3LGUA

Y162a mutant of the degs-deltapdz protease
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
191
Chain Sequence
STDETPASYNLAVRRAAPAVVNVYNRGLLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATGGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSPEGIGFAIPFQLATKIMDKLIRDGRVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 42
structure length 191
sequence length 217
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lguA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lguA02
7KMEH 3QDZB 1H4WA 1GDUA 2FODA 2F9PA 3OY6U 3RXTA 3SI4H 1C4U2 4YO9A 2XTTB 3NKKA 4Y76A 4DT7B 2YNAA 1C1PA 3RU4E 2ZU5A 4FVBA 1BHXF 1DFPA 1ZZZA 3ZVDA 3MNXA 5A0BA 3BIUH 3MU8A 1SFIA 2FXRA 4WVPE 4MNXA 3EGKH 1SC8U 1J15A 1QRZA 1FI8A 3LGIA 2ZGBH 1G3CA 3MU5A 3RXDA 2PKAA 5JB8S 1ESBA 3T62A 1E38B 1PQAA 5HMAA 2J95A 4AORA 4HGCA 1HJ8A 1UCYK 1T8LA 1D4PB 2OCVB 1V6DA 5TCAA 1INCA 1YCPK 1TPSA 1QY6A 3SU3A 1XKBC 1O3KA 4ZKRU 4I8HA 1KXCA 7GCHF 3D23A 5C1XA 2TGAA 4Y79A 3SV2H 1GJDB 1THSH 4OS1A 2ZHDA 3T27A 1T8NA 4UFDH 2VB0A 1EAXA 1Z1JA 2J94A 4FUJA 2CN0H 1O2XA 1FN6A 1O5FH 1DUEA 1O2OA 1IQKA 3EAJA 2BHGA 3SJKA 1EZUC 4VGCB 4YT7H 1AVXA 1O2WA 1W14U 1ID5H 4CRDA 5ESTE 1SG8B 4ISOA 1QBOA 2XC0A 1O0DH 2V3OH 1G2MA 3A7VA 1GWAA 1L1NA 2ZDKA 2BY8X 1FZZA 2H9EH 3LPRA 1PYTD 1C5SA 1GJ6A 4AZ2B 1AIXH 2ZG0H 3P95A 1C5OH 1ZGVA 1ZPZA 3PYHA 3MOCA 2K1QA 1QB9A 1VCWA 3I78A 2BVXH 4CRAA 1KLIH 2VH0A 1FN8A 2ZCKP 2P93A 1GI5A 3UNSA 3TJVA 2G00A 5FPSA 1XKAC 1PYTC 4X6OA 5EXNA 1OP0A 2ZHEH 4XSKU 2B5TB 3HKJB 3PWBA 3SU4A 2FOHA 2BB4A 2WPMS 1OP8A 3U8TH 1T32A 4Z6AH 3LKWA 1W7GH 1JWTA 1F5RA 1TMTH 1YPKH 4HZHA 3F9HA 4ZXYH 1B7XB 2AIQA 4E05H 1C2HA 3A8CA 5EW1H 4NWLA 2EC9H 3FVFB 3QO6A 5LPFA 1C2GA 1C5PA 3SHCH 1LKAA 3A7TA 1DOJA 1P9UA 5EW2H 1G2LA 3ATMA 2Y80A 2C8YB 2P94A 2ANKH 1SLUB 1WTGH 1Q31A 1B0EA 1UTLM 3KHVA 5EQRA 2XBVA 2C8WB 3OX7U 1BRBE 1XUIA 1HGTH 2FWWA 3GCTF 3RXMA 1Q2WA 4Y11E 3FAOA 5C20A 1CBWC 1BQYA 1BHXB 1AGJA 3O8DA 1AU8A 1Y5BT 1PFXC 1UTQA 1TBRH 4ZMAH 2Z3EA 3TGIE 5E0HA 1GJ8B 1N6XA 5CMXH 1UJ1A 4M7GA 4Y0ZE 1LHCH 3NZIA 3FZDA 1DM4B 1UTNA 1RJXB 1HAIH 2FOMB 3DD2H 1V2JT 4Q7ZA 4Y0YE 1ELVA 3ZVBA 1WUNH 1C1OA 2QIQA 1GGDB 1KXEA 1QR3E 3F9GA 3RM2H 1XUFA 1TAWA 1O3AA 4DIIH 3M3SA 1UVSH 2GT7A 5FX5A 1GCTB 1J8AA 1QRXA 3UWIA 4ABFA 2P3FH 3UFAA 3B9FH 1Y3UA 1ARCA 3SNDA 1YGCH 3VFEA 3VGCB 1IHSH 1H9LB 2ZNKH 3IWMA 1XVMA 1O32A 1GMHG 2PWXA 1SGQE 1GMDG 3BN9A 1TIOA 1JIMA 2ZDNA 1BBRE 1OX1A 3LDXH 4RKJB 1GJBB 3KIDU 1MKWH 2TGTA 1OWHA 2BLVA 3LU9B 1WU1A 4ZKNU 3SU0A 1C5TA 1LVYA 1SVPA 3KCGH 2BQ6B 5DKMA 2ZGCA 3TK6A 1ZPBA 2BY7X 2ZF0H 4FXGH 2CGAA 7LPRA 1ELBA 1G36A 1LHFH 1BOQA 2BM2A 5EQSA 1DXWA 2PW8H 1DY9A 4FUHA 1N6YA 3SW2B 1Z1IA 1EATA 3TVJB 3M3VA 1NN6A 4WH8A 1EB1H 2VH6A 1EX3A 3T29A 1C5NH 3Q3XA 1CA0C 1C4Y2 1HAOH 3MU4A 4GVUA 3A7YA 2A4GA 3STIA 2BQWB 5FXLA 4AFSA 5DP9A 3SUDA 2G81E 2TBSA 4XE4A 2FX6A 1FJSA 1K28D 1UHBA 2EI6A 1IOEA 1NRNH 4CHAB 3AAUA 2BVRH 2BMGB 5DP5A 1ZMNA 3GDVA 4TWYA 5JDUB 3Q77A 1OSSA 1Z8IB 5JBAS 1YP9A 1GHAF 5EU8A 8GCHF 1C5ZB 1O5CB 2UUFB 1XM1A 4K8YA 3QX5H 1WQSA 2A31A 3L6PA 4NGAH 4HI3A 1FY5A 5C1YA 3VPKA 1MZAA 1O2IA 2ZTZA 4TYDA 2Q1JA 2Y81A 1ZSJA 4GAWA 2CHAC 2PKAB 3AAVA 4MPUA 1B0FA 1GBFA 1RIWB 1A61H 4D9QA 4I7YH 3OTJE 1PQ8A 1MTUA 1TLDA 2FOEA 4BNRA 2STAE 1HPGA 3RXAA 3ATLA 2GCTB 3A81A 3F68H 1MKXH 4MTBA 4HTCH 1C1VH 2W26A 4CRGA 3SZNA 1OWEA 5EODA 1HBTH 4KELA 1W12U 5TCCA 1HAVA 1T31A 2C8XB 1E36B 1GBMA 1DWCH 3WY8A 1YKTA 4NIXA 3GY6A 1GHBG 3RLWH 1GL0E 1ABJH 1TA2A 1GHWH 3VB3A 3P92A 3SV9A 1ESTA 4A6LA 3ZVEA 5TJXA 2ZDVH 3RMMH 1W10U 1BMMH 2ZDAH 3A83A 1EPTC 1FMGA 2HPPH 1HAXB 3E6PH 2BTCE 3BG4C 4UD9H 4TPIZ 4GLYA 4Y10E 4CH2B 4CH8B 4Z0KA 5T6DA 1K1JA 2VVVA 5GXPA 3TK9A 1N1LA 2VWNA 2BDCA 5E8EH 3NCLA 4NA9H 3RP2A 1BIOA 5DP3A 2QXHA 1CGJE 1SI5H 2PTNA 1GL1A 4IN2A 3PLBA 1QL7A 2WV5A 3TNSA 2F91A 4D8NA 4K1EA 1CT4E 2PGBB 4YOGA 5HYOA 2GT8A 1NRSH 2R2MB 3S9CA 2ZDLA 1C5WB 1MU8B 1V3XA 1GBBA 1O3HA 3R0FA 2FZZA 2ZPRA 5FHTA 1JBUH 5A0CA 1GPZA 2QYIA 3M7UA 1MUEB 1WBGB 2BX3A 2G51A 1ELDE 1MBMA 3RMOH 3BSQA 2BXUH 3ZZAA 1V2VT 5C2ZA 3P8GA 2PUXB 1W2KH 3SN8A 4FUIA 1O2SA 1BMAA 2OC0A 4UFGH 4AFQA 4INHA 3RXFA 5I25A 3RXRA 4WMFA 2ZQ1A 4HFPB 3GDUA 1O38A 2GZ7A 2WPLS 1K1MA 1YYY1 3A80A 1QA0A 1CT2E 2P16A 4IMZA 2ODPA 1UK3A 2A2QH 1IAUA 2EI8A 2A1DB 1DE7H 4Y7AA 1QIXB 3UIRA 1ZJKA 2SNWA 1GBEA 2H9HA 1RGQA 4ASHA 3S7HB 1P11E 1TPAE 4Y8YA 2WUBA 1VCPA 2FI3E 2XYAA 7ESTE 5F8ZA 3U9AH 4I8KA 3ZVGA 4DG4A 1AN1E 2WPIS 1SOTA 5J4QA 2BOHB 1YPJH 3UOPA 2ZWLH 1DVAH 3BG8A 3PO1C 4CRFA 2NU3E 1D6RA 1C5QA 1O2JA 1EJAA 3FANA 5FCRA 1LQEA 2XW9A 2GCHF 1TNIA 1Z7KA 3EA7A 2VIVA 3A87A 4IC6A 3LGWA 5CE1A 1NO9H 1QQUA 1O2MA 4IN1A 3RU4D 1P2OA 2ZFPH 4K8BA 2AMPA 2P95A 1C5MD 1C5UA 2C3SA 2BD7A 1TRNA 4ZXXH 1H9HE 3I29A 4GHQA 1K1OA 2B8OH 2J38A 2ZU1A 4DY7B 4FVDA 3K9XB 5BPEA 3GY4A 1FAXA 3T28A 1MTNB 2OXSA 2OBOA 1XXFA 1JRSA 4XDEA 1SR5C 1HFDA 5F03A 4BOHA 3FZZA 3C27B 4NA7A 3SBKA 1HAZB 4FU7A 1OXGA 3MH5A 1C5LH 2ZU3A 1O37A 1KXFA 4DCDA 2AIPA 5EG4A 1HJAB 4NWKA 1FLEE 2D1JA 3V3MA 2O8TA 2DUCA 1ZTKA 1YC0A 4FUGA 3SHAH 1NU9A 3RXCA 1GHYH 1N8OC 2FMJA 3SNBA 3MH6A 1MTSA 2R0KA 4K5ZA 2WYGA 