1UTOA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
molecule tags Hydrolase
total genus 59
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utoA02
3LKWA 1AN1E 4H6TA 3ENSB 1HYLA 8LPRA 2BQ7B 3UUZA 3M5MA 5FPTA 4FVBA 1KDQA 1GMCF 2OBOA 1HAVA 3RLYH 1BRCE 1EQ9A 3QZRA 3QGNB 3BEIB 3A7YA 1AY6H 5DK1A 1C5YB 3ZVAA 2BTCE 2BZ6H 2M5TA 1GJAB 1HAHH 3BTKE 1O35A 3RXAA 2WYGA 2ZECA 1LCYA 2D2DA 2GCTC 5LPRA 1Y5UT 4CREA 3RXSA 4I32A 3ZZDA 1TPPA 1XX9A 5C67A 4WXVA 1O3GA 2SFAA 3RXOA 3SV6A 4WY3A 4A1TA 2ZEBA 2ZU5A 1QL8A 2RCEA 5DO4H 1AUTC 3LU9B 3SU0A 1MQ6A 1RD3B 4Y7AA 2WPMS 2HRVA 5AFYH 2G8TA 4LOYH 4AGJA 2VIQA 4D9RA 1Y3UA 1MKXK 1YCPM 1P2MA 1N8OC 5HMAA 1BTHH 1Z1IA 2WV4A 3SNDA 3ESTA 1CA0C 1EOLA 1P9SA 2W3IA 2NU0E 1C5OH 5K0HA 5ETXA 2CHAC 3MNSA 2ODPA 1A5IA 2GT8A 1MTNB 1O2IA 1YBWA 4HFPB 4KELA 1O2XA 4CRFA 3I29A 2PSXA 4K1TA 4KTCA 1WOFA 3NPSA 1C2LA 1BCUH 3BTFE 4TY6A 1DX5M 1O5GH 3RMLH 2FIRH 2GP9B 2GKVE 1FN6A 1ABJH 3HGPA 1MAYA 3UY9A 2QY0B 4TYDA 4Y11E 3VB3A 3M7QA 2P8OC 1K1OA 3GY8A 5T6GA 4MTBA 1FZZA 1QBVH 3S7KB 2WV5A 2ZP0H 3EAJA 5ESBA 1Z6JH 3FZZA 1HXFH 1ELVA 3MH6A 1CHOF 3C27B 1KTSB 3S9BA 3V13A 4ABBA 2R3UA 3GCTG 3H5CB 2AS9A 3LGIA 2DUCA 1DY9A 2RA3A 5B6OA 2J9NA 2OXSA 3BSQA 1RTFB 2FOHA 1SLVB 1LMWB 1K22H 3FP8E 1FY5A 1P02A 5E2PA 3RXVA 1J17T 2A5IA 3BTME 1WTHD 1FY3A 1EPTC 3E0NB 2VJ1A 1C2IA 1EZXC 4B2AA 2Z9JA 2EC9H 4UFFH 3DFJA 5CE1A 4FU7A 4Y76A 1SFIA 3GY2A 3ZZ9A 1GDNA 1K9OE 1SMFE 2C3SA 4WVPE 4AB8A 1VGCC 4DJZB 2G5NA 4YLUA 1JXPA 2ZDLA 3VB7A 2P59A 3MI4A 3RUOA 2OCVB 1V2MT 1CA8B 1OWIA 2Y82A 4BAMB 1ZTKA 5EXLA 1EUFA 1TIOA 6GCHF 3NKKA 1ZR0A 2QV1A 3PWCA 4JYTA 3RXMA 2FTLE 1LHCH 2JETB 1FY1A 2PKAB 4ZKNU 3EDXB 2CF8H 3LH1A 2A32A 2ZFSA 4AX9H 1SOTA 1T8NA 1YPKH 4DCDA 1XUGA 2PHBA 2HNTF 1FPHH 3GISB 5DKMA 3SHAH 2BLOA 1GMHG 1P05A 3MU8A 1O5EH 1UHBA 1KSNA 2AIPA 3IWMA 4B75A 3SGBE 4I8HA 1O2JA 2GDEH 3RXRA 1F0SA 4BXWA 3RU4D 2FS8A 1CGJE 2V3OH 2SNWA 1QBNA 3O8DA 4NIVA 1KTTB 1ZSKA 4ZHLU 3SU4A 2Q6DA 1PPGE 1EAIA 3MNCA 2R9PA 1TGCA 1TBRH 1T7CA 2VWNA 4U32A 3S7HB 3GDSA 1KXBA 3BTGE 1D3DB 3LH3A 3U8OH 3V7TA 1G36A 1DWCH 1H9HE 2QC2A 1DVAH 1XUHA 3VXFH 3GDUA 2CN0H 2BX3A 3SNEA 1L4ZA 1UCYH 1S5SA 3ZZ7A 3GY7A 1A2CH 1MKWH 4DURA 1DE7H 5FBEA 5DP7A 1SQOA 5C20A 3SU5A 3DHKH 2PUQH 4OGYA 1O2PA 2A4QA 1V2OT 5C2ZA 1PQ7A 3W95A 1OXGA 1BQYA 4X8TH 2FX6A 5AF9H 1C1PA 1PJPA 2BD3A 4GHQA 2VGCB 1O3JA 2GD4B 4TWYA 2AMDA 2ODYB 3SGQE 1FJSA 1FY8E 4Y0YE 1MBMA 1GJ4H 1SGCA 3PTBA 1YPLH 4HI3A 1SB1H 1HPGA 2G4TA 1BHXF 1RGQA 4YOJA 1HAYB 2GZ8A 1GJDB 1O36A 1C4U2 2WPKS 5FBIA 3M36A 1Y5AT 1C2DA 1PYTD 4DY7B 1C5RA 1JIRA 2V6NA 1VCWA 1NESE 4FU8A 5F8TA 1K28D 1O33A 3QUMP 1OYQA 3GY6A 1GMDG 1QJ6B 2B8OH 1SGTA 4Z6AH 5TJXA 1RIWC 1C1QA 1XXDA 1ZGVA 1LDTT 1K1IA 4OS2A 1DSUA 3T28A 2CHAB 1B0EA 1GHVH 1ZYOA 3SZNA 2A31A 3L33A 1H9LB 4NFEA 4ABDA 2A45B 1NFXA 4IN1A 2H9EH 3QK1A 3PLPA 4BAHB 1FAKH 4AFSA 1WAYB 3MO3A 1V2RT 1TOCB 3HATH 5EW1H 3M5LA 1ZSLA 3CS0A 2Q1JA 2TGTA 3QWCH 3D49H 4NCYA 1HDTH 2FODA 1G9IE 3D62A 1A5HA 3PLKA 1P3EA 1L1JA 1ZMNA 1BTUA 1LVBA 3A84A 7ESTE 2EA3A 3SUGA 3SNAA 2BLQA 1GBLA 1Q3XA 3MMGA 4D76A 3LIWA 3BV9B 4ZH8A 2OLGA 3U98H 1ETTH 1IQMA 4D7GA 2WPLS 1TOMH 3ZVCA 3GOVB 4NA8A 2C93B 3OY6U 5A8XA 1MUEB 1T8LA 5F8ZA 1PPBH 1GJ5H 1CHGA 2HWLB 1KLJH 3U69H 1S83A 3M3VA 1LO6A 2VINA 3RXJA 3ZZAA 1C5WB 2XC4A 1P10A 4AYVB 1BTYA 1E34B 2GZ9A 6CHAB 2YOLA 2J94A 2XNIA 1MTNC 3SGAE 1TGNA 3ZV9A 1P2JA 1ORFA 1YPJH 3HKIB 1EOJA 2WPHS 2FI4E 3STIA 4AB9A 5ESTE 3RXQA 1KDQB 5DP8A 1TONA 1HAVB 2ZTYA 1SI5H 1GL0E 1W0ZU 1YPGH 4A1XA 2BVSH 1C5LH 2J38A 4ZXYH 1CBWC 3OTJE 1QNJA 1N1LA 2PTCE 3A81A 1KIGH 3BF6H 1TMTH 2BY9X 1IQNA 4I8KA 2ZGXH 1FN8A 2AERH 1K1NA 4M7GA 1GI3A 3K6ZA 2PWXA 1TRNA 4UD9H 3MYWA 2FOEA 3ZV8A 3LGYA 4ISNA 1O3EA 2P93A 5EQRA 2RG3A 4AG2A 3RU4T 3BEFB 3PLBA 3PV4A 4IC5A 4WH8A 4IS5A 2ZFFH 1OWHA 1IQEA 1TABE 1AMHA 5F8XA 1GJ8B 4YTAA 1H8DH 1TBQH 3FP7E 1BMMH 1BBRE 1D3TB 4NWLA 4ZKRU 5E0JA 1V2KT 3ATIA 1MH0A 2H5CA 2R3YA 3OX7U 4BTTB 4MPXA 2VVCA 1F0RA 1QY6A 3TH2H 1HAPH 3T62A 1WUNH 5JYIA 4YM9A 3F68H 3EA9A 4MPWA 1VJ9U 2ZQ2A 2BDGA 1G3EA 1Z1JA 1FUJA 1RTKA 1SC8U 3O8RA 3SJ8A 2FLBH 3SU3A 5CMXH 3PWBA 5I46H 2A4RA 1UVPA 1CVWH 4ESTE 1L1GA 1RXPA 3BTEE 4NIXA 4WMEA 1AB9B 3QDZB 7GCHG 1OYTH 1SL3A 1CGIE 2ZTXA 4H6SB 1UTKA 2R0KA 1XUKA 1H1BA 1Y3WA 5FXLA 1L2EA 4E06H 4X6PA 3FVFB 1TMBH 4K8YA 4IW4E 2JETC 3BEUA 4BOHA 1D3PB 3RC5A 1F0TA 1DS2E 3SQHE 2ZCLP 1OWDA 1Y5BT 1GMCG 7KMEH 1A4WH 1GBBA 3B9FH 4WMFA 4IN2A 1YYY1 4FVDA 3TNSA 4KKDA 1TNGA 1T31A 2IPHA 1G3DA 1GVLA 3VEQB 2C8WB 5GPIB 1Z8RA 1ZRBA 1RS0A 1ID5H 1P2QA 1EZQA 1H8IH 1C1TA 2BB4A 5EPNA 1L0ZA 1INCA 2P16A 4WF8A 1C5QA 1SGPE 1GBEA 1O5BB 1O5CB 3QGJA 1LKAA 1Z8JB 2FEQH 2VVUA 3S9CA 1S6HA 1G2LA 1OPHB 1O39A 3M37A 4NZQA 2XCNA 2QXIA 3ZVFA 2FZZA 5JB9S 4A7IB 2AGGX 3BIUH 3FFGA 1MCTA 1O37A 1PFXC 3LT3A 2G55A 2PTNA 3HK6B 2TGDA 1C1RA 1ZLRA 1O3IA 4ISHH 3TK9A 4INLA 2OQUA 3TJUA 1TQ0B 2J34A 1DWEH 1UO6A 5JBBS 2NU2E 3MNBA 2ZWLH 3T5FH 4IMQA 1HV7A 2ZF0H 5AFZH 2F9BH 4FUGA 5FX6A 4NIWA 2BQWB 3BN9A 3E1XB 3SORA 2JH6D 2NU3E 2FMJA 3U1JB 5A09A 1TNLA 1GI9B 4AFUA 5DP3A 4BTUB 4PROA 1TA6A 3O8BA 