3LGUA

Y162a mutant of the degs-deltapdz protease
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
191
Chain Sequence
b'STDETPASYNLAVRRAAPAVVNVYNRGLLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPGQTITQGIISATGGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSPEGIGFAIPFQLATKIMDKLIRDGRVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
molecule tags Hydrolase
source organism Escherichia coli
publication title Allostery is an intrinsic property of the protease domain of DegS: implications for enzyme function and evolution.
pubmed doi rcsb
total genus 42
structure length 191
sequence length 217
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2010-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lguA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lguA02
2F9OA 3BF6H 1GHBF 4I8JA 1V2ST 4ISNA 1LVBA 2BVSH 1ABIH 1J17T 1AI8H 2FXRA 3ZVCA 3RXFA 2Z6BD 1YCPH 2IN2A 1TPAE 1A61H 1ZJDA 2D8WA 3MU0A 2QIQA 1PPEE 3RC5A 3UOUA 1VCWA 2V3OH 1LHDH 2W7UA 4BTTB 1CGIE 2XTTB 2W26A 1OWIA 4ZKRU 4U30A 2QN5T 2VGCB 3SQEE 2ZGHA 1Q31A 4CBNA 3TH4H 2TRMA 5FAHA 1IAUA 1MTSA 4HI3A 4Y8YA 3RP2A 1P2IA 1C1WH 1OXGA 3SJ8A 2CF9H 1RRKA 2VH6A 1KXBA 5HM2A 1NPMA 1O3CA 4KP0A 2FMJA 4B75A 2C8XB 3KHVA 2BY5X 1OP0A 1DM4B 2W3IA 6GCHG 3KQDA 3BN9A 2CJIA 5JDUB 4MPUA 4WH6A 4X6OA 1D3DB 4X6MA 2ILNA 3OX7U 2Z9GA 1O3GA 1TBQH 1VGCC 1PQ7A 2ZTXA 2C8ZB 3SUDA 3RXEA 3NCLA 3GDUA 3ZZ5A 3MO3A 1CT0E 1O3BA 3PO1B 1OWKA 4VGCC 1SQOA 1CQQA 1O3IA 2BY8X 1EJAA 1Y5UT 4TYDA 1A5GH 2ZEBA 1BITA 2SGDE 1QL8A 2UUKB 1Z6JH 1FAXA 4A1TA 1K1MA 5T6FA 3MTYA 1TGSZ 3RLWH 3TITA 3B9FH 3ZZ7A 1SFQB 4M7GA 1PPFE 1W13U 1BOQA 3FAOA 2D26C 1HAVA 4IGDA 3UFAA 3TGJE 4VGCB 2BX4A 1QJ6B 1Y3XA 3OY6U 1GJ9B 4XFQA 1PQ8A 3RXOA 1EPTA 1HAGE 1TMUH 4LOYH 3OU0A 1QQ4A 1UTOA 1D3QB 1HAHH 1AB9B 1YF4A 3MI4A 1HAIH 3SBKA 1C5UA 5HXFA 3TGKE 2SGAA 2STBE 4D8NA 1TIOA 4GPGA 5ESBA 1AFEH 3A7YA 5T6DA 4ABAA 3FZZA 1C5ZB 1EXFA 1O2RA 1C1UH 2SGQE 5GPIB 1F7ZA 4ZXXH 1F0RA 3KCGH 2G52A 1GBKA 1L4DA 1O5AB 3M3VA 2V0BA 3MH5A 1A0LA 2G5VA 3SU1A 5E0GA 1TALA 2J2UA 3AW1A 2G81E 2OTVA 1SLWB 2V3HH 1UO6A 1Y3UA 3VXEH 4BAHB 2G4TA 3BIVH 3P17H 4XBDA 3K6ZA 4ZKNU 2FOEA 4DW2U 1UHBA 3T29A 4AFSA 1O2PA 1UCYH 4IC5A 4JMYA 1NU9A 2ZDNA 3PWBA 1NRSH 1IQEA 2ZG0H 1RTKA 1QL7A 5JBTA 1P2OA 2XCNA 3W95A 4GUXA 4H42U 1UVPA 1ARCA 1DWDH 1Y3YA 5EODA 1EATA 4MTBA 1DY9A 3M61U 3RXTA 5DP5A 1D3TB 1SGPE 1C2HA 1GHAG 1GL1A 1ZJKA 1BHXF 3MU4A 2GMTC 4WY3A 4I32A 4I8GA 3P8GA 1NRPH 1SLXB 1GJDB 1GI4A 1TGCA 1LTOA 3NK8A 2XNIA 2SNWA 1VCQA 2ZI2H 1W7GH 3A88A 1C9PA 3BTTE 1YKTA 1TGBA 5BPEA 3PLPA 2J9NA 2RA3A 3LT3A 2GZ9A 3E3TA 3ENSB 3P95A 4YM9A 6CHAC 3O8RA 3M3TA 5FHTA 1LPKB 1ID5H 1J8AA 1ETSH 1DDJA 2OD3B 1ELBA 3GY6A 1WTHD 2A1DB 1YPKH 2H6MA 1O30A 1JOUB 4Y79A 3SV2H 1XUIA 4NWKA 1C5PA 1TMTH 2PW8H 3VB3A 4FUIA 4O3TA 5A8YA 4A1VA 4GVUA 4YZUA 5F03A 4K1EA 4A1XA 1WSSH 1SGQE 3GISB 2STAE 2V6NA 1IQKA 5HGGA 3MOCA 3QTVH 2Z3CA 1C5WB 2GZ8A 1ESAA 1LDTT 1Z1IA 1O2LA 4Q2KA 5GJ4B 2FOBA 1GHXH 2P93A 2YOLA 1YPLH 4THNH 1T8OA 4CH2B 3O8CA 1C1MA 1TABE 1WV7H 5AVDA 4X8UH 2A4GA 2O8LA 3LDXH 3PLBA 1V2VT 2EI6A 2V35A 4DGJA 4HGCA 2XBVA 1U6QA 4CHAC 5EXMA 3TIUA 4NA9H 3RU4T 3ZZAA 3MHWU 5FPSA 1O2HA 3S7HB 1C2FA 3U98H 1D9IA 1E34B 3TPIZ 2WYJA 4JYUH 2BXTH 1BJUA 1NS3A 1SPJA 4R8TB 3T27A 1IQIA 3ODFA 3SV8A 4YOIA 3RXUA 4X2VA 7LPRA 3M5OA 4A7IB 3LC5A 2CHAB 1MKWH 2O9QA 4SGAE 2HNTF 2VNTA 2KAIB 2Z9JA 1Z8JB 5PTPA 5C2ZA 3K65B 2A5KA 4INHA 3RUOA 1QY6A 1SGFA 2H9TH 2FOAA 1BDAA 3SU5A 3ELAH 4ZH8A 1KLIH 1O3DA 1NC6A 1SGNE 3V7TA 1RIWC 2OC7A 4X8TH 1C2LA 3S9CA 4O9VA 4TPYA 3RMNH 1F0SA 1YGCH 3SZNA 2ZIQH 3EA9A 2BDCA 1MU6B 1DE7H 1NY22 3LGTA 1TX6A 4B71A 1EJMA 1A0HB 2ZHFH 5CHAC 1XUGA 4Y6DA 1OP8A 2PKAA 3ZZ3A 4RN6A 1UCYE 5JBAS 1GJBB 2ANKH 5L6NH 4BTUB 1GJ4H 3A8CA 3FP8E 1MTUA 3BEUA 4K5ZA 1GI1A 4ASHA 1P11E 1UHBB 1SGDE 2ZU4A 4NA7A 1GCTC 3ODDA 2BD4A 4IBLH 3OSYA 2ZGJA 1B0FA 4Y11E 1HRTH 2K1QA 1C5YB 1H8IH 2UUFB 4FUFA 4SGBE 3SU3A 1DANH 1AE5A 3LC3A 3DUXH 3RXAA 3V0XA 2J4IA 2XBXA 1WTGH 2O8UA 2AEIH 1VGCB 3UWIA 3QZRA 3V13A 1IQJA 1C4U2 3M5LA 4H6SB 2OQ5A 4O97A 2TPIZ 4K69A 1NN6A 2FLBH 1V2LT 3F9FA 3QLPH 2FO9A 3SQHE 5DGJA 3TNTA 3A7ZA 4KTSA 2GP9B 1AVGH 2J94A 1HJAB 3PLKA 1GI8B 2CGAA 1MBQA 5F8TA 1XXDA 1BRCE 2ZQ2A 2C4FH 2Y5GA 1C1SA 2BY6X 2BY7X 2Z94A 1W3CA 1Y3WA 2QXHA 4UFEH 5J4QA 1HV7A 2WYGA 3E90B 1DUEA 1P12E 1W8BH 2P8OC 2BDAA 3ZVAA 2PTNA 3ZZ9A 1ZHPA 1G36A 1ZLRA 3ITIA 2OC1A 1RTFB 1OOKB 2WV4A 1L4ZA 2A31A 2O8TA 2P94A 5C1YA 4Z6AH 1PPGE 1GCDA 1THSH 2F9PA 1G30B 2ZDLA 4NIYA 1RD3B 1W12U 5LH8A 1LQEA 1TRNA 3A81A 1BHXB 1PPCE 1MAYA 3LOXA 2QXIA 2ZO3H 1GBFA 1BUIA 1GBTA 1UK4A 1ESBA 4NIXA 3GCOA 3QO6A 6GCHF 2ZZUH 2BLVA 5H4IB 1S6FA 1DWCH 3ESTA 2VINA 1ELAA 1BTHH 2XXLA 4FUEA 3U1JB 4WMEA 1QQUA 1GBIA 1BTXA 4K2YA 4ZKOU 4DG4A 1O32A 4GAWA 3HK3B 1GVLA 1F92A 3M5NA 2Q6FA 4X6PA 2ZCKP 1MTVA 1TNGA 4CR5A 1TPOA 1JWTA 2ZHQH 1O2GH 3RC6A 3PMHB 2IOTA 4D9RA 1O31A 1HAYB 2IPHA 3GYMA 2ANYA 2ZGBH 3IG6B 3UR6A 2B8OH 2BD9A 2H9EH 4FUDA 1NFYA 1SQTA 3HATH 1SGCA 1YPJH 1TWXB 2VIVA 2W3KA 1Y59T 1J9CH 3E16B 3UOPA 5A0BA 5LPEA 1UTJA 1YPGH 1UVUH 2BQ7B 5DJ7A 2BZAA 2Q6GA 3AVZA 4CRCA 1ELFA 1GI3A 3K2UA 1HGTH 