3LGUA

Y162a mutant of the degs-deltapdz protease
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
191
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRGLLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATGGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSPEGIGFAIPFQLATKIMDKLIRDGRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
total genus 42
structure length 191
sequence length 217
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lguA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lguA02
1LVYA 5E2PA 2F3CE 1UTLM 4OS5A 4ABEA 1SHHB 1NM6A 1JIRA 4X8UH 3DUXH 4DURA 2OCVB 1W13U 5PTPA 4HGCA 1EX3A 1MD8A 1GL0E 1KTSB 1TRYA 5JBCS 1SGNE 2JETC 4Y6DA 4Y10E 3LC3A 2BLOA 1YF4A 1LPKB 2A1DB 1OWHA 3A80A 4U01A 3VEQB 5ESTE 2SGAA 1O2RA 4ISNA 3RXIA 1SMFE 1VCPA 4YOJA 1IQEA 4BTIB 1TRMA 1F5LA 4CR9A 1DSTA 1SG8B 2P3TB 3SU6A 2ZECA 1P03A 4MLFB 3RXEA 1BB0B 3IITA 1MAXA 2G00A 2AGIX 1H1BA 1S84A 2ZU5A 1C5PA 2BVXH 2ZDVH 1O30A 3BG8A 2R2MB 1O3AA 1SQAA 1S0QA 4Y8XA 2O9QA 5JYIA 5JB8S 1YPHE 1C4Y2 1SHYA 4BAOB 2A5AA 2ZHWH 1YPMH 4KP0A 5LGOA 1LKBA 3VXEH 3K2UA 5EXLA 1ZHRA 1O36A 1HXEH 1O2TA 5TJXA 3Q3YA 1P2MA 1HDTH 1O2GH 4O9VA 1GJ5H 4CBOA 3NWUA 3UTUH 4KTUA 3ZZ3A 1EAIA 1QJ7B 2VGCC 3U98H 4UEHH 1AVWA 2ZDLA 1MH0A 1XMNB 1QRXA 3M36A 4LK4A 1MTUA 1FZZA 2BY7X 1GJ9B 3RXJA 1CBWB 3PMAB 2XBWA 2V3OH 4CRFA 3BTTE 5FCRA 4ZHLU 1ANDA 3TJNA 2NU0E 3KGPA 2ODPA 2BQ7B 2D26C 3E8LA 3V12A 1MKWK 3ZZAA 3M61U 3K6YA 1ZSJA 1W0ZU 1S5SA 1HAGE 2ZG0H 1C2IA 1P9UA 3A8AA 2WPHS 1W10U 4X1QU 1LDTT 3PTBA 1S85A 1AY6H 1RS0A 3SORA 3GOVB 4I7YH 4NA9H 5FHTA 2XBYA 1W3CA 2ZC9H 1L1NA 3PMJA 1ESAA 1C5TA 1CE5A 2FS8A 4DGJA 1OS8A 1NC6A 1OOKB 1HAPH 1ELFA 1HAOH 2PLXA 3HATH 1HPGA 1PPEE 1K1PA 4MG3A 4IC6A 2BQWB 2BXUH 4MNXA 1DM4B 1TWXB 1NROH 1A0LA 4BXSA 2Y5HA 2CV3A 3HGPA 1K1IA 2VVCA 1BDAA 1TOMH 2BLWA 3HKJB 3TH2H 3RXKA 3TGJE 1A7SA 1K1NA 1O5AB 1YCPM 1O2KA 4MTBA 1E37B 1O5EH 2TIOA 1WTHD 3UR9A 4UFFH 1VJ9U 1MAYA 3NCLA 3B23B 2BDAA 3BG4C 2BMGB 3TJOA 2O8LA 1BMLA 1AKSA 1QA0A 1ZJDA 4IN2A 3GCHB 4D7FA 2C3SA 3RC5A 2VH0A 4YLQH 1ZPCA 4ESTE 3ATMA 3KL6A 4B75A 1DX5M 1SVPA 2Z9KA 3P8OA 4A92A 1HJ9A 4HTCH 1HJ8A 2P95A 1SGYE 2BVSH 2WUBA 1TA2A 3RXAA 3TH3H 3BIUH 1VCQA 3RP2A 2Y6TA 1CA0C 2TRMA 2ZQ1A 1D3TB 2H9HA 1KY9A 4NFEA 2A4RA 2XC5A 3UNRA 2Z9GA 1SGRE 2A4GA 3M35A 3SV2H 5LH8A 2OQUA 3SQEE 4TPYA 3M5NA 2M5TA 1WTGH 3GCOA 2GCTB 1E38B 1QL9A 4Q2KA 2H5CA 3A83A 4Q7XA 1V2NT 2A0QB 2UUYA 3SNDA 1A46H 2VIDA 1P04A 4Y0ZE 1TB6H 1TNLA 2HOBA 2TPIZ 1Z7KA 1GGDB 2SGEE 3U1JB 3KN2A 1TPAE 4Y8ZA 1FUJA 2OBOA 1FY3A 3SI3H 4VGCC 2Z6BD 1V2WT 1N8OB 2J2UA 3O8CA 1VITG 4AORA 1KLTA 1QCPA 4Q7YA 3SZNA 2PKSC 1AKSB 1EJMA 3LH1A 1AWFH 1D3DB 1MBMA 3LU9B 1GVKB 5A0CA 1Y3XA 5A09A 1DE7H 3SBKA 4A5TS 1O3JA 1V2LT 2HWLB 2OUAA 5FPYA 3CS0A 2BD8A 1MTSA 1ZSKA 1EAWA 1TQ0B 4X1NU 1MTWA 1WU1A 1GBDA 1E34B 1LMWB 5ETXA 4I8GA 1BA8B 2TGPZ 1W7XH 4XSKU 1TPPA 2OTVA 4SGAE 1BHXB 1H8IH 4I31A 3A7ZA 1GHXH 2AYWA 4DY7B 1ELDE 2IPHA 5ABWA 3A86A 3WY8A 8KME2 2OBQA 1G32B 1NFWA 3RXLA 1BZXE 3A85A 1W2KH 1QHRB 2QIQA 1P2QA 1AE8H 4AG1A 4FUEA 2Y7XA 1N6YA 2BY9X 1DICA 1XUFA 1ANEA 2BY6X 2VWOA 4UE7H 4X2YA 1AI8H 3MO3A 1P0SH 2HNTE 3RXQA 3TIUA 4GUXA 4LXBH 1Z8GA 3RLWH 1ZOMA 1AE5A 2FODA 2I6SA 2BD5A 3C27B 1QRWA 3SHCH 3HK6B 3KQCA 2TGDA 2PGBB 1LHCH 1MZDA 4K69A 5H4IB 2Z9JA 1DANH 1XVMA 3ATLA 1ZMJA 2FPZA 4JZIA 3V3MA 4ABHA 1P2KA 5HYOA 3A8DA 3LGVA 4X6NA 2QXIA 4NWLA 4WH6A 2B8OH 4GCHG 1AQ7A 2BDGA 1EP6A 2ZFRH 3GDUA 3ZVAA 3LDXH 1W7GH 1KXFA 1QBVH 4O03A 1G3BA 4I8LA 3AASA 1EB1H 2QN5T 1K1LA 3LGTA 2FM2A 1HB0B 1UVSH 4BAMB 1GJ6A 4FUGA 1GBHA 1GHAG 5AHGH 1IOEA 1CSOE 4D9RA 4E7NA 5EW1H 4B2CA 1BIOA 2V6NA 5E0HA 2ZEBA 1W8BH 4IW4E 3VFEA 1O3GA 3RXGA 3LGYA 1F0RA 3Q3KA 2NWNA 5GIBA 1PPGE 3LT3A 4Z0KA 2P3FH 4CHAB 3QX5H 1QURH 3ELAH 3MO6A 1ZHPA 5FPSA 2ZFQH 2ASUB 2OINA 1P10A 3AAVA 3OX7U 1L0ZA 2DE8A 2SGFE 3UREA 3TK5A 1NS3A 4FXGH 4UD9H 1QJ1B 3VB5A 1CBWC 1OWEA 2J95A 3MO9A 1DLEA 2B7DH 1ZMLA 1XM1A 3SOSA 2A32A 8LPRA 1P9SA 2IOTA 1Z71A 2ZI2H 1TMBH 1FMGA 3TITA 1CGHA 4XBCA 4NGAH 1SI5H 1HJAB 1O2MA 1S6FA 3M3VA 1QBOA 2QXGA 1XUHA 1O2SA 1RD3B 2Q6DA 3SI4H 2A2QH 2R3UA 3M5MA 4ZKNU 1IQFA 2ZU4A 3SU5A 2HPPH 1YLDA 3TK9A 1O3FA 2ZA5A 1PJPA 2FTMA 4AOQA 3A7XA 1S6HA 4AX9H 2CXVA 2JKHA 1DOJA 4ZKOU 2GDDA 1Y8TA 1A0HB 1CU1A 3MNBA 5A0BA 3RU4D 1FAKH 3SNEA 1H9HE 2VVVA 3NZIA 1AFQB 4OS6A 1X7AC 2ANYA 1AB9B 5J4SA 5TCCA 1UTMA 4ZHAA 1BTYA 3O8DA 1G2MA 3G01A 1O2UA 2ZNKH 2A7CA 4THNH 1O2YA 3P95A 1QQ4A 1T31A 2ANKH 3MFJA 2BY5X 3DFLA 1ZR0A 1TNGA 4PROA 1TIOA 1DY8A 2BDIA 1HLTH 1TGNA 1C2KA 1O2JA 1AUJA 3GCHC 2FLRH 4OGXA 1TFXA 3JZ2B 2DE9A 3GCTG 1TQ7B 1O2LA 2ZO3H 3QDZB 1Z8IB 5T6FA 3T29A 5C67A 4R0IA 1BBRH 2C8ZB 1KXBA 4NZQA 1LVBA 5HXFA 1S0RA 2JH5D 1UCYH 1ACBE 2XRCA 2ZCLP 1GBMA 2BVRH 1O3CA 1YPJH 1GI8B 5DKMA 4J2YB 1FN6A 2H2ZA 1UTNA 2GCHG 1EP5A 1F2SE 1BITA 3GCNA 4NIWA 5FXLA 4X1PU 1GPZA 3KQBA 2C93B 3T28A 1HAXB 4CR5A 2ZPQA 1GMHG 1YKTA 2GCTC 1O5BB 5C1YA 3TNTA 4ABJA 4IBLH 2HPQH 1LQDB 1FY5A 1V2KT 2BX3A 4ZUHA 2G51A 1K2I1 2BQ6B 2GZ8A 4GCHF 3S69A 1P2IA 4I8HA 1A3BH 1GGDC 3U8TH 4CRBA 4RSPA 4ABDA 3KEEA 1GHBG 2EI8A 4CH2B 6ESTA 4B2AA 