3O8CA 2AIQA 1UHBB 5LGOA 1JWTA 1BRBE 2VGCC 9ESTA 1LHFH 1CE5A 1FPCH 1S0QA 1O3OA 1QL9A 2PLXA 4NGAH 4Y6DA 2FOAA 4AG1A 3HGNA 5GIBA 4ZMAH 5FPYA 1HAGE 1NO9H 3AAVA 3OYPA 1A0JA 3A7XA 1NRNH 1D9IA 3QO6A 4MLFB 3ITIA 2FOFA 1WSSH 4ISOA 1P11E 2SGDE 2Z9LA 1C1SA 4Z0KA 3UOUA 2F9OA 1J9CH 1O2RA 5L30H 2OP9A 1S85A 1CHOG 4Y0ZE 5DJ7A 4E7RG 1VCPA 3QTVH 5PTPA 5EG4A 1O3LA 1TGSZ 2PFEA 1EZSC 1IQFA 3KEEA 2BD2A 1BMNH 4I8JA 4ZHAA 1UCYK 4DT7B 1GBCA 1TAWA 7LPRA 2ILNA 1MKWK 4GLYA 4GPGA 1WYKA 2VH6A 2V35A 1O2GH 2EI6A 3KCGH 1GBAA 3URCA 4TPYA 1ZGIA 2FESH 3DUXH 1KXAA 3SV8A 3V0XA 1CBWB 5FHTA 4A6LA 2B7DH 4X8VH 1FI8A 1GI8B 4ZUHA 1GPZA 3E3TA 5DP6A 4RSPA 1AHTH 5J4SA 3ZVBA 2OQ5A 1EXFA 1P04A 1QA7A 2R2WU 2ANYA 1TRYA 1DXPA 2BOKA 1O2HA 2H2ZA 3KIDU 1K1MA 4ZHMU 3M7UA 2D8WA 4YZUA 4DIIH 1QB9A 2XBXA 1MTUA 3T27A 1WTGH 2Y81A 2ZQ1A 3T26A 6GCHG 2VIDA 1BDAA 1BITA 1NC6A 1PPFE 1S81A 2B9LA 4ABJA 2BHGA 4KGAA 3I78A 1CT4E 4H4FA 1C2HA 1F92A 5DP5A 4XBDA 2QAAA 2FLRH 4JZIA 2ASUB 2P95A 3TIUA 3UWJH 2RDLA 4INKA 2GCHF 1GJ9B 4CRAA 1V2WT 3U8TH 2BDBA 2C8YB 3U9AH 4ABIA 5DPAA 1MU8B 1V3XA 1V2LT 4UFDH 4XOJA 2DE9A 3Q3XA 5SGAE 3SN8A 1A0LA 3A8CA 3ATLA 1ESAA 3TJNA 1GHWH 3K9XB 5HXFA 2W3KA 3GCHC 3Q77A 2CGAA 6CHAC 1V2TT 5BRRE 4JZFH 4JCNA 3SJKA 1G37A 1NY22 2BD4A 1THPB 2VIVA 1ZPBA 3SJIA 1O2QA 1A3EH 1AE5A 3SW2B 2J4IA 1XKBC 2XRCA 1SLXB 2BLWA 4B74A 1LPKB 1LHGH 1AI8H 1C2GA 3BG4B 5E2OA 1F5RA 1ELGA 3SI4H 3RXCA 1FQ3A 1MU6B 1C1WH 1AD8H 2HLCA 1O3FA 1ZZZA 1YF4A 4NIYA 1XMNB 1E37B 1C2FA 1ZPCA 4YLQH 1MD8A 5F03A 1JOUB 1TLDA 1H9IE 2FOCA 2BM2A 1HUTH 5EPYA 1N6XA 1LQDB 1XUFA 2FI3E 1NRPH 1UK4A 1UMAH 4GCHF 3OU0A 1TQ7B 4X2XA 2GX4A 1W0YH 2BDCA 3SJ9A 1IAUA 4TY7A 3KL6A 2STAE 1HNEE 2ZPQA 1UTMA 1RJXB 3S9AA 3ELAH 1YPEH 3B23B 1SGFA 3RMNH 4YOIA 4O97A 1C2JA 4K2YA 1KY9A 1XXFA 4UFEH 3JZ1B 3DFLA 4RKJB 2A7JA 4K69A 3PB1E 1NROH 3F1SB 4FUCA 2FXRA 4FUBA 3A86A 3VB4A 1UTNA 2A5AA 3ZZ6A 3ZZ4A 3TPIZ 1SQTA 4K3JA 4UEHH 5DP4A 2HPQH 4LZ4B 2Q6FA 1HBTH 1ABIH 1WQVH 4B2CA 1HCGA 1FMGA 5CHAB 2AMQA 5GDSH 5A8YA 1SHYA 2ZHDA 1GBMA 1EKBB 2HVXA 4CH2B 1C2KA 1NM6A 4FXGH 1SBWA 1AB9C 3IG6B 3RXGA 2F9PA 1BRAA 4R0IA 3RXHA 2XBVA 3MH5A 1NTPA 5I25A 5TCAA 1O2UA 1W3CA 1C2EA 2AEIH 2XBWA 3FANA 1GI2A 5JPMH 1O3MA 1J14A 2BY6X 5EQSA 1BMLA 3ODDA 1ZMJA 4Y10E 1QB1A 2BVXH 3A7TA 3PM3A 1HGTH 1UTQA 2OBQA 3VGCB 2J2UA 5EXNA 3SJOA 1DDJA 1W2KH 4Y8YA 3M61U 4THNH 4ABAA 1B0FA 1WU1A 2BDIA 2V0BA 1VITH 1HLTH 1HJ8A 3P95A 4WMDA 1NRRH 1VZQH 4FUFA 1B7XB 1L4DA 3UFAA 1XUJA 4JYVH 3SUEA 4D7FA 1ACBE 1KXEA 2VIOA 1EP5A 3TJOA 3F9HA 4JK5A 2VWLA 2OC1A 3EQ0H 2A1DB 3RXEA 2H5DA 1Y3VA 1YLCA 3AASA 2TRMA 2O8WA 1A7SA 4Q80A 1P06A 4ASHA 3LDXH 1EAWA 5GCHF 1DICA 8GCHF 5L6NH 3L6PA 1OX1A 3LGVA 3R0FA 2Q6GA 3NCLA 3LGTA 1F2SE 2HGTH 3GYMA 1C5MD 2G81E 1UTLM 5FCKA 2HPPH 4X0WU 3G01A 4NFFA 1TRMA 3NWUA 2ZFTA 4UONA 4OS1A 1EB2A 3SV9A 1Z7KA 1UVUH 3E16B 2UUYA 4NSYA 1S82A 2QGRA 1HRTH 1Y8TA 1F7ZA 1ELCA 1N6YA 4JZ1A 2HNTC 5T6DA 5FAHA 1BTWA 4Y79A 1BTXA 2BD8A 2ZIQH 4BAKB 4IBLH 1P2KA 1AE8H 4DIHH 3URDA 3T25A 1GVKB 3MU5A 4CBOA 1MAXA 1O5FH 1DANH 1A0HB 2ZGJA 1WCZA 2Z3DA 1GWAA 2Y5GA 2XBYA 2C8ZB 2A2XH 4NWKA 1S6FA 2QXGA 2YNAA 1K2I1 3E90B 3Q76A 4JYUH 2ZU4A 3UTUH 4D9QA 2FO9A 4GUXA 4O3UA 2FYQA 1HIAB 2ZNKH 1YLDA 2Z94A 1T8OA 1QHRB 3SHCH 2BLVA 4Y7BA 2Y5HA 2TIOA 1HAZB 1GL1A 4TWWA 1IQJA 1NFWA 2JKHA 1AWHB 1BBRH 2ZGCA 2J95A 1TFXA 2VWOA 4J2YB 4HGCA 1O3NA 1ANBA 1TALA 2BDAA 3BTHE 4DW2U 2ZGHA 1XVMA 4HZHA 3SO3A 1C5UA 3AVZA 1FDPA 1W12U 3GCHB 3QZQA 1C5PA 1DWBH 1D6WA 4DG4A 2G4UA 3TJVA 1GI7B 1GBHA 1J16A 1GI1A 4KP0A 2ZDMA 1EP6A 2QN5T 1EASA 3GY4A 1V2NT 2VIWA 4X1SU 3MH7A 1P09A 4ZAEA 1V2QT 2GGVB 1PPHE 1GJ7B 1NN6A 1P3CA 4B76A 2UUFB 2P3TB 3C1KA 2AH4X 2ZCKP 1Z71A 1O2YA 2QXJA 3ZVEA 3NK8A 4Q7YA 1AVWA 1ANCA 2BXUH 1GJ6A 3SUDA 1HJAB 8ESTE 3RXPA 2VVVA 1ZJDA 3M7TA 2BZAA 2A5KA 2SGEE 2GT7A 2SGQE 2ZDVH 1NRSH 3F9FA 4Q7XA 1UVOA 1BJUA 3RP2A 3TK5A 4B71A 4ABGA 3TU7H 2EI7A 4ABHA 1ZTJA 3D23A 2ZDKA 3P92A 1C5ZB 2XW9A 2D1JA 1UVSH 5FX5A 2TPIZ 1G3CA 1AGJA 1TB6H 2FOMB 1NS3A 1FV9A 1L1NA 1OWJA 1UJ1A 4BTIB 2QYIA 5AVDA 5HGGA 1GI5A 1BB0B 1A1RA 3BTQE 1PPCE 2ZDAH 1K1PA 3RMMH 5JBCS 2BD5A 3CP7A 5C3NA 3RM0H 4CRCA 2UWPA 2ZGBH 4K5ZA 1LHDH 1GBJA 1D3QB 1QL7A 2QF0A 2PR3A 1FLEE 2W7UA 2PGBB 3PROA 1PQ8A 3RC4A 2QF3A 3UR9A 1MQ5A 1GI4A 1C5VA 4FUDA 1AFQC 1TNJA 1HJ9A 1NU7B 3A8AA 3BG4C 5A0CA 3A87A 2VB0A 1BOQA 3BTWE 1ZTLA 1QQUA 1AVGH 4WH6A 4Y8ZA 4HTCH 5E0GA 1F0UA 5E0HA 1SLWB 1Z8GA 1ELFA 2C8XB 4BANB 1MZDA 1K1LA 4XBCA 3V12A 3SNBA 4IMZA 1QRZA 1QR3E 4K1SA 2BX4A 3UNSA 3A7ZA 4XSKU 2UWOA 1Y3YA 2Y80A 3KN2A 1O2OA 2Z9IA 1O0DH 1FIWA 1WV7H 5EOKA 1TWXB 5EXMA 1T4UH 1CU1A 1GBIA 4U2WA 4NSVA 4B2BA 1GHBF 2ZKSA 4BXSA 3SV2H 1W10U 2ZDNA 4OS6A 1XKAC 2O8MA 3P17H 1W14U 3W94A 1GDQA 3VFEA 1OSSA 3TITA 1JRSA 2EI8A 1GBDA 2FWWA 1D6RA 2SGPE 1ZSJA 2ZPSA 3VPKA 1QJ7B 1O2TA 1QB6A 1ELDE 3LGWA 3SUFA 4GVUA 1GHAF 4MNXA 3DA9B 1VITF 1GHXH 4B73A 1C5SA 1Q31A 1UTJA 2FOBA 5CHAC 2ZFRH 3KQCA 2K1QA 1G2MA 2XC0A 3MU1A 4A92A 2FOGA 2Y6TA 1HAOH 2CF9H 4ZROA 1OWKA 2Z3CA 1U6QA 4JZEH 2NWNA 2FI5E 1W8BH 1GI6A 2H6MA 1SPJA 4X1QU 4YESB 4A5TS 1IHSH 