4U2WA

Atomic resolution crystal structure of hv-bbi protease inhibitor from amphibian skin in complex with bovine trypsin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords Bowman-Birk trypsin inhibitor
publication title Atomic resolution crystal structure of HV-BBI protease inhibitor from amphibian skin in complex with bovine trypsin.
pubmed doi rcsb
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u2wA02
3ZZDA 6CHAB 1MZAA 1NESE 2BY9X 1DLKB 1UMAH 4I32A 3UR9A 2EC9H 2PKAB 1DS2E 4ZROA 2UWOA 1GI0A 5DP5A 1LPGB 2ZHWH 1C1WH 1T4VH 4DY7B 3M5LA 3NXPA 3SU0A 3T27A 3VXFH 4ZKOU 2VWOA 2ZGJA 1P2NA 1CVWH 1JOUB 1OYQA 3ZZ6A 3KQDA 1G37A 4YO9A 1WSSH 3U1IB 3ODDA 1KTTB 1VJAU 1OS8A 3LGUA 5ESBA 1HAVB 1TRYA 1J8AA 4B1TA 3UWIA 1WYKA 4ABDA 2FX6A 1RGQA 1JBUH 2W3KA 3A8CA 3HGNA 4BAHB 2Y5FA 4O9VA 1BRCE 1TIOA 3GOVB 1O34A 1P8VC 3RC4A 1BTWA 1EATA 3MYWA 2Z94A 3P95A 4YZUA 3TITA 4NA7A 4UFFH 4WMFA 2R3UA 3L6PA 1SHYA 5E2PA 4HGCA 4IN2A 4WXVA 1A4WH 1DE7H 4JZIA 3O8CA 3VB3A 1MKWK 1XXFA 3TK5A 2OC1A 3LGIA 4AGJA 4BXWA 1C5VA 2SNVA 1BBRE 1K22H 1GHAG 2BQWB 1OWJA 1RIWC 2J9NA 5GXPA 4YLQH 3GCTF 3HKIB 3KIDU 1T4UH 1GBBA 1ELEE 5AVDA 3A83A 1NFUA 1GJDB 1VCPA 1XVOA 1YGCH 2G52A 3BTDE 2F3CE 5JBAS 4DGJA 2BM2A 2G5NA 4YESB 3SU6A 1D3DB 1ARCA 5C5NA 1EAXA 1EQ9A 3RMNH 4RKOB 3PB1E 2O8UA 1HAHH 8KME2 1V2WT 4BNRA 2VVVA 1AFQB 1WBGB 2HRVA 3U8RH 1AUJA 1TWXB 3QLPH 3A7WA 2F9OA 3SHAH 2FDAA 4FXGH 2BZ6H 1LPKB 2AIQA 4CH2B 1KDQB 2Y80A 2BB4A 1HJ8A 4F4OC 3PMBB 2ANWA 3GY8A 3BSQA 3MO9A 3ITIA 1QJ1B 2BTCE 3NUMA 4BTUB 1C5OH 2O8TA 3AASA 3M3SA 1UHBA 1UTOA 1YPJH 1KLTA 2AMDA 3A7VA 1CA0B 1Y5AT 2A32A 1QBOA 1GWAA 1IQGA 1KLJH 1VCQA 5LPRA 2VWNA 3Q3YA 3TU7H 1GJ8B 1TX7A 5A0BA 3BTME 4LOYH 4D8NA 1IOEA 3A7TA 3I78A 1C5PA 1FY3A 2AIPA 2RDLA 2ZCHP 1EPTA 2VH0A 3H5CB 5DP6A 3S9CA 2TGTA 4VGCC 1UCYK 1FPHH 1FN8A 2W3IA 2A7HA 1S0QA 2O9QA 1NO9H 4OS4A 2ZKSA 1BIOA 1O2YA 3M61U 4X8UH 5CHAC 1QJ6B 1Y3UA 2FLBH 4HZHA 2ZFSA 3D65E 1AFEH 4UD9H 2AMQA 1ZSJA 3KQEA 3NKKA 1CE5A 1C1VH 3EE0B 1LMWB 1BDAA 1BTYA 1MQ5A 4UFEH 2BOKA 2FTLE 4B76A 1PQAA 1W7GH 1BB0B 2V0BA 1G32B 4Y71A 1ELDE 2Z9IA 3GYLB 2QXHA 4ABHA 4FUHA 5FBIA 4IMQA 1ETRH 1IQEA 3UUZA 3RXIA 1AB9C 2VIQA 1O2UA 1C5NH 1UHBB 3TH3H 1TGTA 4B2BA 1SBWA 3RUOA 1O2SA 1RTKA 2G4UA 4R8TB 1AY6H 4HI3A 3B8JA 5EXMA 2GZ9A 1U6QA 3S69A 4A1VA 1G3BA 2XC5A 2AYWA 1LVOA 2R0KA 1EPTB 4DIIH 1RD3B 3BTWE 3CS0A 2VB0A 3MH7A 1MAXA 5FAHA 1GHVH 1PFXC 2F9PA 2FS9A 3A86A 1NT1A 3FZDA 4FU7A 3RXMA 3P6ZB 1GI2A 3RP2A 4BOHA 2STBE 5GPIB 1SGFG 3U8TH 3URDA 1G3EA 1TNHA 1YPMH 1MTUA 2WV5A 2ZG0H 5GCHG 4Y0YE 1HAPH 1GJAB 1O3AA 5ESTE 2VH6A 3MMGA 1GBDA 2H9EH 3PMAB 2ESTE 3OSYA 3UOPA 4CRDA 3UNSA 7KMEH 3LC3A 2J94A 3RDZA 3MNCA 2PKSB 4FUBA 1DSUA 2WPMS 3DFJA 3RXBA 3RMMH 5LH8A 1DANH 3P17H 5E2OA 2ZGCA 1P04A 1K1LA 1O3DA 1WOFA 2VVCA 5FHTA 3K6ZA 1SPJA 2VNTA 2Z9LA 5DP4A 4B71A 4IW4E 1GBCA 1O5AB 2KAIA 3MNSA 1O0DH 4DVAU 2EI6A 5FCRA 3SI4H 4X8TH 4ZXYH 1OP8A 1XKBC 1YPGH 4X8SH 3MH6A 3VB6A 7GCHF 4CREA 4J1YA 3MU5A 5DGJA 4K1SA 1B7XB 1GPZA 3BEIB 4YM9A 3K2UA 3R3GB 3MI4A 2Z7FE 2NU1E 5EXNA 4I8JA 2ZGHA 1UTMA 1J15A 1O35A 1V2ST 3ESTA 1TNJA 2ZHDA 3RXHA 4NIXA 1QBVH 1OP2A 4AB9A 1C4Y2 5BRRE 1IQNA 1UVOA 1DWCH 3E0PB 2GP9B 4GLYA 1AFQC 1EP6A 1ZPBA 2B8OH 3MO3A 2BXTH 1A7SA 1LKAA 2Y7ZA 3RXUA 3AW0A 3R0FA 4FUDA 2BX4A 5EOKA 5C1XA 2ZQ1A 1HV7A 1TBQH 1T8OA 4K69A 2XCNA 2ZIQH 1RFNA 1QB9A 1TX8A 1OX1A 1V2QT 2G55A 2FOFA 4ISOA 4TPIZ 3PLBA 2WPHS 2KAIB 4O03A 1SQAA 2OD3B 3UREA 4YT7H 1ETSH 1V2TT 1V6DA 1MBQA 1FAKH 4KELA 3W95A 3PLPA 2J92A 1A5GH 3NK8A 1P09A 3HK3B 4E05H 2NU2E 2F91A 4ABGA 1AI8H 5TJXA 4MG3A 1HCGA 4NGAH 3ZVCA 3SU3A 3P8OA 3RXGA 1ARBA 1W3CA 1J14A 2FWWA 4UONA 3SU2A 1BUIA 2K1QA 1EJNA 3S7HB 2WYJA 3MOCA 1NS3A 1C2DA 1QL9A 2BD2A 1HRTH 1RXPA 4F49A 4Y76A 3UTUH 3DT0H 5A2MH 5J4QA 3BIUH 3A85A 9LPRA 2PHBA 3MHWU 1FY4A 3SJIA 1EKBB 5T3HA 4DT7B 1SGQE 1V2JT 3T25A 4CBOA 1IQHA 1YF4A 1B0EA 3UOUA 4YT6H 2GDEH 2GT8A 3ZVEA 4A7IB 2P95A 1UTJA 1CT0E 1ZTKA 