1FIWA 1H9IE 1N8OC 4A6LA 1SLWB 2SNVA 3RU4T 1YPHC 1THPB 1DWCH 1GHAF 5GWZA 4JMYA 4AGKA 2GV6A 4MPVA 4CRDA 8GCHG 2ZFTA 1NU9A 3BF6H 1EPTA 4NIXA 2C8YB 1IQGA 2AFQB 1T8MA 2OC8A 2DUCA 4ISHH 4BOHA 5A8YA 2ANMH 1ZTKA 1D6WA 3H7OA 1RTKA 1V2TT 4NFFA 1BTWA 3BTGE 1PQ8A 2FX4A 2G5NA 2SFAA 5AF9H 2Y82A 3FAOA 4KTCA 4BAKB 3ATKA 1TE0A 1SQTA 1C5MD 4MNVA 1SGCA 1W0YH 2J4IA 1F5KU 1WCZA 5EPYA 4MDSA 2Y5GA 1TGBA 2WPKS 3SQHE 2F83A 1K1JA 1O31A 1SFIA 2FOBA 1O2OA 1BTZA 2BOKA 1TBZH 1HBTH 1BRBE 3VPKA 4YT7H 5F8TA 1G3EA 1P06A 2PUXB 2GT8A 1GWAA 1TNHA 2GGVB 4K2YA 1DVAH 3A87A 1IQMA 1PYTC 3CS7A 3UUZA 4QT8C 5F8XA 2W3IA 4INLA 1IQNA 2B9LA 3TH4H 1OWIA 1THSH 4CREA 4FU8A 1A5GH 4UFGH 5L2YH 1DWDH 4GHQA 1SLXB 2PV9B 1EZUC 2LNCA 3ATIA 1CO7E 1PQ7A 1ZPZA 5DJ7A 3I78A 4CBNA 2VH6A 5DP3A 3KF2A 3ZV8A 4GVUA 1DLKB 2G55A 1O2PA 3F9HA 3E1XB 1UVTH 5A8XA 1EPTB 1WAYB 3LPRA 1OWJA 4Y71A 2CF8H 3RMOH 4ZAEA 3SUDA 1TMUH 4DCDA 3S9CA 4O3TA 1C2MA 3TK6A 1BJUA 1C1TA 1P2NA 1O5FH 3C1KA 2F91A 4WF8A 5GPIB 3RLYH 1V2UT 1F7ZA 3Q77A 5I25A 4DVAU 1BMNH 1NPMA 2OC1A 1GJAB 4OS7A 1THRH 2CF9H 7LPRA 1KLJH 1MQ5A 3AW0A 3UR6A 2J34A 1XUKA 1ZGIA 3PV4A 4YZUA 1NU7B 1WBGB 3PTNA 1TABE 3GCTF 1XUGA 3MYWA 1ARBA 2JH0D 1AMHA 1TGTA 2UWOA 3PWBA 1WV7H 2ZHFH 5EXMA 3RXBA 2A45B 1HRTH 2BTCE 4FUFA 3T62A 4CHAC 1KIGH 3ZVDA 2Y81A 1BTUA 3HK3B 1SGDE 1AGJA 4FVDA 2GCHF 1UTQA 3SW2B 3F9GA 2WUCA 3GDVA 4H42U 3A89A 1QGFA 5EOKA 4ZKRU 1Z8JB 1HAYB 5DP4A 3UIRA 4ASHA 1Y3WA 1GMHF 1MKWH 1H9LB 3SU0A 1O33A 3PWCA 3SGAE 1C5YB 1EOJA 2R0LA 4XOJA 1C1OA 1SFQB 3KQDA 1C2HA 1GBEA 1ABJH 2O8MA 1MTNB 5JB9S 1A61H 1HJAC 1OX1A 2ZGHA 2GX4A 1GHVH 1GHBF 1BMMH 2R9PA 3M3SA 1G37A 4K1EA 1YC0A 1CGJE 2XBXA 1N6XA 1ORFA 3Q00A 3LKWA 4NZLA 3OU0A 4O97A 4K5ZA 4AFSA 3URCA 1LKAA 2C4FH 2STAE 3UOPA 2ZGXH 8GCHF 1GHWH 4NCYA 4BTTB 4O3UA 3ZZ7A 5GXPA 5E8EH 3CP7A 2PUQH 2Q6GA 3ZZ5A 5DP6A 5SGAE 1XXDA 2QXHA 4LOYH 4NSYA 1P09A 1IQLA 1O3KA 3ZZCA 1EATA 1AFQC 1EB2A 4NSVA 1O3HA 5T3HA 1ZMNA 5DP7A 1PYTD 1AB9C 1SGFA 1UVOA 3GYLB 4K1TA 4NIVA 3KHVA 1DWEH 2D1JA 3LJOA 3H5CB 1C4U2 2FI4E 1GJCB 2G52A 3PO1B 1O3NA 3D65E 4Y7BA 4JK5A 1Y5UT 3U69H 3MU5A 3BEFB 3VGCB 3SU3A 3ZZBA 4Y7AA 3SO3A 2BD9A 2CHAB 4DW2U 2BM2A 1JBUH 4OS2A 1C5LH 2A4QA 3QN7A 4I32A 1AVGH 2FO9A 2PHBA 1XKBC 1GI5A 2B5TB 1ANBA 1CT4E 1DWBH 3F68H 1K9OE 1C5VA 4F49A 2Y80A 3R0FA 3F9FA 5CHAB 5EU8A 4Y79A 1NZQH 1Y3YA 1V2RT 2HNTC 1GBLA 3RMMH 4IS5A 4X1SU 2SGPE 1IAUA 2EA3A 2VU8E 4WXVA 7GCHG 1N1LA 2H5DA 3DA9B 2F9UA 3M37A 3RXUA 4X8SH 5GCHF 1H8DH 4RN6A 1KXEA 1XUIA 1G3DA 1EUFA 4E06H 2VB0A 4ZMAH 3L6PA 1HAHH 1VR1H 1LHFH 1TBQH 3E90B 2ZTZA 1PQAA 3LH3A 5CE1A 1BHXF 1MKXH 1AN1E 3Q76A 1NESE 5EGMA 1V6DA 4X1RU 1MQ6A 2GTBA 2Z9LA 3SJ8A 4ZXXH 1O2VA 1UJ1A 2I6QA 1C2FA 4TY6A 1GI6A 2BDCA 2CJIA 1MKXK 4BNRA 1GI2A 3MTYA 2BLVA 5GJ4B 3ZZ4A 1HCGA 1QA7A 1DXWA 3SGBE 3UWJH 3D62A 5T6DA 5EW2H 1OXGA 2AERH 4IGDA 1WQVH 2A4OA 3UPEA 1ZTLA 1PQ5A 4ISLA 2WV4A 2EC9H 1C5RA 1YPGH 1TPOA 1RIWB 5C3NA 1TNIA 3EA9A 3IWMA 5C20A 1ZHMA 2EEKA 5L2ZH 4X2VA 3QGNB 1O2IA 4YOGA 2UWLA 1P57B 3SU2A 4WMEA 3ITIA 1NRNH 3LIWA 5AFZH 2STBE 1EOLA 4TWYA 2CMYA 4JZDH 5DPAA 2BB4A 2TGAA 3MMGA 4AB9A 2F9OA 2RDLA 1BCUH 1C1WH 1HUTH 2TGTA 4I8JA 2BXTH 3QO6A 1Z1IA 2FYQA 3LGIA 4CRAA 1QY6A 3O8RA 1QJ6B 2XC0A 1O5GH 5EQQA 1GI0A 3BTKE 1CVWH 3SJOA 1L1JA 1GCDA 2V0BA 2AH4X 1NRPH 3SNCA 1ELAA 2IN2A 1ARCA 3ZVCA 1OYTH 1TYNA 3BEUA 1RRKA 1OYQA 1C1SA 4INKA 1AVXA 1ZYOA 3SV9A 5K0HA 2SGDE 1W11U 2OD3B 3M7QA 1TGCA 3F1SB 3MNXA 1FDPA 5A0AE 3PMHB 2FESH 3CENA 1EPTC 2P16A 1IHTH 2ALPA 5JPMH 1IHSH 1ESBA 5HMAA 1OPHB 1Y59T 1PPFE 1BTXA 3KCGH 4NIYA 1M9UA 1UO6A 2UUKB 2V3HH 1GBKA 1EKBB 1MU6B 1L4DA 2FIRH 3SJ9A 1ESTA 1NFYA 3VB3A 3MU1A 1C1PA 4RKOB 3PYHA 2ODYB 1LPGB 1YLCA 1MTVA 4D7GA 3ODDA 1QNJA 1O3MA 1FONA 2VWNA 3U8RH 2J9NA 2D8WA 5A8ZA 2C8XB 4CRGA 2NU3E 2XCFA 5EODA 2C90B 2H9TH 1ELVA 1C4V2 2FOMB 2J38A 1C5SA 2GZ9A 3GY7A 4Y76A 3GY8A 1BTPA 3MH6A 2QAAA 5FBIA 1G2LA 1V2VT 1MBQA 1PPHE 4B74A 4AFUA 3MI4A 7GCHF 2Z3DA 3RM0H 2A2XH 3ENSB 3NUMA 1T8OA 1T8NA 3A7WA 3ZYEA 2VIPA 2ZCHP 1MMJN 1DSUA 1YPEH 2XYAA 1B0EA 3GY5A 1WOFA 1SLUB 3UQOA 1MTNC 2AIPA 3SNAA 1GBTA 1OP2A 3BV9B 1Z1JA 1E35B 1GVZA 3SUEA 4FU7A 3KNXA 2ZDKA 3TNSA 4K60A 2FEQH 2PR3A 4MNWA 1RTFB 3B9FH 4AFQA 3A88A 4ABIA 2QXJA 3A8BA 4K1SA 1H4WA 4MPXA 1MD7A 2BY8X 4YTAA 1GI4A 1Y3VA 2FWWA 2D2DA 1O3EA 2W26A 4X8VH 5B6OA 2FI3E 3SUFA 1ELBA 1ETTH 1QB6A 3HPTB 3LGUA 1GCTB 3FANA 1UTKA 1C1QA 1F92A 4IMZA 1ZJKA 3UNQA 2HNTF 4FUCA 3UQVA 1O2WA 1FY1A 1J15A 1P05A 3MNSA 1A5IA 1UMAH 2ILNA 1K22H 2OC7A 4YESB 3U9AH 1ZTJA 3PO1C 1C1MA 1CQQA 1PFXC 1SL3A 5DO4H 3VGCC 4WXIA 2ZFFH 3BIVH 4JYTA 1TONA 2XTTB 3GYMA 2CHAC 2ZU1A 2FOEA 5EQSA 1P2OA 3ZVGA 5AVDA 2BZAA 2G8TA 2PFEA 2QC2A 3EQ0H 4B73A 7ESTE 3TJVA 3ZZDA 2BD7A 2VINA 4XBDA 2ZP0H 1EJNA 2BD2A 1EZSC 4IMQA 3SV6A 1O0DH 4WJG2 3MWIU 3HKIB 1T8LA 1J9CH 3QTOH 3P8NA 1Y3UA 1Q2WA 5CHAC 1TRNA 3V0XA 1RXPA 2AEIH 2Z3EA 2VIOA 1VZQH 2PW8H 3M3TA 2FX6A 4FUBA 1E36B 1W14U 2FOHA 3MOCA 3E0PB 1S81A 2FOFA 1P8VC 1IQIA 5FPTA 1D3PB 4FVBA 5DP9A 3P17H 4Q7ZA 5IDKA 4A1TA 2ULLA 2ZDAH 3P6ZB 4I8KA 3AAUA 1A4WH 2P8OB 3QK1A 5J4QA 5JDUB 1BT7A 2G5VA 2HRVA 1C1VH 4B1TA 3DD2H 1O39A 1KXAA 2BDYA 