IN1A 2ZDAH 4YOIA 1LDTT 2ZNKH 1FY4A 1JRSA 3DFLA 4FUGA 1Y5UT 1NRPH 3T28A 1CT2E 1THRH 5E0HA 1MZAA 4X2XA 1SMFE 1ETTH 2VIPA 3BTHE 4NWKA 3V3MA 1SQAA 2D26C 1O2WA 1DVAH 3B8JA 5JBCS 3A81A 3MNXA 2BD9A 2RCEA 1T32A 3FFGA 2B5TB 1V2RT 1WQVH 1L1GA 1ELCA 2G4TA 2P93A 3TGIE 1CHGA 1QY6A 4A1XA 3SHAH 1YKTA 4Y7BA 1S83A 1O2UA 1Z8JB 3S0NA 1MU6B 1OYQA 2G52A 4ZHMU 2JKHA 4Y7AA 1FY5A 1OWIA 4BANB 1SGFA 1O2JA 3SJKA 1QA7A 1XUHA 4CH8B 1LHFH 1O3MA 4CRFA 2P16A 1TWXB 3JZ2B 1C5QA 1KXAA 1GHBF 4OS2A 2A31A 3OY5U 1EJNA 2PSXA 1EP5A 1GMHF 1S0QA 1D9IA 1YPMH 4ABAA 1VITH 1DWEH 2BOHB 1MQ5A 1KTTB 1MQ6A 4OS6A 2P8OB 2PUXB 2VWLA 2Q6FA 4Y76A 1TPAE 2JETB 3VFEA 1AKSB 1O2XA 1O2RA 2QIQA 3EDXB 1GHWH 2AS9A 2XBWA 1BIOA 2A4QA 1IQGA 1BJVA 3ELAH 3UUZA 1GL0E 4AG2A 1HAOH 5EPNA 1O2YA 1PQ5A 1V2LT 3OYPA 1MKWH 1WTGH 2Y81A 3HGPA 2ZO3H 1KXBA 5E2OA 3NUMA 1P09A 3PO1C 5F8XA 2FESH 1O3GA 1YPKH 1C5OH 4YOGA 3M61U 4GHQA 1FI8A 3LONA 1O35A 1O3EA 2WPIS 5BPEA 1VCPA 1C4V2 2FI4E 2F9VA 1C1UH 4DIIH 2FOAA 3BEIB 2GZ9A 3SN8A 2ZECA 1THSH 5A0BA 1FN8A 3EGKH 1BTYA 1CBWB 1UHBA 2PWXA 3KL6A 1UTNA 3UNRA 4AFZA 1BHXF 1DLEA 4JYTA 1E38B 1L2EA 4ZXXH 4ZHAA 1AWHB 1E35B 1PYTD 1D6RA 1LVBA 2VJ1A 4OS5A 3RM0H 1ABIH 1ETRH 1HJ9A 1QL8A 4XE4A 1UVOA 3A8AA 5IYTA 1E36B 3TNSA 5L6NH 4X6PA 4FU9A 1O2KA 1OYTH 1ARCA 1MKWK 1O3PB 2VVCA 3LIWA 3B23B 3VXEH 1C5RA 3O8RA 1XKBC 3K6YA 4Q7ZA 2ZFFH 1AI8H 1LVYA 5A8XA 1K1LA 4AGJA 2BDIA 1GJAB 1SGCA 2SGFE 1NT1A 1GCTB 1AHTH 1P12E 3A7YA 1ZHMA 4X2WA 1NROH 3SGBE 3PWBA 1NN6A 2GT8A 1LKAA 3VB7A 1QRWA 1LPKB 2A0QB 1PFXC 3GY2A 3NPSA 2RA0A 1ARBA 4BTIB 2Y82A 5DG6A 1TFXA 2ZEBA 4D9QA 1OX1A 1MTWA 1A0LA 4XBDA 2P3TB 5HXFA 2TBSA 3STIA 3A7ZA 4NIVA 1W14U 2FODA 3MFJA 1YC0A 2A5IA 1P0SH 1GDQA 3QDZB 2CN0H 1XUGA 3M5OA 1IHTH 1PQAA 1ZGVA 1O2PA 3BIUH 2BY6X 1O2GH 1TE0A 3PYHA 5A0CA 3BSQA 1C5ZB 1W13U 4ZMAH 