1TGTA

On the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase zymogen (serine proteinase)
molecule keywords TRYPSINOGEN
publication title On the Disordered Activation Domain in Trypsinogen. Chemical Labelling and Low-Temperature Crystallography
pubmed rcsb
source organism Bos taurus
total genus 48
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1981-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1tgtA02
4ISHH 1G3CA 1MTNC 1O2IA 1THRH 5L6NH 1O34A 2ZFTA 1NRPH 3SHCH 2SGQE 4JZ1A 1AFEH 1GBFA 1LVBA 2ZU4A 3LGYA 5LPEA 1O3CA 4Y71A 1GJ7B 2AS9A 4Y11E 1JMOH 2THFB 5EG4A 1W14U 4JZEH 1ZHRA 4KTUA 3PM3A 1TQ7B 1LKAA 4NIVA 2JETC 1L2EA 2CGAA 1AVXA 1BT7A 4VGCC 2CJIA 3RP2A 3TGKE 3U8OH 2A31A 2BDHA 1J14A 2BQWB 3TITA 1RGQA 5EXMA 1NTPA 3SO3A 3PTBA 3U98H 3SJ9A 1O3OA 2FM2A 3ZVEA 5F8TA 4MLFB 1Y3WA 4ZHMU 3EA8A 2FOAA 1P2JA 2W3IA 1H9IE 4I33A 1EJAA 1MAXA 1ETTH 2CHAC 3D23A 1ANBA 1N8OB 1ELDE 3W95A 2VU8E 2QXIA 1EAIA 1XKBC 1PQ5A 1LTOA 1YCPH 1QBNA 2A4RA 4BANB 5DO4H 4IS5A 2ZKSA 1UTKA 1GBBA 3FAOA 1O3KA 2XC5A 4X2YA 3PLBA 1TPSA 4CRBA 4X1SU 3GYLB 4E06H 1MD8A 3LGVA 3HKIB 3UIRA 2OINA 1FONA 3PWBA 4Y7AA 4Y76A 1QCPA 3ZV9A 2BDIA 1GI0A 1GMCG 3GCHC 4FUFA 2PLXA 4YM9A 6CHAB 1WYKA 4INLA 5GJ4B 1O33A 1HFDA 1ETSH 2A4GA 1GJ8B 2BY9X 3FZZA 1AVGH 2ZTXA 1GG6B 3MH5A 2BM2A 1TA2A 4NGAH 3SGBE 5JBCS 2ZQ1A 1XKAC 1O2GH 2V35A 5TCCA 1CA0B 1TNGA 1ZSLA 4FU7A 1TE0A 1NM6A 2OCVB 4MTBA 3SNBA 1HAHH 1NRNH 4QT8C 1W3CA 1NRQH 1CHOF 1DWBH 1P2OA 2IN2A 3LJJA 1CO7E 1ID5H 5HYOA 4R0IA 6ESTA 4ABFA 8GCHF 1A2CH 2ZU5A 1EZQA 1SC8U 1TPAE 1SOZA 1VITH 1EB2A 4DY7B 1DXPA 2I6QA 2PWXA 3AVZA 1P11E 1WOFA 1C5QA 4BTTB 2XBYA 3ENSB 3K65B 3M61U 1BOQA 5LGOA 4NA8A 2QC2A 2HRVA 1EAXA 1RD3B 1UVPA 1ORFA 4KELA 2F9VA 1YPMH 1TX7A 2A0QB 4NSYA 1GHBF 1WQVH 2XW9A 3MU8A 1HAVA 4H6SB 3RU4T 1BRCE 1XMNB 2OC1A 4LK4A 2Z6BD 2ANMH 2H6MA 2P3TB 3SUEA 1GI9B 3A7YA 1YPHC 2GV7A 2VJ1A 4YO9A 1O5GH 1PPZA 1C2GA 4B2CA 4AYYB 1ELGA 3OTJE 2EI8A 4JYVH 1GI7B 4WY3A 1HPGA 1O2TA 4ABAA 1VCWA 1FY3A 1EQ9A 3RXIA 3SNCA 2HPPH 3LONA 1ZRKA 3VXEH 3MOCA 6GCHG 2O8TA 1QL9A 3SU5A 1MCTA 1DUEA 4NFFA 1GJ6A 2FESH 2K1QA 1T4UH 2GD4B 3F1SB 1O3HA 1O3LA 1A46H 4FUCA 1ZLRA 1UTPA 2FP7B 4CR5A 8ESTE 1PQAA 4ZH8A 2A7CA 2DE9A 5F8XA 3U69H 4FXGH 1FY1A 1C4Y2 1ZGVA 1BB0B 3DFLA 1G37A 1P57B 3EE0B 3E91A 1TMUH 1MQ5A 4Y0YE 5EPNA 1K1MA 2C93B 1AMHA 2F9UA 1YCPM 2EC9H 3U8TH 1GL0E 2FS8A 3VEQB 1J17T 2QCYA 5IDKA 3BTGE 1GBJA 3A8DA 4JMYA 3RXQA 1T8LA 1MTSA 1OWKA 2ALVA 2P3FH 2OC8A 4MNVA 2BQ6B 3U1IB 1MAYA 3MO9A 1EP5A 2ZDNA 1V2LT 4BAHB 5C2ZA 1N6YA 2V6NA 1K28D 4UFDH 4FVDA 4WXVA 5SGAE 3F9GA 4HZHA 3TJUA 1SGDE 5T6FA 4NG9H 3A81A 1H8IH 1WQSA 1O3DA 3B8JA 1ZHMA 1DUAA 5FCKA 2UWPA 3ZZ9A 3HK3B 2XRCA 1MU6B 2Y5HA 3Q77A 1QA7A 3MH6A 1O2KA 2VVVA 3CP7A 4RSPA 1TAWA 2R2MB 1FY5A 4K1EA 1KYNA 3SUGA 1G32B 3NWUA 4E05H 2J94A 1TFXA 2PTCE 4CH2B 2ZFQH 1P03A 1V2WT 4X1QU 2QXJA 2SGEE 1CSOE 3BTDE 4MNWA 5T6GA 1P2MA 1GI2A 1ZPZA 2AEIH 2Q1JA 1GDQA 2ZHQH 4I7YH 3A7XA 1Y3VA 3PV4A 4CR9A 3RXPA 2XCNA 5L2ZH 1N8OC 2WV4A 1LMWB 1IQJA 4XBCA 1O36A 2CF9H 1HAYB 5JBAS 3BIVH 3RXFA 1RTKA 3A87A 2F9OA 2B0FA 3LPRA 3RMNH 4OGXA 4AG1A 1VJ9U 2G00A 1Q3XA 3MI4A 2VIWA 3SW2B 3BG8A 1NO9H 3WY8A 4B2BA 1TBRH 2ZF0H 3SBKA 5A8ZA 2G55A 1C2DA 3RXBA 4OGYA 1TOMH 1ELEE 5FPTA 4ZKSU 3VGCC 2QYIA 2O8WA 2GT8A 4A92A 3GCOA 4Y8XA 1HAVB 1GBTA 1CU1A 2ZNKH 6CHAC 1P12E 2FEQH 1NU9A 1QA0A 1ELAA 2ZO3H 2FWWA 2PUQH 1D3PB 3LGIA 5A0AE 1VR1H 4O03A 2FI3E 3T27A 2AGEX 1W0ZU 4YESB 2EI7A 4IGDA 1CA0C 1L1JA 2VB0A 1QB1A 1SFQB 2RG3A 3TK9A 1XVMA 3RXVA 2QF0A 3D65E 3UNQA 1O2UA 1T8NA 1GBAA 4H42U 4A6LA 1C1TA 3RXSA 1LKBA 1RRKA 2BD5A 2ZP0H 1O5DH 1GBKA 2G4UA 5A8YA 1C1RA 5JYIA 4YLUA 3AAVA 1Z8GA 1TNHA 1UCYE 4ZAEA 1VJAU 2BY5X 3Q76A 1V2OT 3ZZAA 4AZ2B 3ITIA 4NWLA 2OP9A 2YNBA 1F7ZA 1ZSJA 3GCTF 2H9EH 2BXUH 2HNTE 2W7SA 3FZDA 3SGAE 1E34B 2FOBA 2Z9LA 1UVTH 3C27B 4YT7H 3PO1C 4B2AA 1HJAB 3UOPA 1EOJA 2OXSA 3PLKA 2P8OC 4JZDH 1ABJH 5A2MH 4RKOB 3TNSA 5HMAA 3GISB 2DUCA 1O2OA 3A88A 3O8RA 3EAJA 2ZGHA 1FY8E 3ZYDA 4ZXXH 1B5GH 1TQ0B 4CRDA 3RUOA 4UFGH 3KQBA 3TH2H 3GYMA 4Q2KA 3EA7A 3RXCA 3MNBA 4AFSA 4FUHA 5CMXH 1GBLA 1OXGA 3F9FA 1L4ZA 2F3CE 3D49H 4BTUB 3UNSA 3SNAA 4X8TH 1GMHF 2BY6X 1C5LH 1IQMA 3H7OA 2R9PA 3IITA 2HALA 3FFGA 4BAQB 2OBQA 4A1VA 2G5VA 1QB9A 2TGAA 3ZYEA 1PJPA 1CBWB 4D8NA 5FXLA 4JZIA 1UMAH 4ZUHA 1UTLM 2OTVA 1Y5BT 5T6DA 3SV9A 4ISNA 1TGTA 1QY6A 2RCEA 3M5LA 3V13A 1A4WH 2AMPA 5JB8S 1DFPA 1SPJA 1LPKB 4JK5A 2BOKA 1QB6A 3TNTA 2A1DB 1G36A 2XNIA 5GIBA 2TPIZ 2WPKS 3M37A 4J1YA 1AWHB 4FU8A 3HKJB 7KMEH 3URCA 1B7XB 1DICA 4I31A 4CHAB 4GAWA 1VITG 1EPTC 2LNCA 3M5OA 3E0PB 5DPAA 2PW8H 1P04A 2FX6A 3FP6E 4NA9H 1AB9C 5FBIA 1A3EH 2BD2A 1E38B 1EASA 2Q6FA 2VH6A 1EB1H 1DE7H 2QIQA 1XX9A 1C5TA 2W3KA 2V0BA 3R0FA 2IPHA 1TYNA 1JRSA 4DT7B 2Y5GA 2VWMA 1GHZA 1KLIH 1GI8B 1HAIH 3TH4H 1IHSH 1E36B 2SFAA 3A89A 1XUHA 1P2KA 1O2YA 1GBIA 4FUGA 1DANH 2ZZUH 1C1MA 2STBE 4YOIA 3RMOH 2VVCA 4CBNA 1AE5A 4GSOA 3ZVCA 5E8EH 2OQUA 2J34A 4Y0ZE 2GGVB 1XM1A 3K9XB 5DP8A 3FANA 1P2NA 3SU2A 1GMDG 1MH0A 1NRRH 4Q7ZA 2XXLA 3UQOA 3AW1A 1QTFA 2WYJA 3MNSA 4MNYA 3GDVA 4WF8A 1Y8TA 1HIAA 