3GCTG 4XFQA 3M5NA 3KEEA 3D23A 3LPRA 4R0IA 1GBEA 1NRQH 1O2OA 4UFDH 1P0SH 1Q3XA 1THRH 4LXBH 4DOQA 3PWCA 1EOJA 4XSKU 3BEFB 1BTPA 2VIDA 1TPSA 1P11E 1O37A 2IPHA 3LJJA 3SQEE 1QRXA 1O3JA 1C2IA 4FUCA 4IBLH 5IDKA 1TBZH 4TWWA 1ABIH 4ZHMU 1TA2A 3BTEE 4LZ4B 1Y8TA 4CRAA 1TE0A 4FU9A 1MH0A 2CJIA 1O2IA 5CMXH 3ZZBA 4INHA 5LPEA 5FCKA 1MTNC 1GBTA 1NROH 2BLOA 5FBEA 3EGKH 1Z6EA 1TNKA 3I29A 2HGTH 4DURA 4AZ2B 1SG8B 3A87A 2SGAA 1JIRA 4WMEA 1D9IA 2O8WA 2ZNKH 4IMZA 1Z6JH 2D1JA 2C8YB 8GCHF 3ZV8A 1TONA 1V3XA 2GCHF 2Z9JA 1NFWA 3RC6A 3W94A 2OQ5A 2BVRH 1QB1A 4BTIB 4SGBE 1AE5A 5H4IB 3ZZ5A 1EP5A 1QCPA 1CGHA 1F92A 1T31A 1ACBE 1C4V2 3E1XB 1W0YH 1GBIA 1K1OA 1ZHPA 1SLUB 4D9RA 1C5WB 1L4DA 1UCYE 4ASHA 1YC0A 3GY7A 2FOEA 2THFB 2FX4A 1K9OE 3BTQE 4GHQA 1S84A 1KYNA 2FOAA 1NFXA 1W11U 3EDXB 1O2PA 3A8DA 3FP7E 3PTBA 2Y82A 1YBWA 5EPYA 3Q00A 3ZZ3A 5GCHF 2TBSA 4I8GA 1A1RA 1WQVH 1DLEA 2BDYA 3ZVDA 1SHHB 5A8ZA 4H6TA 5DP3A 1TNLA 5F03A 1ZRBA 5HXFA 1PPHE 4NG9H 2XBYA 1UK3A 3GCOA 5AFYH 4XOJA 4MPXA 1O5GH 1NRNH 1H4WA 1A46H 4YOGA 4ABAA 2EI7A 3ZZAA 2FOMB 4CHAB 1HNEE 1A5IA 1KXCA 1UK4A 2WV4A 2OC8A 5LPFA 3UNQA 4ZHAA 1ELGA 2WYGA 3RXQA 1DUAA 2ZU5A 1BQYA 2H1UA 5EG4A 4K60A 4OGYA 3CS7A 2QF0A 4JYVH 1YPKH 1HAGE 2JETB 4FUIA 3SU4A 2WPKS 4D7FA 2QIQA 1A0LA 4AGKA 2XYAA 1SFQB 2BHGA 1L0ZA 1ZZZA 1NRSH 4TPYA 2IJOB 1S85A 2FI3E 1N6XA 1WUNH 1BITA 1UO6A 3ELAH 4K3JA 5DG6A 1OWIA 2Y81A 4B74A 4ZMAH 1O3HA 1V2UT 3KCGH 2W7SA 2ZCLP 1YYY1 2EEKA 1HUTH 1AB9B 1UTNA 1FY5A 4U01A 1ZSKA 3A89A 4Y8XA 1W8BH 5FPSA 2Z3DA 2AFQB 1PPZA 4E7RG 1MU8B 2H2ZA 3EA7A 1V2KT 4MDSA 4NIVA 4GCHF 2STAE 3PYHA 4XBDA 1P9UA 1E36B 1SGCA 5EGMA 3NZIA 2FLRH 3GY4A 2XBXA 3RU4D 2GD4B 3BTTE 5C1UA 1D6WA 1CHOF 2F9UA 1QGFA 1IQMA 1GCTB 3TGJE 2ZGBH 2VU8E 1YPEH 4JZDH 4IC5A 1K2I1 2OINA 1MTSA 1XMNB 4NSVA 4H42U 1LHFH 4AORA 7GCHG 5K0HA 2OQUA 1ZR0A 1BRAA 3DD2H 3MU4A 2R2MB 3E3TA 3RXSA 1GMDF 1OWEA 4CRCA 1GL0E 2A2QH 3RXKA 5I46H 1N1LA 3OYPA 1KIGH 5T6FA 1LCYA 4MQAA 1OSSA 1FN6A 1NN6A 4Y0ZE 1GI6A 4TWYA 3LT3A 2QCYA 1KDQA 5E8EH 1G3CA 3T2NA 3VXEH 1UCYH 1GHXH 1QB6A 4H4FA 2BLWA 5HM9A 1C1RA 1C5LH 1H9HE 1O2JA 1CGJE 1WQSA 5F8TA 1O2GH 4Q7YA 3BTGE 1NTPA 2AEIH 1K1JA 4K1EA 1GI1A 5FXLA 3LONA 5FPYA 3P92A 1ELVA 4GVUA 5EODA 2PWXA 3GY2A 1FNIA 1RRKA 1Z1IA 1EX3A 5AF9H 1KXDA 1W14U 3T28A 2FEQH 1ANDA 1YCPM 1TABE 6ESTA 3O8DA 1T8MA 4Q80A 3TJOA 1QTFA 1BHXF 1EZQA 2P93A 3P8GA 1RTFB 2M5TA 3EQ0H 4A6LA 1P05A 3OU0A 2GGVB 1DWBH 1IAUA 5HYOA 1S83A 3T62A 1ZHMA 2BDGA 1NU9A 3DFLA 4NSYA 2ODQA 1HXEH 2EA3A 4IS5A 1UTLM 3SUGA 1G9IE 1XM1A 3IWMA 1H8IH 4ESTE 3G01A 5DJ7A 3L33A 3Q3KA 1QRZA 3S0NA 4AYYB 2QN5T 2D2DA 2JH6D 1T7CA 4BAQB 1HJAC 1CBWC 3IG6B 3ZZ4A 1GHBF 4RSPA 2GZ8A 4BXSA 3OY6U 3SN8A 5E0JA 5L6NH 1V2MT 3UIRA 1MU6B 4ABBA 2FP7B 4OS7A 1BTXA 3LJOA 5DO4H 1THPB 1EB2A 3M7UA 3BG8A 3GDVA 4CHAC 3Q77A 1CU1A 4Y8YA 4CBNA 2IN2A 2PUQH 2UUJB 3VEQB 4JZFH 1P57B 1QURH 2YOLA 2F9NA 2ZFPH 2SGDE 3RM0H 2ZU2A 4MNWA 1TMBH 2QC2A 2ZDAH 2BLQA 1P2KA 2FM2A 2JETC 2Z9GA 1ZHRA 1F0SA 4HFPB 1W0ZU 1LHDH 1TB6H 1K1NA 3SJKA 3SNDA 2ZHEH 2GT7A 4B2CA 1Y59T 2ZF0H 3LGWA 2PGBB 2ALPA 3NCLA 1BHXB 4XDEA 2QY0B 2XBWA 4NCYA 3BN9A 4LK4A 1IQFA 3E90B 5JBBS 1V2PT 1L4ZA 1TOMH 1Y3YA 2ZECA 3SU1A 3VB4A 3SUFA 1FAXA 1PQ8A 1O3GA 1QFKH 4AFUA 2HVXA 1YM0A 4X2VA 2RCEA 4MNYA 2CF9H 1MD8A 1IHSH 2OXSA 1D4PB 4TYDA 1P06A 2F83A 3LIWA 1GG6C 2J34A 1EZUC 1DSTA 4I33A 1F5LA 3M35A 5EQQA 5FX5A 8GCHG 2GCHG 1MZDA 1FQ3A 1XUFA 3FZZA 1BMAA 1PJPA 5JYIA 2AGGX 2FI5E 3SV7A 1G30B 2SNWA 2WUCA 3KGPA 1F5KU 3TVJB 5HGGA 3GISB 3MU8A 3TJVA 5DP7A 3O8BA 1KXFA 4U30A 1GCTC 2UUKB 3OX7U 1CT4E 1JXPA 1MTNB 3ZYEA 4DJZB 3U1JB 1H9IE 3LH3A 5FPTA 2XW9A 1WTGH 3B23B 2C93B 2BDIA 1O3IA 5E0GA 3PO1B 2HLCA 4X8VH 1FONA 3SGBE 2AERH 1BZXE 3LC5A 1SGTA 3ATKA 5ABWA 1N6YA 2H9TH 1TLDA 2FZZA 1SLWB 1S82A 2ULLA 1AVGH 4UEHH 2Q1JA 1PYTC 1P2JA 3E8LA 3QN7A 2DE8A 4THNH 3MNXA 4K8BA 4JZEH 4OGXA 1YPHE 2VWLA 4JCNA 1O2KA 1Z1JA 3SV6A 2BY8X 1DXPA 1ELBA 1KXEA 1Y5UT 1FMGA 4A5TS 1QRWA 1GMCF 