4MG3A 2SGAA 4ZKSU 3TNTA 4X6OA 1SGIB 5F6MA 5IYTA 1MZAA 1TA2A 1ELEE 1NFYA 2ANWA 1SOZA 4H42U 3EGKH 4I8GA 2TGPZ 2BVRH 1NU9A 1C2MA 2LPRA 1GG6B 1C1VH 3U8RH 2Z6BD 2PSYA 3MTYA 3VGCC 4UE7H 2ZPRA 3P8OA 4I7YH 3MHWU 5A2MH 1TGTA 2HNTE 1F5LA 3BTTE 1BA8B 1EPTA 4UDWH 1RFNA 4Q2KA 1AZ8A 1DSTA 1SHHB 1Z8IB 3P8FA 2QXHA 3KF2A 2G00A 4ISIH 2VWMA 1OP2A 3UIRA 1V6DA 4MNYA 1ZMLA 2ZTZA 4XE4A 2GV7A 2ODQA 4F4OC 4BNRA 2KAIA 2F3CE 2VIPA 2AGIX 3LONA 3PMAB 2O8LA 4MQAA 5T3HA 3MOCA 1JBUH 4WJG2 5K7RA 4DGJA 2V3HH 3U1IB 4I31A 3FAOA 3HK3B 1PQ5A 1G32B 3MNXA 1JMOH 3RXLA 1AKSA 3S0NA 1P2IA 4OS5A 1SSXA 2C90B 1PYTC 5GXPA 1W11U 4AN7A 4AORA 5DP9A 3GY5A 1O2ZA 1C1OA 1SLUB 2SGFE 3QLPH 2PUXB 1QRWA 3WY8A 1SGNE 1EAXA 4X6NA 3T29A 5C1UA 3JZ2B 4MNVA 1GJCB 1YC0A 2RA0A 2GCHG 5HM2A 1YPHC 1O34A 2ZO3H 4ZXXH 1YM0A 4FUHA 1BT7A 1ZOMA 5GJ4B 2ZA5A 1P12E 2GDDA 5AHGH 1T32A 2CV3A 3N7OA 3ZZBA 1RTLA 4FUJA 1JIMA 5C5NA 2OINA 4JZDH 1D4PB 2AMPA 1OP0A 1DXWA 2I6QA 1O2WA 1YPMH 1O31A 1NFUA 1ZHMA 3E6PH 3EA8A 1ARCA 1GDUA 4O3TA 3UREA 4JMYA 1FY4A 1V2JT 1YP9A 4RN6A 4CHAB 1BHXB 3TK6A 2R2MB 1DM4B 4E05H 4X1NU 3LJOA 1DY8A 4B1TA 5J4QA 1BJVA 3UR6A 1O3BA 1AZZA 1C5NH 1HB0B 1P57B 4GHTA 4LK4A 3A7VA 3EYDA 2BY7X 2DE8A 4YOGA 1C4V2 1RRKA 2GTBA 4AYYB 1V2UT 1E38B 1QURH 2WUCA 2XWBI 1EB1H 4KTUA 4UFGH 1YCPH 4GAWA 3PTNA 2BD9A 3RDZA 1GGDB 4GCHG 3ZVGA 3SBKA 3ATMA 2CJIA 1CQQA 2A4OA 4X6MA 2XCFA 3UNQA 3PO1B 3MU4A 5EQQA 1LVOA 2W5EA 1V2ST 3ZZ5A 1QQ4A 3KQBA 2F9UA 2GMTB 2WYJA 4A1VA 4F49A 1C1UH 1THSH 4I33A 4OS7A 3ATKA 5FPSA 2Z7FE 1TYNA 1QJ1B 4O03A 3V3MA 1VR1H 1AFQB 1SGFG 2F91A 1ZHPA 3AW0A 1IQIA 3M3SA 4NA9H 3A82A 4CR5A 1Y59T 3GY3A 1IQLA 3M35A 1CGHA 1EJMA 1ZRKA 1NZQH 2XTTB 2VNTA 1BZXE 3CS7A 1MD7A 4Y8XA 1OS8A 2BMGB 3D65E 1GCTB 1O2LA 2H1UA 3QTOH 3Q00A 4Y71A 1A5GH 1SGRE 2Z9GA 5BPEA 1OP8A 1O3PB 1HJAC 1A3BH 1T4VH 2A4GA 3STJA 1E36B 3K65B 3NZIA 1HXEH 3GCNA 4U30A 1EZUC 1F5KU 2AFQB 1BMAA 2IJOB 3M5OA 1P2OA 3TGJE 4AFZA 1O38A 1QFKH 3K2UA 4Q7ZA 4CH8B 2NU1E 1S0RA 2HOBA 3RM2H 2OC8A 2BXTH 1SGEE 1PQAA 5ABWA 2FM2A 3K6YA 2ZI2H 3PYHA 1BBRK 1SGYE 1P2NA 1TNIA 3KNXA 1MTVA 1MTWA 3OSYA 1ELBA 1V2VT 3IITA 1QTFA 3RMOH 1LHEH 2Z3EA 1SGQE 4AGKA 1SQAA 1ARBA 2H9TH 1FAXA 2ALPA 3P6ZB 4MVNA 3GCTF 2G5VA 5JB8S 3E0PB 3RXDA 1QRXA 1OOKB 4X2YA 4WXIA 3ODFA 1GBFA 3DD2H 3I77A 4X2VA 1KXFA 3UQOA 3TVJB 1P01A 2JH0D 1O32A 2FX4A 1O3KA 2G52A 2TGAA 3RU4E 1XM1A 3KGPA 2GZ7A 4OS4A 3KQEA 1IOEA 2ZFPH 4VGCB 1XUIA 1EJNA 5E8EH 2ULLA 5LPFA 1ELAA 2ZHWH 1B5GH 5GCHG 4BAOB 8KME2 8GCHG 3L3TA 3KHVA 1O2SA 2HALA 1LTOA 3E8LA 2PKSB 5JBTA 1C5XB 2XWAA 3A88A 1DT2A 1QIXB 5C5OA 4K8BA 2A7HA 1O2KA 3S69A 1TMUH 2ZHFH 1MKXH 5FCRA 3RLWH 4CRBA 3UWIA 3R3GB 2F9VA 1C5TA 3GICB 6LPRA 2ANMH 1C9TA 1ZHRA 5HM9A 2OC0A 1TBZH 5L2ZH 4X1PU 4YT6H 5T6FA 5EODA 4GSOA 2GVFA 2OD3B 2GV6A 3CENA 3H7TA 4X8UH 1EJAA 3VB6A 5C1XA 1PPZA 3SOSA 3SQEE 3F9EA 1IQKA 1C4Y2 4XFQA 2OC7A 1GMHF 1HFDA 3AW1A 1QA0A 4CBNA 4MPUA 9LPRA 1GVZA 3BG8A 4OGXA 1GBKA 3H7OA 1ZPZA 3M3TA 4LXBH 5A0AE 4DVAU 1BRUP 1P03A 5JDUB 1P9UA 1TX7A 2Y7ZA 3DT0H 4ABFA 1AFEH 2GCTB 2QIQA 3RXUA 4I8LA 2I6SA 1TPSA 3LGUA 2A2QH 1MMJN 4O9VA 1LVMA 5GWZA 1QGFA 3E91A 2Y5FA 2FPZA 2QCYA 1GHYH 2STBE 3GCOA 2ZG0H 1UVTH 2EEKA 2P3UB 4X8SH 4ABEA 1WBGB 3A85A 1CT0E 5LPEA 3PMBB 1CO7E 5C1YA 1WQSA 2BOHB 1GHZA 3QN7A 5TCCA 1NPMA 4J1YA 1MCVA 2F83A 2OTVA 3A80A 1S84A 4MNWA 2QA9E 1E35B 3FZDA 4WWYA 1N8OB 1YPHE 3SU1A 1AIXH 2PV9B 1VCQA 1NT1A 1ESBA 3ATWA 5DGJA 4QT8C 1IQHA 1CA0B 1DLKB 1GG6C 2ZU3A 1DWDH 1IQGA 3F6UH 3AAUA 4FU9A 2TBSA 2FS9A 2FYRA 1SVPA 1TNKA 2ZHQH 3A89A 2BDHA 2AYWA 2A0QB 3VXEH 2AGEX 1UCYE 3RXKA 1SG8B 1GBTA 4K1EA 1DFPA 3GYLB 2A7CA 5DG6A 2ZC9H 1A61H 3A8DA 2NU4E 1NRQH 5EU8A 3BIVH 4IGDA 1SR5C 4BAQB 3Q3YA 1SGDE 1ELTA 4INHA 4NG9H 4SGAE 1PPEE 4CR9A 5JBAS 3A8BA 1VJAU 1W7GH 4KTSA 3MO6A 2O9QA 2XXLA 3EA7A 3EE0B 2P8OB 3A7WA 4RKOB 5EW2H 1TX6A 2PKAA 3T2NA 1DUAA 4YT7H 3MFJA 2WPJS 2WINI 1A46H 5H4IB 1AWFH 1C9PA 2BYAX 3RXBA 4CRDA 2WPIS 4SGBE 5LH8A 3FP6E 1GCDA 2UWLA 1GMDF 2W26A 3RC6A 2BDYA 1UTOA 2H9HA 1AO5A 1X7AC 2UUKB 1T8MA 4YO9A 5A0BA 1Y3XA 3TLOA 2XYAA 1LPGB 2ZZUH 1O2NA 1G3BA 1UK2A 2J92A 3A83A 1O5AB 2W7SA 3LJJA 3NUMA 2ESTE 3TGKE 1EAUA 5L2YH 1G30B 2C4FH 3MH4A 3ZZ3A 1EPTB 1O3AA 5IDKA 3TH4H 2O8UA 4CHAC 1VGCB 2G51A 1THRH 4AOQA 1TPOA 1LVYA 1TPAE 2KAIB 2BD7A 2YNBA 4XDEA 1LPZB 1DOJA 1LKBA 1FONA 3LC5A 3TH3H 2OUAA 3ZZ8A 2FP7B 1BIOA 1ESTA 1TGBA 1KLTA 4E7NA 1Z6EA 4ISLA 2P3FH 1KYNA 1AKSB 1C1MA 4JK6A 2PGQB 1P0SH 1OKXA 1GGDC 1GI0A 1BTPA 1K1JA 1SFQB 2IOTA 1XVOA 1BTZA 3SNCA 3PO1C 1GHBG 3VB5A 3P8NA 1MBQA 3GDVA 4AZ2B 2R0LA 1FIZA 4D8NA 2GMTC 1OWEA 2F9NA 3PMHB 4NZLA 2FDAA 1CT2E 1YGCH 2UUJB 3UOPA 1DITH 2ALVA 1HAXB 3RXFA 2WUBA 2Z9KA 3RXTA 1W7XH 3MWIU 1M9UA 1TNHA 1V2PT 1AVXA 1AUJA 1GHAG 1AU8A 4FUEA 1O5DH 2ZU1A 3LC3A 3UNRA 1VITG 1O3DA 2CMYA 3TGIE 1DUEA 1O30A 3HKJB 1H4WA 2B0FA 2ZU2A 1GCTC 3MU0A 1YKTA 3OY5U 2ZHEH 3MO9A 3HPTB 2XC5A 1UTPA 1QCPA 3QX5H 5HYOA 3SU6A 2PW8H 1Q2WA 3BTDE 4U01A 2THFB 1K21H 4R8TB 4X2WA 2LNCA 2BY5X 2BY8X 1FXYA 4FUIA 1GJBB 1QBOA 1O2VA 1YCPK 1EX3A 2ZFQH 4AFQA 1ANEA 3F9GA 1W13U 3UQVA 4IC6A 1J8AA 1UK3A 2O8TA 3NXPA 1ETSH 3SV7A 4XBBA 3P8GA 2VH0A 3ZVDA 3SI3H 5A8ZA 2VU8E 1P8VC 2D26C 3ZYEA 1BUIA 1KXCA 1TE0A 5EGMA 1DPOA 3SU2A 3ZZCA 1KLIH 1DLEA 3RXIA 2BQ6B 3Q3KA 3PMJA 4LZ1H 1ZJKA 1IHTH 4MDSA 4MPVA 1JRTA 1ANDA 5G4BA 1ETRH 1O2MA 3UPEA 3P70B 2IN2A 4K60A 1HIAA 3KQDA 1LQEA 4VGCC 1EATA 1MTSA 6ESTA 4TPIZ 3LPRA 2B5TB 1KXDA 1TX8A 1O3CA 1HAIH 2P94A 3ZYDA 2PKSC 3M5NA 2Y7XA 3B8JA 1E0FD 4X1RU 7GCHF 4CRGA 1FNIA 2SNVA 1CSOE 1C1NA 1AQ7A 2JH5D 4ZKOU 2ZCHP 2FTMA 1RIWB 2ANKH 1J15A 3LOXA 2CXVA 4DOQA 1O3HA 4NA7A