2BD8A 4WXIA 1ZPCA 1O3PB 1EATA 4TYDA 4NIYA 3MU1A 1OSSA 4K2YA 3HATH 2FO9A 2ANWA 3RXKA 3ZZ6A 2O8UA 7LPRA 3EDXB 2TGTA 1O2XA 2GP9B 2H9TH 4FVBA 2D2DA 4B73A 5EW2H 1QRXA 2FX4A 1QBVH 1ZGIA 4B1TA 2PKSB 1BHXB 1QJ1B 4Q80A 1BBRE 4K3JA 4OS1A 1FDPA 2BD3A 3TK5A 2ZQ2A 2G5NA 5CHAC 1T31A 3T5FH 4JYTA 1PFXC 3RXJA 3MMGA 3SI4H 2ZWLH 3NCLA 3SU3A 3URDA 3QX5H 1DWDH 4TY6A 4BAKB 3KHVA 1LO6A 4I8GA 1Z6JH 1SHYA 1PYTC 1A0JA 1BTUA 3KQCA 2TGDA 3UREA 3CENA 2W5EA 1QQUA 2J95A 3TK6A 2G81E 4NZLA 4H4FA 4DVAU 2A7JA 4R8TB 1F92A 1A5HA 4SGAE 1YPHE 1HXFH 2OBOA 2Y81A 1E35B 1ZZZA 1O2LA 2XTTB 2PKAA 2H1UA 1XVOA 1RIWB 1C5UA 1DVAH 1GBHA 3E1XB 1P2QA 3A7VA 5A0CA 3I29A 4BXSA 2BQ7B 3W94A 3HGPA 3RXUA 3TIUA 4Y8YA 1L1NA 2DE8A 3L6PA 4BNRA 3UQVA 2ZC9H 1ANEA 1BQYA 1C5NH 3QTVH 4J2YB 2VGCC 1GVZA 1OYTH 1FQ3A 1A3BH 1ANDA 1C5MD 2JKHA 2AGIX 4AGKA 1AIXH 1ESTA 4HI3A 1CHGA 4B75A 2BD9A 2FMJA 2QV1A 3KEEA 1UJ1A 1P05A 1JIRA 4TPIZ 1TRMA 1KXCA 3RXHA 1QQ4A 2WPJS 4ZHLU 1G9IE 1JRTA 1C2FA 2ZDAH 1J16A 2EEKA 1EUFA 2FZZA 3OU0A 3BV9B 2JH5D 4XDEA 1GJ9B 2PR3A 1C2KA 5TCAA 1GGDB 1DLEA 4DCDA 2STAE 1NPMA 3RXTA 3GOVB 1AUTC 3MH7A 1WSSH 5LPRA 2HGTH 1ARCA 3KQEA 4A5TS 1SI5H 3VB5A 1C5XB 1O2QA 3M7UA 1W11U 3BG4C 5EOKA 4CRGA 1SVPA 3ZVFA 5JB9S 3TU7H 5F03A 4I8HA 4X6NA 5F6MA 1TRYA 4AFZA 3ZVAA 1UCYK 1O3IA 4BOHA 4WMEA 1IQGA 3TJOA 5GWZA 3TGJE 1YPGH 4GHTA 1SHHB 1T8OA 2ZTZA 3Q3KA 4DIHH 4KTSA 2BLQA 4NFEA 1EX3A 4ISIH 1DOJA 2BD7A 4YLQH 3SJ8A 3PLPA 1A5IA 3MU5A 1EZXC 4XE4A 2F9BH 1KTSB 3MYWA 1GI3A 3MH4A 2WPMS 3U8RH 3K6YA 1HIAB 1AFQC 3ZZCA 1TWXB 1QHRB 1GJCB 3PMHB 1S6FA 1S82A 3M7QA 1MKXH 3ZZ8A 1GCTB 2ZFSA 1OWEA 4CREA 1GBMA 1F2SE 1BTWA 1FUJA 1O38A 1C5OH 1EAWA 4F4OC 1DY8A 1NFXA 3AASA 4ZROA 1TNKA 2D8WA 5DGJA 1PPCE 1KXFA 1N1LA 2QXGA 1O5BB 3D62A 3ATIA 1O2ZA 2B7DH 2CMYA 1DSTA 2GZ8A 2FYRA 1BCUH 3MHWU 3AAUA 3L33A 2FODA 1SGFG 2WPLS 5DP5A 2UWLA 2AYWA 1HJ8A 5J4SA 4D7FA 1EZUC 1UHBB 2BZ6H 3TPIZ 1O3NA 3PMAB 1BBRH 1DXWA 5ESTE 2PV9B 3LH1A 3T26A 1YLDA 2FLBH 1AE8H 2ZU3A 3DD2H 1C5PA 1TNIA 2GZ9A 5EXNA 1LVOA 1LHEH 1CT4E 2HNTF 3GY4A 3QK1A 1GCDA 7GCHF 1QURH 2J38A 1PQ8A 3E16B 3BTWE 3LH3A 1W7GH 1BMMH 2XWAA 4BAOB 2PKAB 2ODQA 1WTGH 4IN1A 5GCHG 3V3MA 2C8YB 4A1XA 1K1OA 3BEUA 3RMMH 2Z94A 4DJZB 1PQ7A 2B9LA 1Q31A 2JH0D 2QGRA 3ODFA 1XUKA 4JCNA 2I6SA 3KQDA 1EJNA 1K21H 2C8WB 1HV7A 1WAYB 1S0RA 4Y8ZA 5AVDA 2P93A 4ABEA 1O3GA 3U9AH 1J15A 1SBWA 1KDQA 1W7XH 5B6OA 2ZPQA 4KTCA 2Z3CA 1INCA 1GI6A 1XUIA 1TGCA 1V2PT 2VWOA 3BTTE 2QA9E 1NFWA 1AD8H 1O2RA 1O3AA 1S84A 2KAIA 1K1LA 4KGAA 5JBBS 1A0LA 2IJOB 3FVFB 4WH8A 1AKSA 4MDSA 4O9VA 3E3TA 4INKA 1KXBA 2PSYA 3ZZ7A 4Y7BA 3MU4A 1H1BA 1P2IA 3GY2A 3MNCA 3SV7A 1CHOG 4AB9A 3QWCH 1HJ9A 1MTWA 1AUJA 1UK3A 4RKJB 1MKXK 3NXPA 2PUXB 3RM2H 8GCHG 4O97A 1NFUA 2ZHWH 1C5WB 1GPZA 1IOEA 1ARBA 1ZHPA 3SU4A 3ZVBA 1KLJH 1FV9A 1OWIA 4X8VH 3UNRA 3QGJA 3F6UH 1OP0A 4K5ZA 3CS0A 2Z9KA 1TMBH 1VGCB 1UO6A 1O2HA 1L0ZA 2Y80A 1DT2A 3SJIA 4YOGA 2C3SA 2FYQA 2YOLA 1O5EH 1C9PA 4X2XA 1TX8A 3MWIU 5C67A 2IOTA 1A1RA 1GHBG 1MQ6A 3VB3A 1EAUA 3E0NB 1RS0A 4ZHAA 1S81A 1ESBA 1BBRK 1Z8JB 2HLCA 2ZCKP 3RXMA 1SGIB 1F5LA 1HNEE 4TWWA 3PWCA 2J2UA 1DM4B 4MQAA 1QJ6B 1CE5A 1W8BH 2F9PA 1O2PA 3A84A 2GX4A 3ESTA 4AX9H 1S83A 1GGDC 1BMLA 2PGQB 1GI5A 2C4FH 3PMBB 4JYUH 4B74A 4TWYA 1K1IA 1BJVA 3M35A 3EA9A 3T25A 1EJMA 1SFIA 4X1PU 2TGPZ 3SJOA 2GMTB 2SNWA 1ELFA 1E37B 1K1PA 3M3VA 4LXBH 4Y10E 3ZZ3A 5H4IB 1EZSC 1ELCA 3QTOH 3B9FH 1V2NT 2ANKH 1VZQH 3IG6B 4ABDA 4AG2A 2BVRH 2BY8X 1GG6C 1ZOMA 1GBEA 3HPTB 3CS7A 5EU8A 1ZR0A 1GWAA 3KCGH 9ESTA 2O8MA 1OKXA 3N7OA 2GCTB 1FIZA 1FY4A 5IYTA 1C5YB 2HVXA 1YYY1 4A1TA 1NU7B 2BDAA 4O3UA 1LVMA 4RN6A 2BD4A 1C5ZB 3RC6A 1HRTH 1AQ7A 4FUIA 2H5CA 1OS8A 2XC4A 2G8TA 3LJOA 5EQQA 1T8MA 1IQEA 5L2YH 2G52A 2UUJB 4UE7H 4GCHG 2PHBA 2VH0A 3M3TA 3BTHE 1YC0A 1TA6A 3TH3H 1MTNB 1SL3A 4CRCA 1C2JA 5C3NA 3T2NA 1NY22 2R2WU 4LZ4B 1MZAA 2GCHG 2UWOA 1YP9A 2R0LA 2UUYA 2R0KA 3K6ZA 1O3BA 1Y5AT 2NU3E 3UY9A 2FI4E 2QN5T 1HLTH 1SGEE 3VFEA 1KXDA 3E90B 1KDQB 1NN6A 1T4VH 3R3GB 3RC4A 1GHWH 2BDBA 5DP3A 1F5RA 1DSUA 1GHVH 2F91A 4D9QA 3PTNA 2VIVA 3S0NA 2ZG0H 4FUDA 4AORA 2BMGB 1ZSKA 1O37A 1SGRE 2WPHS 2JETB 1IQLA 2KAIB 1PPHE 2SNVA 4BXWA 4VGCB 1HAXB 1D4PB 3ATMA 1AHTH 4E7RG 5T3HA 1V2UT 2ZGBH 4GVUA 3SV8A 5C1YA 1AKSB 1UK2A 1FNIA 4D7GA 1TPOA 4DIIH 7ESTE 5FPYA 1QNJA 3FP8E 1NESE 2A4QA 2P94A 1TNJA 2FOHA 4IC5A 3P8OA 4H6TA 5CE1A 1BITA 4TPYA 4XSKU 2CHAB 2XYAA 2ZFRH 1SGQE 1Y5UT 5J4QA 1GHAF 4FUEA 2FOEA 3SN8A 1FLEE 3BF6H 4AOQA 3LC3A 1YPKH 2AIQA 3S9CA 1Z7KA 2A5AA 5FHTA 1A7SA 2A5IA 2M5TA 3P70B 1F0TA 3RLWH 2FOCA 2P59A 1O3MA 3T28A 1ZMLA 4AFUA 5C1UA 1L4DA 1NC6A 1RTFB 1C1NA 3VB4A 4UONA 1UVOA 3SORA 1LHDH 1W0YH 1NS3A 1GJAB 3A7WA 3PYHA 1GBCA 3A83A 3ATWA 4ZKRU 4HTCH 5L30H 3LGTA 3LIWA 3QZRA 1O5CB 1AU8A 4O3TA 3S7KB 2GVFA 2NU0E 3STJA 2XWBI 2ZIQH 1H9LB 4FU9A 5G4BA 2A45B 4WWYA 2ULLA 4LOYH 3RDZA 3GDUA 4IW4E 4XOJA 1MTUA 1QIXB 4JZFH 2SGAA 3OY6U 4I32A 5DKMA 3Q00A 4X6PA 3ZZBA 1WBGB 4MPXA 4ABJA 1OYQA 5GDSH 1BTXA 4Q7XA 4OS6A 1C2EA 1WUNH 1HAZB 4BTIB 1TGNA 4X6OA 3DT0H 1FAXA 4HGCA 3ZZDA 2A4OA 2VWLA 3QUMP 3BN9A 3A8CA 2XBVA 4UFFH 1BTPA 2BDCA 3GCTG 1HXEH 2BLOA 