3BTDE 1UVUH 2ZO3H 3I77A 3QLPH 1V2LT 5FX6A 2XBXA 1HUTH 1SGRE 5A09A 1PPFE 3SU6A 1BTWA 3RC5A 1BTPA 4ABDA 3DT0H 4BTIB 4NZLA 2BDGA 3HKIB 1TA6A 2G4UA 3BF6H 1KXDA 1MTVA 3GISB 1C2FA 2HOBA 1P09A 3TITA 3AW0A 3T26A 1UHBB 2O9QA 4R0IA 5HM9A 1X7AC 2QAAA 1UK2A 1H1BA 2WUCA 3CP7A 8KME2 2FLRH 2IN2A 1MD7A 1SQAA 5EGMA 2PR3A 1QB6A 4D7GA 1AMHA 1SBWA 3BTHE 1ZLRA 1GHZA 1GBAA 4FUEA 4SGBE 6GCHF 2F9UA 2BLWA 2A4OA 4UEHH 4MPXA 4JZDH 4U30A 1FPCH 2QGRA 5F8XA 1F5KU 2ESTE 4INKA 1ELGA 4K2YA 4YLQH 1VITH 1O2TA 1C2MA 1DITH 1DY8A 3SU2A 3E91A 3EA8A 4AGJA 3ITIA 1OS8A 3GY7A 2QXJA 1FDPA 4X2WA 1K1NA 3GOVB 1PPCE 3S0NA 2ODQA 3A7ZA 3ZZ9A 3O8RA 2HGTH 2Q6DA 2ZGHA 3MNBA 3CS0A 4GHTA 3RXVA 3BEIB 3UR9A 5EXMA 3FP7E 4CBNA 1HAVB 1GJAB 1SOZA 1OWJA 3UY9A 4QT8C 1E35B 2C93B 4BXWA 1YLCA 1FIWA 2ZC9H 4RSPA 2IJOB 2ZU4A 1V2UT 4MPWA 1IQGA 4NIYA 1V2PT 1YPHC 5B6OA 2J2UA 3TJNA 3RMLH 2BDHA 1EJNA 2C4FH 4J1YA 4JZ1A 1ANCA 1Z8GA 2JKHA 1Z6JH 3HPTB 3SJ9A 2BY6X 5DP7A 1TBQH 2XXLA 1NZQH 1GI0A 2OQUA 2Y7XA 3DHKH 1O2RA 3HGNA 3BTTE 4U01A 1O35A 6ESTA 2QA9E 4NIWA 1F5LA 3E0PB 5C1UA 7GCHG 1F2SE 1ESAA 2GMTC 1GI4A 2OP9A 4ABGA 1SGCA 4ISIH 2BZAA 1GBJA 3DFLA 3ZZ6A 3VXFH 1TNHA 2BD3A 1HCGA 1EPTA 2DE8A 2WPJS 1MCTA 3RXOA 2HNTC 3KQCA 1KXAA 1KSNA 2BD4A 3M5NA 2A7CA 1BJUA 4A7IB 4Y71A 1V2NT 4LZ4B 1C2KA 2XCNA 3SJ8A 1Y3WA 4ISLA 4O9VA 1RRKA 2AGGX 4UDWH 3ESTA 1MMJN 1OOKB 4E7NA 2JH5D 1Y5AT 2BVSH 2ANYA 1D3DB 3E16B 2R9PA 2FOBA 4X2XA 4ZKSU 3CENA 1G3DA 1SGTA 1P2MA 3GCNA 3MNSA 1AE5A 1V2QT 3SORA 4FUCA 1UTPA 1TABE 1TONA 2H6MA 2CJIA 5EXLA 2FOAA 2Z3DA 1EZQA 3BEFB 4B75A 1ZTJA 2NU4E 2CXVA 4R8TB 4I8JA 3UQVA 1ZR0A 2HRVA 1O2NA 1L1JA 3F1SB 1VITG 3PTNA 1SLXB 4H4FA 1O2LA 2GVFA 1DSTA 3BTME 3GY3A 4NZQA 1BMLA 4NFFA 1YPHE 1MU6B 1TBZH 1ZHPA 2W5EA 1FV9A 3SUGA 2VVCA 1QJ1B 2OC1A 3PM3A 3RDZA 1IQMA 4X6PA 2V6NA 1YF4A 5IYTA 1UTKA 3A86A 4A1VA 5DG6A 3KQEA 3RXJA 4BAMB 4NCYA 1BMNH 1YPGH 4YESB 1MAXA 2AGIX 1XX9A 2VJ1A 1S83A 4FUDA 3SJOA 2ASUB 2NU0E 1B5GH 1AZ8A 6CHAC 3H7TA 2XC4A 2ZPQA 3V13A 1A5GH 1CHOF 1AUTC 2P3TB 1MTWA 1A7SA 1CE5A 3ZZ4A 4FU9A 2ZHWH 2TGDA 3GCTG 3SGAE 4BTTB 2Z6BD 4XBDA 1OWKA 1S84A 5L2YH 2NU1E 2HNTE 2BZ6H 1EASA 3UQOA 1GVLA 2JETC 2JH0D 4K3JA 1NESE 4B71A 2Y5HA 2THFB 1H8DH 3LOXA 3TJUA 1ELTA 3UNQA 1JMOH 5LPEA 3L33A 1P57B 1EOLA 1EOJA 1FIZA 3RXEA 4X0WU 1NRRH 4JYTA 1NC6A 1D9IA 4H6TA 1EB2A 3C1KA 1UVPA 4K60A 4H6SB 4ZAEA 2FYQA 3D49H 1GBKA 1EKBB 1E0FD 4MNWA 1UO6A 1O3CA 1YPLH 1Z8JB 3GY2A 1FPHH 2FLBH 4X6MA 3QTOH 4K1TA 4WJG2 1P06A 2OC8A 3ZZ8A 1C1RA 1ZYOA 5A2MH 3OU0A 2QXIA 2Z9KA 4ABJA 2SGEE 1ZGIA 1O2KA 2A32A 1A4WH 3ATKA 2BOKA 1O3OA 4DVAU 1AB9C 1RXPA 5JPMH 2VVUA 3NXPA 3URDA 1LO6A 5JYIA 3LH3A 1VJAU 3NUMA 1O3DA 1TQ7B 3TH3H 2NWNA 4MDSA 3MWIU 3S7KB 4X2YA 1THRH 4ABHA 2C90B 2FX4A 3TK5A 1C2EA 1ZMLA 1O3LA 1TOMH 5L30H 1PPEE 4U2WA 4PROA 1PPZA 5LPRA 1O5DH 1L1GA 3LJJA 3EQ0H 3BTKE 3U1IB 2FOCA 1P0SH 2UWLA 4LOYH 1AWFH 2FI5E 4XBBA 1CA0B 2VWLA 1GMHF 2M5TA 5ESBA 1Y3VA 1RTFB 4OS5A 1A0JA 4FUFA 3T5FH 1K1LA 1P2QA 1P2IA 3LT3A 1O2ZA 1W8BH 3KNXA 1NROH 1OWIA 1VCQA 1GG6C 3RXQA 3E90B 3Q3YA 1CT0E 4A5TS 1OYQA 1NT1A 1KDQA 1M9UA 2PKSC 1SGFG 3A89A 2SGQE 2XRCA 3LH1A 1AHTH 2VIWA 8GCHG 2Z94A 4XBCA 2ZI2H 1KY9A 5A8ZA 4ESTE 4JYVH 2IOTA 3EDXB 2QF3A 2CHAB 3NPSA 5JB9S 2W7UA 4AB9A 1P05A 1CGHA 2FTLE 2ZZUH 3MHWU 3TIUA 1FONA 1MKWK 1NFXA 3PMAB 4B2BA 2SNVA 1D6WA 1XUHA 1L0ZA 3ATWA 4THNH 2BDBA 2H2ZA 2R3YA 1THPB 3M36A 2FYRA 2VWMA 3F6UH 3QZRA 1CGIE 1EZSC 5GJ4B 3S9AA 2IPHA 3E3TA 1BRAA 4AG1A 1AY6H 3GCHC 5ABWA 3PMHB 2AFQB 1UK4A 4I32A 2A0QB 3IITA 1QQ4A 4IBLH 4Y8XA 1CO7E 5JBBS 1ETSH 3SV7A 2CMYA 1AUJA 1NM6A 4X8SH 3GYMA 1Y8TA 1LDTT 5DJ7A 1YLDA 4BTUB 5AF9H 4CRCA 2P8OC 1BT7A 2BD9A 5C5NA 3DA9B 2ALPA 4ZHAA 1C1SA 4BAKB 3AASA 1EPTB 2A7JA 3PB1E 3BG4B 3PLKA 1P2KA 4U32A 3SOSA 2A4RA 2GV6A 1D3PB 5LGOA 2Y5GA 3PTBA 1C2DA 1QCPA 2ANWA 4AYYB 1YBWA 5CHAC 3UUZA 4NSVA 4YOIA 4FUBA 3ZZ5A 4CR9A 1GBCA 4O3TA 3Q3KA 1VR1H 1TQ0B 4AB8A 5E2OA 1S0QA 3MH4A 1GHBF 4KKDA 1A3EH 2FOGA 1ABIH 1FAKH 2QF0A 3P6ZB 4IW4E 1TPPA 2OQ5A 3ZV8A 2V3HH 4DGJA 2BLQA 1GJ4H 5GCHF 1Z8RA 2F9BH 1MQ5A 5AVDA 2Z9GA 4X2VA 1BA8B 3LC3A 3LGUA 1C1TA 1A46H 1AD8H 1YM0A 1MKXK 1BTHH 1VZQH 1QHRB 3TGKE 4NSYA 2EA3A 2G4TA 3M37A 1HLTH 3RXSA 3ZZ7A 1J16A 4X1QU 1DLEA 2B9LA 1O3GA 1SPJA 4TY7A 1A2CH 2G5NA 1C5YB 1P12E 2Q6FA 2GZ8A 1GI9B 1BTXA 1E34B 4MPVA 4MNVA 1O31A 4JZIA 2FS9A 3RXKA 3W95A 1OP2A 3O8BA 2QC2A 1T7CA 2VU8E 4AFZA 4YLUA 4ABIA 1GI2A 1DUAA 2BDIA 2ZP0H 1O39A 1MZDA 1S6HA 1FY4A 1T4UH 1AFEH 3KQDA 5L2ZH 2GX4A 3JZ2B 1ZRBA 2ZPSA 1QJ6B 1JRTA 2ZU2A 3QUMP 2GP9B 2F9OA 2I6SA 3A88A 4DURA 1KXBA 3UOUA 5J4SA 3PO1B 3LGTA 2FPZA 1QNJA 3U8RH 1GBDA 2PLXA 5T3HA 8ESTE 1C5VA 1IQLA 5G4BA 3ZZDA 2ILNA 2GCHG 1BITA 1G30B 3TH4H 4ABEA 2AMDA 9ESTA 3SQHE 5FBIA 4ZHLU 2FEQH 4UFEH 4X1SU 1ELAA 1AVGH 3EE0B 2WPHS 1O3IA 1EP5A 5A8XA 1P9SA 3BTEE 5DO4H 4X8VH 1TX8A 2ZHQH 1FQ3A 3VB4A 1EZXC 4WY3A 2TPIZ 2HNTF 1QA7A 2G55A 2UUJB 2F3CE 5K7RA 4X6NA 1AVWA 2WINI 1VGCC 4JCNA 1N8OB 2VNTA 4MQAA 1JOUB 1PPGE 1SGDE 3DFJA 3M5OA 3TJOA 1O3BA 5DK1A 4RKOB 4YM9A 5EPYA 2D26C 1LCYA 4JZEH 1BCUH 1F7ZA 1GMCF 4B74A 3ZYDA 3P8OA 1KLTA 1PJPA 4Y6DA 3A8AA 3A84A 1TPOA 3V7TA 