1GBTA

Structure of an acyl-enzyme intermediate during catalysis: (guanidinobenzoyl) trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Structure of an acyl-enzyme intermediate during catalysis: (guanidinobenzoyl)trypsin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase(serine proteinase)
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1991-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbtA02
5FCKA 1SPJA 1AB9C 1GWAA 3HPTB 2ODYB 2A0QB 1KLJH 4DT7B 1JOUB 1G2MA 3V3MA 1O5CB 1P2NA 4K8BA 5C5OA 1MQ6A 1GBAA 1SR5C 3VFEA 1V2TT 1D6RA 2D1JA 3GY8A 5F8ZA 1LKAA 2BDBA 1TOCB 4U30A 2RDLA 3HK3B 1TNKA 1SMFE 1A1RA 2F9NA 3SU4A 1FDPA 1RJXB 1HUTH 1IOEA 7GCHG 1SSXA 2A2QH 1A2CH 3BTFE 2R0KA 5AHGH 1AY6H 1NPMA 2PKSB 1CHGA 1MUEB 3KGPA 2FOBA 2P3TB 4Q7ZA 2Y80A 1PYTC 2A1DB 3FZDA 2ZO3H 2OC7A 3UQOA 2BDGA 1T31A 4YLQH 2J38A 5DG6A 3B23B 2CMYA 4CH2B 1MQ5A 3QTVH 1NFWA 3RXPA 4X1SU 4H4FA 3K6ZA 3SV8A 2BVSH 3U69H 1P2KA 1VR1H 2PUXB 5PTPA 1BRUP 1Y5UT 3TK6A 2NU2E 2PGQB 2OQUA 1GBLA 2P8OB 4DW2U 5EQRA 2FOAA 3BTKE 3T2NA 1N8OB 1C1QA 1CT0E 4CHAC 2W7UA 2ZC9H 1SHHB 1VITG 2Y7ZA 1K21H 4LXBH 1CHOF 1G3CA 4O97A 4Q2KA 5DJ7A 3SN8A 4NIXA 1MTNB 1NFUA 3MI4A 3LH1A 3ZVBA 3SV9A 2Z9GA 4MPXA 2IOTA 3RXGA 3M37A 1SC8U 1SB1H 3OTJE 2XCNA 3PMJA 3SHAH 1GBTA 4AFZA 3GCHB 1AIXH 3VPKA 2ANKH 3BTDE 3M36A 1D3TB 4NIYA 3OU0A 1QB1A 2XBYA 3P95A 1F92A 1FQ3A 4O03A 3M3SA 1A4WH 1OOKB 1GHVH 2STAE 5FCRA 4ABHA 4PROA 4UD9H 6CHAB 3SV7A 4OS5A 1G3BA 4ABDA 1O2NA 1AKSB 3GCTG 4E06H 2W5EA 2FTLE 2HALA 5JBTA 3LOXA 3BG4C 3SGQE 1HAPH 1KTTB 5FXLA 2VVUA 1KDQB 5BRRE 1TPAE 1QRXA 1K1NA 2ZPSA 2GTBA 3HGNA 4SGBE 4NSYA 1O32A 3OX7U 3OYPA 1TA2A 1GI0A 2H9HA 3GCOA 1O3NA 5ETXA 3T28A 1DXWA 1QB6A 2A31A 5CMXH 2GCHF 1V2KT 5E2PA 3TIUA 3E1XB 1DLKB 1O2YA 1YF4A 1BT7A 5GXPA 3A7ZA 2QA9E 4HZHA 1HNEE 3UNQA 4HGCA 3A8CA 1Z6JH 1MAYA 3M35A 4QT8C 2SGQE 4CR5A 2D26C 2B9LA 1ZJDA 5EODA 2WYJA 1GMDF 3A7WA 2RA0A 2OUAA 2ZTZA 1PPEE 2ZFQH 4R8TB 3CS0A 4NA8A 5A8ZA 3E91A 1KLIH 3SO3A 1IQIA 1QTFA 4GCHF 5DP3A 1T8MA 1O2QA 3RU4E 3A7VA 1IQMA 1UVTH 4BTTB 1P3EA 1MKXK 4B2CA 1HRTH 3C27B 1W7GH 2BD3A 5K0HA 1ZYOA 7LPRA 1GBJA 3QGJA 5EQSA 1H4WA 4X8TH 2QV1A 3TJNA 2BM2A 3DUXH 3ZVAA 5A0BA 3MU4A 4X8VH 3BTWE 1WTGH 3SU5A 4ABAA 1NFXA 1ZZZA 3MU8A 1K1JA 2FI3E 2PW8H 2THFB 3HKIB 3LJJA 4BAMB 4OS6A 2BQ7B 4JZIA 3U9AH 4ZAEA 2A7JA 2UUKB 1PFXC 2RA3A 4ABGA 4ZXYH 2Z3CA 2F83A 2OP9A 1G30B 1W12U 2ZHWH 4B2BA 3CP7A 1TNHA 3ZVFA 2HGTH 1OWIA 5CHAB 8GCHF 1GI5A 4KP0A 1S6FA 2P59A 2Z9JA 3IG6B 1Y5BT 2GCTC 1QB9A 2ESTE 3RXLA 1HAGE 2AMQA 1GJBB 3A89A 4X2YA 3RXAA 4YM9A 5DKMA 1A3EH 1TRYA 5C3NA 3BTEE 9LPRA 4IS5A 5C1XA 2FOEA 1O3CA 2F9BH 1YCPK 1XKAC 4GSOA 1O2MA 2BTCE 1LVYA 1NRRH 1ZLRA 2AERH 1ZGVA 2B5TB 3EAJA 4IW4E 2XWAA 2A5AA 1TRNA 4K69A 4D8NA 2V3OH 1QRZA 4Y76A 1EJNA 1C1VH 4ZHMU 1LPZB 1O31A 3LC3A 4UDWH 4Y11E 3KL6A 2BQ6B 4MPUA 2WPIS 1DLEA 1S81A 1P06A 3DFJA 4JYTA 2FDAA 1C2IA 1JBUH 3SU3A 1CA0B 1W0YH 4B73A 2VIOA 5G4BA 4I32A 1Z1IA 1YCPM 3GY4A 2C8WB 2W26A 2SFAA 1IAUA 2HLCA 1P0SH 2BY5X 3GYLB 1ZMNA 4A1XA 3SQHE 1YPLH 2AH4X 2A4GA 4FUCA 1HAXB 1QQ4A 4Q80A 1GVZA 3E16B 5EPNA 2F3CE 1FY4A 4Y7AA 1V2UT 4FU9A 4A1TA 2VVCA 3L3TA 1TE0A 1QY6A 4RSPA 3TJOA 1MH0A 1TLDA 2W3KA 1DT2A 1X7AC 1HAHH 2J92A 4FU7A 1ESBA 2ZU4A 3GY7A 3MU1A 5C5NA 5J4SA 2ZF0H 3SOSA 2ZDNA 2ULLA 2AS9A 1FIWA 2FMJA 1BZXE 1XVMA 3H7TA 1HJAC 4CRBA 1PPGE 1Q3XA 4YLUA 2O8MA 1EAXA 2CV3A 3M7UA 1TA6A 1DANH 3A82A 1BTUA 1NRPH 1Y3UA 1DWEH 1K1PA 3TH3H 1GJ8B 4JK5A 1TMBH 1QURH 3SV2H 5L2YH 4FUDA 2BYAX 2QY0B 1YGCH 1UVOA 3GY6A 3KNXA 1FI8A 1GVKB 4DURA 4NGAH 3TH4H 1D3PB 4KELA 4K5ZA 1KXCA 1TONA 2FOMB 3P17H 4K2YA 1GJCB 1L1NA 3B9FH 1P12E 1SLVB 1PPZA 3SJ8A 4IN2A 1T7CA 3ZZ3A 2GZ7A 5EXMA 4TY7A 1SGPE 4X6NA 1UTQA 3ATLA 4I8KA 2J2UA 1NESE 5JBCS 1FV9A 2BD7A 2C8YB 1TBZH 1RTLA 3G01A 2V0BA 4RKJB 2IJOB 4WMEA 1BJVA 1ZSJA 2HNTE 3FP8E 2ANYA 1NROH 1SGRE 1O2RA 4XBBA 3BEIB 1CSOE 1K1LA 1UTNA 1AGJA 5IYTA 1Q2WA 2SGAA 3BIUH 4AGJA 4AZ2B 2ZIQH 1BBRH 1QJ6B 2WPJS 1Y5AT 3ZVDA 1V2QT 1C9PA 1S85A 4ZKRU 3C1KA 2OTVA 2PTCE 1GMHG 1A0JA 3P8OA 3ZZAA 1QA0A 1KXDA 2BX4A 5B6OA 1UK4A 1YLDA 2IPHA 3ODFA 3RC5A 1ZPCA 3MU5A 4Y8XA 2QF3A 1HPGA 3T29A 2WPHS 3M5OA 1ELVA 3ZZ8A 4FVDA 1C1OA 1NRQH 5CE1A 1P3CA 1XUIA 1HGTH 2R0LA 3O8DA 2LNCA 1EAUA 1F0UA 4GLYA 4B74A 1DE7H 4BAKB 1MTSA 1ABJH 3QZQA 1EB2A 1K28D 4E7NA 1O3OA 3TITA 3AW0A 3A7YA 4NIVA 1THPB 1T32A 2VIWA 4NA9H 1NTPA 1J9CH 3V7TA 2ZHQH 4XSKU 3GISB 4DVAU 1D3DB 1UTLM 4AB8A 4I33A 1C5RA 2VWOA 5E2OA 1JXPA 1C1NA 1O5FH 2ZFTA 4INHA 3U8TH 4XDEA 1EZQA 1GJ7B 2PKAA 2BXTH 4GUXA 1CBWC 1TX6A 4OGXA 1LVMA 1RFNA 1TGNA 3LC5A 2OBOA 1C2EA 1AU8A 2V35A 1C5MD 2A7CA 1ZMLA 3ZVGA 5TCCA 1GI2A 3MU0A 2FOGA 1SGEE 2JKHA 2ZCLP 2WUCA 1P04A 3TJVA 5E8EH 2QCYA 2DE9A 1QJ1B 1PQ5A 1ABIH 1ZTKA 1NN6A 1XMNB 1CA8B 2F9UA 3QLPH 3DD2H 1EP5A 1E36B 4CREA 3GCNA 1DXPA 2FESH 3RXCA 4AFQA 2AEIH 3EE0B 4BTIB 4FU8A 5EXNA 3M61U 1BIOA 1TPOA 3Q77A 4MNXA 4VGCB 2O8TA 1NS3A 2BXUH 2Y6TA 4Y8ZA 1DY8A 4WH8A 4Y71A 1W14U 2H1UA 1ESAA 4GHTA 2NU1E 1GBEA 1RS0A 3RXEA 2QXJA 1C1PA 1TNLA 2QXHA 4NZQA 1ZHMA 3SJ9A 4CHAB 1P2QA 2ANWA 2XW9A 1OYQA 1AUJA 4JCNA 1GBDA 3PROA 