5EPYA 1C5SA 2H9HA 1WV7H 3NPSA 3UWIA 3SOSA 2PTNA 2VNTA 5I25A 2QAAA 2ZHFH 1AI8H 3A7TA 1SGPE 5FX5A 3TJNA 5LH8A 1V2QT 1AO5A 1SOTA 2CF8H 3ZV8A 1FPHH 4HFPB 2XCFA 1CGHA 2FOMB 2VWNA 2ZGJA 3BTKE 2AIPA 3A8AA 1OWDA 1O3FA 3HK6B 1UCYH 2CXVA 2ZDLA 3GCNA 4IC6A 4ZKNU 1TGBA 1GMCF 1GMHG 3EYDA 1UTNA 3LT3A 1IQHA 2HPQH 4OS4A 1UVSH 1Y3XA 3RLYH 3SQHE 3BTME 1LPZB 1B0FA 2D26C 3TLOA 4AGJA 3RXGA 4DOQA 1F0UA 1NZQH 4CBOA 1QBOA 2AMDA 1SB1H 2R3YA 1ZPBA 1C1WH 1S0QA 2WUBA 1D6WA 4X0WU 1D6RA 2UUFB 3SU0A 5AFZH 1K22H 1QGFA 1ZRBA 2BB4A 1MZDA 1BIOA 1TIOA 2AGGX 1TABE 2TIOA 3KGPA 3LDXH 3QLPH 1ELBA 1ANCA 3O8BA 1OP2A 4Y79A 1HAOH 1O30A 2AH4X 5AFYH 1H8DH 5DP6A 3S9AA 1ZTKA 3SUDA 5HM2A 3OYPA 5ABWA 5FAHA 2Y5FA 1JBUH 1O35A 3QZQA 1G30B 4YZUA 3UFAA 4I8LA 3TJVA 1E0FD 3SU6A 1MTVA 3S69A 2EI6A 1HJAC 1JIMA 3MO6A 4IN2A 1MKWH 4AFQA 1CQQA 5AF9H 1AGJA 4D76A 1QJ7B 3T62A 3A80A 1CGIE 3KNXA 1S85A 1ZJDA 1W2KH 2ZHDA 2W26A 5C1XA 3B23B 2FS9A 1AY6H 4K8YA 1UK4A 1P06A 6GCHF 1HAGE 1KSNA 1LPGB 1YGCH 1ZTJA 1NRSH 5DK1A 1BA8B 1S5SA 1CGJE 1IQKA 5EQRA 5FX6A 2GKVE 2ZPSA 1UTOA 1GJBB 1UTQA 2Y7ZA 2JH6D 1XUFA 1AVWA 3UWJH 1C1UH 1SGNE 1EPTA 5GCHF 1GI4A 1GJ4H 1CBWC 3BTFE 1BDAA 1DWEH 2GTBA 2J92A 3P17H 5HXFA 1H9HE 2BY7X 1NROH 2FPZA 1O2MA 3A86A 1HUTH 1ZTLA 3OY5U 3VB7A 2XC0A 1GL1A 4OS5A 1BMNH 3HGNA 3M5MA 1TX6A 3K2UA 1P09A 1GBDA 4AYVB 2FOFA 2OC7A 3VGCB 1MUEB 3E8LA 1C4U2 4K1TA 4D9RA 3QN7A 1HYLA 1A5GH 4MNXA 1VCQA 1W10U 1FPCH 1TONA 4CHAC 1A0HB 1ZMNA 2RA3A 1BRUP 2ZFPH 1O2NA 1Z71A 1MBMA 3MNXA 2OC0A 5EXLA 4UD9H 4WVPE 1MU8B 1AZ8A 3T29A 1HCGA 2GV6A 4U30A 4X6MA 2ZGCA 5GPIB 2VIQA 3JZ2B 3LGWA 3BEFB 3VXFH 1OPHB 5E2PA 2ZECA 2BX3A 4NA7A 3C1KA 2Z7FE 4X8SH 1FN8A 4WMFA 1NT1A 4I8JA 4GHQA 5C5NA 1O5FH 3U1JB 1V2VT 2BZAA 1G2MA 1QL8A 1V2TT 1MD7A 2AFQB 3PB1E 5FCRA 3A7ZA 1J9CH 1Y3UA 3RM0H 3S7HB 2OLGA 1UTJA 1TBQH 3MTYA 5TJXA 1RFNA 3RU4E 1P02A 1YPJH 1KLTA 1MKWK 4GUXA 3GY7A 4YTAA 1MBQA 1DS2E 1JOUB 3LKWA 5E2OA 3SUFA 1O39A 4OS7A 1YPEH 4F49A 1O0DH 2F9NA 3PO1B 1IQIA 1C2LA 2P8OB 3ATLA 2BOHB 1C1OA 1TMTH 4A7IB 1PPFE 1LQDB 2LPRA 2C8ZB 2ZU2A 5EW1H 2Z3EA 1D3QB 2Q6GA 1IQFA 1RJXB 1X7AC 5HM9A 1SQOA 1FJSA 5BRRE 2NU2E 3UR6A 5FBEA 1L1GA 4WMDA 3ZVGA 2C90B 3GY3A 4ABBA 4BAMB 4YT6H 4NIXA 3A8BA 3OSYA 1O2WA 1TPPA 2ANYA 3DA9B 2XBXA 1XUGA 2PKSC 2ZDMA 3M3SA 1YCPK 1CVWH 1GI1A 2VIPA 5ETXA 2HWLB 4I8KA 2A5KA 1O32A 3P8NA 4IMQA 1SLXB 3LGUA 2H5DA 1SQAA 2SGPE 1P8VC 1SLUB 4U32A 3S9BA 4X1NU 5E0JA 1O31A 2ZGXH 1XUJA 1G3BA 4ZKOU 3G01A 3P6ZB 1T7CA 5A8XA 2OUAA 4Z6AH 1GHXH 1K9OE 4MPUA 2ODPA 1SLWB 1VCPA 4Z0KA 1OX1A 2VIOA 1YBWA 5A09A 1OWJA 3RXAA 3SHAH 1Z6EA 2BVXH 3H7TA 4GCHF 1ZYOA 1BMAA 1HDTH 1BJUA 1RIWC 2ILNA 5A0BA 1JXPA 2P3UB 2WUCA 4NCYA 1EPTB 2H2ZA 2OQ5A 1C1VH 3DUXH 4E7NA 4YOJA 9LPRA 1P10A 3I78A 1AB9B 1SMFE 3SU1A 4CRFA 1WU1A 4SGBE 2B8OH 1P3CA 3O8CA 2GCHF 1P9UA 2Y6TA 1FN6A 2BLVA 3KL6A 3QDZB 1U6QA 2O9QA 1SR5C 3TVJB 4WJG2 1C2MA 2Z9GA 2GDDA 1ESAA 1DWCH 3SQEE 3P92A 1AN1E 2QY0B 1BRAA 1K2I1 2GZ7A 1LDTT 1THSH 3Q3YA 1FAKH 1XXFA 2BXTH 2ODYB 1HBTH 2ALPA 2BHGA 4ASHA 1PYTD 3SGQE 1C5VA 1ELVA 3OX7U 3RXEA 3SNDA 2G51A 3LC5A 3F68H 3UTUH 3BTEE 4ISOA 5DP7A 1KIGH 1D3DB 1C5RA 5I46H 3GY5A 1F0RA 2ZPRA 2BDGA 3DHKH 1K1JA 1QR3E 1DX5M 3RXDA 3E6PH 2FDAA 1V2RT 4XBBA 1G3DA 1GVKB 1S6HA 7GCHG 8LPRA 2EA3A 1Z8IB 3P8GA 1V3XA 2NU4E 3ZZ5A 1SGCA 2Y82A 1TBZH 4B76A 5K0HA 2C8XB 1O5AB 1V2JT 1IHTH 3EQ0H 4NWKA 1GJ5H 4B71A 3GY8A 3TGIE 1GJDB 1GDUA 2ESTE 8KME2 3EGKH 5DJ7A 2PGBB 1OOKB 1CT0E 3SZNA 1ZMJA 3UR9A 3P95A 1LVYA 1VITF 1AWFH 3KF2A 2VVUA 4UDWH 1BRBE 2SGFE 1TGSZ 4U01A 5CHAB 2AMQA 2BTCE 3NZIA 2QF3A 1GCTC 3SI3H 3NK8A 4MVNA 4K69A 3V12A 2NU1E 4FUJA 2D1JA 3JZ1B 1LHCH 5GXPA 1GDNA 1ABIH 3LOXA 2ZDVH 4GPGA 1Y3YA 4X2VA 5JPMH 1IQNA 1IAUA 4ESTE 2FOGA 2RDLA 4FUBA 1LHGH 3LU9B 5DG6A 1LHFH 3F9EA 3GDSA 1O2JA 1C2IA 4ABGA 1N6XA 2Q6DA 4AB8A 1TB6H 1KTTB 3F9HA 2NWNA 1UTMA 2P16A 1GHYH 2VINA 1G2LA 4ABIA 1V2KT 3GICB 4K60A 1W12U 4X8UH 2CV3A 4X1RU 3BTQE 5JBTA 2BDYA 1KXEA 3UPEA 1GMDF 1V2ST 1YM0A 2W7UA 2J4IA 1C1PA 3SNEA 1SGTA 5EODA 2BYAX 1SGYE 2VGCB 4DURA 1Y59T 2PFEA 5EGMA 1EXFA 3RXLA 2A2QH 2A32A 3IWMA 2WINI 5FPSA 1EOLA 2ZDKA 1M9UA 1TNLA 3BIUH 2UUKB 1J8AA 1C1SA 3KIDU 3ATKA 1NFYA 4ZMAH 1O3JA 1P0SH 1MCVA 2YNAA 3AW0A 1FZZA 4Q7YA 2TBSA 3MFJA 3UUZA 2Y7XA 4CRAA 4TY7A 1AZZA 4WH6A 1DY9A 2WV5A 3FP7E 1HGTH 1RTLA 1Q2WA 4M7GA 3QO6A 1B0EA 1BTYA 5C20A 1BTHH 5AHGH 4THNH 5JDUB 5ESBA 1XXDA 1O3EA 1OP8A 3BG4B 4MPVA 1QL7A 1BHXF 2RA0A 3RXOA 4ABHA 3H5CB 3GCHB 1KXAA 4ZXYH 1YLCA 2OD3B 4GLYA 4AN7A 1YPLH 4IBLH 3L3TA 2AERH 3I77A 3Q3XA 3RMLH 5BPEA 2XBWA 3A85A 1HAPH 4CH8B 1FXYA 2SGDE 1Z8RA 1ELTA 2P95A 5DP9A 3BSQA 4JK6A 3PMJA 1F5KU 1PPEE 1F0SA 4K8BA 2ASUB 3NUMA 1KY9A 1YKTA 1RXPA 2V3HH 3V0XA 3VPKA 2ZHEH 1A61H 1V6DA 2F83A 2VIDA 1BUIA 2O8LA 1TALA 1QRZA 1C4V2 2HOBA 4INHA 2Z3DA 1GVLA 1YF4A 4XBDA 3VB6A 1C9TA 1AFQB 2WPIS 2FTLE 1VGCC 3MU0A 2A7HA 2ZEBA 1FI8A 2ZTYA 3ZZ4A 3M7TA 5LPFA 1Z1IA 2FI5E 4ISLA 4U2WA 4OS2A 1WCZA 1C2HA 1EKBB 1DDJA 1ACBE 4IMZA 1TLDA 1PPGE 2WYGA 4DW2U 1TOCB 4KP0A 1P01A 1DPOA 1LQEA 2ZI2H 4DGJA 3V7TA 2PSXA 1DLKB 2FTMA 3ELAH 1MMJN 4MG3A 2B5TB 3RXRA 1PPBH 1C1QA 1EP6A 3M36A 4DG4A 4NZQA 6LPRA 1TRNA 2FLRH 2J9NA 1D9IA 2ZFFH 3RC5A 1DITH 3O8DA 4MPWA 1T32A 2HNTC 1W13U 1SQTA 1V2MT 5PTPA 1QFKH 1SSXA 2FIRH 1JWTA 3M5NA 5E0HA 1CT2E 2GMTC 2TRMA 1ETRH 5K7RA 1Z1JA 1QRWA 3MO3A 4Y6DA 1G3EA 2QXHA 3KN2A 5HGGA 5DP4A 1ZJKA 2BVSH 4PROA 3UOUA 3BEIB 2ZA5A 4K1SA 4XFQA 1UVUH 2A2XH 2ZCLP 1H4WA 2G4TA 2ZCHP 1GHAG 2CN0H 3A82A 1BTZA 1WTHD 3ZVDA 2BLWA 2GCTC 2GT7A 3PROA 3SV6A 2GDEH 4NSVA 1SLVB 1P3EA 2Z9JA 3GY6A 1FIWA 1THPB 1SGFA 1BZXE 5E0GA 3SJKA 1LCYA 5F8ZA 2BX4A 4X2WA 2R3UA 3NKKA 4KKDA 2FXRA 4UEHH 5EQSA 1HB0B 1K1NA 1SG8B 3STIA 1D3TB 1O2SA 4NIWA 1O2VA 3ODDA 2V3OH 4LZ1H 1CA8B 2ZU1A 3QGNB 5C5OA 4UFEH 1UHBA 2Z9IA 3SV2H 3RU4D 1P9SA 1FMGA 1OWHA 3P8FA 3DFJA