1S83A 3GICB 1L1GA 2PGQB 3NPSA 4YO9A 1O3DA 2NU4E 4DOQA 1LO6A 4YOIA 3V7TA 1RGQA 1K1MA 2XNIA 3A82A 1UK2A 2WPJS 1MU8B 5TCAA 1JRTA 1G30B 4LZ1H 3T5FH 1LHDH 1WQSA 1BQYA 1QIXB 3BTQE 1O34A 1XXFA 3BN9A 2BDBA 3U1IB 2ZTXA 3PLBA 5ESBA 1GJBB 1RIWC 1TGSZ 2NU2E 5DP5A 1KDQA 1ZSLA 4TYDA 1D4PB 1HNEE 5DGJA 1HFDA 1C9TA 1HYLA 2QV1A 2YNBA 1C5UA 4TPIZ 1FPHH 3SN8A 3STIA 2J92A 3UWIA 4HI3A 2UUFB 2FOAA 2VJ1A 3S9BA 1O3OA 1QTFA 2IJOB 1FAXA 2QF3A 2FMJA 1YP9A 4INHA 1Q3XA 3P8FA 2BYAX 1EJAA 1T4UH 1KSNA 3A81A 4AFZA 1O3LA 4JYVH 3F6UH 1V3XA 1EAXA 1WUNH 2EI7A 3F9EA 2SNWA 1UTOA 2WPLS 3RM2H 2G4TA 1BMAA 2OP9A 3AW1A 3GDSA 3ZYDA 4AB8A 1C9PA 5E0GA 4A1VA 2ALVA 2XC4A 3MU0A 1O3BA 4K8YA 2GVFA 2FLBH 2ZZUH 1TNJA 1O2NA 3VB4A 5L6NH 1XUJA 2VIWA 2R0KA 5GCHG 1V2OT 1NRQH 3RXVA 3LJJA 1KDQB 1B0FA 1C2GA 1C5QA 4GAWA 3RXMA 2Q1JA 2WV5A 2KAIA 5T6GA 1QFKH 4KELA 1CHOG 2J94A 3ZZ6A 3IG6B 1KTTB 2O8UA 2H9EH 2OQ5A 3MHWU 3BTFE 1QL7A 1AO5A 3UFAA 4RKJB 3K9XB 3W95A 3T26A 3A7TA 5DK1A 3ZVBA 1DUEA 4BXWA 2K1QA 2VIVA 2F9BH 1WSSH 4NA8A 5FCKA 3PM3A 3SJKA 1J16A 1EASA 2F9VA 2OLGA 4MPWA 2WPIS 1YGCH 3K6ZA 1TOCB 3EE0B 5JBAS 1QB1A 4YM9A 4Y11E 2CN0H 3RXOA 2PTNA 4ZROA 3TJUA 3U8OH 3LONA 1GJ4H 3BSQA 1UHBA 5DG6A 3OY6U 2LPRA 4WMFA 2QA9E 2PTCE 2GDEH 3PB1E 1J17T 1DY9A 2QYIA 1FIZA 4AN7A 1A3EH 2ZQ2A 4B76A 2G4UA 2WINI 1TLDA 1TX7A 2BD4A 4NWKA 2FDAA 2QF0A 3FZZA 1GI9B 2KAIB 4H6SB 1K28D 1LPZB 1O35A 3RXPA 2PKAA 3EYDA 1GDQA 1ID5H 4ABGA 2FOCA 4X0WU 4Y0YE 1GCTC 2CGAA 2A5IA 3VB7A 1TX8A 3M5OA 1FXYA 2VIQA 2F9PA 2GT7A 1LHGH 6CHAB 4ISOA 3OYPA 3P70B 9LPRA 1GL1A 3TPIZ 4H4FA 1NTPA 4UFEH 1ZRKA 2YOLA 1GI7B 2AGEX 5HM9A 3L33A 3E0NB 3M7TA 3B8JA 5FX6A 1C5OH 4J1YA 2ZGBH 2F9NA 3RXRA 3URDA 4WH8A 1GBJA 1C5NH 2FYRA 1VGCB 3UNSA 1GHZA 4SGBE 4GSOA 3S7KB 1C5WB 1V2MT 1BRCE 1GJ8B 9ESTA 1UHBB 1PPCE 2Z9IA 1C2DA 1HIAA 1HV7A 1L4ZA 4XFQA 1O32A 3TGIE 1SSXA 1P3EA 1A0JA 3FZDA 3QWCH 4MPUA 2ZCKP 2ZU3A 1LVMA 1BOQA 1BUIA 3RC4A 1JIMA 2THFB 1TPSA 1YCPH 3RXDA 4Q80A 1CHGA 3KQEA 4YLUA 2H1UA 2ODQA 1TX6A 3MU8A 3GY6A 1HAVA 3LGWA 3DT0H 1GBBA 5C5NA 1O2HA 2V35A 1ELTA 2PKAB 4YT6H 1C1NA 4AYVB 1ZGVA 3BTEE 1C2LA 2ZHQH 5C1XA 1GMCG 1YBWA 1YCPK 2ZHEH 1GJ7B 3PLPA 1P3CA 4ISIH 2HALA 1QBNA 1VJAU 5E0JA 3BTDE 4ABBA 4D8NA 2P8OC 2W7UA 4JK6A 4X8TH 1QL8A 1PPBH 2UWPA 1MZAA 3DFJA 1O5CB 3AVZA 1OWKA 3A7VA 5HGGA 3RDZA 1TA6A 1HGTH 5E2OA 1RJXB 2Z3CA 2BHGA 5FBEA 1Z6EA 4E05H 1CHOF 3PMBB 1ETRH 1D9IA 1OSSA 2A5KA 2GD4B 2Y5FA 3FP6E 1JRSA 1XKAC 1YYY1 3E3TA 5BPEA 1QB9A 1HIAB 4BAQB 1OKXA 1MUEB 2HVXA 4BTUB 1TMTH 2AS9A 2ZDMA 2OXSA 2R2WU 1A2CH 3SV7A 1FLEE 1A5HA 1WYKA 4U2WA 4ZKSU 1DUAA 3HGNA 4OS4A 3S0NA 1O2XA 1ZLRA 2VVUA 1DXPA 3RXCA 3GISB 4HZHA 1GBAA 1HAVB 1INCA 3FP8E 6GCHG 1O37A 2O8WA 8ESTE 3GY3A 4K3JA 2BLQA 2ZIQH 1DS2E 4D76A 1O3IA 4F4OC 1ETSH 2FI5E 3RMNH 2W5EA 1GG6B 3RC6A 2ZHDA 1LHEH 3ZZ8A 1ZZZA 1AIXH 1O5DH 2WYJA 3STJA 2A31A 5EG4A 4X6MA 1YM0A 1IQHA 2ZGCA 1D3QB 4NG9H 1E0FD 2HGTH 1UTPA 2GV7A 1GDNA 4OS1A 4OGYA 3JZ1B 1GHYH 2XW9A 2ZDNA 2P3UB 1NFUA 2TBSA 2BOHB 1MCVA 1AUTC 1DFPA 1C5ZB 2ZWLH 1NRSH 4R8TB 1V2JT 2AMQA 3NXPA 5BRRE 1XX9A 2XWAA 1Y5BT 2UUJB 1DDJA 1O2QA 4A1XA 3M7UA 3TGKE 2GP9B 3K65B 1LVOA 2FS9A 1MCTA 2ANWA 5EXNA 4KGAA 1FY8E 4LZ4B 4E7RG 2GMTB 1SOZA 1C2EA 5LPRA 7KMEH 4FUJA 1B5GH 2VNTA 3RXTA 1FY4A 1FPCH 1K1OA 1ZRBA 5FAHA 3LOXA 1T7CA 3PROA 5CMXH 3MH5A 1AZZA 3M5LA 4DT7B 2WPMS 1O2ZA 2XBVA 4ZXYH 1FV9A 2JETB 4WY3A 1O38A 5FX5A 3RXSA 3SNBA 3SV8A 3NKKA 3A8CA 5LPFA 1AHTH 1YPLH 2ZGJA 4U32A 4D9QA 1TAWA 1QR3E 2ZTYA 4JYUH 1C2JA 1D6RA 1TBRH 4JZFH 1NFXA 1P12E 2ZPRA 4B2BA 2GKVE 2FZZA 3T2NA 1DITH 3PLKA 1EAUA 4HFPB 2P93A 1SGEE 3D49H 1ANCA 1EXFA 1OP8A 2RA3A 1GDUA 4MVNA 1TALA 3OTJE 3SU4A 3MNCA 4IC5A 4X2WA 4I33A 1GBCA 1B7XB 1T4VH 3BTWE 2XWBI 5L30H 4FUDA 4ABAA 3OSYA 1GMCF 1RFNA 1GI3A 3MH4A 3GY4A 1G9IE 2R3YA 3ESTA 5JBTA 3EGKH 1FJSA 1Q31A 1SQOA 4A7IB 1U6QA 2AGGX 1ZPBA 1ABIH 3A84A 3GY2A 1P01A 3I29A 5IYTA 3NK8A 1BBRE 4X6PA 3TVJB 3ZVEA 1UCYE 1UK4A 4XBBA 2A7JA 5C5OA 2YNAA 2VWMA 1Z8RA 3S9AA 5I46H 4DIHH 4Z6AH 1KYNA 2Z94A 2ZKSA 4ZH8A 4M7GA 1HXFH 3P92A 3T27A 1GMDG 1YPKH 3W94A 2PWXA 1SR5C 2VGCB 1NO9H 1CGIE 3D23A 1UVPA 1AD8H 2ZPSA 4CH8B 1FN8A 1V2PT 3RXFA 1AWHB 1SOTA 3N7OA 3UOUA 6CHAC 1JOUB 3QZQA 2H6MA 1G3CA 1GVLA 2EI6A 3RU4E 2B0FA 3E6PH 2AIQA 6LPRA 3ZZ9A 1FNIA 1KXDA 1J14A 1F5RA 1A1RA 1VITH 1OP0A 3T25A 6GCHF 1F0TA 1L2EA 1NN6A 1SGPE 3SGQE 1EQ9A 3TLOA 4MNYA 2SGQE 1VITF 4AYYB 2QCYA 5EPNA 1VGCC 2OC0A 2ZFSA 1QQUA 1C5XB 4UONA 2Q6FA 2RG3A 3FVFB 1EZXC 3BTME 1SGIB 4FUHA 3RUOA 4ZHMU 1C1RA 2RCEA 1BRAA 5AFYH 3BEIB 4IN1A 5GDSH 1OWDA 4FU9A 2FOGA 3SUGA 4XE4A 3RMLH 2FTLE 1SBWA 1CT2E 2Y7ZA 3EDXB 3OY5U 1SC8U 1FI8A 4GPGA 2RA0A 1GBFA 4DIIH 4X2XA 3SU1A 2AMPA 2P59A 3LC5A 2WYGA 3S7HB 3MH7A 2FXRA 1AFEH 1NT1A 1IQJA 1P11E 2O8TA 1V2ST 4TWWA 1HAIH 1BJVA 3BG4B 2BDHA 3E91A 3QUMP 1CA8B 4JZ1A 4BANB 2ZFPH 5G4BA 5C1UA 3QZRA 1ELGA 2FP7B 2XXLA 3ZV9A 5JBBS 1LTOA 3H7TA 2QGRA 3R3GB 1GI1A 4KKDA 3KIDU 3VXFH 4AGJA 1HAZB 2PSXA 5C2ZA 4DG4A 5LPEA 1S82A 1P2JA 1SLVB 1BRUP 1BTHH 1CA0B 3QGJA 1T32A 3TU7H 2Z7FE 4JCNA 5F8ZA 2A7HA 2P94A 5F03A 5HM2A 4ABFA 1BBRK 5DP8A 3EA7A 3ATWA 4NA7A 4BAHB 1SPJA 1G36A 