2QN5T 1SMFE 2ZFSA 1AE8H 1DPOA 2FESH 3NK8A 1W11U 3RXLA 3UPEA 2PGQB 1O3JA 3UTUH 2SGPE 1HDTH 4B73A 3PROA 3V0XA 3HK6B 3SU1A 5HGGA 3MI4A 1CA8B 2Z7FE 1RS0A 2QXGA 4JZFH 3O8CA 1P2JA 1ORFA 1V2RT 1GHVH 1DANH 1LPGB 4ABBA 4LK4A 4ZKOU 2AYWA 1O3NA 1C1MA 1O2YA 1AFQC 3MO9A 1A5IA 4O03A 1O5EH 4GCHF 1GJ7B 1LPKB 6GCHG 3ZZBA 1ZJDA 2BDYA 1AZZA 1P3CA 3D62A 2PTCE 1YCPM 1O34A 3D65E 3LGVA 2TGPZ 4YZUA 2V0BA 3KGPA 2ZDMA 1KYNA 3KL6A 1LKBA 1Q3XA 2AEIH 2Y5FA 4I8GA 4DOQA 4ZUHA 2VGCC 4OGYA 3GY5A 2OTVA 2BX4A 1XMNB 3G01A 1PPBH 1NU7B 2XWBI 2Y6TA 1LHDH 3TPIZ 1XUJA 2FP7B 3RXUA 1TWXB 5F8TA 2OBQA 3RUOA 3VB5A 1UCYH 1P03A 1T4VH 2ALVA 2A5IA 1C2LA 4Y7BA 3SUFA 2BY5X 2XBWA 1O3EA 4SGAE 1F0TA 1SB1H 1C2IA 6LPRA 1IQHA 5A0AE 1DWEH 1P01A 2PV9B 2A5KA 4KGAA 1BRUP 1UVTH 4XFQA 5JBCS 1SHYA 1O33A 3Q76A 2ZA5A 2FDAA 1EQ9A 3E1XB 1FY3A 1O2QA 4YTAA 1PQ7A 1LHGH 1QB1A 4OS2A 2P3UB 4ISNA 3JZ1B 3ZZCA 1ACBE 3M7QA 1DX5M 2GMTB 3NWUA 1AI8H 4OGXA 5C67A 5GDSH 1GBLA 2ZQ2A 1ELEE 1TGNA 1DLKB 1O2PA 2BLOA 4YOJA 5ETXA 3QZQA 4Q2KA 3H5CB 1P04A 3PV4A 3TH2H 5A8YA 3HK3B 2BD5A 3GCOA 1O3MA 3MMGA 1OYTH 3Q00A 4AN7A 1WQVH 1W7XH 5FBEA 3M5LA 1A1RA 1G3EA 3PLPA 1GVKB 4I31A 1ZMJA 1PQ5A 2Y82A 1EUFA 1CU1A 3LONA 1SLVB 3PWCA 1O5AB 1DXPA 1NRQH 1UTMA 3RXBA 2RDLA 1DDJA 1C4V2 2H9TH 3TLOA 1V2OT 2WYJA 2G52A 4E06H 3RXPA 3K2UA 2GDEH 1T8MA 4E7RG 1NFWA 1DT2A 4DW2U 2RCEA 1QRWA 3VEQB 3UNRA 1UMAH 3B8JA 1YPEH 1EAUA 2HALA 1MBQA 1A3BH 1RTLA 2Z9IA 5HM2A 5DP8A 3SNAA 1IHTH 2JH6D 4H42U 1C1QA 4VGCC 4WMDA 4X8UH 1P3EA 4OS6A 2F9VA 2STBE 2RA3A 3QWCH 1C9PA 1AKSA 5GIBA 4ZH8A 1LQDB 1ZHRA 2CF9H 2HPQH 2BY9X 3SO3A 2HVXA 5AFYH 1HRTH 2KAIA 2J9NA 1LTOA 1D3TB 2ZFTA 1TNKA 5LH8A 4NA8A 4DJZB 1F0UA 3MO6A 4F49A 3E0NB 1TNLA 1G37A 1ARBA 2FTMA 2H5CA 3E8LA 6CHAB 1VITF 4KTCA 1Z71A 3A8DA 4FU8A 8LPRA 1QGFA 2W3KA 1CVWH 1FY8E 4IMQA 1CHOG 1DSUA 2H5DA 3MFJA 1CHGA 1EJMA 3R3GB 1GJ5H 4INLA 3RXHA 3ZVAA 1HV7A 1MH0A 1ANEA 1CBWB 2JETB 4OS7A 1LMWB 2FIRH 4JK5A 2ZGJA 1GI8B 1FUJA 5EQQA 2J4IA 2VIQA 3SV6A 1UVOA 3EA9A 1GCDA 3PMJA 3MU1A 3VXEH 1CSOE 1O2HA 4B2CA 2W7SA 4WWYA 4B2AA 1LVBA 4A1XA 2D2DA 4B76A 2PSYA 2ANMH 1UTOA 2A5AA 5FCKA 5C3NA 1IQJA 4X8TH 1ZOMA 1SGFA 3A7XA 1TRMA 2RG3A 3A85A 4J2YB 3U69H 1V2KT 1SL3A 1JIRA 1Y5UT 3OY5U 1AB9B 1GI6A 4IC5A 1VJ9U 1O2UA 3DUXH 1SGYE 3BTWE 2O8UA 4UFFH 3RC4A 3ODFA 1K9OE 3VB7A 2EI7A 3S69A 2AGEX 1A5HA 3V12A 3STJA 3TNTA 4O3UA 2J92A 3MYWA 3ZVCA 1HIAA 1MD8A 5H4IB 4AG2A 2ZFQH 5DP4A 1HAGE 3ZZ3A 4D7FA 1EAIA 1ANDA 3SUEA 1K1PA 4B1TA 1H9IE 1Y3YA 1J17T 1GGDC 1C5XB 2OD3B 4MLFB 4WF8A 2YNBA 3ZYEA 5F6MA 1F0SA 3F9FA 1WYKA 2FOFA 2ZGXH 3LJOA 4KP0A 4BAOB 5L6NH 2O8LA 3BEUA 4Y8ZA 1IQIA 2TIOA 9LPRA 1GCTC 3GY8A 4IS5A 3KEEA 1GI1A 2XBYA 3A82A 4WXVA 2UUYA 2R0LA 4MVNA 1GMDF 3BTQE 5C5OA 2ZCHP 1QTFA 4NG9H 2RA0A 5E2PA 3VGCC 1GBHA 1WV7H 3SJIA 2ZEBA 1QJ7B 3S9BA 1GG6B 1S6FA 5AFZH 2VINA 5T6GA 1XUGA 4AFUA 4TPYA 5K0HA 3RXGA 2PKSB 1ELFA 3ODDA 3HGPA 4GUXA 3PMBB 1K22H 1EAWA 4UONA 2LPRA 1FXYA 1GJCB 2HLCA 1GDQA 1GHAG 3ZV9A 2AH4X 1HAPH 1L4DA 2O8MA 3RM0H 5I46H 1LVMA 3UR6A 3MTYA 1ANBA 1KIGH 5E0GA 1SGNE 2ZCLP 2XC5A 4LXBH 4WMEA 5BRRE 2UUKB 3GCHB 3BTGE 2QCYA 1K21H 4ISHH 1DWBH 1XUKA 2A4QA 5PTPA 2OC7A 4A1TA 3L3TA 1V2MT 4CHAC 3U8OH 4A92A 4DIHH 4CBOA 4F4OC 4WH6A 1W0YH 1TRYA 1KTSB 1TGBA 2P8OB 1O36A 1BTZA 4YT6H 1NPMA 2PHBA 3TU7H 4WXIA 1GVZA 1MAYA 1C2JA 1P2NA 2ZTYA 3URCA 3QGNB 2Y7ZA 3FFGA 4NIVA 3U98H 4KTSA 2BD2A 1O5GH 1HB0B 4X1PU 1RIWC 3W94A 4CREA 1NS3A 4TWWA 5CHAB 1XVOA 2BXTH 1V2TT 4X1RU 3SV8A 1WOFA 1GBIA 2H1UA 1C1UH 3QK1A 2UWOA 2ODYB 1O3PB 1BUIA 1G3BA 4D9RA 2GCTC 4JK6A 1J9CH 1SHHB 2R3UA 1C9TA 2A2XH 1V2ST 1G9IE 5JBTA 4XOJA 1RFNA 1GHXH 4O97A 3ATIA 2CF8H 2FS8A 1KTTB 1MCVA 1TX7A 2SGAA 1NFUA 2J34A 3HATH 5GCHG 1S82A 1TX6A 4AYVB 3M3TA 1D3QB 2TRMA 4BXSA 4ZHMU 1A0LA 1ZTLA 3ENSB 1SSXA 4ZROA 1TE0A 5AHGH 1Y3XA 4D76A 1HXFH 2BD8A 1S0RA 4KTUA 1SFQB 3KN2A 1AKSB 2FO9A 1C1WH 3P8NA 3A7WA 1TGSZ 3A8BA 1GBTA 2Z9LA 2PSXA 2VIPA 2OLGA 3T25A 1TGTA 1BBRH 2KAIB 1P10A 2D8WA 3OSYA 3M5MA 2VIOA 3B23B 1BRCE 3SGQE 3MU0A 1S5SA 2QY0B 1W13U 3QGJA 2R2WU 1GJ9B 2GV7A 2BQ7B 3FP8E 3M35A 3TGJE 4X1NU 2Q6GA 1BB0B 1AQ7A 2YOLA 3GICB 1SGIB 1GDNA 3T2NA 2Z9JA 3GDSA 1MQ6A 1NFYA 2W3IA 1GI7B 2SGDE 1ZSLA 2A45B 5FPYA 1P02A 1O5BB 1BTYA 5DGJA 4MG3A 1UCYE 1Z6EA 1TYNA 2BDAA 5FAHA 1BDAA 3F9EA 1WAYB 2GGVB 1ETTH 4Q80A 3UREA 1LHEH 1E37B 1LVOA 1DWDH 2WV4A 3UWJH 4Q7XA 1ZHMA 1L2EA 3M7TA 3RU4T 3ZVFA 3QN7A 4K1SA 2SFAA 5HXFA 1J14A 4IGDA 1GI3A 1TFXA 2PFEA 2GD4B 2WPKS 3M61U 1OKXA 1QBNA 2GKVE 1BBRK 1IQNA 1TMUH 2ZECA 1WCZA 4CRBA 2P59A 1K2I1 3RLYH 1O3FA 3BIVH 3N7OA 3RXIA 2EEKA 5GPIB 1HJ9A 1CQQA 1LPZB 1SGPE 1DS2E 2XCFA 1F92A 1FY1A 2SGFE 1W0ZU 1XXDA 1S85A 3K65B 4Q7YA 2FM2A 3MO3A 1VGCB 4OS4A 3P70B 4MNYA 4RN6A 1HXEH 2I6QA 2ZHFH 2HWLB 1BZXE 2ZFFH 5DP6A 1BJVA 2G5VA 4JMYA 1ZPCA 2O8WA 1HIAB 1P8VC 1DICA 1TNJA 4GSOA 3RC6A 1A0HB 1IQFA 1V2WT 3SGBE 2GZ9A 2QV1A 2V35A 4LZ1H 1H8IH 3IG6B 2F83A 1HAHH 3BV9B 4I8LA 5SGAE 4CR5A 4BAHB 3CS7A 4BAQB 4K69A 1GMCG 3K6ZA 3KF2A 1MTNC 4TY6A 4JYUH 3P8FA 5E0JA 3MNCA 1O2VA 2ZTXA 5IDKA 3GYLB 5DPAA 2AS9A 1FNIA 1SQTA 1C1NA 3LGYA 4UE7H 3EYDA 1SQOA 3LC5A 3QTVH 1JXPA 2C8ZB 1UTJA 1WSSH 3BTFE 1HAYB 1HJAC 2GDDA 4AGKA 1HNEE 3LIWA 3VB6A 1T8OA 3AVZA 4AX9H 5GWZA 2LNCA 1TB6H 2NU2E 1YPMH 2VIDA 1AFQB 5T6FA 3OYPA 1AWHB 2GTBA 3U1JB 5FPTA 1ZRKA 1RD3B 1NY22 3H7OA 1L4ZA 1ZSKA 1QFKH 3SNCA 3SU5A 2B0FA 1KDQB 5EPNA 1AO5A 1NRPH 3P17H 2CV3A 4GCHG 1QBVH 5EOKA 1TMBH 2BYAX 1OWDA 1WTHD 2UWPA 1U6QA 1KLJH 2VGCB 1BTUA 2OUAA 3SI3H 2DE9A 4GPGA 1O2GH 1TOCB 2PUQH 2ZKSA 1HYLA 2A7HA 4ABAA 1EP6A 1IQEA 1PPHE 3ELAH 1C5RA 2F9NA 1TALA 4AOQA 4NFEA 3KQBA 3K6YA 3RMNH 1SLWB 4BANB 1W3CA 3MH7A 2Z3CA 1O30A 1K1IA 1NTPA 3FP6E 1Y59T 2VWOA 2AERH 1YCPH 2B7DH 2FI4E 3SQEE 1RTKA 1EXFA 1S81A 1QL8A 2OINA 4I33A 1F0RA 2ZIQH 2ULLA 3AW1A 1ETRH 2G8TA 2XNIA 2XWAA 2ZFRH 3SNEA 1TGCA 1SGEE 1OPHB 1QURH 1ELCA 1TNGA 1QL9A 1G32B 2AMQA