chains in the Genus database with same CATH superfamily
4ISHH 1G3CA 1MTNC 1O2IA 1THRH 5L6NH 1O34A 2ZFTA 2PP6A 1NRPH 3SHCH 2SGQE 4JZ1A 1AFEH 1GBFA 1LVBA 1S6LA 2ZU4A 3LGYA 5LPEA 1O3CA 4Y71A 1SQRA 1GJ7B 2W6ID 2AS9A 4Y11E 1JMOH 2THFB 5EG4A 1W14U 4JZEH 1ZHRA 4KTUA 2EY4C 3PM3A 1TQ7B 1LKAA 4NIVA 2JETC 1L2EA 2CGAA 1AVXA 1BT7A 4VGCC 2CJIA 3RP2A 3TGKE 3U8OH 2A31A 2BDHA 1J14A 2BQWB 1UW7A 3TITA 1RGQA 5EXMA 1NTPA 3SO3A 3PTBA 3U98H 3SJ9A 1O3OA 2FM2A 3ZVEA 5F8TA 4MLFB 1Y3WA 4ZHMU 3EA8A 2FOAA 1P2JA 2W3IA 1H9IE 4I33A 1EJAA 5HIZA 1MAXA 1ETTH 2CHAC 3D23A 1ANBA 1N8OB 1ELDE 3W95A 2VU8E 2QXIA 1EAIA 1XKBC 1PQ5A 1LTOA 1YCPH 1QBNA 2A4RA 3OE7D 4BANB 5DO4H 4IS5A 2ZKSA 1UTKA 1GBBA 3FAOA 1O3KA 2XC5A 4X2YA 3PLBA 2KM0A 1TPSA 4CRBA 2J98A 4X1SU 5B6LA 3GYLB 4E06H 1MD8A 3LGVA 3HKIB 3UIRA 2OINA 1FONA 3PWBA 4Y7AA 4Y76A 1QCPA 3ZV9A 2BDIA 1GI0A 1GMCG 3GCHC 4FUFA 2PLXA 4YM9A 6CHAB 1WYKA 4INLA 3WWBA 5GJ4B 1O33A 2YMSC 3KYFA 1HFDA 1ETSH 2A4GA 1GJ8B 2BY9X 3F0PA 3FZZA 1AVGH 2ZTXA 1GG6B 3MH5A 2BM2A 1TA2A 4NGAH 3SGBE 5JBCS 2ZQ1A 1XKAC 1W0KD 1O2GH 2V35A 5TCCA 1CA0B 1TNGA 1ZSLA 4FU7A 1TE0A 1NM6A 2OCVB 4MTBA 2RDEA 1HAHH 3SNBA 1NRNH 4QT8C 1W3CA 1NRQH 1CHOF 1DWBH 1P2OA 2IN2A 3LJJA 1CO7E 1ID5H 5HYOA 4R0IA 6ESTA 4ABFA 8GCHF 1A2CH 2ZU5A 1EZQA 1SC8U 1TPAE 1SOZA 1VITH 1EB2A 4DY7B 1DXPA 2I6QA 2PWXA 3AVZA 1P11E 1WOFA 1C5QA 4BTTB 2XBYA 3ENSB 3K65B 3M61U 5HIYA 1BOQA 5LGOA 4NA8A 2HLDD 2QC2A 2HRVA 3ZIAD 1EAXA 1RD3B 1UVPA 1ORFA 4KELA 2F9VA 1YPMH 1TX7A 2A0QB 4NSYA 1GHBF 1WQVH 2XW9A 3FOAA 1HAVA 3MU8A 4H6SB 1BRCE 3RU4T 1XMNB 2OC1A 4LK4A 2Z6BD 2ANMH 2H6MA 2P3TB 3SUEA 1GI9B 3A7YA 1YPHC 2GV7A 2VJ1A 3MQKC 4YO9A 1O5GH 1PPZA 5C0UA 1C2GA 4B2CA 3DSGA 4AYYB 1ELGA 3OTJE 2EI8A 4JYVH 1GI7B 4WY3A 1HPGA 1O2TA 3NRLA 4ABAA 1VCWA 1FY3A 1EQ9A 3RXIA 3SNCA 2HPPH 3LONA 1ZRKA 3VXEH 3MOCA 6GCHG 2O8TA 1QL9A 3OFND 3SU5A 1MCTA 1DUEA 4NFFA 1GJ6A 2FESH 2K1QA 1T4UH 2GD4B 3F1SB 1O3HA 1O3LA 1A46H 4FUCA 1ZLRA 1UTPA 2FP7B 4CR5A 8ESTE 1PQAA 4ZH8A 2A7CA 2GJGA 2DE9A 5F8XA 3U69H 2V3MA 4FXGH 1FY1A 1C4Y2 1ZGVA 1BB0B 3DFLA 1G37A 1P57B 3EE0B 3E91A 1TMUH 1MQ5A 4Y0YE 5EPNA 1K1MA 2C93B 1AMHA 2F9UA 1YCPM 2EC9H 3U8TH 2XOKD 1GL0E 2FS8A 3VEQB 1J17T 2QCYA 5IDKA 3BTGE 1GBJA 3A8DA 4JMYA 3RXQA 1T8LA 1MTSA 1OWKA 2ALVA 2P3FH 2OC8A 4MNVA 2BQ6B 3U1IB 1MAYA 3MO9A 1EP5A 2ZDNA 1V2LT 4BAHB 5C2ZA 1N6YA 2V6NA 1K28D 4UFDH 4FVDA 4WXVA 5SGAE 3F9GA 4HZHA 3TJUA 1SGDE 1H8ED 5T6FA 4NG9H 3A81A 1H8IH 2J98B 1WQSA 1O3DA 3B8JA 1ZHMA 1DUAA 5FCKA 2UWPA 3ZZ9A 3HK3B 2XRCA 3EE7A 1MU6B 2Y5HA 3Q77A 1QA7A 3MH6A 1O2KA 2VVVA 3CP7A 4RSPA 1TAWA 2R2MB 3OAAD 1FY5A 4K1EA 1KYNA 3SUGA 1G32B 3NWUA 4E05H 2J94A 1TFXA 2PTCE 4CH2B 2ZFQH 1P03A 1V2WT 4X1QU 2QXJA 2SGEE 1CSOE 3BTDE 4MNWA 5T6GA 1P2MA 1GI2A 1ZPZA 2KCPA 2AEIH 2Q1JA 1GDQA 2ZHQH 4I7YH 3A7XA 1Y3VA 3PV4A 4CR9A 3RXPA 2XCNA 5L2ZH 1N8OC 2WV4A 3GS9A 1LMWB 1IQJA 4XBCA 1O36A 2CF9H 1HAYB 5JBAS 3BIVH 3RXFA 1RTKA 3A87A 2F9OA 2B0FA 3LPRA 3RMNH 4OGXA 4AG1A 1VJ9U 2G00A 1OHHD 1Q3XA 3MI4A 4XD7D 2VIWA 3SW2B 3BG8A 1NO9H 3WY8A 4B2BA 1TBRH 2ZF0H 3SBKA 5A8ZA 2G55A 1C2DA 3RXBA 4OGYA 1TOMH 1ELEE 5FPTA 4ZKSU 3VGCC 2QYIA 3F3BA 2O8WA 2GT8A 4A92A 3GCOA 4Y8XA 1HAVB 1GBTA 1CU1A 2ZNKH 6CHAC 1P12E 2FEQH 1NU9A 1QA0A 1ELAA 2ZO3H 2FWWA 5KGOA 2PUQH 1D3PB 3LGIA 5A0AE 1VR1H 4O03A 2FI3E 3T27A 2AGEX 1W0ZU 3UAIC 4YESB 2EI7A 4IGDA 1CA0C 1L1JA 2VB0A 1QB1A 1SFQB 2RG3A 2K8IA 3TK9A 1XVMA 3RXVA 2QF0A 3D65E 3UNQA 1O2UA 1T8NA 1GBAA 4H42U 4A6LA 1C1TA 3RXSA 1LKBA 1RRKA 2BD5A 2ZP0H 1O5DH 1GBKA 2G4UA 5A8YA 1C1RA 5JYIA 4YLUA 3AAVA 1Z8GA 1TNHA 1UCYE 4ZAEA 1VJAU 2BY5X 3Q76A 1V2OT 3ZZAA 3WWFA 4AZ2B 5EIYA 3ITIA 5CDFE 4TT3D 4NWLA 2OP9A 3FKSD 2YNBA 1F7ZA 3FN8A 1ZSJA 3GCTF 2H9EH 2BXUH 2HNTE 2W7SA 3FZDA 3SGAE 1E34B 2FOBA 2Z9LA 1UVTH 3C27B 4YT7H 3DSPA 3PO1C 4B2AA 1HJAB 3UOPA 1EOJA 2OXSA 2YMSD 2P8OC 3PLKA 4JZDH 1ABJH 5A2MH 4RKOB 3TNSA 5HMAA 3GISB 2DUCA 1O2OA 3A88A 3O8RA 3EAJA 3F0OA 2ZGHA 1FY8E 3ZYDA 4ZXXH 1B5GH 1TQ0B 4CRDA 3RUOA 1NBME 4UFGH 2KCAA 3KQBA 3TH2H 3GYMA 4Q2KA 3EA7A 3RXCA 3MNBA 3AK5A 4AFSA 4FUHA 5CMXH 1GBLA 1OXGA 3F9FA 1L4ZA 2F3CE 3D49H 4BTUB 2QE7D 3UNSA 3SNAA 4X8TH 1GMHF 2BY6X 1C5LH 1IQMA 3H7OA 2R9PA 3IITA 2HALA 3FFGA 3SZEA 4BAQB 2OBQA 3KQ5A 4A1VA 2G5VA 1QB9A 2TGAA 3ZYEA 1PJPA 1CBWB 4D8NA 5FXLA 4JZIA 4M9FA 1UMAH 4ZUHA 1UTLM 2OTVA 1Y5BT 5T6DA 3SV9A 4ISNA 1TGTA 1QY6A 2RCEA 3M5LA 3V13A 1A4WH 2AMPA 5JB8S 1DFPA 1SPJA 1LPKB 4JK5A 