2BHGA 3VGCC 4J1YA 1HYLA 4UEHH 1ZMNA 2CF8H 2Q1JA 1K22H 1BJVA 1A0JA 2W5EA 4KTCA 4OS1A 5C20A 3MO9A 2GD4B 4O03A 4ZHAA 3TVJB 1G32B 1SLVB 2VWNA 4IN1A 1DUAA 2BTCE 1YLCA 2RDLA 1KSNA 1GDNA 3BG4C 5DG6A 1G2LA 3UUZA 4DT7B 3DHKH 3KNXA 3DT0H 1HAOH 3MFJA 1GBMA 1MKXK 5E0HA 4JYTA 8GCHG 2OP9A 1TPSA 1Z8GA 1D6RA 1THRH 2TGAA 1KXEA 2BQ6B 1F0UA 5DP8A 3EE0B 2GCHG 3SGQE 2UUYA 5IDKA 1UTMA 1RIWB 3RXGA 3PTBA 3TLOA 3QDZB 2PKAB 3T25A 1P0SH 1E37B 3SHCH 1PYTC 3DD2H 1SI5H 2P3FH 1C4V2 2J38A 3UNRA 1S0QA 1HAZB 1O2YA 1O2JA 1SC8U 2ZECA 1GMCG 1P06A 2ZGXH 1MU8B 5FBEA 3MNCA 1SGFG 1EB2A 4YLUA 1BRUP 1SVPA 1D4PB 1T4UH 1P3EA 5C67A 3GY7A 3U9AH 4AN7A 3ZZDA 4INKA 3UREA 2GVFA 1GGDB 1ANCA 2Z3EA 1BQYA 7KMEH 2ZF0H 1PPZA 2VVVA 5DPAA 1ANBA 4NIWA 1XKAC 3RXJA 2ZDMA 4XDEA 4ABBA 2PFEA 3RM0H 5JB9S 3G01A 2FODA 3NXPA 3L6PA 1K1OA 2XYAA 3P6ZB 4I33A 1DWBH 3ZVDA 4XE4A 1DSUA 1ELEE 5B6OA 4YO9A 3A7XA 4GHTA 1EZUC 5L2YH 5JBBS 2GZ7A 1SHYA 1TRYA 1SOTA 1CHOG 3BTEE 1E38B 1GJ8B 3U8OH 1EOLA 2TGTA 1V2OT 5EGMA 1NFXA 1Y5BT 5LPFA 8LPRA 1G3EA 3TK5A 1T7CA 4XSKU 4GLYA 1Z7KA 1G2MA 3UNSA 5GXPA 3SNDA 1HJ9A 2DE9A 5FBIA 2I6QA 4TWYA 1EAUA 1QRWA 1TBZH 4ABGA 1M9UA 1ANDA 1TE0A 4IW4E 1FJSA 3T26A 4E06H 1SB1H 4IC6A 4AOQA 3MU8A 3ZVFA 2BOHB 1TMBH 3EGKH 1G3CA 2QF3A 3GY3A 2FM2A 3RU4D 3U1IB 4ESTE 1UVTH 1QB6A 2SFAA 4GCHF 2BB4A 1KDQA 2BVXH 5LGOA 1N6YA 3RLYH 1V6DA 2WUBA 3RXQA 1MAXA 1WQVH 1IHTH 1P02A 4JZ1A 2ANWA 2FWWA 3KL6A 4WXVA 1UK2A 1FLEE 5DP7A 4A6LA 1MCTA 1W2KH 1Q2WA 4CH8B 1GHAF 2WPJS 3S7KB 1NT1A 4LXBH 4DOQA 1C2EA 2AIQA 2BLQA 4K1SA 4YT7H 1H9LB 3UWJH 2EI7A 1UK3A 2YNBA 3HKIB 3LGWA 3P8FA 1TNIA 3AAUA 3BTDE 3ZZ8A 1ZSKA 2O8WA 1ZTKA 1YP9A 1LHCH 4YLQH 4INLA 1NZQH 2ZU5A 5AFYH 5CE1A 3MMGA 4KTUA 5E8EH 3T28A 2PHBA 1MQ6A 4Y76A 1LHGH 2FOFA 2ZKSA 2HOBA 4UE7H 1TOCB 3RXIA 1IQHA 3GOVB 1TQ7B 1W0ZU 2ZPRA 5I25A 4AFQA 1RGQA 4X2YA 3RXVA 1PQAA 2QXJA 3P8NA 1N1LA 1GJ7B 3UR9A 1N8OC 3A87A 1BRAA 2FYQA 4K3JA 2ZHWH 3PMAB 1O2UA 1K9OE 3UTUH 1IQNA 1KYNA 1ETRH 3T2NA 4E7NA 4YTAA 2CMYA 2PGQB 2JETB 1K21H 3SNBA 1YC0A 3PMBB 2OUAA 3S9BA 3VB5A 2AERH 1OX1A 2BD8A 2ZDAH 1BA8B 2AIPA 4JZDH 4OS2A 1TA6A 1D3PB 2B7DH 1AKSB 1RXPA 2G8TA 2AGEX 1O3LA 3FZDA 5FX6A 4AFUA 2HPPH 4Y8XA 1AY6H 3M36A 2FS9A 5IYTA 1YYY1 4Y7AA 3SNAA 4CRFA 1VJ9U 2OC8A 2P3TB 1MKXH 2G00A 1UTPA 1JIMA 1F2SE 3SGBE 3O8DA 2Y7ZA 1ZTJA 1T4VH 3D49H 4JK6A 1YCPK 1OWDA 6LPRA 1T8MA 1ZYOA 4I8LA 2B5TB 3LONA 2F9VA 4FU8A 1S83A 4HTCH 3QN7A 2FOHA 1MTNC 1CA8B 1WQSA 1NU7B 3PO1C 2BM2A 1KIGH 1GBAA 3ZYEA 1KLJH 1S82A 3TJUA 3L33A 2Y5FA 1HBTH 3SU2A 2ZC9H 4XOJA 4Q80A 3TJOA 2NU0E 1DLEA 3SU0A 1GHZA 2R2MB 1GI5A 1MTNB 3RMOH 1EB1H 1GG6B 3SUEA 1PPHE 4AZ2B 3M5MA 4YOJA 1ELDE 4Y10E 4ABHA 4I8HA 1QB9A 5E2OA 4BOHA 1QFKH 1QB1A 2GT7A 2HVXA 2C90B 3EYDA 1GVKB 1OS8A 1GI9B 1GI2A 1INCA 4AGKA 2R0KA 1ZRBA 3A84A 1QRZA 4HZHA 1LVYA 1O2MA 3P92A 1ZGVA 1W14U 3KGPA 5GIBA 1CU1A 4GHQA 3D23A 4MPWA 3RXMA 4UFGH 1TFXA 1ETTH 1X7AC 1B5GH 2Z9KA 2GV7A 1C2DA 1S6HA 2A45B 1JIRA 1RFNA 4K60A 8GCHF 3E8LA 3LGVA 1C2GA 3BTQE 1AGJA 1GHYH 1W10U 4ABDA 4AX9H 1O2XA 2HGTH 1IQFA 1C5TA 3KQCA 7ESTE 1LCYA 3EA8A 3B8JA 5F8XA 1HAVB 2G55A 2Y5HA 3A8AA 4UONA 3OYPA 2Y6TA 4BANB 5C5OA 3SI4H 3SU4A 3KF2A 1YPHC 1BMLA 1NROH 1UTLM 2XBWA 1ARBA 1DVAH 2QC2A 2PKSC 1TRMA 1XUHA 4X8VH 7GCHF 3QGJA 1AQ7A 1DWEH 4A5TS 4I7YH 1AIXH 3BTFE 1SQAA 5A8ZA 1C2IA 1O5CB 3QX5H 4DURA 1W7XH 2GTBA 2PWXA 1TA2A 1KXCA 1O2TA 4BAKB 2R0LA 4J2YB 2GV6A 4MQAA 2WPMS 2QCYA 1FIZA 1AVXA 4ZROA 4CRGA 3OTJE 5EU8A 1OP2A 1O3FA 1MBMA 1Y8TA 4YT6H 1FN8A 4K8YA 5C1UA 1G9IE 1SGIB 5HYOA 1ELVA 1P2QA 3HGNA 5A0CA 4X2WA 3VB7A 2J92A 2WPLS 3D62A 3SV7A 3ZZ6A 3GCHB 5K7RA 1ACBE 4B76A 3SNCA 2BDIA 5DP6A 1Z6EA 1WU1A 2ZFPH 1O34A 3E91A 5T3HA 5C5NA 3KIDU 3TH2H 3LJOA 3LU9B 1HNEE 2A7CA 4NWLA 3MNSA 4NA8A 4AGJA 4ISLA 1P57B 2H1UA 1SLUB 1ABJH 4JZEH 2PTCE 3QTOH 1LHEH 3QUMP 3Q00A 4NSYA 5EQRA 1J15A 3EDXB 1AKSA 3FP7E 2B0FA 3VEQB 1ANEA 3R3GB 2HRVA 1IQLA 1C1NA 1T31A 3A7WA 5EW2H 1O2WA 1BTWA 2JH0D 4K8BA 3NKKA 4DIHH 3TNSA 1DPOA 1ZHMA 1GVZA 3BTME 5HM9A 2JH6D 4U2WA 1HIAA 2AGGX 1C1VH 3CP7A 2BD5A 2HNTE 1RJXB 1C5QA 2CXVA 2ZCHP 5GDSH 1XM1A 2F9BH 1TONA 1UVOA 2A4QA 2JKHA 3RXCA 4XBCA 2ZFFH 4TY7A 1ELCA 1ZGIA 1XKBC 1AVWA 3IWMA 3EQ0H 1BZXE 1A4WH 1P8VC 5FPTA 3PTNA 1ZPBA 5JPMH 3PB1E 1NFWA 2D1JA 1V2JT 1QJ7B 1N6XA 1W0YH 1V2NT 1PFXC 1XX9A 2CV3A 2VJ1A 1ZPZA 1G3DA 1OYQA 1GHBG 4IMZA 5AF9H 4OGXA 2GCHF 3BV9B 2FESH 5SGAE 3AW0A 2SGPE 4ZUHA 1A1RA 1WBGB 2VIOA 2WV5A 1GJAB 1P09A 2PUQH 1GBBA 2OINA 1XVOA 5DP9A 1BTUA 5EQQA 1CBWB 1A5HA 1QRXA 4NG9H 3EA7A 3TGIE 1LHFH 2FIRH 2DUCA 4YOGA 4NZLA 2JH5D 3LGUA 1EUFA 3TJVA 2UWLA 1P3CA 1YPHE 1O3JA 4ABEA 1MQ5A 2ZP0H 2FI3E 1FDPA 1JRTA 4JYVH 2EA3A 4U01A 3RXHA 4TWWA 4BNRA 3A82A 2FS8A 1GHVH 4Y71A 2Y82A 1GBDA 4F4OC 1SGYE 3V12A 1HAPH 5F6MA 1MTWA 1XMNB 3TH3H 1V2QT 1YBWA 4DCDA 1O0DH 3UIRA 2A32A 1H4WA 1SGTA 1EP6A 1C1OA 3I29A 2A7JA 3PROA 2BOKA 1WUNH 5EXLA 1O3EA 2J34A 2QF0A 4AB8A 1Z8RA 2R3YA 1O2SA 1L0ZA 1ZMLA 2BXUH 2AMQA 1MUEB 1EX3A 2FYRA 1BB0B 4LK4A 3SJIA 3TJNA 1HB0B 1AFQC 3SU6A 4MNVA 5A8XA 3VGCB 1MD8A 4LZ1H 3LJJA 4IS5A 8KME2 2BD2A 2ZFQH 4CRAA 3BTWE 1EPTC 1RS0A 3W94A 3LPRA 2TBSA 4XBBA 1FIWA 2H5CA 4FUGA 3SJOA 1K1LA 1SR5C 4B74A 