chains in the Genus database with same CATH superfamily
1OHHD 7KMEH 2RFKC 3QDZB 1H4WA 1GDUA 2FODA 2F9PA 3OY6U 3RXTA 3SI4H 1C4U2 4YO9A 2KZ4A 2XTTB 3NKKA 4Y76A 4DT7B 2YNAA 1C1PA 3RU4E 2ZU5A 4FVBA 1BHXF 1DFPA 1ZZZA 3ZVDA 3OEED 3MNXA 5A0BA 3BIUH 3MU8A 1SFIA 2FXRA 4WVPE 4MNXA 3EGKH 1SC8U 3N99A 1J15A 1QRZA 1FI8A 3LGIA 2ZGBH 1G3CA 3MU5A 3RXDA 2PKAA 5JB8S 1ESBA 3T62A 1E38B 1PQAA 5HMAA 2J95A 4AORA 4HGCA 1HJ8A 1UCYK 1T8LA 1D4PB 2OCVB 1V6DA 5TCAA 1INCA 1YCPK 1TPSA 1QY6A 3SU3A 1XKBC 1O3KA 4ZKRU 4I8HA 1KXCA 7GCHF 3D23A 5C1XA 2TGAA 4Y79A 5FL7D 3SV2H 1GJDB 1THSH 5C0TA 4OS1A 2ZHDA 3T27A 1T8NA 4UFDH 2VB0A 1EAXA 1Z1JA 2J94A 4FUJA 4P00A 2CN0H 1O2XA 1FN6A 1O5FH 1DUEA 1O2OA 2HVYB 1IQKA 3EAJA 2BHGA 2M2AA 3SJKA 1EZUC 4VGCB 4YT7H 1AVXA 1O2WA 3FKSD 1W14U 1ID5H 4CRDA 5ESTE 1SG8B 4ISOA 1QBOA 2XC0A 1O0DH 2V3OH 1G2MA 3A7VA 1GWAA 1L1NA 5C17A 2ZDKA 2KCAA 2BY8X 1FZZA 2H9EH 3LPRA 1PYTD 1C5SA 1GJ6A 1S6LA 4AZ2B 1AIXH 2ZG0H 3P95A 1C5OH 1ZGVA 1ZPZA 3PYHA 3MOCA 2VBCA 2QF4A 2K1QA 1QB9A 1VCWA 3I78A 2BVXH 4CRAA 1KLIH 2VH0A 1FN8A 2ZCKP 4XD7D 2P93A 1SQRA 1GI5A 3UNSA 3TJVA 2G00A 5FPSA 3KYFA 1XKAC 1PYTC 4X6OA 5EXNA 3VG8A 1OP0A 2ZHEH 4XSKU 2B5TB 3HKJB 3PWBA 3SU4A 2FOHA 2BB4A 2WPMS 1OP8A 3U8TH 1T32A 4Z6AH 3LKWA 1W7GH 1JWTA 1F5RA 1TMTH 1YPKH 4HZHA 3F9HA 4ZXYH 1B7XB 2AIQA 4E05H 1C2HA 3A8CA 5EW1H 4NWLA 1BMFD 2EC9H 3FVFB 3QO6A 5LPFA 1C2GA 1C5PA 3SHCH 1LKAA 3A7TA 1DOJA 1P9UA 5EW2H 1G2LA 3ATMA 2Y80A 2C8YB 2P94A 2ANKH 1SLUB 1WTGH 1Q31A 1B0EA 3WWFA 1UTLM 3KHVA 5EQRA 2XBVA 2C8WB 3OX7U 1BRBE 1XUIA 1HGTH 3F0OA 2FWWA 3GCTF 3RXMA 1Q2WA 2V3MA 4Y11E 2QE7D 3FAOA 5C20A 1CBWC 1BQYA 1BHXB 1AGJA 3O8DA 1AU8A 1Y5BT 1PFXC 1UTQA 1TBRH 4ZMAH 2Z3EA 3TGIE 5E0HA 1GJ8B 1N6XA 5CMXH 1UJ1A 4M7GA 4Y0ZE 3KYGA 1LHCH 3NZIA 3FZDA 1DM4B 1UTNA 1RJXB 1HAIH 2FOMB 3DD2H 1V2JT 2KX4A 4Q7ZA 4Y0YE 1ELVA 3ZVBA 1WUNH 1C1OA 2QIQA 1GGDB 1KXEA 1QR3E 3F9GA 3RM2H 1XUFA 1TAWA 4B6FA 1O3AA 4DIIH 2EQNA 3M3SA 1UVSH 2GT7A 5FX5A 1GCTB 1J8AA 1QRXA 3UWIA 4ABFA 2P3FH 3UFAA 3B9FH 1Y3UA 1ARCA 3SNDA 1YGCH 3VFEA 3VGCB 1IHSH 1H9LB 2ZNKH 3IWMA 1XVMA 1O32A 1GMHG 2PWXA 1SGQE 1GMDG 3BN9A 1TIOA 1JIMA 2ZDNA 1BBRE 1OX1A 3LDXH 4RKJB 1GJBB 3KIDU 1MKWH 2TGTA 1OWHA 2BLVA 3LU9B 1WU1A 4ZKNU 3SU0A 1C5TA 1LVYA 1SVPA 3KCGH 2BQ6B 5DKMA 2K0QA 2ZGCA 3TK6A 1ZPBA 2BY7X 2ZF0H 4FXGH 2CGAA 7LPRA 1ELBA 1G36A 1LHFH 1BOQA 2BM2A 5CHBA 5EQSA 1DXWA 2PW8H 1DY9A 4FUHA 1N6YA 3SW2B 1Z1IA 1EATA 3TVJB 3M3VA 1NN6A 4WH8A 1EB1H 2HLDD 2VH6A 1EX3A 3T29A 1C5NH 3Q3XA 1CA0C 3ZIAD 1C4Y2 1HAOH 3MU4A 4GVUA 3A7YA 2A4GA 3STIA 2BQWB 5FXLA 4AFSA 5DP9A 3SUDA 2G81E 2TBSA 4XE4A 2FX6A 1FJSA 3PV2A 1K28D 1UHBA 2EI6A 1IOEA 1NRNH 4CHAB 3AAUA 2BVRH 2BMGB 5DP5A 1ZMNA 3GDVA 4TWYA 5JDUB 3Q77A 1OSSA 1Z8IB 5JBAS 1YP9A 1GHAF 5EU8A 8GCHF 1C5ZB 1O5CB 2UUFB 1XM1A 4K8YA 3QX5H 1WQSA 2A31A 3L6PA 4NGAH 4HI3A 1FY5A 5C1YA 3VPKA 1MZAA 1O2IA 2ZTZA 4TYDA 2Q1JA 2Y81A 1ZSJA 4GAWA 2CHAC 2PKAB 3AAVA 2WHXA 4MPUA 1B0FA 4ACAA 1GBFA 1RIWB 1A61H 2WZQA 4D9QA 4I7YH 3F3BA 3OTJE 1PQ8A 1MTUA 1TLDA 3PRDA 2FOEA 4BNRA 2STAE 1HPGA 3RXAA 3ATLA 2GCTB 3A81A 3F68H 1MKXH 4MTBA 4HTCH 1C1VH 2W26A 4CRGA 3SZNA 1OWEA 5EODA 1HBTH 4KELA 1W12U 5TCCA 1HAVA 5EJ1A 1T31A 2C8XB 1E36B 1GBMA 2GJGA 1DWCH 3WY8A 1YKTA 4NIXA 3GY6A 1GHBG 3RLWH 1GL0E 1ABJH 1TA2A 1GHWH 3VB3A 3P92A 3SV9A 1ESTA 4A6LA 3ZVEA 5TJXA 2ZDVH 3RMMH 1W10U 2WSSD 1BMMH 2ZDAH 3A83A 1EPTC 1FMGA 2HPPH 3FO8D 1HAXB 3E6PH 2BTCE 3BG4C 4UD9H 4TPIZ 4GLYA 4Y10E 4CH2B 4CH8B 4Z0KA 5T6DA 1K1JA 2JIZD 2VVVA 5GXPA 3TK9A 1N1LA 2VWNA 2BDCA 5E8EH 3NCLA 4NA9H 5EJLA 3RP2A 3NRLA 1BIOA 5DP3A 2QXHA 1CGJE 1SI5H 2PTNA 1GL1A 4IN2A 3PLBA 1QL7A 2WV5A 3TNSA 2F91A 4D8NA 4K1EA 1CT4E 2PGBB 3PRBA 4YOGA 5HYOA 2GT8A 1NRSH 2R2MB 3S9CA 3SYJA 2ZDLA 1C5WB 1MU8B 1V3XA 1GBBA 1O3HA 3R0FA 2FZZA 2ZPRA 5FHTA 1JBUH 5A0CA 1GPZA 2QYIA 3M7UA 1MUEB 1WBGB 2BX3A 4Q4LA 2G51A 1ELDE 1MBMA 3RMOH 3BSQA 2BXUH 3ZZAA 1V2VT 5C2ZA 3P8GA 2PUXB 1W2KH 3SN8A 4FUIA 1O2SA 1BMAA 2OC0A 3F2FA 4UFGH 4AFQA 4INHA 3RXFA 5I25A 3RXRA 4WMFA 2ZQ1A 4HFPB 3GDUA 1O38A 2GZ7A 2WPLS 1K1MA 1YYY1 3A80A 1QA0A 1CT2E 2P16A 4IMZA 2ODPA 1UK3A 2A2QH 1IAUA 2EI8A 5EIYA 2A1DB 1DE7H 4Y7AA 1QIXB 3UIRA 1ZJKA 2SNWA 1GBEA 2H9HA 1RGQA 4ASHA 3S7HB 1E1RD 1P11E 1TPAE 4Y8YA 2WUBA 1VCPA 2FI3E 2XYAA 7ESTE 5F8ZA 3U9AH 4I8KA 3ZVGA 4DG4A 4FETA 2V7QD 1AN1E 2WPIS 1SOTA 5J4QA 2BOHB 1YPJH 3UOPA 2ZWLH 1DVAH 