1UCYK 2C8WB 2QY0B 3ZVFA 1UVUH 1VCWA 1O3PB 3I77A 1DT2A 1LCYA 1KLIH 5EQRA 3RXHA 4U30A 1Y5AT 2HLCA 1EZQA 4Y8YA 1ELEE 1J8AA 1CT0E 2ZF0H 2XCNA 5K7RA 4TY7A 2BD3A 2W3KA 1Z6JH 2ZU2A 5A2MH 4AG2A 3SJIA 2G81E 1JMOH 4UFDH 1QRZA 1SGTA 4CRCA 4B71A 2W7SA 4XDEA 4VGCB 2GZ7A 1AU8A 1NRRH 3P8GA 1GG6C 1KXCA 1UK3A 2AMDA 3SHAH 3E16B 2JH6D 1F0UA 4WVPE 1GJDB 4MQAA 1DPOA 1SB1H 1SGFG 3A7YA 2BX4A 3BTHE 1JXPA 2PKSB 3ODFA 4JZEH 1V2QT 4KTSA 4H6TA 4WWYA 1NY22 1LQEA 1AZ8A 1C1UH 3O8BA 4X6OA 4GHTA 1ELCA 1XVOA 2PSYA 3FFGA 3DHKH 2ESTE 1UTJA 4GLYA 3Q3XA 4UDWH 1GMDF 1SGQE 1GBIA 3MU4A 1RTLA 2VWLA 1PPZA 1K21H 3V13A 1IQKA 3QLPH 3QTVH 4DJZB 1JWTA 1W12U 4FUIA 2BZ6H 3EA8A 1P02A 4AZ2B 5F6MA 3FP7E 4WMDA 2NU1E 1F0SA 3VB6A 2GMTC 3L3TA 4K8BA 1TNKA 1FQ3A 3UY9A 3EAJA
chains in the Genus database with same CATH superfamily
4OM9A 1LVYA 5E2PA 2F3CE 1UTLM 1COWD 4OS5A 4ABEA 1SHHB 1NM6A 1JIRA 4X8UH 3KQ5A 3PV2A 3DUXH 4DURA 2OCVB 1W13U 5PTPA 4HGCA 1EX3A 1MD8A 1GL0E 1KTSB 1TRYA 5JBCS 1SGNE 2JETC 4Y6DA 4Y10E 3LC3A 2L74A 2BLOA 1YF4A 1LPKB 2A1DB 1OWHA 3A80A 4U01A 3VEQB 5ESTE 2SGAA 1O2RA 4ISNA 3RXIA 1SMFE 1VCPA 4YOJA 1IQEA 4BTIB 1TRMA 1F5LA 4CR9A 1DSTA 1SG8B 2P3TB 3SU6A 2ZECA 1P03A 4MLFB 3RXEA 1BB0B 3IITA 1MAXA 2G00A 2AGIX 1H1BA 3PV5A 1S84A 2ZU5A 1C5PA 2BVXH 2ZDVH 1O30A 3BG8A 2R2MB 1O3AA 1SQAA 1S0QA 4Y8XA 2O9QA 5JYIA 5JB8S 1YPHE 1C4Y2 1SHYA 4BAOB 2A5AA 4ACAA 2ZHWH 5C17A 1YPMH 4KP0A 5LGOA 1LKBA 3VXEH 3K2UA 5EXLA 1ZHRA 1O36A 1HXEH 1O2TA 5TJXA 3Q3YA 1K0HA 1P2MA 1HDTH 1O2GH 4O9VA 4FETA 1GJ5H 4CBOA 3NWUA 3UTUH 4KTUA 3ZZ3A 1EAIA 1QJ7B 2VGCC 3U98H 4UEHH 1AVWA 2ZDLA 1MH0A 1XMNB 1QRXA 3M36A 4LK4A 1MTUA 1FZZA 2BY7X 1GJ9B 3RXJA 1CBWB 5C94A 3PMAB 2XBWA 2V3OH 1SQRA 4CRFA 3BTTE 5FCRA 4ZHLU 1ANDA 3TJNA 2NU0E 3KGPA 2ODPA 2BQ7B 2D26C 3E8LA 3V12A 1MKWK 3ZZAA 3M61U 3K6YA 1ZSJA 1W0ZU 1S5SA 1HAGE 2ZG0H 1C2IA 1P9UA 3A8AA 2WPHS 1W10U 4X1QU 1LDTT 3PTBA 1S85A 1AY6H 1RS0A 3SORA 3GOVB 4I7YH 4NA9H 5FHTA 2XBYA 1W3CA 2ZC9H 1L1NA 2WSSD 3PMJA 1ESAA 2W6JD 3F0PA 1C5TA 1CE5A 2FS8A 4DGJA 1OS8A 1NC6A 1OOKB 1HAPH 1ELFA 1HAOH 2PLXA 3HATH 1HPGA 1PPEE 1K1PA 3GS9A 4IC6A 4MG3A 2BQWB 2BXUH 4MNXA 1DM4B 1E79D 1TWXB 2PP6A 1NROH 1A0LA 4BXSA 2Y5HA 2CV3A 3HGPA 1K1IA 2VVCA 1BDAA 1TOMH 2BLWA 3HKJB 3TH2H 3RXKA 3TGJE 1A7SA 1K1NA 1O5AB 1YCPM 1O2KA 4MTBA 1E37B 1O5EH 2TIOA 1WTHD 3UR9A 4UFFH 2JJ1D 1VJ9U 1MAYA 3NCLA 3B23B 2BDAA 3BG4C 2BMGB 3TJOA 2O8LA 1BMLA 1AKSA 1QA0A 1ZJDA 4IN2A 3GCHB 4D7FA 1BMFD 2C3SA 3RC5A 2VH0A 4YLQH 1ZPCA 4ESTE 3ATMA 3KL6A 4B75A 1DX5M 1SVPA 5KECA 2Z9KA 4Z1MD 3P8OA 4A92A 1HJ9A 4HTCH 1HJ8A 2P95A 1SGYE 5HIZA 2BVSH 2LP6A 2WUBA 1TA2A 3RXAA 3TH3H 3BIUH 1VCQA 3RP2A 2Y6TA 1CA0C 2TRMA 2ZQ1A 1D3TB 2H9HA 1KY9A 4NFEA 2A4RA 2XC5A 3UNRA 2WZQA 2Z9GA 1SGRE 2A4GA 3M35A 3SV2H 5LH8A 2OQUA 3SQEE 4TPYA 3M5NA 2M5TA 1WTGH 3GCOA 2GCTB 1H8ED 1E38B 1QL9A 4Q2KA 2H5CA 3A83A 4Q7XA 1V2NT 2A0QB 2UUYA 3SNDA 1A46H 2VIDA 1P04A 4Y0ZE 1TB6H 1TNLA 2HOBA 2TPIZ 1Z7KA 2EY4C 1GGDB 2SGEE 3U1JB 3KN2A 3SYJA 1TPAE 4Y8ZA 1FUJA 2OBOA 1FY3A 3SI3H 4VGCC 2Z6BD 1KMHB 1N8OB 1V2WT 2J2UA 3O8CA 1VITG 4AORA 1KLTA 2JIZD 1QCPA 4Q7YA 3SZNA 2PKSC 1AKSB 1EJMA 3LH1A 1AWFH 1D3DB 1MBMA 3LU9B 2F4LA 1GVKB 5A0CA 1Y3XA 5A09A 1DE7H 3SBKA 4A5TS 1O3JA 1V2LT 2HWLB 2OUAA 5FPYA 3CS0A 2BD8A 1MTSA 1ZSKA 1EAWA 1TQ0B 4X1NU 1MTWA 1WU1A 4F48B 1GBDA 1E34B 1LMWB 5ETXA 4I8GA 1BA8B 3PRDA 4B6FA 2TGPZ 1W7XH 4XSKU 1TPPA 2OTVA 4SGAE 1BHXB 1H8IH 4I31A 3A7ZA 1GHXH 2AYWA 4DY7B 1ELDE 2IPHA 5ABWA 3A86A 3WY8A 8KME2 2OBQA 1G32B 1NFWA 3RXLA 2V7QD 1BZXE 4I86A 3A85A 1W2KH 1QHRB 2QIQA 1P2QA 1AE8H 4AG1A 4FUEA 3FN8A 2Y7XA 1N6YA 2BY9X 3UB0A 1DICA 1XUFA 1ANEA 2BY6X 2VWOA 4UE7H 1WXRA 4X2YA 1AI8H 3MO3A 1P0SH 2HNTE 3RXQA 3TIUA 4GUXA 4LXBH 1Z8GA 3RLWH 1ZOMA 1AE5A 2F43B 2FODA 2I6SA 2BD5A 3C27B 1QRWA 5GNDA 3SHCH 3HK6B 3KQCA 2TGDA 2PGBB 1LHCH 1MZDA 4K69A 5H4IB 2Z9JA 1DANH 1XVMA 3ATLA 1ZMJA 2FPZA 4JZIA 3N7DA 3V3MA 4ABHA 1P2KA 5HYOA 3A8DA 3LGVA 4X6NA 2QXIA 4NWLA 4WH6A 2B8OH 4GCHG 1AQ7A 2BDGA 1EP6A 2KM0A 2ZFRH 3GDUA 3ZVAA 3LDXH 1W7GH 1KXFA 1QBVH 4O03A 1G3BA 4I8LA 2J97A 3AASA 1EB1H 2QN5T 1K1LA 3LGTA 2FM2A 4P02A 1HB0B 1UVSH 4BAMB 1GJ6A 4FUGA 1GBHA 1GHAG 5AHGH 1IOEA 1CSOE 4D9RA 4E7NA 5EW1H 4B2CA 1BIOA 2V6NA 5E0HA 2ZEBA 1W8BH 4IW4E 3VFEA 1O3GA 3RXGA 3LGYA 1F0RA 3Q3KA 2NWNA 5GIBA 1PPGE 3LT3A 1S6LA 4Z0KA 2P3FH 4CHAB 3QX5H 1QURH 3ELAH 4AC9A 3MO6A 1ZHPA 5FPSA 2ZFQH 2ASUB 2OINA 1P10A 3AAVA 3OX7U 1L0ZA 2DE8A 2SGFE 3UREA 3TK5A 1NS3A 4FXGH 4UD9H 1QJ1B 3VB5A 1CBWC 1OWEA 2J95A 3MO9A 3VG8A 1DLEA 4Q63A 2B7DH 1ZMLA 1XM1A 3SOSA 2A32A 8LPRA 1P9SA 2IOTA 1Z71A 2ZI2H 1TMBH 1FMGA 3TITA 1CGHA 4XBCA 4NGAH 1SI5H 1HJAB 1O2MA 1S6FA 3M3VA 1QBOA 2QXGA 1XUHA 1O2SA 1RD3B 2Q6DA 3SI4H 2A2QH 2R3UA 3M5MA 4ZKNU 1IQFA 2ZU4A 3SU5A 2HPPH 1YLDA 3TK9A 1O3FA 2ZA5A 1PJPA 2FTMA 4AOQA 3A7XA 1S6HA 4AX9H 2CXVA 2JKHA 2W6ID 1DOJA 4ZKOU 2GDDA 1Y8TA 1A0HB 1CU1A 5HKKD 3MNBA 5A0BA 3RU4D 1FAKH 3SNEA 1H9HE 2VVVA 3NZIA 1AFQB 5HIYA 4HG6A 1X7AC 4OS6A 2ANYA 1WDIA 1AB9B 5J4SA 5TCCA 1UTMA 4ZHAA 1BTYA 3O8DA 1G2MA 3G01A 1O2UA 2ZNKH 2A7CA 4THNH 1O2YA 3P95A 3OEHD 4M9FA 1QQ4A 1T31A 2ANKH 3MFJA 2BY5X 3DFLA 