5EU8A 1AVGH 2CGAA 2YNAA 2ZNKH 1YM0A 4B1TA 1C5QA 1FIZA 1MZAA 2BD8A 1TMTH 1ZR0A 2BVXH 1ZPZA 1C4Y2 2FS9A 1GJ6A 1P02A 1IQEA 3ATWA 2CF9H 1LPGB 1O2XA 3KN2A 5DP6A 3SZNA 4XOJA 1HXEH 1G9IE 2SGEE 3F9HA 1C1TA 4HFPB 1EKBB 3P8NA 1T4UH 1TB6H 3I78A 5J4QA 2G4TA 5EXLA 1CT2E 5ABWA 2O8WA 1JWTA 1SGIB 3LGWA 1G36A 2G00A 1LHCH 3RXTA 1GVLA 1O33A 2GT8A 4ZUHA 3UOPA 3BG4B 2JETB 1H9LB 2VINA 4I31A 3QDZB 4D7FA 2WPLS 1TAWA 1SGYE 1WBGB 2K1QA 1NU9A 3H5CB 1SQAA 2BDCA 1UMAH 4AGKA 1XUFA 5TCAA 1KXBA 1TFXA 2QXGA 3MH4A 2UWOA 5DP9A 3GY2A 2XBXA 2XC5A 1D3QB 3TGKE 1A5IA 1O3JA 2A5KA 4INLA 1V2OT 3BTQE 1KSNA 1MTUA 3RLWH 4NZLA 5T6GA 2GCHG 5EW2H 5E0JA 1ELDE 2ANMH 4Y8YA 4AORA 1C4U2 2IN2A 1GHBG 3LGIA 2A4QA 1ZTLA 4BTUB 2Z3DA 1BBRE 5DP7A 2Z3EA 3U8RH 4ZKSU 1TALA 1TPPA 2BDHA 5I46H 1F0TA 4BAHB 4DCDA 4JMYA 1GMDG 2HNTF 4FUIA 4ZHLU 3SBKA 1BB0B 1ZHPA 3A84A 4X2WA 1HXFH 4GCHG 2CHAC 4YTAA 3CENA 4JZ1A 4CRDA 1QCPA 2VGCC 1O2ZA 4FVBA 5DP4A 3UNSA 1P01A 3A88A 3QTOH 1O5DH 1AUTC 2BZ6H 4Y79A 1O2GH 1UTJA 1SGCA 1O36A 3UQVA 2ZECA 3Q3YA 3FVFB 4O3UA 1AFQB 1SGNE 4BAQB 1O35A 1SFIA 1O2IA 2ZDMA 3SNDA 1PQ7A 3ZZDA 2WV5A 2ZGHA 6GCHG 1GHWH 2G5VA 1UK2A 2J4IA 1DWDH 4WJG2 4BXSA 3SUDA 1O2VA 3MTYA 4ABIA 1GDNA 1Z8GA 3VEQB 1BOQA 2ZU5A 1GGDB 4AG2A 1HYLA 3MH7A 2QGRA 3PYHA 2BDIA 3F68H 2RG3A 3PM3A 3SNBA 3DHKH 2GCTB 1ZOMA 2AMPA 4JZDH 8GCHG 2AIPA 3S9BA 1BDAA 3A81A 1WQSA 1EUFA 1B0EA 1BTYA 4IMZA 1OP0A 3M3TA 3OSYA 1S0QA 1WUNH 3VB7A 3F9GA 1GBFA 1E37B 2BLQA 1BRBE 1BTXA 2GD4B 5FX6A 4FUFA 3VGCC 3F9FA 5JBAS 2QAAA 1P9SA 3GOVB 1EOJA 1GJ9B 1V3XA 1IHSH 1AFEH 1O3AA 1G3DA 2Y5FA 3LIWA 4F49A 2ZDLA 4YT7H 2GMTC 1UCYK 2Z9LA 1IQJA 3RMNH 4X8UH 1DVAH 3UFAA 1O3HA 1C5XB 2BB4A 2R9PA 1PPFE 1O37A 1MKWK 2R2WU 4ESTE 5FPSA 2D8WA 4K3JA 3TK9A 1S84A 3B8JA 4AYYB 3Q00A 1O3PB 2UWLA 1TGCA 1DUAA 3K65B 1CE5A 4O3TA 4KGAA 1GHBF 1Y59T 3BTGE 4WXIA 1DPOA 2M5TA 5H4IB 1Y3VA 2ZU1A 1ZRKA 2A32A 3PB1E 1EQ9A 4OGYA 3FP7E 1HDTH 2PSXA 4RN6A 2BLWA 3SUFA 1GJAB 4I8HA 1MU8B 3LT3A 4BAOB 2F9PA 1O2UA 2P3UB 1CGHA 3TPIZ 1ZTJA 2BMGB 1V2VT 1TIOA 3RXKA 3T26A 2PKSC 1W7XH 5A0AE 1A61H 2BHGA 5GCHF 4ISOA 3QX5H 2AIQA 3M7QA 4KTUA 2XWBI 1HAOH 2BD5A 4WY3A 3IWMA 1ELTA 2OC8A 5EOKA 3V0XA 1O3FA 1ARBA 1HJAB 3BEUA 3K9XB 1QNJA 1AMHA 2EEKA 1E38B 4K1EA 1TABE 2XBWA 1TNIA 2QF0A 6GCHF 1HFDA 3NPSA 2BOHB 1AQ7A 2FOCA 3FZZA 3URCA 2ZKSA 3S9AA 3MNBA 1O2SA 3EYDA 2BD4A 3P70B 4YOGA 1BUIA 5LPRA 2H5DA 4ISIH 1MKXH 3FANA 3KQBA 3UOUA 4GVUA 5AVDA 1INCA 4Q7YA 1KIGH 1NY22 3NUMA 1YPEH 1LHEH 1C5YB 1C1UH 1MZDA 1UTOA 3HATH 2C93B 5DO4H 3IITA 2BY9X 2D2DA 1D9IA 1P8VC 2F9OA 2HWLB 3O8BA 1ZGIA 2PV9B 4CH8B 5FPTA 3ZV9A 3HGPA 3BTME 1S83A 2P16A 4K1TA 1V2RT 4LK4A 3VXEH 1LO6A 1EPTC 1LDTT 2ZGBH 1Z7KA 1PQ8A 1V2MT 1YC0A 4IGDA 2G51A 2CF8H 1EAWA 1RIWC 1YLCA 1YPKH 3UWJH 3EGKH 3GDSA 2BY6X 1K2I1 2J95A 1DDJA 5E0HA 1VGCB 2DUCA 2HOBA 1GBHA 4O9VA 2ZI2H 1FY5A 5JPMH 3R0FA 3D23A 1DICA 1GCTC 3A7XA 3TLOA 6LPRA 6CHAC 4IBLH 1C2FA 1FUJA 5DK1A 3M3VA 1ETTH 3RLYH 1Z8JB 1MAXA 2PTNA 3ZZ7A 1BTWA 4B71A 2NWNA 1Z6EA 4A6LA 1J16A 1ETSH 1SGFG 3UR9A 2ZEBA 1EPTA 1ACBE 3TNTA 4BANB 1B7XB 3TJUA 1ESTA 1IHTH 4WWYA 1EX3A 1O5AB 9ESTA 3RXUA 2SNWA 3PWCA 1Q31A 2C4FH 3MO6A 3OY6U 1RTKA 5FPYA 1EJAA 5F03A 1KLTA 2CXVA 4Y6DA 4Y10E 3QK1A 3P92A 3RMOH 3E0PB 4JZFH 4WMDA 1GI6A 2FXRA 1LCYA 2ZCKP 2VB0A 1FAXA 3GDUA 1C1SA 1BTPA 2PKAB 1IQGA 1G37A 4OS2A 2TGAA 5L6NH 4K60A 3BSQA 3ZYDA 1GBBA 1UO6A 3SUEA 1GI3A 1C5WB 2FOFA 3A87A 1QBNA 3PMHB 3VB3A 4MTBA 1P9UA 2ZG0H 1PPBH 4BNRA 4B75A 2XCFA 5GWZA 3STJA 5SGAE 1H8IH 4TYDA 1WSSH 1GBCA 2EA3A 3A8AA 1O3EA 1E0FD 2KAIA 1QJ7B 4D9RA 1DSUA 4I8JA 2VWMA 1LHDH 1GHZA 1MBMA 1JRTA 1CQQA 1TGTA 3U98H 3F6UH 2YOLA 3RXDA 3MH6A 1ORFA 1JMOH 3S7HB 2SGFE 3E90B 2Y82A 1GHXH 4A7IB 4AN7A 1LVBA 3PV4A 4B2AA 1L4ZA 1LVOA 1OP2A 1EJMA 1YPMH 2HVXA 3OY5U 3TH2H 1H9IE 4A5TS 4CBNA 4TPYA 1K1MA 1O2OA 2H5CA 1HIAA 1ELBA 1NM6A 1DM4B 4NFEA 4FUJA 4NIWA 8KME2 2BOKA 1XUGA 3FFGA 3MO3A 5A0CA 1FY8E 2TIOA 1EAIA 1VJ9U 1XX9A 1CGJE 1HAZB 1C4V2 1TYNA 3ESTA 1Y8TA 2Q1JA 2WINI 2GV6A 2PSYA 3E6PH 1UK3A 2Z94A 2C8XB 1TQ7B 3ITIA 5CHAC 1OPHB 5JB9S 1ANBA 2XYAA 2XTTB 2ZU3A 3PMAB 3PTNA 2VIPA 3S9CA 1Y3WA 1O3BA 1UTMA 3Q76A 2I6QA 3T25A 1UCYE 5GPIB 1S6HA 1MD8A 3UIRA 5DP8A 3VB5A 1CU1A 1DOJA 5HMAA 3MNCA 1GHAG 2QIQA 4XBCA 4UFGH 1DWCH 4J1YA 1NO9H 2NU4E 3TNSA 4X6MA 2GDDA 4ABFA 1GL0E 1J8AA 3BF6H 2BDAA 4F4OC 1XUHA 1A5GH 3RC4A 1E34B 4ZXXH 1CT4E 1XXDA 1ANEA 1EB1H 2FYQA 1ID5H 4KTCA 4H42U 1OWEA 2RCEA 3HKJB 4MDSA 3GYMA 1OWKA 2FX6A 1O5EH 1Z71A 2FOHA 2Y81A 1F0SA 3UREA 3K2UA 3PO1C 3ELAH 4WVPE 1A46H 3ZZ5A 5ESBA 1FLEE 1MCVA 1SFQB 3KQEA 3TK5A 1AB9B 2FI4E 3D65E 3Q3XA 4TWYA 1SG8B 1H8DH 1QFKH 1O2KA 1RD3B 2H6MA 2EC9H 3UUZA 2FWWA 3MH5A 2EI6A 2Y7XA 5JDUB 1IQLA 4FUHA 2OC0A 1ZRBA 2NU0E 2CN0H 2G8TA 2Y5HA 2HPPH 2ZPRA 1P03A 3WY8A 2G5NA 3RXSA 4DJZB 5LH8A 2GX4A 1TGBA 3BTTE 1YYY1 1C5NH 3L6PA 4AOQA 2ZDKA 1DFPA 2GT7A 3NCLA 1VCWA 4NCYA 3RM0H 5A8XA 3MFJA 5EG4A 4NWLA 4ABJA 1GI7B 1O34A 2OINA 2BX3A 2SNVA 3SW2B 1A0HB 2ASUB 4ISNA 3RXJA 1YPHC 1ZPBA 1PQAA 4NFFA 4UFFH 2HPQH 3L33A 2I6SA 1ZMJA 3ZVCA 1C2GA 2ZFPH 2XBVA 1NFYA 1HV7A 4YT6H 1V2NT 3S7KB 3RXMA 1SLUB 1MMJN 