2BTCE 2BX3A 2P94A 3PM3A 3A87A 1P8VC 3SI4H 3ZYDA 2BB4A 2O9QA 1MKXK 1C1PA 1P2MA 2BXTH 1WTHD 3PB1E 1JXPA 3CENA 3TIUA 1V2UT 4WMFA 4AYYB 5CMXH 5E2PA 2GCHG 2EI8A 3BV9B 1MMJN 1SGFG 4ASHA 4A92A 1WOFA 1F7ZA 1MTUA 2GDEH 2BD2A 4B75A 1GDUA 1IQJA 3IWMA 3DT0H 2F83A 2NU0E 1CT0E 2QN5T 1SVPA 1S85A 9ESTA 1P3EA 4D9RA 3KGPA 3RXTA 1AFQB 5JYIA 4UFDH 3M7TA 1S6FA 1TNJA 2W3IA 1UTOA 5TCAA 1O3OA 1O5AB 1C1VH 3ZVCA 1K1JA 1DY8A 1FY8E 1T8MA 3F6UH 4YLQH 1QA0A 5F8TA 5I46H 4Q7YA 3UY9A 1O30A 3RC5A 3O8BA 1BMAA 2DUCA 1THPB 1NTPA 1MZDA 1C2LA 1DFPA 3TJOA 2Y80A 2PTCE 1SB1H 4LZ1H 1HBTH 1AGJA 1PPHE 4E7NA 3R3GB 1O2QA 1TABE 4I8GA 4DT7B 1H8IH 1NC6A 3FZDA 4OS4A 4IBLH 1SGRE 2Y5GA 1EPTC 1RRKA 3MH5A 3KIDU 3CS0A 4ISLA 1W11U 1BBRE 2A4OA 1DWBH 1ZJKA 3TJUA 1AO5A 2GCHF 2ZI2H 4IC5A 1F0TA 1Z8RA 1EZSC 1DT2A 3NXPA 3VEQB 1VR1H 1K28D 3MH7A 3GICB 5T6DA 1N1LA 3CP7A 4Y8XA 1TLDA 1UVTH 4IW4E 2GT7A 1YPEH 1CA0B 5ESBA 2W5EA 1PPEE 2ZFTA 4FUJA 2VVUA 1B7XB 1TGBA 5A0AE 2F9OA 4ZAEA 3T2NA 3Q3XA 1FPCH 1FV9A 1G2LA 1CE5A 3BN9A 1D3QB 5EXMA 1TONA 1N8OB 3AVZA 1EX3A 3O8DA 4UEHH 2VGCB 3SGAE 2VWOA 3UNQA 3ZV9A 2FLRH 4UDWH 2XC5A 1O2TA 2QY0B 4JZIA 1UTPA 5I25A 2FDAA 4FUDA 1BOQA 2ODYB 1ZR0A 3LJJA 1GJ7B 1GVKB 4U30A 5CHAB 2M5TA 1BT7A 1TYNA 4ISIH 3PMAB 3BG4B 2YOLA 2ZGJA 1ZSJA 2AGIX 2FS9A 1YGCH 3T5FH 1JIRA 1ANDA 1SOTA 3SZNA 4JYVH 1P11E 1VZQH 1E37B 1ZJDA 2Z9GA 1PPGE 1JBUH 5EGMA 1CHOG 2ZU4A 2HALA 4JZFH 5GWZA 3M7QA 3MWIU 3MNCA 3M3VA 4O9VA 5J4QA 2D2DA 2BQ6B 1UMAH 1GWAA 5FX6A 3ZVDA 3PROA 2V6NA 2G55A 1GI0A 2J4IA 2BDHA 1M9UA 1A0HB 2BD3A 3UOPA 3ZZ7A 4Z6AH 1DY9A 1AQ7A 1HLTH 4K2YA 1L0ZA 1RGQA 1YPHC 4MPWA 1RIWB 2FTMA 2ZQ1A 1ZZZA 1J16A 3EYDA 1HAGE 4I31A 2H9HA 2PKAA 4ISNA 2Z6BD 3TH2H 1GJDB 3BTQE 3MO6A 1OXGA 2D1JA 2XBYA 5FCRA 2P8OC 3L33A 1KDQA 2JETC 1MD7A 1NPMA 1QBNA 3A7WA 2TGAA 3FAOA 3HK3B 4B73A 