2AMPA 2BD5A 3SZNA 4TY7A 3OTJE 4ABJA 1NY22 4O3TA 1P3EA 3MFJA 1XXDA 1K1IA 2GV7A 3SO3A 1UK2A 4I8LA 1UVPA 3E16B 1NC6A 1MD7A 2FYQA 3TGKE 2TGAA 1O3LA 4Z6AH 4FUJA 3GICB 1BJUA 1KXBA 2NU0E 3A7XA 3PMJA 1SMFE 1EZSC 1GDNA 1LPZB 2NU3E 2ZP0H 4ISNA 2O8LA 2A5KA 1F5RA 2SGPE 1OWKA 2BDCA 2FO9A 1WAYB 4WWYA 3MH5A 2R3YA 1P2QA 5DP9A 4IGDA 3GY3A 3UNRA 1VITF 3BG4C 8ESTE 3M5MA 1C1TA 3HATH 4E06H 3N7OA 3QWCH 4CRBA 1O39A 2RG3A 5JDUB 3QUMP 5A0AE 2PLXA 2A4RA 3C27B 2WINI 4SGAE 4LZ1H 1FY1A 1YLCA 1A3EH 3D49H 2V6NA 2H5CA 1W7XH 1XUJA 2QYIA 4AYVB 1S0RA 1MAYA 4INKA 4GCHG 2SGFE 1ZMNA 2PTNA 4Y7BA 3WY8A 4X1PU 5EU8A 2ZTXA 2P94A 2HOBA 3QTVH 2Z6BD 4ABIA 2JH0D 1CHOG 3ZYDA 6GCHF 1BRBE 1C1QA 2EI8A 2FTMA 1ZMJA 1GBMA 3A7ZA 1D6RA 1T8NA 1MKXH 1IQLA 3QZRA 2ZDMA 2PV9B 3MTYA 4RN6A 4AFZA 3H7OA 1O2RA 2G81E 1Z8JB 2PUXB 3UQVA 4WF8A 2BD8A 1GMDG 1TGCA 3MO6A 3SBKA 1C5YB 7ESTE 1TOCB 3JZ2B 1QBNA 2WUBA 1LO6A 1DY9A 1V2VT 1O3MA 3TJNA 3EA8A 4YOIA 1ZTLA 1UVUH 3UY9A 4BAKB 2BDBA 3SJ8A 4ABFA 2R2WU 3TPIZ 2CMYA 2FOHA 1ELTA 4JK5A 3SJ9A 4AB8A 1A2CH 2GMTC 1C5MD 1SGNE 1ZSLA 1OWHA 2Q6FA 4ZUHA 2BLVA 1C5UA 1AUTC 1ZOMA 5BPEA 1K1MA 1HYLA 1ESTA 1LVYA 3P70B 2CHAC 2R9PA 4ISLA 1ESBA 1DVAH 3F9EA 1C2HA 4K2YA 5L2YH 4BTTB 4ZKRU 1V2RT 3U9AH 4CR9A 1Z7KA 2QF3A 3QTOH 1O36A 1UTKA 1VITH 1NZQH 2BY7X 2YNAA 3QK1A 3BEUA 1WTHD 1LHCH 4CR5A 3KQBA 1C5TA 5F8XA 1J9CH 1SOZA 1TQ7B 2A4QA 1BTUA 1IQJA 1W10U 2F9BH 1C1SA 4NFFA 3RLWH 1GGDC 3F9FA 1ZGVA 1O2MA 1O5BB 2P3TB 1MTVA 3S9BA 1O2ZA 1QL8A 1RS0A 1TGNA 4OS5A 3ZZ9A 1TMTH 2QXIA 1FLEE 2BD3A 1MKXK 4J2YB 5JPMH 5L30H 2B9LA 4AN7A 4DG4A 2B7DH 3PO1C 3FFGA 4BAMB 3F9GA 2VWMA 2VVUA 5EXLA 1E37B 1P9SA 2ZGXH 3GCHB 4KGAA 5DKMA 1GHBG 2GZ7A 1TNGA 4XE4A 1J17T 1ID5H 3ATMA 5EPNA 5B6OA 4OS1A 3QZQA 4ZXXH 1DT2A 3SORA 1AHTH 1F0RA 1EJAA 1LDTT 2HPPH 1C2JA 1K21H 1D3QB 1HDTH 3TK6A 2ZHFH 4XBCA 5HMAA 1Z71A 5C67A 1C2MA 4X2YA 2CGAA 3SNEA 1QY6A 2A7JA 3MH4A 1GI9B 2A7CA 3PROA 4ZKSU 4NZLA 3E6PH 2BY5X 3UFAA 3SI3H 4ISHH 1TRMA 1F2SE 2UUFB 1O2QA 2J38A 3A80A 3URCA 1HJAB 1Y5BT 1CBWB 5TCAA 2ZWLH 3SQHE 1GBHA 1V2LT 2VIWA 1GJ5H 2VIPA 2Q6DA 2B5TB 1HIAA 1E34B 1HAIH 3BTKE 1TYNA 5FX6A 1GBAA 1O3BA 4MNXA 3ZZCA 1GCDA 2J2UA 2UWLA 3HGPA 1O2TA 1PPGE 2BVSH 2XTTB 3MU1A 2ZDNA 2QGRA 1SQOA 2HWLB 1WCZA 3ZV9A 2G5VA 3LDXH 3GY5A 4WXIA 3FP8E 3Q76A 4NIWA 2ZDVH 3A7YA 2OUAA 1C9PA 3TNSA 4BANB 2PSXA 3AVZA 1GVZA 1DY8A 1Q2WA 2FOBA 2HPQH 5T6DA 2C90B 1SGPE 1GI5A 4FUFA 1ESAA 1UVSH 4JYUH 1CGIE 2QA9E 2Y5HA 2ZPSA 4FUGA 2ZCKP 1ANBA 3TH4H 3Q3XA 4K1TA 2W7UA 2XWAA 1KY9A 4B75A 1ABJH 2VGCB 1HAZB 5GDSH 2ALVA 1AVXA 4WMDA 4X1NU 3RU4T 1GG6B 3BTFE 1HIAB 3UR6A 1GMHF 2BDAA 3LU9B 2OCVB 2FMJA 1SI5H 3LH1A 1VCWA 1J16A 1HLTH 1ZPCA 4KTCA 1QJ7B 3MU0A 2XCFA 2CXVA 4JK6A 1H8DH 1FUJA 4QT8C 5L2ZH 1HXFH 5F8ZA 3GDUA 1O5FH 1E0FD 2ZEBA 1UVTH 3B9FH 1YPLH 2VIOA 1O5DH 1KTSB 1O2NA 1JRSA 1H9LB 2TPIZ 2ZFQH 1BMLA 1CHGA 3SV9A 2ZFTA 2F9VA 3DA9B 4ISIH 1AN1E 1YPHC 5CE1A 3H7TA 1EUFA 1KLIH 1YLDA 1HBTH 1E35B 1L2EA 1NFYA 2CF8H 3BTHE 2V3HH 2HNTE 1GMCG 5C20A 3ZVFA 4X6OA 1G3DA 2BXUH 1AKSA 1ANEA 1B0FA 4DW2U 5EW2H 3V3MA 1Z8IB 1SFIA 1ZPZA 2FOGA 4D76A 1O38A 1DM4B 1TALA 3K9XB 1C9TA 1PQ5A 1P2OA 3LOXA 1C2EA 1G2LA 1O3PB 2AH4X 2FS8A 4FVDA 4X6NA 1HB0B 2IOTA 1LHEH 1QA7A 2PFEA 2J95A 4AFQA 1W2KH 1LQDB 2ZDKA 3PLKA 1VITG 1IQKA 1VGCC 1AWHB 2R0LA 3ZVAA 3FP6E 1GJBB 5HM2A 1DITH 5E0HA 1SGYE 1FXYA 1LVMA 2BQ6B 3M7QA 1P03A 2LNCA 2GDDA 5JBTA 1S6HA 1VJ9U 2G51A 2HNTF 1SSXA 1IHTH 3NWUA 1FDPA 3SV2H 3RXJA 3F6UH 3KNXA 2DE9A 1GJ7B 1S6FA 2ZTYA 3K6YA 1Q31A 1IQIA 1C4U2 2QAAA 1KXAA 1PYTD 2FI4E 4X1SU 4Y10E 1EAUA 1AIXH 3A84A 2ZA5A 1DFPA 4AG1A 6GCHG 1S5SA 3GCHC 1GI8B 3SNCA 3QO6A 3SJOA 2OP9A 3SW2B 2BMGB 1QHRB 1N8OB 2G4TA 5C3NA 1SVPA 3ZVGA 2ANKH 1AKSB 2A45B 3BG4B 1A61H 2TIOA 2GCTC 3AW1A 3RXOA 1DXWA 3A82A 2D8WA 2QXGA 4BAOB 3SGQE 1VR1H 1ANCA 2NWNA 1C2LA 3RMOH 1XUKA 1MUEB 3I77A 1QA0A 1DWEH 1W12U 4YTAA 1C5XB 1SC8U 4WJG2 4H6SB 5T6GA 1C2GA 1FJSA 1GL1A 4CRGA 4B2AA 1SL3A 3UWJH 1C5SA 1O31A 1ELFA 