2HNTC 1O5GH 3V12A 1SVPA 3SJIA 4I7YH 2GZ8A 2AGIX 3SJOA 3A85A 1O3GA 3CS7A 3H7OA 3SNAA 4FUGA 5F8XA 1O5BB 3MHWU 4LOYH 2G52A 4WF8A 2UWPA 3FP6E 3ODDA 2EI7A 1QIXB 3DA9B 1QR3E 2A2XH 3QN7A 1HJ9A 4Z6AH 1GHAF 2OLGA 2J9NA 1GBMA 1TBQH 2QYIA 1WCZA 3M7TA 2H2ZA 4D7GA 1K1OA 1O2WA 4I8LA 4LZ4B 4THNH 4X0WU 4CBOA 3A8BA 1M9UA 1O2TA 3P8FA 4DG4A 4TY6A 1F2SE 5HXFA 5C1UA 2WV4A 2NU3E 4Q7XA 3ENSB 1BMLA 1QBVH 1AWHB 1MTWA 3SNEA 1FN6A 1UVPA 4XE4A 5A09A 1C2HA 1DUEA 1FN8A 1E35B 2GP9B 2BD9A 3PLBA 3PLKA 1GI1A 2WPKS 5HM9A 2Z9IA 3HK6B 5F6MA 1HBTH 1FNIA 2A45B 2FI5E 3EA7A 3RXOA 1O3KA 3VB6A 4ABBA 4K1SA 3KQCA 2FO9A 1BJUA 2ODPA 2TBSA 2YNBA 2ZWLH 2R3YA 2Y5GA 2VIQA 4M7GA 1OWHA 5GIBA 1AVWA 1EASA 3VXFH 1ELAA 3PLPA 2OCVB 1GL1A 4A92A 1SBWA 1Y3XA 3I77A 2DE8A 1F7ZA 2BY8X 3BG8A 4XBDA 3QWCH 1G32B 1GG6C 2A5IA 3MNSA 4Y0YE 1TOMH 1T4VH 2G81E 3DFLA 3T5FH 1QL7A 1WYKA 1Z8IB 3SNCA 1BHXB 5I25A 2G4UA 5GDSH 1C5SA 1LHFH 3SUGA 3SJKA 1NZQH 4RKOB 1HJ8A 4UFEH 2VJ1A 3NZIA 3SU2A 1C5PA 3JZ2B 1W8BH 3I29A 1KXEA 3MNXA 3ZYEA 1SGTA 1HAVA 3A7TA 4NSVA 2FX4A 1O2PA 1ELCA 1LHGH 1WOFA 4U32A 1BTZA 3K6YA 1KTSB 2TGDA 1ETRH 2WPMS 3BV9B 2VWNA 2CJIA 2Q6FA 2BLOA 5GCHG 1QQUA 1EXFA 3ATKA 8LPRA 4ABEA 1F0RA 1FONA 3EQ0H 5HM2A 1O3LA 3E3TA 1QBOA 1T8LA 5AF9H 4MNWA 1N6XA 3KEEA 5F8TA 5EGMA 1HAIH 3UR6A 4ZMAH 7KMEH 4VGCC 4CR9A 2GKVE 1N1LA 1AE5A 3W94A 1TMUH 2ZHEH 1BQYA 4GHQA 4JYVH 1RRKA 1W10U 3EA8A 1TNGA 5C67A 1AD8H 3SI4H 4FUEA 1P2OA 1FZZA 5JBBS 4INKA 3ZZ4A 1C2DA 1UHBA 3QZRA 5L30H 1PJPA 1XUKA 1KY9A 1SQOA 1PPCE 4AFSA 2TRMA 2P93A 2FIRH 2O8LA 1G2LA 1T8OA 2XNIA 5FBEA 1C5LH 1GI8B 2GV7A 5LPFA 3NXPA 4NWKA 2ILNA 2BDYA 1EPTB 1J14A 2XC4A 4ZROA 1DS2E 3A80A 1W3CA 1ANCA 3LGYA 2Z9KA 2ZQ2A 3ZZBA 1GBIA 2VH6A 3EDXB 8ESTE 3LU9B 1RIWB 3KF2A 1OX1A 2ZFSA 5K7RA 3M5LA 4E05H 2BY7X 1KXFA 4DIIH 1IQNA 1AWFH 2P94A 1ARCA 2TPIZ 1GCTB 1TRMA 4D9QA 2BLVA 1CVWH 5ESTE 2ALPA 1TBRH 3S69A 1S5SA 1P05A 1TX7A 2STBE 3PTBA 4AB9A 3TGIE 2BD2A 2QN5T 4A1VA 1XUJA 2JETC 2OXSA 1J15A 1GI9B 1XXFA 2QXIA 1BMMH 1WQVH 5DGJA 3LDXH 1GPZA 1QRWA 1H1BA 1NRNH 4ZKOU 3UTUH 3D62A 3MYWA 4FXGH 5C2ZA 1A7SA 1SLWB 4AYVB 2KAIB 3A83A 3GY5A 2WYGA 1V2WT 2FTMA 1C2KA 7GCHF 5JB8S 5GJ4B 4ISLA 1P2IA 3PWBA 1UCYH 1OWDA 3O8CA 1LMWB 3U8OH 2FPZA 1PYTD 3LKWA 1OKXA 1MKWH 1O3IA 1V2PT 3LPRA 3FAOA 1LQDB 3STIA 1W13U 1N6YA 1P2JA 4U2WA 3GY3A 1TX8A 1OSSA 4X1NU 1HIAB 2V3HH 4IMQA 5C20A 4H6SB 5DPAA 1F5KU 1B5GH 2P95A 2PWXA 4FUBA 4HTCH 2FP7B 1JIMA 2V6NA 3NWUA 2ZZUH 1AI8H 3RXBA 6ESTA 1A5HA 1PPHE 3MO9A 2SGDE 2FYRA 4GAWA 3AAUA 2A4OA 5E0GA 1AE8H 1MU6B 4X8SH 3UPEA 4YZUA 1SOZA 4MG3A 2FLBH 1VITF 4X1PU 2P8OC 4JK6A 1KYNA 4JZEH 4SGAE 2PHBA 1AFQC 1N8OC 1U6QA 2LPRA 4CRFA 3QO6A 1C5UA 1K22H 4YOJA 4TWWA 1WAYB 2J34A 3RM2H 1MTNC 3R3GB 1C1MA 1HLTH 1J17T 1BA8B 1OP8A 5T6DA 3NK8A 1OS8A 4KTSA 2BQWB 2B0FA 1A3BH 1ZSKA 1EZXC 3SHCH 1WTHD 1BTHH 3RXHA 1F5LA 1QA7A 1C2MA 2J94A 3GCHC 1GGDC 2VU8E 2GGVB 1Z1JA 4X2VA 4Y0ZE 1GHYH 1ELFA 1XKBC 1GJ4H 1ANDA 5EPYA 3QGNB 1P11E 4MNVA 2GDEH 2UUYA 5AFZH 2AYWA 3E0NB 4NG9H 3TU7H 1TGSZ 3GCTF 3AAVA 2XXLA 5EQQA 2VIVA 1HB0B 2VIDA 3SGBE 2EI8A 2XC0A 1MD7A 1MTVA 1W11U 2ZHFH 3ZZ9A 4E7RG 3UWIA 1BITA 1SGQE 3RC6A 3GICB 1AHTH 2Q6GA 1KXAA 3RXFA 3AVZA 1FPCH 3RXRA 1CGIE 1YCPH 2ZDAH 1JRSA 1NT1A 2W7SA 2FEQH 1BMAA 1VCQA 1FY1A 4TPIZ 1TNJA 3MWIU 4DY7B 2ZDVH 3AASA 1FY3A 3UY9A 2AFQB 4BOHA 4JYUH 1BHXF 1HAYB 2OQ5A 3P8GA 1L1JA 3SORA 5FX5A 2Z6BD 1O2JA 2UUJB 4DIHH 1QL8A 3VB4A 3RDZA 1AKSA 3PO1B 3LGVA 2F91A 4ZHAA 3T27A 1LQEA 3RUOA 4UEHH 1KDQA 1SGFA 4OS1A 1EATA 1SHYA 2ZTYA 4NA7A 3LH3A 2SGPE 3U1JB 3RXIA 1V6DA 1AN1E 2PFEA 1A0LA 5LGOA 1GDUA 4X1RU 4MNYA 4HI3A 3SI3H 5FHTA 2Q6DA 2A7HA 1VITH 1XM1A 3SU1A 1NC6A 4GPGA 1V2LT 4X6PA 1DY9A 4YO9A 1UTPA 3ZZ6A 1P10A 2Z7FE 4CRGA 1CBWB 1BCUH 2ZHDA 2ZP0H 1W0ZU 1B0FA 4DGJA 4AG1A 3F9EA 2VNTA 3URDA 2VH0A 1Y3YA 4YOIA 2GVFA 1YPGH 1S82A 4J2YB 2AGEX 3RU4T 1QGFA 1QHRB 4B76A 3SGAE 3BEFB 3E8LA 1BRCE 4MVNA 4IN1A 1K1IA 2VVVA 3RXVA 1VJAU 2OC1A 1W2KH 3F1SB 2PLXA 1C5VA 1RTFB 1AZZA 5BPEA 1O3DA 3BIVH 4MPWA 4ISHH 1BBRK 4K8YA 5LPEA 1VCPA 1V2ST 2H9EH 1GI4A 2P3FH 5IDKA 7ESTE 4X6OA 3T62A 5AFYH 1O38A 1TQ0B 5DP5A 1DITH 3GDVA 4XFQA 1SI5H 2ZFRH 1FJSA 1OWJA 1YPHE 2R3UA 1THRH 3SU0A 4H6TA 1CO7E 1OXGA 1L4DA 1Z8RA 1C5TA 4IC5A 2GZ9A 1C2LA 1GDQA 1MBQA 1DX5M 4AFUA 1NU7B 2R2MB 3SU6A 1VGCC 1IQHA 1D6WA 4KKDA 3S0NA 2FS8A 5A8YA 1AO5A 4OS7A 4CRAA 1P57B 4Z0KA 3KQDA 4R0IA 1C1RA 1SL3A 3MMGA 3RU4D 1LTOA 1RXPA 1RGQA 5A2MH 1CA0C 2OBQA 3BTHE 1IQKA 4OS4A 4YESB 2HRVA 1YKTA 1UJ1A 2AGGX 2O8UA 2ZGJA 2XRCA 2BZAA 3TGJE 2TGPZ 1GJDB 1EZSC 3V13A 1FPHH 2ZCHP 1C2JA 2W3IA 3U1IB 4BXWA 2FM2A 5T3HA 1BMNH 1SGDE 3A86A 1HAVB 3QUMP 3NKKA 1GMCG 1FMGA 2ZU2A 4WH6A 5FAHA 1AVXA 1L0ZA 1YPJH 2BVRH 1GG6B 3O8RA 1O0DH 1O2LA 3ZZCA 4X1QU 2C8ZB 2UUFB 4U01A 4IC6A 3SV6A 1C1WH 3ZV8A 5FBIA 1XVOA 4Y7BA 1O3MA 4WXVA 3DT0H 3SQEE 1UVSH 3MOCA 1MCTA 5TJXA 1WV7H 2G55A 2JH5D 5L2ZH 3ZVEA 3LGTA 1EOLA 1O30A 1TWXB 3P6ZB 2PGBB 4DOQA 3BN9A 1DWBH 1AZ8A 4ZH8A 1S0RA 1O2HA 2H9TH 1IQFA 1ELGA 1G3EA 2A4RA 5T6FA 2B8OH 1O39A 2FODA 1P09A 3A8DA 1GCDA 2JH0D 1VZQH 3TVJB 2TGTA 3KIDU 1NRSH 2VWLA 2ZQ1A 3RP2A 2ZA5A 1K9OE 2ZPQA 1YP9A 1GJ5H 2PUQH 3KHVA 1DSTA 2CHAB 3ATIA 3PMBB 2VGCB 1FXYA 2PR3A 3ATMA 1C5ZB 2FZZA 3Q3KA 1UHBB 1FAKH 4MQAA 3AW1A 2C90B 1WU1A 4MLFB 3LGUA 4I8GA 1YBWA 1JIRA 3M5MA 4CRCA 2JH6D 1LKBA 4X2XA 1THSH 1ZSLA 4UFDH 3JZ1B 1C5OH 2ZGXH 4MPVA 1UTKA 4AX9H 1LPKB 2OD3B 3W95A 3RXQA 2ODQA 5C1YA 5HGGA 4ASHA 4UONA 1P2MA 2AMDA 2WUBA 3LONA 3N7OA 4UE7H 4LZ1H 1GBKA 1OYTH 2O9QA 1F5RA 1EZUC 2ZGCA 1GMHF 1L2EA 1QL9A 3UNRA 1CHOG 1ZJKA 2ZFFH 1BRAA 4D76A 3D49H 2C3SA 1EP6A 3KCGH 4ZKNU 2B7DH 1SLXB 2QC2A 1V2JT 3LJOA 1D4PB 3RMMH 2ALVA 1C9TA 3VGCB 1GMCF 1SOTA 1ELEE 1UVUH 2ZTXA 3RMLH 1TPSA 2F9VA 1H9HE 2GMTB 2FLRH 1HCGA 5JYIA 5EW1H 1L1GA 1T8NA 1SQTA 4WMFA 5HYOA 3M5NA 1ZHRA 3EA9A