2OBOA 1GHAG 1O5DH 1P2IA 3E0PB 1P9SA 3A89A 3AW1A 2BD7A 1ZYOA 5FBIA 2J2UA 1RD3B 3SUEA 2VIWA 3ENSB 4BXSA 1CHOF 3MU5A 6GCHG 4DOQA 4K1TA 1U6QA 3PMBB 2WUBA 1ZMLA 2UUFB 2D8WA 2SGDE 8ESTE 3TVJB 3SU2A 1GBFA 2YNBA 1P06A 2QAAA 3SUGA 2WPHS 2OD3B 2TRMA 1QJ1B 3NCLA 1P2KA 1K21H 3KQBA 1UTQA 1OOKB 2A7JA 5C5NA 2BOKA 1BHXB 1F0UA 3RC6A 1EJAA 1OWDA 2PKSC 3M3SA 3P6ZB 1K9OE 4O03A 2J94A 1A61H 1YF4A 3MYWA 1XXDA 2ANWA 3RXPA 3UFAA 4U32A 4ABJA 2P59A 2H2ZA 1HNEE 3RMOH 4D7GA 3SJ8A 3KQCA 1A7SA 4IS5A 4TY6A 3HKIB 4KKDA 4I8LA 3RXVA 2ALPA 4NSYA 3OY6U 4XBBA 4NIXA 3A80A 2BYAX 1AVXA 1XUKA 1GHAF 1Q31A 2ZKSA 3SO3A 4I8KA 1MBQA 2AGGX 3PMJA 3I29A 1GHYH 3M35A 3RDZA 1OWHA 3A86A 4AOQA 1GCTC 1UK4A 2ZDKA 1RTLA 3TK5A 1K1PA 4B71A 2ZGHA 1ZLRA 1C2GA 1QQ4A 1YPHE 4BAOB 1A1RA 1P01A 2UWOA 6GCHF 4OS1A 1EZXC 4D76A 3U69H 3V12A 2BMGB 4X6NA 1K22H 1GBCA 4IMQA 3UR9A 1XUJA 3Q00A 3PTBA 3A85A 3RLWH 1TX6A 4GPGA 3KQDA 3LKWA 4YZUA 1IAUA 2GTBA 4A1TA 1EAIA 3A82A 3RMNH 1FDPA 2CF9H 3W94A 1CQQA 1Z1IA 1Q3XA 4ZHLU 2QF3A 3PLBA 3QTOH 1GI8B 2WV4A 1G30B 1O38A 1QRZA 5L2ZH 1RJXB 1CGJE 3TJNA 1YP9A 1YBWA 1PPFE 2ZU2A 4QT8C 3RU4E 1FLEE 3UTUH 4MLFB 1P03A 1C1RA 1GBHA 4J2YB 3GCHB 2OC7A 3ITIA 5LPEA 1EZUC 1O2SA 1GVLA 1O3FA 2KAIB 4THNH 3ZYEA 1HUTH 2G8TA 4UE7H 3QO6A 1W8BH 3GYMA 1HJAC 1GG6B 4X6OA 1SPJA 1LHCH 1GHZA 3KEEA 4NIYA 4K1EA 1P04A 2XC0A 5AFYH 1BITA 1CU1A 3UNSA 1EPTA 3PMHB 2C93B 3V7TA 1KLJH 2Z9JA 1PQ8A 5DK1A 3SU5A 1IQMA 1IQIA 1GBEA 2Z9KA 1KXCA 1UK3A 4RKOB 1O31A 4WVPE 1KXDA 1NY22 3OU0A 4NZQA 2QXGA 4ABGA 3UIRA 1K1NA 2QYIA 4BAQB 2QV1A 4GAWA 4MPVA 1HXEH 5JBTA 1Y59T 3LGIA 4XBCA 3I78A 3L3TA 3KF2A 1SLUB 4GVUA 1NFXA 2FX6A 4BTTB 1DUAA 1TPSA 1AZ8A 1TNGA 2SGPE 2OXSA 1MTSA 1ZPBA 3ZV8A 2F9PA 1IQFA 4FU7A 1G2MA 2VB0A 1O5CB 1Q2WA 1HB0B 2TGDA 3M5LA 5EW1H 3WY8A 1EOLA 2GVFA 2ZGBH 4ABBA 5A2MH 1C5UA 5CE1A 