1UTOA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utoA02
3TH3H 4CRDA 1F0TA 5EW1H 5T6GA 1C5LH 1BBRE 2O8TA 3V3MA 4IC6A 5L2YH 2C90B 2GKVE 1P02A 1UCYE 5TCAA 1NESE 3PMBB 2GX4A 2XXLA 1SGIB 5AFZH 1VCQA 3S9BA 3QO6A 4A1XA 1O2ZA 1NFXA 1O2UA 2ZI2H 2DE8A 4GPGA 4BAMB 3FP7E 2R9PA 1KY9A 2QXJA 4KKDA 1BTPA 2SGPE 1EPTA 4FVDA 1SGDE 4NA7A 4GUXA 1C2EA 3RXBA 2Y82A 1IQKA 1W14U 2ZHFH 2PLXA 4BTTB 1AZZA 4ISOA 3SU0A 4Y0ZE 4B74A 4AYVB 2ULLA 3Q3YA 1IHSH 4HI3A 2ALVA 1G3DA 4AX9H 1A2CH 3M3TA 1C5XB 3ODFA 1GMHG 2FXRA 1ID5H 4B73A 3ZVCA 1SGCA 1T8NA 3A7XA 4FUHA 2A1DB 1DVAH 1AVXA 1FAKH 1HAGE 3SW2B 4R8TB 2BD3A 1BA8B 3KIDU 1ABIH 5CHAC 4X6NA 2GV7A 2ZGXH 1FIZA 1UVSH 3BTGE 4INKA 5EQQA 4TY7A 5DP4A 4ABGA 4K3JA 1HCGA 3F1SB 1UTPA 3PMJA 3I78A 1PQ8A 2ANMH 1RTLA 3A7WA 5TCCA 1A46H 3SUEA 3EAJA 1MU8B 2EEKA 4YOGA 3RXIA 4MTBA 4ESTE 1GHYH 2V3OH 2BMGB 2ZZUH 3U1IB 3DD2H 2J95A 1GDUA 1VCPA 1AY6H 2TRMA 4CR5A 1Y3WA 2V0BA 2Z9GA 1WU1A 1O2SA 3ATLA 4K5ZA 2FX4A 1MQ6A 2WPMS 4DY7B 1WCZA 2HGTH 3T26A 3ITIA 2ZP0H 1G36A 1P11E 3M7UA 4HTCH 1AGJA 1C1VH 1C5YB 2J38A 1SFQB 2BDHA 1AWFH 2A31A 2BB4A 4KTSA 4X8SH 1GHVH 2ZDNA 1KDQA 1LKAA 2A4GA 1BBRK 2DE9A 3ATKA 1VR1H 4YESB 3LU9B 4MPWA 4NIWA 3U1JB 5JB8S 1UCYK 1A4WH 3ATMA 4X8UH 2ZECA 1MTVA 4Q7XA 2G51A 3Q3XA 3KNXA 5ETXA 2ZNKH 3SORA 2HOBA 5DP7A 1KTSB 3FAOA 4BAOB 3M37A 1O5BB 2ZHEH 2GCHF 2AS9A 2BZAA 1PPGE 1AU8A 2Z94A 3NPSA 4K8BA 4Y11E 4AN7A 4UE7H 3ZVFA 1ELBA 4DURA 1DT2A 1V2MT 1XUIA 4TPYA 1VJ9U 3S69A 3BTHE 1C1UH 3FZDA 3KQCA 4GVUA 4UFDH 8GCHG 1LHCH 2G5VA 4MPXA 3URDA 2HNTE 2BVRH 1O38A 3A83A 2UWOA 2IOTA 4CRBA 1GWAA 4TY6A 1NROH 4ABAA 2OLGA 1GBJA 2A4QA 2WV4A 3TJNA 3GY3A 5T3HA 2Q6GA 1OP2A 3M35A 4XBCA 2BDBA 1J14A 2V35A 2FOBA 1IQLA 1CGJE 3KQBA 2BDIA 5DP5A 1QY6A 3RXTA 1C5ZB 3PTBA 1EOJA 3TITA 4WMEA 1RD3B 2ASUB 1INCA 1P3EA 2XYAA 3A87A 3P6ZB 1GBCA 4KTUA 3EQ0H 4O03A 4DIIH 3NKKA 1HIAB 3K65B 1FZZA 1ELGA 2XW9A 2C8YB 2GTBA 3MH5A 3PO1C 1TGTA 2ZCLP 2FOAA 3RC4A 2PWXA 4A5TS 4DOQA 1ZMNA 1LDTT 2C8WB 1W2KH 1SQOA 1GMDF 4E05H 1OWDA 4XDEA 1O2TA 3EE0B 4O97A 1TMTH 5F6MA 1TX7A 1BDAA 2BTCE 1XKAC 3BTKE 4BAQB 1CQQA 5L2ZH 1ESTA 2OBQA 3DT0H 3SHAH 3PLPA 4A1TA 1V2JT 1DLKB 2XCFA 1W0ZU 3T2NA 4B71A 2XRCA 3ZVEA 1D4PB 5AVDA 1DUEA 3ELAH 2B8OH 5GCHG 4ZHMU 1L1JA 1AMHA 3P8NA 1ESBA 5C1UA 3TNSA 1MBQA 5CE1A 1V2LT 2ANKH 4ISHH 3ENSB 4IGDA 4CH2B 2OQ5A 1TQ0B 2FZZA 3SGBE 1GG6C 1LPZB 1AWHB 1SR5C 2JH0D 1OSSA 1Q3XA 3JZ2B 1WUNH 2HRVA 3BSQA 3GOVB 3LH1A 4MNWA 2WPLS 1PPEE 2BLQA 1BTYA 1O3OA 1QRZA 2P93A 1NRRH 1TQ7B 3JZ1B 2A2XH 4BXWA 1ZSJA 3SU6A 2CF9H 1HBTH 5FPYA 1QJ1B 4NZLA 2EI8A 3TJUA 1SSXA 2AIQA 2B9LA 5EXLA 1SL3A 1V2ST 2J92A 1P2KA 3EYDA 7LPRA 3RP2A 2D2DA 1C5QA 1OXGA 3UNQA 1O2YA 2OC0A 1HAHH 2QGRA 1C2LA 1PQ7A 1ABJH 1ZR0A 2GT8A 2RCEA 4NWLA 6GCHF 1TNLA 1VZQH 5HYOA 3VB6A 1TLDA 1S6FA 1C5VA 1DFPA 1O30A 2LNCA 2GD4B 3PMAB 4A1VA 4D9RA 1EKBB 2A7HA 2A4OA 1KXCA 1XMNB 1N1LA 1P01A 2AH4X 3H5CB 3E90B 1OP0A 3F6UH 1SVPA 3QN7A 1AE5A 3PB1E 5J4SA 1G2LA 1YPKH 3QUMP 2QYIA 4Y7BA 3ZYDA 3SU1A 3E3TA 3H7TA 2HVXA 1KTTB 2WYJA 1H8IH 1E34B 2A45B 1O2JA 2P3UB 1TPPA 1EB2A 2JH5D 2NU0E 3M5LA 2ZFTA 1Y3VA 1VITG 3VB5A 4XE4A 2XTTB 4DGJA 3RXHA 1QL8A 1HAPH 2SGEE 1DITH 1GI3A 2G8TA 3ZZAA 1XXDA 3LGWA 1YPGH 1K1OA 1VJAU 4WWYA 4RSPA 1V6DA 4YLQH 2BLOA 1L1GA 3PLKA 2VIWA 1LHEH 3RXAA 1G32B 4B2BA 4ISNA 5FAHA 4XSKU 1FJSA 4VGCB 2VJ1A 2LPRA 2TBSA 1Z8RA 2FDAA 8ESTE 3OTJE 4K8YA 3UWJH 1QNJA 3QDZB 3SUFA 2ZDKA 3M36A 4ZKNU 1P09A 2FOGA 3SN8A 5FCKA 5LPEA 1Z6EA 2J9NA 3U69H 2Q6DA 5C1XA 1QBNA 2ALPA 4I32A 3SGAE 2FESH 1MTSA 1O3PB 2BY9X 3Q00A 3SI4H 1TRMA 1GDNA 1DDJA 2F3CE 4X8TH 3E8LA 3SV6A 4VGCC 1XUHA 3TJVA 3LPRA 4O3UA 5F8ZA 1C5PA 2R0KA 1GHXH 4NA8A 4X8VH 3SJ9A 1GHBG 1EJAA 4MNYA 3A7VA 2PR3A 3F9FA 1O2VA 1O2MA 4D9QA 1TRNA 3RU4E 1ELCA 3U8RH 1CT0E 1DXPA 1YPHC 2VGCC 5F8TA 1AQ7A 4ZROA 3ZVGA 1AFQB 2O9QA 1S84A 2PTCE 1O3MA 5FX6A 1BTHH 3HKIB 3TK6A 1BMAA 4I7YH 1LVMA 2AERH 1GI5A 2C3SA 2RA3A 4CHAB 1SGYE 4Y7AA 1G2MA 4GSOA 4WJG2 4IW4E 2ZGJA 4ZKRU 2UWPA 1QTFA 1GBIA 3LGUA 3M7TA 1ELDE 1MD8A 4JK6A 4ZXYH 5A0BA 3SOSA 3V13A 3HK6B 1O2IA 3GCHB 1UMAH 5I46H 4ZKOU 5DPAA 3RLYH 2EI7A 2AGEX 1LPKB 1MUEB 3AVZA 3BEFB 4ABHA 3UPEA 2W3IA 1XKBC 1YCPH 2CHAC 4CHAC 3KL6A 3ZV9A 3MU4A 3FFGA 4ISLA 1TB6H 1HV7A 3GDSA 1DWDH 3M61U 2B7DH 4LZ4B 1C2DA 1TALA 1ACBE 1N8OB 3LJOA 2VWMA 2Z9JA 1DWBH 1O2LA 1QR3E 3BG8A 3RDZA 1UVOA 3LC5A 1BIOA 4YO9A 2R3YA 1RIWC 1EOLA 1SLUB 1GVZA 3PWBA 1QURH 1F0UA 2FP7B 2Y7ZA 5AFYH 5AHGH 1NFYA 2EC9H 4IBLH 2ZGHA 6CHAC 3A7TA 1BRBE 3BTFE 4Y76A 1FPCH 1KXBA 1ZHMA 2ODQA 3UY9A 2B5TB 2WV5A 1HXEH 3SQEE 3TGIE 1ZJKA 2ZG0H 5DP8A 1LO6A 1TNKA 2F9NA 1GJ6A 3TK5A 1YLDA 2A7JA 5IYTA 1VCWA 2G00A 2FOHA 3ZVBA 4IMZA 1O5FH 5JDUB 1TFXA 2BXTH 1TX6A 1ZGIA 3RXFA 1QQUA 4TYDA 4I31A 4YZUA 4J2YB 4ABDA 2NU4E 2VH0A 2HWLB 1YPMH 2FX6A 3MNCA 1VITH 1G37A 1GI1A 5DP3A 1KIGH 4YM9A 1AZ8A 3SBKA 2ANWA 3UIRA 1C1RA 4RKJB 1ZSKA 1WTHD 3TJOA 1GHAG 2ZQ1A 4H6SB 5J4QA 1SGEE 1NY22 1HIAA 1CA0B 4Z0KA 3A8CA 1WQSA 4MPVA 4BAHB 2BHGA 2PSXA 5ESBA 1UVUH 5DP6A 5C1YA 1SMFE 1CE5A 1C2HA 2G52A 1FY8E 3KQDA 4TWYA 3Q76A 1GDQA 4MNXA 