1ZR0A 1TNGA 4PROA 1TIOA 1DY8A 2BDIA 1HLTH 3OE7D 1TGNA 1C2KA 1O2JA 1AUJA 3GCHC 2FLRH 4OGXA 1TFXA 3JZ2B 2DE9A 3GCTG 1TQ7B 5EJLA 1O2LA 2ZO3H 3QDZB 1Z8IB 5T6FA 3T29A 5C67A 4R0IA 1BBRH 2C8ZB 1KXBA 4NZQA 1LVBA 5HXFA 1S0RA 2JH5D 1UCYH 1ACBE 2XRCA 2ZCLP 1GBMA 2BVRH 1O3CA 1YPJH 1GI8B 5DKMA 4J2YB 1FN6A 2H2ZA 1UTNA 2GCHG 1EP5A 1W0KD 1F2SE 1BITA 3GCNA 3OFND 4NIWA 5FXLA 4X1PU 5F53A 1GPZA 3KQBA 2C93B 3T28A 1HAXB 4CR5A 2ZPQA 1GMHG 1YKTA 2GCTC 1O5BB 5C1YA 3TNTA 4ABJA 4IBLH 2HPQH 1LQDB 1FY5A 1V2KT 2BX3A 4ZUHA 2G51A 1K2I1 2BQ6B 2GZ8A 4GCHF 3S69A 1P2IA 4I8HA 1A3BH 1GGDC 3U8TH 4CRBA 4RSPA 4ABDA 3KEEA 1GHBG 2EI8A 4CH2B 6ESTA 4B2AA 1FIWA 1H9IE 2IPQX 1N8OC 4A6LA 1SLWB 2SNVA 3RU4T 1YPHC 1THPB 3PRBA 1DWCH 1GHAF 5GWZA 4JMYA 4AGKA 2GV6A 4MPVA 4CRDA 8GCHG 2ZFTA 1NU9A 3ZIAD 3BF6H 1EPTA 3F2GA 4NIXA 2C8YB 2XNDD 1IQGA 2AFQB 1T8MA 2OC8A 2DUCA 4ISHH 4BOHA 5A8YA 2ANMH 1ZTKA 1D6WA 3H7OA 1RTKA 1V2TT 4NFFA 1BTWA 3BTGE 1PQ8A 2FX4A 2G5NA 2SFAA 5AF9H 2Y82A 3FAOA 4KTCA 3W1EA 4BAKB 3ATKA 1TE0A 1SQTA 1C5MD 4MNVA 1SGCA 1W0YH 2J4IA 1F5KU 1WCZA 5EPYA 3F2FA 4MDSA 5KEDA 2Y5GA 1TGBA 2WPKS 3SQHE 2F83A 1K1JA 1O31A 1SFIA 2FOBA 1O2OA 1BTZA 2BOKA 1TBZH 1HBTH 1BRBE 3VPKA 4YT7H 5F8TA 1G3EA 1P06A 2PUXB 2GT8A 1GWAA 1TNHA 2GGVB 4K2YA 1DVAH 3A87A 1IQMA 1PYTC 3CS7A 3UUZA 4QT8C 5F8XA 2W3IA 4INLA 1IQNA 2B9LA 3TH4H 1OWIA 1THSH 4CREA 4FU8A 1A5GH 4UFGH 5L2YH 1DWDH 4GHQA 1SLXB 2PV9B 1EZUC 3DSOA 2LNCA 3ATIA 1CO7E 1PQ7A 1ZPZA 2KX4A 5DJ7A 3I78A 4CBNA 2VH6A 5DP3A 3KF2A 3ZV8A 4GVUA 1DLKB 2G55A 1O2PA 3F9HA 3E1XB 1UVTH 5A8XA 1EPTB 1WAYB 3LPRA 1OWJA 4Y71A 2CF8H 3RMOH 4ZAEA 3SUDA 1TMUH 4DCDA 3S9CA 4O3TA 1C2MA 3TK6A 1BJUA 1C1TA 1P2NA 1O5FH 3C1KA 2F91A 4WF8A 5GPIB 3RLYH 1V2UT 1F7ZA 3Q77A 5I25A 4DVAU 1BMNH 1NPMA 2OC1A 1GJAB 4OS7A 1THRH 2CF9H 7LPRA 1KLJH 1MQ5A 3AW0A 3UR6A 2J34A 1XUKA 1ZGIA 3PV4A 4YZUA 1NU7B 1WBGB 3PTNA 1TABE 3GCTF 1H8HD 1XUGA 3MYWA 1ARBA 2JH0D 2KCYA 1AMHA 1TGTA 2UWOA 3PWBA 1WV7H 2ZHFH 5EXMA 3RXBA 2A45B 1HRTH 3WW7A 2BTCE 4FUFA 3T62A 4CHAC 1KIGH 3ZVDA 2Y81A 1BTUA 3HK3B 1SGDE 1AGJA 4FVDA 2GCHF 1UTQA 3SW2B 3F9GA 2WUCA 3GDVA 4H42U 3A89A 1QGFA 5EOKA 4ZKRU 1Z8JB 1HAYB 5DP4A 3UIRA 4ASHA 1Y3WA 1GMHF 1MKWH 1H9LB 3SU0A 1O33A 3PWCA 1SKYE 3SGAE 1C5YB 1EOJA 2R0LA 4XOJA 1C1OA 1SFQB 4YXWD 3KQDA 1C2HA 1GBEA 1ABJH 2O8MA 1MTNB 5JB9S 1A61H 1HJAC 1OX1A 2ZGHA 2GX4A 1GHVH 1GHBF 1BMMH 2R9PA 3M3SA 1G37A 4K1EA 1YC0A 1CGJE 2XBXA 1N6XA 1ORFA 3Q00A 3LKWA 3KYGA 4NZLA 3WWFA 3OU0A 4O97A 4K5ZA 4AFSA 3URCA 1LKAA 2C4FH 2STAE 3UOPA 2ZGXH 8GCHF 1GHWH 4NCYA 4BTTB 4O3UA 3ZZ7A 5GXPA 5E8EH 3CP7A 2PUQH 2Q6GA 3ZZ5A 5DP6A 5SGAE 4XD7D 1XXDA 2QXHA 4LOYH 4NSYA 1P09A 1IQLA 1O3KA 3ZZCA 1EATA 1AFQC 1EB2A 4NSVA 1O3HA 5T3HA 1ZMNA 5DP7A 1PYTD 1AB9C 1SGFA 1UVOA 3GYLB 4K1TA 4NIVA 3KHVA 1DWEH 2D1JA 3LJOA 3H5CB 1C4U2 2FI4E 1GJCB 2G52A 3PO1B 1O3NA 3D65E 4Y7BA 4JK5A 1Y5UT 3U69H 3MU5A 3BEFB 3VGCB 3SU3A 3ZZBA 4Y7AA 3SO3A 2BD9A 2CHAB 4DW2U 1E1RD 2BM2A 1JBUH 4OS2A 1C5LH 2A4QA 3QN7A 4I32A 1AVGH 2FO9A 2PHBA 1XKBC 1GI5A 2B5TB 2VBCA 1ANBA 1CT4E 1DWBH 3F2HA 3F68H 1K9OE 2XOKD 1C5VA 4F49A 2Y80A 3R0FA 3F9FA 5CHAB 5EU8A 4Y79A 1NZQH 1Y3YA 1V2RT 2HNTC 1W0JD 1GBLA 3RMMH 4IS5A 4X1SU 2SGPE 1IAUA 2EA3A 2VU8E 4WXVA 7GCHG 1N1LA 3F3BA 2H5DA 3FO8D 3DA9B 2F9UA 3M37A 3RXUA 4X8SH 5GCHF 1H8DH 4RN6A 1KXEA 1XUIA 1G3DA 1EUFA 4E06H 2JJ2D 2VB0A 3L6PA 1HAHH 4ZMAH 1VR1H 1LHFH 1TBQH 3E90B 2ZTZA 1PQAA 3LH3A 5CE1A 1BHXF 1MKXH 1AN1E 3Q76A 1NESE 5EGMA 1V6DA 4X1RU 1MQ6A 2GTBA 2YMSB 2Z9LA 3SJ8A 4ZXXH 1O2VA 1UJ1A 2I6QA 1C2FA 4TY6A 1GI6A 2BDCA 2CJIA 1MKXK 4BNRA 5IK2D 1GI2A 5KGOA 3MTYA 2BLVA 5GJ4B 3ZZ4A 1HCGA 1QA7A 1DXWA 3SGBE 3UWJH 3D62A 5T6DA 5EW2H 1OXGA 2AERH 4IGDA 3H09A 1WQVH 2A4OA 3UPEA 2EQNA 1ZTLA 1PQ5A 4ISLA 2WV4A 2EC9H 1C5RA 1YPGH 1TPOA 1RIWB 5C3NA 1TNIA 3EA9A 3IWMA 5C20A 1ZHMA 2EEKA 5L2ZH 4X2VA 3QGNB 1O2IA 4YOGA 2UWLA 1P57B 2KCOA 3SU2A 4WMEA 3ITIA 1NRNH 3LIWA 5AFZH 2STBE 1EOLA 4TWYA 2CMYA 1YWUA 4JZDH 5DPAA 2BB4A 2TGAA 3MMGA 4AB9A 2F9OA 2RDLA 1BCUH 1C1WH 1HUTH 2TGTA 4I8JA 2BXTH 3QO6A 1Z1IA 2FYQA 3F0OA 3LGIA 4CRAA 1QY6A 3O8RA 1QJ6B 2XC0A 1O5GH 5EQQA 1GI0A 3BTKE 1CVWH 3SJOA 1L1JA 1GCDA 2V0BA 2AH4X 1NRPH 3SNCA 1ELAA 2IN2A 1ARCA 3ZVCA 1OYTH 1TYNA 3BEUA 1RRKA 1OYQA 1C1SA 4INKA 1AVXA 1ZYOA 3SV9A 5K0HA 2SGDE 1W11U 2OD3B 3M7QA 1TGCA 3F1SB 3MNXA 1FDPA 5A0AE 3PMHB 2FESH 3CENA 1EPTC 2P16A 1IHTH 2ALPA 5JPMH 1IHSH 1ESBA 4RT1A 5HMAA 1E1QD 1OPHB 1Y59T 1PPFE 1BTXA 3KCGH 4NIYA 1M9UA 1UO6A 2UUKB 2V3HH 2IJD1 1GBKA 1EKBB 1MU6B 1L4DA 2FIRH 3SJ9A 1ESTA 1NFYA 3VB3A 1FX0B 1C1PA 3MU1A 4RKOB 3PYHA 2ODYB 1LPGB 1YLCA 1QZ8A 1MTVA 4D7GA 3ODDA 1QNJA 1O3MA 5EJZA 3FOAA 5CDFE 1FONA 2VWNA 3U8RH 2J9NA 2D8WA 5A8ZA 3MQKC 2C8XB 4CRGA 2NU3E 2XCFA 5EODA 2C90B 2H9TH 1ELVA 1C4V2 2FOMB 2J38A 1C5SA 2GZ9A 3GY7A 4Y76A 2WPDD 3GY8A 1BTPA 3MH6A 2QAAA 5FBIA 1G2LA 1V2VT 1MBQA 1PPHE 4B74A 4AFUA 3MI4A 2LELA 5DSFA 2Z3DA 3RM0H 7GCHF 2A2XH 3ENSB 3N7EA 3NUMA 1T8OA 1T8NA 3A7WA 3ZYEA 2VIPA 2ZCHP 1MMJN 1DSUA 1YPEH 2XYAA 1B0EA 3GY5A 1WOFA 1SLUB 3UQOA 5EJ1A 1MTNC 2AIPA 3SNAA 1GBTA 1OP2A 2QF4A 3BV9B 1Z1JA 1E35B 4FOUC 1GVZA 3SUEA 4FU7A 3KNXA 2ZDKA 3TNSA 