3HATH 3QX5H 3T29A 4CHAB 3RU4T 1SHHB 1G3DA 4OS7A 1HPGA 2FI5E 1D3TB 5EW2H 1Y3WA 3P8OA 4Y11E 3A88A 4WJG2 2QF0A 1LQEA 4HGCA 1O3DA 3N7OA 1CA0C 1T4UH 1RFNA 1SGDE 4NCYA 4DJZB 1RS0A 1O5EH 1NESE 4NFFA 4TPYA 2PW8H 5DP7A 1FN6A 1F5RA 1CO7E 1S0RA 1H9IE 7LPRA 3RXKA 1ZMNA 1TGCA 4X1RU 4TWWA 2BVRH 4DURA 2FOGA 4B2CA 5H4IB 2TPIZ 3F68H 1N8OC 1Z8GA 2JH6D 4E06H 2VGCC 1V2MT 1BJUA 2H9TH 3EA8A 4X6MA 1BMNH 3DUXH 4CBOA 2HOBA 2W7SA 8KME2 3LGUA 2FWWA 1T8NA 1WCZA 2UWPA 1O5FH 1P3CA 4UFFH 1F0SA 1XKAC 5F03A 5CHAC 4K60A 1H4WA 3BG4C 2G81E 1HRTH 5DKMA 1ELFA 1GMDG 1F5KU 4A1VA 1SI5H 3SV8A 1HAHH 1PPZA 3VGCB 1O3KA 2GGVB 3U1JB 1EZQA 3FANA 2O8UA 2UUKB 3UWJH 1LVOA 3DA9B 1Y3XA 1WQSA 1Z6JH 1EB2A 3D62A 3E0NB 1GBDA 2ZHWH 4H6TA 1J8AA 1V3XA 1G9IE 1FIWA 3RXRA 4BTUB 1ANEA 5EXNA 4DW2U 1DSUA 4X2VA 1MCVA 5PTPA 5C20A 5HYOA 2PKSB 4AN7A 1NFWA 2A2XH 2XBXA 1KIGH 4E7RG 2TIOA 3TH3H 1OP2A 1JMOH 3SNBA 2Z7FE 2GCTB 1V2QT 3H7TA 1ELAA 4DIHH 1BTUA 1HDTH 3K9XB 4HI3A 2C8YB 1Z6EA 1RXPA 4JZDH 2WV5A 2OC8A 1INCA 1TQ0B 1RIWC 1EP6A 2V35A 3EE0B 3ZZ3A 5HM2A 1MKXH 1UTKA 4CH2B 3P8NA 1O3BA 1H8DH 4ABEA 1IQNA 3GY7A 2XW9A 4X1NU 4VGCB 1O3AA 2C8ZB 2UUJB 3SU6A 1QL7A 1X7AC 5B6OA 1O36A 1FIZA 1C2IA 1UVPA 1AMHA 3BTME 1DXPA 1BZXE 1GMDF 2FMJA 1J15A 1O3HA 1HCGA 2BQWB 3AAUA 2BQ7B 3E3TA 3SOSA 1GBMA 1DSTA 1BRUP 4O3UA 2BDAA 3E90B 1GI3A 1ZRKA 1SBWA 5EQSA 4IMZA 1MTVA 1GL1A 3MO3A 5DP4A 1A5IA 1BRAA 3BTTE 1TMUH 1ACBE 5L30H 1G37A 2IJOB 4MPUA 1W7GH 2SGEE 3LC5A 2F3CE 1SSXA 1P10A 1GJCB 4JMYA 1TRMA 4YT6H 2BLOA 5EOKA 1FAXA 2BM2A 1BTHH 1T8OA 4K69A 1C1WH 1HAZB 3RC4A 2W3KA 2H1UA 2HNTF 2VU8E 4B2AA 3U8RH 2J38A 1N6XA 1TMBH 4MG3A 4IGDA 3S9CA 4H4FA 1HJAB 1CGHA 1TX8A 2TGTA 1TBRH 1CGIE 4Q7XA 1V2VT 2XWAA 3P70B 4JK6A 1W0YH 1WUNH 1O33A 2BZAA 1HAYB 5EXLA 4R8TB 1V2ST 2ZDLA 2FYRA 1OSSA 3TNTA 1K1OA 3GYLB 3C27B 3R0F<