1GBTA

Structure of an acyl-enzyme intermediate during catalysis: (guanidinobenzoyl) trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Structure of an acyl-enzyme intermediate during catalysis: (guanidinobenzoyl)trypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(serine proteinase)
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbtA02
2A7HA 1O37A 1EP5A 5C1XA 2VVVA 3CS7A 4E7RG 2JH6D 4ISIH 3PMBB 3MU8A 2K1QA 5DJ7A 3M5MA 4TPIZ 2BVXH 3BIUH 5HXFA 2OP9A 2PR3A 1O5EH 1K1PA 2B5TB 1NFYA 1T7CA 1UJ1A 1S5SA 2Z9LA 3A7YA 3A89A 2QCYA 1T8OA 1HAPH 5JBTA 3CENA 4AFUA 2PW8H 4B73A 2ZCLP 1KXDA 2OCVB 1EKBB 4JK6A 3RMNH 2ZEBA 2FX6A 2O9QA 3SNAA 1OXGA 3SU2A 1J16A 1N6XA 1SLXB 1GHXH 1V2LT 1MAYA 1QL8A 1ZPBA 2LPRA 2R3YA 1GI0A 2EI7A 4Y0YE 3TGKE 1O5CB 1SGPE 4BAKB 1YPKH 1BMNH 1GCTB 1W3CA 1KY9A 4X0WU 1SGIB 1F0UA 1C5XB 1SGCA 2PV9B 3A8BA 2BLQA 2GKVE 2GZ7A 1CVWH 2P94A 3UQOA 5SGAE 1A3EH 2WUCA 2HWLB 1XMNB 1TFXA 2NWNA 3K6ZA 2C8WB 4WXVA 1S81A 5DP6A 3ZV8A 1HYLA 4I8KA 1BMLA 2BHGA 4MDSA 3BG4B 1BUIA 1A0LA 3N7OA 1SG8B 2F9BH 1GHYH 1UVSH 4GVUA 2Z9KA 3AAUA 1LKAA 3FZZA 4NSYA 3ZZ5A 1G2LA 3FFGA 4X1SU 5LGOA 5GCHF 1K1MA 4IC5A 4ABAA 1LHEH 2FOAA 2J34A 4X2VA 1UMAH 3C1KA 1EPTC 1G36A 3GY6A 1BA8B 1ZHRA 3ATMA 3TK5A 1K28D 1A7SA 1KTTB 2BZ6H 4AFQA 2A7JA 2WUBA 1HAGE 1PPHE 2ASUB 2O8LA 1GI4A 2I6SA 3RXOA 4CRFA 1GBBA 4Q80A 1PPEE 3RMOH 4TWWA 1AE8H 2A4RA 2NU0E 4I8GA 3SN8A 4CBOA 3V13A 4D7FA 3FAOA 1ESAA 2P8OB 4TYDA 2SGAA 2OC7A 2QF3A 1PYTC 2GD4B 2ULLA 1EPTA 4XBBA 3RU4D 1AUJA 1DT2A 4DT7B 1C4Y2 5GPIB 3ESTA 3BTGE 1VJ9U 4J1YA 1FZZA 3L33A 1THSH 4TY7A 1N1LA 3RXVA 2WPKS 3P92A 3EE0B 2ZPQA 3GCTF 1VITF 2GCTC 2VINA 3C27B 1ZR0A 1BBRH 2RCEA 2OD3B 4YT6H 6CHAC 2QV1A 1TNLA 3M5LA 1XUHA 3TJOA 4JZEH 2V0BA 3ZZ6A 1P2OA 1C2HA 4MPXA 3VB3A 1IQLA 3RXLA 3Q3XA 4KTSA 1G3EA 1S0RA 5BRRE 1DWBH 5G4BA 1C1TA 2HGTH 1RTLA 1EB1H 2BXTH 1SLVB 3LGYA 1Z8RA 3LH3A 1FUJA 2PSYA 3ZZ9A 1OYTH 1Y3YA 2B7DH 1D3PB 4GHTA 3LGTA 1LDTT 1V2PT 2GP9B 4AG2A 2STAE 3D49H 3TPIZ 2SNVA 1ZOMA 3T62A 5C2ZA 2EI6A 2A2XH 3A8DA 2AGEX 1O0DH 2O8MA 3QDZB 1MU8B 4O97A 1JMOH 1E38B 2QYIA 3SUFA 3ZVAA 3ELAH 2G5VA 1GCDA 2ODYB 3A86A 1RFNA 2SNWA 1BCUH 2AMDA 2FTLE 5BPEA 1BRAA 1SI5H 4MQAA 1ZTJA 2FOHA 3A85A 2FLBH 4UD9H 5EGMA 1ELDE 5ESBA 2H5CA 4KGAA 1ELVA 3MHWU 1QQUA 1GDNA 1P11E 4JK5A 1NTPA 1AHTH 1GI2A 3SV9A 1GVLA 3M5NA 1ZHMA 3KQCA 2SGQE 8GCHF 1BB0B 3A82A 1QRWA 2ZFPH 4NFFA 2FWWA 1G3BA 2BOKA 1Z1JA 3ZVCA 1BDAA 1GMCF 1P02A 3BG8A 3H5CB 3PMAB 3SU3A 1GMHF 1J15A 5EQQA 1OWJA 1VITH 1MTSA 2WINI 3SUEA 4LZ4B 3ENSB 3HGPA 2J38A 5JBCS 1ZHPA 1ANEA 2O8WA 3U69H 1UHBB 1VCWA 3F9EA 6GCHF 4ABJA 6LPRA 1SQTA 4ABHA 4INLA 4K69A 3LC3A 1EJNA 1IQNA 4WXIA 1LHFH 4WVPE 1O2OA 1K1NA 4WMEA 1C1MA 2CXVA 2RDLA 3MYWA 1V3XA 1FAKH 1F5LA 2PKSC 3D65E 3K6YA 3TH3H 5C67A 1GBCA 1UTPA 2ZHEH 3Q77A 4DY7B 1D6RA 4K1EA 4KELA 3RM0H 2GT8A 5ABWA 4I7YH 1FIWA 1FV9A 4H6TA 4UFFH 1AKSB 3V7TA 5DP3A 2AEIH 1LHGH 2ODPA 1GCTC 2FTMA 1Y5BT 5ETXA 3BTTE 2XWBI 3RXPA 2GGVB 1SQOA 4MNYA 1DY8A 4CREA 3RU4T 1NFWA 2CN0H 5AVDA 3VB7A 1QL9A 2B0FA 1C1VH 1W11U 5JBBS 1S85A 1C5RA 4K2YA 3P95A 1ESBA 2ZA5A 1BTZA 1MTVA 1AQ7A 1F0SA 1UCYE 3A7WA 1P57B 3NK8A 2ANWA 4D7GA 1NESE 4DOQA 1SGFG 1AY6H 1H9IE 3E6PH 4B1TA 1ZPCA 4CRGA 1XXDA 3I78A 4U30A 5EU8A 3BG4C 1LO6A 5EPNA 1HAIH 2UUFB 1K2I1 5FX6A 1ZSKA 3AAVA 1RXPA 5DP4A 1GJAB 1OS8A 1DWCH 1MQ6A 1Z6EA 2IOTA 2PGBB 1SGYE 1XKBC 1SL3A 3TGIE 3MH5A 3M36A 4A1XA 1IQKA 3M7TA 2W26A 3PM3A 1DS2E 1DSTA 1LPZB 4FVDA 1TLDA 3RXUA 1MQ5A 4BANB 1HUTH 2J94A 1P2IA 3SU0A 2FYRA 3Q00A 5J4QA 4DVAU 5LPEA 4MPUA 1O32A 1V2MT 2EI8A 3AW1A 5E2OA 1NROH 1GVZA 5FHTA 3SGAE 3A7ZA 5EQSA 1BZXE 3LIWA 1TRMA 4NG9H 3QTOH 5E0JA 2BY9X 4Y79A 4SGBE 2P8OC 1UCYK 2G8TA 3TLOA 2FM2A 2BQ7B 4XBDA 4A1VA 2FS8A 4FUGA 2OBOA 1FLEE 2FMJA 1G3DA 3QX5H 3M7UA 2F83A 3OX7U 1KIGH 1D6WA 2ZGCA 1B7XB 1MD8A 2ZFTA 2XC5A 4Y7AA 1V2RT 5DO4H 5T6FA 1DSUA 1O5GH 3QZRA 5FBIA 1IQHA 3SU1A 4RKOB 4I31A 2G81E 2ZFSA 3OY5U 5JDUB 1GWAA 3SO3A 2BD8A 1HIAA 3MU0A 1GDQA 2G55A 2VH0A 2WYGA 4B2AA 2VGCB 1BMMH 2BM2A 5EOKA 5EG4A 1DUEA 2ZQ1A 4ZMAH 2BDYA 3TU7H 3EA8A 2A4OA 1F5KU 3F6UH 1O2RA 1O3FA 1SGRE 1P04A 4GCHG 1XVOA 3MH6A 2ODQA 1VZQH 1ZMLA 1K1JA 2ANKH 1RJXB 2HLCA 2ZDNA 3KQEA 1H9HE 1H9LB 3UNSA 2J92A 2TGDA 2VWNA 3VXEH 4IN1A 1TNKA 3K2UA 1LCYA 2VU8E 1AFQB 3UTUH 2G51A 4CR9A 1GBEA 1Z8GA 4XOJA 1MZDA 1PPGE 1Z71A 4MNXA 1AE5A 3QLPH 3TGJE 2BZAA 1QBNA 1AVWA 2ZC9H 3UNRA 1S83A 5DGJA 3V0XA 2J9NA 3OU0A 1YPEH 5DG6A 3LC5A 1Z8IB 4ABIA 5CE1A 4WMFA 1TOCB 2QA9E 3PB1E 5L30H 3S9AA 1HJAB 1YBWA 4NA7A 2F3CE 3DA9B 3KN2A 3TK9A 1W7GH 1SGFA 3GDUA 4J2YB 1QJ1B 2FOMB 2UWLA 1C9PA 1EASA 3DFLA 1HPGA 1QCPA 1TA2A 4B74A 1BQYA 4NIYA 1TGBA 5GJ4B 4D8NA 3TK6A 5GIBA 3UWJH 4X2WA 1GHBF 3U8TH 2ZP0H 3MFJA 3SNDA 1W8BH 1FN6A 1UTKA 1C1OA 2H1UA 1TYNA 1ABIH 2GTBA 5LPFA 1F92A 1P12E 1UVTH 1XUJA 1TWXB 3TH2H 1FPCH 3P8GA 1G37A 1K22H 1YPJH 1IHTH 1EP6A 2SGDE 3A80A 3EGKH 3TJUA 3F9FA 3SNCA 3NUMA 1QA7A 1M9UA 3VGCB 4JCNA 2WV4A 1W2KH 3E91A 1O2ZA 2FOGA 1HRTH 5I25A 2SFAA 1V2OT 2XC4A 2H5DA 1TPOA 4NA9H 5PTPA 4MNWA 5A0AE 3M3SA 2XC0A 1O2HA 5EODA 2TGAA 2BD4A 4HZHA 4IMQA 2P3FH 