1KTSB 1Z1JA 4GSOA 1P01A 2XC0A 2Z9IA 1IQGA 2BMGB 4NCYA 4JZIA 1L1JA 1O2KA 1TLDA 3FP6E 3FANA 2Y7XA 3QGNB 4WMDA 2QXGA 4OS5A 2FPZA 5L2ZH 2VIPA 2ZWLH 3VFEA 1GJ6A 1CE5A 1S0RA 3STJA 2R3UA 1WAYB 1FQ3A 2FZZA 3A86A 1F5RA 1EKBB 1CT2E 4WJG2 1TB6H 1QJ1B 2BD3A 2PSXA 4AB9A 1WCZA 3K6YA 4QT8C 5DKMA 5EQSA 3HK6B 2EI8A 1FY5A 1LPZB 3JZ2B 1E0FD 4H6TA 1P10A 1QL9A 1J14A 4NFEA 1C2KA 1J16A 1K1NA 2P8OB 4OS4A 1AUJA 2G5NA 4Q7XA 1KTTB 4Y0ZE 1BCUH 1JBUH 1D6WA 1ZRKA 1FY4A 3SJ9A 1O38A 1SGRE 1IOEA 1ORFA 3E1XB 1AFQB 1HJAC 1XUJA 1T8NA 4RSPA 3LH1A 2FTMA 1V2PT 1NO9H 1FPHH 1YM0A 2QV1A 5K0HA 1GG6C 2OCVB 1AWHB 1O5GH 1QURH 4GCHG 2QYIA 4BXWA 3URDA 3A8DA 2F9NA 1VR1H 1P05A 2J95A 4CRBA 2PV9B 3SJKA 2KAIA 2AGIX 1O3AA 4ABJA 3GY8A 3GDVA 3A7VA 4BXSA 3LIWA 3DFJA 4PROA 1LKBA 5AFZH 1MD7A 1HXEH 1LQDB 3MWIU 1OWJA 2GDEH 5BRRE 1BT7A 1A7SA 5E2PA 4X1RU 1TBRH 2A2XH 2ZDKA 1QCPA 4X1NU 2F91A 1EJNA 1XUKA 1SBWA 4MNWA 2A5IA 4X1PU 1GBLA 1ZPCA 3MNBA 3LGYA 2A4OA 4JK5A 3UQVA 3NPSA 1VITG 2BDYA 1GJCB 2EEKA 2FTLE 4WWYA 2OXSA 1CBWC 1S81A 2G4UA 1O2ZA 1O5EH 1P2KA 4IN2A 1ZSLA 1A3EH 4FVBA 1C5SA 1EASA 1YPEH 1CA0B 3CS7A 1JXPA 1TX7A 2YNAA 3RXRA 1L1NA 1O33A 4D7GA 1S85A 4WXIA 1P03A 1EAWA 3FFGA 3QWCH 2H5DA 2HWLB 5ABWA 4X2XA 1C5LH 1NRNH 5C3NA 1C5NH 2HNTC 1TYNA 3LKWA 3F6UH 5JB8S 1K1IA 4MVNA 1DXPA 2AYWA 4FUJA 4UDWH 5EPNA 1S5SA 3U69H 1V2KT 4Y8ZA 1EZSC 1HDTH 2HLCA 2H9HA 3T5FH 1PJPA 4R0IA 1Y3VA 2ZDVH 1FY1A 1YLDA 1JRSA 1GMHF 2CHAC 1NTPA 2Z3DA 5FPYA 1O3OA 1A2CH 2ALPA 3GY2A 1O3HA 2Y80A 4DY7B 2BD7A 3VXFH 1HAXB 1GI7B 1O3NA 2ZTYA 1QHRB 4ZKSU 1GMHG 4NZQA 4Y7BA 3UPEA 1VZQH 1V3XA 5A0AE 4BAOB 1QNJA 1L2EA 2P16A 1OYTH 2ESTE 1MZAA 3A7TA 2ZA5A 5CMXH 3MU5A 2FI4E 1SG8B 1V2UT 4OS7A 1PPBH 2PUXB 2RG3A 3SOSA 1SFIA 1OSSA 2ZTZA 1HLTH 4CHAB 1H9HE 3A85A 1EP5A 3AAVA 2WPHS 3QZQA 1O5DH 1A5IA 1DFPA 1NRQH 1K1PA 1AO5A 2P3UB 3ATLA 1BTYA 3VPKA 2THFB 1C5VA 1HJ8A 4X6NA 1HPGA 5JYIA 1W11U 2Y81A 4NFFA 1BMAA 5G4BA 1AUTC 2VWMA 1Q3XA 3SO3A 2ZU3A 1EQ9A 5GCHG 4KGAA 2NU4E 2O8MA 2FOMB 1SHHB 1XUFA 4FXGH 3BSQA 4F49A 3A83A 1DOJA 3A80A 4WVPE 4DVAU 1C5RA 1AZ8A 1T8LA 4B1TA 2XCFA 2A0QB 1HFDA 1O36A 3ZVGA 3MYWA 2R9PA 2ZU2A 3E0NB 3DA9B 3N7OA 1AMHA 1FAKH 4FUCA 4Z0KA 2G51A 2PR3A 3GICB 3BTKE 3S9AA 3M3SA 1DXWA 1A3BH 1ZMJA 4MNYA 2BDGA 6CHAB 1EZQA 2AMDA 1GMCF 2ZGCA 1UJ1A 3H5CB 2C8WB 2VWLA 3C1KA 1LO6A 1CSOE 5A2MH 1NESE 3I78A 2PKSB 3PWCA 5AHGH 3SNEA 2VIQA 2PSYA 1V2RT 1AZZA 1MMJN 1OPHB 3HGPA 1FV9A 3F9GA 3NWUA 2F83A 3KQBA 3BTGE 2AH4X 2GMTB 3F1SB 1C1TA 1EOJA 2VIDA 1VITH 1DICA 2ZFTA 1BIOA 1BMNH 1TAWA 1FY8E 1CGHA 5C1XA 2GGVB 1LVMA 2QAAA 4WF8A 3U8TH 5GCHF 2BQWB 3SI3H 4E05H 1KDQB 3MNXA 1LPGB 1C4Y2 3RDZA 1GGDC 2WPIS 3KQEA 4MG3A 2XWBI 1LMWB 1SMFE 3Q77A 1CA0C 3BG8A 3F68H 2A7HA 1THPB 2RA0A 3WY8A 3RXBA 5DP4A 4B2CA 4NIVA 2AMPA 1DITH 1DY8A 4OS6A 1K1JA 2BVRH 2FOGA 2VWOA 1KY9A 1WYKA 1ZHRA 1C2JA 3TU7H 4FUBA 2ZPQA 2XC4A 3ZV8A 2WPKS 1GHWH 4I31A 5TCCA 4ZXYH 2F9UA 2HALA 4BAMB 4UD9H 3GCTF 1H1BA 3I77A 4D76A 2FDAA 1O2OA 1DX5M 1PQ5A 2A5AA 2ODPA 1FPCH 2ZFSA 5EW1H 1AB9C 1O5FH 2ZNKH 1UVSH 1FY3A 3E6PH 3U8RH 2W7SA 5F8ZA 4AORA 2OBOA 3SV6A 3UY9A 2GKVE 5FXLA 4X1SU 2C3SA 3BG4B 3ZZCA 1TNJA 4AG1A 5TCAA 3M7TA 2UWOA 3MO6A 1FI8A 4E7RG 2DE8A 1CVWH 2GT8A 1O35A 1DLKB 1F5LA 1KLTA 1E36B 1ZOMA 1DS2E 2FP7B 1BMMH 1GBJA 1A46H 5EOKA 1MCVA 1UTNA 1DSTA 1BBRK 1C9TA 1C1RA 1O2NA 3PYHA 4LZ4B 1GBCA 3RU4E 4Q7YA 1TPPA 3SHAH 2ZU1A 3M35A 3RMLH 3ZV9A 1TGTA 1LKAA 3KEEA 3SW2B 1FUJA 3O8BA 4B2AA 4WMFA 4ZHMU 2AFQB 2LNCA 3A89A 2QY0B 3VB4A 3PM3A 4UFFH 4A92A 1HIAB 4CRDA 3MH7A 4BAQB 1KXDA 5L30H 2SGFE 1UTKA 3LH3A 4FU7A 4RKJB 3RC4A 1ELGA 2RCEA 3ZZBA 3HPTB 5GWZA 2D2DA 3GY4A 2JETC 2NWNA 1CHGA 2XBYA 1V2MT 1P2NA 2VH0A 4X0WU 1EAXA 1LVOA 2XRCA 4K1TA 5EG4A 3GDSA 1QBNA 1BBRH 2VGCC 2UWPA 1Y5AT 1TNHA 1FONA 3P70B 1KXFA 2OC0A 1N8OB 2XC5A 4ZAEA 4MLFB 1MZDA 1AD8H 3HKJB 2VVCA 1B0EA 4HFPB 1VJAU 5E0JA 1FMGA 1DT2A 2FOCA 4UFDH 3E0PB 1C5XB 2WINI 1GDQA 1YCPM 1GJ5H 2XWAA 1ESTA 1P9SA 3M7UA 1P04A 1RTLA 3BEFB 5T6GA 3H7TA 4FUHA 1GMDF 3Q3XA 1F5KU 5FX5A 3F9HA 3RXLA 3UQOA 2BYAX 1EPTB 2Q6DA 1BTPA 2C8YB 1PYTD 1QTFA 1MH0A 5ESTE 3BTHE 1NFUA 1P2MA 3PV4A 5JBCS 1GI0A 1GBHA 3IITA 2BX3A 2VB0A 1TGNA 1TNKA 3ZVBA 3H7OA 2FLRH 1VITF 1K2I1 3P8OA 3GCTG 2BDHA 3MU1A 3RXSA 3NUMA 1UMAH 1HXFH 2AS9A 1O3KA 3RXDA 1O3PB 2ZHEH 4FU9A 4JZFH 2F3CE 1TNLA 3TK9A 1H8DH 3A8BA 4ABFA 1O39A 3EAJA 2HPQH 4KELA 5DO4H 3LGIA 4NSVA 3RMMH 5EPYA 1CO7E 1S84A 1GDUA 4DJZB 5EXNA 4ISIH 3NZIA 3SUFA 1QA7A 2A2QH 1C2MA 5J4SA 1V2TT 2ODQA 1H9IE 2BLWA 1BBRE 2FX6A 2ZPSA 3SORA 1MKWK 4BTIB 1C5MD 1GCTB 1F0TA 5FCRA 4D9QA 1QA0A 2VIWA 1TQ0B 1V2WT 1FXYA 1GWAA 9ESTA 1GPZA 1YPMH 2FEQH 4AYYB 2XW9A 3ATMA 1TX8A 3T62A 2PGBB 5CHAB 1C1PA 2ZHDA 1ZTLA 5LPRA 2ODYB 2ASUB 2GX4A 3CENA 3MH6A 1AE8H 3M7QA 1CGJE 3DFLA 1T32A 1OWEA 1HCGA 1OKXA 2CN0H 1NRRH 4B2BA 2VU8E 1SOZA 3SUGA 2VVUA 1OWHA 3R0FA 2Z7FE 1SL3A 3TK6A 1O2VA 1UTQA 2B9LA 1QBOA 4AG2A 2ULLA 3V3MA 2BZ6H 2R2WU 3M37A 4Q7ZA 4CBOA 3AASA 4MPVA 4X8SH 5ETXA 1B7XB 4KKDA 1O3MA 2GDDA 4ZMAH 5I46H 1NM6A 2GCTC 1EZXC 1VCPA 5TJXA 3ZVEA 1QGFA 1BTZA 1AWFH 1Z71A 3CS0A 3B23B 3S0NA 3K9XB 4B73A 3C27B 2ZCLP 1ZSJA 2GCTB 3SV9A 3GCNA 2NU2E 3BIUH 3GY5A 1GBEA 1G3BA 