4AORA 1C5UA 2WPJS 1P57B 2QC2A 1GMCF 2TGAA 3TH2H 1MH0A 3OX7U 1NPMA 4OS6A 1AD8H 3CP7A 1FY5A 3ZV8A 2YNAA 1B5GH 1MKXH 1N6XA 1ZLRA 3ZZ6A 5FXLA 2GMTC 3PWCA 1TPOA 2A4RA 1O5AB 1FV9A 3LGIA 4I33A 1FONA 2BD7A 3RU4T 1HDTH 2QXHA 3RXUA 2M5TA 3LDXH 3STJA 3STIA 4MG3A 1H1BA 1HAZB 3O8BA 1J9CH 1SGFG 4K60A 2ANYA 5T6DA 4AB8A 1D6WA 2O8LA 5FBIA 3SQHE 3GYMA 5FPSA 1W13U 2C8ZB 2ZQ2A 3M5MA 3MH4A 4AOQA 4FUCA 3QTOH 3VGCC 5HXFA 3NUMA 3WY8A 1C5WB 2QCYA 1MKWH 1P12E 1Q31A 1W10U 3GY5A 1SOTA 4X1NU 5CHAB 3RMOH 5L6NH 4DJZB 3GCOA 5IDKA 1O0DH 1F5RA 1K22H 1THPB 1QIXB 1YF4A 4JZ1A 1S83A 1UTLM 3NCLA 2H2ZA 2STBE 3O8CA 2XBYA 2RA0A 3I77A 2QA9E 3HK3B 2OQUA 3P8OA 1NN6A 3SV8A 2BDCA 2FLBH 1O39A 2FOFA 3LIWA 1NS3A 1YPEH 1GJBB 4X6MA 2G4TA 1GJ4H 2OP9A 2PHBA 1QHRB 4WH6A 1G30B 1IQIA 1T4UH 3P92A 2A2QH 2J2UA 1F0SA 2K1QA 2CJIA 1UTKA 3K6YA 4KELA 3A82A 1A0HB 1C1TA 2F9VA 1OS8A 3NZIA 1HAOH 1GI0A 1ANDA 1K1IA 1DOJA 4FUJA 1CSOE 2YOLA 4IN2A 3MI4A 3NK8A 1UHBB 3KF2A 3TPIZ 3E1XB 2BDGA 2ZKSA 1V2NT 4D76A 1LQEA 1O36A 2FWWA 1P2IA 1GBMA 5A2MH 2EI6A 1ELVA 1P2QA 1P9SA 4ZHLU 4FXGH 2H5DA 1O5CB 1CHOF 4FU8A 2OBOA 1SLXB 1TOMH 1SOZA 4F4OC 1XVOA 1IQJA 1OYQA 2ZU2A 1CGIE 3DFLA 1FN6A 2Y81A 3F9HA 4E7NA 1S0QA 3K6ZA 4M7GA 5EODA 3UWIA 1XX9A 4NSYA 4OGYA 1EAUA 1QB1A 4CRCA 3SU5A 1DY9A 4FU7A 1RGQA 4B2CA 5A8XA 3LGYA 1PPCE 1MCTA 1BTZA 2D8WA 1K1PA 1BRAA 1UTJA 1GJAB 4K1SA 2VIPA 5LH8A 3VXEH 5JPMH 3E0NB 5BPEA 4AFQA 1N6YA 2VINA 3MHWU 1BHXF 1PYTD 4FVBA 1NRPH 2WPKS 2Y6TA 1BITA 3IG6B 4Q80A 1NT1A 1OWIA 3OSYA 1GJ7B 4IS5A 1E36B 4Y71A 4GCHG 5E0GA 3DA9B 5I25A 2GZ9A 2GDEH 1GI2A 1G3CA 4OS7A 2AYWA 1M9UA 1ZPBA 3PO1B 1E35B 3QGNB 4HFPB 2H5CA 7GCHG 1UK4A 1A3BH 4Y6DA 3SJKA 4A92A 4OS1A 2BQWB 5A0AE 2J4IA 3QK1A 4MNVA 1D3DB 2IJOB 3V12A 2GP9B 4AGKA 1F2SE 3NXPA 4CH8B 4Z6AH 5K7RA 1ZSLA 1DSTA 3RXQA 1GBAA 2KAIA 1GJCB 4AFSA 2FI3E 1S82A 3CS0A 1GMHF 2Z9KA 1O2XA 1TGCA 3T28A 3UOUA 2XCNA 3U8TH 2AIPA 1BMMH 1CVWH 1W3CA 1NC6A 1AN1E 3A84A 2ZFQH 5B6OA 1HAYB 2F9UA 4BTUB 3U8OH 2BVSH 1JMOH 3LOXA 2QN5T 1DICA 1O33A 1ZOMA 5A0CA 1BRUP 2CGAA 5F8XA 1EZSC 2FI5E 3PV4A 1C1PA 1DWEH 3VB4A 1S81A 1F5LA 1KLJH 2TGPZ 5EPYA 2TGDA 3GDVA 1C5NH 1BJUA 4ZHAA 2RG3A 3ESTA 1AUTC 1ARBA 1GG6B 1JXPA 3D65E 5HGGA 1DLEA 1UVPA 1THSH 2VWOA 4AYYB 1OOKB 1GJ9B 1O32A 1ZTJA 1EP6A 4XBBA 1H8DH 2W3KA 1HJ8A 4ZAEA 1K1JA 2BY5X 5G4BA 2ZTYA 2QF3A 4LOYH 1UK3A 1P2NA 4MVNA 1EB1H 2Z9LA 5EU8A 9ESTA 1ELFA 1OWHA 2SGAA 2R3UA 3I29A 3Q77A 4U01A 2J94A 4Y8ZA 3T27A 3TNTA 5C20A 3PMHB 2A32A 4X2YA 1HAVA 2OC8A 2F91A 1P2MA 3VXFH 4AB9A 2CN0H 2QY0B 1CHGA 1QL7A 5C67A 3BIUH 5JBTA 1BTUA 2W26A 3KGPA 1KXDA 1PPHE 2H6MA 3LKWA 3R0FA 1AKSB 1F5KU 2SNVA 2BX3A 3UNSA 1DSUA 2I6QA 1F7ZA 3EA8A 1OX1A 2FMJA 1V2QT 2I6SA 2HLCA 3E16B 1ZHPA 1P10A 4B75A 4OGXA 2FM2A 2Y5GA 1FY1A 2PKAB 2P16A 3ODDA 4SGAE 4DW2U 2BDAA 2Z6BD 5FHTA 1AE8H 5E0JA 4F49A 1DY8A 5JBAS 2AMDA 1GI7B 3GICB 1BMLA 8GCHF 2THFB 1EAIA 1KSNA 3UTUH 4JYUH 1TNIA 4GLYA 1C1OA 2VVVA 1O3EA 1T31A 2OC1A 3VB3A 3MO3A 2QXIA 4B1TA 3GY6A 3H7OA 4ISIH 2FTMA 5C5OA 1W11U 1MTNC 3QWCH 3GCTG 2ZDAH 1J16A 3URCA 2ZDLA 1JOUB 1GCTB 4WXVA 4YT7H 3AW0A 3RM0H 1QL9A 1TMUH 1SGQE 4ASHA 3ZZ5A 1TX8A 3MO9A 2G81E 2BXUH 5L30H 2AFQB 1IQNA 2OTVA 4NZQA 3BTQE 3ZZCA 1RS0A 1DS2E 1OKXA 2ZU1A 3GCNA 2XC0A 1G3EA 1O31A 1H9LB 2ZFRH 3ZZ4A 1GCTC 5A09A 2VB0A 1LTOA 3MOCA 1CBWB 3FVFB 4GAWA 2FYRA 1B0FA 3GY4A 3HGNA 3AAUA 3SNEA 2ZPQA 3P8FA 1YM0A 2UUKB 1O34A 1P05A 3O8RA 3ZVDA 3RXKA 1FMGA 1FAXA 1EAWA 1LKBA 2SGFE 1TA2A 4TPIZ 5EG4A 2R2MB 3LT3A 2VGCB 2P59A 1UTOA 3TGJE 1QCPA 1E0FD 1GL0E 1HJ9A 3PM3A 1Z71A 5GCHF 1TBQH 4DCDA 3LH3A 1TGNA 4Q7ZA 1CBWC 2FOEA 1FN8A 1O2KA 3E6PH 1Z8JB 5DP9A 1KXEA 1GGDC 1GI6A 1KXFA 1ZJDA 4U32A 6ESTA 1FUJA 1TPSA 1ZTKA 2NU2E 3B8JA 4Y79A 1DM4B 4I8GA 1AHTH 5EGMA 1LPGB 1GBTA 4MQAA 2ZHDA 5C2ZA 1EQ9A 1ZRKA 1S6HA 2R0LA 1A5GH 1V2WT 4Y0YE 4JZEH 2P95A 3MYWA 2CHAB 1EZQA 2NU3E 1P3CA 1B7XB 1CU1A 1KLTA 1TPAE 2FYQA 1PPBH 1FY4A 2FI4E 4PROA 1IOEA 1UHBA 1JWTA 2GCTB 1BBRH 1P06A 4O3TA 3KN2A 3M3SA 1BUIA 1PQ5A 1Y5UT 2KAIB 3AASA 2F9OA 2H9TH 3UQOA 2FPZA 1C4Y2 2V6NA 1V2VT 4H42U 1UCYH 1GHZA 2RDLA 1RIWB 1HFDA 2FIRH 2Z9IA 1WAYB 3MU5A 3TK9A 3BV9B 5HMAA 3W95A 1O37A 1Y8TA 4UEHH 4MDSA 2ZPSA 6CHAB 8KME2 3GY7A 3KEEA 2FODA 1T8LA 4ABBA 1P03A 1J8AA 1V2TT 2GCTC 2VU8E 3GISB 1C4U2 1MAXA 4NWKA 3PYHA 3OY6U 4XFQA 1XM1A 1NM6A 3CENA 1VITF 1P9UA 2TIOA 4FUEA 1P0SH 4X6PA 3ZYEA 1ZMJA 1SGTA 4UFFH 4K2YA 3D23A 2ZWLH 4X0WU 2SGDE 1T4VH 1KXAA 2WUBA 3PTNA 1QGFA 1SI5H 3EA9A 3SO3A 3S7HB 4IC5A 1ETRH 1YC0A 1AIXH 3DFJA 1TNHA 4ABEA 2BM2A 4I8HA 2A7CA 3MU0A 1O3BA 4JZDH 3S7KB 3SNDA 1UJ1A 4BAKB 2BLWA 1SHYA 4BNRA 1BOQA 1Y3XA 3N7OA 1DANH 3A88A 3T29A 1HAXB 1ZGVA 1XVMA 1C2MA 1HAVB 1TBRH 1C5TA 2FS9A 2YNBA 5K0HA 4NIVA 4Y8YA 3TVJB 1JIMA 1YPJH 4AFZA 5PTPA 1GBEA 5EQSA 3EDXB 1LVOA 1QJ7B 1YYY1 4WY3A 2GT7A 2VNTA 3BIVH 4NCYA 3RMMH 4CRAA 1O2QA 1ELEE 2D26C 3UR6A 1W7GH 2PV9B 3TGKE 1DPOA 3V0XA 4J1YA 3LJJA 1O2GH 2JKHA 1GHBF 1QA7A 1WTGH 1SQTA 2STAE 1A0JA 5H4IB 1TIOA 1XUJA 3AAVA 3F9GA 3L33A 2V3HH 5DJ7A 2Z3DA 4A7IB 2FTLE 1V2UT 2HPQH 1TGBA 2FS8A 2ODYB 2GZ8A 1RJXB 2GMTB 