chains in the Genus database with same CATH superfamily
3LKWA 1AN1E 1YY3A 4H6TA 3ENSB 1HYLA 8LPRA 2BQ7B 2V7QD 3UUZA 3M5MA 5FPTA 4FVBA 1KDQA 1GMCF 2OBOA 1HAVA 3RLYH 1BRCE 1EQ9A 3QZRA 3QGNB 3BEIB 2J5UA 3A7YA 1AY6H 5DK1A 1C5YB 3ZVAA 2BTCE 2BZ6H 2M5TA 1GJAB 1HAHH 3BTKE 1O35A 3RXAA 2WYGA 4F55A 2ZECA 1LCYA 2D2DA 1VKYA 2GCTC 5LPRA 1Y5UT 4CREA 3RXSA 4I32A 3ZZDA 1TPPA 1XX9A 5C67A 4WXVA 1O3GA 2SFAA 3RXOA 3SV6A 4WY3A 4A1TA 2ZEBA 2ZU5A 1QL8A 2RCEA 5DO4H 1AUTC 3LU9B 3SU0A 1MQ6A 1RD3B 4Y7AA 2WPMS 2HRVA 5AFYH 2G8TA 4ZCNA 4LOYH 4AGJA 3SZEA 2VIQA 2JJ2D 4D9RA 1Y3UA 1MKXK 1YCPM 1P2MA 1N8OC 5HMAA 1BTHH 1Z1IA 2WV4A 5CHBA 2IPQX 3SNDA 3ESTA 1CA0C 1EOLA 1P9SA 2W3IA 2NU0E 1C5OH 5K0HA 5ETXA 3WWFA 2CHAC 3MNSA 2ODPA 1A5IA 2GT8A 1MTNB 1O2IA 1YBWA 4HFPB 4KELA 1O2XA 4CRFA 3I29A 2PSXA 4K1TA 4KTCA 1YLNA 1WOFA 3NPSA 1C2LA 1BCUH 3BTFE 4TY6A 1DX5M 1O5GH 3RMLH 2FIRH 2GP9B 1NBMD 2GKVE 1FN6A 1ABJH 3HGPA 1MAYA 3UY9A 5DSFA 2QY0B 4TYDA 4Y11E 3VB3A 4AC9A 3M7QA 2P8OC 1K1OA 3GY8A 5T6GA 4MTBA 1FZZA 1QBVH 3S7KB 2WV5A 2ZP0H 3EAJA 5ESBA 1Z6JH 5KGOA 3FZZA 1HXFH 1ELVA 3MH6A 1CHOF 3C27B 1KTSB 3S9BA 3V13A 4ABBA 2R3UA 3GCTG 5HIZA 3H5CB 2AS9A 3LGIA 2DUCA 1DY9A 2RA3A 5B6OA 2J9NA 2OXSA 3BSQA 1RTFB 2FOHA 1SLVB 1LMWB 1K22H 3FP8E 1FY5A 1P02A 5E2PA 3RXVA 1J17T 2A5IA 3BTME 1WTHD 1FY3A 3UB0A 1EPTC 3E0NB 2VJ1A 1C2IA 1EZXC 4B2AA 2Z9JA 2EC9H 4UFFH 3DFJA 3FO8D 5CE1A 4FU7A 4Y76A 1SFIA 3GY2A 3ZZ9A 1GDNA 1K9OE 1SMFE 2C3SA 4WVPE 4AB8A 1VGCC 4DJZB 2G5NA 4YLUA 1JXPA 2ZDLA 3VB7A 2P59A 3MI4A 3RUOA 2OCVB 1V2MT 1CA8B 1OWIA 2Y82A 4BAMB 1ZTKA 5EXLA 1EUFA 1TIOA 6GCHF 3NKKA 1ZR0A 2QV1A 5F53A 3PWCA 4JYTA 3RXMA 2FTLE 1LHCH 2JETB 1FY1A 2PKAB 4ZKNU 2WHXA 3EDXB 2CF8H 3LH1A 2A32A 2ZFSA 4AX9H 1SOTA 1T8NA 1YPKH 4DCDA 1XUGA 2PHBA 2HNTF 1FPHH 3GISB 5DKMA 3SHAH 2BLOA 1GMHG 1P05A 3MU8A 1O5EH 1UHBA 1KSNA 2AIPA 3IWMA 4B75A 4P00A 3SGBE 4I8HA 1O2JA 2GDEH 3RXRA 1F0SA 4BXWA 3RU4D 2FS8A 1CGJE 2V3OH 2SNWA 1QBNA 3O8DA 4NIVA 1KTTB 1ZSKA 2YMSD 4ZHLU 3SU4A 2Q6DA 1PPGE 1EAIA 3MNCA 2R9PA 1TGCA 1TBRH 1T7CA 2VWNA 4U32A 3S7HB 3GDSA 1KXBA 3BTGE 1D3DB 3LH3A 3U8OH 3V7TA 1G36A 1DWCH 1H9HE 2QC2A 1DVAH 1XUHA 3VXFH 3GDUA 2CN0H 2BX3A 3SNEA 1L4ZA 1UCYH 1S5SA 3ZZ7A 3GY7A 1A2CH 1MKWH 4DURA 1DE7H 5FBEA 5DP7A 1SQOA 5C20A 3SU5A 3DHKH 2PUQH 4OGYA 3FN8A 1O2PA 2A4QA 1V2OT 5C2ZA 1PQ7A 3ZIAD 3W95A 1OXGA 1BQYA 4ACAA 4X8TH 1E1QD 2FX6A 1C1PA 1PJPA 2BD3A 4GHQA 5AF9H 2VGCB 1O3JA 2GD4B 4TWYA 2AMDA 2ODYB 3SGQE 1FJSA 1FY8E 4Y0YE 1MBMA 1GJ4H 1SGCA 3PTBA 1YPLH 4HI3A 1SB1H 1HPGA 2G4TA 1BHXF 1RGQA 4YOJA 1HAYB 2GZ8A 1GJDB 1O36A 1C4U2 2WPKS 5FBIA 3M36A 1Y5AT 1C2DA 1PYTD 4DY7B 1C5RA 1JIRA 2V6NA 1VCWA 1NESE 4FU8A 5F8TA 1K28D 1O33A 4RT1A 3QUMP 1OYQA 3GY6A 1GMDG 1QJ6B 3MQKC 2B8OH 3F0OA 1SGTA 4Z6AH 5TJXA 1RIWC 1C1QA 1XXDA 1ZGVA 2WV9A 1LDTT 1K1IA 4OS2A 1DSUA 3T28A 2CHAB 1B0EA 1GHVH 1ZYOA 3SZNA 2A31A 3L33A 1H9LB 4NFEA 4ABDA 2A45B 1NFXA 4IN1A 2H9EH 4XD7D 3QK1A 3PLPA 2KCYA 4BAHB 3KYGA 1FAKH 4AFSA 1WAYB 3MO3A 1V2RT 1TOCB 3HATH 5EW1H 3M5LA 1ZSLA 3CS0A 2Q1JA 2TGTA 3QWCH 3D49H 4NCYA 1HDTH 2FODA 1G9IE 3D62A 1A5HA 3PLKA 1P3EA 1L1JA 1ZMNA 4RT0A 1BTUA 1LVBA 3A84A 7ESTE 2EA3A 3SUGA 3SNAA 2BLQA 1GBLA 2J98A 1Q3XA 3MMGA 4D76A 3LIWA 3BV9B 4ZH8A 2OLGA 3U98H 1ETTH 1IQMA 4D7GA 2WPLS 1TOMH 3ZVCA 3GOVB 4NA8A 2C93B 3OY6U 5A8XA 1MUEB 1T8LA 5F8ZA 1PPBH 1GJ5H 1CHGA 2HWLB 1KLJH 3U69H 1S83A 2V3MA 3M3VA 1LO6A 2VINA 3RXJA 3ZZAA 1C5WB 2XC4A 1P10A 4AYVB 1WXRA 1BTYA 1E34B 2GZ9A 6CHAB 2YOLA 2J94A 2XNIA 1MTNC 3SGAE 1TGNA 3ZV9A 1P2JA 1ORFA 1YPJH 3HKIB 1EOJA 2WPHS 2FI4E 3STIA 4AB9A 1SKYE 5ESTE 3RXQA 1KDQB 5DP8A 1TONA 1HAVB 2ZTYA 1SI5H 1GL0E 1W0ZU 1YPGH 4A1XA 2BVSH 1C5LH 2J38A 4ZXYH 4P02A 1CBWC 2WZQA 3OTJE 1QNJA 1N1LA 2PTCE 3A81A 1KIGH 3BF6H 1TMTH 2CK3D 2BY9X 1IQNA 4I8KA 2ZGXH 1FN8A 2AERH 1K1NA 4M7GA 1GI3A 3K6ZA 2PWXA 1TRNA 4UD9H 3MYWA 2FOEA 3ZV8A 3LGYA 4F48B 4ISNA 1O3EA 2P93A 5EQRA 2RG3A 4AG2A 3RU4T 3BEFB 2M2AA 3PLBA 3PV4A 4IC5A 4WH8A 3AK5A 4IS5A 2ZFFH 1OWHA 1IQEA 1TABE 1AMHA 1H8HD 5F8XA 1GJ8B 4YTAA 1H8DH 1TBQH 3DSGA 3FP7E 1BMMH 1BBRE 1D3TB 4NWLA 4ZKRU 5E0JA 1V2KT 3ATIA 1MH0A 2H5CA 2R3YA 3OX7U 4BTTB 4MPXA 2VVCA 1F0RA 1QY6A 3TH2H 1HAPH 3T62A 1WUNH 5JYIA 4YM9A 3F68H 3EA9A 4MPWA 1VJ9U 2ZQ2A 2BDGA 1G3EA 1Z1JA 1FUJA 1RTKA 1SC8U 3O8RA 3SJ8A 2FLBH 3SU3A 5CMXH 3PWBA 5I46H 2A4RA 1UVPA 1CVWH 4ESTE 1L1GA 1RXPA 3BTEE 4NIXA 4WMEA 1AB9B 3QDZB 7GCHG 1OYTH 1SL3A 1CGIE 2ZTXA 4H6SB 1UTKA 2R0KA 1XUKA 1H1BA 1Y3WA 5FXLA 1E79D 1L2EA 4X6PA 3FVFB 4E06H 1TMBH 4K8YA 4IW4E 2JETC 3BEUA 4BOHA 1D3PB 3OAAD 5C0TA 3RC5A 