2P95A 1O2IA 2M5TA 4MNXA 4X1QU 1FNIA 7GCHG 3ZYDA 4ISHH 3S69A 4AYVB 1ZR0A 1XXFA 3FVFB 4Y0YE 1GI6A 1ELTA 1WOFA 5HMAA 2H2ZA 3JZ1B 4CREA 2NU3E 4DIIH 3SGAE 1O2QA 1O5BB 3ATWA 3L3TA 2QA9E 2TIOA 2ZFRH 5A09A 1SGEE 3SN8A 3STIA 2EC9H 2I6SA 2OQUA 2WUCA 1C1QA 2PLXA 2OLGA 1AHTH 3BEIB 4U32A 1UCYK 1JMOH 2OBQA 3RXKA 1AU8A 4H4FA 1BRBE 3GCHC 4I8KA 8ESTE 3UNQA 2TGPZ 1SSXA 1TOMH 3VB6A 2FI5E 3URCA 1K28D 1XVMA 1HUTH 2QGRA 2Z9LA 4WH8A 3Q3KA 1CHOF 1KXAA 2P59A 1FZZA 3ATIA 3F9EA 4AFZA 2SGEE 6ESTA 1O37A 1QBVH 4FVDA 1E35B 3ATKA 4ZHLU 4ISOA 4MPXA 1L1GA 1QR3E 3PMJA 3Q3YA 1P2JA 5DK1A 1AN1E 1ZZZA 1G37A 1GL0E 1P9UA 3D65E 2A4RA 4JCNA 4ABIA 1FN6A 3RXPA 1GMDG 2FX4A 3ZZ4A 4D7FA 2ZQ1A 1QIXB 5FCKA 3GYLB 2UUJB 4CR9A 2IJOB 2NU1E 3KN2A 4NGAH 1IHSH 3Q76A 4OGYA 3MH4A 3QK1A 1IQMA 3OY5U 4MDSA 4RKOB 9LPRA 4IMQA 4TY6A 2BY9X 4O3UA 4YESB 2BDBA 2BLOA 2ALVA 1CT4E 1EAIA 2C93B 1C5OH 3RM2H 4TPIZ 2ANMH 5DP3A 2SNVA 2LPRA 1Z8IB 2TGDA
chains in the Genus database with same CATH superfamily
2F9OA 3BF6H 1GHBF 5HKKD 4I8JA 1V2ST 4ISNA 1LVBA 2BVSH 1ABIH 1J17T 1AI8H 2FXRA 3ZVCA 3RXFA 2Z6BD 1YCPH 2IN2A 1TPAE 1A61H 1ZJDA 2D8WA 3MU0A 2QIQA 2J5UA 1PPEE 3RC5A 3UOUA 1VCWA 2V3OH 1LHDH 2W7UA 4BTTB 1CGIE 2XTTB 3FN8A 2W26A 1OWIA 4ZKRU 4U30A 2QN5T 2VGCB 3SQEE 2ZGHA 1Q31A 4CBNA 3TH4H 2TRMA 5FAHA 1IAUA 1MTSA 4HI3A 4Y8YA 3RP2A 1P2IA 1C1WH 1OXGA 3SJ8A 3OFND 2CF9H 1RRKA 2VH6A 1KXBA 5HM2A 2XOKD 1NPMA 1O3CA 4KP0A 2FMJA 4B75A 2C8XB 3KHVA 2BY5X 1OP0A 3WW7A 1DM4B 2W3IA 6GCHG 3KQDA 3BN9A 2CJIA 5JDUB 4MPUA 4WH6A 4X6OA 1D3DB 4X6MA 2ILNA 3OX7U 5C17A 2Z9GA 1O3GA 1TBQH 1VGCC 1PQ7A 2ZTXA 2C8ZB 3SUDA 3RXEA 3NCLA 3GDUA 3ZZ5A 3MO3A 1CT0E 1H8ED 1O3BA 3PO1B 1OWKA 4VGCC 1SQOA 1CQQA 1O3IA 2BY8X 1EJAA 1Y5UT 4TYDA 1A5GH 2ZEBA 1BITA 2SGDE 1QL8A 2UUKB 1Z6JH 1FAXA 4A1TA 1K1MA 5T6FA 3MTYA 1TGSZ 3RLWH 2HLDD 3TITA 3B9FH 3ZZ7A 1SFQB 1W0KD 4M7GA 1PPFE 1W13U 2J98B 1BOQA 3FAOA 2D26C 1HAVA 4IGDA 3UFAA 3TGJE 4VGCB 2BX4A 1QJ6B 1Y3XA 4RT0A 4XD7D 3OY6U 1GJ9B 3NRLA 4XFQA 1PQ8A 3RXOA 1EPTA 1HAGE 1TMUH 4LOYH 3OU0A 1QQ4A 1UTOA 1D3QB 1HAHH 1AB9B 1YF4A 3MI4A 1HAIH 3SBKA 1C5UA 5HXFA 3TGKE 2SGAA 2STBE 4D8NA 1TIOA 4GPGA 5ESBA 1AFEH 3A7YA 5T6DA 4ABAA 3FZZA 1C5ZB 1EXFA 1O2RA 1C1UH 2SGQE 5GPIB 1F7ZA 4ZXXH 1F0RA 3KCGH 1E1RD 2G52A 1GBKA 1L4DA 1O5AB 3M3VA 2V0BA 3MH5A 1A0LA 2G5VA 3SU1A 5E0GA 1TALA 5CDFE 2J2UA 3AW1A 2G81E 2OTVA 1SLWB 3OEHD 2V3HH 1UO6A 1Y3UA 3VXEH 4BAHB 2G4TA 3BIVH 3P17H 4XBDA 3K6ZA 4ZKNU 2FOEA 4DW2U 1UHBA 3T29A 4AFSA 1O2PA 1UCYH 4IC5A 4JMYA 1NU9A 2ZDNA 3PWBA 1NRSH 1IQEA 2ZG0H 1RTKA 1QL7A 5JBTA 1P2OA 2XCNA 3W95A 4GUXA 4H42U 1UVPA 1ARCA 1DWDH 1Y3YA 5EODA 1EATA 4MTBA 1DY9A 3M61U 3RXTA 5DP5A 1D3TB 1SGPE 1C2HA 1GHAG 1GL1A 1ZJKA 1BHXF 3MU4A 2GMTC 4WY3A 4I32A 4I8GA 3P8GA 1NRPH 1SLXB 1GJDB 1GI4A 1TGCA 4I86A 1LTOA 3NK8A 2XNIA 2SNWA 1VCQA 2ZI2H 1W7GH 3A88A 1C9PA 3BTTE 1YKTA 1TGBA 5BPEA 3PLPA 2J9NA 2RA3A 3LT3A 4DT4A 2GZ9A 3E3TA 3ENSB 3P95A 4YM9A 6CHAC 3O8RA 3M3TA 5FHTA 1LPKB 1ID5H 1J8AA 1ETSH 1DDJA 2OD3B 1ELBA 3GY6A 1WTHD 2A1DB 1YPKH 2H6MA 3DSGA 3CNRA 3KYGA 1O30A 1JOUB 4Y79A 3SV2H 1XUIA 4NWKA 1C5PA 1TMTH 2PW8H 3VB3A 4FUIA 4O3TA 5A8YA 5EJLA 4A1VA 4GVUA 4YZUA 5F03A 4K1EA 4A1XA 1WSSH 1SGQE 3GISB 2STAE 2V6NA 1IQKA 5HGGA 3MOCA 3QTVH 2Z3CA 1C5WB 2GZ8A 1ESAA 1LDTT 1Z1IA 1O2LA 4Q2KA 5GJ4B 2FOBA 1GHXH 2P93A 2YOLA 1YPLH 4THNH 1T8OA 4CH2B 3O8CA 1C1MA 1TABE 2J98A 1WV7H 5AVDA 4X8UH 2A4GA 2O8LA 3LDXH 3PLBA 1V2VT 2M2AA 2EI6A 2V35A 4P00A 4DGJA 4HGCA 2XBVA 2EY4C 1U6QA 4CHAC 5EXMA 3TIUA 4NA9H 3RU4T 3ZZAA 3MHWU 5FPSA 1O2HA 3S7HB 1C2FA 3U98H 1D9IA 1E34B 3TPIZ 2WYJA 4JYUH 2BXTH 1BJUA 1NS3A 1SPJA 4R8TB 3T27A 1IQIA 3ODFA 3SV8A 4YOIA 3RXUA 2JJ1D 4X2VA 7LPRA 3M5OA 4A7IB 3LC5A 2CHAB 1MKWH 2O9QA 4SGAE 2L6OA 2HNTF 2VNTA 2KAIB 1YLNA 2Z9JA 5EJZA 1Z8JB 5PTPA 5C2ZA 3K65B 2A5KA 4INHA 3RUOA 1QY6A 1SGFA 2H9TH 2FOAA 1BDAA 3SU5A 3ELAH 4ZH8A 1KLIH 1O3DA 4AC9A 1NC6A 1SGNE 3V7TA 1RIWC 2OC7A 4X8TH 1C2LA 3S9CA 4O9VA 4TPYA 3RMNH 1F0SA 1YGCH 3SZNA 2ZIQH 3EA9A 2BDCA 1MU6B 1DE7H 1NY22 5C0UA 3LGTA 1TX6A 4B71A 1EJMA 1A0HB 2ZHFH 5CHAC 1XUGA 4Y6DA 1OP8A 5EJ1A 2PKAA 3ZZ3A 4RN6A 1UCYE 5JBAS 1GJBB 2ANKH 5L6NH 4BTUB 1GJ4H 3A8CA 3FP8E 1MTUA 3BEUA 4K5ZA 1GI1A 4ASHA 1P11E 1UHBB 1SGDE 2ZU4A 4NA7A 1GCTC 3ODDA 2BD4A 4IBLH 3OSYA 2ZGJA 1B0FA 4Y11E 1HRTH 2K1QA 1C5YB 1H8IH 2UUFB 4FUFA 4SGBE 3SU3A 1DANH 2KCPA 2KR7A 1AE5A 3LC3A 3DUXH 3RXAA 3V0XA 5F53A 2J4IA 2XBXA 1WTGH 2O8UA 2AEIH 1VGCB 3UWIA 3QZRA 3V13A 1IQJA 1C4U2 3M5LA 5KECA 4H6SB 2OQ5A 4O97A 2TPIZ 4K69A 4B6EA 1NN6A 2FLBH 1V2LT 3F9FA 3QLPH 2FO9A 3SQHE 5DGJA 3TNTA 3A7ZA 4KTSA 2GP9B 1AVGH 3UB0A 2J94A 1HJAB 5HIYA 3PLKA 1GI8B 2CGAA 1MBQA 5F8TA 1XXDA 1BRCE 2ZQ2A 2C4FH 2Y5GA 1C1SA 2BY6X 2BY7X 2Z94A 1W3CA 1Y3WA 2QXHA 4UFEH 5J4QA 1HV7A 2WYGA 3E90B 1DUEA 1P12E 1W8BH 2P8OC 2BDAA 3ZVAA 2PTNA 3ZZ9A 1ZHPA 1G36A 1ZLRA 3ITIA 2OC1A 1RTFB 1OOKB 2WV4A 1L4ZA 2A31A 2O8TA 2P94A 5C1YA 4Z6AH 1PPGE 1GCDA 1THSH 2F9PA 1G30B 2ZDLA 4NIYA 1RD3B 1W12U 2QF5A 5LH8A 1LQEA 1TRNA 3A81A 1BHXB 1PPCE 1MAYA 3LOXA 2QXIA 2ZO3H 2K8IA 1GBFA 5DSFA 1BUIA 1GBTA 1UK4A 1ESBA 4NIXA 3GCOA 3QO6A 6GCHF 2ZZUH 2BLVA 5H4IB 1S6FA 1DWCH 4F55A 3ESTA 2VINA 