chains in the Genus database with same CATH superfamily
5FCKA 1SPJA 1AB9C 1GWAA 3HPTB 2ODYB 2A0QB 1KLJH 4DT7B 3F2HA 1JOUB 1G2MA 3V3MA 1O5CB 1P2NA 4K8BA 5C5OA 1MQ6A 1GBAA 1SR5C 3VFEA 1V2TT 2J98B 4ASUD 1D6RA 2D1JA 3GY8A 5F8ZA 1LKAA 2BDBA 1TOCB 4U30A 2RDLA 3HK3B 1TNKA 1SMFE 1A1RA 2F9NA 3SU4A 1FDPA 1RJXB 1HUTH 1IOEA 7GCHG 1SSXA 2A2QH 1A2CH 3BTFE 2R0KA 5AHGH 1AY6H 1NPMA 2PKSB 1CHGA 1MUEB 3KGPA 2FOBA 2P3TB 4Q7ZA 2Y80A 1PYTC 2A1DB 3FZDA 2ZO3H 2OC7A 3UQOA 2BDGA 1T31A 4YLQH 2J38A 5DG6A 3B23B 2CMYA 4CH2B 1MQ5A 3MQKC 3QTVH 1NFWA 3RXPA 4X1SU 4H4FA 3K6ZA 3SV8A 2BVSH 3U69H 1P2KA 5DSFA 1VR1H 2PUXB 5HIZA 5PTPA 1BRUP 1Y5UT 3TK6A 2NU2E 2PGQB 2M2AA 2OQUA 3OE7D 1GBLA 2P8OB 4DW2U 5EQRA 2FOAA 3BTKE 3T2NA 1N8OB 1C1QA 1CT0E 4CHAC 2W7UA 2ZC9H 2WZQA 1SHHB 1VITG 2Y7ZA 1K21H 4LXBH 1CHOF 1G3CA 4O97A 4Q2KA 5DJ7A 3SN8A 4NIXA 1MTNB 1NFUA 3MI4A 3LH1A 3ZVBA 3SV9A 2Z9GA 4MPXA 2IOTA 3RXGA 3M37A 1SC8U 5EJ1A 1SB1H 3OTJE 2XCNA 3PMJA 3SHAH 1GBTA 4AFZA 3GCHB 1AIXH 3VPKA 2ANKH 3BTDE 3M36A 1D3TB 4NIYA 3OU0A 1QB1A 2XBYA 3P95A 1F92A 1FQ3A 4O03A 3M3SA 1A4WH 1OOKB 1GHVH 2STAE 5FCRA 4ABHA 4PROA 4UD9H 6CHAB 3SV7A 4OS5A 1G3BA 4ABDA 1O2NA 1AKSB 3GCTG 4E06H 2W5EA 2FTLE 2HALA 4B6FA 5JBTA 3LOXA 3BG4C 3SGQE 1HAPH 1KTTB 5FXLA 2VVUA 1KDQB 5BRRE 1TPAE 1QRXA 1K1NA 2ZPSA 2GTBA 3HGNA 4SGBE 4NSYA 1O32A 3OX7U 3OYPA 1TA2A 1GI0A 2H9HA 3AK5A 3GCOA 1O3NA 5ETXA 3T28A 1DXWA 1QB6A 2A31A 5CMXH 2GCHF 1V2KT 5E2PA 3TIUA 3E1XB 1DLKB 1O2YA 1YF4A 1BT7A 5GXPA 3A7ZA 2QA9E 4HZHA 1HNEE 3UNQA 4HGCA 3A8CA 1Z6JH 1MAYA 3M35A 4QT8C 2SGQE 4CR5A 2D26C 2B9LA 1ZJDA 5EODA 2WYJA 1GMDF 3A7WA 2RA0A 2OUAA 2ZTZA 1PPEE 2ZFQH 4R8TB 3CS0A 4NA8A 5A8ZA 3E91A 1KLIH 2J98A 3SO3A 1IQIA 1QTFA 4GCHF 5DP3A 1T8MA 1O2QA 3RU4E 3A7VA 1IQMA 1UVTH 4BTTB 1P3EA 2RDEA 1MKXK 4B2CA 1HRTH 3C27B 1W7GH 2BD3A 5K0HA 1ZYOA 7LPRA 1GBJA 3QGJA 5EQSA 1H4WA 4X8TH 2QV1A 3TJNA 2BM2A 3DUXH 3ZVAA 5A0BA 3MU4A 4X8VH 3BTWE 1WTGH 3SU5A 4ABAA 1NFXA 1ZZZA 3MU8A 1K1JA 2FI3E 2PW8H 2THFB 3HKIB 3LJJA 4BAMB 4OS6A 2BQ7B 4JZIA 3U9AH 4ZAEA 2A7JA 2UUKB 1PFXC 2RA3A 4ABGA 4ZXYH 2Z3CA 2F83A 2OP9A 1G30B 1W12U 2ZHWH 4B2BA 3CP7A 1TNHA 3ZVFA 2HGTH 1OWIA 5CHAB 8GCHF 1GI5A 4KP0A 1S6FA 2P59A 2Z9JA 3IG6B 1Y5BT 4ACAA 2GCTC 1QB9A 2ESTE 3RXLA 1HAGE 2AMQA 1GJBB 3A89A 4X2YA 3RXAA 4YM9A 5DKMA 1A3EH 1TRYA 5C3NA 3BTEE 9LPRA 4IS5A 2K0QA 5C1XA 2FOEA 1O3CA 2F9BH 1YCPK 1XKAC 4GSOA 1O2MA 2BTCE 1LVYA 1NRRH 1ZLRA 2AERH 1ZGVA 2B5TB 3EAJA 3SZEA 4IW4E 4M9FA 2XWAA 2A5AA 1TRNA 4K69A 4D8NA 2V3OH 1QRZA 4Y76A 1EJNA 3OFND 4Z1MD 1C1VH 4ZHMU 1LPZB 1O31A 3LC3A 2J5UA 4UDWH 4Y11E 5KGOA 3KL6A 2BQ6B 4MPUA 2WPIS 1DLEA 2LP6A 1S81A 1P06A 3DFJA 4JYTA 2FDAA 2W6ID 1C2IA 1JBUH 3SU3A 2RFKC 1CA0B 1W0YH 4AC9A 2VIOA 5G4BA 4B73A 4I32A 1Z1IA 1YCPM 3GY4A 2C8WB 2W26A 2SFAA 1IAUA 2HLCA 1P0SH 2BY5X 3DCLA 3GYLB 1ZMNA 4A1XA 3SQHE 1YPLH 2AH4X 2A4GA 4FUCA 1HAXB 3DSPA 1QQ4A 4Q80A 1GVZA 3E16B 5EPNA 2F3CE 1FY4A 4Y7AA 1V2UT 4FU9A 4XRNA 4A1TA 2VVCA 3L3TA 1TE0A 1QY6A 4RSPA 3TJOA 1MH0A 1TLDA 2W3KA 1DT2A 1X7AC 1HAHH 2J92A 4FU7A 1ESBA 2ZU4A 3GY7A 3MU1A 5C5NA 5J4SA 2ZF0H 3SOSA 2ZDNA 2ULLA 2AS9A 1FIWA 2FMJA 1BZXE 1XVMA 3H7TA 1HJAC 4CRBA 1PPGE 1Q3XA 4YLUA 2O8MA 1EAXA 2CV3A 3M7UA 2JIZD 1TA6A 1DANH 2KM0A 3A82A 1BTUA 1NRPH 1Y3UA 1DWEH 1K1PA 3TH3H 5C94A 1GJ8B 4JK5A 1TMBH 1QURH 3SV2H 5L2YH 4FUDA 2BYAX 2QY0B 1YGCH 1UVOA 3GY6A 3KNXA 1FI8A 1GVKB 4DURA 4NGAH 3TH4H 1D3PB 4KELA 4K5ZA 1KXCA 1TONA 2FOMB 3P17H 4K2YA 1GJCB 1L1NA 3B9FH 1P12E 1SLVB 1PPZA 3SJ8A 4IN2A 1T7CA 3ZZ3A 2GZ7A 5EXMA 4TY7A 1SGPE 4X6NA 1UTQA 3ATLA 4I8KA 2J2UA 1NESE 5JBCS 1FV9A 2BD7A 2C8YB 1TBZH 3UAIC 1RTLA 3G01A 2V0BA 4RKJB 2IJOB 4WMEA 1BJVA 1ZSJA 2HNTE 3FP8E 2ANYA 1NROH 1SGRE 1O2RA 3OEED 3BEIB 1CSOE 2QE7D 4XBBA 1K1LA 1UTNA 1AGJA 5IYTA 1Q2WA 2SGAA 3BIUH 4AGJA 4AZ2B 2ZIQH 1BBRH 1QJ6B 2WPJS 1Y5AT 3ZVDA 1V2QT 1C9PA 4I86A 1S85A 4ZKRU 3C1KA 2OTVA 2PTCE 1GMHG 1A0JA 3P8OA 3ZZAA 3OTPA 1QA0A 1KXDA 2BX4A 5B6OA 1UK4A 1YLDA 2IPHA 3ODFA 3RC5A 1ZPCA 3MU5A 4Y8XA 2VBCA 2QF3A 1HPGA 3T29A 2WPHS 3M5OA 1ELVA 3ZZ8A 4Q63A 4FVDA 1C1OA 1NRQH 5CE1A 1P3CA 1XUIA 1HGTH 2R0LA 3O8DA 2LNCA 1EAUA 1F0UA 4GLYA 4B74A 1DE7H 4BAKB 1MTSA 1ABJH 1MABB 3QZQA 1EB2A 1K28D 4E7NA 1O3OA 3TITA 3AW0A 3A7YA 4NIVA 1THPB 1T32A 2VIWA 4NA9H 1NTPA 1J9CH 3V7TA 2ZHQH 4XSKU 3GISB 4DVAU 1S6LA 5C0TA 1D3DB 1UTLM 4AB8A 4I33A 1C5RA 2VWOA 5E2OA 1JXPA 1E1QD 1C1NA 1O5FH 2ZFTA 4INHA 3U8TH 4XDEA 4ZCNA 