1F0TA 1DS2E 3SQHE 1K0HA 2ZCLP 1OWDA 1Y5BT 3WW7A 1GMCG 7KMEH 1A4WH 1GBBA 3B9FH 4WMFA 4IN2A 1YYY1 4FVDA 3TNSA 4KKDA 1TNGA 1T31A 2IPHA 1G3DA 1GVLA 3VEQB 2C8WB 5GPIB 3F3BA 1Z8RA 1ZRBA 1RS0A 1ID5H 1P2QA 1EZQA 1H8IH 1C1TA 2BB4A 2KM0A 5EPNA 1L0ZA 1INCA 2P16A 4WF8A 1C5QA 1SGPE 1GBEA 1O5BB 1O5CB 3QGJA 1LKAA 1Z8JB 2FEQH 2VVUA 3S9CA 1S6HA 2L6OA 1G2LA 1OPHB 2JIZD 1O39A 3M37A 4NZQA 2XCNA 2QXIA 3ZVFA 2FZZA 5JB9S 4A7IB 3F0PA 2AGGX 3BIUH 3FFGA 5C17A 1MCTA 1O37A 1PFXC 3LT3A 2G55A 2PTNA 3HK6B 2TGDA 1C1RA 1ZLRA 1O3IA 4ISHH 3TK9A 4INLA 2OQUA 3TJUA 1TQ0B 2J34A 3F2HA 1DWEH 1UO6A 5JBBS 2NU2E 3MNBA 2ZWLH 3T5FH 4IMQA 1HV7A 2ZF0H 5AFZH 4I86A 2F9BH 4FUGA 5FX6A 4NIWA 2BQWB 3BN9A 3E1XB 3SORA 2JH6D 2NU3E 2FMJA 3U1JB 5A09A 1TNLA 2K0QA 1GI9B 4AFUA 5DP3A 4BTUB 4PROA 1TA6A 3O8BA 3O8CA 2AIQA 1UHBB 5LGOA 1JWTA 1BRBE 2VGCC 3PRBA 9ESTA 3UAIC 1LHFH 1CE5A 1FPCH 4B6EA 1S0QA 1O3OA 1QL9A 2PLXA 4NGAH 4Y6DA 2FOAA 4AG1A 3HGNA 5GIBA 4ZMAH 5FPYA 1HAGE 1NO9H 3AAVA 3OYPA 1A0JA 3A7XA 1NRNH 1D9IA 3QO6A 4MLFB 3ITIA 2FOFA 1WSSH 4ISOA 1P11E 2SGDE 2Z9LA 1C1SA 4Z0KA 3UOUA 2F9OA 1J9CH 1O2RA 5L30H 2OP9A 5EJLA 1S85A 1CHOG 4Y0ZE 5DJ7A 4E7RG 5EJ1A 1VCPA 3QTVH 5PTPA 1FX0B 2QF4A 1O3LA 1TGSZ 2PFEA 5EG4A 1S6LA 1EZSC 1IQFA 3KEEA 2BD2A 1BMNH 4I8JA 4ZHAA 1UCYK 4DT7B 1GBCA 1TAWA 7LPRA 2ILNA 1MKWK 4GLYA 4GPGA 3PV5A 1WYKA 2VH6A 2V35A 2KCOA 1O2GH 2VBCA 2EI6A 3KCGH 1GBAA 3URCA 4TPYA 1ZGIA 2FESH 2RFKC 3DUXH 1KXAA 3SV8A 3V0XA 1CBWB 5FHTA 4A6LA 3OEHD 2B7DH 4X8VH 1FI8A 1GI8B 4ZUHA 1GPZA 3E3TA 5DP6A 4RSPA 1AHTH 5J4SA 3ZVBA 2OQ5A 1EXFA 1P04A 1QA7A 2R2WU 2ANYA 1TRYA 1DXPA 2BOKA 1O2HA 2H2ZA 3KIDU 1K1MA 4ZHMU 3M7UA 2D8WA 4YZUA 4DIIH 1QB9A 2XBXA 1MTUA 2WSSD 3T27A 1WTGH 2Y81A 2ZQ1A 3T26A 6GCHG 2VIDA 1BDAA 1BITA 1NC6A 1PPFE 1S81A 2B9LA 4ABJA 2BHGA 4KGAA 3I78A 1CT4E 4H4FA 1C2HA 5C94A 1F92A 5DP5A 4XBDA 2QAAA 2FLRH 4JZIA 5CDFE 2ASUB 2P95A 3TIUA 3UWJH 2RDLA 4INKA 2GCHF 1GJ9B 4CRAA 1V2WT 3U8TH 2BDBA 2C8YB 1SQRA 3U9AH 4ABIA 5DPAA 1MU8B 1V3XA 1V2LT 4UFDH 4XOJA 2DE9A 3Q3XA 5SGAE 3SN8A 1A0LA 3A8CA 3ATLA 1ESAA 3TJNA 1GHWH 3K9XB 5HXFA 2W3KA 3GCHC 3DCLA 2CGAA 3Q77A 2L74A 6CHAC 1V2TT 5BRRE 4JZFH 4JCNA 3SJKA 1G37A 1NY22 2BD4A 1THPB 2IJD1 2VIVA 1ZPBA 4B6FA 3SJIA 1O2QA 1A3EH 1AE5A 3SW2B 2J4IA 1XKBC 5B6LA 2XRCA 1SLXB 2BLWA 4B74A 1LPKB 1LHGH 1AI8H 1C2GA 3BG4B 5E2OA 1F5RA 1ELGA 3SI4H 3RXCA 1FQ3A 1MU6B 1C1WH 1AD8H 2HLCA 1O3FA 1ZZZA 1YF4A 4NIYA 1XMNB 1E37B 1C2FA 1ZPCA 4YLQH 1MD8A 5F03A 1JOUB 1TLDA 1H9IE 2FOCA 2BM2A 1HUTH 5EPYA 1N6XA 1LQDB 1XUFA 2J98B 2FI3E 1W0JD 1NRPH 1UK4A 1UMAH 4GCHF 3OU0A 1TQ7B 4X2XA 2GX4A 1W0YH 2BDCA 3SJ9A 1IAUA 3SYJA 4TY7A 3KL6A 2STAE 1HNEE 2ZPQA 1UTMA 1RJXB 3S9AA 3ELAH 1YPEH 3B23B 1SGFA 3RMNH 4YOIA 1E1RD 1KMHB 4O97A 1C2JA 4K2YA 1KY9A 1XXFA 4UFEH 3JZ1B 3DFLA 4RKJB 2A7JA 4K69A 3PB1E 1NROH 3F1SB 4FUCA 2FXRA 4FUBA 3A86A 3VB4A 1UTNA 2A5AA 3ZZ6A 3ZZ4A 3PRDA 3TPIZ 1SQTA 4K3JA 4UEHH 5DP4A 2HPQH 4LZ4B 2Q6FA 1HBTH 1ABIH 1WQVH 4B2CA 1HCGA 1FMGA 5CHAB 2F43B 2AMQA 5GDSH 5A8YA 1SHYA 2YMSB 2ZHDA 1GBMA 1EKBB 2HVXA 4CH2B 1C2KA 1NM6A 4FXGH 1SBWA 1AB9C 3IG6B 3RXGA 2F9PA 1BRAA 4R0IA 3RXHA 2XBVA 3MH5A 1NTPA 5I25A 5TCAA 1O2UA 1W3CA 1C2EA 2AEIH 2XBWA 3FANA 3F2GA 1GI2A 5JPMH 1O3MA 1J14A 2BY6X 2PP6A 2HVYB 5EQSA 1BMLA 3ODDA 1ZMJA 5KECA 2LELA 4Y10E 1QB1A 2BVXH 3A7TA 3PM3A 1HGTH 1UTQA 2OBQA 3VGCB 2J2UA 5EXNA 3SJOA 1DDJA 1W2KH 4Y8YA 3M61U 4THNH 1UW7A 4ABAA 1B0FA 1WU1A 2BDIA 2V0BA 1VITH 1HLTH 1HJ8A 3P95A 4WMDA 1NRRH 1VZQH 4FUFA 1B7XB 1L4DA 3UFAA 1XUJA 4JYVH 3SUEA 4D7FA 1ACBE 1KXEA 2VIOA 1EP5A 3TJOA 3F9HA 4JK5A 1COWD 2VWLA 2OC1A 3EQ0H 2A1DB 3RXEA 2H5DA 1Y3VA 1YLCA 3AASA 2TRMA 5KEDA 2O8WA 1A7SA 4Q80A 1P06A 4ASHA 3LDXH 1EAWA 5GCHF 1DICA 8GCHF 5L6NH 2W6JD 3L6PA 1OX1A 3LGVA 3R0FA 2Q6GA 3NCLA 2QE7D 2W6ID 3LGTA 1F2SE 2HGTH 3GYMA 1C5MD 2G81E 1UTLM 5FCKA 2HPPH 4X0WU 4DT4A 3G01A 4NFFA 1TRMA 3NWUA 2ZFTA 4UONA 4OS1A 1EB2A 3SV9A 1Z7KA 1UVUH 3E16B 2UUYA 4NSYA 1S82A 2QGRA 4XRNA 1HRTH 1Y8TA 1F7ZA 1ELCA 1N6YA 3N99A 4JZ1A 2HNTC 5T6DA 5FAHA 1BTWA 4Y79A 1BTXA 2BD8A 2ZIQH 2WPDD 4BAKB 4IBLH 1P2KA 1AE8H 4DIHH 2KCPA 5T1VA 3URDA 3T25A 1GVKB 3MU5A 4CBOA 3FKSD 1MAXA 1O5FH 1DANH 1A0HB 2ZGJA 1WCZA 2Z3DA 1GWAA 2Y5GA 2XBYA 2C8ZB 2A2XH 4NWKA 1S6FA 2QXGA 2YNAA 1K2I1 3E90B 3Q76A 4JYUH 2ZU4A 3UTUH 4D9QA 2FO9A 4GUXA 5EJZA 4O3UA 2FYQA 1HIAB 2ZNKH 1YLDA 2Z94A 1T8OA 4TT3D 1QHRB 3SHCH 2BLVA 2KFWA 4Y7BA 2Y5HA 2TIOA 1HAZB 1GL1A 4TWWA 1IQJA 1NFWA 2JKHA 1QZ8A 1AWHB 1BBRH 2ZGCA 2J95A 1TFXA 2VWOA 4J2YB 4HGCA 1O3NA 1ANBA 1TALA 2BDAA 3BTHE 4DW2U 2ZGHA 1XVMA 4HZHA 3SO3A 1C5UA 3AVZA 1FDPA 1W12U 4FETA 3GCHB 3QZQA 1C5PA 1DWBH 1D6WA 4DG4A 2G4UA 3TJVA 1GI7B 1GBHA 1J16A 1GI1A 4KP0A 2ZDMA 1EP6A 2QN5T 1EASA 3GY4A 1V2NT 2KZ4A 2VIWA 4X1SU 3MH7A 1P09A 4ZAEA 1V2QT 2GGVB 2LP6A 1PPHE 1GJ7B 1NN6A 1P3CA 2XNDD 1WDIA 4B76A 2UUFB 2P3TB 3C1KA 2AH4X 2JJ1D 2ZCKP 5HIYA 1Z71A 1O2YA 2QXJA 3ZVEA 3NK8A 4Q7YA 1AVWA 3H09A 1ANCA 2BXUH 1GJ6A 3SUDA 1HJAB 8ESTE 3RXPA 5HKKD 2VVVA 1ZJDA 3M7TA 2BZAA 2A5KA 2SGEE 2GT7A 2SGQE 2ZDVH 1NRSH 3F9FA 4Q7XA 1UVOA 1BJUA 3RP2A 3TK5A 4B71A 4ABGA 