4P02A 1ELAA 1BTHH 2XXLA 4FUEA 3U1JB 4WMEA 1QQUA 1GBIA 1BTXA 4K2YA 4ZKOU 4DG4A 1O32A 4GAWA 3HK3B 1GVLA 1F92A 2QE7D 3M5NA 2Q6FA 4X6PA 2ZCKP 1MTVA 1TNGA 4CR5A 1TPOA 1JWTA 2ZHQH 1O2GH 3RC6A 3PMHB 2IOTA 4D9RA 1O31A 1HAYB 2IPHA 3GYMA 2ANYA 2ZGBH 3IG6B 3UR6A 2B8OH 2BD9A 2H9EH 3N7EA 4FUDA 1NFYA 1SQTA 3HATH 1SGCA 1YPJH 1TWXB 2VIVA 2W3KA 1Y59T 1J9CH 3E16B 3UOPA 5A0BA 5LPEA 1UTJA 1YPGH 1UVUH 2BQ7B 5DJ7A 2WHXA 2BZAA 2Q6GA 3AVZA 4CRCA 2CK3D 1ELFA 5GNDA 1GI3A 3K2UA 3N7DA 1HGTH 2BHGA 3VGCC 4J1YA 1HYLA 4UEHH 1ZMNA 2CF8H 2Q1JA 2WPDD 1K22H 3W1EA 1BJVA 1A0JA 2W5EA 4KTCA 4OS1A 5C20A 3MO9A 2GD4B 4O03A 4ZHAA 3TVJB 1G32B 1SLVB 2VWNA 4IN1A 1DUAA 2BTCE 1YLCA 2RDLA 1KSNA 2KCOA 1GDNA 3BG4C 1H8HD 3KQ5A 5DG6A 1G2LA 3UUZA 3GS9A 4DT7B 3DHKH 3KNXA 3DT0H 1HAOH 3MFJA 1GBMA 1MKXK 1SKYE 5E0HA 4JYTA 8GCHG 2KCYA 2OP9A 1TPSA 1Z8GA 1D6RA 1THRH 2TGAA 1KXEA 2BQ6B 1F0UA 5DP8A 3EE0B 2GCHG 3SGQE 2UUYA 5IDKA 2VBCA 1UTMA 1RIWB 3RXGA 3PTBA 3TLOA 3QDZB 2PKAB 3T25A 1P0SH 1E37B 3SHCH 1PYTC 3DD2H 1SI5H 2P3FH 1C4V2 2J38A 3UNRA 1S0QA 1HAZB 1O2YA 2F43B 1O2JA 1SC8U 2ZECA 1GMCG 1P06A 2J97A 2ZGXH 1MU8B 5FBEA 3MNCA 1SGFG 1EB2A 4YLUA 1BRUP 1SVPA 1D4PB 1T4UH 1P3EA 5C67A 3GY7A 3U9AH 4AN7A 2JDID 4INKA 3ZZDA 3UREA 2GVFA 5IK2D 1GGDB 1ANCA 2Z3EA 1BQYA 7KMEH 2ZF0H 1PPZA 2VVVA 5DPAA 1ANBA 4NIWA 1XKAC 3RXJA 2ZDMA 4XDEA 4ABBA 2YMSD 2PFEA 3RM0H 5JB9S 3G01A 2FODA 3NXPA 3L6PA 1K1OA 2XYAA 3P6ZB 4I33A 3F2FA 1DWBH 3ZVDA 4XE4A 1DSUA 1ELEE 4FOUC 4OM9A 4YO9A 5B6OA 3A7XA 4GHTA 1EZUC 5L2YH 5JBBS 2GZ7A 4ASUD 1SHYA 1TRYA 1SOTA 1CHOG 3BTEE 1E38B 1GJ8B 3U8OH 1EOLA 2TGTA 1V2OT 5EGMA 1NFXA 1Y5BT 5LPFA 8LPRA 1G3EA 3TK5A 1T7CA 4XSKU 4GLYA 1Z7KA 1G2MA 3UNSA 5GXPA 3SNDA 1HJ9A 2DE9A 5C0TA 5FBIA 2I6QA 4TWYA 1EAUA 1QRWA 1TBZH 4ABGA 1M9UA 1ANDA 1TE0A 3DSPA 4IW4E 1FJSA 2HVYB 3T26A 1K0HA 4E06H 1SB1H 4IC6A 4AOQA 3MU8A 3ZVFA 2BOHB 1TMBH 3EGKH 1G3CA 2QF3A 3GY3A 2FM2A 3RU4D 3U1IB 4ESTE 1UVTH 1QB6A 2SFAA 4GCHF 2BB4A 1KDQA 2BVXH 5LGOA 1N6YA 3RLYH 1V6DA 2WUBA 3RXQA 1MAXA 3OE7D 1WQVH 1IHTH 1P02A 4JZ1A 2ANWA 2FWWA 3KL6A 4WXVA 1UK2A 1FLEE 5DP7A 4A6LA 1MCTA 1W2KH 1Q2WA 4CH8B 1GHAF 2WPJS 3S7KB 1NT1A 4LXBH 4DOQA 1C2EA 3WWFA 2AIQA 2BLQA 4K1SA 4YT7H 1H9LB 3UWJH 2EI7A 1UK3A 2YNBA 3HKIB 3LGWA 3P8FA 1TNIA 3AAUA 3BTDE 3ZZ8A 1ZSKA 2O8WA 1ZTKA 1YP9A 1LHCH 4YLQH 4INLA 1NZQH 2ZU5A 5AFYH 5CE1A 3MMGA 4KTUA 5E8EH 3T28A 2PHBA 1MQ6A 4Y76A 1LHGH 2FOFA 2ZKSA 2HOBA 4UE7H 1TOCB 2L74A 3RXIA 1IQHA 3GOVB 1TQ7B 1W0ZU 2ZPRA 5I25A 4AFQA 1RGQA 4X2YA 3RXVA 2KFWA 1PQAA 2QXJA 3P8NA 3F2HA 1N1LA 1GJ7B 3UR9A 1N8OC 3A87A 1BRAA 2FYQA 4K3JA 2ZHWH 3PMAB 4XRNA 1O2UA 1K9OE 3UTUH 1IQNA 1KYNA 1ETRH 3T2NA 4E7NA 4YTAA 2CMYA 1W0JD 2PGQB 2JETB 1K21H 3SNBA 1YC0A 3PMBB 2OUAA 3S9BA 2JJ2D 3VB5A 4YXWD 2AERH 1OX1A 2BD8A 5EIYA 2ZDAH 1BA8B 2AIPA 4JZDH 4OS2A 1TA6A 1D3PB 2B7DH 1AKSB 1RXPA 2G8TA 3VG8A 2AGEX 1O3LA 3FZDA 5FX6A 4AFUA 2HPPH 4Y8XA 1AY6H 3M36A 2FS9A 5IYTA 1YYY1 4Y7AA 3SNAA 4CRFA 1VJ9U 2OC8A 2P3TB 1MKXH 2G00A 1UTPA 1JIMA 1F2SE 1NBME 3SGBE 3O8DA 2Y7ZA 1ZTJA 1T4VH 3D49H 4JK6A 1YCPK 1OWDA 2YMSC 3OEED 6LPRA 1T8MA 1YWUA 1ZYOA 4I8LA 2B5TB 3LONA 2F9VA 4FU8A 1S83A 4HTCH 3QN7A 2FOHA 3PRBA 1MTNC 1CA8B 1WQSA 1NU7B 3PO1C 2BM2A 1KIGH 1GBAA 3ZYEA 1KLJH 1S82A 3TJUA 3L33A 2Y5FA 1HBTH 3SU2A 2ZC9H 4XOJA 4Q80A 3TJOA 4B6FA 1MABB 2NU0E 1DLEA 3SU0A 1GHZA 2R2MB 1GI5A 1MTNB 3RMOH 3FO8D 1EB1H 1GG6B 3SUEA 1PPHE 4AZ2B 3M5MA 1UW7A 4YOJA 1ELDE 4Y10E 4ABHA 4I8HA 1QB9A 5E2OA 4BOHA 1QFKH 1QB1A 2GT7A 2HVXA 2C90B 3EYDA 1GVKB 3H09A 1OS8A 1GI9B 1GI2A 1INCA 4AGKA 2R0KA 1ZRBA 3A84A 1QRZA 4HZHA 1LVYA 1O2MA 3P92A 1ZGVA 1W14U 3KGPA 5GIBA 1CU1A 4GHQA 3D23A 4MPWA 3RXMA 4UFGH 1TFXA 1ETTH 1X7AC 1B5GH 2Z9KA 2GV7A 1C2DA 1S6HA 2A45B 1JIRA 1RFNA 3DSOA 4K60A 8GCHF 3E8LA 3LGVA 1C2GA 3BTQE 1AGJA 1GHYH 1W10U 4ABDA 4AX9H 1O2XA 2HGTH 1IQFA 1C5TA 3KQCA 7ESTE 1LCYA 3EA8A 3B8JA 5F8XA 1HAVB 2G55A 2Y5HA 3A8AA 4UONA 3OYPA 2Y6TA 4BANB 2KM0A 5C5OA 3SI4H 3SU4A 3KF2A 1YPHC 2IJD1 1BMLA 1NROH 1UTLM 2XBWA 1ARBA 2V7QD 2LELA 1DVAH 2QC2A 2PKSC 1TRMA 1XUHA 4X8VH 7GCHF 3QGJA 5CHBA 1AQ7A 1DWEH 4A5TS 4I7YH 1AIXH 2QF4A 3BTFE 1SQAA 5A8ZA 1C2IA 1O5CB 3QX5H 4DURA 1W7XH 3F0OA 2GTBA 2PWXA 1TA2A 1KXCA 1O2TA 4BAKB 2R0LA 4J2YB 2GV6A 4MQAA 2WPMS 4ZCNA 2QCYA 1FIZA 1AVXA 3EE7A 4ZROA 4CRGA 3OTJE 5EU8A 1OP2A 1O3FA 1MBMA 1Y8TA 4YT6H 1FN8A 4K8YA 5C1UA 1G9IE 3UAIC 1SGIB 5HYOA 1ELVA 1P2QA 3HGNA 5A0CA 2EQNA 4X2WA 3VB7A 2J92A 2WPLS 3D62A 3SV7A 3ZZ6A 3GCHB 5K7RA 1ACBE 4B76A 3SNCA 2BDIA 5DP6A 1Z6EA 1WU1A 2ZFPH 1O34A 3E91A 5T3HA 5C5NA 2W6JD 3KIDU 5KGOA 3TH2H 3LJOA 3LU9B 1HNEE 2A7CA 4NWLA 3MNSA 4NA8A 4AGJA 4Q4LA 4ISLA 1P57B 2H1UA 1SLUB 1ABJH 4JZEH 2PTCE 3QTOH 1LHEH 3QUMP 3Q00A 4NSYA 5EQRA 1J15A 3EDXB 1AKSA 3FP7E 2B0FA 3VEQB 1ANEA 3R3GB 2HRVA 1IQLA 1C1NA 1T31A 3A7WA 5EW2H 1O2WA 1BTWA 2JH0D 4K8BA 3NKKA 4DIHH 3TNSA 1DPOA 4RT1A 1ZHMA 1GVZA 3BTME 5HM9A 3SYJA 2JH6D 4U2WA 1HIAA 2AGGX 3F0PA 1C1VH 3CP7A 2BD5A 2HNTE 1RJXB 1C5QA 2CXVA 2ZCHP 5GDSH 1XM1A 2F9BH 1TONA 1UVOA 2A4QA 2JKHA 3RXCA 4XBCA 2ZFFH 4TY7A 3F2GA 1ELCA 1ZGIA 1XKBC 1AVWA 3IWMA 3EQ0H 1BZXE 1A4WH 1P8VC 5FPTA 3PTNA 1ZPBA 5JPMH 3PB1E 1NFWA 2D1JA 1V2JT 1QJ7B 1N6XA 