4O3UA 4THNH 4IMZA 1P2KA 2OTVA 2XYAA 1YLCA 1W13U 4CH8B 2VIPA 4ZHLU 2Q6FA 1SR5C 3TJNA 4AORA 3LGWA 2PSXA 1QA0A 2W7UA 3A7TA 1GBLA 4ZHAA 1ZGVA 3QGNB 4BTIB 3RXCA 2GV7A 1CSOE 3E0PB 4ZKNU 4IW4E 3RXDA 4TY6A 2ZFRH 1AB9B 2ZHWH 5E8EH 4KTCA 2A4GA 3A88A 4A1TA 1O5BB 2XBVA 1CT2E 3BTEE 2ZHQH 2FO9A 5A8XA 4CH2B 4YZUA 5JB9S 1FN8A 1TABE 5L6NH 3GY5A 3GYLB 4TPYA 1Y5UT 1VCQA 5EXLA 3CP7A 2FOCA 3T28A 3RXTA 4B2BA 1SOTA 4ISOA 1HCGA 1O2UA 2STBE 2CGAA 1HNEE 4GLYA 1ORFA 3MI4A 1GI5A 4FUIA 1INCA 1GI9B 3RLWH 3LH1A 3KGPA 3QK1A 4CRDA 4AYVB 4ZHMU 5T6DA 1NRPH 1DVAH 2ZTZA 1MAXA 1ZRBA 1P03A 1GJCB 4YTAA 1HAHH 1C2JA 2VNTA 1O2VA 1PQ5A 1AGJA 3LGUA 3M35A 3UOPA 3MH4A 3SJ8A 3O8DA 1O3CA 1ZGIA 4BAMB 2AH4X 1V2KT 1DLKB 3FP6E 4IBLH 1YPMH 3MO9A 1ELCA 1FPHH 1FY5A 3MU5A 2TRMA 2QC2A 1NRRH 4GHQA 4OGXA 3RXAA 2BLWA 1QURH 1YCPK 1HAXB 1CGHA 1A61H 1G3CA 2ZTXA 3SW2B 3MH7A 2Y6TA 1V2VT 4BTUB 1EX3A 1AMHA 1WQVH 1LTOA 1TPAE 5F8TA 4E7NA 1O2KA 1ID5H 4CRBA 1AI8H 1DWDH 1KXCA 3DD2H 2VGCC 1T4UH 4YM9A 1EAUA 2P93A 1O3LA 2WPIS 3E90B 2GZ8A 4XFQA 4ABDA 1A1RA 1N6YA 2IPHA 1TBZH 2A2QH 1KLTA 4RSPA 1O3EA 1O3AA 4X8SH 1ELGA 3F68H 1IQJA 1QB6A 5FX5A 1GVKB 1ZTKA 1W7XH 2TGTA 1YP9A 3SV7A 3Q76A 1CHOG 4ZUHA 3LGVA 5C5OA 1C5QA 1KDQA 1TRYA 3NKKA 5DPAA 1O38A 1ZPZA 3NPSA 1AFQC 1PPZA 1KYNA 1GI8B 1C5MD 1ZMJA 1V2JT 2C90B 4A5TS 4BAOB 1ZMNA 2ZKSA 2VVCA 1C5PA 1DOJA 2A1DB 3RMLH 2ANYA 1FY1A 2HPQH 2FOEA 1O2SA 7ESTE 3BTME 3KQBA 3MNCA 1HJAC 3EAJA 1WBGB 1AD8H 4OS4A 1MUEB 1A0HB 3GY8A 1GDUA 1XUIA 4ZXYH 1T32A 2ZECA 1O34A 1AVXA 4X8UH 3S9BA 1CBWB 3TJVA 8LPRA 2VWMA 3T26A 2FIRH 2ZU3A 1C2KA 4GUXA 1EUFA 1OSSA 3SJ9A 4X6MA 3K65B 1G32B 2TBSA 2AYWA 1P05A 2TIOA 3MNXA 4DURA 2BY6X 1LVBA 3Q3KA 1O2LA 1Q2WA 3DT0H 3RMMH 1C1QA 3SI3H 4AGKA 1PPCE 1GBHA 1GJ8B 3PV4A 4XSKU 3P8FA 2SGEE 3VEQB 3VGCC 2Q6DA 3NCLA 1ARBA 1P3CA 3BN9A 4MVNA 5EXNA 5GDSH 1NRSH 2CF9H 3HK3B 3KL6A 2F9VA 1UTJA 5EW2H 1Y59T 2R3UA 3H7TA 1EAWA 2ZFQH 1GJ7B 1O36A 1SPJA 1CT4E 2VVUA 5GXPA 1W14U 4ASHA 1GBKA 1TX7A 4CR5A 1HIAB 1TGSZ 1C2MA 2FS9A 3JZ1B 3OSYA 2XW9A 1UCYH 3SORA 1H4WA 1O3JA 1ETSH 3RDZA 4HTCH 3WY8A 2FI4E 2Y82A 4FVBA 3OY6U 1V2NT 1C2DA 1IQEA 1P2JA 1QNJA 3RLYH 3S9CA 2BY8X 4UFEH 3TIUA 1HAOH 4I33A 1NY22 1D3QB 2AERH 4LOYH 5JB8S 3ODFA 5F8ZA 5C1UA 1WCZA 1AB9C 2QXIA 5C20A 1KXBA 1P10A 2EA3A 1TPPA 4AX9H 1LVYA 4JZIA 3VB4A 1GJDB 3D23A 2AIQA 1FONA 2BVSH 1UVPA 2GDEH 5A0BA 1LPGB 1TGCA 1GBTA 4AGJA 2PUXB 1EZQA 4A7IB 1KSNA 1A3BH 4WJG2 3UREA 3TH4H 1BJUA 1SQAA 3RXBA 2BDGA 1QY6A 2FZZA 3BEIB 3GY7A 2ZU4A 1L2EA 1L0ZA 4F49A 1BRUP 3ZYDA 4FUCA 3U98H 1ARCA 3LT3A 3VPKA 4OS5A 1J8AA 2IJOB 3ITIA 1NN6A 2JETB 1IQMA 3SQEE 1K21H 3E1XB 4U32A 1QR3E 3KHVA 4UFDH 1MBMA 9ESTA 1XXFA 4AFSA 4DGJA 4NIXA 1O3MA 1RS0A 4Q7YA 1PJPA 1ANCA 1T31A 2OXSA 1O3NA 1GL1A 1TAWA 4K8BA 3M7QA 1MU6B 3LDXH 3PTBA 3M37A 2PHBA 4WF8A 4ISLA 4IGDA 1GI7B 1GJ9B 3HPTB 3P17H 2VIOA 1V2ST 3SHCH 1EAXA 1YKTA 1C5ZB 4X1QU 4XDEA 2V6NA 2QXHA 5AFZH 3VXFH 3T29A 2AGGX 2H9HA 1TE0A 5AFYH 2NU3E 3MO3A 2FP7B 4OS7A 3E0NB 4GPGA 1E35B 3IG6B 2A45B 5F03A 3SJIA 1RRKA 4X1NU 3ATWA 4JZDH 4OGYA 4FU7A 1BRCE 5CMXH 1O5FH 3SU4A 1A0JA 4Q7XA 1TOMH 5HMAA 1OX1A 1O2QA 1CHGA 1F7ZA 4FXGH 1BBRE 4R0IA 1O5DH 3LOXA 4ABBA 2VJ1A 2EC9H 4MLFB 3GCHB 3IWMA 3KIDU 4Q2KA 3V12A 2FEQH 2YOLA 2ZU2A 4K1SA 3K9XB 2ZI2H 1HAVB 1SGNE 1ZRKA 3BEFB 4B76A 1DX5M 2R0KA 2HRVA 3NWUA 1CBWC 1DM4B 2VWLA 5C3NA 1ESTA 2I6QA 1C5LH 1BT7A 3AVZA 1TBQH 4OS1A 2D8WA 1EXFA 1GMDG 3UUZA 2F9OA 1TPSA 2CV3A 2PTCE 1GG6B 4ISHH 3P8NA 1F5RA 3PYHA 2DE8A 3RXQA 3SV6A 1B0EA 5FPTA 3VFEA 4GCHF 2G52A 2A7CA 4JMYA 4X2YA 3UR6A 1C1NA 1FQ3A 4NZQA 1WUNH 3EDXB 1KXFA 1RTFB 4NIVA 4Z0KA 2XRCA 1IOEA 1DDJA 4XBCA 2GX4A 2PUQH 4XE4A 3U1JB 4MTBA 4I8JA 2OC0A 3B8JA 2R2WU 4INHA 1Y3WA 2Y7ZA 3QUMP 1Y3XA 4FUFA 2G5NA 3RXJA 2R0LA 3P6ZB 2CHAB 1GHAG 1KXEA 4K3JA 1IQIA 4WH6A 1HJ8A 3D62A 1P9SA 4DW2U 5JPMH 1FY8E 3GY4A 1YPHE 4NCYA 4UEHH 3MWIU 2D1JA 1CA0B 1DUAA 2XBWA 3NXPA 4Y8YA 1Y3VA 1THPB 2JH5D 2ZDAH 3F9HA 1HGTH 1OPHB 3FVFB 2HNTE 3E8LA 3PO1B 2Y81A 1H8DH 1SGTA 2FODA 1BMAA 1DXWA 2UUJB 1AZ8A 1JIRA 1EZXC 3M3VA 2C8ZB 1CO7E 1BJVA 1KDQB 2FI5E 1MCVA 1E37B 1K1OA 1PPBH 1YCPH 1C1PA 1JRSA 2Y5GA 3M3TA 2VWOA 1QGFA 5DP9A 4IN2A 2Q6GA 1DLEA 1XM1A 4AB9A 1LQEA 4X2XA 3R0FA 3ATKA 2FDAA 4X6NA 1O33A 1DWEH 1QJ7B 1LVOA 5FAHA 1G9IE 2GT7A 3T25A 1WTHD 1TNIA 2BX3A 1T4VH 4FU8A 2PFEA 1LKBA 3TNSA 2Y5HA 5C5NA 2Z3DA 4F4OC 3BTKE 5JBAS 1OP0A 3BTWE 1HFDA 5A8ZA 1AIXH 1OWIA 1C5OH 4O9VA 1C1RA 1QBVH 2JETC 1CA8B 1SMFE 3SJOA 1HXFH 4ZKOU 2H9TH 5LPRA 1TX6A 1QQ4A 1NPMA 4X8VH 4R8TB 4HGCA 2UUKB 3V3MA 1Y8TA 1ZYOA 1ABJH 1SLWB 3B23B 5L2YH 1YC0A 1JBUH 5F6MA 4FU9A 3SGQE 3QZQA 3SJKA 2OLGA 1LVMA 2FI3E 2QAAA 2A5IA 4YOGA 3PROA 4CRCA 1FY4A 5IYTA 1P2MA 4KP0A 4K60A 3UPEA 4AN7A 3MNSA 1Q3XA 4QT8C 1FAXA 1MH0A 5FCRA 1W12U 1NT1A 5JYIA 2ZIQH 2PKAA 2JH0D 2ZDMA 5A0CA 1ETTH 3KQDA 1MTNB 3GY3A 4OS6A 4D9RA 2ZDVH 2BTCE 1SGDE 1QIXB 1OWDA 4E06H 3PLPA 1D3TB 1ZJKA 4BXSA 1EJAA 4K5ZA 3ZVFA 4UFGH 1YPLH 1CT0E 1ZJDA 1JWTA 4ZXXH 2A4QA 3ZV9A 1UVUH 1HAZB 2BX4A 1O2TA 4U2WA 1ELEE 2WV5A 5LH8A 2TGPZ 4DIIH 1P3EA 1F0TA 4YLQH 4IC6A 4ZAEA 2F9PA 1QTFA 2AMPA 3QO6A 