1O3KA 3U98H 4UDWH 1OWEA 1D3QB 3OU0A 2GZ7A 1A7SA 4WXIA 2JETB 2ZPRA 1GHWH 1BQYA 2XBXA 1PFXC 3VFEA 3RXGA 3S9CA 2VIVA 1A5HA 2TGTA 4D7GA 2GDDA 2BQ7B 1O3FA 1JIRA 1O2OA 3D49H 3L3TA 3RXVA 3FP8E 3NWUA 4KGAA 1S85A 4NFEA 1PYTC 2W5EA 2H9HA 1O5EH 3BTTE 1O5GH 2P94A 2ZF0H 5GXPA 4ZMAH 1MQ5A 1ESAA 2ZGCA 2ZU4A 3VGCB 3M5NA 1RXPA 2BYAX 4YOIA 3SNCA 4CREA 2JETC 3E0PB 3MFJA 4WH8A 1UTNA 1ZHRA 4LZ1H 3QZQA 2UUFB 5E2PA 1FPHH 1UVTH 2WYGA 3KQEA 4NFFA 1NFUA 3BF6H 1L1NA 3P17H 4I8KA 5EXMA 5A8YA 1TA6A 3SI3H 1AFEH 3LGVA 4KP0A 2G5NA 4D8NA 1LVBA 3TH4H 3UNRA 2A5AA 4Y8XA 1AKSA 4E06H 5JBBS 1Q2WA 3SNAA 1P8VC 1FY3A 4X1PU 1C5MD 1MCVA 2GCHG 2ZU5A 2PFEA 2BQ6B 3GY2A 2PKAA 2GGVB 3R3GB 2FLRH 5HM2A 5JYIA 1CGHA 3IWMA 1F0RA 2ZO3H 4DVAU 3ZZBA 2BD2A 1MTUA 1O3NA 3A7YA 4Q7YA 1TYNA 3W94A 1W7XH 2GVFA 3S9AA 4BOHA 1J15A 2XWBI 3VEQB 4FUBA 5HM9A 4ABFA 3SJ8A 2O8MA 1DX5M 2XNIA 2A5IA 8LPRA 4X1RU 3IITA 2ZGBH 3L6PA 2PTNA 2G4UA 1FI8A 4HZHA 3KCGH 2ZTXA 1NRSH 4E7RG 3SZNA 1HAIH 4B76A 1BT7A 3VB7A 1GHAF 1EZUC 3RXJA 4K1EA 1WOFA 2ZDMA 1MZDA 2BOHB 1O2RA 1TNJA 2ESTE 1GBFA 1Z8IB 2ZCKP 2ZEBA 4IMQA 3TLOA 4OS5A 4ZXXH 3B23B 1GMDG 1PJPA 3DUXH 5EW2H 1JRSA 2A0QB 3A8DA 4NIYA 1C1WH 1ZZZA 2ZFFH 3SU4A 4TWWA 1ETTH 1KYNA 3TIUA 1Z7KA 1TE0A 2OUAA 3QZRA 3UUZA 1Y3UA 1T32A 2CF8H 3EA7A 2BX4A 2NU1E 3QLPH 3RXCA 1GCDA 3MH6A 5F03A 2WINI 1BB0B 1Y59T 5LPRA 2BLVA 1O3AA 4JK5A 3RXEA 1BTXA 3HGPA 4UFEH 2JH6D 5SGAE 1O2HA 1MD7A 1GBDA 4LK4A 2HALA 5TJXA 4FUFA 3UR9A 2QXGA 1AI8H 2VIQA 3RLWH 2IPHA 1RTKA 4DT7B 5E8EH 3HATH 1T7CA 2F83A 1XUKA 1AVWA 5ABWA 1ARCA 3RXSA 1TOCB 1V2KT 5GIBA 2Z3EA 4CR9A 1QBVH 1LHGH 1FQ3A 1HPGA 3UFAA 3MNBA 3SUDA 1ZRBA 1TNGA 3P95A 1A3EH 3A8BA 2B0FA 1S5SA 4CRFA 3DHKH 2A5KA 2BY6X 1IQHA 3FANA 1AB9B 1SGRE 2OXSA 4ABJA 3MNXA 1GVKB 4BTIB 1YCPK 4YT6H 2QAAA 1P2OA 2PW8H 1DUAA 2F9BH 1YBWA 2OD3B 3V7TA 3ATWA 3RMNH 6GCHG 3MU1A 1IAUA 1YPHE 2ODPA 1DXWA 4NSVA 1ELAA 1SG8B 1C2GA 4THNH 2OCVB 1XUGA 1NU7B 2Z7FE 2VIDA 2C8XB 2CV3A 3B9FH 1DE7H 1C2FA 1MBMA 1YPLH 2HPPH 4JYVH 1GBHA 1V2RT 1HUTH 5FX5A 1AB9C 1L4ZA 2CXVA 1MAYA 3GY8A 1K1NA 2FOMB 1QQ4A 4WVPE 1HYLA 1O3GA 3BN9A 2ZDVH 1W0YH 1PPFE 2FOCA 4SGBE 3M7QA 2H1UA 2W7UA 3SV7A 1D9IA 4A6LA 4JCNA 2BVXH 3P70B 1O5DH 2WUCA 4INLA 5EPNA 2D1JA 1D3PB 2BD4A 1C1MA 2Y7XA 4MLFB 3SU2A 3AW1A 4ZKSU 1HGTH 1K28D 1OPHB 1QFKH 1O3HA 2IN2A 1TABE 2UUJB 2ZFPH 4UD9H 3PROA 3A8AA 3T25A 3U9AH 3A81A 2C4FH 3ATIA 2BDYA 1UK2A 1T8OA 2VVCA 4NA9H 4X1QU 1PQAA 1SLVB 1O3JA 2R2WU 3RU4D 2VWNA 1O3LA 3MH7A 1EJMA 1UTQA 3SNBA 3RC5A 5FBEA 1OP8A 4I8JA 1C1SA 1RFNA 3GDUA 1LVYA 1EZXC 3KHVA 1GJ5H 3P8GA 4D7FA 1FXYA 1DWCH 1FIWA 1A1RA 3EGKH 1W12U 3Q3KA 1YKTA 4MPUA 4X2WA 1WQVH 4UONA 1IHTH 1KLIH 1BRCE 2PGQB 2BY8X 4NGAH 3RM2H 3RXRA 3HPTB 1MZAA 4JYTA 4X2XA 1ANCA 1Y5BT 1GBLA 1EX3A 1SQAA 1A61H 5ESTE 1BMNH 1C5RA 3K9XB 1S0RA 1C5SA 2PSYA 1K1MA 1L2EA 4FUGA 2Q1JA 1TMBH 1EXFA 1VGCB 3BEIB 4FU9A 4LXBH 1IQFA 5A8ZA 1HLTH 1MTNB 1EPTB 2ZIQH 1Z1IA 4WMFA 3T62A 1XXFA 1EP5A 1FLEE 1MKXK 5GJ4B 2DUCA 1HJAB 1Z8GA 3LONA 1GVLA 4AFUA 1TAWA 1ETSH 3RXOA 4GCHF 1GJ8B 1NU9A 1A0LA 3A80A 1P2JA 4X2VA 3ZZ7A 4INHA 1ZPCA 2PKSB 1QB6A 3LC3A 7GCHF 4CRGA 4ABIA 1UO6A 1FDPA 1IQEA 1W8BH 2CMYA 2UWLA 1GL1A 1NFWA 1VGCC 1FNIA 1EASA 2Y80A 1OWKA 1EPTC 1SGFA 3HKJB 4RN6A 1NRQH 3QTVH 2VH6A 5BRRE 2H9EH 5C5NA 1WYKA 1HJAC 3ZZ8A 4X6OA 7KMEH 2AMQA 1QA0A 2P8OB 4I8LA 2PUQH 1OWJA 1LHDH 3F9EA 3MU8A 1AUJA 4GHQA 1MKWK 3C1KA 2PKSC 2QF0A 4RKOB 1C2IA 3RUOA 2ZCHP 1O2WA 3G01A 1IQGA 3TU7H 3BTDE 1UTMA 1CO7E 2AGIX 1ELTA 1EAXA 3D62A 5FCRA 5DO4H 1A5IA 2PUXB 4WF8A 2ZC9H 1Z1JA 1C1QA 3C27B 1NTPA 5FPTA 2P8OC 4K69A 3FZZA 1U6QA 2VVUA 1AO5A 2F9PA 1C4V2 1GBBA 1C9PA 5EXNA 1O35A 1H4WA 1BJVA 1SLWB 3K2UA 1GGDB 4DG4A 1Y3YA 1SB1H 4JZFH 1ZTLA 3MO6A 2P3TB 2W7SA 1K2I1 4XOJA 1O2PA 3SV2H 9LPRA 1G9IE 7ESTE 1B0EA 5LGOA 1AVGH 4OS4A 1WSSH 1F92A 2XBWA 2TPIZ 1H9HE 3SUGA 5E2OA 1LCYA 1KDQB 4NG9H 4KTCA 1BZXE 1QBOA 1D6RA 2BD9A 2O8WA 4H6TA 1SFIA 5DK1A 2QV1A 2Q6FA 3UREA 1O3CA 1V2OT 1NO9H 1BCUH 1CT4E 1K9OE 1QRXA 1EATA 1C2JA 2ZHQH 2ZU3A 2ZFSA 4NIXA 1X7AC 3UOPA 4X1SU 2O8UA 1LQDB 4U30A 1MU6B 2NWNA 2HNTC 1V3XA 5DG6A 4ZH8A 5GPIB 4JZIA 4YTAA 1QRWA 2UUYA 1NRNH 1ORFA 3QX5H 4AZ2B 1ANEA 1XUFA 4BXSA 2AEIH 1TRYA 5EOKA 2BD8A 5DGJA 4AG2A 1ANBA 1GPZA 2ZHWH 1HNEE 5GWZA 2OINA 1K1LA 2WPHS 2WPIS 1ZMLA 1D3TB 2PGBB 1JRTA 4Q2KA 1GMCG 3O8DA 2SGQE 2Y5FA 5EQRA 2P3FH 1TBZH 3A89A 3UQVA 3OYPA 1C2KA 2EA3A 1Y5AT 3RXPA 1C1NA 1GJDB 1ZPZA 2BOKA 1HXFH 1GI9B 1TWXB 3GCTF 3RXLA 2AMPA 1AFQC 3BEUA 5JBCS 3BG4B 4QT8C 3SHCH 4H4FA 3SJIA 1L0ZA 4IN1A 1OYTH 1WBGB 1EJNA 3SU3A 1SPJA 1HRTH 2SFAA 2FO9A 3T5FH 4DIHH 1O3IA 4B2AA 1SHHB 1K21H 4YLUA 5AF9H 1THRH 4K1TA 6LPRA 2XWAA 5JB9S 2SNWA 5CMXH 3A85A 3GCHC 3QGJA 3BTME 3MWIU 4FUIA 4JMYA 3BG4C 1BTWA 5DKMA 1L4DA 1LMWB 2J34A 2XC4A 4YOJA 2VWLA 2G55A 1HB0B 2BD5A 1H9IE 3VPKA 1JBUH 4R0IA 3ZVAA 3GYLB 3CS7A 3E91A 4XBDA 4HGCA 1CA8B 3RXDA 2ZTZA 1N8OC 3ZZ3A 2C93B 3SV9A 1YP9A 1MMJN 1GBKA 2OC7A 1RTFB 1YGCH 1Z6JH 3BTWE 5T6FA 1E38B 2BZ6H 2BY7X 4O9VA 3RC6A 3SGQE 1SC8U 4BANB 4CBOA 4GHTA 3LGTA 2XC5A 3MNSA 4AG1A 1SGNE 1PPZA 3PLBA 1C9TA 1LHFH 2VIOA 1GI4A 5GDSH 3FP6E 4AGJA 5LPFA 3ZZDA 3SJOA 2FEQH 3MMGA 1WV7H 1T8MA 1YLCA 1TGSZ 3A86A 1C5OH 1O2NA 1MTWA 1QB9A 4FUDA 1ZYOA 2QIQA 5E0HA 1O3DA 2HNTF 4WMDA 3MTYA 1YCPM 3RXMA 1TONA 2XBVA 2GV6A 1RRKA 1SBWA 1V2PT 3RMLH 4U2WA 1CT2E 2Z3CA 3M5OA 4ZUHA 1SGPE 3S0NA 1G3BA 1IQMA 1CHOG 1P04A 2AGGX 1EUFA 1J17T 2Y5HA 4UFGH 1E37B 3OY5U 3A7ZA 4Y10E 1NZQH 3BTEE 3ZZ9A 2ZA5A 1CA0C 4OS2A 4CBNA 3F68H 1BHXB 1GI8B 1QJ6B 2ILNA 5C3NA 3M3VA