2BOKA 1QB6A 3TNTA 2A1DB 1G36A 2XNIA 5GIBA 2TPIZ 2WPKS 3M37A 4J1YA 1AWHB 4FU8A 3HKJB 7KMEH 3URCA 1B7XB 1DICA 4I31A 4CHAB 4GAWA 1VITG 1EPTC 2LNCA 3M5OA 3E0PB 5DPAA 2PW8H 1P04A 2FX6A 3FP6E 4NA9H 1AB9C 5FBIA 1A3EH 2BD2A 1E38B 1EASA 2Q6FA 2VH6A 1EB1H 1DE7H 2QIQA 1XX9A 1C5TA 2W3KA 2V0BA 3R0FA 2IPHA 1TYNA 1JRSA 4DT7B 2Y5GA 2VWMA 1GHZA 2RFKC 5FL7D 1KLIH 1GI8B 1HAIH 3TH4H 1IHSH 1E36B 2J97A 2SFAA 3A89A 1XUHA 1P2KA 1O2YA 1GBIA 4FUGA 1DANH 3N7EA 2ZZUH 1C1MA 2OK5A 2STBE 4YOIA 3RMOH 2VVCA 4CBNA 1AE5A 4GSOA 3ZVCA 3DCLA 5E8EH 2OQUA 2J34A 4Y0ZE 2GGVB 1XM1A 3K9XB 5DP8A 3FANA 1P2NA 3SU2A 1GMDG 1MH0A 1NRRH 4Q7ZA 2XXLA 3UQOA 3AW1A 1QTFA 2WYJA 3MNSA 4MNYA 3GDVA 4WF8A 1Y8TA 1HIAA 2BD8A 2V7QD 4WXIA 1ZPCA 1O3PB 1EATA 4TYDA 4NIYA 3MU1A 1OSSA 4K2YA 3HATH 2FO9A 2ANWA 3RXKA 3ZZ6A 2O8UA 7LPRA 3EDXB 2TGTA 1O2XA 2GP9B 2H9TH 4FVBA 2D2DA 4B73A 2WSSD 5EW2H 2AHME 1QRXA 2FX4A 2QF5A 1QBVH 1ZGIA 4B1TA 2PKSB 1BHXB 1QJ1B 1SKYE 2WHXA 4Q80A 1BBRE 4K3JA 4OS1A 1FDPA 2BD3A 3TK5A 2ZQ2A 2G5NA 5CHAC 1T31A 3T5FH 4JYTA 1PFXC 3RXJA 3MMGA 3SYJA 3SI4H 2ZWLH 3NCLA 3SU3A 3URDA 3QX5H 1DWDH 4TY6A 4BAKB 3KHVA 1LO6A 4I8GA 1Z6JH 1SHYA 1PYTC 1A0JA 1BTUA 3KQCA 2TGDA 3UREA 3CENA 2W5EA 1QQUA 2J95A 3TK6A 2G81E 4NZLA 4H4FA 4DVAU 2F43B 2A7JA 4R8TB 1F92A 1A5HA 4SGAE 1YPHE 1HXFH 2OBOA 2Y81A 4XRNA 1E35B 1ZZZA 1O2LA 2XTTB 2PKAA 2H1UA 1XVOA 1RIWB 1C5UA 1DVAH 1GBHA 3E1XB 1P2QA 3A7VA 5A0CA 3U28C 3I29A 4BXSA 2BQ7B 3W94A 3HGPA 3RXUA 3TIUA 4Y8YA 1L1NA 2DE8A 3L6PA 4BNRA 3UQVA 2ZC9H 1ANEA 1BQYA 1C5NH 3QTVH 4J2YB 2VGCC 1GVZA 1OYTH 1FQ3A 1A3BH 1ANDA 1C5MD 1VKYA 2AGIX 2JKHA 4AGKA 1AIXH 1ESTA 4HI3A 1CHGA 3PV2A 4B75A 2BD9A 2FMJA 2QV1A 3KEEA 1UJ1A 1P05A 1JIRA 4TPIZ 1TRMA 1KXCA 3RXHA 1QQ4A 2WPJS 4ZHLU 1G9IE 1JRTA 1C2FA 2ZDAH 1J16A 2EEKA 1EUFA 2FZZA 3OU0A 3BV9B 2JH5D 4XDEA 1GJ9B 2PR3A 1C2KA 5TCAA 1GGDB 1DLEA 4DCDA 2STAE 1NPMA 3RXTA 3GOVB 1AUTC 1W0JD 3MH7A 1WSSH 5LPRA 2HGTH 1ARCA 3KQEA 4A5TS 1SI5H 3VB5A 1C5XB 1O2QA 3H09A 3M7UA 1W11U 3BG4C 5EOKA 4CRGA 1SVPA 3ZVFA 5JB9S 3TU7H 5F03A 4I8HA 4X6NA 5F6MA 1TRYA 4AFZA 3ZVAA 1UCYK 1O3IA 4BOHA 4WMEA 1IQGA 3TJOA 5GWZA 3TGJE 1YPGH 4GHTA 1SHHB 1T8OA 2ZTZA 3Q3KA 4DIHH 4KTSA 2BLQA 4NFEA 1EX3A 4ISIH 1DOJA 2BD7A 4YLQH 3SJ8A 3PLPA 1A5IA 3MU5A 1EZXC 4XE4A 2F9BH 1KTSB 3MYWA 1GI3A 3MH4A 2WPMS 3U8RH 3K6YA 1HIAB 1AFQC 3ZZCA 1TWXB 1QHRB 1GJCB 3PMHB 1S6FA 1S82A 3M7QA 4ACAA 1MKXH 3ZZ8A 1GCTB 2ZFSA 1OWEA 4CREA 1GBMA 1F2SE 1BTWA 1FUJA 1O38A 1C5OH 1EAWA 4F4OC 1DY8A 1NFXA 3AASA 4ZROA 1TNKA 5EJLA 2D8WA 5DGJA 1PPCE 1KXFA 1N1LA 2QXGA 1O5BB 3D62A 3ATIA 4TSFD 1O2ZA 2B7DH 2CMYA 1DSTA 2GZ8A 2FYRA 1BCUH 3MHWU 3AAUA 3L33A 2FODA 1SGFG 2WPLS 5DP5A 3N99A 2UWLA 2AYWA 1HJ8A 5J4SA 4D7FA 1EZUC 1UHBB 2BZ6H 3TPIZ 1O3NA 3PMAB 5KECA 1BBRH 1DXWA 5ESTE 2PV9B 3LH1A 3T26A 2JIZD 1YLDA 2FLBH 1AE8H 2ZU3A 3DD2H 1C5PA 1TNIA 2GZ9A 5EXNA 1LVOA 1LHEH 1CT4E 2HNTF 3GY4A 3QK1A 1GCDA 7GCHF 1QURH 2J38A 1PQ8A 3E16B 3BTWE 1MABB 3LH3A 1W7GH 1BMMH 2XWAA 4BAOB 2PKAB 2ODQA 1WTGH 3OTPA 4IN1A 5GCHG 3V3MA 2C8YB 4A1XA 1K1OA 3BEUA 3RMMH 2Z94A 4DJZB 1PQ7A 2B9LA 1Q31A 2JH0D 2QGRA 3ODFA 1XUKA 4JCNA 1EFRD 2I6SA 3KQDA 1EJNA 1K21H 4RT0A 2C8WB 1HV7A 1WAYB 1S0RA 4Y8ZA 5AVDA 2P93A 4ABEA 1O3GA 3U9AH 1J15A 1SBWA 1KDQA 1W7XH 5B6OA 2ZPQA 4KTCA 2Z3CA 1INCA 1GI6A 1XUIA 1TGCA 1V2PT 2VWOA 3BTTE 2QA9E 1NFWA 1AD8H 1O2RA 1O3AA 1S84A 2KAIA 1K1LA 4KGAA 5JBBS 1A0LA 2IJOB 3FVFB 4WH8A 1AKSA 4MDSA 4O9VA 3VG8A 3E3TA 4INKA 1KXBA 2PSYA 3ZZ7A 4Y7BA 3MU4A 1H1BA 1P2IA 3GY2A 3MNCA 3SV7A 1CHOG 4AB9A 3QWCH 1HJ9A 1MTWA 1AUJA 1UK3A 4RKJB 1E79D 1MKXK 3NXPA 2PUXB 3RM2H 8GCHG 4O97A 1NFUA 2ZHWH 1C5WB 1GPZA 1IOEA 1ARBA 1ZHPA 3SU4A 3ZVBA 1KLJH 2KZ4A 1FV9A 1OWIA 1NBMD 4X8VH 3UNRA 3QGJA 3F6UH 1OP0A 4K5ZA 3CS0A 2Z9KA 1TMBH 1VGCB 1UO6A 1O2HA 1L0ZA 2Y80A 1DT2A 3SJIA 4YOGA 2C3SA 2FYQA 2YOLA 1O5EH 1C9PA 4X2XA 1TX8A 3MWIU 5C67A 2IOTA 1A1RA 1GHBG 1MQ6A 3VB3A 1EAUA 3E0NB 1RS0A 4ZHAA 1S81A 4ZCNA 1ESBA 1BBRK 1Z8JB 2HLCA 2ZCKP 3RXMA 1SGIB 1F5LA 1HNEE 4TWWA 3PWCA 2J2UA 1DM4B 4MQAA 1QJ6B 1CE5A 1W8BH 2F9PA 3F2GA 1O2PA 3A84A 2GX4A 3ESTA 4AX9H 1S83A 1GGDC 1BMLA 2C4FH 1GI5A 2PGQB 3OEHD 3PMBB 4JYUH 4B74A 4TWYA 1K1IA 1BJVA 3M35A 3EA9A 3T25A 1EJMA 1SFIA 4X1PU 2TGPZ 3SJOA 2GMTB 2SNWA 1ELFA 1E37B 1K1PA 3M3VA 4LXBH 4Y10E 3ZZ3A 5H4IB 1EZSC 1ELCA 3QTOH 3B9FH 1V2NT 2ANKH 1VZQH 3IG6B 4ABDA 4AG2A 2BVRH 2BY8X 1GG6C 1ZOMA 1GBEA 3HPTB 3CS7A 5EU8A 1ZR0A 1GWAA 1YY3A 3KCGH 9ESTA 2O8MA 1OKXA 3N7DA 3N7OA 2K0QA 2GCTB 1FIZA 1FY4A 5IYTA 5C17A 1C5YB 2HVXA 1YYY1 4A1TA 1NU7B 2BDAA 2KFWA 4B6FA 4O3UA 1LVMA 4RN6A 2BD4A 1C5ZB 3RC6A 1HRTH 5C94A 1AQ7A 4FUIA 2H5CA 1OS8A 2XC4A 2G8TA 3LJOA 5EQQA 1T8MA 1IQEA 5L2YH 2G52A 2UUJB 1E1QD 4UE7H 4GCHG 2PHBA 2VH0A 3M3TA 3BTHE 1YC0A 1TA6A 1WDIA 3TH3H 1MTNB 1SL3A 4CRCA 1C2JA 5C3NA 3T2NA 1NY22 2R2WU 4LZ4B 1MZAA 2GCHG 2UWOA 1YP9A 2R0LA 2UUYA 2R0KA 3K6ZA 1O3BA 1Y5AT 2NU3E 2W6JD 3PRBA 3UY9A 2FI4E 2QN5T 1HLTH 1SGEE 3VFEA 1KXDA 3E90B 1KDQB 1NN6A 1T4VH 3R3GB 3RC4A 1GHWH 2BDBA 5DP3A 1F5RA 1DSUA 1GHVH 2F91A 4D9QA 3PTNA 2VIVA 3S0NA 2ZG0H 4FUDA 4AORA 2BMGB 1ZSKA 1O37A 1SGRE 2WPHS 3W1EA 2JETB 1IQLA 