4Y11E 3MNBA 3GCHC 3OYPA 4JZ1A 1TONA 3E16B 1O3HA 1SOZA 2ZF0H 3BV9B 2C4FH 4CRAA 1HLTH 1EQ9A 1ELAA 1J9CH 2SGFE 2Y7XA 3QN7A 4M7GA 1V2UT 4AFZA 4YOIA 2W3KA 4NA8A 5EW1H 1BRBE 1TNHA 1FDPA 1UK3A 4VGCB 2C3SA 1WOFA 4CHAB 2AIPA 4YO9A 2HPPH 3PMJA 1S0QA 1O3PB 1O3OA 3MU4A 1VGCB 1AN1E 1OWKA 1O2GH 3RXHA 1EOLA 3GICB 1SFQB 1HAVA 4U01A 4Y7BA 1GBAA 1MBQA 1ELFA 3EQ0H 1WV7H 2A5AA 2GCHG 1G2MA 1CHOF 3GDVA 4NFEA 4DCDA 2XNIA 1PFXC 1PQ7A 1Y3UA 4JYVH 2ZCHP 1UTLM 3HKJB 1AZZA 2P3UB 3LGIA 5B6OA 3L6PA 2CHAC 1GL0E 1Z7KA 1SC8U 5DP7A 3O8CA 5A2MH 1BITA 1IQGA 3SBKA 1C2GA 2H9EH 2ESTE 1BIOA 5ESTE 2W5EA 1CA0C 1C2EA 3GOVB 3VB6A 2BDBA 1O5AB 1EOJA 1QL7A 3PO1C 1BHXB 1N8OB 1DPOA 5L2ZH 2C8YB 3A8AA 3RXKA 3W94A 2ANMH 1AVGH 3T5FH 1TGTA 4BXWA 1AUTC 2GZ9A 2PGQB 2ZO3H 1W10U 1BHXF 5J4SA 4UONA 1QRZA 1ZSJA 1O3KA 3UWIA 3VB5A 2Z9JA 2WPMS 4E05H 2R9PA 4DJZB 2FXRA 4IS5A 3HK6B 2B8OH 3U8OH 4MPWA 4UDWH 2J4IA 4FUDA 1GJ6A 5TJXA 1MMJN 1TQ7B 3RU4E 2F9UA 4ABFA 1XUFA 1GJ4H 1QBOA 1TQ0B 2ZFFH 2PKSB 1UVOA 1T8NA 2H6MA 5CHAB 2C93B 2IN2A 1T8LA 2AS9A 2B9LA 3P70B 1OYQA 4Y10E 3PMHB 1H8IH 7GCHG 1E0FD 4ZROA 1G30B 1MKWK 1O35A 4YOJA 3P8OA 1C5YB 1WAYB 1OP8A 3RC5A 3SV8A 3ZZ4A 3PWCA 4AZ2B 4NSVA 5FPSA 2M5TA 1O3GA 3TITA 1SFIA 3RXGA 2HOBA 3I77A 3SNBA 3ZZDA 2ZQ2A 1SLUB 1QHRB 2NU4E 1NU9A 2AMQA 3EYDA 1KTSB 1HV7A 2ZHFH 2GV6A 3URCA 1V2QT 2JKHA 1UK4A 4FUHA 5HGGA 2OC8A 1C5NH 1SHHB 4I8LA 2P3TB 4FUEA 3PLBA 2XTTB 2BQ6B 3ZVEA 3ZZ3A 1IHSH 3S69A 4X6OA 3O8RA 2BD7A 2FLRH 2RG3A 1V2TT 1MTNC 2QF0A 5DP5A 1DFPA 1ETRH 2W7SA 1K1LA 1TALA 1VR1H 2FOFA 2G4UA 1V2WT 2OBQA 3DFJA 1ELTA 1WSSH 3QTVH 1NO9H 1RIWB 1YF4A 2PLXA 1C2FA 1C5TA 1GJBB 2ILNA 2FX4A 2ZPSA 3F9GA 4YT7H 1FXYA 3BEUA 1AU8A 3AASA 5E2PA 3RXSA 1MKXK 1PQAA 1XKAC 1K9OE 5DKMA 2HNTF 2YNBA 1OWHA 1QJ6B 4Y0ZE 2BYAX 3Q3YA 3TVJB 3TNTA 1GHWH 2BD2A 4H42U 1ZTLA 1THRH 1SVPA 5EQRA 1A2CH 2A32A 2VB0A 2CMYA 3BSQA 4NWLA 1E34B 1FY3A 2ZGBH 3SU6A 5HM9A 1Y5AT 1S6HA 2Q1JA 4VGCC 2RA3A 1J14A 2R2MB 4ESTE 5EXMA 2BD5A 4CHAC 4PROA 3U1IB 2XBYA 4B2CA 1ZSLA 3RXIA 3IITA 5FXLA 1GPZA 3GCNA 3ZZBA 1E36B 1VGCC 1YLDA 1OP2A 3BTDE 5GCHG 4LXBH 3SQHE 5FCKA 2OQ5A 3STIA 3ODDA 2EEKA 4BNRA 1AWFH 2D2DA 3SUDA 4B75A 5AHGH 4YLUA 5F8XA 4D9QA 1DANH 1GI6A 5DK1A 3W95A 1T8MA 1BTXA 2Z6BD 1MCTA 1NS3A 1O3DA 2Z3EA 1O2XA 3PTNA 3UOUA 4B71A 2ZGJA 1OOKB 3S7HB 1P9UA 1MZAA 2ALPA 1CQQA 4MG3A 2Z94A 1Z1IA 1OWEA 1O2JA 3RC6A 4Y71A 1TMBH 1TMUH 4JZFH 1GBMA 1DITH 3U9AH 4ZKRU 7LPRA 1P8VC 1HAYB 1GGDB 1JXPA 1C9TA 3ZVGA 3LONA 3GCTG 1P0SH 1VITG 5FBEA 3S0NA 1NRNH 4WWYA 2PKAB 3KEEA 2BQWB 2WPLS 2FYQA 1S84A 3M5OA 1N8OC 2ZWLH 3O8BA 2HALA 4BAHB 1LQDB 1JRTA 4Q7ZA 4BOHA 1BTPA 3LJOA 2P95A 3ATLA 1O2NA 2O8TA 2BVRH 1TNJA 1GBJA 2ZPRA 1BTYA 1GMDF 1JOUB 1FI8A 1MTWA 1RGQA 1YPGH 1O31A 1TNGA 2QIQA 2BY5X 2ZGHA 1PYTD 1A5HA 4KTUA 1C1UH 1UK2A 1IAUA 1W0ZU 2GVFA 4OS2A 1O3BA 1MD7A 3DHKH 5CHAC 4AOQA 4WMDA 5GWZA 1YM0A 4MPVA 2V35A 4KKDA 3UY9A 1TB6H 1EATA 3LJJA 4Y8XA 4ZKSU 1KXAA 2BDAA 2BY7X 1TX8A 2W3IA 1GHAF 3UR9A 5IDKA 3DUXH 3URDA 4X1RU 4JYUH 2ZDKA 2KAIB 2YNAA 8ESTE 2J2UA 2ZG0H 4X8TH 1A4WH 1Q31A 1TA6A 1O30A 1SBWA 1NFXA 3MMGA 2VH6A 3BTHE 3NZIA 4NIWA 3S7KB 4D76A 1UTQA 4HFPB 1C5UA 2UWOA 1A5IA 3QWCH 3T2NA 1UTMA 3LU9B 1A5GH 3B9FH 3BIVH 8GCHG 3SU5A 1VCPA 2BDIA 5K0HA 2QXJA 2ZTYA 2GMTB 3U8RH 1C2LA 3FP7E 3ZYEA 3SGBE 1TMTH 1GMCG 3UQVA 1ANBA 2A5KA 2ZZUH 1GMHG 4NZLA 2WYJA 2CJIA 3ZZAA 2ZU1A 2QN5T 2XXLA 2BD9A 1HXEH 1D3DB 3GCOA 5EPYA 1XVMA 3RXRA 1NZQH 5FPYA 4AB8A 6GCHG 3A84A 1ANDA 2FOBA 2ZGXH 2A31A 1O2PA 1P2QA 3KNXA 1BTUA 2ALVA 1BTWA 1PQ8A 2A0QB 3MU1A 4A92A 1NRQH 1GHVH 1QB9A 3MTYA 1SB1H 4ZH8A 1RIWC 5A09A 1O2IA 4GSOA 1YPHC 4LK4A 1BTHH 1BBRK 3A8CA 4WH8A 1C2IA 3FP8E 2BXUH 1LMWB 1SGQE 4NWKA 4H4FA 1NU7B 3A7VA 2HNTC 1C5WB 4Y8ZA 3UFAA 2F9NA 1HDTH 3RXEA 1SSXA 1TRNA 2RA0A 1EZUC 1AO5A 1W0YH 3F1SB 3MO6A 1DE7H 4CBNA 1JIMA 4AYYB 2OINA 2OUAA 3FANA 1FMGA 6ESTA 4HI3A 1FNIA 1HB0B 1O3IA 1O2YA 1OKXA 3BTQE 1B0FA 1HJ9A 5HM2A 2HVXA 4SGAE 4WY3A 2PWXA 2XBXA 1F0RA 3E3TA 4DG4A 4Z6AH 2BLOA 4O3TA 1U6QA 3LPRA 1NC6A 1O2WA 1GJ5H 1QRXA 1ZLRA 1D9IA 3CS0A 2NU1E 3GISB 3RC4A 2OQUA 4X6PA 1LHCH 4UE7H 1FIZA 2XWAA 4BTTB 1P01A 2P59A 2QY0B 3BTFE 2VIVA 5HYOA 5TCCA 3ATIA 1IQFA 3G01A 5C1YA 4ABGA 1J17T 3MOCA 2H2ZA 1CU1A 2LNCA 2ZHDA 3A7XA 2QXGA 1RTKA 1L1JA 2Z7FE 2SGPE 3KF2A 2Y5FA 1GI1A 2BMGB 2BDCA 3EA9A 2WPHS 2VIWA 4GAWA 4X1PU 3ZVBA 1B5GH 1QB1A 3RXMA 3PWBA 4FUJA 1Z6JH 1CE5A 1EJMA 3L3TA 1SGEE 2UWPA 2DUCA 3R3GB 3SUGA 2C8XB 1WYKA 5T3HA 5I46H 1YGCH 1V6DA 2BLVA 2P16A 3FZDA 1GGDC 4RN6A 3UNQA 2NU2E 1GHZA 4Y6DA 1MKWH 1TBRH 4RKJB 1L1NA 1O2MA 3SHAH 3UIRA 2BDHA 5H4IB 1C1WH 3BF6H 1FJSA 4H6SB 3RXFA 3SI4H 4ABEA 3JZ2B 1XUKA 1TIOA 3ZVDA 5K7RA 1DY9A 4MNVA 1O39A 3HKIB 3RM2H 1NM6A 1ZZZA 3STJA 5TCAA 1GI3A 1A46H 2V3HH 1EB2A 3QGJA 1WQSA 3EA7A 2QGRA 4BAQB 1GBFA 2AGIX 1C5SA 2UUYA 1EAIA 8KME2 1H1BA 1P06A 2O8UA 1GBIA 5E0HA 2OC1A 4YESB 1VJAU 2GCHF 1EPTB 1P2NA 3GYMA 1WTGH 5DP8A 1K1IA 1UO6A 4TWYA 1SHYA 4Y76A 2VIQA 1BOQA 3SV2H 2ZNKH 1L1GA 3RP2A 2Z9GA 1UHBA 4INKA 2BB4A 3GY2A 1YCPM 1Z8JB 5T6GA 2F91A 5E0GA 1KLIH 3GDSA 1L4ZA 4LZ1H 3H7OA 2Z3CA 2G00A 1X7AC 1EZSC 1GBDA 1AWHB 1L4DA 2D26C 3SNEA 2FESH 2CF8H 3RUOA 1NFUA 2GCTB 3ZZ8A 3PLKA 3A81A 4JYTA 1AKSA 3KCGH 1D4PB 6CHAB 1LHDH 1MTUA 1TGNA 1C1SA 2GMTC 2ZDLA 2TPIZ 1WU1A 2ZU5A 1MKXH 1PPFE 1HBTH 4I8HA 1F2SE 1DICA 2KAIA 1UTNA 1DXPA 3ZZCA 4AG1A 5AF9H 2G4TA 3SZNA 1C4V2 1YYY1 2XCFA 4I32A 4FUBA 1XUGA 3HGNA 1S6FA 1GG6C 4NGAH 3M61U 1CGJE 4K8YA 4K1TA 2J95A 7KMEH 2AFQB 2V3OH 3HATH 1GHBG 1P09A 1ACBE 1AFEH 1ELBA 9LPRA 1RD3B 2Z9IA 3SOSA 3ZZ7A 3A83A 3OTJE 2ZCKP 2THFB 3AW0A 7GCHF 3T27A 4DIHH 1UTOA 1XX9A 2FPZA 2XCNA 1CGIE 2DE9A 3LKWA 1QFKH 1C5VA 1S82A 2GDDA 3A87A 2PTNA 4A6LA 4ISNA 2BOHB 4O03A 2Y80A 1C4U2 2VIDA 3I29A 1KLJH 5A8YA 2BD3A 1LPKB 2WPJS