4K60A 2FEQH 2PR3A 4MNWA 1RTFB 3B9FH 4AFQA 3A88A 4ABIA 2QXJA 3A8BA 4K1SA 1H4WA 4MPXA 1MD7A 2BY8X 4YTAA 1GI4A 1Y3VA 2FWWA 2D2DA 1O3EA 2W26A 4X8VH 5B6OA 2FI3E 3SUFA 1ELBA 1ETTH 1QB6A 3HPTB 3LGUA 1GCTB 3FANA 1UTKA 1C1QA 1F92A 4IMZA 1ZJKA 3UNQA 1YY3A 2HNTF 2KCAA 4FUCA 1O2WA 1FY1A 1J15A 1P05A 3UQVA 3MNSA 1A5IA 1UMAH 2ILNA 1K22H 2OC7A 4YESB 3U9AH 1ZTJA 3PO1C 1C1MA 1CQQA 1PFXC 1SL3A 5DO4H 3VGCC 4WXIA 2ZFFH 3BIVH 4JYTA 1TONA 2XTTB 3GYMA 2QF5A 2CHAC 2ZU1A 2FOEA 5EQSA 1P2OA 3ZVGA 5AVDA 2BZAA 3WWBA 2G8TA 2PFEA 2QC2A 3EQ0H 4B73A 7ESTE 3TJVA 3ZZDA 2BD7A 2VINA 4XBDA 2ZP0H 1EJNA 2BD2A 1EZSC 4IMQA 3SV6A 1O0DH 4WJG2 2JDID 3MWIU 3HKIB 1T8LA 1J9CH 3QTOH 3P8NA 1Y3UA 1Q2WA 5CHAC 1TRNA 3V0XA 1RXPA 2AEIH 2Z3EA 2VIOA 1VZQH 2PW8H 3M3TA 2FX6A 4FUBA 1E36B 1W14U 2FOHA 3MOCA 3E0PB 1S81A 4ZCNA 2FOFA 1P8VC 4P00A 1IQIA 5FPTA 1D3PB 4FVBA 5DP9A 3P17H 4Q7ZA 5IDKA 4A1TA 5DN6D 2ULLA 2ZDAH 3P6ZB 4I8KA 3AAUA 1A4WH 2P8OB 3QK1A 5J4QA 5JDUB 1BT7A 2G5VA 2HRVA 1C1VH 2RDEA 4B1TA 1O39A 3DD2H 1KXAA 2BDYA 1S83A 3GICB 2KFWA 1L1GA 2PGQB 3NPSA 4YO9A 1O3DA 2WV9A 2NU4E 2YMSC 1LO6A 4YOIA 4DOQA 3V7TA 1RGQA 1K1MA 2XNIA 3A82A 1UK2A 2WPJS 1MU8B 5TCAA 1JRTA 1G30B 4LZ1H 3T5FH 1LHDH 1WQSA 1BQYA 1QIXB 3BTQE 1O34A 1XXFA 3BN9A 2BDBA 3U1IB 2ZTXA 3PLBA 3NRLA 5ESBA 1GJBB 1RIWC 1TGSZ 2NU2E 5DP5A 3AK5A 1KDQA 1ZSLA 4TYDA 1D4PB 1HNEE 5DGJA 1HFDA 1C9TA 1HYLA 2QV1A 2YNBA 1C5UA 2M2AA 4TPIZ 1FPHH 3SN8A 3STIA 2J92A 3UWIA 4HI3A 2UUFB 2FOAA 2VJ1A 3S9BA 1O3OA 1QTFA 2IJOB 1FAXA 2QF3A 3DCLA 2FMJA 1YP9A 4INHA 1Q3XA 4RT0A 2V3MA 3P8FA 2BYAX 1EJAA 1T4UH 1KSNA 3A81A 4AFZA 1O3LA 4JYVH 3F6UH 1V3XA 1EAXA 1WUNH 2EI7A 3F9EA 2SNWA 1UTOA 2WPLS 3RM2H 2G4TA 1BMAA 2OP9A 3AW1A 3GDSA 3ZYDA 4AB8A 1C9PA 5E0GA 4A1VA 2ALVA 2XC4A 3MU0A 1O3BA 4K8YA 2GVFA 2FLBH 3OAAD 2ZZUH 1TNJA 1O2NA 3VB4A 5L6NH 1XUJA 2VIWA 2R0KA 5T1VA 5GCHG 1V2OT 1NRQH 3RXVA 3LJJA 1KDQB 1B0FA 1C2GA 1C5QA 4GAWA 3RXMA 2Q1JA 2WV5A 2KAIA 5T6GA 1QFKH 4KELA 1CHOG 2CK3D 2J94A 3U28C 3ZZ6A 3IG6B 1KTTB 2O8UA 2H9EH 2OQ5A 3MHWU 3BTFE 1QL7A 1AO5A 3UFAA 4RKJB 3K9XB 2RFKC 3W95A 3T26A 3A7TA 5DK1A 3ZVBA 1DUEA 4BXWA 2K1QA 2VIVA 4TSFD 2F9BH 1WSSH 4NA8A 5FCKA 3PM3A 4XRNA 3SJKA 1J16A 1EASA 1EFRD 2F9VA 2OLGA 4MPWA 2WPIS 1YGCH 2YMSD 3K6ZA 1TOCB 3EE0B 5JBAS 1QB1A 4YM9A 4Y11E 2CN0H 3RXOA 2PTNA 4ZROA 3TJUA 3U8OH 3LONA 1GJ4H 3BSQA 1UHBA 5DG6A 3OY6U 2LPRA 4WMFA 2QA9E 2PTCE 2GDEH 3PB1E 2KCPA 1J17T 1DY9A 2QYIA 1FIZA 4AN7A 1A3EH 2ZQ2A 4B76A 1UW7A 2G4UA 2WINI 2QE7D 1TLDA 1TX7A 2BD4A 4NWKA 2FDAA 2QF0A 3FZZA 1GI9B 2KAIB 4H6SB 1K28D 1LPZB 1O35A 3RXPA 2PKAA 3EYDA 1GDQA 1ID5H 4ABGA 2FOCA 4X0WU 4Y0YE 1GCTC 2CGAA 2A5IA 3VB7A 4ACBA 1TX8A 3M5OA 1FXYA 2VIQA 2F9PA 2GT7A 1LHGH 6CHAB 4ISOA 3OYPA 3P70B 9LPRA 1GL1A 3TPIZ 4H4FA 1NTPA 4UFEH 1ZRKA 2YOLA 1GI7B 2AGEX 5HM9A 3L33A 3E0NB 3M7TA 3B8JA 5FX6A 1C5OH 4J1YA 2ZGBH 2F9NA 3RXRA 3URDA 4WH8A 1GBJA 1C5NH 2FYRA 1VGCB 3UNSA 1GHZA 4SGBE 4GSOA 3S7KB 1C5WB 1V2MT 1BRCE 1GJ8B 9ESTA 1UHBB 4ASUD 1PPCE 2Z9IA 1C2DA 1HIAA 1HV7A 1L4ZA 4XFQA 1O32A 3TGIE 1SSXA 1P3EA 1A0JA 3FZDA 5FL7D 3QWCH 4MPUA 2ZCKP 2ZU3A 1LVMA 1BOQA 1BUIA 3RC4A 1JIMA 2THFB 1TPSA 1YCPH 3RXDA 4Q80A 2GJGA 1CHGA 3KQEA 4YLUA 2H1UA 2ODQA 1TX6A 3MU8A 3GY6A 1HAVA 3LGWA 3DT0H 1GBBA 5C5NA 1O2HA 2V35A 1ELTA 2PKAB 4YT6H 1VKYA 1C1NA 4AYVB 1ZGVA 2OK5A 3BTEE 1C2LA 2ZHQH 5C1XA 1GMCG 1YBWA 1YCPK 2WHXA 2ZHEH 1GJ7B 3PLPA 1P3CA 4ISIH 2HALA 1QBNA 1VJAU 5E0JA 3BTDE 4ABBA 4D8NA 2P8OC 2W7UA 4JK6A 4X8TH 1QL8A 1PPBH 2UWPA 1MZAA 3DFJA 1O5CB 3AVZA 1OWKA 3A7VA 5HGGA 3RDZA 1TA6A 1HGTH 5E2OA 1RJXB 2Z3CA 2BHGA 5FBEA 1Z6EA 4E05H 1CHOF 3PMBB 1ETRH 1D9IA 1OSSA 2A5KA 2GD4B 2Y5FA 3FP6E 1JRSA 1XKAC 1YYY1 4B6EA 3E3TA 5BPEA 1QB9A 1HIAB 4BAQB 1OKXA 1MUEB 2HVXA 4BTUB 1TMTH 2AS9A 2ZDMA 3OEED 2OXSA 2R2WU 1A2CH 3SV7A 1FLEE 1A5HA 1WYKA 4U2WA 4ZKSU 1DUAA 3HGNA 1MABB 4OS4A 3S0NA 1O2XA 1ZLRA 2VVUA 1DXPA 3OTPA 3RXCA 3GISB 4HZHA 1GBAA 1HAVB 1INCA 3FP8E 6GCHG 1O37A 2O8WA 3N99A 8ESTE 3GY3A 4K3JA 2BLQA 2ZIQH 1DS2E 4D76A 1O3IA 2K8IA 4F4OC 4DT4A 1ETSH 2FI5E 3RMNH 2W5EA 1GG6B 2J98A 3RC6A 2ZHDA 1LHEH 3ZZ8A 1ZZZA 1AIXH 1O5DH 2WYJA 3STJA 2A31A 5EG4A 4X6MA 1YM0A 1IQHA 2ZGCA 1D3QB 4NG9H 1E0FD 2HGTH 1UTPA 2GV7A 1GDNA 4OS1A 4OGYA 3JZ1B 1GHYH 2XW9A 2ZDNA 2P3UB 1NFUA 2TBSA 2BOHB 1MCVA 1AUTC 1DFPA 1C5ZB 2ZWLH 1NRSH 4R8TB 2L6OA 1V2JT 2AMQA 3NXPA 5BRRE 5CHBA 1XX9A 2XWAA 5C0TA 1Y5BT 2UUJB 5B6LA 1DDJA 1O2QA 4A1XA 3M7UA 3TGKE 2GP9B 3K65B 1LVOA 2FS9A 1MCTA 2ANWA 5EXNA 4KGAA 4TT3D 1FY8E 1NBME 2J5UA 4E7RG 4LZ4B 2GMTB 1SOZA 1C2EA 5LPRA 4Q4LA 4FUJA 7KMEH 1B5GH 2VNTA 3RXTA 1FY4A 3DSGA 3CNRA 1FPCH 1K1OA 1ZRBA 5FAHA 3LOXA 1T7CA 3PROA 5CMXH 3MH5A 1AZZA 3M5LA 4DT7B 2WPMS 1O2ZA 2XBVA 4ZXYH 1FV9A 2JETB 4WY3A 1O38A 5FX5A 3RXSA 3SNBA 3SV8A 3NKKA 3A8CA 5LPFA 1AHTH 1YPLH 2ZGJA 4U32A 1NBMD 4D9QA 2J98B 1TAWA 2KR7A 1QR3E 2ZTYA 4JYUH 1C2JA 1D6RA 1TBRH 4JZFH 1NFXA 1P12E 2ZPRA 4B2BA 2GKVE 2FZZA 3T2NA 1DITH 3PLKA 1EAUA 4HFPB 2P93A 1SGEE 3D49H 2AHME 1ANCA 1EXFA 1OP8A 2RA3A 1GDUA 4MVNA 1TALA 3OTJE 3SU4A 3MNCA 4IC5A 4X2WA 4I33A 1GBCA 1B7XB 1T4VH 3BTWE 2XWBI 5L30H 4FUDA 4ABAA 3OSYA 1GMCF 1RFNA 1GI3A 3MH4A 