2KAIB 1PPHE 2SNVA 4BXWA 4VGCB 1HAXB 1D4PB 3ATMA 1AHTH 4E7RG 2L6OA 1V2UT 5T3HA 2KX4A 2ZGBH 4GVUA 3SV8A 5C1YA 4RT1A 1AKSB 1UK2A 1FNIA 4D7GA 1TPOA 4DIIH 7ESTE 5FPYA 1QNJA 3FP8E 4RI0A 1NESE 2A4QA 2P94A 1TNJA 2FOHA 4IC5A 3P8OA 4H6TA 5CE1A 1BITA 4TPYA 4XSKU 2CHAB 2XYAA 2ZFRH 1SGQE 1Y5UT 5J4QA 1GHAF 4FUEA 2FOEA 3SN8A 1FLEE 3BF6H 4AOQA 3LC3A 1YPKH 2AIQA 3S9CA 1Z7KA 2A5AA 5FHTA 1A7SA 2A5IA 2M5TA 3P70B 1F0TA 3RLWH 2FOCA 2P59A 1O3MA 3T28A 1ZMLA 4AFUA 5C1UA 1L4DA 1NC6A 1RTFB 4F48B 1C1NA 3VB4A 4UONA 1UVOA 3SORA 1LHDH 1W0YH 1NS3A 1GJAB 3A7WA 3PYHA 1GBCA 2L74A 3A83A 2YMSB 3ATWA 4ZKRU 3OEED 4HTCH 5L30H 3LGTA 3LIWA 3QZRA 5T1VA 1O5CB 1AU8A 4O3TA 3S7KB 2GVFA 3F2HA 2NU0E 3STJA 2XWBI 2ZIQH 1H9LB 4FU9A 5G4BA 2A45B 4WWYA 2ULLA 4LOYH 3RDZA 3GDUA 4IW4E 4XOJA 1MTUA 1QIXB 4JZFH 4B6EA 2SGAA 3OY6U 4I32A 5DKMA 3Q00A 3FO8D 4X6PA 3ZZBA 1WBGB 4MPXA 4ABJA 1OYQA 5GDSH 1BTXA 4Q7XA 4OS6A 1C2EA 1WUNH 1HAZB 4BTIB 1E1RD 1TGNA 2JJ2D 4X6OA 3DT0H 1FAXA 4HGCA 3ZZDA 2A4OA 2VWLA 3QUMP 3BN9A 2JJ1D 2XBVA 3A8CA 4UFFH 1BTPA 3KYGA 2BDCA 4Q4LA 3GCTG 1HXEH 2BLOA 5EPYA 1C5SA 2H9HA 1WV7H 3NPSA 3UWIA 3SOSA 4ASUD 2PTNA 2VNTA 5I25A 2QAAA 2ZHFH 1AI8H 3A7TA 1SGPE 5FX5A 1YLNA 3TJNA 5LH8A 1V2QT 1AO5A 5C0TA 1SOTA 2CF8H 3ZV8A 1FPHH 4HFPB 2XCFA 1CGHA 2FOMB 2VWNA 2ZGJA 3BTKE 2AIPA 3A8AA 1OWDA 1O3FA 3HK6B 1UCYH 2CXVA 2ZDLA 3GCNA 4IC6A 4ZKNU 1TGBA 4F55A 1GMCF 1GMHG 3EYDA 1UTNA 3LT3A 1IQHA 2HPQH 4OS4A 1UVSH 1Y3XA 5GNDA 3RLYH 3SQHE 3BTME 1LPZB 1B0FA 2D26C 3TLOA 3PRDA 4AGJA 3RXGA 4DOQA 1F0UA 1NZQH 4CBOA 1QBOA 2AMDA 1SB1H 2R3YA 1ZPBA 1C1WH 1S0QA 2WUBA 1D6WA 4X0WU 1D6RA 2UUFB 3SU0A 5AFZH 1K22H 1QGFA 1ZRBA 2BB4A 1MZDA 1BIOA 1TIOA 2AGGX 1TABE 2TIOA 3KGPA 3LDXH 3QLPH 1ELBA 1ANCA 3O8BA 1OP2A 4Y79A 1HAOH 1O30A 2AH4X 5AFYH 1H8DH 5DP6A 3S9AA 1ZTKA 3SUDA 5HM2A 3OYPA 5ABWA 1H8HD 5FAHA 2Y5FA 1JBUH 1O35A 3QZQA 1G30B 4YZUA 3UFAA 4I8LA 3TJVA 1E0FD 3SU6A 1MTVA 3S69A 2EI6A 1HJAC 1JIMA 3MO6A 4IN2A 1MKWH 4AFQA 1CQQA 5AF9H 1AGJA 4D76A 1QJ7B 3T62A 3A80A 1CGIE 3KNXA 1S85A 1ZJDA 1W2KH 2ZHDA 2W26A 5C1XA 3B23B 2FS9A 1AY6H 4K8YA 1UK4A 1P06A 6GCHF 1HAGE 1KSNA 1LPGB 1YGCH 1ZTJA 1NRSH 5DK1A 1BA8B 1S5SA 1CGJE 1IQKA 5EQRA 5FX6A 2GKVE 2WV9A 2ZPSA 1UTOA 1GJBB 1UTQA 2Y7ZA 2JH6D 1XUFA 1AVWA 3UWJH 1C1UH 1SGNE 2JDID 1EPTA 2CK3D 5GCHF 1GI4A 1GJ4H 1CBWC 3BTFE 1BDAA 1DWEH 3CNRA 2GTBA 2J92A 3P17H 5HXFA 1H9HE 2BY7X 1NROH 2FPZA 1O2MA 3A86A 1HUTH 1ZTLA 3OY5U 3VB7A 2XC0A 1GL1A 4OS5A 1BMNH 3HGNA 3M5MA 1TX6A 3K2UA 1P09A 1GBDA 4AYVB 2FOFA 2OC7A 3VGCB 1MUEB 3E8LA 1C4U2 4K1TA 4D9RA 1WXRA 3QN7A 1HYLA 1A5GH 4MNXA 1VCQA 1W10U 1FPCH 1TONA 4CHAC 1A0HB 1ZMNA 2RA3A 1BRUP 2ZFPH 5HKKD 1O2NA 1Z71A 1MBMA 2J5UA 2OC0A 3MNXA 5EXLA 4FETA 4UD9H 4WVPE 1MU8B 1AZ8A 3T29A 1HCGA 2GV6A 4U30A 4X6MA 2ZGCA 5GPIB 2VIQA 3JZ2B 3LGWA 3BEFB 3VXFH 1OPHB 5E2PA 2ZECA 2BX3A 4NA7A 3C1KA 2Z7FE 4X8SH 2IJD1 1FN8A 4WMFA 1NT1A 4I8JA 4GHQA 5C5NA 1O5FH 3U1JB 1V2VT 2BZAA 1G2MA 1QL8A 1V2TT 1MD7A 2AFQB 3PB1E 5FCRA 3A7ZA 1J9CH 1Y3UA 3RM0H 3S7HB 2OLGA 1UTJA 3WW7A 2KR7A 1TBQH 3MTYA 5TJXA 1RFNA 1FX0B 4YXWD 3RU4E 1P02A 1YPJH 1KLTA 1MKWK 4GUXA 3GY7A 4YTAA 1MBQA 1DS2E 1JOUB 3LKWA 5E2OA 3SUFA 1O39A 4OS7A 1YPEH 4F49A 1O0DH 2F9NA 3PO1B 2M2AA 1IQIA 1C2LA 2P8OB 3ATLA 2BOHB 1C1OA 1TMTH 4A7IB 1PPFE 1LQDB 2LPRA 2C8ZB 2ZU2A 5EW1H 2Z3EA 5EJZA 1D3QB 2Q6GA 1IQFA 1RJXB 1X7AC 5HM9A 1SQOA 1FJSA 5BRRE 2NU2E 3UR6A 5FBEA 1L1GA 3F2FA 4WMDA 3ZVGA 2C90B 3GY3A 4ABBA 4BAMB 4YT6H 4NIXA 3A8BA 3OSYA 1O2WA 1TPPA 2ANYA 3DA9B 2XBXA 1XUGA 2PKSC 2ZDMA 3M3SA 1YCPK 1CVWH 1GI1A 2VIPA 5ETXA 2HWLB 4I8KA 2A5KA 1O32A 3P8NA 4IMQA 1SLXB 3LGUA 2H5DA 1KMHB 1SQAA 2SGPE 1P8VC 1SLUB 4OM9A 2KCOA 5IK2D 4U32A 3S9BA 4X1NU 5E0JA 5EJ1A 1O31A 2ZGXH 1XUJA 1G3BA 4ZKOU 3G01A 3P6ZB 1T7CA 5A8XA 2OUAA 4Z6AH 1GHXH 1K9OE 4MPUA 2ODPA 1SLWB 1VCPA 4Z0KA 1OX1A 4FOUC 2VIOA 1YBWA 5A09A 1OWJA 1COWD 3RXAA 3SHAH 1Z6EA 2BVXH 3H7TA 4GCHF 1ZYOA 1BMAA 1HDTH 1BJUA 1RIWC 2ILNA 5A0BA 1JXPA 2P3UB 2WUCA 4NCYA 1EPTB 2H2ZA 2OQ5A 5CHBA 1C1VH 2LP6A 3DUXH 4E7NA 4YOJA 9LPRA 1P10A 3I78A 1AB9B 1SMFE 3SU1A 4CRFA 1WU1A 4P00A 4SGBE 2B8OH 1P3CA 3O8CA 1K0HA 2GCHF 1P9UA 2Y6TA 1FN6A 2BLVA 3KL6A 3QDZB 1U6QA 2O9QA 1SR5C 3TVJB 4WJG2 1C2MA 2Z9GA 2GDDA 1ESAA 2KCYA 1DWCH 3SQEE 3P92A 1AN1E 2QY0B 5DN6D 1BRAA 4Q63A 1K2I1 2GZ7A 1LDTT 1THSH 3Q3YA 1FAKH 1XXFA 2BXTH 2ODYB 1HBTH 2ALPA 2BHGA 4ASHA 1PYTD 3SGQE 1C5VA 1ELVA 3OX7U 2VBCA 4Z1MD 3RXEA 3SNDA 2G51A 3LC5A 3F68H 3UTUH 3BTEE 4ISOA 5DP7A 1KIGH 1D3DB 1C5RA 5I46H 3GY5A 1F0RA 2ZPRA 2BDGA 3DHKH 1K1JA 1QR3E 1DX5M 3RXDA 3E6PH 2FDAA 1V2RT 4XBBA 1G3DA 1GVKB 1S6HA 7GCHG 8LPRA 2EA3A 1Z8IB 3P8GA 1V3XA 2NU4E 3ZZ5A 1SGCA 2Y82A 1TBZH 4B76A 5K0HA 2C8XB 1O5AB 1V2JT 1IHTH 3EQ0H 4NWKA 5DSFA 1GJ5H 4B71A 3GY8A 3TGIE 1GJDB 1GDUA 2ESTE 8KME2 3EGKH 5DJ7A 2PGBB 1OOKB 1CT0E 3SZNA 1ZMJA 3UR9A 3P95A 1LVYA 1VITF 1AWFH 3KF2A 2VVUA 4UDWH 1BRBE 2SGFE 1TGSZ 4U01A 5CHAB 2AMQA 2BTCE 3NZIA 2QF3A 1GCTC 3SI3H 2WZQA 3NK8A 4MVNA 4K69A 3V12A 2NU1E 4FUJA 2D1JA 3JZ1B 1LHCH 5GXPA 1GDNA 1ABIH 3LOXA 2ZDVH 4GPGA 1Y3YA 4X2VA 2IPQX 4I86A 1IQNA 1IAUA 5JPMH 4ESTE 2FOGA 2RDLA 4FUBA 1LHGH 