chains in the Genus database with same CATH superfamily
3TH3H 4CRDA 1F0TA 2KCOA 5EW1H 5T6GA 1C5LH 1BBRE 2O8TA 3V3MA 4IC6A 5L2YH 2C90B 2GKVE 3WW7A 1P02A 1UCYE 5TCAA 1NESE 3PMBB 2GX4A 2XXLA 1SGIB 5AFZH 1VCQA 3S9BA 3QO6A 4A1XA 1O2ZA 1NFXA 1O2UA 2ZI2H 2DE8A 4GPGA 4BAMB 3FP7E 2R9PA 1KY9A 2QXJA 4KKDA 1BTPA 2SGPE 3F2FA 1EPTA 4FVDA 1SGDE 4NA7A 4P00A 3N7DA 4GUXA 1C2EA 3RXBA 2Y82A 1IQKA 1W14U 2ZHFH 2PLXA 4BTTB 1AZZA 4ISOA 1FX0B 4Y0ZE 3SU0A 4B74A 4AYVB 2ULLA 3Q3YA 4RI0A 1IHSH 1E1RD 4HI3A 2ALVA 1G3DA 4AX9H 1A2CH 4YXWD 3M3TA 1C5XB 3ODFA 1GMHG 2FXRA 1ID5H 4B73A 3ZVCA 1SGCA 1T8NA 3A7XA 4FUHA 2A1DB 4TSFD 1DVAH 2OK5A 1AVXA 1FAKH 1HAGE 3SW2B 4R8TB 2BD3A 1BA8B 3KIDU 1ABIH 5CHAC 4X6NA 2GV7A 2ZGXH 1FIZA 1UVSH 1NBME 3BTGE 4INKA 5EQQA 4TY7A 5DP4A 2QF4A 4ABGA 4K3JA 1HCGA 3F1SB 1UTPA 3PMJA 3I78A 1PQ8A 2ANMH 1RTLA 3A7WA 5TCCA 5KGOA 1A46H 3SUEA 2J5UA 3EAJA 1MU8B 2EEKA 4YOGA 3RXIA 4MTBA 4ESTE 1GHYH 2V3OH 2BMGB 2ZZUH 3U1IB 3PV5A 2J95A 3DD2H 1GDUA 1VCPA 1AY6H 2K0QA 2TRMA 4CR5A 1Y3WA 2V0BA 2Z9GA 1WU1A 1O2SA 3ATLA 4K5ZA 2FX4A 1MQ6A 2WPMS 4DY7B 1WCZA 2HGTH 3T26A 3ITIA 2ZP0H 1G36A 1P11E 3M7UA 4HTCH 1AGJA 1C1VH 1C5YB 2J38A 1SFQB 2BDHA 1AWFH 2A31A 2BB4A 4KTSA 4X8SH 1GHVH 2F43B 2ZDNA 1KDQA 1LKAA 2A4GA 1BBRK 2DE9A 3ATKA 1VR1H 4YESB 3LU9B 4M9FA 4MPWA 4NIWA 1KMHB 3U1JB 5JB8S 1UCYK 2KFWA 1A4WH 3ATMA 4X8UH 2ZECA 1MTVA 4B6FA 4Q7XA 2G51A 3Q3XA 3KNXA 5ETXA 2ZNKH 3SORA 2HOBA 5DP7A 1KTSB 3FAOA 4BAOB 3M37A 1O5BB 2ZHEH 2GCHF 2AS9A 2BZAA 1PPGE 1AU8A 2Z94A 3NPSA 4K8BA 4Y11E 4AN7A 4UE7H 3ZVFA 1ELBA 4DURA 3FO8D 1DT2A 1V2MT 1XUIA 4TPYA 1VJ9U 3S69A 3BTHE 1C1UH 3FZDA 3KQCA 4GVUA 4UFDH 8GCHG 1LHCH 2G5VA 4MPXA 3URDA 2HNTE 2BVRH 1O38A 3A83A 2UWOA 2IOTA 4CRBA 1GWAA 4TY6A 1NROH 4ABAA 2OLGA 1GBJA 2A4QA 2WV4A 3TJNA 3GY3A 5T3HA 2Q6GA 1OP2A 3M35A 2KZ4A 4XBCA 2BDBA 1J14A 2J98B 2V35A 2FOBA 1IQLA 1CGJE 3KQBA 2BDIA 5DP5A 1QY6A 3RXTA 1C5ZB 3PTBA 1EOJA 3TITA 3PRDA 1RD3B 4WMEA 2ASUB 1INCA 1P3EA 2XYAA 3A87A 3OAAD 3P6ZB 1GBCA 4KTUA 3EQ0H 4O03A 4DIIH 3NKKA 1HIAB 3K65B 1FZZA 1ELGA 2XW9A 2C8YB 2GTBA 3MH5A 3PO1C 1TGTA 2ZCLP 2FOAA 3OE7D 3U28C 3RC4A 1COWD 2PWXA 4A5TS 4DOQA 1ZMNA 1LDTT 2C8WB 1W2KH 1SQOA 1GMDF 4E05H 1OWDA 4XDEA 1O2TA 3EE0B 4O97A 1TMTH 5F6MA 2RFKC 1TX7A 1BDAA 2BTCE 1XKAC 3BTKE 4BAQB 4FOUC 1CQQA 5L2ZH 1ESTA 2OBQA 3DT0H 3SHAH 3PLPA 4A1TA 1V2JT 1DLKB 2XCFA 1W0ZU 3T2NA 4B71A 5C0UA 2XRCA 3ZVEA 1D4PB 5AVDA 1DUEA 3ELAH 2B8OH 5GCHG 4ZHMU 1L1JA 1AMHA 3P8NA 1ESBA 5C1UA 3TNSA 1MBQA 5CE1A 1V2LT 2ANKH 4ISHH 3ENSB 4IGDA 5C17A 4CH2B 2OQ5A 1TQ0B 1W0JD 2FZZA 3SGBE 1GG6C 1LPZB 1AWHB 1SR5C 2JH0D 1OSSA 1Q3XA 3JZ2B 1WUNH 2HRVA 3BSQA 3GOVB 3LH1A 4MNWA 2WPLS 1PPEE 2BLQA 1BTYA 1O3OA 1QRZA 2P93A 1NRRH 1TQ7B 3JZ1B 2A2XH 4BXWA 1ZSJA 3SU6A 2CF9H 1HBTH 5FPYA 1QJ1B 4NZLA 2EI8A 3TJUA 1SSXA 2AIQA 2B9LA 5EXLA 1SL3A 1V2ST 2J92A 1P2KA 3EYDA 7LPRA 1E1QD 5HIYA 3RP2A 2D2DA 1C5QA 1OXGA 3UNQA 1O2YA 2OC0A 1HAHH 2QGRA 1C2LA 1PQ7A 1ABJH 1ZR0A 2GT8A 2RCEA 2VBCA 4NWLA 6GCHF 1TNLA 1VZQH 5HYOA 2WPDD 3VB6A 1TLDA 1S6FA 1C5VA 1DFPA 1O30A 2LNCA 2GD4B 3PMAB 4A1VA 4D9RA 1EKBB 2A7HA 2A4OA 2IJD1 1KXCA 1XMNB 1N1LA 1P01A 2AH4X 3H5CB 3E90B 1OP0A 3F6UH 1SVPA 1YWUA 2JIZD 3DSPA 3QN7A 1AE5A 3PB1E 5J4SA 1G2LA 1YPKH 3QUMP 2QYIA 4Y7BA 2HLDD 3ZYDA 3SU1A 3E3TA 3H7TA 2HVXA 1KTTB 2WYJA 1H8IH 1E34B 2A45B 1O2JA 2P3UB 1TPPA 1EB2A 2JH5D 2NU0E 3M5LA 2ZFTA 1Y3VA 1VITG 3VB5A 4XE4A 2XTTB 4DGJA 3RXHA 1QL8A 1HAPH 4F48B 2QF5A 1DITH 2SGEE 1GI3A 2G8TA 3ZZAA 1XXDA 3LGWA 1YPGH 3F0OA 3OTPA 1K1OA 2W6JD 1VJAU 4WWYA 4RSPA 1V6DA 4YLQH 2BLOA 1L1GA 3PLKA 2VIWA 1LHEH 3RXAA 1G32B 4B2BA 4ISNA 5FAHA 4XSKU 1FJSA 4VGCB 2VJ1A 2LPRA 2TBSA 1Z8RA 5EIYA 2FDAA 8ESTE 3OTJE 4K8YA 3UWJH 1QNJA 3QDZB 2JDID 3SUFA 2ZDKA 3M36A 2WZQA 4ZKNU 1P09A 2FOGA 3SN8A 5FCKA 5LPEA 1Z6EA 2J9NA 1SQRA 2HVYB 3U69H 2Q6DA 5C1XA 1QBNA 2ALPA 4I32A 3SGAE 2FESH 4FETA 5GNDA 1MTSA 1O3PB 2BY9X 3Q00A 3SI4H 1TRMA 1GDNA 1DDJA 2F3CE 4X8TH 3E8LA 3SV6A 4VGCC 1XUHA 3TJVA 3LPRA 4O3UA 5F8ZA 1C5PA 2R0KA 1GHXH 4NA8A 4X8VH 3SJ9A 1GHBG 1EJAA 4MNYA 4XD7D 3A7VA 2PR3A 3F9FA 1O2VA 1O2MA 4D9QA 1TRNA 3RU4E 1ELCA 3U8RH 1CT0E 1DXPA 1YPHC 2VGCC 5F8TA 1AQ7A 4ZROA 3ZVGA 1AFQB 2O9QA 1S84A 2PTCE 1O3MA 5FX6A 1BTHH 3HKIB 3TK6A 1BMAA 4I7YH 1LVMA 2AERH 1GI5A 2C3SA 2RA3A 4CHAB 1SGYE 4Y7AA 1G2MA 4GSOA 4WJG2 4IW4E 2ZGJA 4ZKRU 2UWPA 1QTFA 1GBIA 3LGUA 3M7TA 1ELDE 1MD8A 4JK6A 4ZXYH 5A0BA 3SOSA 3V13A 3HK6B 1O2IA 3GCHB 1UMAH 5I46H 4ZKOU 3N7EA 5DPAA 3RLYH 2EI7A 2AGEX 1LPKB 1MUEB 3AVZA 3BEFB 4ABHA 3UPEA 2W3IA 1XKBC 1YCPH 2CHAC 4CHAC 3KL6A 3ZV9A 3MU4A 3FFGA 4ISLA 1TB6H 1HV7A 3GDSA 1DWDH 3M61U 