3GY4A 1G9IE 2R3YA 3ESTA 5JBTA 3EGKH 1FJSA 1Q31A 1SQOA 4A7IB 1U6QA 2AGGX 1ZPBA 1ABIH 3A84A 3KYFA 3GY2A 1P01A 3I29A 5IYTA 3NK8A 1BBRE 4X6PA 4RI0A 3TVJB 3ZVEA 1UCYE 1UK4A 4XBBA 2A7JA 5C5OA 2YNAA 2VWMA 1Z8RA 3S9AA 5I46H 4DIHH 4Z6AH 1KYNA 2Z94A 2ZKSA 4ZH8A 4M7GA 1HXFH 3P92A 3T27A 1GMDG 1YPKH 3W94A 2PWXA 1SR5C 2VGCB 1NO9H 1CGIE 3D23A 1UVPA 1AD8H 2ZPSA 4CH8B 1FN8A 1V2PT 3RXFA 1AWHB 1SOTA 3N7OA 3UOUA 6CHAC 1JOUB 3QZQA 2H6MA 1G3CA 1GVLA 2EI6A 3RU4E 2B0FA 3E6PH 2AIQA 6LPRA 2HVYB 3ZZ9A 1FNIA 1KXDA 1J14A 1F5RA 1A1RA 1VITH 1OP0A 3T25A 6GCHF 1F0TA 1L2EA 1NN6A 1SGPE 3SGQE 1EQ9A 3TLOA 4MNYA 2SGQE 1VITF 4AYYB 5C0UA 2QCYA 5EPNA 1VGCC 3DSPA 2OC0A 2ZFSA 1QQUA 1C5XB 4UONA 2Q6FA 2RG3A 3FVFB 1EZXC 3BTME 1SGIB 4FUHA 3RUOA 1OHHD 4ZHMU 1C1RA 2RCEA 1BRAA 5AFYH 3BEIB 4IN1A 5GDSH 1OWDA 4FU9A 2FOGA 3SUGA 4XE4A 4F55A 3RMLH 2FTLE 1SBWA 3FKSD 1CT2E 2Y7ZA 3EDXB 3OY5U 1SC8U 1FI8A 4GPGA 2RA0A 1GBFA 4DIIH 4X2XA 3SU1A 2AMPA 2P59A 3LC5A 1YLNA 2WYGA 3S7HB 3MH7A 2FXRA 1AFEH 1NT1A 1IQJA 1P11E 2O8TA 1V2ST 4TWWA 1HAIH 2HLDD 1BJVA 3BG4B 2BDHA 3E91A 3QUMP 1CA8B 4JZ1A 4BANB 2ZFPH 5G4BA 5C1UA 3QZRA 1ELGA 2FP7B 2XXLA 3ZV9A 3UAIC 5JBBS 1LTOA 3H7TA 2QGRA 3R3GB 1GI1A 4KKDA 3KIDU 3VXFH 4AGJA 1HAZB 2PSXA 5C2ZA 4DG4A 5LPEA 1S82A 1P2JA 1SLVB 1BRUP 1BTHH 1CA0B 3QGJA 1T32A 3TU7H 2Z7FE 4JCNA 5F8ZA 2A7HA 2P94A 5F03A 5HM2A 4ABFA 1BBRK 5DP8A 3EA7A 3ATWA 4NA7A 4BAHB 1SPJA 1G36A 1UCYK 2C8WB 2QY0B 3ZVFA 1UVUH 1VCWA 1O3PB 3I77A 1DT2A 1LCYA 1KLIH 5EQRA 3RXHA 4U30A 1Y5AT 2HLCA 1EZQA 4Y8YA 1ELEE 1J8AA 1CT0E 2ZF0H 2XCNA 5K7RA 3EE7A 4TY7A 2BD3A 2W3KA 1Z6JH 2ZU2A 5A2MH 4AG2A 3SJIA 2G81E 1JMOH 4UFDH 1QRZA 1SGTA 4CRCA 4B71A 5EIYA 2W7SA 4XDEA 4VGCB 2GZ7A 1AU8A 1NRRH 3P8GA 1GG6C 1KXCA 1UK3A 2AMDA 3SZEA 3SHAH 3E16B 2JH6D 1F0UA 4WVPE 1GJDB 4MQAA 1DPOA 1SB1H 1SGFG 3A7YA 2BX4A 3BTHE 1JXPA 2PKSB 3ODFA 4JZEH 1V2QT 4KTSA 4H6TA 4WWYA 1NY22 1LQEA 1AZ8A 1C1UH 3O8BA 4X6OA 2K0QA 4GHTA 1ELCA 2KZ4A 1XVOA 2PSYA 3FFGA 3DHKH 2ESTE 1UTJA 4GLYA 3Q3XA 4UDWH 1GMDF 1SGQE 1GBIA 3MU4A 1RTLA 2VWLA 1PPZA 1K21H 3V13A 1IQKA 3QLPH 3QTVH 4DJZB 1JWTA 1W12U 4FUIA 2BZ6H 3EA8A 1P02A 4AZ2B 5F6MA 3FP7E 4WMDA 2NU1E 1F0SA 3VB6A 2GMTC 3L3TA 4K8BA 1TNKA 1FQ3A 3UY9A 3EAJA
chains in the Genus database with same CATH topology
1LVYA 5E2PA 2F3CE 1UTLM 4OS5A 4ABEA 1SHHB 1NM6A 1JIRA 4X8UH 3DUXH 4DURA 2OCVB 1W13U 5PTPA 4HGCA 1EX3A 1MD8A 1GL0E 1KTSB 1TRYA 5JBCS 1SGNE 2JETC 4Y6DA 4Y10E 3LC3A 2BLOA 1YF4A 1LPKB 2A1DB 1OWHA 3A80A 4U01A 3VEQB 5ESTE 2SGAA 1O2RA 4ISNA 3RXIA 1SMFE 1VCPA 4YOJA 1IQEA 4BTIB 1TRMA 1F5LA 4CR9A 1DSTA 1SG8B 2P3TB 3SU6A 2ZECA 1P03A 4MLFB 3RXEA 1BB0B 3IITA 1MAXA 2G00A 2AGIX 1H1BA 1S84A 2ZU5A 1C5PA 2BVXH 2ZDVH 1O30A 3BG8A 2R2MB 1O3AA 1SQAA 1S0QA 4Y8XA 2O9QA 5JYIA 5JB8S 1YPHE 1C4Y2 1SHYA 4BAOB 2A5AA 2ZHWH 1YPMH 4KP0A 5LGOA 1LKBA 3VXEH 3K2UA 5EXLA 1ZHRA 1O36A 1HXEH 1O2TA 5TJXA 3Q3YA 1P2MA 1HDTH 1O2GH 4O9VA 1GJ5H 4CBOA 3NWUA 3UTUH 4KTUA 3ZZ3A 1EAIA 1QJ7B 2VGCC 3U98H 4UEHH 1AVWA 2ZDLA 1MH0A 1XMNB 1QRXA 3M36A 4LK4A 1MTUA 1FZZA 2BY7X 1GJ9B 3RXJA 1CBWB 3PMAB 2XBWA 2V3OH 4CRFA 3BTTE 5FCRA 4ZHLU 1ANDA 3TJNA 2NU0E 3KGPA 2ODPA 2BQ7B 2D26C 3E8LA 3V12A 1MKWK 3ZZAA 3M61U 3K6YA 1ZSJA 1W0ZU 1S5SA 1HAGE 2ZG0H 1C2IA 1P9UA 3A8AA 2WPHS 1W10U 4X1QU 1LDTT 3PTBA 1S85A 1AY6H 1RS0A 3SORA 3GOVB 4I7YH 4NA9H 5FHTA 2XBYA 1W3CA 2ZC9H 1L1NA 3PMJA 1ESAA 1C5TA 1CE5A 2FS8A 4DGJA 1OS8A 1NC6A 1OOKB 1HAPH 1ELFA 1HAOH 2PLXA 3HATH 1HPGA 1PPEE 1K1PA 4MG3A 4IC6A 2BQWB 2BXUH 4MNXA 1DM4B 1TWXB 1NROH 1A0LA 4BXSA 2Y5HA 2CV3A 3HGPA 1K1IA 2VVCA 1BDAA 1TOMH 2BLWA 3HKJB 3TH2H 3RXKA 3TGJE 1A7SA 1K1NA 1O5AB 1YCPM 1O2KA 4MTBA 1E37B 1O5EH 2TIOA 1WTHD 3UR9A 4UFFH 1VJ9U 1MAYA 3NCLA 3B23B 2BDAA 3BG4C 2BMGB 3TJOA 2O8LA 1BMLA 1AKSA 1QA0A 1ZJDA 4IN2A 3GCHB 4D7FA 2C3SA 3RC5A 2VH0A 4YLQH 1ZPCA 4ESTE 3ATMA 3KL6A 4B75A 1DX5M 1SVPA 2Z9KA 3P8OA 4A92A 1HJ9A 4HTCH 1HJ8A 2P95A 1SGYE 2BVSH 2WUBA 1TA2A 3RXAA 3TH3H 3BIUH 1VCQA 3RP2A 2Y6TA 1CA0C 2TRMA 2ZQ1A 1D3TB 2H9HA 1KY9A 4NFEA 2A4RA 2XC5A 3UNRA 2Z9GA 1SGRE 2A4GA 3M35A 3SV2H 5LH8A 2OQUA 3SQEE 4TPYA 3M5NA 2M5TA 1WTGH 3GCOA 2GCTB 1E38B 1QL9A 4Q2KA 2H5CA 3A83A 4Q7XA 1V2NT 2A0QB 2UUYA 3SNDA 1A46H 2VIDA 1P04A 4Y0ZE 1TB6H 1TNLA 2HOBA 2TPIZ 1Z7KA 1GGDB 2SGEE 3U1JB 3KN2A 1TPAE 4Y8ZA 1FUJA 2OBOA 1FY3A 3SI3H 4VGCC 2Z6BD 1V2WT 1N8OB 2J2UA 3O8CA 1VITG 4AORA 1KLTA 1QCPA 4Q7YA 3SZNA 2PKSC 1AKSB 1EJMA 3LH1A 1AWFH 1D3DB 1MBMA 3LU9B 1GVKB 5A0CA 1Y3XA 5A09A 1DE7H 3SBKA 4A5TS 1O3JA 1V2LT 2HWLB 2OUAA 5FPYA 3CS0A 2BD8A 1MTSA 1ZSKA 1EAWA 1TQ0B 4X1NU 1MTWA 1WU1A 1GBDA 1E34B 1LMWB 5ETXA 4I8GA 1BA8B 2TGPZ 1W7XH 4XSKU 1TPPA 2OTVA 4SGAE 1BHXB 1H8IH 4I31A 3A7ZA 1GHXH 2AYWA 4DY7B 1ELDE 2IPHA 5ABWA 3A86A 3WY8A 8KME2 2OBQA 1G32B 1NFWA 3RXLA 1BZXE 3A85A 1W2KH 1QHRB 2QIQA 1P2QA 1AE8H 4AG1A 4FUEA 2Y7XA 1N6YA 2BY9X 1DICA 1XUFA 1ANEA 2BY6X 2VWOA 4UE7H 4X2YA 1AI8H 3MO3A 1P0SH 2HNTE 3RXQA 3TIUA 4GUXA 4LXBH 1Z8GA 3RLWH 1ZOMA 1AE5A 2FODA 2I6SA 2BD5A 3C27B 1QRWA 3SHCH 3HK6B 3KQCA 2TGDA 2PGBB 1LHCH 1MZDA 4K69A 5H4IB 2Z9JA 1DANH 1XVMA 3ATLA 1ZMJA 2FPZA 4JZIA 3V3MA 4ABHA 1P2KA 5HYOA 3A8DA 3LGVA 