2P8OC 1CSOE 3STJA 1MMJN 2ZO3H 3PTNA 4MPUA 1ETTH 3KN2A 4ZKNU 2PTCE 1SGEE 3E91A 3ZZ8A 4X1RU 1PPEE 3FANA 2ANYA 2I6QA 3C1KA 1FI8A 4UFGH 4CH8B 1BRUP 2XXLA 1EXFA 4GAWA 4X2XA 1THSH 2ZZUH 1ZTJA 5DP8A 1BTZA 4B73A 1P2MA 3V7TA 2ZFFH 1FIWA 1ZYOA 1GHWH 3M3VA 2FPZA 4DIHH 1JIMA 4KP0A 1HPGA 1D3TB 2P59A 4NWLA 3SV8A 1HAXB 2BD7A 1NPMA 1O2LA 3F68H 1DUEA 2GMTB 4Q7ZA 2GTBA 2XNIA 3M5OA 3TLOA 1HGTH 1L1GA 1QNJA 5PTPA 4NA9H 2OBQA 2JKHA 1DOJA 2FYRA 2CHAB 2CV3A 3CP7A 4FUEA 3DHKH 1SLVB 1HJ9A 1A0HB 2BVXH 3MWIU 1MQ6A 1UTQA 4A1XA 1GJCB 4K8YA 5C1YA 3P8NA 1PQ7A 2XWBI 1P10A 1TPAE 4OS2A 1PPBH 1SQTA 2ZQ2A 2AGIX 2VGCC 3T26A 1A5HA 1YCPH 1ZJDA 3A8AA 1H1BA 1RJXB 4WY3A 2J4IA 4IN1A 1CT2E 4MVNA 2QXJA 1K28D 4GHTA 2SGEE 1TRNA 2VJ1A 1GI3A 1ZLRA 1TPOA 1O32A 1OYTH 2PW8H 1AU8A 2ILNA 1TX6A 1C1PA 4NWKA 2ZFRH 2XC0A 2FESH 4GSOA 3QX5H 5IYTA 2XBVA 3TK9A 1CA8B 1SOTA 1GGDB 4O97A 1AD8H 1GJ9B 1FY8E 1ZMLA 1TGSZ 1GBJA 5J4SA 4GPGA 2WPJS 3RXAA 3ODFA 4TY6A 6CHAC 1UJ1A 2YNBA 4MTBA 4X2WA 3RXDA 1O3OA 1V2OT 1TPPA 1C2FA 1BBRH 1TBRH 4JMYA 2A4OA 1BCUH 3QGNB 1C5QA 3D62A 1LHGH 2WPIS 3CENA 3RXRA 2OBOA 3RXEA 2ANMH 4WVPE 1EZXC 2LPRA 1DX5M 4X6PA 4IC6A 5EW1H 4I7YH 2BDHA 3BF6H 4Y79A 5C5OA 1Y3XA 2BZAA 2A31A 3RC5A 3ZVBA 1BMNH 3PM3A 4Q7XA 1CO7E 4A1TA 3ATIA 1O3CA 2G00A 4Z0KA 7LPRA 1GBLA 1YP9A 2C8WB 2FODA 2HALA 1TAWA 1TQ0B 1P12E 1P2IA 2A0QB 2A4GA 1E38B 4NZQA 4PROA 3VGCB 2Z3EA 5AHGH 1QQ4A 2UWPA 1GBFA 1JWTA 3U98H 2C8XB 3TGIE 1XKAC 5EQSA 1GHYH 1O3FA 1O5EH 3KHVA 3RXVA 2W5EA 1YCPK 2AGEX 4YLUA 1A3BH 1N8OC 1FIZA 1GI4A 3KQCA 2C3SA 2ZPQA 2H9HA 1BTHH 1O3EA 1CQQA 2BOHB 3V0XA 4YOJA 1EJMA 2TGDA 2JH5D 4ABEA 3RM2H 1BOQA 1O3NA 1DWDH 3VPKA 3PMHB 5C2ZA 1HFDA 1GMHG 2UUYA 1M9UA 1A0JA 1WU1A 4FVBA 1HAOH 2Y7XA 1GDUA 2C8ZB 3QDZB 2BD4A 1LQEA 2OC7A 2OC0A 5DK1A 5TCCA 1AZZA 5A09A 2P3FH 1DICA 1ZRKA 3M37A 1AO5A 3JZ1B 1WV7H 4Y11E 3TH2H 3U69H 4E7NA 5I25A 1BBRK 1Y3VA 5SGAE 4NA8A 1GHAF 3LGTA 1QR3E 1GBKA 3A81A 3UQOA 2GV6A 1NU7B 4JZ1A 4Y6DA 3SGAE 3GDSA 1Z8GA 1O2XA 1OKXA 2XRCA 2HNTC 4RKJB 1NM6A 1GJ6A 1O30A 1S81A 5F6MA 2AS9A 2OTVA 4NFEA 2A2XH 3HK6B 3ATWA 1EB1H 1V2NT 4XBBA 3STIA 1X7AC 3P8FA 1CA0C 1TFXA 1TMUH 2H6MA 3FVFB 3SNAA 1F0UA 4X0WU 2P16A 4INLA 4WH6A 4UDWH 4X6MA 8LPRA 1Y3WA 3AAVA 1C5ZB 2CN0H 5LGOA 1O2HA 1O2WA 3A8BA 1GDQA 4WH8A 4AX9H 1FPCH 1SB1H 5A8YA 1SGRE 2D26C 1LVBA 2SFAA 3GYMA 1INCA 3RXCA 3PWBA 3SOSA 3PV4A 3EA9A 5GJ4B 2Y6TA 3O8RA 1MCVA 1F0TA 2ZHQH 2B0FA 2OLGA 3RMLH 1ELAA 4M7GA 4U2WA 4X1QU 1FZZA 1UTPA 1OOKB 1XUIA 2RA3A 2PGQB 2XC4A 2ZU4A 3M3TA 3IITA 2Z3CA 5DPAA 1BT7A 4OS6A 2RA0A 3RXFA 4ZH8A 4D9QA 1VGCB 2GVFA 1JRTA 2ODYB 1KSNA 1LKBA 1OWDA 1DPOA 1P01A 1L1NA 2C4FH 3UPEA 3NPSA 1LTOA 5ETXA 2BQ7B 4I8KA 1GVKB 4D7GA 3VB5A 4O3UA 3BIVH 3RXTA 3S9AA 5JB9S 4AFSA 2TRMA 1DDJA 1O5CB 1EPTC 1PPCE 3EAJA 3OY5U 4Q2KA 3U8OH 1O3KA 4NIYA 2A5IA 4U32A 4CRFA 1ORFA 1SGDE 1G2MA 2BX3A 2Q6GA 3F9HA 3RU4E 1B5GH 3V13A 1EOLA 1ZJKA 1OP0A 3GCNA 2ZI2H 2Z9KA 1XX9A 5GIBA 1TGBA 3RXLA 1SR5C 4AG2A 1AQ7A 1Z8RA 1RIWB 3SUEA 2FOCA 2GCTB 4MLFB 1AWFH 1MCTA 3M36A 4AOQA 2ZDLA 4HTCH 4Y8ZA 3L3TA 1T8LA 2ZPRA 2PSYA 1GI7B 1ZGIA 2H5DA 4MPWA 3QGJA 3TIUA 4KTSA 2A1DB 1NRPH 2NU4E 1C1OA 2PKSC 2Y5GA 1AE8H 1C1UH 3FAOA 3SHCH 2P8OB 3TJUA 3E0NB 3DUXH 3VGCC 4UE7H 2PR3A 2P3UB 2I6SA 3A88A 2BD9A 2BY6X 1OPHB 3K65B 1L1JA 3LKWA 1EASA 2V3OH 3VB7A 3GY6A 3S7KB 2SGQE 3HPTB 3LGYA 3BV9B 3ZZ7A 3VFEA 1GHZA 1G36A 1SGFA 1C5RA 1W13U 1EAWA 1QL7A 1P02A 2WPLS 5JBCS 2BYAX 2V35A 1MBMA 1F7ZA 2ODPA 3ENSB 1SGIB 3AAUA 2GX4A 3KL6A 4ZAEA 4DCDA 5AFZH 3LGVA 4MPVA 1BA8B 2ZU1A 1GJ4H 1C2KA 1AMHA 4VGCB 2ZC9H 9ESTA 4ZHLU 2FXRA 5G4BA 3SUDA 1XVMA 1AGJA 1QIXB 4I31A 3RLYH 1C1MA 2PKAA 4FU8A 2VIVA 1XUHA 1AZ8A 1VZQH 1RTLA 5CHAB 2A5AA 3ATLA 1XUGA 3SNBA 2FIRH 1BJVA 2W26A 2ZU3A 4GUXA 4I8HA 2DUCA 4JYTA 3V12A 2ZTZA 4KKDA 1MKWH 3T5FH 2QV1A 1ELCA 4K5ZA 2O8MA 5A8XA 5A0CA 2GKVE 1TNIA 1AVWA 1HAVA 2TGPZ 1SLXB 4A92A 1JMOH 3HKJB 1QQUA 1D3PB 3MNBA 3EYDA 1HAYB 1O2VA 2G8TA 4KTUA 5EQRA 3SU5A 1GVLA 3T29A 6LPRA 2VINA 1EAIA 1FV9A 1K1PA 2ASUB 1PPFE 1TA6A 3M7TA 3TNTA 3KF2A 1T32A 5GWZA 1P3CA 1O33A 4Y7AA 1OXGA 1NRRH 1YKTA 4MNVA 1BMMH 1MTWA 3RXPA 1C1NA 5K7RA 5JB8S 3F1SB