chains in the Genus database with same CATH superfamily
2A7HA 1O37A 1EP5A 5C1XA 2VVVA 3CS7A 4E7RG 2JH6D 4ISIH 1E79D 3PMBB 3MU8A 2K1QA 5DJ7A 3M5MA 3F2GA 2BVXH 4TPIZ 3BIUH 5HXFA 2OP9A 2PR3A 1O5EH 1K1PA 2B5TB 1NFYA 1T7CA 1UJ1A 1S5SA 2Z9LA 3A7YA 3A89A 2QCYA 1T8OA 1HAPH 5JBTA 3CENA 4AFUA 2PW8H 4B73A 2ZCLP 1KXDA 2OCVB 1EKBB 3FN8A 4JK6A 3RMNH 2ZEBA 2FX6A 2O9QA 3SNAA 1OXGA 1WDIA 3SU2A 1J16A 1N6XA 1SLXB 1GHXH 1V2LT 1MAYA 1QL8A 1ZPBA 2LPRA 1YWUA 2R3YA 1GI0A 2EI7A 4Y0YE 3TGKE 1O5CB 3KYGA 1SGPE 4BAKB 1YPKH 1BMNH 1GCTB 1W3CA 2KFWA 1KY9A 4X0WU 1NBME 1SGIB 1F0UA 1C5XB 3PV5A 1SGCA 2PV9B 3A8BA 2BLQA 2GKVE 2GZ7A 4B6EA 1CVWH 2P94A 3UQOA 5SGAE 1A3EH 2WUCA 2HWLB 1XMNB 1TFXA 2NWNA 5EJ1A 3K6ZA 2C8WB 4WXVA 4DT4A 1S81A 5DP6A 3ZV8A 1HYLA 4I8KA 1BMLA 2BHGA 4MDSA 3BG4B 1BUIA 4I86A 1A0LA 3N7OA 1SG8B 2F9BH 1GHYH 1UVSH 4GVUA 2Z9KA 3AAUA 1LKAA 3FZZA 3FOAA 4NSYA 3ZZ5A 3PRDA 1G2LA 3FFGA 4X1SU 5LGOA 5GCHF 1K1MA 5IK2D 4IC5A 4ABAA 1LHEH 2FOAA 2J34A 4X2VA 1UMAH 3C1KA 1EPTC 1G36A 3GY6A 1BA8B 1ZHRA 3ATMA 2KCYA 3TK5A 1K28D 1A7SA 1KTTB 2BZ6H 4AFQA 2A7JA 2WUBA 1HAGE 1PPHE 2ASUB 2O8LA 1GI4A 2I6SA 3RXOA 4CRFA 1GBBA 5C0TA 4Q80A 1PPEE 3RMOH 4TWWA 1AE8H 2A4RA 2NU0E 4I8GA 3SN8A 4CBOA 1W0JD 3V13A 4D7FA 3FAOA 1ESAA 2P8OB 4TYDA 2SGAA 1QZ8A 2OC7A 2QF3A 1PYTC 2GD4B 2ULLA 1EPTA 4XBBA 3RU4D 1AUJA 1DT2A 4DT7B 1C4Y2 5GPIB 3ESTA 3BTGE 1VJ9U 4J1YA 1FZZA 3L33A 1THSH 4TY7A 1N1LA 3RXVA 2WPKS 3P92A 3EE0B 2ZPQA 3N7EA 3GCTF 1VITF 2GCTC 2VINA 3C27B 1ZR0A 1BBRH 2RCEA 2OD3B 4YT6H 6CHAC 2QV1A 1TNLA 3M5LA 1XUHA 3TJOA 4JZEH 2V0BA 3ZZ6A 1P2OA 1C2HA 4MPXA 3VB3A 1IQLA 3RXLA 3Q3XA 4KTSA 1G3EA 1S0RA 5BRRE 1NBMD 1DWBH 5G4BA 1C1TA 2HGTH 1RTLA 1EB1H 2BXTH 1SLVB 3LGYA 1Z8RA 3LH3A 1FUJA 2PSYA 3ZZ9A 1OYTH 1Y3YA 2B7DH 1D3PB 4GHTA 3LGTA 1LDTT 1V2PT 2GP9B 4AG2A 2STAE 3D49H 3KQ5A 3TPIZ 2SNVA 1ZOMA 3T62A 5C2ZA 2EI6A 2A2XH 3A8DA 2AGEX 1O0DH 2O8MA 3QDZB 4P02A 1MU8B 4O97A 1JMOH 1E38B 2QYIA 4FETA 3SUFA 3ZVAA 3ELAH 2G5VA 1GCDA 2ODYB 3A86A 4OM9A 1RFNA 2SNWA 1BCUH 2AMDA 2FTLE 5BPEA 3H09A 1BRAA 1SI5H 2KM0A 4MQAA 1ZTJA 2FOHA 3A85A 2FLBH 4UD9H 5EGMA 1ELDE 5ESBA 2H5CA 4KGAA 4XRNA 1ELVA 3MHWU 1QQUA 1GDNA 1P11E 2YMSB 2QE7D 4JK5A 1NTPA 1AHTH 1GI2A 3N7DA 4TT3D 1GVLA 3SV9A 3M5NA 1ZHMA 3KQCA 2SGQE 8GCHF 2PP6A 1BB0B 3A82A 1QRWA 2ZFPH 4NFFA 2FWWA 1G3BA 2BOKA 1Z1JA 3ZVCA 1BDAA 1GMCF 1P02A 3BG8A 3H5CB 3PMAB 3SU3A 3ZIAD 1GMHF 3F2HA 1J15A 5EQQA 1OWJA 1VITH 1MTSA 2WINI 3SUEA 4LZ4B 3OEHD 3ENSB 3HGPA 2J38A 5JBCS 1ZHPA 1ANEA 2O8WA 3U69H 1UHBB 1VCWA 3F9EA 6GCHF 4ABJA 6LPRA 1SQTA 2KCAA 4INLA 4K69A 3LC3A 1EJNA 1IQNA 4WXIA 4ABHA 1LHFH 4WVPE 2J98A 1O2OA 1K1NA 4WMEA 1C1MA 2CXVA 2RDLA 3MYWA 1V3XA 1FAKH 1F5LA 2PKSC 3D65E 3K6YA 3TH3H 5C67A 1GBCA 1UTPA 2ZHEH 3Q77A 4DY7B 1D6RA 4K1EA 4KELA 3RM0H 2GT8A 5ABWA 4I7YH 1FIWA 1FV9A 4H6TA 4UFFH 1AKSB 3V7TA 5DP3A 2AEIH 1LHGH 2ODPA 1GCTC 2FTMA 1Y5BT 5ETXA 1WXRA 3BTTE 2XWBI 3RXPA 2GGVB 1SQOA 4MNYA 1DY8A 4CREA 3RU4T 1NFWA 2CN0H 5AVDA 3VB7A 3WWFA 1QL9A 2B0FA 1C1VH 1W11U 4RT1A 5JBBS 1S85A 1C5RA 4K2YA 3P95A 1ESBA 2WV9A 2ZA5A 1BTZA 1MTVA 1AQ7A 3CNRA 1F0SA 1UCYE 3A7WA 1P57B 3NK8A 2ANWA 4D7GA 1NESE 4DOQA 1SGFG 1AY6H 1H9IE 3E6PH 4B1TA 1ZPCA 4CRGA 1XXDA 3I78A 4U30A 5EU8A 3BG4C 1LO6A 5EPNA 1HAIH 2UUFB 1K2I1 5FX6A 1ZSKA 3AAVA 1RXPA 5DP4A 1GJAB 1OS8A 1DWCH 1MQ6A 1Z6EA 2IOTA 2PGBB 1SGYE 1XKBC 1SL3A 3TGIE 3MH5A 3M36A 4A1XA 1IQKA 3M7TA 2W26A 3PM3A 1DS2E 1DSTA 1LPZB 4FVDA 1TLDA 3RXUA 1MQ5A 4BANB 1HUTH 2J94A 1P2IA 3SU0A 2FYRA 3Q00A 5J4QA 4DVAU 5LPEA 2WZQA 4MPUA 1O32A 1V2MT 2EI8A 3AW1A 5E2OA 1NROH 1GVZA 5FHTA 3SGAE 3A7ZA 5EQSA 1BZXE 3LIWA 1TRMA 4NG9H 3QTOH 5E0JA 2BY9X 4Y79A 4SGBE 2P8OC 1UCYK 2G8TA 3TLOA 2FM2A 2BQ7B 4XBDA 4A1VA 2FS8A 2KCOA 4FUGA 2OBOA 1FLEE 2FMJA 1G3DA 3QX5H 3M7UA 2F83A 3OX7U 1KIGH 1D6WA 2ZGCA 1B7XB 1MD8A 2ZFTA 2AHME 2XC5A 3N99A 4Y7AA 1V2RT 5DO4H 5T6FA 1DSUA 1O5GH 3QZRA 5FBIA 5FL7D 1IQHA 3SU1A 4RKOB 4I31A 2W6ID 2G81E 2ZFSA 3OY5U 5HKKD 5JDUB 2KZ4A 1GWAA 2K8IA 3SO3A 2BD8A 1HIAA 3MU0A 1GDQA 2G55A 2VH0A 2WYGA 4B2AA 2VGCB 1BMMH 2BM2A 5EOKA 5EG4A 1DUEA 2ZQ1A 3OAAD 4ZMAH 2BDYA 3TU7H 3EA8A 2A4OA 1H8ED 1F5KU 3F6UH 1O2RA 1O3FA 1SGRE 1P04A 4GCHG 1XVOA 1EFRD 3MH6A 2ODQA 1VZQH 1ZMLA 1K1JA 2ANKH 1RJXB 2HLCA 2ZDNA 3KQEA 1H9HE 1H9LB 3UNSA 2JIZD 2J92A 2TGDA 4RT0A 2VWNA 3VXEH 4IN1A 1TNKA 3K2UA 1LCYA 2VU8E 1AFQB 3UTUH 2G51A 4CR9A 1GBEA 1Z8GA 4XOJA 1MZDA 1PPGE 1Z71A 4MNXA 1AE5A 3QLPH 3TGJE 2BZAA 1QBNA 1AVWA 