2B7DH 4LZ4B 1C2DA 2LELA 1TALA 1ACBE 1N8OB 3LJOA 2VWMA 2WSSD 2Z9JA 5C94A 1DWBH 3MQKC 1O2LA 1QR3E 3BG8A 3RDZA 1UVOA 3LC5A 1BIOA 4YO9A 2R3YA 1RIWC 1EOLA 1SLUB 1GVZA 3PWBA 1QURH 1F0UA 2FP7B 2Y7ZA 5AFYH 5AHGH 1NFYA 2EC9H 4IBLH 2ZGHA 6CHAC 3A7TA 1BRBE 3BTFE 4Y76A 1FPCH 1KXBA 1ZHMA 2ODQA 3UY9A 2XOKD 2B5TB 2WV5A 1HXEH 3SQEE 3TGIE 1NBMD 1ZJKA 2ZG0H 2YMSD 5DP8A 1LO6A 1TNKA 2F9NA 1GJ6A 3TK5A 1YLDA 2A7JA 5IYTA 1VCWA 2G00A 2FOHA 3ZVBA 4IMZA 1O5FH 5JDUB 3DSGA 1TFXA 2BXTH 1TX6A 1ZGIA 3RXFA 1QQUA 4TYDA 4I31A 4YZUA 4J2YB 4ABDA 2NU4E 2VH0A 2HWLB 1YPMH 2FX6A 3MNCA 1VITH 1G37A 1GI1A 5DP3A 1KIGH 4YM9A 1AZ8A 3SBKA 2ANWA 3UIRA 1C1RA 4RKJB 1ZSKA 1WTHD 3TJOA 1GHAG 2ZQ1A 4H6SB 5J4QA 1SGEE 1NY22 1HIAA 1CA0B 4Z0KA 3A8CA 1WQSA 4MPVA 4BAHB 2BHGA 2PSXA 5ESBA 1UVUH 5DP6A 5C1YA 1SMFE 1CE5A 1C2HA 2G52A 1FY8E 4B6EA 3KQDA 4TWYA 3Q76A 1GDQA 4MNXA 4AORA 1C5UA 2F4LA 2WPJS 1P57B 2QC2A 1W0KD 1GMCF 2TGAA 3TH2H 1MH0A 3OX7U 1NPMA 4OS6A 1AD8H 3W1EA 3CP7A 1FY5A 3ZV8A 2YNAA 4HG6A 1B5GH 1MKXH 1N6XA 1ZLRA 3ZZ6A 5FXLA 2GMTC 3PWCA 1TPOA 2A4RA 1O5AB 4F55A 1FV9A 3LGIA 4I33A 1FONA 2BD7A 3RU4T 1HDTH 2QXHA 3RXUA 2M5TA 3LDXH 3FOAA 3STJA 3STIA 4MG3A 1H1BA 1HAZB 3O8BA 1J9CH 1SGFG 4K60A 2ANYA 5DSFA 5T6DA 4AB8A 1D6WA 2O8LA 5FBIA 1UW7A 3SQHE 3GYMA 5FPSA 1W13U 2C8ZB 2ZQ2A 3M5MA 3MH4A 4AOQA 4FUCA 1QZ8A 3QTOH 3VGCC 5HXFA 3FN8A 3NUMA 3H09A 3WY8A 1C5WB 2QCYA 1MKWH 1P12E 1Q31A 1W10U 3GY5A 1SOTA 4X1NU 5CHAB 3RMOH 5L6NH 4DJZB 2J97A 3GCOA 1O0DH 5IDKA 1F5RA 1K22H 1THPB 1QIXB 1YF4A 4JZ1A 1S83A 1UTLM 3NCLA 2H2ZA 2STBE 3O8CA 2XBYA 2RA0A 3I77A 2QA9E 3HK3B 2OQUA 3P8OA 1NN6A 3SV8A 2BDCA 2FLBH 1O39A 2FOFA 3LIWA 1NS3A 1YPEH 1GJBB 4X6MA 2G4TA 1GJ4H 2OP9A 2PHBA 1QHRB 4WH6A 1G30B 1IQIA 1T4UH 3P92A 2A2QH 2J2UA 1F0SA 2K1QA 2CJIA 1UTKA 3K6YA 4KELA 3A82A 1A0HB 1C1TA 2F9VA 1OS8A 3NZIA 1HAOH 1GI0A 1ANDA 1K1IA 1DOJA 3FKSD 4FUJA 1CSOE 2YOLA 4IN2A 1S6LA 3MI4A 3NK8A 1UHBB 3KF2A 3TPIZ 3E1XB 2BDGA 2ZKSA 1V2NT 4D76A 1LQEA 1O36A 2FWWA 1P2IA 1GBMA 5A2MH 2EI6A 1ELVA 1P2QA 1P9SA 4ZHLU 4FXGH 2H5DA 1O5CB 1CHOF 2JJ2D 4FU8A 2OBOA 1SLXB 1TOMH 1SOZA 4F4OC 1XVOA 1IQJA 1OYQA 2ZU2A 1CGIE 3DFLA 1FN6A 2Y81A 3F9HA 4E7NA 1S0QA 3K6ZA 4M7GA 5EODA 3UWIA 1XX9A 5KEDA 4NSYA 4OGYA 1EAUA 1QB1A 4CRCA 3SU5A 1DY9A 4FU7A 1RGQA 4B2CA 1BMFD 5A8XA 3LGYA 1PPCE 1MCTA 1BTZA 3DSOA 2D8WA 1K1PA 1BRAA 1UTJA 1GJAB 4K1SA 2VIPA 5LH8A 3VXEH 5JPMH 2RDEA 3E0NB 5BPEA 4AFQA 1N6YA 2VINA 3MHWU 1BHXF 1PYTD 4FVBA 1NRPH 2WPKS 4Q63A 2Y6TA 1BITA 3IG6B 4Q80A 1NT1A 1OWIA 3OSYA 1GJ7B 4IS5A 1E36B 4Y71A 4GCHG 5E0GA 3DA9B 5I25A 2GZ9A 5KECA 2GDEH 1GI2A 1G3CA 4OS7A 2AYWA 1M9UA 1ZPBA 3PO1B 1E35B 3QGNB 4HFPB 2H5CA 7GCHG 1UK4A 1A3BH 4Y6DA 3SJKA 4A92A 4OS1A 2BQWB 5A0AE 2J4IA 3QK1A 4MNVA 1D3DB 2IJOB 3V12A 2GP9B 4AGKA 2IPQX 1F2SE 3NXPA 4CH8B 4Z6AH 5K7RA 1WXRA 1ZSLA 1DSTA 3RXQA 1GBAA 2KAIA 1GJCB 4AFSA 2FI3E 1S82A 3CS0A 1GMHF 2Z9KA 1O2XA 1TGCA 3T28A 3UOUA 2XCNA 2EY4C 3U8TH 2AIPA 1BMMH 1CVWH 1W3CA 1NC6A 1AN1E 3A84A 2ZFQH 5B6OA 1HAYB 2F9UA 4BTUB 3U8OH 2AHME 2BVSH 1JMOH 3LOXA 2QN5T 1DICA 1O33A 1ZOMA 5A0CA 1BRUP 2CGAA 5F8XA 1EZSC 2FI5E 3PV4A 1C1PA 1DWEH 3VB4A 1S81A 1F5LA 1KLJH 2TGPZ 5EPYA 2TGDA 3GDVA 1C5NH 1BJUA 4ZHAA 2RG3A 3ESTA 1AUTC 1ARBA 1GG6B 1JXPA 3D65E 5HGGA 1DLEA 1UVPA 1THSH 2VWOA 4AYYB 1OOKB 1GJ9B 1O32A 1ZTJA 1EP6A 4XBBA 1VKYA 1H8DH 2W3KA 1HJ8A 4ZAEA 1K1JA 2BY5X 5G4BA 2ZTYA 2QF3A 4LOYH 4P02A 1UK3A 1P2NA 4MVNA 1EB1H 2Z9LA 2CK3D 5EU8A 9ESTA 1ELFA 1OWHA 2SGAA 2R3UA 3I29A 3Q77A 4U01A 2J94A 4Y8ZA 3T27A 3TNTA 5C20A 3PMHB 2A32A 4X2YA 1HAVA 2OC8A 2F91A 1P2MA 3VXFH 4AB9A 2L6OA 2CN0H 2QY0B 1CHGA 1QL7A 5C67A 3BIUH 5JBTA 1BTUA 2W26A 3KGPA 1KXDA 1PPHE 2H6MA 3LKWA 3R0FA 1AKSB 1F5KU 3SZEA 2SNVA 2BX3A 3UNSA 1DSUA 2I6QA 1F7ZA 3EA8A 1OX1A 2FMJA 1V2QT 2I6SA 2HLCA 3E16B 1ZHPA 1P10A 4B75A 4OGXA 2FM2A 2Y5GA 1FY1A 2PKAB 2P16A 3ODDA 4SGAE 4DW2U 4RT0A 2BDAA 2Z6BD 5FHTA 1AE8H 5E0JA 4F49A 1DY8A 5JBAS 2AMDA 1GI7B 1YLNA 3GICB 1BMLA 8GCHF 2THFB 1EAIA 2LP6A 1KSNA 3UTUH 4JYUH 1TNIA 4GLYA 1C1OA 2VVVA 1O3EA 1T31A 2OC1A 3VB3A 3MO3A 2QXIA 4B1TA 3GY6A 3H7OA 4ISIH 2FTMA 5C5OA 1W11U 1MTNC 5EJ1A 2YMSC 3QWCH 3GCTG 2ZDAH 1J16A 3URCA 2ZDLA 1JOUB 1GCTB 4WXVA 4YT7H 3AW0A 3RM0H 1QL9A 1TMUH 1SGQE 4ASHA 3ZZ5A 1TX8A 3MO9A 2G81E 2BXUH 5L30H 2AFQB 1IQNA 2OTVA 5FL7D 4NZQA 3BTQE 3ZZCA 1RS0A 1DS2E 1OKXA 2ZU1A 3GCNA 2XC0A 1G3EA 2K8IA 1O31A 1H9LB 2ZFRH 3ZZ4A 1GCTC 4D7GA 2M2AA 5A09A 2VB0A 5HIZA 1LTOA 3MOCA 1CBWB 3FVFB 4GAWA 2FYRA 1B0FA 3GY4A 3HGNA 2KR7A 3AAUA 3SNEA 2ZPQA 3P8FA 1YM0A 2UUKB 1O34A 1P05A 3VG8A 3O8RA 3ZVDA 3RXKA 1FMGA 1FAXA 1EAWA 1LKBA 2SGFE 1TA2A 4TPIZ 5EG4A 2R2MB 3LT3A 2VGCB 2P59A 1UTOA 3TGJE 1QCPA 1E0FD 1GL0E 1HJ9A 3PM3A 1Z71A 5GCHF 1TBQH 4DCDA 3LH3A 1TGNA 4Q7ZA 1CBWC 2FOEA 1FN8A 1O2KA 3E6PH 1Z8JB 5DP9A 1KXEA 1GGDC 4Q4LA 1GI6A 1KXFA 1ZJDA 4U32A 6ESTA 1FUJA 1TPSA 1ZTKA 2NU2E 3B8JA 4Y79A 1DM4B 4I8GA 1AHTH 5EGMA 1LPGB 1GBTA 4MQAA 2ZHDA 5C2ZA 1EQ9A 5EJZA 1ZRKA 1S6HA 2R0LA 1A5GH 1V2WT 4Y0YE 4JZEH 2P95A 3MYWA 2CHAB 1EZQA 2NU3E 1P3CA 5T1VA 1B7XB 1CU1A 1KLTA 1TPAE 2FYQA 1SKYE 1PPBH 