4X6NA 2QXIA 4NWLA 4WH6A 2B8OH 4GCHG 1AQ7A 2BDGA 1EP6A 2ZFRH 3GDUA 3ZVAA 3LDXH 1W7GH 1KXFA 1QBVH 4O03A 1G3BA 4I8LA 3AASA 1EB1H 2QN5T 1K1LA 3LGTA 2FM2A 1HB0B 1UVSH 4BAMB 1GJ6A 4FUGA 1GBHA 1GHAG 5AHGH 1IOEA 1CSOE 4D9RA 4E7NA 5EW1H 4B2CA 1BIOA 2V6NA 5E0HA 2ZEBA 1W8BH 4IW4E 3VFEA 1O3GA 3RXGA 3LGYA 1F0RA 3Q3KA 2NWNA 5GIBA 1PPGE 3LT3A 4Z0KA 2P3FH 4CHAB 3QX5H 1QURH 3ELAH 3MO6A 1ZHPA 5FPSA 2ZFQH 2ASUB 2OINA 1P10A 3AAVA 3OX7U 1L0ZA 2DE8A 2SGFE 3UREA 3TK5A 1NS3A 4FXGH 4UD9H 1QJ1B 3VB5A 1CBWC 1OWEA 2J95A 3MO9A 1DLEA 2B7DH 1ZMLA 1XM1A 3SOSA 2A32A 8LPRA 1P9SA 2IOTA 1Z71A 2ZI2H 1TMBH 1FMGA 3TITA 1CGHA 4XBCA 4NGAH 1SI5H 1HJAB 1O2MA 1S6FA 3M3VA 1QBOA 2QXGA 1XUHA 1O2SA 1RD3B 2Q6DA 3SI4H 2A2QH 2R3UA 3M5MA 4ZKNU 1IQFA 2ZU4A 3SU5A 2HPPH 1YLDA 3TK9A 1O3FA 2ZA5A 1PJPA 2FTMA 4AOQA 3A7XA 1S6HA 4AX9H 2CXVA 2JKHA 1DOJA 4ZKOU 2GDDA 1Y8TA 1A0HB 1CU1A 3MNBA 5A0BA 3RU4D 1FAKH 3SNEA 1H9HE 2VVVA 3NZIA 1AFQB 4OS6A 1X7AC 2ANYA 1AB9B 5J4SA 5TCCA 1UTMA 4ZHAA 1BTYA 3O8DA 1G2MA 3G01A 1O2UA 2ZNKH 2A7CA 4THNH 1O2YA 3P95A 1QQ4A 1T31A 2ANKH 3MFJA 2BY5X 3DFLA 1ZR0A 1TNGA 4PROA 1TIOA 1DY8A 2BDIA 1HLTH 1TGNA 1C2KA 1O2JA 1AUJA 3GCHC 2FLRH 4OGXA 1TFXA 3JZ2B 2DE9A 3GCTG 1TQ7B 1O2LA 2ZO3H 3QDZB 1Z8IB 5T6FA 3T29A 5C67A 4R0IA 1BBRH 2C8ZB 1KXBA 4NZQA 1LVBA 5HXFA 1S0RA 2JH5D 1UCYH 1ACBE 2XRCA 2ZCLP 1GBMA 2BVRH 1O3CA 1YPJH 1GI8B 5DKMA 4J2YB 1FN6A 2H2ZA 1UTNA 2GCHG 1EP5A 1F2SE 1BITA 3GCNA 4NIWA 5FXLA 4X1PU 1GPZA 3KQBA 2C93B 3T28A 1HAXB 4CR5A 2ZPQA 1GMHG 1YKTA 2GCTC 1O5BB 5C1YA 3TNTA 4ABJA 4IBLH 2HPQH 1LQDB 1FY5A 1V2KT 2BX3A 4ZUHA 2G51A 1K2I1 2BQ6B 2GZ8A 4GCHF 3S69A 1P2IA 4I8HA 1A3BH 1GGDC 3U8TH 4CRBA 4RSPA 4ABDA 3KEEA 1GHBG 2EI8A 4CH2B 6ESTA 4B2AA 1FIWA 1H9IE 1N8OC 4A6LA 1SLWB 2SNVA 3RU4T 1YPHC 1THPB 1DWCH 1GHAF 5GWZA 4JMYA 4AGKA 2GV6A 4MPVA 4CRDA 8GCHG 2ZFTA 1NU9A 3BF6H 1EPTA 4NIXA 2C8YB 1IQGA 2AFQB 1T8MA 2OC8A 2DUCA 4ISHH 4BOHA 5A8YA 2ANMH 1ZTKA 1D6WA 3H7OA 1RTKA 1V2TT 4NFFA 1BTWA 3BTGE 1PQ8A 2FX4A 2G5NA 2SFAA 5AF9H 2Y82A 3FAOA 4KTCA 4BAKB 3ATKA 1TE0A 1SQTA 1C5MD 4MNVA 1SGCA 1W0YH 2J4IA 1F5KU 1WCZA 5EPYA 4MDSA 2Y5GA 1TGBA 2WPKS 3SQHE 2F83A 1K1JA 1O31A 1SFIA 2FOBA 1O2OA 1BTZA 2BOKA 1TBZH 1HBTH 1BRBE 3VPKA 4YT7H 5F8TA 1G3EA 1P06A 2PUXB 2GT8A 1GWAA 1TNHA 2GGVB 4K2YA 1DVAH 3A87A 1IQMA 1PYTC 3CS7A 3UUZA 4QT8C 5F8XA 2W3IA 4INLA 1IQNA 2B9LA 3TH4H 1OWIA 1THSH 4CREA 4FU8A 1A5GH 4UFGH 5L2YH 1DWDH 4GHQA 1SLXB 2PV9B 1EZUC 2LNCA 3ATIA 1CO7E 1PQ7A 1ZPZA 5DJ7A 3I78A 4CBNA 2VH6A 5DP3A 3KF2A 3ZV8A 4GVUA 1DLKB 2G55A 1O2PA 3F9HA 3E1XB 1UVTH 5A8XA 1EPTB 1WAYB 3LPRA 1OWJA 4Y71A 2CF8H 3RMOH 4ZAEA 3SUDA 1TMUH 4DCDA 3S9CA 4O3TA 1C2MA 3TK6A 1BJUA 1C1TA 1P2NA 1O5FH 3C1KA 2F91A 4WF8A 5GPIB 3RLYH 1V2UT 1F7ZA 3Q77A 5I25A 4DVAU 1BMNH 1NPMA 2OC1A 1GJAB 4OS7A 1THRH 2CF9H 7LPRA 1KLJH 1MQ5A 3AW0A 3UR6A 2J34A 1XUKA 1ZGIA 3PV4A 4YZUA 1NU7B 1WBGB 3PTNA 1TABE 3GCTF 1XUGA 3MYWA 1ARBA 2JH0D 1AMHA 1TGTA 2UWOA 3PWBA 1WV7H 2ZHFH 5EXMA 3RXBA 2A45B 1HRTH 2BTCE 4FUFA 3T62A 4CHAC 1KIGH 3ZVDA 2Y81A 1BTUA 3HK3B 1SGDE 1AGJA 4FVDA 2GCHF 1UTQA 3SW2B 3F9GA 2WUCA 3GDVA 4H42U 3A89A 1QGFA 5EOKA 4ZKRU 1Z8JB 1HAYB 5DP4A 3UIRA 4ASHA 1Y3WA 1GMHF 1MKWH 1H9LB 3SU0A 1O33A 3PWCA 3SGAE 1C5YB 1EOJA 2R0LA 4XOJA 1C1OA 1SFQB 3KQDA 1C2HA 1GBEA 1ABJH 2O8MA 1MTNB 5JB9S 1A61H 1HJAC 1OX1A 2ZGHA 2GX4A 1GHVH 1GHBF 1BMMH 2R9PA 3M3SA 1G37A 4K1EA 1YC0A 1CGJE 2XBXA 1N6XA 1ORFA 3Q00A 3LKWA 4NZLA 3OU0A 4O97A 4K5ZA 4AFSA 3URCA 1LKAA 2C4FH 2STAE 3UOPA 2ZGXH 8GCHF 1GHWH 4NCYA 4BTTB 4O3UA 3ZZ7A 5GXPA 5E8EH 3CP7A 2PUQH 2Q6GA 3ZZ5A 5DP6A 5SGAE 1XXDA 2QXHA 4LOYH 4NSYA 1P09A 1IQLA 1O3KA 3ZZCA 1EATA 1AFQC 1EB2A 4NSVA 1O3HA 5T3HA 1ZMNA 5DP7A 1PYTD 1AB9C 1SGFA 1UVOA 3GYLB 4K1TA 4NIVA 3KHVA 1DWEH 2D1JA 3LJOA 3H5CB 1C4U2 2FI4E 1GJCB 2G52A 3PO1B 1O3NA 3D65E 4Y7BA 4JK5A 1Y5UT 3U69H 3MU5A 3BEFB 3VGCB 3SU3A 3ZZBA 4Y7AA 3SO3A 2BD9A 2CHAB 4DW2U 2BM2A 1JBUH 4OS2A 1C5LH 2A4QA 3QN7A 4I32A 1AVGH 2FO9A 2PHBA 1XKBC 1GI5A 2B5TB 1ANBA 1CT4E 1DWBH 3F68H 1K9OE 1C5VA 4F49A 2Y80A 3R0FA 3F9FA 5CHAB 5EU8A 4Y79A 1NZQH 1Y3YA 1V2RT 2HNTC 1GBLA 3RMMH 4IS5A 4X1SU 2SGPE 1IAUA 2EA3A 2VU8E 4WXVA 7GCHG 1N1LA 2H5DA 3DA9B 2F9UA 3M37A 3RXUA 4X8SH 5GCHF 1H8DH 4RN6A 1KXEA 1XUIA 1G3DA 1EUFA 4E06H 2VB0A 4ZMAH 3L6PA 1HAHH 1VR1H 1LHFH 1TBQH 3E90B 2ZTZA 1PQAA 3LH3A 5CE1A 1BHXF 1MKXH 1AN1E 3Q76A 1NESE 5EGMA 1V6DA 4X1RU 1MQ6A 2GTBA 2Z9LA 3SJ8A 4ZXXH 1O2VA 1UJ1A 2I6QA 1C2FA 4TY6A 1GI6A 2BDCA 2CJIA 1MKXK 4BNRA 1GI2A 3MTYA 2BLVA 5GJ4B 3ZZ4A 1HCGA 1QA7A 1DXWA 3SGBE 3UWJH 3D62A 5T6DA 5EW2H 1OXGA 2AERH 4IGDA 1WQVH 2A4OA 3UPEA 1ZTLA 1PQ5A 4ISLA 2WV4A 2EC9H 1C5RA 1YPGH 1TPOA 1RIWB 5C3NA 1TNIA 3EA9A 3IWMA 5C20A 1ZHMA 2EEKA 5L2ZH 4X2VA 3QGNB 1O2IA 4YOGA 2UWLA 1P57B 3SU2A 4WMEA 3ITIA 1NRNH 3LIWA 5AFZH 2STBE 1EOLA 4TWYA 2CMYA 4JZDH 5DPAA 2BB4A 2TGAA 3MMGA 4AB9A 2F9OA 2RDLA 1BCUH 1C1WH 1HUTH 2TGTA 4I8JA 2BXTH 3QO6A 1Z1IA 2FYQA 3LGIA 4CRAA 1QY6A 3O8RA 1QJ6B 2XC0A 1O5GH 5EQQA 1GI0A 3BTKE 1CVWH 3SJOA 1L1JA 1GCDA 2V0BA 2AH4X 1NRPH 3SNCA 1ELAA 2IN2A 1ARCA 3ZVCA 1OYTH 1TYNA 3BEUA 1RRKA 1OYQA 1C1SA 4INKA 1AVXA 1ZYOA 3SV9A 5K0HA 2SGDE 1W11U