3TU7H 2EI7A 4ABHA 1H8ED 1ZTJA 3D23A 2ZDKA 3P92A 1C5ZB 2XW9A 2D1JA 1UVSH 5FX5A 2TPIZ 1G3CA 1AGJA 1TB6H 3OE7D 2FOMB 1NS3A 1FV9A 1L1NA 1OWJA 1UJ1A 4BTIB 2QYIA 5AVDA 5HGGA 1GI5A 1BB0B 1A1RA 3BTQE 1PPCE 2ZDAH 1K1PA 3RMMH 5JBCS 2BD5A 3CP7A 5C3NA 3RM0H 4CRCA 2UWPA 2ZGBH 5IK2D 4K5ZA 1LHDH 1GBJA 1D3QB 1QL7A 2QF0A 2PR3A 1FLEE 2W7UA 3OTPA 2PGBB 3PROA 1PQ8A 3RC4A 2QF3A 3UR9A 1MQ5A 1GI4A 5FL7D 1C5VA 4FUDA 1AFQC 1TNJA 1HJ9A 1NU7B 3A8AA 3BG4C 5A0CA 2F4LA 3A87A 2VB0A 1BOQA 3BTWE 1ZTLA 1QQUA 1AVGH 4WH6A 4Y8ZA 4HTCH 5E0GA 1F0UA 5E0HA 1SLWB 1Z8GA 1ELFA 2C8XB 4BANB 1MZDA 1K1LA 4XBCA 3V12A 4Z1MD 3SNBA 4IMZA 1QRZA 1QR3E 3FOAA 4K1SA 3W1EA 2BX4A 3UNSA 2OK5A 3A7ZA 1MABB 2UWOA 1Y3YA 2Y80A 3KN2A 4XSKU 1O2OA 2Z9IA 1O0DH 1FIWA 1WV7H 5EOKA 1TWXB 3OFND 5EXMA 1T4UH 3OEED 1CU1A 1GBIA 4U2WA 4NSVA 4B2BA 1GHBF 2ZKSA 4BXSA 3SV2H 1W10U 2ZDNA 4OS6A 1XKAC 2O8MA 3P17H 1W14U 3W94A 1GDQA 3VFEA 1OSSA 3TITA 1JRSA 2EI8A 1GBDA 2FWWA 1D6RA 2SGPE 1ZSJA 2ZPSA 3VPKA 1QJ7B 1O2TA 1QB6A 1ELDE 3LGWA 3SUFA 4GVUA 1GHAF 4MNXA 2EY4C 3DA9B 1VITF 1GHXH 4B73A 1C5SA 1Q31A 1UTJA 2FOBA 5CHAC 2ZFRH 3KQCA 2K1QA 1G2MA 2XC0A 3MU1A 4A92A 2FOGA 2Y6TA 1HAOH 2CF9H 2YMSC 4ZROA 4ASUD 1OWKA 2Z3CA 1EFRD 1U6QA 4JZEH 2NWNA 2FI5E 1W8BH 1GI6A 2H6MA 1SPJA 4X1QU 4YESB 4A5TS 1IHSH 4MG3A 2SGAA 4ZKSU 3TNTA 4X6OA 1SGIB 5F6MA 5IYTA 1MZAA 1TA2A 1ELEE 1NFYA 2ANWA 1SOZA 4H42U 3EGKH 4I8GA 2TGPZ 2BVRH 1NU9A 1C2MA 2LPRA 1GG6B 1C1VH 3U8RH 2Z6BD 2PSYA 3MTYA 3VGCC 4UE7H 2ZPRA 3P8OA 4I7YH 3MHWU 5A2MH 1TGTA 2HNTE 1F5LA 3BTTE 1BA8B 1EPTA 4UDWH 1RFNA 4RI0A 4Q2KA 1AZ8A 1DSTA 1SHHB 1Z8IB 3P8FA 2QXHA 3KF2A 2G00A 4ISIH 2VWMA 1OP2A 3EE7A 3UIRA 1V6DA 4MNYA 1ZMLA 2ZTZA 4XE4A 2GV7A 2ODQA 4F4OC 2JDID 4BNRA 2KAIA 2F3CE 2VIPA 2AGIX 3LONA 3PMAB 2O8LA 3DSPA 4MQAA 5T3HA 3MOCA 1JBUH 4WJG2 5K7RA 4DGJA 2V3HH 3U1IB 4I31A 3N7EA 3FAOA 3HK3B 1PQ5A 1G32B 3MNXA 1JMOH 3RXLA 1AKSA 3S0NA 1P2IA 4OS5A 1SSXA 2C90B 1PYTC 5GXPA 1W11U 4AN7A 4AORA 5DP9A 3GY5A 1O2ZA 3KQ5A 1C1OA 1SLUB 2SGFE 3QLPH 3KYFA 2PUXB 1QRWA 3WY8A 1SGNE 1EAXA 4X6NA 3T29A 5C1UA 3JZ2B 4MNVA 1GJCB 1YC0A 2RA0A 2GCHG 5HM2A 1YPHC 1O34A 2ZO3H 4ZXXH 1YM0A 4FUHA 1BT7A 1ZOMA 5GJ4B 2ZA5A 4HG6A 1P12E 2GDDA 5AHGH 1T32A 2CV3A 3N7OA 3ZZBA 1RTLA 4FUJA 1JIMA 5C5NA 2OINA 4JZDH 1D4PB 2AMPA 1OP0A 1DXWA 2I6QA 1O2WA 1YPMH 1O31A 1NFUA 1ZHMA 3E6PH 3EA8A 1ARCA 1GDUA 4O3TA 3UREA 4JMYA 1FY4A 1V2JT 4M9FA 1YP9A 1YWUA 4RN6A 4CHAB 1BHXB 3TK6A 2R2MB 1DM4B 4E05H 4X1NU 3LJOA 1DY8A 4B1TA 5J4QA 1BJVA 1NBME 3UR6A 1O3BA 1AZZA 1C5NH 1HB0B 1P57B 2KCAA 4GHTA 4LK4A 3A7VA 3EYDA 2BY7X 2DE8A 4YOGA 1C4V2 1RRKA 2GTBA 4AYYB 1V2UT 1E38B 1QURH 2WUCA 2XWBI 1EB1H 4KTUA 3GS9A 4UFGH 4YXWD 1YCPH 4GAWA 3PTNA 2BD9A 2K8IA 4TSFD 1GGDB 3RDZA 4GCHG 3ZVGA 3SBKA 3ATMA 2CJIA 1CQQA 2A4OA 4X6MA 2XCFA 3DSOA 3UNQA 3PO1B 3MU4A 5EQQA 1LVOA 2W5EA 1V2ST 3ZZ5A 1QQ4A 3KQBA 2F9UA 2GMTB 2WYJA 4A1VA 4F49A 2GJGA 1C1UH 1THSH 4I33A 4OS7A 3ATKA 5FPSA 2Z7FE 1TYNA 1QJ1B 2RDEA 4O03A 2J97A 3V3MA 1VR1H 1AFQB 1SGFG 2F91A 1ZHPA 3AW0A 1IQIA 3M3SA 4NA9H 3A82A 4CR5A 1Y59T 3GY3A 1IQLA 3M35A 1CGHA 1EJMA 1ZRKA 1NZQH 2XTTB 2VNTA 1BZXE 3CS7A 1MD7A 4Y8XA 1OS8A 2BMGB 3D65E 1GCTB 1O2LA 2H1UA 3QTOH 3Q00A 4Y71A 1A5GH 1SGRE 2Z9GA 5BPEA 1OP8A 2KR7A 1O3PB 1HJAC 1A3BH 1T4VH 2A4GA 1BMFD 3STJA 1E36B 3K65B 3NZIA 1HXEH 3GCNA 4U30A 1EZUC 1F5KU 2AFQB 1BMAA 2IJOB 3M5OA 1P2OA 3TGJE 4AFZA 1O38A 1QFKH 3K2UA 4Q7ZA 4Q63A 2NU1E 4CH8B 1S0RA 2HOBA 3RM2H 2OC8A 2BXTH 1SGEE 1PQAA 5ABWA 2FM2A 3K6YA 2ZI2H 3PYHA 1BBRK 1SGYE 1P2NA 1TNIA 3KNXA 1MTVA 1MTWA 3OSYA 1ELBA 1V2VT 3IITA 1QTFA 3RMOH 1LHEH 2KX4A 2Z3EA 1SGQE 4AGKA 1SQAA 1ARBA 2H9TH 1FAXA 2ALPA 3P6ZB 4MVNA 3GCTF 2G5VA 5JB8S 3E0PB 3RXDA 1QRXA 1OOKB 4X2YA 4WXIA 3ODFA 1GBFA 3DD2H 3I77A 4X2VA 1KXFA 3UQOA 3TVJB 1P01A 2JH0D 1O32A 2FX4A 1O3KA 2G52A 2TGAA 3RU4E 1XM1A 3KGPA 2GZ7A 4OS4A 3KQEA 1IOEA 2ZFPH 4VGCB 1XUIA 1EJNA 5E8EH 2ULLA 5LPFA 1ELAA 2ZHWH 1B5GH 5GCHG 4BAOB 8KME2 8GCHG 3L3TA 3KHVA 1O2SA 2HALA 1LTOA 3E8LA 2PKSB 5JBTA 1C5XB 2XWAA 3A88A 1DT2A 1QIXB 5C5OA 4K8BA 2A7HA 1O2KA 3S69A 1TMUH 2ZHFH 1MKXH 5FCRA 3RLWH 4CRBA 3UWIA 3R3GB 2F9VA 1C5TA 3GICB 6LPRA 2ANMH 1C9TA 1ZHRA 5HM9A 2OC0A 1TBZH 4FOUC 5L2ZH 4X1PU 4YT6H 5T6FA 5EODA 4GSOA 2GVFA 2OD3B 2GV6A 3CENA 3H7TA 4X8UH 1EJAA 3VB6A 5C1XA 1PPZA 3SOSA 3SQEE 3F9EA 1IQKA 4Q4LA 1C4Y2 4XFQA 2OC7A 1GMHF 1HFDA 3AW1A 1QA0A 4CBNA 4MPUA 5GNDA 9LPRA 1W0KD 1GVZA 3BG8A 4OGXA 1GBKA 3H7OA 1ZPZA 3M3TA 4LXBH 5A0AE 4DVAU 1BRUP 1P03A 5JDUB 1P9UA 1TX7A 2Y7ZA 3DT0H 4ABFA 1AFEH 2GCTB 2QIQA 3RXUA 4I8LA 2I6SA 1TPSA 3LGUA 2A2QH 1MMJN 4O9VA 1LVMA 5GWZA 1QGFA 3E91A 2Y5FA 2FPZA 2QCYA 1GHYH 2STBE 3GCOA 2ZG0H 1UVTH 2EEKA 2P3UB 4X8SH 4ABEA 1WBGB 3A85A 1CT0E 2AHME 4OM9A 5LPEA 3PMBB 3NRLA 1CO7E 5C1YA 1WQSA 2BOHB 1GHZA 3QN7A 5TCCA 1NPMA 4J1YA 1MCVA 2F83A 2OTVA 3A80A 1S84A 4MNWA 2QA9E 1E35B 2HLDD 3FZDA 4WWYA 1N8OB 1YPHE 3SU1A 4ACBA 1AIXH 2PV9B 1VCQA 1NT1A 1ESBA 3ATWA 5DGJA 4QT8C 1IQHA 1CA0B 1DLKB 1GG6C 2ZU3A 1DWDH 1IQGA 3F6UH 3AAUA 4FU9A 2TBSA 2FS9A 2FYRA 1SVPA 1TNKA 2ZHQH 3A89A 2BDHA 2AYWA 2A0QB 3VXEH 2AGEX 1UCYE 