chains in the Genus database with same CATH superfamily
2K8IA 3ZZDA 6CHAB 1MZAA 1NESE 2BY9X 1DLKB 1UMAH 4I32A 3UR9A 2EC9H 2PKAB 1DS2E 4ZROA 2UWOA 1GI0A 5DP5A 1LPGB 2ZHWH 1C1WH 1T4VH 5T1VA 4DY7B 3M5LA 3NXPA 3SU0A 3T27A 3VXFH 4ZKOU 2VWOA 2ZGJA 1P2NA 1CVWH 1JOUB 1OYQA 3ZZ6A 3KQDA 1G37A 4YO9A 1WSSH 3U1IB 3ODDA 1KTTB 1VJAU 1OS8A 3LGUA 5ESBA 1HAVB 1TRYA 1J8AA 4B1TA 3UWIA 1WYKA 4ABDA 2FX6A 1RGQA 1JBUH 2W3KA 3A8CA 3HGNA 4BAHB 2Y5FA 4O9VA 1BRCE 1TIOA 3GOVB 1O34A 1P8VC 3RC4A 1BTWA 1EATA 3MYWA 4ASUD 2Z94A 3P95A 4YZUA 3TITA 1YWUA 2XNDD 4NA7A 4UFFH 4WMFA 2R3UA 3L6PA 1SHYA 5E2PA 4HGCA 4IN2A 4WXVA 1A4WH 1DE7H 4JZIA 3O8CA 3VB3A 1MKWK 1XXFA 3TK5A 2OC1A 3LGIA 4AGJA 4BXWA 1C5VA 2SNVA 1BBRE 1K22H 1GHAG 2BQWB 1OWJA 1RIWC 2J9NA 3PRBA 5GXPA 4YLQH 3GCTF 3HKIB 3KIDU 1T4UH 1GBBA 1ELEE 5AVDA 3A83A 1NFUA 1GJDB 1VCPA 1XVOA 1YGCH 2G52A 3BTDE 2F3CE 5JBAS 4DGJA 2BM2A 2G5NA 4YESB 4OM9A 3SU6A 1D3DB 1ARCA 5C5NA 1EAXA 1EQ9A 3RMNH 4RKOB 3PB1E 2O8UA 1HAHH 8KME2 1V2WT 4BNRA 2VVVA 1AFQB 1WBGB 2HRVA 3U8RH 1AUJA 1TWXB 3QLPH 3A7WA 2F9OA 3SHAH 2FDAA 4FXGH 2BZ6H 1LPKB 2AIQA 4CH2B 1KDQB 2Y80A 2BB4A 1HJ8A 4F4OC 3PMBB 2ANWA 3GY8A 3BSQA 3MO9A 3ITIA 1QJ1B 2BTCE 3NUMA 4BTUB 1C5OH 2O8TA 3AASA 3M3SA 1UHBA 1UTOA 1YPJH 1KLTA 2AMDA 3A7VA 1CA0B 1Y5AT 2A32A 1QBOA 1GWAA 1IQGA 1KLJH 1VCQA 5LPRA 2VWNA 3Q3YA 3TU7H 1GJ8B 1TX7A 5A0BA 3BTME 4LOYH 4D8NA 1IOEA 3A7TA 3I78A 2LP6A 1C5PA 1FY3A 2AIPA 2RDLA 2ZCHP 1EPTA 2VH0A 3H5CB 5DP6A 3S9CA 2TGTA 4VGCC 1UCYK 1FPHH 3PRDA 1FN8A 2W3IA 2A7HA 1S0QA 2O9QA 1NO9H 2JJ1D 4OS4A 2ZKSA 1BIOA 1O2YA 3M61U 4X8UH 5CHAC 3UAIC 1QJ6B 1Y3UA 2FLBH 4HZHA 2ZFSA 3D65E 1AFEH 4UD9H 2AMQA 1ZSJA 3KQEA 3NKKA 1CE5A 1C1VH 3EE0B 1LMWB 4P02A 1BDAA 1BTYA 1MQ5A 4UFEH 2BOKA 2FTLE 4B76A 1PQAA 1W7GH 1BB0B 2V0BA 1G32B 4Y71A 1ELDE 3GS9A 2Z9IA 4F55A 3GYLB 2QXHA 4ABHA 4FUHA 5FBIA 4IMQA 1ETRH 1IQEA 3UUZA 3RXIA 1AB9C 2VIQA 1O2UA 1C5NH 1UHBB 3TH3H 1TGTA 4B2BA 1SBWA 3RUOA 1O2SA 1RTKA 4RI0A 2G4UA 4R8TB 1AY6H 4HI3A 3B8JA 5EXMA 2GZ9A 1U6QA 3S69A 4A1VA 1G3BA 2XC5A 2AYWA 1LVOA 2R0KA 1EPTB 4DIIH 1RD3B 3BTWE 3CS0A 1BMFD 2VB0A 3MH7A 1MAXA 5FAHA 1GHVH 1PFXC 2F9PA 2FS9A 3A86A 1NT1A 3FZDA 4FU7A 3RXMA 3P6ZB 1GI2A 3RP2A 4BOHA 2STBE 5GPIB 1SGFG 3U8TH 3URDA 1G3EA 3DSGA 1TNHA 1YPMH 1MTUA 3N99A 2WV5A 2ZG0H 5GCHG 4Y0YE 1HAPH 1GJAB 1O3AA 5ESTE 2VH6A 3MMGA 1GBDA 2H9EH 3PMAB 2ESTE 3OSYA 1EFRD 2OK5A 3UOPA 1SKYE 2HLDD 3UNSA 3LC3A 4CRDA 2J94A 3RDZA 3MNCA 2PKSB 4FUBA 1DSUA 2WPMS 3DFJA 3RXBA 3RMMH 5LH8A 1DANH 3P17H 5E2OA 2ZGCA 1P04A 1K1LA 1O3DA 1WOFA 2VVCA 5FHTA 3K6ZA 1SPJA 2VNTA 2Z9LA 5DP4A 4B71A 4IW4E 3OE7D 1GBCA 1O5AB 2KAIA 3MNSA 1O0DH 4DVAU 4XD7D 2EI6A 5FCRA 3SI4H 4X8TH 4ZXYH 1OP8A 1XKBC 1YPGH 4X8SH 3MH6A 3VB6A 7GCHF 4CREA 4F48B 4J1YA 3MU5A 5DGJA 4K1SA 1B7XB 1GPZA 3BEIB 4YM9A 3K2UA 3R3GB 3MI4A 2Z7FE 2NU1E 5EXNA 4I8JA 2ZGHA 1UTMA 1J15A 1O35A 1V2ST 3FO8D 3ESTA 1TNJA 2ZHDA 3RXHA 4NIXA 1QBVH 1OP2A 4AB9A 1C4Y2 5BRRE 1IQNA 1UVOA 1DWCH 3E0PB 2GP9B 4GLYA 1AFQC 1EP6A 1ZPBA 2B8OH 3MO3A 2BXTH 1A7SA 1LKAA 2Y7ZA 3KYGA 3RXUA 3AW0A 3R0FA 4FUDA 2BX4A 5EOKA 3AK5A 5C1XA 2ZQ1A 1HV7A 1TBQH 1T8OA 4K69A 2XCNA 2ZIQH 1RFNA 1QB9A 1TX8A 1OX1A 1V2QT 2G55A 2FOFA 4ISOA 4TPIZ 5KEDA 3PLBA 2WPHS 2KAIB 4O03A 1SQAA 2OD3B 3UREA 4YT7H 1ETSH 1V2TT 1V6DA 1MBQA 1FAKH 4KELA 3W95A 3FOAA 3PLPA 2J92A 1A5GH 3NK8A 1P09A 3HK3B 4E05H 2NU2E 5C0UA 2F91A 4ABGA 2JJ2D 1AI8H 5TJXA 4MG3A 1HCGA 4NGAH 3ZVCA 3SU3A 3P8OA 3RXGA 1ARBA 1W3CA 1J14A 2FWWA 4UONA 3SU2A 1BUIA 2K1QA 1EJNA 3S7HB 2WYJA 3MOCA 1NS3A 4ACBA 1C2DA 1QL9A 2BD2A 1HRTH 1RXPA 2L74A 4F49A 4Y76A 3UTUH 3DT0H 5A2MH 5J4QA 3BIUH 3A85A 5CHBA 9LPRA 2PHBA 3MHWU 1FY4A 3SJIA 1EKBB 5T3HA 4DT7B 1SGQE 1V2JT 3T25A 4CBOA 1IQHA 1YF4A 1B0EA 3UOUA 4YT6H 2GDEH 2GT8A 3ZVEA 4A7IB 2P95A 1UTJA 1CT0E 