1EZQA 1GJ7B 2PKAA 2BXTH 4GUXA 1CBWC 1TX6A 4OGXA 1LVMA 1RFNA 1TGNA 3LC5A 2OBOA 1C2EA 1AU8A 2V35A 1C5MD 2A7CA 1ZMLA 3ZVGA 5TCCA 1GI2A 3MU0A 2FOGA 1SGEE 2JKHA 2ZCLP 2WUCA 1P04A 3TJVA 1NBME 5E8EH 2QCYA 2DE9A 1QJ1B 1BMFD 1ABIH 1PQ5A 1ZTKA 4HG6A 1NN6A 1XMNB 2YMSC 1CA8B 2F9UA 3QLPH 3DD2H 1EP5A 2QF4A 1E36B 4CREA 3GCNA 1DXPA 2KCYA 2FESH 3RXCA 4AFQA 2AEIH 3EE0B 4BTIB 4FU8A 5EXNA 3M61U 1BIOA 1TPOA 3Q77A 4MNXA 4VGCB 2O8TA 1NS3A 2BXUH 2Y6TA 4Y8ZA 3FN8A 1DY8A 4WH8A 4Y71A 1W14U 2H1UA 1ESAA 4GHTA 2NU1E 1GBEA 1RS0A 3RXEA 2QXJA 1C1PA 1TNLA 2QXHA 4NZQA 1ZHMA 3SJ9A 4CHAB 1P2QA 2ANWA 2XW9A 1OYQA 1AUJA 4JCNA 1GBDA 3PROA 5EU8A 1AVGH 2CGAA 2YNAA 2ZNKH 3SYJA 1YM0A 4B1TA 1C5QA 1FIZA 1MZAA 2BD8A 1TMTH 1ZR0A 2BVXH 1ZPZA 1C4Y2 2FS9A 1GJ6A 1P02A 1IQEA 3ATWA 5T1VA 2CF9H 5KEDA 5KECA 1LPGB 1O2XA 3KN2A 5DP6A 3SZNA 4XOJA 1HXEH 2AHME 1G9IE 2SGEE 3F9HA 1C1TA 4HFPB 1EKBB 3P8NA 1T4UH 1TB6H 3I78A 5J4QA 2G4TA 5EXLA 1CT2E 5ABWA 2O8WA 1JWTA 1SGIB 3LGWA 1G36A 2G00A 1LHCH 3RXTA 2J97A 1GVLA 1O33A 2GT8A 4ZUHA 3UOPA 3BG4B 2JETB 1H9LB 2VINA 4I31A 3QDZB 4D7FA 2WPLS 1TAWA 1SGYE 1WBGB 2K1QA 1NU9A 3H5CB 1SQAA 2BDCA 1UMAH 4AGKA 1XUFA 4TSFD 1KXBA 5TCAA 3OEHD 1TFXA 2QXGA 3MH4A 2UWOA 5B6LA 5DP9A 3GY2A 2XBXA 2XC5A 1D3QB 3TGKE 1A5IA 1O3JA 2KCAA 2A5KA 4INLA 1V2OT 3BTQE 4F55A 1KSNA 1MTUA 3RLWH 4NZLA 5T6GA 2GCHG 3W1EA 5E0JA 5EW2H 1ELDE 2ANMH 4Y8YA 4AORA 1C4U2 2F4LA 2IN2A 1GHBG 3LGIA 2A4QA 1ZTLA 4BTUB 2Z3DA 1BBRE 4FETA 1YY3A 5DP7A 2Z3EA 3U8RH 4ZKSU 1TALA 2YMSD 1TPPA 2BDHA 5I46H 1F0TA 4BAHB 4DCDA 4JMYA 1GMDG 2HNTF 4FUIA 4ZHLU 3SBKA 1BB0B 1ZHPA 3A84A 4X2WA 1HXFH 2QF5A 4GCHG 2CHAC 4YTAA 3CENA 4JZ1A 4CRDA 1QCPA 2VGCC 1O2ZA 4FVBA 5DP4A 3UNSA 1P01A 3A88A 3QTOH 1O5DH 1AUTC 2BZ6H 2WV9A 4Y79A 1O2GH 1UTJA 1SGCA 1O36A 3UQVA 2ZECA 3Q3YA 3FVFB 4O3UA 1AFQB 1SGNE 4BAQB 1O35A 1SFIA 1O2IA 2ZDMA 3SNDA 1PQ7A 3ZZDA 2WV5A 2ZGHA 6GCHG 1GHWH 2G5VA 1UK2A 2J4IA 1DWDH 4WJG2 4BXSA 3NRLA 2LELA 3SUDA 1O2VA 3MTYA 3N7EA 4ABIA 1GDNA 1Z8GA 3VEQB 1BOQA 2ZU5A 1GGDB 4AG2A 1HYLA 3MH7A 2QGRA 3PYHA 2BDIA 3F68H 2RG3A 3PM3A 3SNBA 3DHKH 2GCTB 1ZOMA 2AMPA 4JZDH 8GCHG 1UW7A 2AIPA 3S9BA 1BDAA 3A81A 1WQSA 1EUFA 1B0EA 1BTYA 4IMZA 1OP0A 3M3TA 3OSYA 1S0QA 1WUNH 3VB7A 3F9GA 1GBFA 1E37B 2BLQA 1BRBE 1BTXA 2GD4B 5FX6A 4FUFA 3VGCC 3F9FA 5JBAS 2QAAA 1P9SA 3GOVB 1EOJA 1GJ9B 1V3XA 1IHSH 1AFEH 1O3AA 1G3DA 2Y5FA 3LIWA 4F49A 2ZDLA 4YT7H 2GMTC 1UCYK 2Z9LA 1YLNA 3KQ5A 1IQJA 3RMNH 4X8UH 1DVAH 3UFAA 1O3HA 1C5XB 2BB4A 2R9PA 1PPFE 1O37A 1MKWK 2R2WU 4ESTE 5FPSA 2D8WA 4K3JA 3TK9A 1S84A 3B8JA 4AYYB 3Q00A 1O3PB 2UWLA 1TGCA 1DUAA 3K65B 1CE5A 4O3TA 4KGAA 1GHBF 1H8ED 1Y59T 4OM9A 3BTGE 4WXIA 1DPOA 2M5TA 2KCPA 5H4IB 1Y3VA 2ZU1A 1ZRKA 2A32A 3PB1E 1EQ9A 1OHHD 4OGYA 3FP7E 1HDTH 2PSXA 4RN6A 2BLWA 3SUFA 1GJAB 4I8HA 1MU8B 3LT3A 4BAOB 2F9PA 1O2UA 2P3UB 1CGHA 3TPIZ 1ZTJA 2BMGB 1V2VT 1TIOA 3RXKA 3T26A 2PKSC 1W7XH 5A0AE 3DSGA 1A61H 2BHGA 5GCHF 2JDID 3QX5H 1EFRD 4ISOA 2AIQA 3M7QA 4KTUA 2XWBI 1HAOH 2BD5A 4WY3A 3IWMA 1ELTA 2OC8A 5EOKA 3V0XA 1O3FA 1ARBA 1HJAB 3BEUA 3K9XB 1QNJA 1AMHA 2EEKA 1E38B 4K1EA 1TABE 2XBWA 1TNIA 2QF0A 2XNDD 6GCHF 1HFDA 3NPSA 2BOHB 1AQ7A 2V3MA 2FOCA 3FZZA 3URCA 2ZKSA 3S9AA 3MNBA 1O2SA 3EYDA 2BD4A 3P70B 4YOGA 2XOKD 2KX4A 3N7DA 1BUIA 5LPRA 2H5DA 4ISIH 1MKXH 3FANA 3KQBA 5C0UA 3UOUA 4GVUA 5AVDA 1INCA 4Q7YA 1KIGH 1NY22 3NUMA 1YPEH 1LHEH 1C5YB 1C1UH 1MZDA 1UTOA 3HATH 2C93B 5DO4H 3IITA 2BY9X 2D2DA 1D9IA 1P8VC 2F9OA 2HWLB 3O8BA 1ZGIA 2PV9B 4CH8B 5FPTA 3ZV9A 3HGPA 3BTME 1S83A 2P16A 4K1TA 1V2RT 4LK4A 3VXEH 5CHBA 1LO6A 3F3BA 1EPTC 1LDTT 2ZGBH 1Z7KA 1PQ8A 1V2MT 1YC0A 4IGDA 2G51A 2CF8H 1EAWA 1RIWC 1YLCA 1YPKH 3UWJH 3EGKH 3KYFA 3GDSA 2BY6X 1K2I1 2J95A 1DDJA 5E0HA 1VGCB 2DUCA 2HOBA 1WDIA 1GBHA 4O9VA 2ZI2H 1FY5A 5JPMH 3R0FA 3D23A 1DICA 1GCTC 3A7XA 3TLOA 6LPRA 6CHAC 4IBLH 1C2FA 1FUJA 2WSSD 5DK1A 3M3VA 1ETTH 3RLYH 5EJLA 1Z8JB 1MAXA 2PTNA 3ZZ7A 1BTWA 1K0HA 4B71A 2NWNA 1Z6EA 4A6LA 1J16A 1ETSH 1SGFG 3UR9A 2ZEBA 1EPTA 1ACBE 3TNTA 4BANB 5EJZA 1B7XB 3TJUA 1ESTA 1IHTH 4WWYA 5C17A 1EX3A 1O5AB 9ESTA 3RXUA 2SNWA 3PWCA 1Q31A 2C4FH 3MO6A 3OY6U 1RTKA 5FPYA 1EJAA 5F03A 1KLTA 2CXVA 4Y6DA 4Y10E 3QK1A 3P92A 3RMOH 2JJ2D 3E0PB 4JZFH 4WMDA 1GI6A 2FXRA 1LCYA 2ZCKP 2VB0A 1FAXA 3GDUA 1C1SA 1BTPA 2PKAB 1IQGA 1G37A 4OS2A 2TGAA 5L6NH 4K60A 3BSQA 3ZYDA 1GBBA 4DT4A 1UO6A 3SUEA 1GI3A 1C5WB 2FOFA 3DSOA 3A87A 1QBNA 3PMHB 3VB3A 4MTBA 1P9UA 2ZG0H 1PPBH 4BNRA 4B75A 2XCFA 5GWZA 3STJA 5SGAE 1H8IH 3N99A 4TYDA 2GJGA 1WSSH 1GBCA 2EA3A 3A8AA 1O3EA 1E0FD 2KAIA 1QJ7B 4D9RA 1DSUA 4I8JA 2VWMA 1LHDH 1GHZA 1MBMA 1JRTA 1CQQA 1TGTA 3U98H 2EQNA 3F6UH 2YOLA 2KFWA 3RXDA 3MH6A 1ORFA 1JMOH 3S7HB 2SGFE 3E90B 2Y82A 1GHXH 4A7IB 4AN7A 1LVBA 3PV4A 4B2AA 1L4ZA 1LVOA 1OP2A 1EJMA 1YPMH 2HVXA 3OY5U 3TH2H 1H9IE 4A5TS 4CBNA 4TPYA 1K1MA 1O2OA 2H5CA 1HIAA 1ELBA 1NM6A 1DM4B 4NFEA 4FUJA 4NIWA 8KME2 2BOKA 1XUGA 3FFGA 3MO3A 5A0CA 1FY8E 2TIOA 1EAIA 1VJ9U 1XX9A 1CGJE 1HAZB 1C4V2 1TYNA 3ESTA 1Y8TA 2Q1JA 2WINI 4YXWD 2GV6A 2PSYA 3E6PH 1UK3A 2Z94A 2C8XB 1TQ7B 3ITIA 5CHAC 1OPHB 5JB9S 1ANBA 2XYAA 2XTTB 3GS9A 2ZU3A 3PMAB 3PTNA 2VIPA 3S9CA 