3RXKA 1SG8B 1GBTA 4K1EA 1DFPA 3GYLB 2A7CA 5DG6A 2ZC9H 1A61H 3A8DA 2NU4E 1NRQH 5EU8A 3BIVH 4IGDA 1SR5C 4BAQB 3Q3YA 1SGDE 1ELTA 4INHA 4NG9H 4SGAE 1PPEE 4CR9A 5JBAS 3A8BA 1VJAU 1W7GH 4KTSA 3F2FA 3MO6A 2O9QA 2XXLA 3EA7A 3EE0B 2P8OB 3A7WA 4RKOB 5EW2H 1TX6A 2PKAA 3T2NA 1DUAA 4YT7H 3MFJA 2WPJS 2WINI 1A46H 5H4IB 1AWFH 1C9PA 2BYAX 3RXBA 4CRDA 2WPIS 4SGBE 5LH8A 3FP6E 1GCDA 2UWLA 1GMDF 2W26A 3RC6A 2BDYA 1UTOA 2H9HA 1AO5A 1X7AC 2UUKB 1T8MA 4YO9A 5A0BA 1Y3XA 3TLOA 2XYAA 1LPGB 2ZZUH 1O2NA 1G3BA 1UK2A 2J92A 3A83A 1O5AB 2W7SA 3LJJA 3NUMA 2ESTE 3TGKE 1EAUA 5L2YH 1G30B 2C4FH 3MH4A 3ZZ3A 1EPTB 5C0UA 1O3AA 5IDKA 3TH4H 2O8UA 4CHAC 1VGCB 2G51A 1THRH 4AOQA 1TPOA 1LVYA 1TPAE 2KAIB 2BD7A 2YNBA 4XDEA 1LPZB 1DOJA 1LKBA 1FONA 3LC5A 3TH3H 2OUAA 3ZZ8A 2FP7B 1BIOA 1ESTA 1TGBA 1KLTA 4E7NA 1Z6EA 3CNRA 4ISLA 2P3FH 1KYNA 1AKSB 1C1MA 4JK6A 1P0SH 2PGQB 1OKXA 3U28C 1GGDC 1GI0A 1BTPA 1K1JA 1SFQB 2IOTA 1XVOA 1BTZA 3SNCA 3PO1C 1GHBG 3VB5A 3P8NA 1MBQA 3GDVA 4AZ2B 2R0LA 1FIZA 4D8NA 2GMTC 1OWEA 2F9NA 3PMHB 4NZLA 2FDAA 1CT2E 1YGCH 2UUJB 3UOPA 1DITH 2XOKD 3PV2A 2ALVA 1HAXB 3RXFA 2WUBA 2Z9KA 3RXTA 1W7XH 3MWIU 1M9UA 1TNHA 1V2PT 1AVXA 1AUJA 1GHAG 1AU8A 4FUEA 1O5DH 2ZU1A 3LC3A 3UNRA 1VITG 1O3DA 2CMYA 3TGIE 1DUEA 1O30A 3HKJB 5DN6D 1H4WA 2B0FA 2ZU2A 1GCTC 3MU0A 1YKTA 3OY5U 2ZHEH 3MO9A 3HPTB 2XC5A 1UTPA 1QCPA 3QX5H 5HYOA 3SU6A 2PW8H 1Q2WA 3BTDE 4U01A 2THFB 1K21H 4R8TB 4X2WA 2LNCA 2BY5X 2BY8X 1FXYA 4FUIA 1GJBB 1QBOA 1O2VA 1YCPK 3N7DA 2EQNA 1EX3A 2ZFQH 4AFQA 1ANEA 3F9GA 1W13U 3UQVA 4IC6A 1J8AA 1UK3A 2O8TA 3NXPA 1ETSH 3SV7A 4XBBA 2QF5A 3P8GA 2VH0A 3ZVDA 3SI3H 5A8ZA 2VU8E 1P8VC 2D26C 3ZYEA 1BUIA 1KXCA 1TE0A 5EGMA 1DPOA 3SU2A 3ZZCA 1KLIH 1DLEA 3RXIA 2BQ6B 3Q3KA 3PMJA 4LZ1H 1ZJKA 1IHTH 4MDSA 4MPVA 1JRTA 1ANDA 5G4BA 1ETRH 1O2MA 3UPEA 3P70B 2IN2A 4K60A 1HIAA 5EIYA 3KQDA 1LQEA 4VGCC 1EATA 1MTSA 6ESTA 4TPIZ 3LPRA 3WWBA 2B5TB 1KXDA 1TX8A 1O3CA 1HAIH 2P94A 3ZYDA 2PKSC 3M5NA 2Y7XA 3B8JA 1E0FD 4X1RU 7GCHF 4CRGA 1FNIA 1OHHD 2SNVA 1CSOE 1C1NA 1AQ7A 2JH5D 4ZKOU 2ZCHP 2FTMA 1RIWB 2ANKH 1J15A 3LOXA 2CXVA 3VG8A 4DOQA 1O3HA 4NA7A
chains in the Genus database with same CATH topology
3LKWA 1AN1E 4H6TA 3ENSB 1HYLA 8LPRA 2BQ7B 3UUZA 3M5MA 5FPTA 4FVBA 1KDQA 1GMCF 2OBOA 1HAVA 3RLYH 1BRCE 1EQ9A 3QZRA 3QGNB 3BEIB 3A7YA 1AY6H 5DK1A 1C5YB 3ZVAA 2BTCE 2BZ6H 2M5TA 1GJAB 1HAHH 3BTKE 1O35A 3RXAA 2WYGA 2ZECA 1LCYA 2D2DA 2GCTC 5LPRA 1Y5UT 4CREA 3RXSA 4I32A 3ZZDA 1TPPA 1XX9A 5C67A 4WXVA 1O3GA 2SFAA 3RXOA 3SV6A 4WY3A 4A1TA 2ZEBA 2ZU5A 1QL8A 2RCEA 5DO4H 1AUTC 3LU9B 3SU0A 1MQ6A 1RD3B 4Y7AA 2WPMS 2HRVA 5AFYH 2G8TA 4LOYH 4AGJA 2VIQA 4D9RA 1Y3UA 1MKXK 1YCPM 1P2MA 1N8OC 5HMAA 1BTHH 1Z1IA 2WV4A 3SNDA 3ESTA 1CA0C 1EOLA 1P9SA 2W3IA 2NU0E 1C5OH 5K0HA 5ETXA 2CHAC 3MNSA 2ODPA 1A5IA 2GT8A 1MTNB 1O2IA 1YBWA 4HFPB 4KELA 1O2XA 4CRFA 3I29A 2PSXA 4K1TA 4KTCA 1WOFA 3NPSA 1C2LA 1BCUH 3BTFE 4TY6A 1DX5M 1O5GH 3RMLH 2FIRH 2GP9B 2GKVE 1FN6A 1ABJH 3HGPA 1MAYA 3UY9A 2QY0B 4TYDA 4Y11E 3VB3A 3M7QA 2P8OC 1K1OA 3GY8A 5T6GA 4MTBA 1FZZA 1QBVH 3S7KB 2WV5A 2ZP0H 3EAJA 5ESBA 1Z6JH 3FZZA 1HXFH 1ELVA 3MH6A 1CHOF 3C27B 1KTSB 3S9BA 3V13A 4ABBA 2R3UA 3GCTG 3H5CB 2AS9A 3LGIA 2DUCA 1DY9A 2RA3A 5B6OA 2J9NA 2OXSA 3BSQA 1RTFB 2FOHA 1SLVB 1LMWB 1K22H 3FP8E 1FY5A 1P02A 5E2PA 3RXVA 1J17T 2A5IA 3BTME 1WTHD 1FY3A 1EPTC 3E0NB 2VJ1A 1C2IA 1EZXC 4B2AA 2Z9JA 2EC9H 4UFFH 3DFJA 5CE1A 4FU7A 4Y76A 1SFIA 3GY2A 3ZZ9A 1GDNA 1K9OE 1SMFE 2C3SA 4WVPE 4AB8A 1VGCC 4DJZB 2G5NA 4YLUA 1JXPA 2ZDLA 3VB7A 2P59A 3MI4A 3RUOA 2OCVB 1V2MT 1CA8B 1OWIA 2Y82A 4BAMB 1ZTKA 5EXLA 1EUFA 1TIOA 6GCHF 3NKKA 1ZR0A 2QV1A 3PWCA 4JYTA 3RXMA 2FTLE 1LHCH 2JETB 1FY1A 2PKAB 4ZKNU 3EDXB 2CF8H 3LH1A 2A32A 2ZFSA 4AX9H 1SOTA 1T8NA 1YPKH 4DCDA 1XUGA 2PHBA 2HNTF 1FPHH 3GISB 5DKMA 3SHAH 2BLOA 1GMHG 1P05A 3MU8A 1O5EH 1UHBA 1KSNA 2AIPA 3IWMA 4B75A 3SGBE 4I8HA 1O2JA 2GDEH 3RXRA 1F0SA 4BXWA 3RU4D 2FS8A 1CGJE 2V3OH 2SNWA 1QBNA 3O8DA 4NIVA 1KTTB 1ZSKA 4ZHLU 3SU4A 2Q6DA 1PPGE 1EAIA 3MNCA 2R9PA 1TGCA 1TBRH 1T7CA 2VWNA 4U32A 3S7HB 3GDSA 1KXBA 3BTGE 1D3DB 3LH3A 3U8OH 3V7TA 1G36A 1DWCH 1H9HE 2QC2A 1DVAH 1XUHA 3VXFH 3GDUA 2CN0H 2BX3A 3SNEA 1L4ZA 1UCYH 1S5SA 3ZZ7A 3GY7A 1A2CH 1MKWH 4DURA 1DE7H 5FBEA 5DP7A 1SQOA 5C20A 3SU5A 3DHKH 2PUQH 4OGYA 1O2PA 2A4QA 1V2OT 5C2ZA 1PQ7A 3W95A 1OXGA 1BQYA 4X8TH 2FX6A 5AF9H 1C1PA 1PJPA 2BD3A 4GHQA 2VGCB 1O3JA 2GD4B 4TWYA 2AMDA 2ODYB 3SGQE 1FJSA 1FY8E 4Y0YE 1MBMA 1GJ4H 1SGCA 3PTBA 1YPLH 4HI3A 1SB1H 1HPGA 2G4TA 1BHXF 1RGQA 4YOJA 1HAYB 2GZ8A 1GJDB 1O36A 1C4U2 2WPKS 5FBIA 3M36A 1Y5AT 1C2DA 1PYTD 4DY7B 1C5RA 1JIRA 2V6NA 1VCWA 1NESE 4FU8A 5F8TA 1K28D 1O33A 3QUMP 1OYQA 3GY6A 1GMDG 1QJ6B 2B8OH 1SGTA 4Z6AH 5TJXA 1RIWC 1C1QA 1XXDA 1ZGVA 1LDTT 1K1IA 4OS2A 1DSUA 3T28A 2CHAB 1B0EA 1GHVH 1ZYOA 3SZNA 2A31A 3L33A 1H9LB 4NFEA 4ABDA 2A45B 1NFXA 4IN1A 2H9EH 3QK1A 3PLPA 4BAHB 1FAKH 4AFSA 1WAYB 3MO3A 1V2RT 1TOCB 3HATH 5EW1H 3M5LA 1ZSLA 3CS0A 2Q1JA 2TGTA 3QWCH 3D49H 4NCYA 1HDTH 2FODA 1G9IE 3D62A 1A5HA 3PLKA 1P3EA 1L1JA 1ZMNA 1BTUA 1LVBA 3A84A 7ESTE 2EA3A 3SUGA 3SNAA 2BLQA 1GBLA 