1FY4A 2FI4E 4PROA 1IOEA 1UHBA 1JWTA 2GCTB 1BBRH 1P06A 5HKKD 4O3TA 3KN2A 3M3SA 1BUIA 1PQ5A 1Y5UT 2KAIB 3AASA 2F9OA 2H9TH 3UQOA 2FPZA 1C4Y2 2V6NA 1V2VT 4H42U 1UCYH 1GHZA 2RDLA 1RIWB 1HFDA 2FIRH 2Z9IA 1WAYB 3MU5A 3TK9A 3BV9B 5HMAA 3W95A 1O37A 1Y8TA 4UEHH 4MDSA 2ZPSA 2QE7D 6CHAB 8KME2 3N99A 3GY7A 3UAIC 3KEEA 2FODA 1T8LA 4ABBA 1P03A 1J8AA 1V2TT 2GCTC 2VU8E 3GISB 1C4U2 1MAXA 4NWKA 3PYHA 3OY6U 4XFQA 1XM1A 1NM6A 3CENA 1VITF 1P9UA 2TIOA 4FUEA 1P0SH 4X6PA 3ZYEA 1ZMJA 1SGTA 4UFFH 4K2YA 3D23A 2ZWLH 4X0WU 2SGDE 1EFRD 1T4VH 1KXAA 2WUBA 3PTNA 1QGFA 1SI5H 3EA9A 3SO3A 3S7HB 4IC5A 1ETRH 1YC0A 1AIXH 2WV9A 3DFJA 1TNHA 4ABEA 2BM2A 4I8HA 3SYJA 2A7CA 3PRBA 3MU0A 1O3BA 4JZDH 3S7KB 3SNDA 1UJ1A 4BAKB 2GJGA 2BLWA 1SHYA 4BNRA 1BOQA 1Y3XA 3N7OA 1DANH 3A88A 3T29A 1HAXB 1ZGVA 1XVMA 1C2MA 1HAVB 1TBRH 1C5TA 2FS9A 2YNBA 5K0HA 4NIVA 4Y8YA 3TVJB 1JIMA 1YPJH 4AFZA 5PTPA 1GBEA 5EQSA 3EDXB 1LVOA 1QJ7B 1YYY1 4WY3A 2GT7A 2VNTA 3BIVH 4NCYA 3RMMH 4CRAA 1O2QA 1ELEE 2D26C 3UR6A 1W7GH 2PV9B 3TGKE 1DPOA 3V0XA 4J1YA 3LJJA 1O2GH 2JKHA 1GHBF 1QA7A 1WTGH 1SQTA 2STAE 1A0JA 5H4IB 1TIOA 1XUJA 1OHHD 3AAVA 3F9GA 3L33A 2V3HH 5DJ7A 2Z3DA 4A7IB 2FTLE 1V2UT 2HPQH 1TGBA 2FS8A 1H8ED 2ODYB 2GZ8A 1RJXB 2GMTB 1O3KA 3U98H 4UDWH 1OWEA 1D3QB 3OU0A 2GZ7A 1A7SA 4WXIA 2JETB 2ZPRA 1GHWH 1BQYA 2XBXA 1PFXC 3VFEA 3RXGA 3S9CA 2VIVA 1A5HA 2TGTA 3KYGA 2GDDA 2BQ7B 1O3FA 1JIRA 1O2OA 3D49H 3L3TA 3RXVA 3FP8E 3NWUA 4KGAA 1S85A 4NFEA 1PYTC 3WWFA 2W5EA 2H9HA 1O5EH 3BTTE 1O5GH 2P94A 2ZF0H 5GXPA 4ZMAH 3AK5A 1MQ5A 1ESAA 2ZGCA 2ZU4A 3VGCB 3M5NA 1RXPA 2BYAX 4YOIA 3SNCA 4CREA 2JETC 3E0PB 3MFJA 3PV2A 4WH8A 1UTNA 1ZHRA 4LZ1H 3QZQA 2UUFB 5E2PA 1FPHH 1UVTH 2WYGA 3KQEA 1YY3A 4NFFA 1NFUA 3BF6H 1L1NA 3P17H 4I8KA 5EXMA 5A8YA 1TA6A 3OEHD 3SI3H 1AFEH 3LGVA 4KP0A 2G5NA 4D8NA 1LVBA 3TH4H 3UNRA 2A5AA 4Y8XA 1AKSA 4E06H 4XRNA 5JBBS 1Q2WA 3SNAA 1P8VC 1FY3A 4X1PU 1C5MD 1MCVA 2GCHG 2ZU5A 3KYFA 2PFEA 2BQ6B 3GY2A 2PKAA 2GGVB 3R3GB 2FLRH 5HM2A 5JYIA 1CGHA 3IWMA 4ASUD 1F0RA 2ZO3H 2PP6A 4DVAU 3ZZBA 2BD2A 1MTUA 1O3NA 3A7YA 4Q7YA 1TYNA 3W94A 1W7XH 2GVFA 3S9AA 4BOHA 1J15A 2XWBI 3VEQB 4FUBA 5HM9A 4ABFA 3SJ8A 2O8MA 1DX5M 2XNIA 2A5IA 8LPRA 4X1RU 3IITA 2ZGBH 3L6PA 2PTNA 2G4UA 1FI8A 4HZHA 3KCGH 2ZTXA 1NRSH 4E7RG 3SZNA 1HAIH 4B76A 1BT7A 3VB7A 1GHAF 1EZUC 3RXJA 4K1EA 1WOFA 2ZDMA 1H8HD 1MZDA 2BOHB 1O2RA 1TNJA 2ESTE 1GBFA 1Z8IB 2ZCKP 2ZEBA 4IMQA 3TLOA 4OS5A 4ZXXH 3B23B 1GMDG 1PJPA 3DUXH 5EW2H 1JRSA 2A0QB 3A8DA 4NIYA 1C1WH 1ZZZA 4ACAA 2ZFFH 3SU4A 4TWWA 1ETTH 1KYNA 3TIUA 1Z7KA 1TE0A 2OUAA 3QZRA 3UUZA 1Y3UA 1T32A 2CF8H 3EA7A 2BX4A 4OM9A 2NU1E 3QLPH 3RXCA 1GCDA 3MH6A 5F03A 2WINI 1BB0B 1Y59T 5LPRA 2BLVA 1O3AA 4JK5A 3RXEA 1BTXA 3CNRA 3HGPA 4UFEH 2JH6D 5SGAE 1O2HA 1MD7A 1GBDA 4LK4A 2HALA 5TJXA 4FUFA 3UR9A 2QXGA 1AI8H 2VIQA 3RLWH 2IPHA 1RTKA 5CHBA 4DT7B 5E8EH 3HATH 1T7CA 2F83A 1XUKA 1AVWA 5ABWA 1K0HA 1ARCA 3RXSA 1TOCB 1V2KT 5GIBA 2Z3EA 4CR9A 1QBVH 1LHGH 1MABB 1FQ3A 1HPGA 5EJLA 3UFAA 3MNBA 3SUDA 1ZRBA 1TNGA 3P95A 1A3EH 3A8BA 2B0FA 1S5SA 4CRFA 3DHKH 2A5KA 2BY6X 4ZCNA 1IQHA 3FANA 1AB9B 1SGRE 2OXSA 4ABJA 3MNXA 1GVKB 4BTIB 1YCPK 4YT6H 2QAAA 1P2OA 2PW8H 1DUAA 2F9BH 1YBWA 3NRLA 2OD3B 3V7TA 3ATWA 3RMNH 6GCHG 3MU1A 1IAUA 1YPHE 2ODPA 1DXWA 4NSVA 1ELAA 1SG8B 1C2GA 4THNH 2OCVB 1XUGA 1NU7B 2Z7FE 2VIDA 2C8XB 2CV3A 3B9FH 1DE7H 1C2FA 1MBMA 1YPLH 2HPPH 4JYVH 1GBHA 1V2RT 1HUTH 4I86A 5FX5A 1AB9C 1L4ZA 2CXVA 2KCYA 1MAYA 3GY8A 1K1NA 2FOMB 1QQ4A 4WVPE 1HYLA 1O3GA 3BN9A 2ZDVH 1W0YH 1PPFE 2FOCA 4SGBE 3M7QA 2H1UA 5CDFE 2KCPA 2W7UA 3SV7A 1D9IA 4A6LA 4JCNA 2BVXH 3P70B 1O5DH 2WUCA 3UB0A 4INLA 5EPNA 2D1JA 1D3PB 2BD4A 1C1MA 2Y7XA 4MLFB 3SU2A 3AW1A 4ZKSU 1HGTH 1K28D 1OPHB 1QFKH 1O3HA 2IN2A 1TABE 2UUJB 2ZFPH 4UD9H 3PROA 3A8AA 3T25A 3U9AH 3A81A 3OFND 2C4FH 3ATIA 2BDYA 1UK2A 1T8OA 2VVCA 4NA9H 4X1QU 1PQAA 1SLVB 1O3JA 2R2WU 3RU4D 2VWNA 1O3LA 2JJ1D 3MH7A 1EJMA 1UTQA 3SNBA 3RC5A 5FBEA 1OP8A 4I8JA 1C1SA 1RFNA 3GDUA 1LVYA 1EZXC 3KHVA 1GJ5H 3DCLA 3P8GA 4D7FA 1FXYA 1DWCH 1FIWA 1A1RA 3GS9A 3EGKH 2L74A 1W12U 3Q3KA 1YKTA 4MPUA 4X2WA 1WQVH 4UONA 1IHTH 1KLIH 1BRCE 2PGQB 2BY8X 4NGAH 3RM2H 3RXRA 3HPTB 1MZAA 4JYTA 4DT4A 4X2XA 1ANCA 1Y5BT 1GBLA 1EX3A 1SQAA 1A61H 5ESTE 1BMNH 1C5RA 3K9XB 1S0RA 1C5SA 2PSYA 1K1MA 1L2EA 4FUGA 2Q1JA 1TMBH 1EXFA 1VGCB 3BEIB 4FU9A 4LXBH 1IQFA 5A8ZA 1HLTH 1MTNB 1EPTB 2ZIQH 1Z1IA 4WMFA 3T62A 1XXFA 1EP5A 1FLEE 2YMSB 1MKXK 5GJ4B 2DUCA 1HJAB 1Z8GA 3LONA 1GVLA 4AFUA 1TAWA 1ETSH 3RXOA 4GCHF 1GJ8B 1NU9A 1A0LA 3A80A 1P2JA 4X2VA 3ZZ7A 4INHA 1ZPCA 2PKSB 1QB6A 3LC3A 7GCHF 4CRGA 4ABIA 1UO6A 1FDPA 1IQEA 1W8BH 2CMYA 2UWLA 1GL1A 1NFWA 1VGCC 1FNIA 1EASA 2Y80A 3ZIAD 1OWKA 1EPTC 1SGFA 3HKJB 4RN6A 1NRQH 3QTVH 2VH6A 5BRRE 2H9EH 5C5NA 1WYKA 1HJAC 3ZZ8A 4X6OA 4AC9A 7KMEH 2AMQA 1QA0A 2P8OB 4I8LA 2PUQH 1OWJA 1LHDH 3F9EA 3MU8A 1AUJA 2XNDD 4GHQA 1MKWK 3C1KA 2PKSC 2QF0A 4RKOB 1C2IA 3RUOA 2ZCHP 1O2WA 3G01A 2KCAA 1IQGA 3TU7H 3BTDE 1UTMA 1CO7E 2AGIX 1ELTA 1EAXA 3D62A 3EE7A 5FCRA 5DO4H 1A5IA 2KM0A 2PUXB 4WF8A 2ZC9H 2V7QD 1Z1JA 1C1QA 3C27B 1NTPA 5FPTA 2P8OC 4K69A 