2ZC9H 3UNRA 1S83A 2J5UA 5DGJA 2J9NA 3OU0A 3V0XA 1YPEH 5DG6A 3LC5A 1Z8IB 4ABIA 5CE1A 4WMFA 1TOCB 2K0QA 2QA9E 3PB1E 5L30H 3S9AA 1HJAB 1YBWA 4NA7A 2F3CE 3DA9B 3KN2A 3TK9A 1W7GH 1SGFA 3GDUA 4J2YB 1QJ1B 2FOMB 2UWLA 1C9PA 1EASA 3DFLA 1HPGA 1QCPA 1TA2A 4B74A 1BQYA 4NIYA 1TGBA 2LELA 5GJ4B 4D8NA 3TK6A 5GIBA 3UWJH 4X2WA 1GHBF 3U8TH 2ZP0H 3MFJA 3SNDA 1W8BH 1FN6A 1UTKA 1C1OA 2H1UA 1TYNA 2EQNA 1ABIH 2GTBA 1E1QD 5LPFA 1F92A 1P12E 1UVTH 1XUJA 2GJGA 1TWXB 3TH2H 1FPCH 3P8GA 1G37A 1K22H 1YPJH 1IHTH 1EP6A 3WWBA 2SGDE 3A80A 3EGKH 3TJUA 3F9FA 3SNCA 3NUMA 1QA7A 1M9UA 3VGCB 4JCNA 2WV4A 1W2KH 3E91A 5KGOA 1O2ZA 2FOGA 1HRTH 5I25A 2SFAA 1V2OT 2XC4A 2H5DA 1TPOA 4NA9H 5PTPA 3OEED 4MNWA 5A0AE 3M3SA 2XC0A 1O2HA 5EODA 2TGAA 2BD4A 4HZHA 4IMQA 2P3FH 4O3UA 4THNH 4IMZA 1P2KA 2OTVA 2XYAA 1YLCA 1W13U 4CH8B 2VIPA 4ZHLU 2Q6FA 1SR5C 3TJNA 4AORA 3LGWA 2PSXA 1QA0A 2W7UA 3A7TA 1GBLA 4ZHAA 1ZGVA 3QGNB 4BTIB 3RXCA 2GV7A 1CSOE 3E0PB 4ZKNU 4IW4E 3RXDA 4TY6A 2ZFRH 1AB9B 2ZHWH 5E8EH 4KTCA 2A4GA 3A88A 4A1TA 1O5BB 2XBVA 1CT2E 3BTEE 2ZHQH 2FO9A 2YMSD 5A8XA 4CH2B 4YZUA 5JB9S 1FN8A 1TABE 5L6NH 3GY5A 3GYLB 4TPYA 1Y5UT 2HVYB 1VCQA 5EXLA 3CP7A 2FOCA 2QF4A 3T28A 3RXTA 4B2BA 2J97A 1SOTA 1W0KD 4ISOA 1HCGA 1O2UA 2STBE 2CGAA 1HNEE 5HIZA 4GLYA 1ORFA 3MI4A 1GI5A 4FUIA 1INCA 4P00A 1GI9B 3RLWH 3LH1A 3KGPA 3QK1A 4CRDA 4AYVB 4ZHMU 5T6DA 1NRPH 1DVAH 2ZTZA 3U28C 3MQKC 1MAXA 1ZRBA 1P03A 1GJCB 4YTAA 1HAHH 1C2JA 2VNTA 1O2VA 1PQ5A 1AGJA 3LGUA 3M35A 3UOPA 3MH4A 3SJ8A 3O8DA 1O3CA 1ZGIA 4BAMB 2J98B 2AH4X 1V2KT 1DLKB 3FP6E 4IBLH 1YPMH 3MO9A 1ELCA 1FPHH 1FY5A 3MU5A 2QF5A 2TRMA 2QC2A 1NRRH 4GHQA 4OGXA 3RXAA 2BLWA 1QURH 1YCPK 1HAXB 1CGHA 1A61H 1H8HD 1G3CA 2ZTXA 4HG6A 3SW2B 3MH7A 2EY4C 1V2VT 2Y6TA 4BTUB 1EX3A 1AMHA 1WQVH 1LTOA 1TPAE 5F8TA 4E7NA 1O2KA 1ID5H 4CRBA 2WPDD 1AI8H 1DWDH 1KXCA 3DD2H 2VGCC 1T4UH 4YM9A 1EAUA 2P93A 1O3LA 2WPIS 3E90B 2GZ8A 4XFQA 4ABDA 1A1RA 1N6YA 2IPHA 1TBZH 2A2QH 1KLTA 4RSPA 1O3EA 1O3AA 4X8SH 1ELGA 3F68H 1IQJA 1QB6A 5FX5A 1GVKB 1ZTKA 1W7XH 2TGTA 1YP9A 3SV7A 3Q76A 1CHOG 4ZUHA 3LGVA 5C5OA 1C5QA 1KDQA 1TRYA 3NKKA 5DPAA 1O38A 1ZPZA 2IJD1 3NPSA 1AFQC 1PPZA 2OK5A 1KYNA 1GI8B 1C5MD 1ZMJA 1V2JT 2C90B 4A5TS 4BAOB 1ZMNA 2ZKSA 2VVCA 1C5PA 1DOJA 2A1DB 3RMLH 2ANYA 1FY1A 2HPQH 2FOEA 1O2SA 7ESTE 3BTME 3KQBA 3MNCA 1HJAC 3EAJA 1WBGB 1AD8H 4OS4A 1MUEB 1A0HB 3GY8A 1GDUA 1XUIA 4ZXYH 1T32A 2ZECA 1O34A 1AVXA 4X8UH 3S9BA 1CBWB 3TJVA 8LPRA 2VWMA 3T26A 2FIRH 2ZU3A 1C2KA 4GUXA 1EUFA 1OSSA 3SJ9A 4X6MA 1VKYA 3K65B 1G32B 2TBSA 2AYWA 1P05A 2TIOA 3PRBA 3MNXA 4DURA 2BY6X 1LVBA 3F0PA 3Q3KA 1O2LA 1Q2WA 3DT0H 3RMMH 1C1QA 3SI3H 4AGKA 1PPCE 1GBHA 1GJ8B 3PV4A 4XSKU 3P8FA 2SGEE 3VEQB 3VGCC 2Q6DA 3NCLA 1ARBA 1P3CA 3BN9A 4MVNA 5EXNA 5GDSH 1NRSH 2CF9H 3HK3B 3KL6A 2F9VA 1UTJA 5EW2H 1Y59T 2R3UA 3H7TA 1EAWA 2ZFQH 1GJ7B 1O36A 1SPJA 1CT4E 2VVUA 5GXPA 1W14U 4ASHA 1GBKA 1TX7A 4CR5A 1HIAB 1TGSZ 1C2MA 2FS9A 3JZ1B 3OSYA 5GNDA 3SYJA 2XW9A 1UCYH 3SORA 1H4WA 1O3JA 1ETSH 3RDZA 4HTCH 3WY8A 2FI4E 2Y82A 4FVBA 3OY6U 1V2NT 2W6JD 1C2DA 1IQEA 1P2JA 1QNJA 3RLYH 3FKSD 3S9CA 2BY8X 4UFEH 3TIUA 1HAOH 4I33A 1NY22 1D3QB 2AERH 4LOYH 5JB8S 3ODFA 5F8ZA 5C1UA 1WCZA 1AB9C 2QXIA 1SQRA 5C20A 5C94A 1KXBA 1P10A 2EA3A 1COWD 1TPPA 2WSSD 4AX9H 1LVYA 4JZIA 3VB4A 1GJDB 1YY3A 3D23A 3F0OA 2AIQA 1FONA 2BVSH 1UVPA 2GDEH 5A0BA 1LPGB 1TGCA 4YXWD 1GBTA 4AGJA 2KCPA 2PUXB 1EZQA 4A7IB 1KSNA 1A3BH 4WJG2 3UREA 3TH4H 1BJUA 1SQAA 3RXBA 2BDGA 1QY6A 2FZZA 3BEIB 3GY7A 2ZU4A 3UB0A 3AK5A 1L2EA 1L0ZA 4F49A 1BRUP 3ZYDA 4FUCA 3U98H 1ARCA 3LT3A 3VPKA 4OS5A 1J8AA 2IJOB 3ITIA 1NN6A 2JETB 1IQMA 3SQEE 1K21H 3E1XB 4U32A 4Z1MD 1QR3E 3KHVA 4UFDH 1MBMA 9ESTA 1XXFA 4AFSA 4DGJA 4NIXA 1O3MA 1RS0A 4Q7YA 1PJPA 1ANCA 1T31A 2OXSA 1O3NA 1GL1A 1TAWA 4K8BA 3M7QA 1MU6B 3LDXH 3PTBA 3M37A 2PHBA 4WF8A 4ISLA 4IGDA 1GI7B 1GJ9B 3HPTB 3P17H 2VIOA 1V2ST 3SHCH 1EAXA 1YKTA 1C5ZB 4X1QU 4XDEA 2V6NA 2QXHA 5AFZH 3VXFH 3T29A 2AGGX 2H9HA 1TE0A 5AFYH 2NU3E 3MO3A 2FP7B 4OS7A 3E0NB 4GPGA 1E35B 3IG6B 2A45B 5F03A 3SJIA 1RRKA 4X1NU 3ATWA 4JZDH 4OGYA 4FU7A 1BRCE 5CMXH 1O5FH 3SU4A 1A0JA 4Q7XA 1TOMH 5HMAA 3WW7A 1OX1A 1O2QA 1CHGA 1F7ZA 4FXGH 1BBRE 4R0IA 1O5DH 2V7QD 3LOXA 4ABBA 2VJ1A 2EC9H 4MLFB 3GCHB 3IWMA 3KIDU 4Q2KA 3V12A 2FEQH 5CHBA 2YOLA 2ZU2A 4K1SA 3K9XB 2ZI2H 1HAVB 1SGNE 1ZRKA 5KECA 3BEFB 4B76A 1DX5M 2R0KA 2HRVA 3NWUA 1CBWC 1DM4B 2VWLA 5C3NA 1ESTA 1OHHD 2I6QA 1C5LH 1BT7A 3AVZA 1TBQH 4OS1A 2D8WA 1EXFA 1GMDG 3UUZA 2F9OA 1TPSA 2CV3A 2PTCE 1GG6B 4ISHH 3P8NA 2VBCA 1F5RA 3PYHA 2DE8A 3RXQA 3SV6A 1B0EA 5FPTA 3VFEA 4GCHF 2G52A 2A7CA 4JMYA 4X2YA 3UR6A 1C1NA 1FQ3A 4NZQA 1WUNH 3EDXB 1KXFA 1RTFB 4NIVA 4Z0KA 2XRCA 1IOEA 1DDJA 4XBCA 2GX4A 2PUQH 4XE4A 3U1JB 4MTBA 4I8JA 2OC0A 3B8JA 2R2WU 4INHA 1Y3WA 2Y7ZA 3QUMP 1Y3XA 4FUFA 2G5NA 3RXJA 2R0LA 3P6ZB 2CHAB 1GHAG 1KXEA 3EE7A 1IQIA 4K3JA 4WH6A 1HJ8A 3D62A 1P9SA 4DW2U 5JPMH 1FY8E 3GY4A 1YPHE 4NCYA 4RI0A 4UEHH 3MWIU 4TSFD 3UAIC 2D1JA 4ZCNA 1CA0B 1DUAA 2XBWA 3NXPA 4Y8YA 1Y3VA 1THPB 2JH5D 2ZDAH 3F9HA 1HGTH 1OPHB 3FVFB 2HNTE 3E8LA 3PO1B 2Y81A 1H8DH 1SGTA 2FODA 1BMAA 1DXWA 2UUJB 1AZ8A 1JIRA 