1W0YH 1V2NT 1PFXC 4HG6A 1XX9A 2CV3A 2VJ1A 1ZPZA 3N99A 1G3DA 1OYQA 1GHBG 4IMZA 5AF9H 4OGXA 3PV2A 2V3MA 2GCHF 3BV9B 2FESH 5SGAE 3AW0A 2SGPE 4ZUHA 1A1RA 1WBGB 2VIOA 2WV5A 1GJAB 1P09A 2PUQH 1GBBA 2OINA 1XVOA 5DP9A 1BTUA 5EQQA 1CBWB 1A5HA 1QRXA 4NG9H 3EA7A 3TGIE 1LHFH 2FIRH 2DUCA 4YOGA 4NZLA 2JH5D 3SZEA 3LGUA 1EUFA 3TJVA 2UWLA 1P3CA 1YPHE 1O3JA 4ABEA 1MQ5A 3OTPA 2ZP0H 2FI3E 1FDPA 5FL7D 1JRTA 4JYVH 2EA3A 4U01A 3RXHA 4TWWA 4BNRA 3A82A 4Z1MD 2FS8A 1GHVH 4Y71A 2Y82A 1GBDA 4F4OC 1SGYE 3V12A 1HAPH 5F6MA 1MTWA 1XMNB 3TH3H 1V2QT 1YBWA 4DCDA 1O0DH 3UIRA 2A32A 1VKYA 1H4WA 1SGTA 1EP6A 1C1OA 3I29A 2A7JA 3PROA 2BOKA 1WUNH 5EXLA 1O3EA 2J34A 2QF0A 4AB8A 1Z8RA 2R3YA 1O2SA 1L0ZA 1ZMLA 2BXUH 2AMQA 1MUEB 1EX3A 2FYRA 1BB0B 4LK4A 3SJIA 3TJNA 1HB0B 1AFQC 3SU6A 4MNVA 5A8XA 3VGCB 1MD8A 4LZ1H 3LJJA 4IS5A 3DCLA 8KME2 2BD2A 2ZFQH 4CRAA 3BTWE 1EPTC 1RS0A 3W94A 3LPRA 2TBSA 4XBBA 1FIWA 2H5CA 4FUGA 3SJOA 1K1LA 1SR5C 4B74A 1KTSB 1Z1JA 3ZIAD 4GSOA 1P01A 2XC0A 2Z9IA 1IQGA 2BMGB 4NCYA 4JZIA 1L1JA 1O2KA 1TLDA 3FP6E 3FANA 2Y7XA 3QGNB 4WMDA 2QXGA 4OS5A 2FPZA 5L2ZH 2VIPA 2ZWLH 3VFEA 1GJ6A 1CE5A 1S0RA 3STJA 2R3UA 1WAYB 1FQ3A 2KZ4A 2FZZA 3A86A 1F5RA 1EKBB 1CT2E 4WJG2 1TB6H 1QJ1B 2BD3A 2PSXA 4AB9A 1WCZA 5B6LA 3K6YA 4QT8C 5DKMA 5EQSA 3HK6B 2EI8A 1FY5A 1LPZB 3JZ2B 1E0FD 4H6TA 1P10A 1QL9A 1J14A 1KMHB 4NFEA 1C2KA 1J16A 1K1NA 2P8OB 4OS4A 1AUJA 2GJGA 2G5NA 4Q7XA 1KTTB 4Y0ZE 1BCUH 1JBUH 1D6WA 1ZRKA 1FY4A 3SJ9A 1O38A 1SGRE 1IOEA 1ORFA 3E1XB 1AFQB 1HJAC 2RFKC 1XUJA 1T8NA 4RSPA 3LH1A 2FTMA 1V2PT 1NO9H 1FPHH 1YM0A 2QV1A 5K0HA 1GG6C 2OCVB 1AWHB 1O5GH 1QURH 4GCHG 2QYIA 4BXWA 3URDA 3A8DA 2F9NA 1VR1H 1P05A 2J95A 4Q63A 4CRBA 2PV9B 3WWBA 3SJKA 3F3BA 2KAIA 2AGIX 1O3AA 4ABJA 3GY8A 3GDVA 3A7VA 4BXSA 3LIWA 3DFJA 4PROA 1LKBA 5AFZH 1MD7A 2RDEA 1HXEH 1LQDB 3MWIU 1OWJA 2GDEH 5BRRE 1BT7A 1A7SA 5E2PA 4X1RU 1TBRH 2A2XH 2ZDKA 1QCPA 4X1NU 2F91A 1EJNA 1XUKA 1SBWA 2YMSB 4MNWA 2A5IA 4X1PU 1GBLA 1ZPCA 3MNBA 1S6LA 3LGYA 2A4OA 2F4LA 4JK5A 3UQVA 3NPSA 1VITG 2BDYA 1GJCB 2EEKA 2FTLE 4WWYA 2OXSA 1CBWC 1S81A 2G4UA 1O2ZA 1O5EH 1P2KA 4IN2A 5C94A 1ZSLA 1A3EH 4FVBA 1C5SA 2OK5A 1EASA 1YPEH 1CA0B 3CS7A 3AK5A 1JXPA 1TX7A 2YNAA 3RXRA 1L1NA 1O33A 4D7GA 1S85A 4WXIA 1P03A 1EAWA 3FFGA 3QWCH 1E1QD 2H5DA 2HWLB 5ABWA 4X2XA 1C5LH 1NRNH 5C3NA 1C5NH 2HNTC 1TYNA 3LKWA 3F6UH 5JB8S 1K1IA 4MVNA 1DXPA 2AYWA 4FUJA 4UDWH 5EPNA 1S5SA 3U69H 1V2KT 4Y8ZA 1EZSC 1HDTH 2HLCA 2H9HA 3T5FH 1PJPA 4R0IA 1Y3VA 2ZDVH 1FY1A 1YLDA 1JRSA 1GMHF 2CHAC 1NTPA 2Z3DA 5FPYA 1O3OA 1A2CH 2ALPA 3GY2A 1O3HA 2Y80A 4DY7B 2BD7A 3VXFH 1HAXB 1GI7B 1O3NA 2ZTYA 1QHRB 4ZKSU 1GMHG 4NZQA 4Y7BA 3UPEA 1VZQH 1V3XA 5A0AE 4BAOB 1QNJA 1L2EA 2P16A 1OYTH 3PRDA 2ESTE 1MZAA 3A7TA 2ZA5A 5CMXH 3MU5A 2FI4E 1SG8B 1V2UT 4OS7A 1PPBH 2PUXB 2RG3A 3SOSA 1SFIA 1OSSA 2ZTZA 1HLTH 4CHAB 1H9HE 3A85A 1EP5A 3AAVA 2WPHS 3QZQA 1O5DH 1A5IA 1DFPA 1NRQH 5KEDA 1BMFD 1K1PA 1AO5A 2P3UB 3ATLA 1BTYA 3VPKA 2THFB 1C5VA 1HJ8A 4X6NA 1HPGA 5JYIA 1W11U 2Y81A 4FETA 4NFFA 1BMAA 5G4BA 1AUTC 2VWMA 1Q3XA 1QZ8A 3SO3A 2ZU3A 1EQ9A 5GCHG 4KGAA 2NU4E 2O8MA 2FOMB 1SHHB 1XUFA 4FXGH 3BSQA 4F49A 3A83A 1DOJA 3A80A 4WVPE 4DVAU 1C5RA 1AZ8A 2PP6A 1T8LA 4B1TA 2XCFA 2A0QB 1HFDA 1O36A 3ZVGA 3MYWA 2R9PA 2ZU2A 3E0NB 3DA9B 3N7OA 2XNDD 1AMHA 1FAKH 4FUCA 4Z0KA 2G51A 2PR3A 3GICB 3BTKE 3S9AA 2JIZD 3M3SA 1DXWA 1A3BH 1ZMJA 4MNYA 2BDGA 6CHAB 1EZQA 2AMDA 1GMCF 2ZGCA 1UJ1A 3H5CB 2C8WB 2VWLA 3C1KA 1LO6A 1CSOE 3FOAA 5A2MH 1NESE 3I78A 2PKSB 3PWCA 5AHGH 3SNEA 2VIQA 2PSYA 1V2RT 1AZZA 1MMJN 1OPHB 3HGPA 1FV9A 3F9GA 3NWUA 2F83A 4ACBA 3KQBA 3BTGE 2AH4X 2GMTB 3F1SB 1C1TA 1EOJA 2VIDA 1VITH 1DICA 2ZFTA 1BIOA 1BMNH 1TAWA 1FY8E 1CGHA 5C1XA 2GGVB 1LVMA 2QAAA 4WF8A 3U8TH 5GCHF 2BQWB 3SI3H 4E05H 1KDQB 3MNXA 1LPGB 1C4Y2 3RDZA 1GGDC 2WPIS 3KQEA 4MG3A 2XWBI 1LMWB 1SMFE 3Q77A 1CA0C 3BG8A 3F68H 2A7HA 1THPB 3KYFA 2RA0A 3WY8A 3RXBA 5DP4A 4B2CA 4NIVA 2AMPA 1DITH 1DY8A 4OS6A 1YY3A 1K1JA 2BVRH 2FOGA 2VWOA 1KY9A 1WYKA 1ZHRA 1C2JA 2AHME 3TU7H 4FUBA 2ZPQA 2XC4A 3ZV8A 2WPKS 1GHWH 4I31A 5TCCA 4ZXYH 2F9UA 2HALA 4BAMB 4UD9H 3GCTF 1H1BA 3I77A 4D76A 2FDAA 1O2OA 1DX5M 1PQ5A 2A5AA 2ODPA 1FPCH 2ZFSA 1E79D 5EW1H 1AB9C 1O5FH 2ZNKH 1UVSH 1FY3A 3E6PH 2IPQX 2W7SA 3U8RH 5F8ZA 4AORA 2OBOA 3SV6A 3UY9A 2GKVE 5FXLA 4X1SU 2C3SA 3BG4B 3ZZCA 1TNJA 4AG1A 5TCAA 3M7TA 2UWOA 3MO6A 1FI8A 4E7RG 2DE8A 1CVWH 2GT8A 1O35A 1DLKB 1F5LA 1KLTA 1E36B 1ZOMA 1DS2E 2FP7B 1BMMH 1GBJA 1A46H 5EOKA 1MCVA 1UTNA 1DSTA 5DN6D 1BBRK 1C9TA 1C1RA 1O2NA 3PYHA 4LZ4B 1GBCA 3OAAD 3RU4E 4Q7YA 1TPPA 3SHAH 2ZU1A 3M35A 3RMLH 3ZV9A 1TGTA 1LKAA 3KEEA 3SW2B 1FUJA 3O8BA 4B2AA 4WMFA 4ZHMU 1EFRD 2AFQB 2KCAA 2LNCA 3A89A 2QY0B 3VB4A 3PM3A 4UFFH 4A92A 1HIAB 4CRDA 3MH7A 4BAQB 1KXDA 5L30H 2SGFE 1UTKA 3LH3A 4FU7A 4RKJB 3RC4A 1ELGA 2RCEA 3ZZBA 3HPTB 5GWZA 2D2DA 3GY4A 2JETC 2NWNA 1CHGA 2XBYA 1V2MT 1P2NA 1OHHD 2VH0A 4X0WU 1EAXA 1LVOA 2XRCA 4K1TA 5EG4A 3GDSA 1QBNA 1BBRH 2VGCC 2UWPA 1Y5AT 1TNHA 1FONA 3P70B 1KXFA 2OC0A 1N8OB 2XC5A 4ZAEA 2WSSD 4MLFB 1MZDA 1AD8H 3HKJB 2VVCA 1B0EA 4HFPB 4ACAA 1VJAU 5E0JA 1FMGA 1DT2A 2FOCA 4UFDH 3E0PB 1C5XB 2WINI 1GDQA 1YCPM 1GJ5H 2XWAA 1ESTA 3MQKC 1P9SA 3M7UA 