3BG8A 3PO1C 4CRFA 2NU3E 1D6RA 1C5QA 1O2JA 1EJAA 3FANA 5FCRA 1LQEA 2XW9A 2GCHF 1TNIA 1Z7KA 3EA7A 5GNDA 2VIVA 3A87A 4IC6A 3LGWA 5CE1A 1NO9H 1QQUA 1O2MA 4IN1A 3RU4D 5KEDA 1P2OA 2ZFPH 4K8BA 2AMPA 2P95A 1C5MD 1C5UA 2C3SA 2BD7A 1TRNA 4ZXXH 1H9HE 3UAIC 3I29A 4GHQA 1K1OA 2B8OH 2J38A 2ZU1A 4DY7B 4FVDA 3K9XB 5BPEA 3GY4A 1FAXA 3T28A 1MTNB 5B6LA 2OXSA 2OBOA 1XXFA 1JRSA 4XDEA 1SR5C 1HFDA 5F03A 4BOHA 3FZZA 3C27B 4NA7A 3SBKA 1HAZB 4FU7A 1OXGA 3MH5A 1C5LH 2ZU3A 1O37A 5IK2D 1KXFA 4DCDA 2AIPA 5EG4A 1HJAB 2J97A 4NWKA 1FLEE 2D1JA 3V3MA 2O8TA 2DUCA 3AK5A 1ZTKA 1YC0A 4FUGA 3SHAH 3WWBA 1NU9A 3RXCA 1GHYH 1N8OC 2FMJA 3SNBA 3MH6A 1MTSA 2R0KA 4K5ZA 2WYGA 3BTDE 1UVUH 2ZO3H 3I77A 3QLPH 1V2LT 5FX6A 2XBXA 1HUTH 1SGRE 5A09A 1PPFE 3SU6A 1BTWA 3RC5A 1BTPA 4ABDA 3DT0H 4ACBA 4BTIB 4NZLA 2BDGA 3HKIB 1TA6A 2G4UA 3BF6H 1KXDA 1MTVA 3OE7D 3GISB 1C2FA 2HOBA 1P09A 3TITA 3AW0A 3T26A 1UHBB 2O9QA 4R0IA 5HM9A 1X7AC 2QAAA 1UK2A 1H1BA 2WUCA 3CP7A 8KME2 2FLRH 2W6ID 2IN2A 1MD7A 1SQAA 5EGMA 2PR3A 1QB6A 4D7GA 1AMHA 1SBWA 3BTHE 1ZLRA 1GHZA 1GBAA 4FUEA 4SGBE 6GCHF 3OTPA 2F9UA 2BLWA 1SKYE 2A4OA 4UEHH 4MPXA 4JZDH 4U30A 1FPCH 2QGRA 5F8XA 2J98A 1F5KU 3N7DA 2ESTE 4INKA 2LP6A 1ELGA 4K2YA 1H8ED 4YLQH 1VITH 1O2TA 1C2MA 1DITH 1DY8A 3SU2A 3E91A 3EA8A 4AGJA 3ITIA 1OS8A 3GY7A 2QXJA 1FDPA 4X2WA 1K1NA 3GOVB 1PPCE 3S0NA 2ODQA 3A7ZA 3ZZ9A 3O8RA 2HGTH 2Q6DA 2ZGHA 3MNBA 3CS0A 4GHTA 3RXVA 3BEIB 3UR9A 5EXMA 3FP7E 4CBNA 1HAVB 1GJAB 1SOZA 1OWJA 3UY9A 5C0UA 4QT8C 1E35B 2C93B 4BXWA 1YLCA 5C94A 1FIWA 2ZC9H 4RSPA 2IJOB 2ZU4A 1V2UT 2EY4C 1IQGA 4MPWA 4NIYA 1V2PT 1YPHC 5B6OA 2J2UA 3TJNA 2J5UA 3RMLH 1W0KD 5HIYA 2BDHA 2YMSC 1EJNA 2C4FH 4J1YA 4JZ1A 4HG6A 1ANCA 1Z8GA 2JKHA 1Z6JH 3HPTB 3SJ9A 2BY6X 1KMHB 5DP7A 1TBQH 2XXLA 1NZQH 1GI0A 2OQUA 2Y7XA 3DHKH 1O2RA 3HGNA 3BTTE 4U01A 1O35A 6ESTA 2QA9E 4NIWA 1F5LA 3E0PB 5C1UA 3EE7A 7GCHG 1F2SE 1ESAA 2GMTC 1GI4A 2OP9A 5DSFA 4ABGA 1SGCA 4ISIH 2BZAA 1GBJA 3DFLA 3ZZ6A 4TSFD 3VXFH 1TNHA 2BD3A 1HCGA 1EPTA 2DE8A 2WPJS 1MCTA 2XNDD 3RXOA 2HNTC 3KQCA 1KXAA 1KSNA 2BD4A 3M5NA 2A7CA 1BJUA 4A7IB 4Y71A 1V2NT 4LZ4B 1C2KA 2XCNA 3SJ8A 1Y3WA 4ISLA 4O9VA 1RRKA 2AGGX 3CNRA 4UDWH 3ESTA 1MMJN 1OOKB 4E7NA 2JH5D 1Y5AT 2BVSH 2ANYA 1D3DB 3E16B 2R9PA 2FOBA 4X2XA 1FX0B 4ZKSU 3CENA 1G3DA 1SGTA 1P2MA 3GCNA 3MNSA 1AE5A 1V2QT 3SORA 4FUCA 1UTPA 1TABE 1TONA 2H6MA 2CJIA 5EXLA 2FOAA 2Z3DA 1EZQA 3BEFB 4B75A 1ZTJA 2NU4E 2CXVA 4R8TB 4I8JA 3UQVA 1ZR0A 2HRVA 1O2NA 1L1JA 3F1SB 4RI0A 1EFRD 1VITG 3PTNA 1SLXB 4H4FA 1O2LA 2GVFA 1DSTA 3BTME 3GY3A 4NZQA 1BMLA 4RT1A 4NFFA 1YPHE 1MU6B 1TBZH 1ZHPA 2W5EA 1FV9A 3SUGA 2VVCA 1QJ1B 2OC1A 3PM3A 3RDZA 1IQMA 4X6PA 2V6NA 1YF4A 5IYTA 1UTKA 3A86A 4A1VA 5DG6A 3KQEA 3RXJA 4BAMB 4NCYA 1BMNH 1YPGH 4YESB 1MAXA 2AGIX 1XX9A 1UW7A 2VJ1A 1S83A 4FUDA 3SJOA 2ASUB 2NU0E 1B5GH 1AZ8A 6CHAC 3H7TA 2XC4A 2ZPQA 3V13A 1A5GH 1CHOF 1AUTC 2P3TB 1MTWA 1A7SA 1CE5A 3ZZ4A 4FU9A 2ZHWH 2TGDA 3GCTG 3SGAE 4BTTB 2Z6BD 4XBDA 1OWKA 1S84A 5L2YH 2NU1E 2HNTE 2BZ6H 1EASA 3UQOA 1GVLA 2JETC 2JH0D 4K3JA 1NESE 4B71A 2Y5HA 2THFB 1H8DH 3LOXA 3TJUA 1ELTA 3UNQA 1JMOH 5LPEA 3L33A 1P57B 1EOLA 2K8IA 1EOJA 1FIZA 3RXEA 4X0WU 1NRRH 4JYTA 1NC6A 1D9IA 4H6TA 1EB2A 3C1KA 1UVPA 4K60A 1VKYA 4H6SB 4ZAEA 2FYQA 3D49H 1GBKA 1EKBB 1E0FD 4MNWA 1UO6A 1O3CA 1YPLH 1Z8JB 3GY2A 1FPHH 3DSGA 2FLBH 4X6MA 3QTOH 4K1TA 4WJG2 1P06A 2OC8A 3ZZ8A 1C1RA 1ZYOA 5A2MH 3OU0A 2QXIA 2Z9KA 3OEHD 4ABJA 2SGEE 1ZGIA 1O2KA 2A32A 1A4WH 3ATKA 2BOKA 1O3OA 4DVAU 1AB9C 1RXPA 5JPMH 2VVUA 3NXPA 3URDA 1LO6A 5JYIA 3LH3A 1VJAU 3NUMA 1O3DA 1TQ7B 3TH3H 2NWNA 4MDSA 3MWIU 3S7KB 4X2YA 1THRH 4ABHA 2C90B 2FX4A 3TK5A 1C2EA 1ZMLA 1O3LA 1TOMH 5L30H 1PPEE 4U2WA 4PROA 1PPZA 4FOUC 4ASUD 5LPRA 1O5DH 1L1GA 3LJJA 3EQ0H 3BTKE 3U1IB 2FOCA 1P0SH 2UWLA 4LOYH 1AWFH 1H8HD 2FI5E 4XBBA 1CA0B 2VWLA 1GMHF 2KCOA 2M5TA 5ESBA 2RDEA 1Y3VA 1RTFB 4OS5A 1A0JA 4FUFA 3T5FH 1K1LA 1P2QA 1P2IA 3LT3A 1O2ZA 1W8BH 3KNXA 1NROH 1OWIA 1VCQA 1GG6C 3RXQA 3E90B 3Q3YA 1CT0E 3FN8A 4A5TS 1OYQA 1NT1A 1KDQA 1M9UA 2PKSC 1SGFG 3A89A 2SGQE 2XRCA 3LH1A 1AHTH 2L74A 2VIWA 8GCHG 2Z94A 4XBCA 2ZI2H 1KY9A 5A8ZA 4ESTE 4JYVH 2IOTA 3EDXB 2QF3A 2CHAB 3NPSA 5JB9S 2W7UA 4AB9A 1P05A 1CGHA 2FTLE 2ZZUH 3MHWU 3TIUA 1FONA 1MKWK 1NFXA 3PMAB 4B2BA 2SNVA 1D6WA 1XUHA 1L0ZA 3ATWA 4THNH 2BDBA 2H2ZA 2R3YA 1THPB 3M36A 2FYRA 2VWMA 3F6UH 3QZRA 1CGIE 1EZSC 5GJ4B 3S9AA 2IPHA 3E3TA 1BRAA 4AG1A 1AY6H 3GCHC 5ABWA 3PMHB 2AFQB 1UK4A 4I32A 2KR7A 2JJ2D 2A0QB 3IITA 1QQ4A 4IBLH 4Y8XA 1CO7E 5JBBS 1ETSH 3SV7A 2CMYA 1AUJA 1NM6A 4X8SH 3GYMA 1Y8TA 1LDTT 5DJ7A 1YLDA 4BTUB 5AF9H 4CRCA 2P8OC 1BT7A 2BD9A 4DT4A 5C5NA 3DA9B 2ALPA 4ZHAA 1C1SA 4BAKB 3AASA 1EPTB 2A7JA 3PB1E 3BG4B 3PLKA 1P2KA 4U32A 3SOSA 2A4RA 2GV6A 1D3PB 5LGOA 2Y5GA 3PTBA 1C2DA 1QCPA 2ANWA 4AYYB 1YBWA 5CHAC 3UUZA 4NSVA 4YOIA 4FUBA 3ZZ5A 4CR9A 1GBCA 4O3TA 3Q3KA 1VR1H 1TQ0B 3DSPA 4AB8A 5E2OA 1S0QA 3MH4A 1GHBF 4KKDA 1A3EH 2FOGA 1ABIH 1FAKH 2QF0A 3P6ZB 4IW4E 1TPPA 2OQ5A 3ZV8A 2V3HH 4DGJA 2BLQA 1GJ4H 5GCHF 1Z8RA 2F9BH 1MQ5A 5AVDA 2Z9GA 4X2VA 1BA8B 3LC3A 3LGUA 1C1TA 1A46H 1AD8H 1YM0A 1MKXK 1BTHH 1VZQH 1QHRB 3TGKE 4NSYA 2EA3A 2G4TA 