1EZXC 3M3VA 2C8ZB 1CO7E 1BJVA 1KDQB 2FI5E 4FOUC 1MCVA 1E37B 1K1OA 1PPBH 1YCPH 1C1PA 1JRSA 2Y5GA 3M3TA 2VWOA 1QGFA 5DP9A 4IN2A 2Q6GA 1DLEA 1XM1A 4AB9A 1LQEA 4X2XA 5B6LA 3R0FA 3ATKA 2FDAA 4X6NA 1O33A 1DWEH 1QJ7B 1LVOA 5FAHA 1G9IE 2GT7A 3T25A 1WTHD 1TNIA 2BX3A 1T4VH 4FU8A 2PFEA 1LKBA 3TNSA 2Y5HA 5C5NA 2Z3DA 4F4OC 2YMSC 3BTKE 5JBAS 1OP0A 1S6LA 3BTWE 1HFDA 5A8ZA 1AIXH 1OWIA 1C5OH 4O9VA 1C1RA 1QBVH 2JETC 1CA8B 1SMFE 2JJ2D 3SJOA 1HXFH 4M9FA 4ZKOU 2H9TH 5LPRA 1TX6A 1QQ4A 1NPMA 4X8VH 4R8TB 4HGCA 2UUKB 3V3MA 1Y8TA 1ZYOA 2XNDD 1ABJH 1SLWB 3B23B 5L2YH 1YC0A 1JBUH 5F6MA 4FU9A 3SGQE 3QZQA 3SJKA 2OLGA 1LVMA 2FI3E 2QAAA 2A5IA 4YOGA 3PROA 4CRCA 1FY4A 5IYTA 1P2MA 4KP0A 4K60A 3UPEA 4AN7A 3MNSA 1Q3XA 4QT8C 1FAXA 1MH0A 5FCRA 1W12U 1NT1A 5JYIA 4ACAA 2ZIQH 2PKAA 2JH0D 2ZDMA 5A0CA 1ETTH 3KQDA 1MTNB 3GY3A 4OS6A 3VG8A 4D9RA 2ZDVH 2BTCE 1SGDE 3F3BA 1QIXB 1OWDA 4E06H 3PLPA 1D3TB 1ZJKA 4BXSA 1EJAA 4K5ZA 3ZVFA 4UFGH 1YPLH 1CT0E 1ZJDA 1JWTA 4ZXXH 2A4QA 3ZV9A 1UVUH 3OFND 1HAZB 2BX4A 1O2TA 4U2WA 1ELEE 2WV5A 5LH8A 2TGPZ 4DIIH 1P3EA 1F0TA 4YLQH 4IC6A 4ZAEA 2F9PA 1QTFA 2AMPA 3QO6A 5F53A 4Y11E 3MNBA 3GCHC 3OYPA 4JZ1A 1TONA 3E16B 1O3HA 1SOZA 2ZF0H 3BV9B 2C4FH 4CRAA 1HLTH 1EQ9A 1ELAA 1J9CH 2SGFE 2Y7XA 2L74A 3QN7A 4M7GA 1V2UT 4AFZA 4YOIA 2W3KA 4NA8A 5EW1H 1BRBE 1TNHA 1FDPA 1UK3A 4VGCB 2C3SA 1WOFA 4CHAB 2AIPA 4YO9A 2HPPH 3PMJA 1S0QA 1O3PB 1O3OA 3MU4A 1VGCB 1AN1E 1OWKA 1O2GH 2KX4A 1EOLA 3GICB 1SFQB 3RXHA 1HAVA 4U01A 4Y7BA 1GBAA 1MBQA 1ELFA 3EQ0H 1WV7H 2A5AA 2GCHG 3DSPA 1G2MA 3OE7D 1CHOF 3GDVA 2L6OA 4NFEA 4DCDA 2XNIA 1PFXC 3FO8D 1PQ7A 1Y3UA 4JYVH 2ZCHP 5DN6D 1UTLM 3HKJB 1AZZA 2P3UB 3LGIA 5B6OA 4Q4LA 3L6PA 2CHAC 1GL0E 1Z7KA 1SC8U 5DP7A 3O8CA 5A2MH 1BITA 1IQGA 3SBKA 1C2GA 2H9EH 2ESTE 1BIOA 5ESTE 2W5EA 1CA0C 1C2EA 3GOVB 3VB6A 2BDBA 1O5AB 1EOJA 1QL7A 3PO1C 1BHXB 1N8OB 1DPOA 5L2ZH 2C8YB 3A8AA 3RXKA 3W94A 2ANMH 1AVGH 3T5FH 1TGTA 4BXWA 1AUTC 2GZ9A 2PGQB 2ZO3H 1W10U 1BHXF 5J4SA 4UONA 1QRZA 1ZSJA 1O3KA 3UWIA 3VB5A 2Z9JA 2WPMS 4E05H 2R9PA 4DJZB 2FXRA 4IS5A 3HK6B 2B8OH 3U8OH 4MPWA 4UDWH 1UW7A 2J4IA 4FUDA 1GJ6A 5TJXA 1MABB 1MMJN 1TQ7B 3RU4E 2F9UA 4AC9A 4ABFA 1XUFA 1GJ4H 1QBOA 1TQ0B 2ZFFH 2PKSB 1UVOA 1T8NA 2H6MA 5CHAB 2C93B 2IN2A 1T8LA 2AS9A 2B9LA 3P70B 1OYQA 4Y10E 3PMHB 3DSOA 1H8IH 7GCHG 1E0FD 4ZROA 1G30B 1MKWK 1O35A 4YOJA 3P8OA 1C5YB 1WAYB 1OP8A 3RC5A 3SV8A 3ZZ4A 3PWCA 4AZ2B 3F2FA 4NSVA 2JJ1D 2M5TA 5FPSA 1O3GA 3TITA 1SFIA 3RXGA 2HOBA 3I77A 3SNBA 3ZZDA 2ZQ2A 1SLUB 1QHRB 2NU4E 1NU9A 2AMQA 3EYDA 1KTSB 1HV7A 2ZHFH 2GV6A 3URCA 1V2QT 2JKHA 1UK4A 4FUHA 5HGGA 5KEDA 2OC8A 1C5NH 1SHHB 4I8LA 2P3TB 4FUEA 3PLBA 2XTTB 2BQ6B 3ZVEA 3ZZ3A 1IHSH 3S69A 5C0UA 4X6OA 3O8RA 2BD7A 2FLRH 2RG3A 1V2TT 1MTNC 2QF0A 5DP5A 1DFPA 1ETRH 2W7SA 1K1LA 2V3MA 1TALA 1VR1H 2FOFA 2G4UA 1V2WT 2OBQA 3DFJA 1ELTA 1WSSH 3QTVH 1NO9H 1RIWB 1YF4A 2PLXA 1C2FA 1C5TA 1GJBB 2ILNA 2FX4A 2ZPSA 3F9GA 4YT7H 1FXYA 3BEUA 1AU8A 3AASA 5E2PA 3RXSA 4F55A 1MKXK 1PQAA 1XKAC 1K9OE 5DKMA 2HNTF 2YNBA 1OWHA 1QJ6B 4Y0ZE 2BYAX 3Q3YA 3TVJB 3TNTA 1GHWH 2BD2A 4H42U 1ZTLA 1THRH 1SVPA 5EQRA 1A2CH 2A32A 2VB0A 2CMYA 3BSQA 4NWLA 1E34B 1FY3A 2ZGBH 3SU6A 5HM9A 1Y5AT 1S6HA 2Q1JA 4VGCC 2RA3A 1J14A 2R2MB 4ESTE 5EXMA 2BD5A 4CHAC 5EJLA 4PROA 3U1IB 2XBYA 4B2CA 1ZSLA 3RXIA 3IITA 5FXLA 1GPZA 3GCNA 3ZZBA 1E36B 1VGCC 1YLDA 1OP2A 3BTDE 5GCHG 4LXBH 3SQHE 5FCKA 2OQ5A 3STIA 3ODDA 5DSFA 2EEKA 4BNRA 1AWFH 2D2DA 3SUDA 4B75A 5AHGH 4YLUA 5F8XA 4D9QA 1DANH 1GI6A 5DK1A 3W95A 2CK3D 1T8MA 1BTXA 2RFKC 2Z6BD 1MCTA 1NS3A 1O3DA 2Z3EA 1O2XA 3PTNA 3UOUA 4B71A 2ZGJA 1OOKB 3S7HB 1P9UA 1MZAA 2ALPA 1CQQA 4MG3A 2Z94A 1Z1IA 1OWEA 1O2JA 3RC6A 4Y71A 1TMBH 1TMUH 4JZFH 1GBMA 1DITH 3U9AH 4ZKRU 7LPRA 1P8VC 1HAYB 1GGDB 1JXPA 1C9TA 3DCLA 3ZVGA 3LONA 3GCTG 1P0SH 1VITG 5FBEA 3S0NA 1NRNH 4WWYA 2PKAB 3KEEA 2BQWB 2WPLS 2F43B 2FYQA 1S84A 3M5OA 1N8OC 2ZWLH 3O8BA 2HALA 4BAHB 1LQDB 1JRTA 4Q7ZA 2XOKD 4BOHA 1BTPA 3LJOA 2P95A 3ATLA 1O2NA 3KYFA 2O8TA 4B6FA 2KR7A 2BVRH 1TNJA 1GBJA 2ZPRA 1BTYA 4XD7D 1GMDF 1JOUB 1FI8A 1MTWA 1RGQA 1FX0B 1YPGH 1O31A 1TNGA 2QIQA 2BY5X 2ZGHA 3PV2A 1PYTD 1A5HA 4KTUA 1C1UH 1UK2A 1IAUA 1W0ZU 2GVFA 4OS2A 1O3BA 1MD7A 3DHKH 5CHAC 4AOQA 4WMDA 5GWZA 3NRLA 1YM0A 4MPVA 2V35A 4KKDA 2JDID 3UY9A 1TB6H 1EATA 3LJJA 4Y8XA 4ZKSU 1KXAA 2BDAA 2BY7X 1TX8A 2W3IA 1GHAF 3UR9A 5IDKA 3DUXH 3URDA 4X1RU 4JYUH 2ZDKA 2KAIB 2YNAA 2HLDD 8ESTE 3GS9A 2J2UA 2ZG0H 4X8TH 1A4WH 1Q31A 1TA6A 1O30A 1SBWA 1NFXA 3MMGA 2VH6A 3BTHE 3NZIA 4NIWA 3S7KB 4D76A 1UTQA 4HFPB 1C5UA 5EIYA 2UWOA 1A5IA 3QWCH 3T2NA 1UTMA 3LU9B 5HIYA 1A5GH 3B9FH 3BIVH 8GCHG 3SU5A 1VCPA 2BDIA 5K0HA 2QXJA 2ZTYA 2GMTB 3U8RH 1C2LA 3FP7E 3ZYEA 1BMFD 3SGBE 1TMTH 1GMCG 3UQVA 1ANBA 2A5KA 2ZZUH 1GMHG 4NZLA 2WYJA 2CJIA 3ZZAA 2ZU1A 2QN5T 2XXLA 2BD9A 1HXEH 1D3DB 3GCOA 5EPYA 1XVMA 3RXRA 1NZQH 5FPYA 4AB8A 6GCHG 3A84A 1ANDA 2FOBA 5C17A 2ZGXH 2A31A 1O2PA 1P2QA 3KNXA 4F48B 1BTUA 3W1EA 2ALVA 1BTWA 1PQ8A 2A0QB 3MU1A 4A92A 1NRQH 1GHVH 1QB9A 3MTYA 1SB1H 4ZH8A 1RIWC 5A09A 1O2IA 4GSOA 1YPHC 4LK4A 1BTHH 1BBRK 3A8CA 4WH8A 1C2IA 3FP8E 2BXUH 1LMWB 1SGQE 4NWKA 4H4FA 