1P04A 1RTLA 3BEFB 5T6GA 3H7TA 2KX4A 4FUHA 1GMDF 3Q3XA 1F5KU 5FX5A 3F9HA 3RXLA 3UQOA 2BYAX 3U28C 2LP6A 1EPTB 2Q6DA 1BTPA 2C8YB 1PYTD 1QTFA 1MH0A 5ESTE 3BTHE 1NFUA 1P2MA 3PV4A 3PV5A 5JBCS 1GI0A 1COWD 1GBHA 3IITA 2BX3A 2VB0A 1TGNA 1TNKA 3ZVBA 4RI0A 3H7OA 2FLRH 1VITF 1K2I1 3P8OA 3GCTG 2BDHA 3MU1A 3RXSA 3NUMA 1UMAH 1HXFH 2AS9A 1O3KA 3RXDA 1O3PB 2ZHEH 4FU9A 4JZFH 2F3CE 1TNLA 3TK9A 1H8DH 3A8BA 4ABFA 1O39A 3EAJA 2HPQH 4KELA 5DO4H 3LGIA 4NSVA 3RMMH 5EPYA 1CO7E 1S84A 1GDUA 4DJZB 5EXNA 4ISIH 3NZIA 3SUFA 1QA7A 2A2QH 1C2MA 5J4SA 1V2TT 2ODQA 1H9IE 2BLWA 1BBRE 2FX6A 2ZPSA 3SORA 1MKWK 4BTIB 1C5MD 1GCTB 1F0TA 5FCRA 4D9QA 1QA0A 2VIWA 1TQ0B 1V2WT 1FXYA 1GWAA 9ESTA 1GPZA 1YPMH 2FEQH 4AYYB 2XW9A 3ATMA 1TX8A 3T62A 2PGBB 5CHAB 1C1PA 2ZHDA 1ZTLA 5LPRA 2ODYB 2ASUB 2GX4A 3CENA 3MH6A 1AE8H 3M7QA 1CGJE 3DFLA 1T32A 1OWEA 1HCGA 1OKXA 2CN0H 1NRRH 4B2BA 2VU8E 1SOZA 3SUGA 1WDIA 2WV9A 2VVUA 1OWHA 3R0FA 2Z7FE 1WXRA 1SL3A 3TK6A 1O2VA 1UTQA 2B9LA 1QBOA 4AG2A 2ULLA 3V3MA 2BZ6H 2R2WU 3M37A 4Q7ZA 4CBOA 3AASA 4MPVA 4X8SH 5ETXA 2K0QA 1B7XB 4KKDA 1O3MA 2GDDA 4ZMAH 5I46H 1NM6A 2GCTC 1EZXC 1VCPA 2W6ID 5TJXA 3ZVEA 1QGFA 1BTZA 1AWFH 1Z71A 2WZQA 3CS0A 3B23B 3S0NA 3K9XB 4B73A 3C27B 2ZCLP 1ZSJA 2GCTB 3SV9A 3GCNA 2NU2E 3BIUH 3GY5A 1GBEA 1NBMD 1G3BA 2P95A 1O2IA 4TSFD 2M5TA 4MNXA 4X1QU 1FNIA 7GCHG 3ZYDA 4ISHH 3S69A 4AYVB 1ZR0A 1XXFA 3FVFB 4Y0YE 1GI6A 1ELTA 1WOFA 5HMAA 2H2ZA 3JZ1B 4CREA 2NU3E 4DIIH 3SGAE 1O2QA 1O5BB 3ATWA 3L3TA 2QA9E 2TIOA 2ZFRH 5A09A 1SGEE 3SN8A 3STIA 2EC9H 2I6SA 2OQUA 1C1QA 2WUCA 2PLXA 2OLGA 1AHTH 3BEIB 4U32A 1UCYK 1JMOH 2OBQA 3RXKA 1AU8A 4H4FA 1BRBE 3GCHC 4I8KA 8ESTE 3UNQA 2TGPZ 1SSXA 1TOMH 3VB6A 2FI5E 3URCA 1K28D 1XVMA 1HUTH 2QGRA 2Z9LA 4WH8A 3Q3KA 1CHOF 1KXAA 2P59A 1FZZA 3ATIA 3F9EA 4AFZA 2SGEE 6ESTA 1O37A 1FX0B 1QBVH 3FKSD 1E35B 3ATKA 4FVDA 4ZHLU 4ISOA 4MPXA 4TT3D 1SQRA 4F48B 1L1GA 1QR3E 3PMJA 3Q3YA 1P2JA 5DK1A 1AN1E 1ZZZA 1G37A 1GL0E 1P9UA 3D65E 2A4RA 4JCNA 4M9FA 4ABIA 1FN6A 3RXPA 1GMDG 2FX4A 3ZZ4A 4D7FA 2ZQ1A 1QIXB 5FCKA 3GYLB 2UUJB 4CR9A 2IJOB 2NU1E 3KN2A 4NGAH 1IHSH 3Q76A 4OGYA 3MH4A 3QK1A 1IQMA 5HIZA 3OY5U 4MDSA 4RKOB 9LPRA 4IMQA 4TY6A 2BY9X 4O3UA 4YESB 2BDBA 2BLOA 2ALVA 1CT4E 1EAIA 2C93B 1C5OH 3RM2H 4TPIZ 2ANMH 5DP3A 2SNVA 5T1VA 2LPRA 1Z8IB 2TGDA
chains in the Genus database with same CATH topology
2F9OA 3BF6H 1GHBF 4I8JA 1V2ST 4ISNA 1LVBA 2BVSH 1ABIH 1J17T 1AI8H 2FXRA 3ZVCA 3RXFA 2Z6BD 1YCPH 2IN2A 1TPAE 1A61H 1ZJDA 2D8WA 3MU0A 2QIQA 1PPEE 3RC5A 3UOUA 1VCWA 2V3OH 1LHDH 2W7UA 4BTTB 1CGIE 2XTTB 2W26A 1OWIA 4ZKRU 4U30A 2QN5T 2VGCB 3SQEE 2ZGHA 1Q31A 4CBNA 3TH4H 2TRMA 5FAHA 1IAUA 1MTSA 4HI3A 4Y8YA 3RP2A 1P2IA 1C1WH 1OXGA 3SJ8A 2CF9H 1RRKA 2VH6A 1KXBA 5HM2A 1NPMA 1O3CA 4KP0A 2FMJA 4B75A 2C8XB 3KHVA 2BY5X 1OP0A 1DM4B 2W3IA 6GCHG 3KQDA 3BN9A 2CJIA 5JDUB 4MPUA 4WH6A 4X6OA 1D3DB 4X6MA 2ILNA 3OX7U 2Z9GA 1O3GA 1TBQH 1VGCC 1PQ7A 2ZTXA 2C8ZB 3SUDA 3RXEA 3NCLA 3GDUA 3ZZ5A 3MO3A 1CT0E 1O3BA 3PO1B 1OWKA 4VGCC 1SQOA 1CQQA 1O3IA 2BY8X 1EJAA 1Y5UT 4TYDA 1A5GH 2ZEBA 1BITA 2SGDE 1QL8A 2UUKB 1Z6JH 1FAXA 4A1TA 1K1MA 5T6FA 3MTYA 1TGSZ 3RLWH 3TITA 3B9FH 3ZZ7A 1SFQB 4M7GA 1PPFE 1W13U 1BOQA 3FAOA 2D26C 1HAVA 4IGDA 3UFAA 3TGJE 4VGCB 2BX4A 1QJ6B 1Y3XA 3OY6U 1GJ9B 4XFQA 1PQ8A 3RXOA 1EPTA 1HAGE 1TMUH 4LOYH 3OU0A 1QQ4A 1UTOA 1D3QB 1HAHH 1AB9B 1YF4A 3MI4A 1HAIH 3SBKA 1C5UA 5HXFA 3TGKE 2SGAA 2STBE 4D8NA 1TIOA 4GPGA 5ESBA 1AFEH 3A7YA 5T6DA 4ABAA 3FZZA 1C5ZB 1EXFA 1O2RA 1C1UH 2SGQE 5GPIB 1F7ZA 4ZXXH 1F0RA 3KCGH 2G52A 1GBKA 1L4DA 1O5AB 3M3VA 2V0BA 3MH5A 1A0LA 2G5VA 3SU1A 5E0GA 1TALA 2J2UA 3AW1A 2G81E 2OTVA 1SLWB 2V3HH 1UO6A 1Y3UA 3VXEH 4BAHB 2G4TA 3BIVH 3P17H 4XBDA 3K6ZA 4ZKNU 2FOEA 4DW2U 1UHBA 3T29A 4AFSA 1O2PA 1UCYH 4IC5A 4JMYA 1NU9A 2ZDNA 3PWBA 1NRSH 1IQEA 2ZG0H 1RTKA 1QL7A 5JBTA 1P2OA 2XCNA 3W95A 4GUXA 4H42U 1UVPA 1ARCA 1DWDH 1Y3YA 5EODA 1EATA 4MTBA 1DY9A 3M61U 3RXTA 5DP5A 1D3TB 1SGPE 1C2HA 1GHAG 1GL1A 1ZJKA 1BHXF 3MU4A 2GMTC 4WY3A 4I32A 4I8GA 3P8GA 1NRPH 1SLXB 1GJDB 1GI4A 1TGCA 1LTOA 3NK8A 2XNIA 2SNWA 1VCQA 2ZI2H 1W7GH 3A88A 1C9PA 3BTTE 1YKTA 1TGBA 5BPEA 3PLPA 2J9NA 2RA3A 3LT3A 2GZ9A 3E3TA 3ENSB 3P95A 4YM9A 6CHAC 3O8RA 3M3TA 5FHTA 1LPKB 1ID5H 1J8AA 1ETSH 1DDJA 2OD3B 1ELBA 3GY6A 1WTHD 2A1DB 1YPKH 2H6MA 1O30A 1JOUB 4Y79A 3SV2H 1XUIA 4NWKA 1C5PA 1TMTH 2PW8H 3VB3A 4FUIA 4O3TA 5A8YA 4A1VA 4GVUA 4YZUA 5F03A 4K1EA 4A1XA 1WSSH 1SGQE 3GISB 2STAE 2V6NA 1IQKA 5HGGA 3MOCA 3QTVH 2Z3CA 1C5WB 2GZ8A 1ESAA 1LDTT 1Z1IA 1O2LA 4Q2KA 5GJ4B 2FOBA 1GHXH 2P93A 2YOLA 1YPLH 4THNH 1T8OA 4CH2B 3O8CA 1C1MA 1TABE 1WV7H 5AVDA 4X8UH 2A4GA 2O8LA 3LDXH 3PLBA 1V2VT 2EI6A 2V35A 4DGJA 4HGCA 2XBVA 1U6QA 4CHAC 5EXMA 3TIUA 4NA9H 3RU4T 3ZZAA 3MHWU 5FPSA 1O2HA 3S7HB 1C2FA 3U98H 1D9IA 1E34B 3TPIZ 2WYJA 4JYUH 2BXTH 1BJUA 1NS3A 1SPJA 4R8TB 3T27A 1IQIA 3ODFA 3SV8A 4YOIA 3RXUA 4X2VA 7LPRA 3M5OA 4A7IB 3LC5A 2CHAB 1MKWH 2O9QA 4SGAE 2HNTF 2VNTA 2KAIB 2Z9JA 1Z8JB 5PTPA 5C2ZA 3K65B 2A5KA 4INHA 3RUOA 1QY6A 1SGFA 2H9TH 2FOAA 1BDAA 3SU5A 3ELAH 4ZH8A 1KLIH 1O3DA 1NC6A 1SGNE 3V7TA 1RIWC 2OC7A 4X8TH 1C2LA 3S9CA 4O9VA 4TPYA 3RMNH 1F0SA 1YGCH 3SZNA 2ZIQH 3EA9A 2BDCA 1MU6B 1DE7H 