1Q3XA 3MMGA 4D76A 3LIWA 3BV9B 4ZH8A 2OLGA 3U98H 1ETTH 1IQMA 4D7GA 2WPLS 1TOMH 3ZVCA 3GOVB 4NA8A 2C93B 3OY6U 5A8XA 1MUEB 1T8LA 5F8ZA 1PPBH 1GJ5H 1CHGA 2HWLB 1KLJH 3U69H 1S83A 3M3VA 1LO6A 2VINA 3RXJA 3ZZAA 1C5WB 2XC4A 1P10A 4AYVB 1BTYA 1E34B 2GZ9A 6CHAB 2YOLA 2J94A 2XNIA 1MTNC 3SGAE 1TGNA 3ZV9A 1P2JA 1ORFA 1YPJH 3HKIB 1EOJA 2WPHS 2FI4E 3STIA 4AB9A 5ESTE 3RXQA 1KDQB 5DP8A 1TONA 1HAVB 2ZTYA 1SI5H 1GL0E 1W0ZU 1YPGH 4A1XA 2BVSH 1C5LH 2J38A 4ZXYH 1CBWC 3OTJE 1QNJA 1N1LA 2PTCE 3A81A 1KIGH 3BF6H 1TMTH 2BY9X 1IQNA 4I8KA 2ZGXH 1FN8A 2AERH 1K1NA 4M7GA 1GI3A 3K6ZA 2PWXA 1TRNA 4UD9H 3MYWA 2FOEA 3ZV8A 3LGYA 4ISNA 1O3EA 2P93A 5EQRA 2RG3A 4AG2A 3RU4T 3BEFB 3PLBA 3PV4A 4IC5A 4WH8A 4IS5A 2ZFFH 1OWHA 1IQEA 1TABE 1AMHA 5F8XA 1GJ8B 4YTAA 1H8DH 1TBQH 3FP7E 1BMMH 1BBRE 1D3TB 4NWLA 4ZKRU 5E0JA 1V2KT 3ATIA 1MH0A 2H5CA 2R3YA 3OX7U 4BTTB 4MPXA 2VVCA 1F0RA 1QY6A 3TH2H 1HAPH 3T62A 1WUNH 5JYIA 4YM9A 3F68H 3EA9A 4MPWA 1VJ9U 2ZQ2A 2BDGA 1G3EA 1Z1JA 1FUJA 1RTKA 1SC8U 3O8RA 3SJ8A 2FLBH 3SU3A 5CMXH 3PWBA 5I46H 2A4RA 1UVPA 1CVWH 4ESTE 1L1GA 1RXPA 3BTEE 4NIXA 4WMEA 1AB9B 3QDZB 7GCHG 1OYTH 1SL3A 1CGIE 2ZTXA 4H6SB 1UTKA 2R0KA 1XUKA 1H1BA 1Y3WA 5FXLA 1L2EA 4E06H 4X6PA 3FVFB 1TMBH 4K8YA 4IW4E 2JETC 3BEUA 4BOHA 1D3PB 3RC5A 1F0TA 1DS2E 3SQHE 2ZCLP 1OWDA 1Y5BT 1GMCG 7KMEH 1A4WH 1GBBA 3B9FH 4WMFA 4IN2A 1YYY1 4FVDA 3TNSA 4KKDA 1TNGA 1T31A 2IPHA 1G3DA 1GVLA 3VEQB 2C8WB 5GPIB 1Z8RA 1ZRBA 1RS0A 1ID5H 1P2QA 1EZQA 1H8IH 1C1TA 2BB4A 5EPNA 1L0ZA 1INCA 2P16A 4WF8A 1C5QA 1SGPE 1GBEA 1O5BB 1O5CB 3QGJA 1LKAA 1Z8JB 2FEQH 2VVUA 3S9CA 1S6HA 1G2LA 1OPHB 1O39A 3M37A 4NZQA 2XCNA 2QXIA 3ZVFA 2FZZA 5JB9S 4A7IB 2AGGX 3BIUH 3FFGA 1MCTA 1O37A 1PFXC 3LT3A 2G55A 2PTNA 3HK6B 2TGDA 1C1RA 1ZLRA 1O3IA 4ISHH 3TK9A 4INLA 2OQUA 3TJUA 1TQ0B 2J34A 1DWEH 1UO6A 5JBBS 2NU2E 3MNBA 2ZWLH 3T5FH 4IMQA 1HV7A 2ZF0H 5AFZH 2F9BH 4FUGA 5FX6A 4NIWA 2BQWB 3BN9A 3E1XB 3SORA 2JH6D 2NU3E 2FMJA 3U1JB 5A09A 1TNLA 1GI9B 4AFUA 5DP3A 4BTUB 4PROA 1TA6A 3O8BA 3O8CA 2AIQA 1UHBB 5LGOA 1JWTA 1BRBE 2VGCC 9ESTA 1LHFH 1CE5A 1FPCH 1S0QA 1O3OA 1QL9A 2PLXA 4NGAH 4Y6DA 2FOAA 4AG1A 3HGNA 5GIBA 4ZMAH 5FPYA 1HAGE 1NO9H 3AAVA 3OYPA 1A0JA 3A7XA 1NRNH 1D9IA 3QO6A 4MLFB 3ITIA 2FOFA 1WSSH 4ISOA 1P11E 2SGDE 2Z9LA 1C1SA 4Z0KA 3UOUA 2F9OA 1J9CH 1O2RA 5L30H 2OP9A 1S85A 1CHOG 4Y0ZE 5DJ7A 4E7RG 1VCPA 3QTVH 5PTPA 5EG4A 1O3LA 1TGSZ 2PFEA 1EZSC 1IQFA 3KEEA 2BD2A 1BMNH 4I8JA 4ZHAA 1UCYK 4DT7B 1GBCA 1TAWA 7LPRA 2ILNA 1MKWK 4GLYA 4GPGA 1WYKA 2VH6A 2V35A 1O2GH 2EI6A 3KCGH 1GBAA 3URCA 4TPYA 1ZGIA 2FESH 3DUXH 1KXAA 3SV8A 3V0XA 1CBWB 5FHTA 4A6LA 2B7DH 4X8VH 1FI8A 1GI8B 4ZUHA 1GPZA 3E3TA 5DP6A 4RSPA 1AHTH 5J4SA 3ZVBA 2OQ5A 1EXFA 1P04A 1QA7A 2R2WU 2ANYA 1TRYA 1DXPA 2BOKA 1O2HA 2H2ZA 3KIDU 1K1MA 4ZHMU 3M7UA 2D8WA 4YZUA 4DIIH 1QB9A 2XBXA 1MTUA 3T27A 1WTGH 2Y81A 2ZQ1A 3T26A 6GCHG 2VIDA 1BDAA 1BITA 1NC6A 1PPFE 1S81A 2B9LA 4ABJA 2BHGA 4KGAA 3I78A 1CT4E 4H4FA 1C2HA 1F92A 5DP5A 4XBDA 2QAAA 2FLRH 4JZIA 2ASUB 2P95A 3TIUA 3UWJH 2RDLA 4INKA 2GCHF 1GJ9B 4CRAA 1V2WT 3U8TH 2BDBA 2C8YB 3U9AH 4ABIA 5DPAA 1MU8B 1V3XA 1V2LT 4UFDH 4XOJA 2DE9A 3Q3XA 5SGAE 3SN8A 1A0LA 3A8CA 3ATLA 1ESAA 3TJNA 1GHWH 3K9XB 5HXFA 2W3KA 3GCHC 3Q77A 2CGAA 6CHAC 1V2TT 5BRRE 4JZFH 4JCNA 3SJKA 1G37A 1NY22 2BD4A 1THPB 2VIVA 1ZPBA 3SJIA 1O2QA 1A3EH 1AE5A 3SW2B 2J4IA 1XKBC 2XRCA 1SLXB 2BLWA 4B74A 1LPKB 1LHGH 1AI8H 1C2GA 3BG4B 5E2OA 1F5RA 1ELGA 3SI4H 3RXCA 1FQ3A 1MU6B 1C1WH 1AD8H 2HLCA 1O3FA 1ZZZA 1YF4A 4NIYA 1XMNB 1E37B 1C2FA 1ZPCA 4YLQH 1MD8A 5F03A 1JOUB 1TLDA 1H9IE 2FOCA 2BM2A 1HUTH 5EPYA 1N6XA 1LQDB 1XUFA 2FI3E 1NRPH 1UK4A 1UMAH 4GCHF 3OU0A 1TQ7B 4X2XA 2GX4A 1W0YH 2BDCA 3SJ9A 1IAUA 4TY7A 3KL6A 2STAE 1HNEE 2ZPQA 1UTMA 1RJXB 3S9AA 3ELAH 1YPEH 3B23B 1SGFA 3RMNH 4YOIA 4O97A 1C2JA 4K2YA 1KY9A 1XXFA 4UFEH 3JZ1B 3DFLA 4RKJB 2A7JA 4K69A 3PB1E 1NROH 3F1SB 4FUCA 2FXRA 4FUBA 3A86A 3VB4A 1UTNA 2A5AA 3ZZ6A 3ZZ4A 3TPIZ 1SQTA 4K3JA 4UEHH 5DP4A 2HPQH 4LZ4B 2Q6FA 1HBTH 1ABIH 1WQVH 4B2CA 1HCGA 1FMGA 5CHAB 2AMQA 5GDSH 5A8YA 1SHYA 2ZHDA 1GBMA 1EKBB 2HVXA 4CH2B 1C2KA 1NM6A 4FXGH 1SBWA 1AB9C 3IG6B 3RXGA 2F9PA 1BRAA 4R0IA 3RXHA 2XBVA 3MH5A 1NTPA 5I25A 5TCAA 1O2UA 1W3CA 1C2EA 2AEIH 2XBWA 3FANA 1GI2A 5JPMH 1O3MA 1J14A 2BY6X 5EQSA 1BMLA 3ODDA 1ZMJA 4Y10E 1QB1A 2BVXH 3A7TA 3PM3A 1HGTH 1UTQA 2OBQA 3VGCB 2J2UA 5EXNA 3SJOA 1DDJA 1W2KH 4Y8YA 3M61U 4THNH 4ABAA 1B0FA 1WU1A 2BDIA 2V0BA 1VITH 1HLTH 1HJ8A 3P95A 4WMDA 1NRRH 1VZQH 4FUFA 1B7XB 1L4DA 3UFAA 1XUJA 4JYVH 3SUEA 4D7FA 1ACBE 1KXEA 2VIOA 1EP5A 3TJOA 3F9HA 4JK5A 2VWLA 2OC1A 3EQ0H 2A1DB 3RXEA 2H5DA 1Y3VA 1YLCA 3AASA 2TRMA 2O8WA 1A7SA 4Q80A 1P06A 4ASHA 3LDXH 1EAWA 5GCHF 1DICA 8GCHF 5L6NH 3L6PA 1OX1A 3LGVA 3R0FA 2Q6GA 3NCLA 3LGTA 1F2SE 2HGTH 3GYMA 1C5MD 2G81E 1UTLM 5FCKA 2HPPH 4X0WU 3G01A 4NFFA 1TRMA 3NWUA 2ZFTA 4UONA 4OS1A 1EB2A 3SV9A 1Z7KA 1UVUH 3E16B 2UUYA 4NSYA 1S82A 2QGRA 1HRTH 1Y8TA 1F7ZA 1ELCA 1N6YA 4JZ1A 2HNTC 5T6DA 5FAHA 1BTWA 4Y79A 1BTXA 2BD8A 2ZIQH 4BAKB 4IBLH 1P2KA 1AE8H 4DIHH 3URDA 3T25A 1GVKB 3MU5A 4CBOA 1MAXA 1O5FH 1DANH 1A0HB 2ZGJA 1WCZA