1ZTKA 3GCTG 4XFQA 3U28C 3M5NA 3KEEA 3D23A 3LPRA 4R0IA 1GBEA 1NRQH 1O2OA 4UFDH 1P0SH 1Q3XA 1THRH 4LXBH 2KCYA 4DOQA 3PWCA 1EOJA 4XSKU 3BEFB 1BTPA 2VIDA 1TPSA 1P11E 1O37A 2IPHA 3LJJA 3SQEE 5F53A 1QRXA 5KGOA 1O3JA 1C2IA 4FUCA 4IBLH 5IDKA 1TBZH 4TWWA 1ABIH 4ZHMU 1TA2A 3BTEE 4LZ4B 1Y8TA 4CRAA 1TE0A 4FU9A 1MH0A 2CJIA 1O2IA 5CMXH 3ZZBA 4INHA 5LPEA 5FCKA 1MTNC 1GBTA 1NROH 2BLOA 5FBEA 3EGKH 1Z6EA 1TNKA 3I29A 2HGTH 4DURA 4AZ2B 1SG8B 2RFKC 3A87A 1WDIA 2SGAA 1JIRA 4WMEA 3NRLA 1D9IA 2O8WA 2ZNKH 4IMZA 1Z6JH 2D1JA 2C8YB 8GCHF 5EJ1A 3ZV8A 1TONA 1V3XA 2GCHF 2Z9JA 1NFWA 3OEED 3RC6A 3W94A 2OQ5A 2BVRH 1QB1A 4BTIB 4SGBE 1AE5A 5H4IB 3ZZ5A 1EP5A 3SYJA 4B6FA 1QCPA 1CGHA 1F92A 1T31A 2L6OA 1ACBE 1C4V2 3E1XB 1W0YH 1GBIA 1K1OA 1ZHPA 1SLUB 4D9RA 1C5WB 1L4DA 1UCYE 4ASHA 1YC0A 2J97A 3GY7A 2FOEA 2THFB 2FX4A 1K9OE 3BTQE 4GHQA 1S84A 1KYNA 2FOAA 1NFXA 1W11U 2EY4C 3EDXB 1O2PA 3A8DA 3FP7E 3PTBA 2Y82A 1YBWA 5EPYA 3Q00A 3ZZ3A 5GCHF 2TBSA 4I8GA 1A1RA 1WQVH 1DLEA 2BDYA 3ZVDA 1SHHB 5A8ZA 4H6TA 5DP3A 1TNLA 5F03A 1ZRBA 5HXFA 1PPHE 4NG9H 5HIYA 2XBYA 2WPDD 1UK3A 3GCOA 5AFYH 4XOJA 4MPXA 1O5GH 1NRNH 1H4WA 3N7DA 1A46H 4I86A 4YOGA 4ABAA 2EI7A 3ZZAA 2FOMB 4CHAB 1HNEE 1A5IA 1KXCA 1UK4A 2WV4A 2OC8A 5LPFA 3UNQA 4ZHAA 1ELGA 2WYGA 3RXQA 1DUAA 2ZU5A 1BQYA 2H1UA 5EG4A 4K60A 4OGYA 3CS7A 2QF0A 4JYVH 1YPKH 1HAGE 2JETB 2KM0A 4FUIA 3SU4A 2WPKS 4D7FA 2QIQA 1A0LA 4AGKA 2XYAA 1SFQB 2YMSD 2BHGA 1L0ZA 1ZZZA 1NRSH 4TPYA 2IJOB 1S85A 2FI3E 1N6XA 1WUNH 1BITA 1UO6A 3ELAH 4K3JA 5DG6A 1OWIA 2Y81A 4B74A 4ZMAH 1O3HA 1V2UT 3KCGH 2W7SA 2ZCLP 1YYY1 2EEKA 1HUTH 1AB9B 1UTNA 1FY5A 4U01A 1ZSKA 3A89A 4Y8XA 1W8BH 5FPSA 2Z3DA 2AFQB 1PPZA 4E7RG 1MU8B 2H2ZA 3EA7A 1V2KT 4MDSA 4NIVA 3VG8A 4GCHF 2STAE 3PYHA 4XBDA 1P9UA 1E36B 1SGCA 5EGMA 3NZIA 2FLRH 3GY4A 2XBXA 3RU4D 2GD4B 3BTTE 5C1UA 1D6WA 1CHOF 2F9UA 1QGFA 2K0QA 1E79D 1IQMA 1GCTB 3TGJE 2ZGBH 2VU8E 1YPEH 4JZDH 4IC5A 1K2I1 2OINA 1MTSA 1XMNB 4NSVA 4H42U 1LHFH 4AORA 7GCHG 5K0HA 1H8ED 2OQUA 1ZR0A 1BRAA 3DD2H 3MU4A 2R2MB 3E3TA 2CK3D 3RXSA 1GMDF 1OWEA 4CRCA 1GL0E 2A2QH 3RXKA 5I46H 1N1LA 3OYPA 1KIGH 5T6FA 1LCYA 4MQAA 2IPQX 1OSSA 1FN6A 1NN6A 4Y0ZE 1GI6A 4TWYA 3LT3A 2QCYA 1KDQA 5E8EH 1G3CA 3T2NA 3VXEH 1UCYH 1GHXH 1QB6A 4H4FA 2BLWA 2LELA 5HM9A 1C1RA 1C5LH 1H9HE 1O2JA 1CGJE 1WQSA 5F8TA 1O2GH 4Q7YA 3BTGE 1NTPA 2AEIH 1K1JA 4K1EA 1GI1A 5FXLA 1SQRA 3LONA 5FPYA 3P92A 1ELVA 4GVUA 5EODA 2PWXA 3GY2A 1FNIA 1RRKA 1Z1IA 1EX3A 5AF9H 1KXDA 1W14U 3T28A 1K0HA 2FEQH 1ANDA 1YCPM 1TABE 6ESTA 3O8DA 1T8MA 4Q80A 3TJOA 1QTFA 1BHXF 1EZQA 2P93A 3P8GA 1RTFB 2M5TA 3EQ0H 4A6LA 1P05A 3OU0A 2GGVB 1DWBH 1IAUA 3N7EA 5HYOA 1S83A 3T62A 1ZHMA 2BDGA 1NU9A 3DFLA 4NSYA 2ODQA 1HXEH 2EA3A 3F2HA 4IS5A 1UTLM 3SUGA 1G9IE 1XM1A 3IWMA 1H8IH 4ESTE 3G01A 5DJ7A 3L33A 3Q3KA 1QRZA 3S0NA 4AYYB 2QN5T 2D2DA 3WWBA 2JH6D 1T7CA 4BAQB 1HJAC 1CBWC 3IG6B 3ZZ4A 1GHBF 4RSPA 2GZ8A 4BXSA 3OY6U 3SN8A 5E0JA 5L6NH 1V2MT 3UIRA 1MU6B 4ABBA 2FP7B 4OS7A 1BTXA 3LJOA 5DO4H 1THPB 1EB2A 3M7UA 3BG8A 3GDVA 4CHAC 3Q77A 1CU1A 4Y8YA 4CBNA 2IN2A 2PUQH 2UUJB 3VEQB 4JZFH 1P57B 1QURH 2YOLA 2F9NA 2ZFPH 2SGDE 3RM0H 2ZU2A 4MNWA 1TMBH 4M9FA 2QC2A 4FETA 2ZDAH 2BLQA 1P2KA 2FM2A 2JETC 2Z9GA 1ZHRA 1F0SA 4HFPB 1W0ZU 1LHDH 1TB6H 1K1NA 3SJKA 3SNDA 2ZHEH 2GT7A 4B2CA 1Y59T 2ZF0H 3LGWA 3W1EA 2PGBB 4AC9A 2ALPA 3NCLA 1BHXB 4XDEA 5DN6D 2QY0B 2XBWA 4NCYA 3BN9A 3DCLA 4LK4A 1IQFA 3E90B 5JBBS 1V2PT 1L4ZA 1TOMH 1Y3YA 2ZECA 3SU1A 3VB4A 3SUFA 1FAXA 1PQ8A 1O3GA 1QFKH 4AFUA 2HVXA 1YM0A 4X2VA 2RCEA 4MNYA 2CF9H 1MD8A 1IHSH 2OXSA 1D4PB 4TYDA 1P06A 2F83A 3LIWA 1GG6C 2J34A 1EZUC 1DSTA 4I33A 1F5LA 3M35A 5EQQA 5FX5A 4HG6A 8GCHG 2KCPA 2GCHG 1MZDA 1FQ3A 1XUFA 3FZZA 1BMAA 1PJPA 5JYIA 2AGGX 2FI5E 3SV7A 1G30B 2SNWA 2WUCA 3KGPA 1F5KU 3TVJB 5HGGA 3GISB 3MU8A 3TJVA 5DP7A 3O8BA 1KXFA 4U30A 1GCTC 2UUKB 3OX7U 1CT4E 1JXPA 1MTNB 3ZYEA 4DJZB 3U1JB 1H9IE 3LH3A 5FPTA 2XW9A 1WTGH 3B23B 2C93B 2BDIA 1O3IA 5E0GA 3PO1B 2HLCA 4X8VH 1FONA 3SGBE 