1NY22 3LGTA 1TX6A 4B71A 1EJMA 1A0HB 2ZHFH 5CHAC 1XUGA 4Y6DA 1OP8A 2PKAA 3ZZ3A 4RN6A 1UCYE 5JBAS 1GJBB 2ANKH 5L6NH 4BTUB 1GJ4H 3A8CA 3FP8E 1MTUA 3BEUA 4K5ZA 1GI1A 4ASHA 1P11E 1UHBB 1SGDE 2ZU4A 4NA7A 1GCTC 3ODDA 2BD4A 4IBLH 3OSYA 2ZGJA 1B0FA 4Y11E 1HRTH 2K1QA 1C5YB 1H8IH 2UUFB 4FUFA 4SGBE 3SU3A 1DANH 1AE5A 3LC3A 3DUXH 3RXAA 3V0XA 2J4IA 2XBXA 1WTGH 2O8UA 2AEIH 1VGCB 3UWIA 3QZRA 3V13A 1IQJA 1C4U2 3M5LA 4H6SB 2OQ5A 4O97A 2TPIZ 4K69A 1NN6A 2FLBH 1V2LT 3F9FA 3QLPH 2FO9A 3SQHE 5DGJA 3TNTA 3A7ZA 4KTSA 2GP9B 1AVGH 2J94A 1HJAB 3PLKA 1GI8B 2CGAA 1MBQA 5F8TA 1XXDA 1BRCE 2ZQ2A 2C4FH 2Y5GA 1C1SA 2BY6X 2BY7X 2Z94A 1W3CA 1Y3WA 2QXHA 4UFEH 5J4QA 1HV7A 2WYGA 3E90B 1DUEA 1P12E 1W8BH 2P8OC 2BDAA 3ZVAA 2PTNA 3ZZ9A 1ZHPA 1G36A 1ZLRA 3ITIA 2OC1A 1RTFB 1OOKB 2WV4A 1L4ZA 2A31A 2O8TA 2P94A 5C1YA 4Z6AH 1PPGE 1GCDA 1THSH 2F9PA 1G30B 2ZDLA 4NIYA 1RD3B 1W12U 5LH8A 1LQEA 1TRNA 3A81A 1BHXB 1PPCE 1MAYA 3LOXA 2QXIA 2ZO3H 1GBFA 1BUIA 1GBTA 1UK4A 1ESBA 4NIXA 3GCOA 3QO6A 6GCHF 2ZZUH 2BLVA 5H4IB 1S6FA 1DWCH 3ESTA 2VINA 1ELAA 1BTHH 2XXLA 4FUEA 3U1JB 4WMEA 1QQUA 1GBIA 1BTXA 4K2YA 4ZKOU 4DG4A 1O32A 4GAWA 3HK3B 1GVLA 1F92A 3M5NA 2Q6FA 4X6PA 2ZCKP 1MTVA 1TNGA 4CR5A 1TPOA 1JWTA 2ZHQH 1O2GH 3RC6A 3PMHB 2IOTA 4D9RA 1O31A 1HAYB 2IPHA 3GYMA 2ANYA 2ZGBH 3IG6B 3UR6A 2B8OH 2BD9A 2H9EH 4FUDA 1NFYA 1SQTA 3HATH 1SGCA 1YPJH 1TWXB 2VIVA 2W3KA 1Y59T 1J9CH 3E16B 3UOPA 5A0BA 5LPEA 1UTJA 1YPGH 1UVUH 2BQ7B 5DJ7A 2BZAA 2Q6GA 3AVZA 4CRCA 1ELFA 1GI3A 3K2UA 1HGTH 2BHGA 3VGCC 4J1YA 1HYLA 4UEHH 1ZMNA 2CF8H 2Q1JA 1K22H 1BJVA 1A0JA 2W5EA 4KTCA 4OS1A 5C20A 3MO9A 2GD4B 4O03A 4ZHAA 3TVJB 1G32B 1SLVB 2VWNA 4IN1A 1DUAA 2BTCE 1YLCA 2RDLA 1KSNA 1GDNA 3BG4C 5DG6A 1G2LA 3UUZA 4DT7B 3DHKH 3KNXA 3DT0H 1HAOH 3MFJA 1GBMA 1MKXK 5E0HA 4JYTA 8GCHG 2OP9A 1TPSA 1Z8GA 1D6RA 1THRH 2TGAA 1KXEA 2BQ6B 1F0UA 5DP8A 3EE0B 2GCHG 3SGQE 2UUYA 5IDKA 1UTMA 1RIWB 3RXGA 3PTBA 3TLOA 3QDZB 2PKAB 3T25A 1P0SH 1E37B 3SHCH 1PYTC 3DD2H 1SI5H 2P3FH 1C4V2 2J38A 3UNRA 1S0QA 1HAZB 1O2YA 1O2JA 1SC8U 2ZECA 1GMCG 1P06A 2ZGXH 1MU8B 5FBEA 3MNCA 1SGFG 1EB2A 4YLUA 1BRUP 1SVPA 1D4PB 1T4UH 1P3EA 5C67A 3GY7A 3U9AH 4AN7A 3ZZDA 4INKA 3UREA 2GVFA 1GGDB 1ANCA 2Z3EA 1BQYA 7KMEH 2ZF0H 1PPZA 2VVVA 5DPAA 1ANBA 4NIWA 1XKAC 3RXJA 2ZDMA 4XDEA 4ABBA 2PFEA 3RM0H 5JB9S 3G01A 2FODA 3NXPA 3L6PA 1K1OA 2XYAA 3P6ZB 4I33A 1DWBH 3ZVDA 4XE4A 1DSUA 1ELEE 5B6OA 4YO9A 3A7XA 4GHTA 1EZUC 5L2YH 5JBBS 2GZ7A 1SHYA 1TRYA 1SOTA 1CHOG 3BTEE 1E38B 1GJ8B 3U8OH 1EOLA 2TGTA 1V2OT 5EGMA 1NFXA 1Y5BT 5LPFA 8LPRA 1G3EA 3TK5A 1T7CA 4XSKU 4GLYA 1Z7KA 1G2MA 3UNSA 5GXPA 3SNDA 1HJ9A 2DE9A 5FBIA 2I6QA 4TWYA 1EAUA 1QRWA 1TBZH 4ABGA 1M9UA 1ANDA 1TE0A 4IW4E 1FJSA 3T26A 4E06H 1SB1H 4IC6A 4AOQA 3MU8A 3ZVFA 2BOHB 1TMBH 3EGKH 1G3CA 2QF3A 3GY3A 2FM2A 3RU4D 3U1IB 4ESTE 1UVTH 1QB6A 2SFAA 4GCHF 2BB4A 1KDQA 2BVXH 5LGOA 1N6YA 3RLYH 1V6DA 2WUBA 3RXQA 1MAXA 1WQVH 1IHTH 1P02A 4JZ1A 2ANWA 2FWWA 3KL6A 4WXVA 1UK2A 1FLEE 5DP7A 4A6LA 1MCTA 1W2KH 1Q2WA 4CH8B 1GHAF 2WPJS 3S7KB 1NT1A 4LXBH 4DOQA 1C2EA 2AIQA 2BLQA 4K1SA 4YT7H 1H9LB 3UWJH 2EI7A 1UK3A 2YNBA 3HKIB 3LGWA 3P8FA 1TNIA 3AAUA 3BTDE 3ZZ8A 1ZSKA 2O8WA 1ZTKA 1YP9A 1LHCH 4YLQH 4INLA 1NZQH 2ZU5A 5AFYH 5CE1A 3MMGA 4KTUA 5E8EH 3T28A 2PHBA 1MQ6A 4Y76A 1LHGH 2FOFA 2ZKSA 2HOBA 4UE7H 1TOCB 3RXIA 1IQHA 3GOVB 1TQ7B 1W0ZU 2ZPRA 5I25A 4AFQA 1RGQA 4X2YA 3RXVA 1PQAA 2QXJA 3P8NA 1N1LA 1GJ7B 3UR9A 1N8OC 3A87A 1BRAA 2FYQA 4K3JA 2ZHWH 3PMAB 1O2UA 1K9OE 3UTUH 1IQNA 1KYNA 1ETRH 3T2NA 4E7NA 4YTAA 2CMYA 2PGQB 2JETB 1K21H 3SNBA 1YC0A 3PMBB 2OUAA 3S9BA 3VB5A 2AERH 1OX1A 2BD8A 2ZDAH 1BA8B 2AIPA 4JZDH 4OS2A 1TA6A 1D3PB 2B7DH 1AKSB 1RXPA 2G8TA 2AGEX 1O3LA 3FZDA 5FX6A 4AFUA 2HPPH 4Y8XA 1AY6H 3M36A 2FS9A 5IYTA 1YYY1 4Y7AA 3SNAA 4CRFA 1VJ9U 2OC8A 2P3TB 1MKXH 2G00A 1UTPA 1JIMA 1F2SE 3SGBE 3O8DA 2Y7ZA 1ZTJA 1T4VH 3D49H 4JK6A 1YCPK 1OWDA 6LPRA 1T8MA 1ZYOA 4I8LA 2B5TB 3LONA 2F9VA 4FU8A 1S83A 4HTCH 3QN7A 2FOHA 1MTNC 1CA8B 1WQSA 1NU7B 3PO1C 2BM2A 1KIGH 1GBAA 3ZYEA 1KLJH 1S82A 3TJUA 3L33A 2Y5FA 1HBTH 3SU2A 2ZC9H 4XOJA 4Q80A 3TJOA 2NU0E 1DLEA 3SU0A 1GHZA 2R2MB 1GI5A 1MTNB 3RMOH 1EB1H 1GG6B 3SUEA 1PPHE 4AZ2B 3M5MA 4YOJA 1ELDE 4Y10E 4ABHA 4I8HA 1QB9A 5E2OA 4BOHA 1QFKH 1QB1A 2GT7A 2HVXA 2C90B 3EYDA 1GVKB 1OS8A 1GI9B 1GI2A 1INCA 4AGKA 2R0KA 1ZRBA 3A84A 1QRZA 4HZHA 1LVYA 1O2MA 3P92A 1ZGVA 1W14U 3KGPA 5GIBA 1CU1A 4GHQA 3D23A 4MPWA 3RXMA 4UFGH 1TFXA 1ETTH 1X7AC 1B5GH 2Z9KA 2GV7A 1C2DA 1S6HA 2A45B 1JIRA 1RFNA 4K60A 8GCHF 3E8LA 3LGVA 1C2GA 3BTQE 1AGJA 1GHYH 1W10U 4ABDA 4AX9H 1O2XA 2HGTH 1IQFA 1C5TA 3KQCA 7ESTE 1LCYA 3EA8A 3B8JA 5F8XA 1HAVB 2G55A 2Y5HA 3A8AA 4UONA 3OYPA 2Y6TA 4BANB 5C5OA 3SI4H 3SU4A 3KF2A 1YPHC 1BMLA 1NROH 1UTLM 2XBWA 1ARBA 1DVAH 2QC2A 2PKSC 1TRMA 1XUHA 4X8VH 7GCHF 3QGJA 1AQ7A 1DWEH 4A5TS 4I7YH 1AIXH 3BTFE 1SQAA 5A8ZA 1C2IA 1O5CB 3QX5H 4DURA 1W7XH 2GTBA 2PWXA 1TA2A 1KXCA 1O2TA 4BAKB 2R0LA 4J2YB 2GV6A 4MQAA 2WPMS 2QCYA 1FIZA 1AVXA 4ZROA 4CRGA 3OTJE 5EU8A 1OP2A 1O3FA 1MBMA 1Y8TA 4YT6H 1FN8A 4K8YA 5C1UA 1G9IE 1SGIB 5HYOA 1ELVA 1P2QA 3HGNA 5A0CA 4X2WA 3VB7A 2J92A 2WPLS 3D62A 3SV7A 3ZZ6A 3GCHB 5K7RA 1ACBE 4B76A 3SNCA 2BDIA 5DP6A 1Z6EA