3M37A 1HLTH 3RXSA 3ZZ7A 1J16A 4X1QU 1DLEA 2B9LA 1O3GA 1SPJA 4TY7A 1A2CH 2G5NA 1C5YB 1P12E 2Q6FA 2GZ8A 1GI9B 1BTXA 1E34B 4MPVA 4MNVA 1O31A 4JZIA 2FS9A 3RXKA 3W95A 1OP2A 3O8BA 2JDID 2QC2A 1T7CA 2VU8E 4AFZA 4YLUA 4ABIA 1GI2A 1DUAA 2BDIA 2ZP0H 1O39A 1MZDA 1S6HA 1FY4A 4Z1MD 1T4UH 4XRNA 1AFEH 3KQDA 5L2ZH 2GX4A 3JZ2B 1ZRBA 2ZPSA 1QJ6B 1JRTA 2ZU2A 3QUMP 2GP9B 2F9OA 2I6SA 3A88A 4DURA 1KXBA 3UOUA 5J4SA 3PO1B 3LGTA 2FPZA 1QNJA 3U8RH 1GBDA 2PLXA 5T3HA 8ESTE 5HIZA 1C5VA 1IQLA 3W1EA 2QF5A 5G4BA 3ZZDA 2ILNA 2GCHG 1BITA 1G30B 3TH4H 4ABEA 2AMDA 9ESTA 3SQHE 5FBIA 4ZHLU 2FEQH 3KQ5A 4UFEH 4X1SU 1ELAA 1AVGH 3EE0B 3SZEA 2WPHS 1O3IA 1EP5A 5A8XA 1P9SA 3BTEE 5DO4H 2WV9A 4X8VH 1TX8A 2ZHQH 3DCLA 1FQ3A 3VB4A 1EZXC 1NBME 4WY3A 2TPIZ 4AC9A 2JJ1D 2HNTF 1QA7A 2G55A 2KFWA 4Q63A 2UUJB 2F3CE 5K7RA 4X6NA 1AVWA 2WINI 1VGCC 4JCNA 4RT0A 1N8OB 2VNTA 4MQAA 1JOUB 1PPGE 1YY3A 1SGDE 3DFJA 2KCYA 3M5OA 3TJOA 1O3BA 5DK1A 4RKOB 4B6EA 4YM9A 5EPYA 2D26C 1LCYA 4JZEH 1BCUH 1F7ZA 1GMCF 4B74A 3ZYDA 3P8OA 1KLTA 1PJPA 4Y6DA 3A8AA 3A84A 1TPOA 3V7TA 2QN5T 1SMFE 2ZFSA 1AE8H 1DPOA 2FESH 3NK8A 1W11U 3RXLA 3UPEA 2PGQB 1W0JD 1O3JA 3UTUH 2IPQX 2SGPE 1HDTH 4B73A 3PROA 2XOKD 3V0XA 3HK6B 3SU1A 5HGGA 3MI4A 1CA8B 2Z7FE 1RS0A 2QXGA 4JZFH 3O8CA 1E1QD 1P2JA 1ORFA 1V2RT 1GHVH 1DANH 1LPGB 4ABBA 4LK4A 4ZKOU 2AYWA 1O3NA 2W6JD 1C1MA 1O2YA 1AFQC 3MO9A 1A5IA 4O03A 1O5EH 4GCHF 1GJ7B 1LPKB 6GCHG 3ZZBA 1ZJDA 2BDYA 1AZZA 1P3CA 3D62A 2PTCE 1YCPM 1O34A 3D65E 3LGVA 2TGPZ 4YZUA 2V0BA 3KGPA 2ZDMA 1KYNA 3KL6A 1LKBA 1Q3XA 2AEIH 2Y5FA 4I8GA 4DOQA 4ZUHA 2VGCC 4OGYA 3GY5A 3H09A 2OTVA 2BX4A 1XMNB 3G01A 1PPBH 1NU7B 2XWBI 2Y6TA 1LHDH 3TPIZ 1XUJA 2FP7B 3RXUA 1TWXB 5F8TA 2OBQA 3RUOA 3VB5A 1UCYH 1P03A 2YMSD 1T4VH 2ALVA 2A5IA 4I86A 1C2LA 4Y7BA 3SUFA 2BY5X 2XBWA 1O3EA 4SGAE 1F0TA 1SB1H 1C2IA 6LPRA 1IQHA 5A0AE 1DWEH 1P01A 2PV9B 2A5KA 4KGAA 2YMSB 1BRUP 1UVTH 4XFQA 5JBCS 1SHYA 1O33A 3Q76A 2ZA5A 2FDAA 1EQ9A 3E1XB 1FY3A 1O2QA 4YTAA 5T1VA 1PQ7A 1LHGH 1QB1A 4OS2A 4M9FA 2P3UB 4ISNA 3JZ1B 3ZZCA 1ACBE 3M7QA 1DX5M 2GMTB 3NWUA 1AI8H 4OGXA 5C67A 5GDSH 1GBLA 2ZQ2A 1ELEE 1TGNA 1DLKB 1O2PA 2BLOA 4YOJA 5ETXA 3QZQA 4Q2KA 3H5CB 1P04A 3PV4A 3TH2H 5A8YA 3HK3B 2BD5A 3GCOA 1O3MA 3MMGA 1OYTH 3Q00A 4AN7A 3U28C 1WQVH 1W7XH 5FBEA 3M5LA 1A1RA 1G3EA 3PLPA 1GVKB 4I31A 1ZMJA 1PQ5A 2Y82A 1EUFA 1CU1A 3LONA 1SLVB 3PWCA 1O5AB 1DXPA 1NRQH 1UTMA 3RXBA 2RDLA 1DDJA 1C4V2 2H9TH 3TLOA 1V2OT 3WW7A 2WYJA 2G52A 4E06H 3RXPA 5EJZA 3K2UA 1QZ8A 2GDEH 1T8MA 4E7RG 1NFWA 3FOAA 1DT2A 4DW2U 2RCEA 1QRWA 3VEQB 3UNRA 1UMAH 3B8JA 1YPEH 1EAUA 2HALA 1MBQA 1A3BH 1RTLA 2L6OA 2Z9IA 5HM2A 2CK3D 5DP8A 3SNAA 1IHTH 2JH6D 2AHME 3OFND 4H42U 1C1QA 4VGCC 4WMDA 4X8UH 1P3EA 4OS6A 2F9VA 2STBE 2RA3A 3QWCH 1C9PA 1AKSA 5GIBA 4ZH8A 1LQDB 3UB0A 1ZHRA 2CF9H 2HPQH 2BY9X 3SO3A 2HVXA 5AFYH 1HRTH 2KAIA 2J9NA 1LTOA 1D3TB 2ZFTA 1TNKA 5LH8A 4NA8A 4DJZB 1F0UA 3MO6A 4F49A 3E0NB 1TNLA 1G37A 1ARBA 2FTMA 2H5CA 3E8LA 6CHAB 1VITF 4KTCA 1Z71A 3A8DA 4FU8A 8LPRA 1QGFA 2W3KA 1CVWH 1FY8E 4IMQA 3OAAD 1CHOG 1DSUA 2H5DA 4P02A 3MFJA 1CHGA 1EJMA 3R3GB 1WDIA 1GJ5H 4INLA 3RXHA 3ZVAA 1HV7A 1MH0A 1ANEA 1CBWB 2JETB 4OS7A 1LMWB 2FIRH 4JK5A 2ZGJA 1GI8B 1FUJA 5EQQA 4F48B 2J4IA 2VIQA 3SV6A 1UVOA 3EA9A 1GCDA 2LELA 3PMJA 3MU1A 3VXEH 1CSOE 1O2HA 4B2CA 2W7SA 4WWYA 4B2AA 1LVBA 4A1XA 2D2DA 4B76A 1YWUA 2ANMH 2PSYA 1UTOA 2A5AA 5FCKA 5C3NA 1IQJA 4X8TH 1ZOMA 1SGFA 3A7XA 1TRMA 2RG3A 3A85A 4J2YB 3U69H 1V2KT 1SL3A 1JIRA 1Y5UT 3OY5U 1AB9B 1GI6A 4IC5A 1VJ9U 1O2UA 3DUXH 1SGYE 3BTWE 2O8UA 4UFFH 3RC4A 3ODFA 1K9OE 1YLNA 3VB7A 2EI7A 3S69A 2AGEX 1A5HA 3V12A 3STJA 3TNTA 4O3UA 2J92A 3MYWA 3ZVCA 1HIAA 1MD8A 5H4IB 4AG2A 2ZFQH 5DP4A 1HAGE 3ZZ3A 4D7FA 1EAIA 1ANDA 3SUEA 1K1PA 4B1TA 1H9IE 1Y3YA 1J17T 1GGDC 1C5XB 2OD3B 4MLFB 4WF8A 2YNBA 3ZYEA 5F6MA 1F0SA 3F9FA 1WYKA 2FOFA 2ZGXH 3LJOA 4KP0A 4BAOB 5L6NH 2O8LA 3BEUA 4Y8ZA 1IQIA 2TIOA 9LPRA 1GCTC 3GY8A 4IS5A 3KEEA 1GI1A 2XBYA 3A82A 4WXVA 4TT3D 2UUYA 2R0LA 4MVNA 1GMDF 3BTQE 5C5OA 2ZCHP 1QTFA 4NG9H 2RA0A 5E2PA 2J98B 3VGCC 1GBHA 1WV7H 3SJIA 2ZEBA 1QJ7B 3S9BA 1GG6B 1S6FA 5AFZH 2VINA 5T6GA 1XUGA 4AFUA 4TPYA 5K0HA 3RXGA 2PKSB 1ELFA 3ODDA 3HGPA 4GUXA 3PMBB 1K22H 1EAWA 4UONA 2LPRA 5F53A 1FXYA 1GJCB 2HLCA 1GDQA 1GHAG 3ZV9A 2AH4X 1HAPH 1L4DA 2O8MA 3RM0H 5I46H 1LVMA 3PV5A 3UR6A 3MTYA 1ANBA 1KIGH 5E0GA 1SGNE 2ZCLP 2XC5A 4LXBH 4WMEA 5BRRE 2KCPA 2UUKB 3GCHB 3BTGE 2QCYA 1K21H 4ISHH 1DWBH 1XUKA 2A4QA 5PTPA 2OC7A 4A1TA 3L3TA 2WPDD 1V2MT 4CHAC 3U8OH 4A92A 4DIHH 4CBOA 4F4OC 4WH6A 5KECA 1W0YH 1TRYA 1KTSB 1TGBA 2P8OB 1O36A 1BTZA 4YT6H 1NPMA 2PHBA 3TU7H 4WXIA 1GVZA 1MAYA 1C2JA 1P2NA 2ZTYA 3URCA 3QGNB 2Y7ZA 3FFGA 4NIVA 3U98H 4KTSA 2BD2A 1O5GH 1HB0B 4X1PU 1RIWC 3W94A 4CREA 1NS3A 4TWWA 3DSOA 1XVOA 5CHAB 2BXTH 1V2TT 4X1RU 3SV8A 1WOFA 1NBMD 1GBIA 2H1UA 1C1UH 3QK1A 2UWOA 2ODYB 1O3PB 1BUIA 1G3BA 4D9RA 2GCTC 4JK6A 1J9CH 1SHHB 2R3UA 1C9TA 2A2XH 1V2ST 1G9IE 5JBTA 4XOJA 1RFNA 1GHXH 4O97A 3ATIA 2CF8H 2FS8A 1KTTB 1MCVA 1TX7A 2SGAA 1NFUA 2J34A 3HATH 5GCHG 1S82A 1TX6A 4AYVB 3M3TA 1D3QB 2TRMA 4BXSA 4ZHMU 1A0LA 1ZTLA 3ENSB 1SSXA 4ZROA 1TE0A 5AHGH 1Y3XA 4D76A 