2AERH 1BZXE 3LC5A 1SGTA 3ATKA 5ABWA 1N6YA 2H9TH 1TLDA 2FZZA 1SLWB 5C17A 1S82A 2ULLA 1AVGH 3KYFA 4UEHH 2Q1JA 1PYTC 1P2JA 3E8LA 3QN7A 2DE8A 4THNH 3MNXA 4K8BA 3UB0A 4JZEH 4OGXA 1YPHE 2VWLA 2KFWA 4JCNA 1O2KA 1Z1JA 3SV6A 2BY8X 1DXPA 1ELBA 1KXEA 1Y5UT 1FMGA 4A5TS 1QRWA 1GMCF 2AMPA 2BD5A 3SZNA 4TY7A 3OTJE 2XOKD 4ABJA 2QF5A 1NY22 4O3TA 1P3EA 3MFJA 1XXDA 1K1IA 2GV7A 3SO3A 1UK2A 4I8LA 1UVPA 3E16B 1NC6A 1MD7A 2FYQA 3TGKE 2TGAA 1O3LA 4Z6AH 1NBME 4FUJA 3GICB 1BJUA 1KXBA 2NU0E 3A7XA 3PMJA 1SMFE 1EZSC 1GDNA 1LPZB 2NU3E 2ZP0H 4ISNA 2O8LA 2A5KA 1F5RA 2SGPE 1OWKA 2BDCA 2FO9A 1WAYB 3CNRA 4WWYA 3MH5A 2R3YA 1P2QA 5DP9A 4IGDA 3GY3A 3UNRA 1VITF 3BG4C 8ESTE 3M5MA 1C1TA 3HATH 4E06H 3N7OA 3QWCH 4CRBA 1O39A 2RG3A 5JDUB 3QUMP 5A0AE 2PLXA 2A4RA 3C27B 2WINI 1VKYA 4SGAE 4LZ1H 1FY1A 1YLCA 1A3EH 3D49H 2V6NA 2H5CA 1W7XH 1XUJA 2QYIA 4AYVB 4ZCNA 1S0RA 1MAYA 4INKA 4GCHG 2SGFE 1ZMNA 2PTNA 4Y7BA 3WY8A 4X1PU 5EU8A 3EE7A 2ZTXA 2P94A 2HOBA 3QTVH 2Z6BD 4ABIA 2JH0D 1CHOG 3ZYDA 6GCHF 1BRBE 1C1QA 2EI8A 2FTMA 1ZMJA 1GBMA 3A7ZA 1D6RA 1T8NA 1MKXH 1IQLA 3QZRA 2ZDMA 2PV9B 3MTYA 4RN6A 4AFZA 3H7OA 1O2RA 2G81E 3OAAD 1Z8JB 2PUXB 3UQVA 4WF8A 2BD8A 1GMDG 1TGCA 3MO6A 4Z1MD 3SBKA 1C5YB 7ESTE 1TOCB 3JZ2B 1QBNA 2WUBA 1LO6A 1DY9A 1V2VT 1O3MA 3TJNA 3EA8A 4YOIA 1ZTLA 1UVUH 3UY9A 4TT3D 4BAKB 2BDBA 3SJ8A 4ABFA 2R2WU 3TPIZ 2CMYA 2FOHA 1ELTA 4JK5A 3SJ9A 4AB8A 1A2CH 2GMTC 1C5MD 1SGNE 1ZSLA 1OWHA 2Q6FA 4ZUHA 2BLVA 1C5UA 1AUTC 1ZOMA 5BPEA 1K1MA 1HYLA 1ESTA 1LVYA 3P70B 2CHAC 3FN8A 2R9PA 4ISLA 1ESBA 1DVAH 3F9EA 1C2HA 4K2YA 5L2YH 4BTTB 4ZKRU 1V2RT 3U9AH 4CR9A 1Z7KA 2QF3A 3QTOH 1O36A 1UTKA 3OFND 1VITH 1NZQH 2BY7X 2YNAA 3QK1A 3BEUA 1WTHD 1LHCH 4CR5A 3KQBA 1C5TA 1OHHD 5F8XA 1J9CH 2WZQA 1SOZA 1TQ7B 2A4QA 1BTUA 1IQJA 1W10U 2F9BH 1C1SA 4NFFA 3RLWH 1GGDC 3F9FA 1ZGVA 1O2MA 1O5BB 3F2GA 2P3TB 1MTVA 3S9BA 1O2ZA 1QL8A 1RS0A 1TGNA 4OS5A 3ZZ9A 1TMTH 2QXIA 1FLEE 2BD3A 1MKXK 4J2YB 5JPMH 5L30H 2B9LA 4AN7A 4DG4A 2B7DH 3PO1C 3MQKC 3FFGA 4BAMB 3F9GA 2VWMA 2VVUA 5EXLA 1E37B 2JDID 1P9SA 2ZGXH 3GCHB 4KGAA 5DKMA 1GHBG 2GZ7A 1TNGA 4XE4A 1J17T 1ID5H 3ATMA 5EPNA 5B6OA 4OS1A 3QZQA 4ZXXH 1DT2A 3SORA 1AHTH 1F0RA 1EJAA 5EJZA 1LDTT 2HPPH 1C2JA 1K21H 4RT0A 1D3QB 1HDTH 3TK6A 2ZHFH 4XBCA 5HMAA 1Z71A 5C67A 1C2MA 4X2YA 2CGAA 2VBCA 3SNEA 1QY6A 2A7JA 3MH4A 1GI9B 2A7CA 5KECA 3PROA 4ZKSU 4NZLA 3E6PH 2BY5X 3UFAA 3SI3H 4ISHH 1TRMA 1F2SE 2UUFB 1O2QA 2J38A 3A80A 3URCA 1HJAB 1Y5BT 1CBWB 5TCAA 2ZWLH 3SQHE 1GBHA 1V2LT 2VIWA 1GJ5H 2VIPA 2Q6DA 2KCAA 2B5TB 1HIAA 1E34B 1HAIH 3BTKE 1TYNA 5FX6A 7KMEH 5EIYA 1GBAA 1O3BA 4MNXA 3ZZCA 1GCDA 2J2UA 2UWLA 2PP6A 3HGPA 1O2TA 1PPGE 2BVSH 2XTTB 3MU1A 2ZDNA 2QGRA 1SQOA 2HWLB 1WCZA 3ZV9A 2G5VA 3LDXH 3GY5A 4WXIA 1S6LA 3FP8E 2KR7A 3Q76A 4NIWA 2ZDVH 3A7YA 2OUAA 1C9PA 3TNSA 4BANB 2PSXA 3AVZA 1GVZA 1DY8A 1Q2WA 2FOBA 2HPQH 5T6DA 1H8HD 2C90B 1SGPE 1GI5A 4FUFA 1ESAA 1UVSH 4JYUH 1CGIE 2QA9E 2Y5HA 2ZPSA 4FUGA 2ZCKP 1ANBA 3TH4H 3Q3XA 4K1TA 2W7UA 2XWAA 1KY9A 4B75A 1ABJH 2VGCB 1HAZB 5GDSH 2ALVA 1AVXA 4WMDA 4X1NU 3RU4T 1GG6B 3BTFE 1HIAB 3UR6A 1GMHF 2BDAA 3LU9B 2OCVB 2FMJA 1SI5H 3LH1A 1VCWA 1J16A 1HLTH 1ZPCA 4KTCA 1QJ7B 3MU0A 2XCFA 2CXVA 4JK6A 1H8DH 1FUJA 4QT8C 5L2ZH 1HXFH 5F8ZA 3GDUA 1O5FH 1E0FD 2ZEBA 1UVTH 3B9FH 1YPLH 2VIOA 1O5DH 1KTSB 1O2NA 1JRSA 1H9LB 2TPIZ 2ZFQH 1BMLA 1CHGA 3SV9A 2ZFTA 2F9VA 3DA9B 4ISIH 1AN1E 1YPHC 5CE1A 3H7TA 1EUFA 1KLIH 1YLDA 1HBTH 1E35B 1L2EA 1NFYA 2CF8H 3PV2A 3BTHE 1FX0B 2V3HH 2HNTE 1GMCG 5C20A 3ZVFA 4X6OA 1G3DA 2BXUH 1AKSA 1ANEA 1B0FA 3DSOA 4DW2U 5EW2H 3V3MA 1Z8IB 1WXRA 1SFIA 1ZPZA 2FOGA 4D76A 3KQ5A 1O38A 1DM4B 1TALA 3K9XB 1C9TA 1PQ5A 1P2OA 3LOXA 1C2EA 1G2LA 1O3PB 2AH4X 2FS8A 1YY3A 4FVDA 4X6NA 4DT4A 1HB0B 2IOTA 1LHEH 1QA7A 2PFEA 2J95A 4AFQA 1W2KH 1LQDB 2ZDKA 3PLKA 1VITG 1IQKA 1VGCC 1AWHB 2R0LA 3ZVAA 3FP6E 1GJBB 5HM2A 1DITH 5E0HA 1SGYE 1FXYA 1LVMA 2BQ6B 3M7QA 1P03A 2LNCA 2GDDA 5JBTA 1S6HA 1VJ9U 2G51A 2HNTF 1SSXA 1IHTH 3NWUA 1FDPA 3SV2H 3RXJA 