3FZZA 1U6QA 2VVUA 1AO5A 2F9PA 1C4V2 1GBBA 1C9PA 5EXNA 2EQNA 1O35A 1H4WA 1BJVA 1SLWB 3K2UA 1GGDB 4DG4A 1Y3YA 1SB1H 4JZFH 1ZTLA 3MO6A 2P3TB 2W7SA 1K2I1 4XOJA 1O2PA 1E79D 3SV2H 9LPRA 1G9IE 7ESTE 1B0EA 5LGOA 1AVGH 4OS4A 4ACBA 1WSSH 1F92A 2XBWA 2TPIZ 1H9HE 3SUGA 5E2OA 1LCYA 1KDQB 4NG9H 4KTCA 1BZXE 1QBOA 1D6RA 2BD9A 2O8WA 4H6TA 1SFIA 5DK1A 3OEED 2QV1A 2Q6FA 3UREA 1O3CA 1V2OT 1NO9H 1BCUH 1CT4E 1K9OE 1QRXA 1EATA 1C2JA 2ZHQH 2ZU3A 3F2HA 2ZFSA 4NIXA 1X7AC 3UOPA 4X1SU 2O8UA 1LQDB 4U30A 1MU6B 2NWNA 2HNTC 1V3XA 5DG6A 4ZH8A 5GPIB 4JZIA 4YTAA 1QRWA 2UUYA 1NRNH 1ORFA 3QX5H 4AZ2B 1ANEA 1XUFA 4RT1A 5F53A 4BXSA 2AEIH 1TRYA 5EOKA 5IK2D 2BD8A 5DGJA 4AG2A 1ANBA 1GPZA 2ZHWH 1HNEE 5GWZA 2OINA 1K1LA 2WPHS 2WPIS 1ZMLA 1D3TB 2PGBB 1JRTA 4Q2KA 1GMCG 3F0PA 3O8DA 2SGQE 2Y5FA 5EQRA 2P3FH 1TBZH 3A89A 3UQVA 3OYPA 1C2KA 2EA3A 1Y5AT 3RXPA 1C1NA 1GJDB 1ZPZA 2BOKA 1HXFH 1GI9B 1TWXB 3GCTF 3RXLA 2AMPA 1AFQC 3BEUA 4Z1MD 5JBCS 3BG4B 4QT8C 3SHCH 3F3BA 4H4FA 3SJIA 1L0ZA 4IN1A 3F2GA 2W6ID 1OYTH 1WBGB 1EJNA 3SU3A 1SPJA 1HRTH 2SFAA 2FO9A 2V3MA 3T5FH 4DIHH 1O3IA 4B2AA 1SHHB 4TT3D 1K21H 4YLUA 5AF9H 1THRH 4K1TA 6LPRA 2XWAA 5JB9S 2SNWA 5CMXH 3A85A 3GCHC 3QGJA 3BTME 3MWIU 4FUIA 4JMYA 5C0TA 3BG4C 1BTWA 5DKMA 1L4DA 1LMWB 2J34A 2XC4A 4YOJA 2VWLA 2G55A 1HB0B 2BD5A 1H9IE 3VPKA 1JBUH 4R0IA 3ZVAA 3GYLB 3CS7A 3E91A 4XBDA 4HGCA 1CA8B 3RXDA 2ZTZA 1N8OC 3ZZ3A 2C93B 3SV9A 1YP9A 1MMJN 1GBKA 2OC7A 1RTFB 1YGCH 1Z6JH 2WHXA 3BTWE 1E38B 5T6FA 2BZ6H 2BY7X 4O9VA 3RC6A 3SGQE 1SC8U 4BANB 4CBOA 4GHTA 3LGTA 2XC5A 3MNSA 4AG1A 1SGNE 1PPZA 3PLBA 2J98A 1C9TA 1LHFH 2VIOA 1GI4A 5GDSH 3FP6E 4AGJA 5LPFA 3ZZDA 3SJOA 2FEQH 3MMGA 1WV7H 1T8MA 1YLCA 1TGSZ 3A86A 1C5OH 1O2NA 1MTWA 1QB9A 4FUDA 1ZYOA 2QIQA 5E0HA 1O3DA 2HNTF 4WMDA 5B6LA 3MTYA 3KQ5A 1YCPM 3RXMA 1TONA 2XBVA 2GV6A 5DN6D 2KX4A 1RRKA 1SBWA 1V2PT 3RMLH 4U2WA 1CT2E 2Z3CA 3WWBA 3M5OA 4ZUHA 1SGPE 3S0NA 1G3BA 1IQMA 1CHOG 1P04A 2AGGX 1EUFA 1J17T 2Y5HA 4UFGH 1E37B 3OY5U 3A7ZA 4Y10E 1WDIA 1NZQH 3BTEE 3ZZ9A 2ZA5A 1CA0C 4OS2A 4CBNA 3F68H 1BHXB 1GI8B 1QJ6B 2ILNA 5C3NA 3M3VA
chains in the Genus database with same CATH topology
3TH3H 4CRDA 1F0TA 5EW1H 5T6GA 1C5LH 1BBRE 2O8TA 3V3MA 4IC6A 5L2YH 2C90B 2GKVE 1P02A 1UCYE 5TCAA 1NESE 3PMBB 2GX4A 2XXLA 1SGIB 5AFZH 1VCQA 3S9BA 3QO6A 4A1XA 1O2ZA 1NFXA 1O2UA 2ZI2H 2DE8A 4GPGA 4BAMB 3FP7E 2R9PA 1KY9A 2QXJA 4KKDA 1BTPA 2SGPE 1EPTA 4FVDA 1SGDE 4NA7A 4GUXA 1C2EA 3RXBA 2Y82A 1IQKA 1W14U 2ZHFH 2PLXA 4BTTB 1AZZA 4ISOA 3SU0A 4Y0ZE 4B74A 4AYVB 2ULLA 3Q3YA 1IHSH 4HI3A 2ALVA 1G3DA 4AX9H 1A2CH 3M3TA 1C5XB 3ODFA 1GMHG 2FXRA 1ID5H 4B73A 3ZVCA 1SGCA 1T8NA 3A7XA 4FUHA 2A1DB 1DVAH 1AVXA 1FAKH 1HAGE 3SW2B 4R8TB 2BD3A 1BA8B 3KIDU 1ABIH 5CHAC 4X6NA 2GV7A 2ZGXH 1FIZA 1UVSH 3BTGE 4INKA 5EQQA 4TY7A 5DP4A 4ABGA 4K3JA 1HCGA 3F1SB 1UTPA 3PMJA 3I78A 1PQ8A 2ANMH 1RTLA 3A7WA 5TCCA 1A46H 3SUEA 3EAJA 1MU8B 2EEKA 4YOGA 3RXIA 4MTBA 4ESTE 1GHYH 2V3OH 2BMGB 2ZZUH 3U1IB 3DD2H 2J95A 1GDUA 1VCPA 1AY6H 2TRMA 4CR5A 1Y3WA 2V0BA 2Z9GA 1WU1A 1O2SA 3ATLA 4K5ZA 2FX4A 1MQ6A 2WPMS 4DY7B 1WCZA 2HGTH 3T26A 3ITIA 2ZP0H 1G36A 1P11E 3M7UA 4HTCH 1AGJA 1C1VH 1C5YB 2J38A 1SFQB 2BDHA 1AWFH 2A31A 2BB4A 4KTSA 4X8SH 1GHVH 2ZDNA 1KDQA 1LKAA 2A4GA 1BBRK 2DE9A 3ATKA 1VR1H 4YESB 3LU9B 4MPWA 4NIWA 3U1JB 5JB8S 1UCYK 1A4WH 3ATMA 4X8UH 2ZECA 1MTVA 4Q7XA 2G51A 3Q3XA 3KNXA 5ETXA 2ZNKH 3SORA 2HOBA 5DP7A 1KTSB 3FAOA 4BAOB 3M37A 1O5BB 2ZHEH 2GCHF 2AS9A 2BZAA 1PPGE 1AU8A 2Z94A 3NPSA 4K8BA 4Y11E 4AN7A 4UE7H 3ZVFA 1ELBA 4DURA 1DT2A 1V2MT 1XUIA 4TPYA 1VJ9U 3S69A 3BTHE 1C1UH 3FZDA 3KQCA 4GVUA 4UFDH 8GCHG 1LHCH 2G5VA 4MPXA 3URDA 2HNTE 2BVRH 1O38A 3A83A 2UWOA 2IOTA 4CRBA 1GWAA 4TY6A 1NROH 4ABAA 2OLGA 1GBJA 2A4QA 2WV4A 3TJNA 3GY3A 5T3HA 2Q6GA 1OP2A 3M35A 4XBCA 2BDBA 1J14A 2V35A 2FOBA 1IQLA 1CGJE 3KQBA 2BDIA 5DP5A 1QY6A 3RXTA 1C5ZB 3PTBA 1EOJA 3TITA 4WMEA 1RD3B 2ASUB 1INCA 1P3EA 2XYAA 3A87A 3P6ZB 1GBCA 4KTUA 3EQ0H 4O03A 4DIIH 3NKKA 1HIAB 3K65B 1FZZA 1ELGA 2XW9A 2C8YB 2GTBA 3MH5A 3PO1C 1TGTA 2ZCLP 2FOAA 3RC4A 2PWXA 4A5TS 4DOQA 1ZMNA 1LDTT 2C8WB 1W2KH 1SQOA 1GMDF 4E05H 1OWDA 4XDEA 1O2TA 3EE0B 4O97A 1TMTH 5F6MA 1TX7A 1BDAA 2BTCE 1XKAC 3BTKE 4BAQB 1CQQA 5L2ZH 1ESTA 2OBQA 3DT0H 3SHAH 3PLPA 4A1TA 1V2JT 1DLKB 2XCFA 1W0ZU 3T2NA 4B71A 2XRCA 3ZVEA 1D4PB 5AVDA 1DUEA 3ELAH 2B8OH 5GCHG 4ZHMU 1L1JA 1AMHA 3P8NA 1ESBA 5C1UA 3TNSA 1MBQA 5CE1A 1V2LT 2ANKH 4ISHH 3ENSB 4IGDA 4CH2B 2OQ5A 1TQ0B 2FZZA 3SGBE 1GG6C 1LPZB 1AWHB 1SR5C 2JH0D 1OSSA 1Q3XA 3JZ2B 1WUNH 2HRVA 3BSQA 3GOVB 3LH1A 4MNWA 2WPLS 1PPEE 2BLQA 1BTYA 1O3OA 1QRZA 2P93A 1NRRH 1TQ7B 3JZ1B 2A2XH 4BXWA 1ZSJA 3SU6A 2CF9H 1HBTH 5FPYA 1QJ1B 4NZLA 2EI8A 3TJUA 1SSXA 2AIQA 2B9LA 5EXLA 1SL3A 1V2ST 2J92A 1P2KA 3EYDA 7LPRA 3RP2A 2D2DA 1C5QA 1OXGA 3UNQA 1O2YA 2OC0A 1HAHH 2QGRA 1C2LA 1PQ7A 1ABJH 1ZR0A 2GT8A 2RCEA 4NWLA 6GCHF 1TNLA 1VZQH 5HYOA 3VB6A 1TLDA 1S6FA 1C5VA 1DFPA 1O30A 2LNCA 2GD4B 3PMAB 4A1VA 4D9RA 1EKBB 2A7HA 2A4OA 1KXCA 1XMNB 1N1LA 1P01A 2AH4X 3H5CB 3E90B 1OP0A 3F6UH 1SVPA 3QN7A 1AE5A 3PB1E 5J4SA 1G2LA 1YPKH 3QUMP 2QYIA 