5KGOA 1HXFH 2BD8A 1S0RA 2F43B 3F2HA 5HKKD 4KTUA 1SFQB 3KN2A 1AKSB 2FO9A 1C1WH 3P8NA 3A7WA 1TGSZ 3A8BA 1GBTA 1WXRA 2Z9LA 2PSXA 2VIPA 2OLGA 3T25A 1TGTA 1BBRH 2KAIB 1P10A 2D8WA 3OSYA 3M5MA 2VIOA 3B23B 1BRCE 3SGQE 3MU0A 1S5SA 2QY0B 1W13U 3QGJA 2R2WU 1GJ9B 2GV7A 2BQ7B 3FP8E 3M35A 3TGJE 4X1NU 2Q6GA 1BB0B 1AQ7A 2YOLA 3GICB 1SGIB 1GDNA 3T2NA 2Z9JA 3GDSA 1MQ6A 1NFYA 2W3IA 1GI7B 2IJD1 2SGDE 1ZSLA 2A45B 5FPYA 1P02A 1O5BB 1BTYA 5DGJA 4MG3A 1UCYE 1Z6EA 1TYNA 2BDAA 5FAHA 1BDAA 3F9EA 1WAYB 2GGVB 1ETTH 4Q80A 3UREA 1LHEH 1K0HA 1E37B 1LVOA 1DWDH 1E79D 2WV4A 3UWJH 4Q7XA 1ZHMA 1L2EA 3M7TA 3RU4T 3ZVFA 3QN7A 4K1SA 2SFAA 5HXFA 1J14A 4IGDA 1GI3A 1TFXA 2PFEA 2GD4B 2WPKS 3M61U 1OKXA 1QBNA 2GKVE 1BBRK 1IQNA 1TMUH 2ZECA 1WCZA 4CRBA 2P59A 1K2I1 3RLYH 1O3FA 3BIVH 3N7OA 3RXIA 2EEKA 5GPIB 1HJ9A 1CQQA 1LPZB 1SGPE 1DS2E 2XCFA 1F92A 1FY1A 2SGFE 1W0ZU 1XXDA 1S85A 3K65B 4Q7YA 2FM2A 3MO3A 1VGCB 2F4LA 4OS4A 3P70B 4MNYA 4RN6A 1HXEH 2I6QA 2ZHFH 2HWLB 2OK5A 3F2GA 1BZXE 2ZFFH 5DP6A 1BJVA 2G5VA 4JMYA 1ZPCA 2O8WA 1HIAB 1P8VC 1DICA 1TNJA 4GSOA 3RC6A 1A0HB 1IQFA 1V2WT 3SGBE 2GZ9A 2QV1A 2V35A 4LZ1H 1H8IH 3IG6B 2F83A 1HAHH 3BV9B 4I8LA 5SGAE 4ZCNA 4CR5A 4BAHB 3CS7A 4BAQB 4K69A 1GMCG 3K6ZA 3KF2A 1MTNC 4TY6A 4JYUH 2KM0A 3P8FA 5E0JA 3MNCA 1O2VA 2ZTXA 5IDKA 3GYLB 5DPAA 4YXWD 2AS9A 5CDFE 1FNIA 1SQTA 1C1NA 3LGYA 4UE7H 3MQKC 3EYDA 1SQOA 3LC5A 3QTVH 1JXPA 2C8ZB 3N7EA 1UTJA 1WSSH 3BTFE 1HAYB 1HJAC 2GDDA 4AGKA 2PP6A 1HNEE 3LIWA 3VB6A 1T8OA 3AVZA 4AX9H 5GWZA 2LNCA 1TB6H 2NU2E 1YPMH 2VIDA 3F0PA 1AFQB 5T6FA 3OYPA 1AWHB 2GTBA 3U1JB 5FPTA 1ZRKA 1RD3B 1NY22 3H7OA 1L4ZA 1ZSKA 1QFKH 3SNCA 3SU5A 2B0FA 1KDQB 5EPNA 1AO5A 1NRPH 3P17H 2CV3A 4GCHG 1QBVH 5EOKA 1TMBH 2BYAX 1OWDA 1WTHD 2UWPA 1U6QA 1KLJH 2VGCB 1BTUA 1COWD 2OUAA 3SI3H 2DE9A 4GPGA 4OM9A 1O2GH 1TOCB 2PUQH 2ZKSA 1HYLA 2A7HA 4ABAA 1EP6A 1IQEA 1PPHE 5DN6D 3ELAH 1C5RA 3GS9A 2F9NA 1TALA 4AOQA 4NFEA 3KQBA 3K6YA 3RMNH 1SLWB 4BANB 1W3CA 3MH7A 2Z3CA 1O30A 1K1IA 1NTPA 3FP6E 1Y59T 2VWOA 4F55A 2AERH 1YCPH 2B7DH 2FI4E 3SQEE 1RTKA 1EXFA 1S81A 1QL8A 2OINA 4I33A 1MABB 1F0RA 2ZIQH 2ULLA 3AW1A 1ETRH 2G8TA 2XNIA 2XWAA 2ZFRH 3SNEA 1TGCA 1SGEE 1OPHB 1QURH 1ELCA 1TNGA 1QL9A 1G32B 2AMQA
chains in the Genus database with same CATH topology
7KMEH 3QDZB 1H4WA 1GDUA 2FODA 2F9PA 3OY6U 3RXTA 3SI4H 1C4U2 4YO9A 2XTTB 3NKKA 4Y76A 4DT7B 2YNAA 1C1PA 3RU4E 2ZU5A 4FVBA 1BHXF 1DFPA 1ZZZA 3ZVDA 3MNXA 5A0BA 3BIUH 3MU8A 1SFIA 2FXRA 4WVPE 4MNXA 3EGKH 1SC8U 1J15A 1QRZA 1FI8A 3LGIA 2ZGBH 1G3CA 3MU5A 3RXDA 2PKAA 5JB8S 1ESBA 3T62A 1E38B 1PQAA 5HMAA 2J95A 4AORA 4HGCA 1HJ8A 1UCYK 1T8LA 1D4PB 2OCVB 1V6DA 5TCAA 1INCA 1YCPK 1TPSA 1QY6A 3SU3A 1XKBC 1O3KA 4ZKRU 4I8HA 1KXCA 7GCHF 3D23A 5C1XA 2TGAA 4Y79A 3SV2H 1GJDB 1THSH 4OS1A 2ZHDA 3T27A 1T8NA 4UFDH 2VB0A 1EAXA 1Z1JA 2J94A 4FUJA 2CN0H 1O2XA 1FN6A 1O5FH 1DUEA 1O2OA 1IQKA 3EAJA 2BHGA 3SJKA 1EZUC 4VGCB 4YT7H 1AVXA 1O2WA 1W14U 1ID5H 4CRDA 5ESTE 1SG8B 4ISOA 1QBOA 2XC0A 1O0DH 2V3OH 1G2MA 3A7VA 1GWAA 1L1NA 2ZDKA 2BY8X 1FZZA 2H9EH 3LPRA 1PYTD 1C5SA 1GJ6A 4AZ2B 1AIXH 2ZG0H 3P95A 1C5OH 1ZGVA 1ZPZA 3PYHA 3MOCA 2K1QA 1QB9A 1VCWA 3I78A 2BVXH 4CRAA 1KLIH 2VH0A 1FN8A 2ZCKP 2P93A 1GI5A 3UNSA 3TJVA 2G00A 5FPSA 1XKAC 1PYTC 4X6OA 5EXNA 1OP0A 2ZHEH 4XSKU 2B5TB 3HKJB 3PWBA 3SU4A 2FOHA 2BB4A 2WPMS 1OP8A 3U8TH 1T32A 4Z6AH 3LKWA 1W7GH 1JWTA 1F5RA 1TMTH 1YPKH 4HZHA 3F9HA 4ZXYH 1B7XB 2AIQA 4E05H 1C2HA 3A8CA 5EW1H 4NWLA 2EC9H 3FVFB 3QO6A 5LPFA 1C2GA 1C5PA 3SHCH 1LKAA 3A7TA 1DOJA 1P9UA 5EW2H 1G2LA 3ATMA 2Y80A 2C8YB 2P94A 2ANKH 1SLUB 1WTGH 1Q31A 1B0EA 1UTLM 3KHVA 5EQRA 2XBVA 2C8WB 3OX7U 1BRBE 1XUIA 1HGTH 2FWWA 3GCTF 3RXMA 1Q2WA 4Y11E 3FAOA 5C20A 1CBWC 1BQYA 1BHXB 1AGJA 3O8DA 1AU8A 1Y5BT 1PFXC 1UTQA 1TBRH 4ZMAH 2Z3EA 3TGIE 5E0HA 1GJ8B 1N6XA 5CMXH 1UJ1A 4M7GA 4Y0ZE 1LHCH 3NZIA 3FZDA 1DM4B 1UTNA 1RJXB 1HAIH 2FOMB 3DD2H 1V2JT 4Q7ZA 4Y0YE 1ELVA 3ZVBA 1WUNH 1C1OA 2QIQA 1GGDB 1KXEA 1QR3E 3F9GA 3RM2H 1XUFA 1TAWA 1O3AA 4DIIH 3M3SA 1UVSH 2GT7A 5FX5A 1GCTB 1J8AA 1QRXA 3UWIA 4ABFA 2P3FH 3UFAA 3B9FH 1Y3UA 1ARCA 3SNDA 1YGCH 3VFEA 3VGCB 1IHSH 1H9LB 2ZNKH 3IWMA 1XVMA 1O32A 1GMHG 2PWXA 1SGQE 1GMDG 3BN9A 1TIOA 1JIMA 2ZDNA 1BBRE 1OX1A 3LDXH 4RKJB 1GJBB 3KIDU 1MKWH 2TGTA 1OWHA 2BLVA 3LU9B 1WU1A 4ZKNU 3SU0A 1C5TA 1LVYA 1SVPA 3KCGH 2BQ6B 5DKMA 2ZGCA 3TK6A 1ZPBA 2BY7X 2ZF0H 4FXGH 2CGAA 7LPRA 1ELBA 1G36A 1LHFH 1BOQA 2BM2A 5EQSA 1DXWA 2PW8H 1DY9A 4FUHA 1N6YA 3SW2B 1Z1IA 1EATA 3TVJB 3M3VA 1NN6A 4WH8A 1EB1H 2VH6A 1EX3A 3T29A 1C5NH 3Q3XA 1CA0C 1C4Y2 1HAOH 3MU4A 4GVUA 3A7YA 2A4GA 3STIA 2BQWB 5FXLA 4AFSA 5DP9A 3SUDA 2G81E 2TBSA 4XE4A 2FX6A 1FJSA 1K28D 1UHBA 2EI6A 1IOEA 1NRNH 4CHAB 3AAUA 2BVRH 2BMGB 5DP5A 1ZMNA 3GDVA 4TWYA 5JDUB 3Q77A 1OSSA 1Z8IB 5JBAS 1YP9A 1GHAF 5EU8A 8GCHF 1C5ZB 1O5CB 2UUFB 1XM1A 4K8YA 3QX5H 1WQSA 2A31A 3L6PA 4NGAH 4HI3A 1FY5A 5C1YA 3VPKA 1MZAA 1O2IA 2ZTZA 4TYDA 2Q1JA 2Y81A 1ZSJA 4GAWA 2CHAC 2PKAB 3AAVA 4MPUA 1B0FA 1GBFA 1RIWB 1A61H 4D9QA 4I7YH 3OTJE 1PQ8A 1MTUA 1TLDA 2FOEA 4BNRA 2STAE 1HPGA 3RXAA 3ATLA 2GCTB 3A81A 3F68H 1MKXH 4MTBA 4HTCH 1C1VH 2W26A 4CRGA 3SZNA 1OWEA 5EODA 1HBTH 