1NU7B 3A7VA 2HNTC 1C5WB 4Y8ZA 3UFAA 2F9NA 1HDTH 3RXEA 1SSXA 1TRNA 2RA0A 1EZUC 1AO5A 1W0YH 3F1SB 3MO6A 1DE7H 4CBNA 1JIMA 4AYYB 2OINA 2OUAA 3FANA 1FMGA 6ESTA 4HI3A 1FNIA 1HB0B 1O3IA 1O2YA 1OKXA 3BTQE 1B0FA 1HJ9A 5HM2A 2HVXA 4SGAE 4WY3A 2PWXA 2XBXA 1F0RA 3E3TA 4DG4A 4Z6AH 2BLOA 4O3TA 1U6QA 3LPRA 1NC6A 1O2WA 1GJ5H 1QRXA 1ZLRA 1D9IA 3CS0A 2NU1E 3GISB 3RC4A 2OQUA 4X6PA 1LHCH 4UE7H 1FIZA 2XWAA 4BTTB 1P01A 2P59A 2QY0B 3BTFE 2VIVA 5HYOA 5TCCA 3ATIA 1IQFA 3G01A 5C1YA 4ABGA 1J17T 3MOCA 2H2ZA 1CU1A 2LNCA 2ZHDA 3A7XA 2QXGA 4Q63A 1RTKA 1L1JA 2Z7FE 2SGPE 3KF2A 2Y5FA 1GI1A 2BMGB 2BDCA 3EA9A 2WPHS 2VIWA 4GAWA 4X1PU 3ZVBA 1B5GH 1QB1A 3RXMA 3PWBA 4FUJA 1Z6JH 1SKYE 1CE5A 1EJMA 3L3TA 1SGEE 2UWPA 2DUCA 3R3GB 3SUGA 2C8XB 1WYKA 5T3HA 5I46H 1YGCH 2RDEA 5T1VA 1V6DA 2BLVA 2P16A 3FZDA 1GGDC 4RN6A 3UNQA 2NU2E 1K0HA 1GHZA 1E1RD 4Y6DA 1MKWH 1TBRH 4RKJB 1L1NA 1O2MA 3SHAH 3UIRA 2BDHA 5H4IB 1C1WH 3BF6H 1FJSA 4H6SB 3RXFA 3SI4H 4ABEA 3JZ2B 1XUKA 1TIOA 3ZVDA 5K7RA 1DY9A 4MNVA 1O39A 3HKIB 3RM2H 1NM6A 1ZZZA 3STJA 5TCAA 1GI3A 1A46H 5CDFE 2V3HH 1EB2A 3QGJA 1WQSA 4ACBA 3EA7A 2QGRA 4BAQB 1GBFA 1KMHB 2AGIX 1C5SA 2UUYA 1EAIA 4ASUD 8KME2 1H1BA 1P06A 2O8UA 3SZEA 1GBIA 5E0HA 2OC1A 4YESB 1VJAU 2GCHF 1EPTB 1P2NA 3GYMA 1WTGH 5DP8A 1K1IA 1UO6A 4TWYA 1SHYA 4Y76A 2VIQA 1BOQA 3SV2H 2ZNKH 1L1GA 3RP2A 2Z9GA 1UHBA 4INKA 2BB4A 3GY2A 1YCPM 1Z8JB 5T6GA 2F91A 5E0GA 1KLIH 3GDSA 1L4ZA 4LZ1H 3H7OA 2Z3CA 2G00A 1X7AC 1EZSC 1GBDA 2F4LA 1AWHB 1L4DA 2D26C 3SNEA 2FESH 2CF8H 2IPQX 3RUOA 1NFUA 2GCTB 3ZZ8A 3PLKA 3A81A 4JYTA 1AKSA 3KCGH 1D4PB 6CHAB 1LHDH 1MTUA 1TGNA 1C1SA 2GMTC 2ZDLA 2TPIZ 1WU1A 2ZU5A 1MKXH 1PPFE 1HBTH 4I8HA 1F2SE 1DICA 2KAIA 1UTNA 1DXPA 3DSGA 3ZZCA 4AG1A 5AF9H 2G4TA 3SZNA 1C4V2 1YYY1 2XCFA 4I32A 4FUBA 3OTPA 1XUGA 3HGNA 1S6FA 1GG6C 4NGAH 3M61U 1CGJE 4K8YA 4K1TA 2J95A 7KMEH 2AFQB 2V3OH 3HATH 1GHBG 1P09A 1ACBE 1YLNA 1AFEH 2LP6A 1ELBA 9LPRA 1RD3B 5EJZA 2Z9IA 3SOSA 3ZZ7A 3A83A 3OTJE 2ZCKP 2M2AA 2THFB 3AW0A 7GCHF 3T27A 4DIHH 1UTOA 1XX9A 2FPZA 2XCNA 1CGIE 2DE9A 3LKWA 1QFKH 1C5VA 1S82A 2GDDA 2WHXA 3A87A 2PTNA 4A6LA 4ISNA 2BOHB 4O03A 2Y80A 1C4U2 2VIDA 3I29A 1KLJH 5A8YA 2BD3A 1LPKB 2WPJS
chains in the Genus database with same CATH topology
2A7HA 1O37A 1EP5A 5C1XA 2VVVA 3CS7A 4E7RG 2JH6D 4ISIH 3PMBB 3MU8A 2K1QA 5DJ7A 3M5MA 4TPIZ 2BVXH 3BIUH 5HXFA 2OP9A 2PR3A 1O5EH 1K1PA 2B5TB 1NFYA 1T7CA 1UJ1A 1S5SA 2Z9LA 3A7YA 3A89A 2QCYA 1T8OA 1HAPH 5JBTA 3CENA 4AFUA 2PW8H 4B73A 2ZCLP 1KXDA 2OCVB 1EKBB 4JK6A 3RMNH 2ZEBA 2FX6A 2O9QA 3SNAA 1OXGA 3SU2A 1J16A 1N6XA 1SLXB 1GHXH 1V2LT 1MAYA 1QL8A 1ZPBA 2LPRA 2R3YA 1GI0A 2EI7A 4Y0YE 3TGKE 1O5CB 1SGPE 4BAKB 1YPKH 1BMNH 1GCTB 1W3CA 1KY9A 4X0WU 1SGIB 1F0UA 1C5XB 1SGCA 2PV9B 3A8BA 2BLQA 2GKVE 2GZ7A 1CVWH 2P94A 3UQOA 5SGAE 1A3EH 2WUCA 2HWLB 1XMNB 1TFXA 2NWNA 3K6ZA 2C8WB 4WXVA 1S81A 5DP6A 3ZV8A 1HYLA 4I8KA 1BMLA 2BHGA 4MDSA 3BG4B 1BUIA 1A0LA 3N7OA 1SG8B 2F9BH 1GHYH 1UVSH 4GVUA 2Z9KA 3AAUA 1LKAA 3FZZA 4NSYA 3ZZ5A 1G2LA 3FFGA 4X1SU 5LGOA 5GCHF 1K1MA 4IC5A 4ABAA 1LHEH 2FOAA 2J34A 4X2VA 1UMAH 3C1KA 1EPTC 1G36A 3GY6A 1BA8B 1ZHRA 3ATMA 3TK5A 1K28D 1A7SA 1KTTB 2BZ6H 4AFQA 2A7JA 2WUBA 1HAGE 1PPHE 2ASUB 2O8LA 1GI4A 2I6SA 3RXOA 4CRFA 1GBBA 4Q80A 1PPEE 3RMOH 4TWWA 1AE8H 2A4RA 2NU0E 4I8GA 3SN8A 4CBOA 3V13A 4D7FA 3FAOA 1ESAA 2P8OB 4TYDA 2SGAA 2OC7A 2QF3A 1PYTC 2GD4B 2ULLA 1EPTA 4XBBA 3RU4D 1AUJA 1DT2A 4DT7B 1C4Y2 5GPIB 3ESTA 3BTGE 1VJ9U 4J1YA 1FZZA 3L33A 1THSH 4TY7A 1N1LA 3RXVA 2WPKS 3P92A 3EE0B 2ZPQA 3GCTF 1VITF 2GCTC 2VINA 3C27B 1ZR0A 1BBRH 2RCEA 2OD3B 4YT6H 6CHAC 2QV1A 1TNLA 3M5LA 1XUHA 3TJOA 4JZEH 2V0BA 3ZZ6A 1P2OA 1C2HA 4MPXA 3VB3A 1IQLA 3RXLA 3Q3XA 4KTSA 1G3EA 1S0RA 5BRRE 1DWBH 5G4BA 1C1TA 2HGTH 1RTLA 1EB1H 2BXTH 1SLVB 3LGYA 1Z8RA 3LH3A 1FUJA 2PSYA 3ZZ9A 1OYTH 1Y3YA 2B7DH 1D3PB 4GHTA 3LGTA 1LDTT 1V2PT 2GP9B 4AG2A 2STAE 3D49H 3TPIZ 2SNVA 1ZOMA 3T62A 5C2ZA 2EI6A 2A2XH 3A8DA 2AGEX 1O0DH 2O8MA 3QDZB 1MU8B 4O97A 1JMOH 1E38B 2QYIA 3SUFA 3ZVAA 3ELAH 2G5VA 1GCDA 2ODYB 3A86A 1RFNA 2SNWA 1BCUH 2AMDA 2FTLE 5BPEA 1BRAA 1SI5H 4MQAA 1ZTJA 2FOHA 3A85A 2FLBH 4UD9H 5EGMA 1ELDE 5ESBA 2H5CA 4KGAA 1ELVA 3MHWU 1QQUA 1GDNA 1P11E 4JK5A 1NTPA 1AHTH 1GI2A 3SV9A 1GVLA 3M5NA 1ZHMA 3KQCA 2SGQE 8GCHF 1BB0B 3A82A 1QRWA 2ZFPH 4NFFA 2FWWA 1G3BA 2BOKA 1Z1JA 3ZVCA 1BDAA 1GMCF 1P02A 3BG8A 3H5CB 3PMAB 3SU3A 1GMHF 1J15A 5EQQA 1OWJA 1VITH 1MTSA 2WINI 3SUEA 4LZ4B 3ENSB 3HGPA 2J38A 5JBCS 1ZHPA 1ANEA 2O8WA 3U69H 1UHBB 1VCWA 3F9EA 6GCHF 4ABJA 6LPRA 1SQTA 4ABHA 4INLA 4K69A 3LC3A 1EJNA 1IQNA 4WXIA 1LHFH 4WVPE 1O2OA 1K1NA 4WMEA 1C1MA 2CXVA 2RDLA 3MYWA 1V3XA 1FAKH 1F5LA 2PKSC 3D65E 3K6YA 3TH3H 5C67A 1GBCA 1UTPA 2ZHEH 3Q77A 4DY7B 1D6RA 4K1EA 4KELA 3RM0H 2GT8A 5ABWA 4I7YH 1FIWA 1FV9A 4H6TA 4UFFH 1AKSB 3V7TA 5DP3A 2AEIH 1LHGH 2ODPA 1GCTC 2FTMA 1Y5BT 5ETXA 3BTTE 2XWBI 3RXPA 2GGVB 1SQOA 4MNYA 1DY8A 4CREA 3RU4T 1NFWA 2CN0H 5AVDA 3VB7A 1QL9A 2B0FA 1C1VH 1W11U 5JBBS 1S85A 1C5RA 4K2YA 3P95A 1ESBA 2ZA5A 1BTZA 1MTVA 1AQ7A 1F0SA 1UCYE 3A7WA 1P57B 3NK8A 2ANWA 4D7GA 1NESE 4DOQA 1SGFG 1AY6H 1H9IE 3E6PH 4B1TA 1ZPCA 4CRGA 