3LU9B 5DG6A 1LHFH 3F9EA 3GDSA 1O2JA 1C2IA 4ACBA 4ABGA 1N6XA 2Q6DA 4AB8A 1TB6H 1KTTB 3F9HA 2NWNA 3DSOA 1UTMA 2P16A 1GHYH 2VINA 1G2LA 4ABIA 1V2KT 3GICB 4K60A 1W12U 4X8UH 2CV3A 4X1RU 3BTQE 5JBTA 2BDYA 1KXEA 4P02A 3UPEA 5KEDA 1GMDF 1V2ST 1YM0A 2W7UA 2J4IA 1C1PA 3SNEA 1SGTA 5EODA 2BYAX 1SGYE 2VGCB 4DURA 1Y59T 2PFEA 5EGMA 1EXFA 3RXLA 2A2QH 2A32A 3IWMA 2WINI 5FPSA 1EOLA 2ZDKA 1M9UA 1TNLA 3BIUH 2UUKB 1J8AA 1C1SA 3KIDU 3ATKA 1NFYA 4ZMAH 1O3JA 1P0SH 1MCVA 2YNAA 3PV5A 3AW0A 1FZZA 4Q7YA 2TBSA 3MFJA 3UUZA 2Y7XA 4CRAA 4TY7A 1AZZA 4WH6A 1DY9A 2WV5A 3FP7E 1HGTH 1RTLA 1Q2WA 4M7GA 3QO6A 1B0EA 1BTYA 5C20A 1BTHH 5AHGH 2HVYB 4THNH 5JDUB 5ESBA 1XXDA 1O3EA 1OP8A 3BG4B 4MPVA 1QL7A 1BHXF 2RA0A 3RXOA 4ABHA 3H5CB 3GCHB 1KXAA 4ZXYH 1YLCA 2OD3B 4GLYA 4AN7A 1YPLH 4IBLH 3L3TA 2AERH 3I77A 3Q3XA 3RMLH 5BPEA 2XBWA 3A85A 1HAPH 4CH8B 1FXYA 2SGDE 1Z8RA 1ELTA 2P95A 5DP9A 3BSQA 4JK6A 3PMJA 1F5KU 1PPEE 1F0SA 4K8BA 2ASUB 3NUMA 1KY9A 1YKTA 1RXPA 2V3HH 3V0XA 3VPKA 3UB0A 2ZHEH 1A61H 1V6DA 2F83A 2VIDA 1BUIA 2O8LA 1TALA 1QRZA 1C4V2 2HOBA 4INHA 2WPDD 2Z3DA 1GVLA 1YF4A 4XBDA 3VB6A 1C9TA 1AFQB 2WPIS 2FTLE 1VGCC 3MU0A 2A7HA 2ZEBA 1FI8A 2ZTYA 3ZZ4A 3M7TA 5LPFA 1Z1IA 2FI5E 4ISLA 4U2WA 4OS2A 1WCZA 1C2HA 1EKBB 1DDJA 1ACBE 4IMZA 1TLDA 1PPGE 2WYGA 4DW2U 1TOCB 4KP0A 1P01A 5F53A 1DPOA 1LQEA 2ZI2H 4DGJA 3V7TA 4HG6A 2XNDD 2PSXA 1DLKB 2FTMA 3ELAH 1MMJN 4MG3A 2B5TB 3RXRA 1PPBH 1C1QA 1EP6A 3M36A 4DG4A 4NZQA 6LPRA 1TRNA 2FLRH 2QF4A 2J9NA 1D9IA 2ZFFH 3RC5A 1DITH 3O8DA 4MPWA 1BMFD 1T32A 2HNTC 1W13U 1SQTA 1V2MT 2F4LA 5PTPA 1QFKH 1SSXA 2FIRH 1JWTA 3M5NA 5E0HA 1CT2E 2GMTC 2TRMA 1ETRH 5K7RA 1Z1JA 1QRWA 3MO3A 4Y6DA 1G3EA 2QXHA 3KN2A 5HGGA 5DP4A 1ZJKA 2BVSH 4PROA 3UOUA 3BEIB 2ZA5A 4K1SA 4XFQA 1UVUH 2A2XH 2ZCLP 1QZ8A 1H4WA 2G4TA 2ZCHP 1GHAG 2CN0H 3A82A 1BTZA 1WTHD 3ZVDA 2BLWA 2GCTC 2GT7A 3PROA 4DT4A 2GDEH 4NSVA 3SV6A 1SLVB 1P3EA 2Z9JA 3GY6A 1FIWA 1THPB 1SGFA 1BZXE 5E0GA 3SJKA 1LCYA 5F8ZA 2BX4A 4X2WA 2R3UA 3NKKA 4KKDA 2FXRA 4UEHH 5EQSA 1HB0B 1K1NA 2EQNA 1YWUA 1SG8B 3STIA 1D3TB 1O2SA 4NIWA 1O2VA 3ODDA 2V3OH 4LZ1H 1CA8B 2ZU1A 3QGNB 5C5OA 4UFEH 1UHBA 2Z9IA 2LELA 3SV2H 3RU4D 1P9SA 1FMGA 1OWHA 3P8FA 4AC9A 3DFJA
chains in the Genus database with same CATH topology
4ISHH 1G3CA 1MTNC 1O2IA 1THRH 5L6NH 1O34A 2ZFTA 1NRPH 3SHCH 2SGQE 4JZ1A 1AFEH 1GBFA 1LVBA 2ZU4A 3LGYA 5LPEA 1O3CA 4Y71A 1GJ7B 2AS9A 4Y11E 1JMOH 2THFB 5EG4A 1W14U 4JZEH 1ZHRA 4KTUA 3PM3A 1TQ7B 1LKAA 4NIVA 2JETC 1L2EA 2CGAA 1AVXA 1BT7A 4VGCC 2CJIA 3RP2A 3TGKE 3U8OH 2A31A 2BDHA 1J14A 2BQWB 3TITA 1RGQA 5EXMA 1NTPA 3SO3A 3PTBA 3U98H 3SJ9A 1O3OA 2FM2A 3ZVEA 5F8TA 4MLFB 1Y3WA 4ZHMU 3EA8A 2FOAA 1P2JA 2W3IA 1H9IE 4I33A 1EJAA 1MAXA 1ETTH 2CHAC 3D23A 1ANBA 1N8OB 1ELDE 3W95A 2VU8E 2QXIA 1EAIA 1XKBC 1PQ5A 1LTOA 1YCPH 1QBNA 2A4RA 4BANB 5DO4H 4IS5A 2ZKSA 1UTKA 1GBBA 3FAOA 1O3KA 2XC5A 4X2YA 3PLBA 1TPSA 4CRBA 4X1SU 3GYLB 4E06H 1MD8A 3LGVA 3HKIB 3UIRA 2OINA 1FONA 3PWBA 4Y7AA 4Y76A 1QCPA 3ZV9A 2BDIA 1GI0A 1GMCG 3GCHC 4FUFA 2PLXA 4YM9A 6CHAB 1WYKA 4INLA 5GJ4B 1O33A 1HFDA 1ETSH 2A4GA 1GJ8B 2BY9X 3FZZA 1AVGH 2ZTXA 1GG6B 3MH5A 2BM2A 1TA2A 4NGAH 3SGBE 5JBCS 2ZQ1A 1XKAC 1O2GH 2V35A 5TCCA 1CA0B 1TNGA 1ZSLA 4FU7A 1TE0A 1NM6A 2OCVB 4MTBA 3SNBA 1HAHH 1NRNH 4QT8C 1W3CA 1NRQH 1CHOF 1DWBH 1P2OA 2IN2A 3LJJA 1CO7E 1ID5H 5HYOA 4R0IA 6ESTA 4ABFA 8GCHF 1A2CH 2ZU5A 1EZQA 1SC8U 1TPAE 1SOZA 1VITH 1EB2A 4DY7B 1DXPA 2I6QA 2PWXA 3AVZA 1P11E 1WOFA 1C5QA 4BTTB 2XBYA 3ENSB 3K65B 3M61U 1BOQA 5LGOA 4NA8A 2QC2A 2HRVA 1EAXA 1RD3B 1UVPA 1ORFA 4KELA 2F9VA 1YPMH 1TX7A 2A0QB 4NSYA 1GHBF 1WQVH 2XW9A 3MU8A 1HAVA 4H6SB 3RU4T 1BRCE 1XMNB 2OC1A 4LK4A 2Z6BD 2ANMH 2H6MA 2P3TB 3SUEA 1GI9B 3A7YA 1YPHC 2GV7A 2VJ1A 4YO9A 1O5GH 1PPZA 1C2GA 4B2CA 4AYYB 1ELGA 3OTJE 2EI8A 4JYVH 1GI7B 4WY3A 1HPGA 1O2TA 4ABAA 1VCWA 1FY3A 1EQ9A 3RXIA 3SNCA 2HPPH 3LONA 1ZRKA 3VXEH 3MOCA 6GCHG 2O8TA 1QL9A 3SU5A 1MCTA 1DUEA 4NFFA 1GJ6A 2FESH 2K1QA 1T4UH 2GD4B 3F1SB 1O3HA 1O3LA 1A46H 4FUCA 1ZLRA 1UTPA 2FP7B 4CR5A 8ESTE 1PQAA 4ZH8A 2A7CA 2DE9A 5F8XA 3U69H 4FXGH 1FY1A 1C4Y2 1ZGVA 1BB0B 3DFLA 1G37A 1P57B 3EE0B 3E91A 1TMUH 1MQ5A 4Y0YE 5EPNA 1K1MA 2C93B 1AMHA 2F9UA 1YCPM 2EC9H 3U8TH 1GL0E 2FS8A 3VEQB 1J17T 2QCYA 5IDKA 3BTGE 1GBJA 3A8DA 4JMYA 3RXQA 1T8LA 1MTSA 1OWKA 2ALVA 2P3FH 2OC8A 4MNVA 2BQ6B 3U1IB 1MAYA 3MO9A 1EP5A 2ZDNA 1V2LT 4BAHB 5C2ZA 1N6YA 2V6NA 1K28D 4UFDH 4FVDA 4WXVA 5SGAE 3F9GA 4HZHA 3TJUA 1SGDE 5T6FA 4NG9H 3A81A 1H8IH 1WQSA 1O3DA 3B8JA 1ZHMA 1DUAA 5FCKA 2UWPA 3ZZ9A 3HK3B 2XRCA 1MU6B 2Y5HA 3Q77A 1QA7A 3MH6A 1O2KA 2VVVA 3CP7A 4RSPA 1TAWA 2R2MB 1FY5A 4K1EA 1KYNA 3SUGA 1G32B 3NWUA 4E05H 2J94A 1TFXA 2PTCE 4CH2B 2ZFQH 1P03A 1V2WT 4X1QU 2QXJA 2SGEE 1CSOE 3BTDE 4MNWA 5T6GA 1P2MA 1GI2A 1ZPZA 2AEIH 2Q1JA 1GDQA 2ZHQH 4I7YH 3A7XA 1Y3VA 3PV4A 4CR9A 3RXPA 2XCNA 5L2ZH 1N8OC 2WV4A 1LMWB 1IQJA 4XBCA 1O36A 2CF9H 1HAYB 5JBAS 3BIVH 3RXFA 1RTKA 3A87A 2F9OA 2B0FA 3LPRA 3RMNH 4OGXA 4AG1A 1VJ9U 2G00A 1Q3XA 3MI4A 2VIWA 3SW2B 3BG8A 1NO9H 3WY8A 4B2BA 1TBRH 2ZF0H 3SBKA 5A8ZA 2G55A 1C2DA 3RXBA 4OGYA 1TOMH 1ELEE 5FPTA 4ZKSU 3VGCC 2QYIA 2O8WA 2GT8A 4A92A 