1Y3WA 1O3BA 1UTMA 3Q76A 2I6QA 3T25A 1UCYE 5GPIB 1S6HA 1MD8A 3UIRA 5DP8A 3VB5A 1CU1A 1DOJA 5HMAA 3MNCA 1GHAG 2QIQA 4XBCA 4UFGH 1DWCH 4FOUC 4J1YA 1NO9H 2NU4E 3TNSA 4X6MA 2GDDA 4ABFA 1GL0E 1E79D 1J8AA 3BF6H 4RT1A 2BDAA 4F4OC 1XUHA 1A5GH 3RC4A 1E34B 4ZXXH 1CT4E 1XXDA 1ANEA 1EB1H 2FYQA 1ID5H 4KTCA 4H42U 1OWEA 2RCEA 3HKJB 4MDSA 3GYMA 1OWKA 2FX6A 1O5EH 1Z71A 2FOHA 2Y81A 1F0SA 3UREA 3K2UA 3PO1C 3ELAH 4WVPE 1A46H 3ZZ5A 5ESBA 1FLEE 1MCVA 1SFQB 3KQEA 3TK5A 1AB9B 2FI4E 3D65E 3Q3XA 4TWYA 1SG8B 1H8DH 1QFKH 1O2KA 1RD3B 2H6MA 2EC9H 3UUZA 2FWWA 3MH5A 4P00A 2EI6A 2L74A 2F43B 2Y7XA 2CK3D 5JDUB 1IQLA 3PV5A 4FUHA 2OC0A 1ZRBA 2NU0E 2CN0H 2G8TA 2Y5HA 2HPPH 2ZPRA 1P03A 3WY8A 2G5NA 3RXSA 4DJZB 5LH8A 2GX4A 1TGBA 3BTTE 1YYY1 1C5NH 3L6PA 4AOQA 2ZDKA 1DFPA 2GT7A 3NCLA 1VCWA 4NCYA 3RM0H 5A8XA 3MFJA 5EG4A 4NWLA 4ABJA 1GI7B 1O34A 2OINA 1VKYA 2BX3A 2SNVA 3SW2B 2V7QD 1A0HB 2ASUB 4ISNA 3RXJA 1YPHC 1ZPBA 1PQAA 2K8IA 4NFFA 4UFFH 2HPQH 3L33A 2I6SA 1ZMJA 3CNRA 3ZVCA 1C2GA 2ZFPH 2XBVA 1NFYA 1HV7A 4YT6H 1V2NT 3S7KB 3RXMA 1SLUB 1MMJN 2HNTC 1O5GH 3V12A 1SVPA 3SJIA 4I7YH 2GZ8A 2AGIX 3SJOA 3A85A 1O3GA 3CS7A 3H7OA 3SNAA 4FUGA 5F8XA 1O5BB 3MHWU 4LOYH 2G52A 4WF8A 2UWPA 3FP6E 3ODDA 2EI7A 1QIXB 3DA9B 1QR3E 2A2XH 3QN7A 1FX0B 1HJ9A 4Z6AH 1GHAF 2OLGA 2J9NA 1GBMA 1TBQH 2QYIA 1WCZA 3M7TA 2H2ZA 4D7GA 1K1OA 1O2WA 4I8LA 4LZ4B 4THNH 4X0WU 4CBOA 3A8BA 1M9UA 1O2TA 3P8FA 4DG4A 4TY6A 1F2SE 5HXFA 5C1UA 2WV4A 2NU3E 4Q7XA 3ENSB 1BMLA 1QBVH 1AWHB 1MTWA 3SNEA 1FN6A 1UVPA 4XE4A 5A09A 2HVYB 1C2HA 1DUEA 1FN8A 1E35B 2GP9B 2BD9A 3PLBA 3PLKA 1GI1A 2WPKS 5HM9A 2Z9IA 3HK6B 5GNDA 5F6MA 1HBTH 1FNIA 2A45B 2FI5E 3EA7A 3RXOA 1O3KA 3VB6A 4ABBA 4K1SA 2L6OA 3KQCA 2FO9A 1BJUA 2ODPA 1SKYE 2TBSA 2YNBA 2ZWLH 3FOAA 2R3YA 2OK5A 2Y5GA 2VIQA 4M7GA 2EY4C 1OWHA 5GIBA 5FL7D 1AVWA 1EASA 3VXFH 1ELAA 3PLPA 2OCVB 3VG8A 1GL1A 4A92A 1SBWA 1Y3XA 3I77A 2DE8A 1F7ZA 2BY8X 3BG8A 3FKSD 4XBDA 3QWCH 1G32B 1GG6C 2A5IA 3MNSA 4Y0YE 1TOMH 1T4VH 2G81E 3DFLA 3T5FH 1QL7A 1WYKA 1Z8IB 3SNCA 1BHXB 5I25A 2G4UA 5GDSH 1C5SA 1LHFH 3SUGA 3SJKA 1NZQH 4RKOB 1HJ8A 4UFEH 2VJ1A 3NZIA 3SU2A 1C5PA 3JZ2B 1W8BH 3I29A 1KXEA 3MNXA 3ZYEA 1SGTA 4B6EA 1HAVA 3A7TA 4NSVA 2FX4A 1O2PA 1ELCA 1LHGH 1WOFA 4U32A 1BTZA 4XD7D 3K6YA 1KTSB 2TGDA 1ETRH 2WPMS 3BV9B 2VWNA 2CJIA 2Q6FA 2BLOA 1WXRA 2KZ4A 5GCHG 1QQUA 1EXFA 3ATKA 8LPRA 4ABEA 1F0RA 1FONA 3EQ0H 5HM2A 3F2FA 1O3LA 3E3TA 1QBOA 1T8LA 3WWBA 5AF9H 4MNWA 1N6XA 3KEEA 5F8TA 5EGMA 5F53A 1HAIH 3UR6A 4ZMAH 7KMEH 4VGCC 4CR9A 2GKVE 1N1LA 1AE5A 3W94A 1TMUH 2ZHEH 1BQYA 4GHQA 4JYVH 1RRKA 1W10U 3EA8A 1TNGA 5C67A 1AD8H 3SI4H 4FUEA 1P2OA 1FZZA 5JBBS 4INKA 3ZZ4A 1C2DA 1UHBA 3QZRA 5L30H 1PJPA 1XUKA 1KY9A 1SQOA 1PPCE 4AFSA 1YWUA 2TRMA 2P93A 2FIRH 2O8LA 1G2LA 1T8OA 2XNIA 3PRDA 5FBEA 1C5LH 1GI8B 2GV7A 5LPFA 3NXPA 4NWKA 2ILNA 2BDYA 1EPTB 1J14A 2XC4A 4ZROA 1DS2E 3A80A 1W3CA 1ANCA 3LGYA 2Z9KA 2ZQ2A 3ZZBA 1GBIA 2VH6A 3EDXB 8ESTE 3LU9B 1RIWB 3KF2A 1OX1A 2ZFSA 5K7RA 3M5LA 4E05H 2BY7X 1KXFA 4DIIH 1IQNA 1AWFH 2P94A 1ARCA 2TPIZ 1GCTB 1TRMA 3FO8D 3ZIAD 4D9QA 2BLVA 1CVWH 5ESTE 2ALPA 2W6JD 1TBRH 3S69A 1S5SA 1P05A 1TX7A 2STBE 3PTBA 4AB9A 2IPQX 3TGIE 2BD2A 2QN5T 4A1VA 1XUJA 2JETC 2OXSA 1J15A 1GI9B 1XXFA 2QXIA 1BMMH 3PV2A 1WQVH 5DGJA 4RI0A 1NBMD 3LDXH 1GPZA 1QRWA 1H1BA 1NRNH 4ZKOU 3UTUH 3D62A 3MYWA 4FXGH 5C2ZA 1A7SA 1SLWB 4AYVB 2KAIB 3A83A 3GY5A 2WYGA 1V2WT 2FTMA 1C2KA 7GCHF 1KMHB 3EE7A 5JB8S 5HIYA 5GJ4B 4ISLA 1P2IA 3PWBA 1UCYH 1OWDA 3O8CA 2PP6A 1LMWB 3U8OH 2FPZA 1PYTD 3LKWA 1OKXA 1MKWH 1O3IA 1V2PT 3LPRA 3FAOA 1LQDB 3STIA 1W13U 1N6YA 1P2JA 4U2WA 3WWFA 3GY3A 1TX8A 1OSSA 4X1NU 1HIAB 2V3HH 4IMQA 5C20A 4H6SB 5DPAA 1F5KU 1B5GH 4ACBA 3H09A 2P95A 2PWXA 4FUBA 4HTCH 2FP7B 1JIMA 2V6NA 3NWUA 2ZZUH 1AI8H 3RXBA 6ESTA 1A5HA 1PPHE 3MO9A 3UB0A 2SGDE 1COWD 2FYRA 2KR7A 3AAUA 2A4OA 4GAWA 1AE8H 1MU6B 4X8SH 5E0GA 4YZUA 1SOZA 3UPEA 4MG3A 2FLBH 1VITF 4X1PU 2P8OC 4JK6A 1KYNA 4JZEH 4SGAE 2PHBA 1AFQC 1N8OC 1U6QA 2LPRA 4CRFA 3QO6A 1C5UA 1K22H 4YOJA 4TWWA 1WAYB 2J34A 3RM2H 5HKKD 1MTNC 3R3GB 1C1MA 1HLTH 1J17T 1BA8B 1OP8A 5T6DA 3NK8A 1OS8A 4KTSA 2BQWB 2B0FA 1A3BH 1ZSKA 1EZXC 3SHCH 1WTHD 1BTHH 3RXHA 1F5LA 1QA7A 1C2MA 2J94A 3GCHC 1GGDC 2VU8E 2GGVB 1Z1JA 4X2VA 4Y0ZE 1GHYH 1ELFA 1XKBC 1GJ4H 1ANDA 5EPYA 3QGNB 1P11E 5IK2D 4MNVA 2GDEH 2UUYA 5AFZH 2AYWA 3E0NB 4NG9H 3TU7H 1TGSZ 3GCTF 3AAVA 2XXLA 5EQQA 2VIVA 3OAAD 1HB0B 2VIDA 3SGBE 2EI8A 2XC0A 1MD7A 1MTVA 1W11U 2ZHFH 3ZZ9A 4E7RG 3UWIA 1BITA 1SGQE 3RC6A 3GICB 1AHTH 2Q6GA 1KXAA 3RXFA 3AVZA 1FPCH 4TT3D 3RXRA 1CGIE 1YCPH 2ZDAH 1JRSA 1NT1A 2W7SA 2FEQH 1BMAA 1VCQA 1FY1A 4TPIZ 1TNJA 3MWIU 4DY7B 2ZDVH 2WHXA 3AASA 1FY3A 3UY9A 2AFQB 4BOHA 4JYUH 1BHXF 1HAYB 2OQ5A 1H8HD 3P8GA 1L1JA 3SORA 5FX5A 2Z6BD 1O2JA 2UUJB 4DIHH 1QL8A 3VB4A 3RDZA 1AKSA 3KYGA 3PO1B 3LGVA 2F91A 4ZHAA 3T27A 1LQEA 3RUOA 4UEHH 1KDQA 1SGFA 4OS1A 1EATA 1SHYA 2ZTYA 4NA7A 3LH3A 3F0OA 2SGPE 3U1JB 3RXIA 1V6DA 1AN1E 2PFEA 1A0LA 5LGOA 1GDUA 4X1RU 4MNYA 4HI3A 4P02A 3SI3H 5FHTA 2Q6DA 2A7HA 1VITH 1XM1A 3SU1A 1NC6A 4GPGA 1V2LT 4X6PA 1DY9A 4YO9A 1UTPA 3ZZ6A 1P10A 2Z7FE 4CRGA 1CBWB 1BCUH 2WPDD 