1XXDA 3I78A 4U30A 5EU8A 3BG4C 1LO6A 5EPNA 1HAIH 2UUFB 1K2I1 5FX6A 1ZSKA 3AAVA 1RXPA 5DP4A 1GJAB 1OS8A 1DWCH 1MQ6A 1Z6EA 2IOTA 2PGBB 1SGYE 1XKBC 1SL3A 3TGIE 3MH5A 3M36A 4A1XA 1IQKA 3M7TA 2W26A 3PM3A 1DS2E 1DSTA 1LPZB 4FVDA 1TLDA 3RXUA 1MQ5A 4BANB 1HUTH 2J94A 1P2IA 3SU0A 2FYRA 3Q00A 5J4QA 4DVAU 5LPEA 4MPUA 1O32A 1V2MT 2EI8A 3AW1A 5E2OA 1NROH 1GVZA 5FHTA 3SGAE 3A7ZA 5EQSA 1BZXE 3LIWA 1TRMA 4NG9H 3QTOH 5E0JA 2BY9X 4Y79A 4SGBE 2P8OC 1UCYK 2G8TA 3TLOA 2FM2A 2BQ7B 4XBDA 4A1VA 2FS8A 4FUGA 2OBOA 1FLEE 2FMJA 1G3DA 3QX5H 3M7UA 2F83A 3OX7U 1KIGH 1D6WA 2ZGCA 1B7XB 1MD8A 2ZFTA 2XC5A 4Y7AA 1V2RT 5DO4H 5T6FA 1DSUA 1O5GH 3QZRA 5FBIA 1IQHA 3SU1A 4RKOB 4I31A 2G81E 2ZFSA 3OY5U 5JDUB 1GWAA 3SO3A 2BD8A 1HIAA 3MU0A 1GDQA 2G55A 2VH0A 2WYGA 4B2AA 2VGCB 1BMMH 2BM2A 5EOKA 5EG4A 1DUEA 2ZQ1A 4ZMAH 2BDYA 3TU7H 3EA8A 2A4OA 1F5KU 3F6UH 1O2RA 1O3FA 1SGRE 1P04A 4GCHG 1XVOA 3MH6A 2ODQA 1VZQH 1ZMLA 1K1JA 2ANKH 1RJXB 2HLCA 2ZDNA 3KQEA 1H9HE 1H9LB 3UNSA 2J92A 2TGDA 2VWNA 3VXEH 4IN1A 1TNKA 3K2UA 1LCYA 2VU8E 1AFQB 3UTUH 2G51A 4CR9A 1GBEA 1Z8GA 4XOJA 1MZDA 1PPGE 1Z71A 4MNXA 1AE5A 3QLPH 3TGJE 2BZAA 1QBNA 1AVWA 2ZC9H 3UNRA 1S83A 5DGJA 3V0XA 2J9NA 3OU0A 1YPEH 5DG6A 3LC5A 1Z8IB 4ABIA 5CE1A 4WMFA 1TOCB 2QA9E 3PB1E 5L30H 3S9AA 1HJAB 1YBWA 4NA7A 2F3CE 3DA9B 3KN2A 3TK9A 1W7GH 1SGFA 3GDUA 4J2YB 1QJ1B 2FOMB 2UWLA 1C9PA 1EASA 3DFLA 1HPGA 1QCPA 1TA2A 4B74A 1BQYA 4NIYA 1TGBA 5GJ4B 4D8NA 3TK6A 5GIBA 3UWJH 4X2WA 1GHBF 3U8TH 2ZP0H 3MFJA 3SNDA 1W8BH 1FN6A 1UTKA 1C1OA 2H1UA 1TYNA 1ABIH 2GTBA 5LPFA 1F92A 1P12E 1UVTH 1XUJA 1TWXB 3TH2H 1FPCH 3P8GA 1G37A 1K22H 1YPJH 1IHTH 1EP6A 2SGDE 3A80A 3EGKH 3TJUA 3F9FA 3SNCA 3NUMA 1QA7A 1M9UA 3VGCB 4JCNA 2WV4A 1W2KH 3E91A 1O2ZA 2FOGA 1HRTH 5I25A 2SFAA 1V2OT 2XC4A 2H5DA 1TPOA 4NA9H 5PTPA 4MNWA 5A0AE 3M3SA 2XC0A 1O2HA 5EODA 2TGAA 2BD4A 4HZHA 4IMQA 2P3FH 4O3UA 4THNH 4IMZA 1P2KA 2OTVA 2XYAA 1YLCA 1W13U 4CH8B 2VIPA 4ZHLU 2Q6FA 1SR5C 3TJNA 4AORA 3LGWA 2PSXA 1QA0A 2W7UA 3A7TA 1GBLA 4ZHAA 1ZGVA 3QGNB 4BTIB 3RXCA 2GV7A 1CSOE 3E0PB 4ZKNU 4IW4E 3RXDA 4TY6A 2ZFRH 1AB9B 2ZHWH 5E8EH 4KTCA 2A4GA 3A88A 4A1TA 1O5BB 2XBVA 1CT2E 3BTEE 2ZHQH 2FO9A 5A8XA 4CH2B 4YZUA 5JB9S 1FN8A 1TABE 5L6NH 3GY5A 3GYLB 4TPYA 1Y5UT 1VCQA 5EXLA 3CP7A 2FOCA 3T28A 3RXTA 4B2BA 1SOTA 4ISOA 1HCGA 1O2UA 2STBE 2CGAA 1HNEE 4GLYA 1ORFA 3MI4A 1GI5A 4FUIA 1INCA 1GI9B 3RLWH 3LH1A 3KGPA 3QK1A 4CRDA 4AYVB 4ZHMU 5T6DA 1NRPH 1DVAH 2ZTZA 1MAXA 1ZRBA 1P03A 1GJCB 4YTAA 1HAHH 1C2JA 2VNTA 1O2VA 1PQ5A 1AGJA 3LGUA 3M35A 3UOPA 3MH4A 3SJ8A 3O8DA 1O3CA 1ZGIA 4BAMB 2AH4X 1V2KT 1DLKB 3FP6E 4IBLH 1YPMH 3MO9A 1ELCA 1FPHH 1FY5A 3MU5A 2TRMA 2QC2A 1NRRH 4GHQA 4OGXA 3RXAA 2BLWA 1QURH 1YCPK 1HAXB 1CGHA 1A61H 1G3CA 2ZTXA 3SW2B 3MH7A 2Y6TA 1V2VT 4BTUB 1EX3A 1AMHA 1WQVH 1LTOA 1TPAE 5F8TA 4E7NA 1O2KA 1ID5H 4CRBA 1AI8H 1DWDH 1KXCA 3DD2H 2VGCC 1T4UH 4YM9A 1EAUA 2P93A 1O3LA 2WPIS 3E90B 2GZ8A 4XFQA 4ABDA 1A1RA 1N6YA 2IPHA 1TBZH 2A2QH 1KLTA 4RSPA 1O3EA 1O3AA 4X8SH 1ELGA 3F68H 1IQJA 1QB6A 5FX5A 1GVKB 1ZTKA 1W7XH 2TGTA 1YP9A 3SV7A 3Q76A 1CHOG 4ZUHA 3LGVA 5C5OA 1C5QA 1KDQA 1TRYA 3NKKA 5DPAA 1O38A 1ZPZA 3NPSA 1AFQC 1PPZA 1KYNA 1GI8B 1C5MD 1ZMJA 1V2JT 2C90B 4A5TS 4BAOB 1ZMNA 2ZKSA 2VVCA 1C5PA 1DOJA 2A1DB 3RMLH 2ANYA 1FY1A 2HPQH 2FOEA 1O2SA 7ESTE 3BTME 3KQBA 3MNCA 1HJAC 3EAJA 1WBGB 1AD8H 4OS4A 1MUEB 1A0HB 3GY8A 1GDUA 1XUIA 4ZXYH 1T32A 2ZECA 1O34A 1AVXA 4X8UH 3S9BA 1CBWB 3TJVA 8LPRA 2VWMA 3T26A 2FIRH 2ZU3A 1C2KA 4GUXA 1EUFA 1OSSA 3SJ9A 4X6MA 3K65B 1G32B 2TBSA 2AYWA 1P05A 2TIOA 3MNXA 4DURA 2BY6X 1LVBA 3Q3KA 1O2LA 1Q2WA 3DT0H 3RMMH 1C1QA 3SI3H 4AGKA 1PPCE 1GBHA 1GJ8B 3PV4A 4XSKU 3P8FA 2SGEE 3VEQB 3VGCC 2Q6DA 3NCLA 1ARBA 1P3CA 3BN9A 4MVNA 5EXNA 5GDSH 1NRSH 2CF9H 3HK3B 3KL6A 2F9VA 1UTJA 5EW2H 1Y59T 2R3UA 3H7TA 1EAWA 2ZFQH 1GJ7B 1O36A 1SPJA 1CT4E 2VVUA 5GXPA 1W14U 4ASHA 1GBKA 1TX7A 4CR5A 1HIAB 1TGSZ 1C2MA 2FS9A 3JZ1B 3OSYA 2XW9A 1UCYH 3SORA 1H4WA 1O3JA 1ETSH 3RDZA 4HTCH 3WY8A 2FI4E 2Y82A 4FVBA 3OY6U 1V2NT 1C2DA 1IQEA 1P2JA 1QNJA 3RLYH 3S9CA 2BY8X 4UFEH 3TIUA 1HAOH 4I33A 1NY22 1D3QB 2AERH 4LOYH 5JB8S 3ODFA 5F8ZA 5C1UA 1WCZA 1AB9C 2QXIA 5C20A 1KXBA 1P10A 2EA3A 1TPPA 4AX9H 1LVYA 4JZIA 3VB4A 1GJDB 3D23A 2AIQA 1FONA 2BVSH 1UVPA 2GDEH 5A0BA 1LPGB 1TGCA 1GBTA 4AGJA 2PUXB 1EZQA 4A7IB 1KSNA 1A3BH 4WJG2 3UREA 3TH4H 1BJUA 1SQAA 3RXBA 2BDGA 1QY6A 2FZZA 3BEIB 3GY7A 2ZU4A 1L2EA 1L0ZA 4F49A 1BRUP 3ZYDA 4FUCA 3U98H 1ARCA 3LT3A 3VPKA 4OS5A 1J8AA 2IJOB 3ITIA 1NN6A 2JETB 1IQMA 3SQEE 1K21H 3E1XB 4U32A 1QR3E 3KHVA 4UFDH 1MBMA 9ESTA 1XXFA 4AFSA 4DGJA 4NIXA 1O3MA 1RS0A 4Q7YA 1PJPA 1ANCA 1T31A 2OXSA 1O3NA 1GL1A 1TAWA 4K8BA 3M7QA 1MU6B 3LDXH 3PTBA 3M37A 2PHBA 4WF8A 4ISLA 4IGDA 1GI7B 1GJ9B 3HPTB 3P17H 2VIOA 1V2ST 3SHCH 1EAXA 1YKTA 1C5ZB 4X1QU 4XDEA 2V6NA 2QXHA 5AFZH 3VXFH 3T29A 2AGGX 2H9HA 1TE0A 5AFYH 2NU3E 3MO3A 2FP7B 4OS7A 3E0NB 4GPGA 1E35B 3IG6B 2A45B 5F03A 3SJIA 1RRKA 4X1NU 3ATWA 4JZDH 4OGYA 4FU7A 1BRCE 5CMXH 1O5FH 3SU4A 1A0JA 4Q7XA 1TOMH 5HMAA 1OX1A 1O2QA 1CHGA 1F7ZA 4FXGH 1BBRE 4R0IA 1O5DH 3LOXA 4ABBA 2VJ1A 2EC9H 4MLFB 3GCHB 3IWMA 3KIDU 4Q2KA 3V12A