3GCOA 4Y8XA 1HAVB 1GBTA 1CU1A 2ZNKH 6CHAC 1P12E 2FEQH 1NU9A 1QA0A 1ELAA 2ZO3H 2FWWA 2PUQH 1D3PB 3LGIA 5A0AE 1VR1H 4O03A 2FI3E 3T27A 2AGEX 1W0ZU 4YESB 2EI7A 4IGDA 1CA0C 1L1JA 2VB0A 1QB1A 1SFQB 2RG3A 3TK9A 1XVMA 3RXVA 2QF0A 3D65E 3UNQA 1O2UA 1T8NA 1GBAA 4H42U 4A6LA 1C1TA 3RXSA 1LKBA 1RRKA 2BD5A 2ZP0H 1O5DH 1GBKA 2G4UA 5A8YA 1C1RA 5JYIA 4YLUA 3AAVA 1Z8GA 1TNHA 1UCYE 4ZAEA 1VJAU 2BY5X 3Q76A 1V2OT 3ZZAA 4AZ2B 3ITIA 4NWLA 2OP9A 2YNBA 1F7ZA 1ZSJA 3GCTF 2H9EH 2BXUH 2HNTE 2W7SA 3FZDA 3SGAE 1E34B 2FOBA 2Z9LA 1UVTH 3C27B 4YT7H 3PO1C 4B2AA 1HJAB 3UOPA 1EOJA 2OXSA 3PLKA 2P8OC 4JZDH 1ABJH 5A2MH 4RKOB 3TNSA 5HMAA 3GISB 2DUCA 1O2OA 3A88A 3O8RA 3EAJA 2ZGHA 1FY8E 3ZYDA 4ZXXH 1B5GH 1TQ0B 4CRDA 3RUOA 4UFGH 3KQBA 3TH2H 3GYMA 4Q2KA 3EA7A 3RXCA 3MNBA 4AFSA 4FUHA 5CMXH 1GBLA 1OXGA 3F9FA 1L4ZA 2F3CE 3D49H 4BTUB 3UNSA 3SNAA 4X8TH 1GMHF 2BY6X 1C5LH 1IQMA 3H7OA 2R9PA 3IITA 2HALA 3FFGA 4BAQB 2OBQA 4A1VA 2G5VA 1QB9A 2TGAA 3ZYEA 1PJPA 1CBWB 4D8NA 5FXLA 4JZIA 1UMAH 4ZUHA 1UTLM 2OTVA 1Y5BT 5T6DA 3SV9A 4ISNA 1TGTA 1QY6A 2RCEA 3M5LA 3V13A 1A4WH 2AMPA 5JB8S 1DFPA 1SPJA 1LPKB 4JK5A 2BOKA 1QB6A 3TNTA 2A1DB 1G36A 2XNIA 5GIBA 2TPIZ 2WPKS 3M37A 4J1YA 1AWHB 4FU8A 3HKJB 7KMEH 3URCA 1B7XB 1DICA 4I31A 4CHAB 4GAWA 1VITG 1EPTC 2LNCA 3M5OA 3E0PB 5DPAA 2PW8H 1P04A 2FX6A 3FP6E 4NA9H 1AB9C 5FBIA 1A3EH 2BD2A 1E38B 1EASA 2Q6FA 2VH6A 1EB1H 1DE7H 2QIQA 1XX9A 1C5TA 2W3KA 2V0BA 3R0FA 2IPHA 1TYNA 1JRSA 4DT7B 2Y5GA 2VWMA 1GHZA 1KLIH 1GI8B 1HAIH 3TH4H 1IHSH 1E36B 2SFAA 3A89A 1XUHA 1P2KA 1O2YA 1GBIA 4FUGA 1DANH 2ZZUH 1C1MA 2STBE 4YOIA 3RMOH 2VVCA 4CBNA 1AE5A 4GSOA 3ZVCA 5E8EH 2OQUA 2J34A 4Y0ZE 2GGVB 1XM1A 3K9XB 5DP8A 3FANA 1P2NA 3SU2A 1GMDG 1MH0A 1NRRH 4Q7ZA 2XXLA 3UQOA 3AW1A 1QTFA 2WYJA 3MNSA 4MNYA 3GDVA 4WF8A 1Y8TA 1HIAA 2BD8A 4WXIA 1ZPCA 1O3PB 1EATA 4TYDA 4NIYA 3MU1A 1OSSA 4K2YA 3HATH 2FO9A 2ANWA 3RXKA 3ZZ6A 2O8UA 7LPRA 3EDXB 2TGTA 1O2XA 2GP9B 2H9TH 4FVBA 2D2DA 4B73A 5EW2H 1QRXA 2FX4A 1QBVH 1ZGIA 4B1TA 2PKSB 1BHXB 1QJ1B 4Q80A 1BBRE 4K3JA 4OS1A 1FDPA 2BD3A 3TK5A 2ZQ2A 2G5NA 5CHAC 1T31A 3T5FH 4JYTA 1PFXC 3RXJA 3MMGA 3SI4H 2ZWLH 3NCLA 3SU3A 3URDA 3QX5H 1DWDH 4TY6A 4BAKB 3KHVA 1LO6A 4I8GA 1Z6JH 1SHYA 1PYTC 1A0JA 1BTUA 3KQCA 2TGDA 3UREA 3CENA 2W5EA 1QQUA 2J95A 3TK6A 2G81E 4NZLA 4H4FA 4DVAU 2A7JA 4R8TB 1F92A 1A5HA 4SGAE 1YPHE 1HXFH 2OBOA 2Y81A 1E35B 1ZZZA 1O2LA 2XTTB 2PKAA 2H1UA 1XVOA 1RIWB 1C5UA 1DVAH 1GBHA 3E1XB 1P2QA 3A7VA 5A0CA 3I29A 4BXSA 2BQ7B 3W94A 3HGPA 3RXUA 3TIUA 4Y8YA 1L1NA 2DE8A 3L6PA 4BNRA 3UQVA 2ZC9H 1ANEA 1BQYA 1C5NH 3QTVH 4J2YB 2VGCC 1GVZA 1OYTH 1FQ3A 1A3BH 1ANDA 1C5MD 2JKHA 2AGIX 4AGKA 1AIXH 1ESTA 4HI3A 1CHGA 4B75A 2BD9A 2FMJA 2QV1A 3KEEA 1UJ1A 1P05A 1JIRA 4TPIZ 1TRMA 1KXCA 3RXHA 1QQ4A 2WPJS 4ZHLU 1G9IE 1JRTA 1C2FA 2ZDAH 1J16A 2EEKA 1EUFA 2FZZA 3OU0A 3BV9B 2JH5D 4XDEA 1GJ9B 2PR3A 1C2KA 5TCAA 1GGDB 1DLEA 4DCDA 2STAE 1NPMA 3RXTA 3GOVB 1AUTC 3MH7A 1WSSH 5LPRA 2HGTH 1ARCA 3KQEA 4A5TS 1SI5H 3VB5A 1C5XB 1O2QA 3M7UA 1W11U 3BG4C 5EOKA 4CRGA 1SVPA 3ZVFA 5JB9S 3TU7H 5F03A 4I8HA 4X6NA 5F6MA 1TRYA 4AFZA 3ZVAA 1UCYK 1O3IA 4BOHA 4WMEA 1IQGA 3TJOA 5GWZA 3TGJE 1YPGH 4GHTA 1SHHB 1T8OA 2ZTZA 3Q3KA 4DIHH 4KTSA 2BLQA 4NFEA 1EX3A 4ISIH 1DOJA 2BD7A 4YLQH 3SJ8A 3PLPA 1A5IA 3MU5A 1EZXC 4XE4A 2F9BH 1KTSB 3MYWA 1GI3A 3MH4A 2WPMS 3U8RH 3K6YA 1HIAB 1AFQC 3ZZCA 1TWXB 1QHRB 1GJCB 3PMHB 1S6FA 1S82A 3M7QA 1MKXH 3ZZ8A 1GCTB 2ZFSA 1OWEA 4CREA 1GBMA 1F2SE 1BTWA 1FUJA 1O38A 1C5OH 1EAWA 4F4OC 1DY8A 1NFXA 3AASA 4ZROA 1TNKA 2D8WA 5DGJA 1PPCE 1KXFA 1N1LA 2QXGA 1O5BB 3D62A 3ATIA 1O2ZA 2B7DH 2CMYA 1DSTA 2GZ8A 2FYRA 1BCUH 3MHWU 3AAUA 3L33A 2FODA 1SGFG 2WPLS 5DP5A 2UWLA 2AYWA 1HJ8A 5J4SA 4D7FA 1EZUC 1UHBB 2BZ6H 3TPIZ 1O3NA 3PMAB 1BBRH 1DXWA 5ESTE 2PV9B 3LH1A 3T26A 1YLDA 2FLBH 1AE8H 2ZU3A 3DD2H 1C5PA 1TNIA 2GZ9A 5EXNA 1LVOA 1LHEH 1CT4E 2HNTF 3GY4A 3QK1A 1GCDA 7GCHF 1QURH 2J38A 1PQ8A 3E16B 3BTWE 3LH3A 1W7GH 1BMMH 2XWAA 4BAOB 2PKAB 2ODQA 1WTGH 4IN1A 5GCHG 3V3MA 2C8YB 4A1XA 1K1OA 3BEUA 3RMMH 2Z94A 4DJZB 1PQ7A 2B9LA 1Q31A 2JH0D 2QGRA 3ODFA 1XUKA 4JCNA 2I6SA 3KQDA 1EJNA 1K21H 2C8WB 1HV7A 1WAYB 1S0RA 4Y8ZA 5AVDA 2P93A 4ABEA 1O3GA 3U9AH 1J15A 1SBWA 1KDQA 1W7XH 5B6OA 2ZPQA 4KTCA 2Z3CA 1INCA 1GI6A 1XUIA 1TGCA 1V2PT 2VWOA 3BTTE 2QA9E 1NFWA 1AD8H 1O2RA 1O3AA 1S84A 2KAIA 1K1LA 4KGAA 5JBBS 1A0LA 2IJOB 3FVFB 4WH8A 1AKSA 4MDSA 4O9VA 3E3TA 4INKA 1KXBA 2PSYA 3ZZ7A 4Y7BA 3MU4A 1H1BA 1P2IA 3GY2A 3MNCA 3SV7A 1CHOG 4AB9A 3QWCH 1HJ9A 1MTWA 1AUJA 1UK3A 4RKJB 1MKXK 3NXPA 2PUXB 3RM2H 8GCHG 4O97A 1NFUA 2ZHWH 1C5WB 1GPZA 1IOEA 1ARBA 1ZHPA 3SU4A 3ZVBA 1KLJH 1FV9A 1OWIA 4X8VH 3UNRA 3QGJA 3F6UH 1OP0A 4K5ZA 3CS0A 2Z9KA 1TMBH 1VGCB 1UO6A 1O2HA 1L0ZA 2Y80A 1DT2A 3SJIA 4YOGA 2C3SA 2FYQA 2YOLA 1O5EH 1C9PA 4X2XA 1TX8A 3MWIU 5C67A 2IOTA 1A1RA 1GHBG 1MQ6A 3VB3A 1EAUA 3E0NB 1RS0A 4ZHAA 1S81A 1ESBA 1BBRK 1Z8JB 2HLCA 2ZCKP 3RXMA 1SGIB 1F5LA 1HNEE 4TWWA 3PWCA 2J2UA 1DM4B 4MQAA 1QJ6B 1CE5A 1W8BH 2F9PA 1O2PA 3A84A 2GX4A 3ESTA 4AX9H 1S83A 1GGDC 1BMLA 2PGQB 1GI5A 2C4FH 3PMBB 4JYUH 4B74A 4TWYA 1K1IA 1BJVA 3M35A 3EA9A 3T25A 1EJMA 1SFIA 4X1PU 2TGPZ 3SJOA