2ZHDA 2ZP0H 1W0ZU 1B0FA 4DGJA 4Q4LA 1W0JD 4AG1A 2KCOA 2VNTA 3F9EA 3URDA 2VH0A 1Y3YA 4YOIA 2GVFA 1YPGH 1S82A 4J2YB 2AGEX 5CDFE 3RU4T 1E1RD 1QGFA 1QHRB 1QZ8A 4B76A 3SGAE 3BEFB 3E8LA 2YMSB 1BRCE 4MVNA 4IN1A 1K1IA 2VVVA 3RXVA 1VJAU 2OC1A 1W2KH 3F1SB 2PLXA 1C5VA 1RTFB 1AZZA 5BPEA 1O3DA 3BIVH 4MPWA 3U28C 4ISHH 1BBRK 4K8YA 5LPEA 1VCPA 1V2ST 2H9EH 1GI4A 2P3FH 5IDKA 7ESTE 4X6OA 3T62A 5AFYH 1O38A 1TQ0B 5DP5A 1DITH 3GDVA 4XFQA 1SI5H 2ZFRH 1FJSA 1OWJA 1YPHE 2R3UA 1THRH 3SU0A 4H6TA 1CO7E 1OXGA 1L4DA 1Z8RA 1C5TA 4IC5A 2GZ9A 1C2LA 1GDQA 1MBQA 1DX5M 4AFUA 1NU7B 2R2MB 3SU6A 1VGCC 1IQHA 1D6WA 4KKDA 3S0NA 2FS8A 5A8YA 1AO5A 4OS7A 4CRAA 1P57B 4Z0KA 3KQDA 4R0IA 1C1RA 1SL3A 3MMGA 3RU4D 1LTOA 1RXPA 1RGQA 5A2MH 1CA0C 2OBQA 3BTHE 1IQKA 4OS4A 4YESB 2HRVA 1YKTA 1UJ1A 2AGGX 2O8UA 2ZGJA 2XRCA 2BZAA 2HLDD 3TGJE 2TGPZ 1GJDB 1EZSC 3V13A 1FPHH 2ZCHP 1C2JA 2W3IA 3U1IB 4BXWA 2FM2A 5T3HA 1BMNH 1SGDE 3A86A 1HAVB 3QUMP 3NKKA 1GMCG 1FMGA 2ZU2A 4WH6A 5FAHA 1AVXA 1L0ZA 1YPJH 3WW7A 2BVRH 1GG6B 3O8RA 1O0DH 1O2LA 3ZZCA 4X1QU 2C8ZB 2UUFB 4U01A 4IC6A 3SV6A 2JJ1D 1C1WH 3ZV8A 5FBIA 1XVOA 4Y7BA 1O3MA 4WXVA 3DT0H 3SQEE 1UVSH 3MOCA 1MCTA 5TJXA 1WV7H 2G55A 2JH5D 5L2ZH 3ZVEA 3LGTA 1EOLA 1O30A 1TWXB 3P6ZB 2PGBB 4DOQA 5EIYA 3F0PA 3BN9A 1DWBH 1AZ8A 4ZH8A 1S0RA 1O2HA 2H9TH 1IQFA 1ELGA 1G3EA 2A4RA 5T6FA 2B8OH 1O39A 4F48B 2FODA 3F2GA 1P09A 3A8DA 1GCDA 2JH0D 1VZQH 3TVJB 2TGTA 3KIDU 1NRSH 2VWLA 2ZQ1A 3RP2A 2ZA5A 1K9OE 2ZPQA 1YP9A 1GJ5H 2PUQH 3KHVA 1DSTA 2CHAB 3ATIA 3PMBB 5DN6D 1SQRA 2VGCB 1FXYA 2PR3A 3ATMA 1C5ZB 2FZZA 3Q3KA 1UHBB 1FAKH 4MQAA 3AW1A 2C90B 1WU1A 4MLFB 3LGUA 4I8GA 1YBWA 1JIRA 3M5MA 4CRCA 2JH6D 1LKBA 4X2XA 1THSH 1ZSLA 4UFDH 3JZ1B 1C5OH 2ZGXH 4MPVA 1UTKA 4AX9H 1LPKB 2OD3B 3W95A 3RXQA 2ODQA 5C1YA 5HGGA 4RT0A 4ASHA 4UONA 1P2MA 2AMDA 2WUBA 3LONA 3N7OA 4UE7H 3PRBA 4LZ1H 1GBKA 1OYTH 2O9QA 1F5RA 1EZUC 2ZGCA 1GMHF 1L2EA 1QL9A 3UNRA 1CHOG 1ZJKA 2ZFFH 1BRAA 4D76A 3D49H 2C3SA 1EP6A 1W0KD 3KCGH 4ZKNU 2B7DH 1SLXB 2QC2A 1V2JT 3LJOA 1D4PB 3RMMH 2ALVA 1C9TA 3VGCB 1GMCF 1SOTA 1ELEE 1UVUH 2ZTXA 2IJD1 3RMLH 1TPSA 2F9VA 1H9HE 2GMTB 2FLRH 1HCGA 5JYIA 5EW1H 1L1GA 1T8NA 1SQTA 4WMFA 5HYOA 3M5NA 1ZHRA 3EA9A
chains in the Genus database with same CATH topology
5FCKA 1SPJA 1AB9C 1GWAA 3HPTB 2ODYB 2A0QB 1KLJH 4DT7B 1JOUB 1G2MA 3V3MA 1O5CB 1P2NA 4K8BA 5C5OA 1MQ6A 1GBAA 1SR5C 3VFEA 1V2TT 1D6RA 2D1JA 3GY8A 5F8ZA 1LKAA 2BDBA 1TOCB 4U30A 2RDLA 3HK3B 1TNKA 1SMFE 1A1RA 2F9NA 3SU4A 1FDPA 1RJXB 1HUTH 1IOEA 7GCHG 1SSXA 2A2QH 1A2CH 3BTFE 2R0KA 5AHGH 1AY6H 1NPMA 2PKSB 1CHGA 1MUEB 3KGPA 2FOBA 2P3TB 4Q7ZA 2Y80A 1PYTC 2A1DB 3FZDA 2ZO3H 2OC7A 3UQOA 2BDGA 1T31A 4YLQH 2J38A 5DG6A 3B23B 2CMYA 4CH2B 1MQ5A 3QTVH 1NFWA 3RXPA 4X1SU 4H4FA 3K6ZA 3SV8A 2BVSH 3U69H 1P2KA 1VR1H 2PUXB 5PTPA 1BRUP 1Y5UT 3TK6A 2NU2E 2PGQB 2OQUA 1GBLA 2P8OB 4DW2U 5EQRA 2FOAA 3BTKE 3T2NA 1N8OB 1C1QA 1CT0E 4CHAC 2W7UA 2ZC9H 1SHHB 1VITG 2Y7ZA 1K21H 4LXBH 1CHOF 1G3CA 4O97A 4Q2KA 5DJ7A 3SN8A 4NIXA 1MTNB 1NFUA 3MI4A 3LH1A 3ZVBA 3SV9A 2Z9GA 4MPXA 2IOTA 3RXGA 3M37A 1SC8U 1SB1H 3OTJE 2XCNA 3PMJA 3SHAH 1GBTA 4AFZA 3GCHB 1AIXH 3VPKA 2ANKH 3BTDE 3M36A 1D3TB 4NIYA 3OU0A 1QB1A 2XBYA 3P95A 1F92A 1FQ3A 4O03A 3M3SA 1A4WH 1OOKB 1GHVH 2STAE 5FCRA 4ABHA 4PROA 4UD9H 6CHAB 3SV7A 4OS5A 1G3BA 4ABDA 1O2NA 1AKSB 3GCTG 4E06H 2W5EA 2FTLE 2HALA 5JBTA 3LOXA 3BG4C 3SGQE 1HAPH 1KTTB 5FXLA 2VVUA 1KDQB 5BRRE 1TPAE 1QRXA 1K1NA 2ZPSA 2GTBA 3HGNA 4SGBE 4NSYA 1O32A 3OX7U 3OYPA 1TA2A 1GI0A 2H9HA 3GCOA 1O3NA 5ETXA 3T28A 1DXWA 1QB6A 2A31A 5CMXH 2GCHF 1V2KT 5E2PA 3TIUA 3E1XB 1DLKB 1O2YA 1YF4A 1BT7A 5GXPA 3A7ZA 2QA9E 4HZHA 1HNEE 3UNQA 4HGCA 3A8CA 1Z6JH 1MAYA 3M35A 4QT8C 2SGQE 4CR5A 2D26C 2B9LA 1ZJDA 5EODA 2WYJA 1GMDF 3A7WA 2RA0A 2OUAA 2ZTZA 1PPEE 2ZFQH 4R8TB 3CS0A 4NA8A 5A8ZA 3E91A 1KLIH 3SO3A 1IQIA 1QTFA 4GCHF 5DP3A 1T8MA 1O2QA 3RU4E 3A7VA 1IQMA 1UVTH 4BTTB 1P3EA 1MKXK 4B2CA 1HRTH 3C27B 1W7GH 2BD3A 5K0HA 1ZYOA 7LPRA 1GBJA 3QGJA 5EQSA 1H4WA 4X8TH 2QV1A 3TJNA 2BM2A 3DUXH 3ZVAA 5A0BA 3MU4A 4X8VH 3BTWE 1WTGH 3SU5A 4ABAA 1NFXA 1ZZZA 3MU8A 1K1JA 2FI3E 2PW8H 2THFB 3HKIB 3LJJA 4BAMB 4OS6A 2BQ7B 4JZIA 3U9AH 4ZAEA 2A7JA 2UUKB 1PFXC 2RA3A 4ABGA 4ZXYH 2Z3CA 2F83A 2OP9A 1G30B 1W12U 2ZHWH 4B2BA 3CP7A 1TNHA 3ZVFA 2HGTH 1OWIA 5CHAB 8GCHF 1GI5A 4KP0A 1S6FA 2P59A 2Z9JA 3IG6B 1Y5BT 2GCTC 1QB9A 2ESTE 3RXLA 1HAGE 2AMQA 1GJBB 3A89A 4X2YA 3RXAA 4YM9A 5DKMA 1A3EH 1TRYA 5C3NA 3BTEE 9LPRA 4IS5A 5C1XA 2FOEA 1O3CA 2F9BH 1YCPK 1XKAC 4GSOA 1O2MA 2BTCE 1LVYA 1NRRH 1ZLRA 2AERH 1ZGVA 2B5TB 3EAJA 4IW4E 2XWAA 2A5AA 1TRNA 4K69A 4D8NA 2V3OH 1QRZA 4Y76A 1EJNA 1C1VH 4ZHMU 1LPZB 1O31A 3LC3A 4UDWH 4Y11E 3KL6A 2BQ6B 4MPUA 2WPIS 1DLEA 1S81A 1P06A 3DFJA 4JYTA 2FDAA 1C2IA 1JBUH 3SU3A 1CA0B 1W0YH 4B73A 2VIOA 5G4BA 4I32A 1Z1IA 1YCPM 3GY4A 2C8WB 2W26A 2SFAA 1IAUA 2HLCA 1P0SH 2BY5X 3GYLB 1ZMNA 4A1XA 3SQHE 1YPLH 2AH4X 2A4GA 4FUCA 1HAXB 1QQ4A 4Q80A 1GVZA 3E16B 5EPNA 2F3CE 1FY4A 4Y7AA 1V2UT 4FU9A 4A1TA 2VVCA 3L3TA 1TE0A 1QY6A 4RSPA 3TJOA 1MH0A 1TLDA 2W3KA 1DT2A 1X7AC 1HAHH 2J92A 4FU7A 1ESBA 2ZU4A 3GY7A 3MU1A 5C5NA 5J4SA 2ZF0H 3SOSA 2ZDNA 