4KELA 1W12U 5TCCA 1HAVA 1T31A 2C8XB 1E36B 1GBMA 1DWCH 3WY8A 1YKTA 4NIXA 3GY6A 1GHBG 3RLWH 1GL0E 1ABJH 1TA2A 1GHWH 3VB3A 3P92A 3SV9A 1ESTA 4A6LA 3ZVEA 5TJXA 2ZDVH 3RMMH 1W10U 1BMMH 2ZDAH 3A83A 1EPTC 1FMGA 2HPPH 1HAXB 3E6PH 2BTCE 3BG4C 4UD9H 4TPIZ 4GLYA 4Y10E 4CH2B 4CH8B 4Z0KA 5T6DA 1K1JA 2VVVA 5GXPA 3TK9A 1N1LA 2VWNA 2BDCA 5E8EH 3NCLA 4NA9H 3RP2A 1BIOA 5DP3A 2QXHA 1CGJE 1SI5H 2PTNA 1GL1A 4IN2A 3PLBA 1QL7A 2WV5A 3TNSA 2F91A 4D8NA 4K1EA 1CT4E 2PGBB 4YOGA 5HYOA 2GT8A 1NRSH 2R2MB 3S9CA 2ZDLA 1C5WB 1MU8B 1V3XA 1GBBA 1O3HA 3R0FA 2FZZA 2ZPRA 5FHTA 1JBUH 5A0CA 1GPZA 2QYIA 3M7UA 1MUEB 1WBGB 2BX3A 2G51A 1ELDE 1MBMA 3RMOH 3BSQA 2BXUH 3ZZAA 1V2VT 5C2ZA 3P8GA 2PUXB 1W2KH 3SN8A 4FUIA 1O2SA 1BMAA 2OC0A 4UFGH 4AFQA 4INHA 3RXFA 5I25A 3RXRA 4WMFA 2ZQ1A 4HFPB 3GDUA 1O38A 2GZ7A 2WPLS 1K1MA 1YYY1 3A80A 1QA0A 1CT2E 2P16A 4IMZA 2ODPA 1UK3A 2A2QH 1IAUA 2EI8A 2A1DB 1DE7H 4Y7AA 1QIXB 3UIRA 1ZJKA 2SNWA 1GBEA 2H9HA 1RGQA 4ASHA 3S7HB 1P11E 1TPAE 4Y8YA 2WUBA 1VCPA 2FI3E 2XYAA 7ESTE 5F8ZA 3U9AH 4I8KA 3ZVGA 4DG4A 1AN1E 2WPIS 1SOTA 5J4QA 2BOHB 1YPJH 3UOPA 2ZWLH 1DVAH 3BG8A 3PO1C 4CRFA 2NU3E 1D6RA 1C5QA 1O2JA 1EJAA 3FANA 5FCRA 1LQEA 2XW9A 2GCHF 1TNIA 1Z7KA 3EA7A 2VIVA 3A87A 4IC6A 3LGWA 5CE1A 1NO9H 1QQUA 1O2MA 4IN1A 3RU4D 1P2OA 2ZFPH 4K8BA 2AMPA 2P95A 1C5MD 1C5UA 2C3SA 2BD7A 1TRNA 4ZXXH 1H9HE 3I29A 4GHQA 1K1OA 2B8OH 2J38A 2ZU1A 4DY7B 4FVDA 3K9XB 5BPEA 3GY4A 1FAXA 3T28A 1MTNB 2OXSA 2OBOA 1XXFA 1JRSA 4XDEA 1SR5C 1HFDA 5F03A 4BOHA 3FZZA 3C27B 4NA7A 3SBKA 1HAZB 4FU7A 1OXGA 3MH5A 1C5LH 2ZU3A 1O37A 1KXFA 4DCDA 2AIPA 5EG4A 1HJAB 4NWKA 1FLEE 2D1JA 3V3MA 2O8TA 2DUCA 1ZTKA 1YC0A 4FUGA 3SHAH 1NU9A 3RXCA 1GHYH 1N8OC 2FMJA 3SNBA 3MH6A 1MTSA 2R0KA 4K5ZA 2WYGA 3BTDE 1UVUH 2ZO3H 3I77A 3QLPH 1V2LT 5FX6A 2XBXA 1HUTH 1SGRE 5A09A 1PPFE 3SU6A 1BTWA 3RC5A 1BTPA 4ABDA 3DT0H 4BTIB 4NZLA 2BDGA 3HKIB 1TA6A 2G4UA 3BF6H 1KXDA 1MTVA 3GISB 1C2FA 2HOBA 1P09A 3TITA 3AW0A 3T26A 1UHBB 2O9QA 4R0IA 5HM9A 1X7AC 2QAAA 1UK2A 1H1BA 2WUCA 3CP7A 8KME2 2FLRH 2IN2A 1MD7A 1SQAA 5EGMA 2PR3A 1QB6A 4D7GA 1AMHA 1SBWA 3BTHE 1ZLRA 1GHZA 1GBAA 4FUEA 4SGBE 6GCHF 2F9UA 2BLWA 2A4OA 4UEHH 4MPXA 4JZDH 4U30A 1FPCH 2QGRA 5F8XA 1F5KU 2ESTE 4INKA 1ELGA 4K2YA 4YLQH 1VITH 1O2TA 1C2MA 1DITH 1DY8A 3SU2A 3E91A 3EA8A 4AGJA 3ITIA 1OS8A 3GY7A 2QXJA 1FDPA 4X2WA 1K1NA 3GOVB 1PPCE 3S0NA 2ODQA 3A7ZA 3ZZ9A 3O8RA 2HGTH 2Q6DA 2ZGHA 3MNBA 3CS0A 4GHTA 3RXVA 3BEIB 3UR9A 5EXMA 3FP7E 4CBNA 1HAVB 1GJAB 1SOZA 1OWJA 3UY9A 4QT8C 1E35B 2C93B 4BXWA 1YLCA 1FIWA 2ZC9H 4RSPA 2IJOB 2ZU4A 1V2UT 4MPWA 1IQGA 4NIYA 1V2PT 1YPHC 5B6OA 2J2UA 3TJNA 3RMLH 2BDHA 1EJNA 2C4FH 4J1YA 4JZ1A 1ANCA 1Z8GA 2JKHA 1Z6JH 3HPTB 3SJ9A 2BY6X 5DP7A 1TBQH 2XXLA 1NZQH 1GI0A 2OQUA 2Y7XA 3DHKH 1O2RA 3HGNA 3BTTE 4U01A 1O35A 6ESTA 2QA9E 4NIWA 1F5LA 3E0PB 5C1UA 7GCHG 1F2SE 1ESAA 2GMTC 1GI4A 2OP9A 4ABGA 1SGCA 4ISIH 2BZAA 1GBJA 3DFLA 3ZZ6A 3VXFH 1TNHA 2BD3A 1HCGA 1EPTA 2DE8A 2WPJS 1MCTA 3RXOA 2HNTC 3KQCA 1KXAA 1KSNA 2BD4A 3M5NA 2A7CA 1BJUA 4A7IB 4Y71A 1V2NT 4LZ4B 1C2KA 2XCNA 3SJ8A 1Y3WA 4ISLA 4O9VA 1RRKA 2AGGX 4UDWH 3ESTA 1MMJN 1OOKB 4E7NA 2JH5D 1Y5AT 2BVSH 2ANYA 1D3DB 3E16B 2R9PA 2FOBA 4X2XA 4ZKSU 3CENA 1G3DA 1SGTA 1P2MA 3GCNA 3MNSA 1AE5A 1V2QT 3SORA 4FUCA 1UTPA 1TABE 1TONA 2H6MA 2CJIA 5EXLA 2FOAA 2Z3DA 1EZQA 3BEFB 4B75A 1ZTJA 2NU4E 2CXVA 4R8TB 4I8JA 3UQVA 1ZR0A 2HRVA 1O2NA 1L1JA 3F1SB 1VITG 3PTNA 1SLXB 4H4FA 1O2LA 2GVFA 1DSTA 3BTME 3GY3A 4NZQA 1BMLA 4NFFA 1YPHE 1MU6B 1TBZH 1ZHPA 2W5EA 1FV9A 3SUGA 2VVCA 1QJ1B 2OC1A 3PM3A 3RDZA 1IQMA 4X6PA 2V6NA 1YF4A 5IYTA 1UTKA 3A86A 4A1VA 5DG6A 3KQEA 3RXJA 4BAMB 4NCYA 1BMNH 1YPGH 4YESB 1MAXA 2AGIX 1XX9A 2VJ1A 1S83A 4FUDA 3SJOA 2ASUB 2NU0E 1B5GH 1AZ8A 6CHAC 3H7TA 2XC4A 2ZPQA 3V13A 1A5GH 1CHOF 1AUTC 2P3TB 1MTWA 1A7SA 1CE5A 3ZZ4A 4FU9A 2ZHWH 2TGDA 3GCTG 3SGAE 4BTTB 2Z6BD 4XBDA 1OWKA 1S84A 5L2YH 2NU1E 2HNTE 2BZ6H 1EASA 3UQOA 1GVLA 2JETC 2JH0D 4K3JA 1NESE 4B71A 2Y5HA 2THFB 1H8DH 3LOXA 3TJUA 1ELTA 3UNQA 1JMOH 5LPEA 3L33A 1P57B 1EOLA 1EOJA 1FIZA 3RXEA 4X0WU 1NRRH 4JYTA 1NC6A 1D9IA 4H6TA 1EB2A 3C1KA 1UVPA 4K60A 4H6SB 4ZAEA 2FYQA 3D49H 1GBKA 1EKBB 1E0FD 4MNWA 1UO6A 1O3CA 1YPLH 1Z8JB 3GY2A 1FPHH 2FLBH 4X6MA 3QTOH 4K1TA 4WJG2 1P06A 2OC8A 3ZZ8A 1C1RA 1ZYOA 5A2MH 3OU0A 2QXIA 2Z9KA 4ABJA 2SGEE 1ZGIA 1O2KA 2A32A 1A4WH 3ATKA 2BOKA 1O3OA 4DVAU 1AB9C 1RXPA 5JPMH 2VVUA 3NXPA 3URDA 1LO6A 5JYIA 3LH3A 1VJAU 3NUMA 1O3DA 1TQ7B 3TH3H 2NWNA 4MDSA 3MWIU 3S7KB 4X2YA 1THRH 4ABHA 2C90B 2FX4A 3TK5A 1C2EA 1ZMLA 1O3LA 1TOMH 5L30H 1PPEE 4U2WA 4PROA 1PPZA 5LPRA 1O5DH 1L1GA 3LJJA 3EQ0H 3BTKE 3U1IB 2FOCA 1P0SH 2UWLA 4LOYH 1AWFH 2FI5E 4XBBA 1CA0B 2VWLA 1GMHF 2M5TA 5ESBA 1Y3VA 1RTFB 4OS5A 1A0JA 4FUFA 3T5FH 1K1LA 1P2QA 1P2IA 3LT3A 1O2ZA 1W8BH 3KNXA 1NROH 1OWIA 1VCQA 1GG6C 3RXQA 3E90B 3Q3YA 1CT0E 4A5TS 1OYQA 1NT1A 1KDQA 1M9UA 2PKSC 1SGFG 3A89A 2SGQE 2XRCA 3LH1A 1AHTH 2VIWA 8GCHG 2Z94A 4XBCA 2ZI2H 1KY9A 5A8ZA 4ESTE 4JYVH 2IOTA 3EDXB 2QF3A 2CHAB 3NPSA 5JB9S 2W7UA 4AB9A 1P05A 1CGHA 2FTLE 2ZZUH 3MHWU 3TIUA 1FONA 1MKWK 1NFXA 3PMAB 4B2BA 2SNVA 1D6WA 1XUHA 1L0ZA 3ATWA 4THNH 2BDBA 2H2ZA 2R3YA 1THPB