4Y7BA 3ZYDA 3SU1A 3E3TA 3H7TA 2HVXA 1KTTB 2WYJA 1H8IH 1E34B 2A45B 1O2JA 2P3UB 1TPPA 1EB2A 2JH5D 2NU0E 3M5LA 2ZFTA 1Y3VA 1VITG 3VB5A 4XE4A 2XTTB 4DGJA 3RXHA 1QL8A 1HAPH 2SGEE 1DITH 1GI3A 2G8TA 3ZZAA 1XXDA 3LGWA 1YPGH 1K1OA 1VJAU 4WWYA 4RSPA 1V6DA 4YLQH 2BLOA 1L1GA 3PLKA 2VIWA 1LHEH 3RXAA 1G32B 4B2BA 4ISNA 5FAHA 4XSKU 1FJSA 4VGCB 2VJ1A 2LPRA 2TBSA 1Z8RA 2FDAA 8ESTE 3OTJE 4K8YA 3UWJH 1QNJA 3QDZB 3SUFA 2ZDKA 3M36A 4ZKNU 1P09A 2FOGA 3SN8A 5FCKA 5LPEA 1Z6EA 2J9NA 3U69H 2Q6DA 5C1XA 1QBNA 2ALPA 4I32A 3SGAE 2FESH 1MTSA 1O3PB 2BY9X 3Q00A 3SI4H 1TRMA 1GDNA 1DDJA 2F3CE 4X8TH 3E8LA 3SV6A 4VGCC 1XUHA 3TJVA 3LPRA 4O3UA 5F8ZA 1C5PA 2R0KA 1GHXH 4NA8A 4X8VH 3SJ9A 1GHBG 1EJAA 4MNYA 3A7VA 2PR3A 3F9FA 1O2VA 1O2MA 4D9QA 1TRNA 3RU4E 1ELCA 3U8RH 1CT0E 1DXPA 1YPHC 2VGCC 5F8TA 1AQ7A 4ZROA 3ZVGA 1AFQB 2O9QA 1S84A 2PTCE 1O3MA 5FX6A 1BTHH 3HKIB 3TK6A 1BMAA 4I7YH 1LVMA 2AERH 1GI5A 2C3SA 2RA3A 4CHAB 1SGYE 4Y7AA 1G2MA 4GSOA 4WJG2 4IW4E 2ZGJA 4ZKRU 2UWPA 1QTFA 1GBIA 3LGUA 3M7TA 1ELDE 1MD8A 4JK6A 4ZXYH 5A0BA 3SOSA 3V13A 3HK6B 1O2IA 3GCHB 1UMAH 5I46H 4ZKOU 5DPAA 3RLYH 2EI7A 2AGEX 1LPKB 1MUEB 3AVZA 3BEFB 4ABHA 3UPEA 2W3IA 1XKBC 1YCPH 2CHAC 4CHAC 3KL6A 3ZV9A 3MU4A 3FFGA 4ISLA 1TB6H 1HV7A 3GDSA 1DWDH 3M61U 2B7DH 4LZ4B 1C2DA 1TALA 1ACBE 1N8OB 3LJOA 2VWMA 2Z9JA 1DWBH 1O2LA 1QR3E 3BG8A 3RDZA 1UVOA 3LC5A 1BIOA 4YO9A 2R3YA 1RIWC 1EOLA 1SLUB 1GVZA 3PWBA 1QURH 1F0UA 2FP7B 2Y7ZA 5AFYH 5AHGH 1NFYA 2EC9H 4IBLH 2ZGHA 6CHAC 3A7TA 1BRBE 3BTFE 4Y76A 1FPCH 1KXBA 1ZHMA 2ODQA 3UY9A 2B5TB 2WV5A 1HXEH 3SQEE 3TGIE 1ZJKA 2ZG0H 5DP8A 1LO6A 1TNKA 2F9NA 1GJ6A 3TK5A 1YLDA 2A7JA 5IYTA 1VCWA 2G00A 2FOHA 3ZVBA 4IMZA 1O5FH 5JDUB 1TFXA 2BXTH 1TX6A 1ZGIA 3RXFA 1QQUA 4TYDA 4I31A 4YZUA 4J2YB 4ABDA 2NU4E 2VH0A 2HWLB 1YPMH 2FX6A 3MNCA 1VITH 1G37A 1GI1A 5DP3A 1KIGH 4YM9A 1AZ8A 3SBKA 2ANWA 3UIRA 1C1RA 4RKJB 1ZSKA 1WTHD 3TJOA 1GHAG 2ZQ1A 4H6SB 5J4QA 1SGEE 1NY22 1HIAA 1CA0B 4Z0KA 3A8CA 1WQSA 4MPVA 4BAHB 2BHGA 2PSXA 5ESBA 1UVUH 5DP6A 5C1YA 1SMFE 1CE5A 1C2HA 2G52A 1FY8E 3KQDA 4TWYA 3Q76A 1GDQA 4MNXA 4AORA 1C5UA 2WPJS 1P57B 2QC2A 1GMCF 2TGAA 3TH2H 1MH0A 3OX7U 1NPMA 4OS6A 1AD8H 3CP7A 1FY5A 3ZV8A 2YNAA 1B5GH 1MKXH 1N6XA 1ZLRA 3ZZ6A 5FXLA 2GMTC 3PWCA 1TPOA 2A4RA 1O5AB 1FV9A 3LGIA 4I33A 1FONA 2BD7A 3RU4T 1HDTH 2QXHA 3RXUA 2M5TA 3LDXH 3STJA 3STIA 4MG3A 1H1BA 1HAZB 3O8BA 1J9CH 1SGFG 4K60A 2ANYA 5T6DA 4AB8A 1D6WA 2O8LA 5FBIA 3SQHE 3GYMA 5FPSA 1W13U 2C8ZB 2ZQ2A 3M5MA 3MH4A 4AOQA 4FUCA 3QTOH 3VGCC 5HXFA 3NUMA 3WY8A 1C5WB 2QCYA 1MKWH 1P12E 1Q31A 1W10U 3GY5A 1SOTA 4X1NU 5CHAB 3RMOH 5L6NH 4DJZB 3GCOA 5IDKA 1O0DH 1F5RA 1K22H 1THPB 1QIXB 1YF4A 4JZ1A 1S83A 1UTLM 3NCLA 2H2ZA 2STBE 3O8CA 2XBYA 2RA0A 3I77A 2QA9E 3HK3B 2OQUA 3P8OA 1NN6A 3SV8A 2BDCA 2FLBH 1O39A 2FOFA 3LIWA 1NS3A 1YPEH 1GJBB 4X6MA 2G4TA 1GJ4H 2OP9A 2PHBA 1QHRB 4WH6A 1G30B 1IQIA 1T4UH 3P92A 2A2QH 2J2UA 1F0SA 2K1QA 2CJIA 1UTKA 3K6YA 4KELA 3A82A 1A0HB 1C1TA 2F9VA 1OS8A 3NZIA 1HAOH 1GI0A 1ANDA 1K1IA 1DOJA 4FUJA 1CSOE 2YOLA 4IN2A 3MI4A 3NK8A 1UHBB 3KF2A 3TPIZ 3E1XB 2BDGA 2ZKSA 1V2NT 4D76A 1LQEA 1O36A 2FWWA 1P2IA 1GBMA 5A2MH 2EI6A 1ELVA 1P2QA 1P9SA 4ZHLU 4FXGH 2H5DA 1O5CB 1CHOF 4FU8A 2OBOA 1SLXB 1TOMH 1SOZA 4F4OC 1XVOA 1IQJA 1OYQA 2ZU2A 1CGIE 3DFLA 1FN6A 2Y81A 3F9HA 4E7NA 1S0QA 3K6ZA 4M7GA 5EODA 3UWIA 1XX9A 4NSYA 4OGYA 1EAUA 1QB1A 4CRCA 3SU5A 1DY9A 4FU7A 1RGQA 4B2CA 5A8XA 3LGYA 1PPCE 1MCTA 1BTZA 2D8WA 1K1PA 1BRAA 1UTJA 1GJAB 4K1SA 2VIPA 5LH8A 3VXEH 5JPMH 3E0NB 5BPEA 4AFQA 1N6YA 2VINA 3MHWU 1BHXF 1PYTD 4FVBA 1NRPH 2WPKS 2Y6TA 1BITA 3IG6B 4Q80A 1NT1A 1OWIA 3OSYA 1GJ7B 4IS5A 1E36B 4Y71A 4GCHG 5E0GA 3DA9B 5I25A 2GZ9A 2GDEH 1GI2A 1G3CA 4OS7A 2AYWA 1M9UA 1ZPBA 3PO1B 1E35B 3QGNB 4HFPB 2H5CA 7GCHG 1UK4A 1A3BH 4Y6DA 3SJKA 4A92A 4OS1A 2BQWB 5A0AE 2J4IA 3QK1A 4MNVA 1D3DB 2IJOB 3V12A 2GP9B 4AGKA 1F2SE 3NXPA 4CH8B 4Z6AH 5K7RA 1ZSLA 1DSTA 3RXQA 1GBAA 2KAIA 1GJCB 4AFSA 2FI3E 1S82A 3CS0A 1GMHF 2Z9KA 1O2XA 1TGCA 3T28A 3UOUA 2XCNA 3U8TH 2AIPA 1BMMH 1CVWH 1W3CA 1NC6A 1AN1E 3A84A 2ZFQH 5B6OA 1HAYB 2F9UA 4BTUB 3U8OH 2BVSH 1JMOH 3LOXA 2QN5T 1DICA 1O33A 1ZOMA 5A0CA 1BRUP 2CGAA 5F8XA 1EZSC 2FI5E 3PV4A 1C1PA 1DWEH 3VB4A 1S81A 1F5LA 1KLJH 2TGPZ 5EPYA 2TGDA 3GDVA 1C5NH 1BJUA 4ZHAA 2RG3A 3ESTA 1AUTC 1ARBA 1GG6B 1JXPA 3D65E 5HGGA 1DLEA 1UVPA 1THSH 2VWOA 4AYYB 1OOKB 1GJ9B 1O32A 1ZTJA 1EP6A 4XBBA 1H8DH 2W3KA 1HJ8A 4ZAEA 1K1JA 2BY5X 5G4BA 2ZTYA 2QF3A 4LOYH 1UK3A 1P2NA 4MVNA 1EB1H 2Z9LA 5EU8A 9ESTA 1ELFA 1OWHA 2SGAA 2R3UA 3I29A 3Q77A 4U01A 2J94A 4Y8ZA 3T27A 3TNTA 5C20A 3PMHB 2A32A 4X2YA 1HAVA 2OC8A 2F91A 1P2MA 3VXFH 4AB9A 2CN0H 2QY0B 1CHGA 1QL7A 5C67A 3BIUH 5JBTA 1BTUA 2W26A 3KGPA 1KXDA 1PPHE 2H6MA 3LKWA 3R0FA 1AKSB 1F5KU 2SNVA 2BX3A 3UNSA 1DSUA 2I6QA 1F7ZA 3EA8A 1OX1A 2FMJA 1V2QT 2I6SA 2HLCA 3E16B 1ZHPA 1P10A 4B75A 4OGXA 2FM2A 2Y5GA 1FY1A 2PKAB 2P16A 3ODDA 4SGAE 4DW2U 2BDAA 2Z6BD 5FHTA 1AE8H 5E0JA 4F49A 1DY8A 5JBAS 2AMDA 1GI7B 3GICB 1BMLA 8GCHF 2THFB 1EAIA 1KSNA 3UTUH 4JYUH 1TNIA 4GLYA 1C1OA 2VVVA 1O3EA 1T31A 2OC1A 3VB3A 3MO3A 2QXIA 4B1TA 3GY6A