2ULLA 2AS9A 1FIWA 2FMJA 1BZXE 1XVMA 3H7TA 1HJAC 4CRBA 1PPGE 1Q3XA 4YLUA 2O8MA 1EAXA 2CV3A 3M7UA 1TA6A 1DANH 3A82A 1BTUA 1NRPH 1Y3UA 1DWEH 1K1PA 3TH3H 1GJ8B 4JK5A 1TMBH 1QURH 3SV2H 5L2YH 4FUDA 2BYAX 2QY0B 1YGCH 1UVOA 3GY6A 3KNXA 1FI8A 1GVKB 4DURA 4NGAH 3TH4H 1D3PB 4KELA 4K5ZA 1KXCA 1TONA 2FOMB 3P17H 4K2YA 1GJCB 1L1NA 3B9FH 1P12E 1SLVB 1PPZA 3SJ8A 4IN2A 1T7CA 3ZZ3A 2GZ7A 5EXMA 4TY7A 1SGPE 4X6NA 1UTQA 3ATLA 4I8KA 2J2UA 1NESE 5JBCS 1FV9A 2BD7A 2C8YB 1TBZH 1RTLA 3G01A 2V0BA 4RKJB 2IJOB 4WMEA 1BJVA 1ZSJA 2HNTE 3FP8E 2ANYA 1NROH 1SGRE 1O2RA 4XBBA 3BEIB 1CSOE 1K1LA 1UTNA 1AGJA 5IYTA 1Q2WA 2SGAA 3BIUH 4AGJA 4AZ2B 2ZIQH 1BBRH 1QJ6B 2WPJS 1Y5AT 3ZVDA 1V2QT 1C9PA 1S85A 4ZKRU 3C1KA 2OTVA 2PTCE 1GMHG 1A0JA 3P8OA 3ZZAA 1QA0A 1KXDA 2BX4A 5B6OA 1UK4A 1YLDA 2IPHA 3ODFA 3RC5A 1ZPCA 3MU5A 4Y8XA 2QF3A 1HPGA 3T29A 2WPHS 3M5OA 1ELVA 3ZZ8A 4FVDA 1C1OA 1NRQH 5CE1A 1P3CA 1XUIA 1HGTH 2R0LA 3O8DA 2LNCA 1EAUA 1F0UA 4GLYA 4B74A 1DE7H 4BAKB 1MTSA 1ABJH 3QZQA 1EB2A 1K28D 4E7NA 1O3OA 3TITA 3AW0A 3A7YA 4NIVA 1THPB 1T32A 2VIWA 4NA9H 1NTPA 1J9CH 3V7TA 2ZHQH 4XSKU 3GISB 4DVAU 1D3DB 1UTLM 4AB8A 4I33A 1C5RA 2VWOA 5E2OA 1JXPA 1C1NA 1O5FH 2ZFTA 4INHA 3U8TH 4XDEA 1EZQA 1GJ7B 2PKAA 2BXTH 4GUXA 1CBWC 1TX6A 4OGXA 1LVMA 1RFNA 1TGNA 3LC5A 2OBOA 1C2EA 1AU8A 2V35A 1C5MD 2A7CA 1ZMLA 3ZVGA 5TCCA 1GI2A 3MU0A 2FOGA 1SGEE 2JKHA 2ZCLP 2WUCA 1P04A 3TJVA 5E8EH 2QCYA 2DE9A 1QJ1B 1PQ5A 1ABIH 1ZTKA 1NN6A 1XMNB 1CA8B 2F9UA 3QLPH 3DD2H 1EP5A 1E36B 4CREA 3GCNA 1DXPA 2FESH 3RXCA 4AFQA 2AEIH 3EE0B 4BTIB 4FU8A 5EXNA 3M61U 1BIOA 1TPOA 3Q77A 4MNXA 4VGCB 2O8TA 1NS3A 2BXUH 2Y6TA 4Y8ZA 1DY8A 4WH8A 4Y71A 1W14U 2H1UA 1ESAA 4GHTA 2NU1E 1GBEA 1RS0A 3RXEA 2QXJA 1C1PA 1TNLA 2QXHA 4NZQA 1ZHMA 3SJ9A 4CHAB 1P2QA 2ANWA 2XW9A 1OYQA 1AUJA 4JCNA 1GBDA 3PROA 5EU8A 1AVGH 2CGAA 2YNAA 2ZNKH 1YM0A 4B1TA 1C5QA 1FIZA 1MZAA 2BD8A 1TMTH 1ZR0A 2BVXH 1ZPZA 1C4Y2 2FS9A 1GJ6A 1P02A 1IQEA 3ATWA 2CF9H 1LPGB 1O2XA 3KN2A 5DP6A 3SZNA 4XOJA 1HXEH 1G9IE 2SGEE 3F9HA 1C1TA 4HFPB 1EKBB 3P8NA 1T4UH 1TB6H 3I78A 5J4QA 2G4TA 5EXLA 1CT2E 5ABWA 2O8WA 1JWTA 1SGIB 3LGWA 1G36A 2G00A 1LHCH 3RXTA 1GVLA 1O33A 2GT8A 4ZUHA 3UOPA 3BG4B 2JETB 1H9LB 2VINA 4I31A 3QDZB 4D7FA 2WPLS 1TAWA 1SGYE 1WBGB 2K1QA 1NU9A 3H5CB 1SQAA 2BDCA 1UMAH 4AGKA 1XUFA 5TCAA 1KXBA 1TFXA 2QXGA 3MH4A 2UWOA 5DP9A 3GY2A 2XBXA 2XC5A 1D3QB 3TGKE 1A5IA 1O3JA 2A5KA 4INLA 1V2OT 3BTQE 1KSNA 1MTUA 3RLWH 4NZLA 5T6GA 2GCHG 5EW2H 5E0JA 1ELDE 2ANMH 4Y8YA 4AORA 1C4U2 2IN2A 1GHBG 3LGIA 2A4QA 1ZTLA 4BTUB 2Z3DA 1BBRE 5DP7A 2Z3EA 3U8RH 4ZKSU 1TALA 1TPPA 2BDHA 5I46H 1F0TA 4BAHB 4DCDA 4JMYA 1GMDG 2HNTF 4FUIA 4ZHLU 3SBKA 1BB0B 1ZHPA 3A84A 4X2WA 1HXFH 4GCHG 2CHAC 4YTAA 3CENA 4JZ1A 4CRDA 1QCPA 2VGCC 1O2ZA 4FVBA 5DP4A 3UNSA 1P01A 3A88A 3QTOH 1O5DH 1AUTC 2BZ6H 4Y79A 1O2GH 1UTJA 1SGCA 1O36A 3UQVA 2ZECA 3Q3YA 3FVFB 4O3UA 1AFQB 1SGNE 4BAQB 1O35A 1SFIA 1O2IA 2ZDMA 3SNDA 1PQ7A 3ZZDA 2WV5A 2ZGHA 6GCHG 1GHWH 2G5VA 1UK2A 2J4IA 1DWDH 4WJG2 4BXSA 3SUDA 1O2VA 3MTYA 4ABIA 1GDNA 1Z8GA 3VEQB 1BOQA 2ZU5A 1GGDB 4AG2A 1HYLA 3MH7A 2QGRA 3PYHA 2BDIA 3F68H 2RG3A 3PM3A 3SNBA 3DHKH 2GCTB 1ZOMA 2AMPA 4JZDH 8GCHG 2AIPA 3S9BA 1BDAA 3A81A 1WQSA 1EUFA 1B0EA 1BTYA 4IMZA 1OP0A 3M3TA 3OSYA 1S0QA 1WUNH 3VB7A 3F9GA 1GBFA 1E37B 2BLQA 1BRBE 1BTXA 2GD4B 5FX6A 4FUFA 3VGCC 3F9FA 5JBAS 2QAAA 1P9SA 3GOVB 1EOJA 1GJ9B 1V3XA 1IHSH 1AFEH 1O3AA 1G3DA 2Y5FA 3LIWA 4F49A 2ZDLA 4YT7H 2GMTC 1UCYK 2Z9LA 1IQJA 3RMNH 4X8UH 1DVAH 3UFAA 1O3HA 1C5XB 2BB4A 2R9PA 1PPFE 1O37A 1MKWK 2R2WU 4ESTE 5FPSA 2D8WA 4K3JA 3TK9A 1S84A 3B8JA 4AYYB 3Q00A 1O3PB 2UWLA 1TGCA 1DUAA 3K65B 1CE5A 4O3TA 4KGAA 1GHBF 1Y59T 3BTGE 4WXIA 1DPOA 2M5TA 5H4IB 1Y3VA 2ZU1A 1ZRKA 2A32A 3PB1E 1EQ9A 4OGYA 3FP7E 1HDTH 2PSXA 4RN6A 2BLWA 3SUFA 1GJAB 4I8HA 1MU8B 3LT3A 4BAOB 2F9PA 1O2UA 2P3UB 1CGHA 3TPIZ 1ZTJA 2BMGB 1V2VT 1TIOA 3RXKA 3T26A 2PKSC 1W7XH 5A0AE 1A61H 2BHGA 5GCHF 4ISOA 3QX5H 2AIQA 3M7QA 4KTUA 2XWBI 1HAOH 2BD5A 4WY3A 3IWMA 1ELTA 2OC8A 5EOKA 3V0XA 1O3FA 1ARBA 1HJAB 3BEUA 3K9XB 1QNJA 1AMHA 2EEKA 1E38B 4K1EA 1TABE 2XBWA 1TNIA 2QF0A 6GCHF 1HFDA 3NPSA 2BOHB 1AQ7A 2FOCA 3FZZA 3URCA 2ZKSA 3S9AA 3MNBA 1O2SA 3EYDA 2BD4A 3P70B 4YOGA 1BUIA 5LPRA 2H5DA 4ISIH 1MKXH 3FANA 3KQBA 3UOUA 4GVUA 5AVDA 1INCA 4Q7YA 1KIGH 1NY22 3NUMA 1YPEH 1LHEH 1C5YB 1C1UH 1MZDA 1UTOA 3HATH 2C93B 5DO4H 3IITA 2BY9X 2D2DA 1D9IA 1P8VC 2F9OA 2HWLB 3O8BA 1ZGIA 2PV9B 4CH8B 5FPTA 3ZV9A 3HGPA 3BTME 1S83A 2P16A 4K1TA 1V2RT 4LK4A 3VXEH 1LO6A 1EPTC 1LDTT 2ZGBH 1Z7KA 1PQ8A 1V2MT 1YC0A 4IGDA 2G51A 2CF8H 1EAWA 1RIWC 1YLCA 1YPKH 3UWJH 3EGKH 3GDSA 2BY6X 1K2I1 2J95A 1DDJA 5E0HA 1VGCB 2DUCA 2HOBA 1GBHA 4O9VA 2ZI2H 1FY5A 5JPMH 3R0FA 3D23A 1DICA 1GCTC 3A7XA 3TLOA 6LPRA 6CHAC 4IBLH 1C2FA 1FUJA 5DK1A 3M3VA 1ETTH 3RLYH 1Z8JB 1MAXA 2PTNA 3ZZ7A 1BTWA 4B71A 2NWNA 1Z6EA 4A6LA 1J16A 1ETSH 1SGFG 3UR9A 2ZEBA 1EPTA 1ACBE 3TNTA 4BANB 1B7XB 3TJUA 1ESTA 1IHTH 4WWYA 1EX3A 1O5AB 9ESTA 3RXUA 2SNWA 3PWCA 1Q31A 2C4FH 3MO6A 3OY6U 1RTKA 5FPYA 1EJAA 5F03A 1KLTA 2CXVA 4Y6DA 4Y10E 3QK1A 3P92A 3RMOH 3E0PB 4JZFH 4WMDA 1GI6A 2FXRA 1LCYA 2ZCKP 2VB0A 1FAXA 3GDU