3F2FA 3F6UH 2HVYB 3KNXA 2DE9A 1GJ7B 1S6FA 2ZTYA 3K6YA 1Q31A 1IQIA 1C4U2 2QAAA 1KXAA 1PYTD 2FI4E 4X1SU 4Y10E 1EAUA 1AIXH 3A84A 2ZA5A 1DFPA 4AG1A 6GCHG 1S5SA 3GCHC 1GI8B 3OEHD 3SNCA 3QO6A 3SJOA 2OP9A 3SW2B 4ACAA 2BMGB 1QHRB 1N8OB 2G4TA 5C3NA 1SVPA 3ZVGA 2ANKH 1AKSB 2A45B 3BG4B 1A61H 2TIOA 2GCTC 3AW1A 3RXOA 1DXWA 3A82A 2D8WA 2QXGA 4BAOB 3SGQE 1VR1H 1ANCA 2NWNA 1C2LA 3RMOH 1XUKA 1MUEB 3I77A 1QA0A 1DWEH 1W12U 4YTAA 1C5XB 1SC8U 4WJG2 4H6SB 2KZ4A 3F0OA 1C2GA 5T6GA 1FJSA 1GL1A 4CRGA 4B2AA 1SL3A 3UWJH 1C5SA 2V3MA 1O31A 1ELFA 2P8OC 1CSOE 4RT1A 3STJA 1MMJN 1YLNA 2ZO3H 3PTNA 4MPUA 1ETTH 3KN2A 4ZKNU 2PTCE 1SGEE 3E91A 3ZZ8A 4X1RU 1PPEE 3FANA 1E1RD 2ANYA 3F0PA 2I6QA 3C1KA 1FI8A 4UFGH 4CH8B 1BRUP 2XXLA 1EXFA 4GAWA 4X2XA 1THSH 2ZZUH 1ZTJA 5DP8A 1BTZA 4B73A 1P2MA 3V7TA 2ZFFH 1FIWA 1ZYOA 1GHWH 1W0JD 2YMSC 2FPZA 3M3VA 4DIHH 1JIMA 4KP0A 2JIZD 1HPGA 1D3TB 2P59A 4NWLA 3SV8A 1HAXB 2BD7A 1NPMA 1O2LA 3F68H 1DUEA 2GMTB 4Q7ZA 2GTBA 5HIZA 2XNIA 3M5OA 3TLOA 1HGTH 1L1GA 1QNJA 2F43B 5PTPA 4NA9H 2OBQA 2JKHA 1DOJA 2FYRA 2CHAB 2CV3A 3CP7A 4FUEA 3DHKH 1SLVB 1HJ9A 1A0HB 1UW7A 2BVXH 3MWIU 1MQ6A 1UTQA 4A1XA 1GJCB 4K8YA 5C1YA 5C0TA 3P8NA 1PQ7A 2XWBI 1P10A 1TPAE 4OS2A 4TSFD 1PPBH 1SQTA 2ZQ2A 2AGIX 2VGCC 3T26A 2QE7D 1A5HA 1YCPH 1ZJDA 3A8AA 1H1BA 4B6EA 1RJXB 4WY3A 2J4IA 4IN1A 1CT2E 4MVNA 2QXJA 1K28D 4GHTA 2SGEE 1TRNA 2VJ1A 1GI3A 1ZLRA 1TPOA 1O32A 1OYTH 2PW8H 3SZEA 1AU8A 2ILNA 1TX6A 1C1PA 4NWKA 2ZFRH 2XC0A 5B6LA 2J98A 2FESH 4GSOA 3F3BA 3QX5H 5IYTA 2XBVA 3TK9A 1CA8B 1SOTA 1GGDB 4O97A 1AD8H 1GJ9B 5CDFE 1FY8E 1ZMLA 1TGSZ 1GBJA 2W6JD 5J4SA 4GPGA 2WPJS 3RXAA 3ODFA 4TY6A 6CHAC 1UJ1A 4Q4LA 2YNBA 4MTBA 4X2WA 3RXDA 1O3OA 5DSFA 1V2OT 1TPPA 1C2FA 1BBRH 1TBRH 4JMYA 2A4OA 1BCUH 3QGNB 1C5QA 3D62A 1LHGH 2WPIS 3CENA 3RXRA 2OBOA 3RXEA 2ANMH 4WVPE 1EZXC 2LPRA 1DX5M 4X6PA 4IC6A 5EW1H 4I7YH 2BDHA 3BF6H 4Y79A 5C5OA 1Y3XA 2BZAA 2A31A 3RC5A 3ZVBA 1BMNH 3PM3A 4Q7XA 1CO7E 4A1TA 3ATIA 1O3CA 2G00A 4Z0KA 7LPRA 1QZ8A 1GBLA 1YP9A 2C8WB 2FODA 2HALA 1TAWA 1TQ0B 3PV5A 1P12E 1P2IA 2A0QB 2A4GA 1E38B 2J98B 4NZQA 4PROA 5FL7D 3VGCB 2Z3EA 5AHGH 1QQ4A 2UWPA 1GBFA 1JWTA 3U98H 2C8XB 3TGIE 1XKAC 5EQSA 1GHYH 1O3FA 1O5EH 3KHVA 3RXVA 2KCOA 2W5EA 1YCPK 2AGEX 4YLUA 1A3BH 1N8OC 1FIZA 1GI4A 3KQCA 2C3SA 2ZPQA 2H9HA 1BTHH 1O3EA 1CQQA 2BOHB 3V0XA 5C94A 4YOJA 1EJMA 2TGDA 2JH5D 4ABEA 3RM2H 1BOQA 1O3NA 1DWDH 3VPKA 2AHME 3PMHB 5C2ZA 1HFDA 1GMHG 2UUYA 1M9UA 1A0JA 1WU1A 4FVBA 2W6ID 1HAOH 2Y7XA 1GDUA 1MABB 2C8ZB 3QDZB 2BD4A 1LQEA 2OC7A 2OC0A 2V7QD 5DK1A 5TCCA 1AZZA 5A09A 2P3FH 1DICA 1ZRKA 3M37A 1AO5A 3JZ1B 1WV7H 4Y11E 3TH2H 3U69H 4E7NA 5I25A 1BBRK 1Y3VA 5SGAE 4NA8A 1GHAF 3LGTA 1QR3E 1GBKA 3A81A 3UQOA 2GV6A 1NU7B 4JZ1A 4Y6DA 3SGAE 3GDSA 1Z8GA 1O2XA 1OKXA 2XRCA 2HNTC 4RKJB 1NM6A 1GJ6A 1O30A 1S81A 5F6MA 2AS9A 2WV9A 2OTVA 4NFEA 2A2XH 3HK6B 3ATWA 1EB1H 1V2NT 4XBBA 3STIA 1X7AC 3P8FA 1CA0C 1TFXA 1TMUH 2H6MA 3FVFB 3SNAA 1F0UA 4X0WU 2P16A 4INLA 2GJGA 4WH6A 4UDWH 4X6MA 8LPRA 1Y3WA 3AAVA 1C5ZB 2CN0H 4XRNA 1O2HA 5LGOA 1O2WA 3A8BA 1GDQA 4WH8A 4AX9H 1FPCH 1SB1H 5A8YA 1SGRE 2D26C 1LVBA 2SFAA 3GYMA 1INCA 3WWFA 3RXCA 2IJD1 3PWBA 3SOSA 3PV4A 3EA9A 5GJ4B 2Y6TA 3O8RA 1MCVA 1F0TA 2ZHQH 2B0FA 2OLGA 3RMLH 1ELAA 4M7GA 4U2WA 2KX4A 1FZZA 1UTPA 4X1QU 1OOKB 1XUIA 2RA3A 2PGQB 2XC4A 2ZU4A 3M3TA 3IITA 2M2AA 2Z3CA 5DPAA 1BT7A 4OS6A 2RA0A 3RXFA 4ZH8A 4D9QA 1VGCB 2GVFA 1JRTA 2ODYB 1KSNA 1LKBA 1OWDA 1DPOA 5HKKD 1P01A 2J5UA 1L1NA 2C4FH 3UPEA 3NPSA 1LTOA 5ETXA 2BQ7B 4I8KA 1GVKB 4D7GA 3VB5A 4O3UA 3BIVH 3RXTA 3S9AA 5JB9S 2WSSD 4AFSA 2TRMA 1DDJA 1O5CB 1EPTC 1NBMD 1PPCE 3EAJA 3OY5U 4Q2KA 3U8OH 1O3KA 4NIYA 2A5IA 4U32A 4CRFA 1ORFA 1SGDE 1G2MA 5IK2D 2BX3A 2Q6GA 3F9HA 3RU4E 1B5GH 3V13A 1EOLA 1ZJKA 3OTPA 1OP0A 3GCNA 2ZI2H 2WHXA 1XX9A 2Z9KA 5GIBA 2RDEA 1TGBA 3RXLA 1SR5C 4AG2A 1AQ7A 1Z8RA 1RIWB 4P00A 3SUEA 2FOCA 2GCTB 1W0KD 4MLFB 1AWFH 1MCTA 3M36A 4AOQA 2ZDLA 4HTCH 4Y8ZA 3L3TA 1T8LA 2ZPRA 2PSYA 1GI7B 1ZGIA 2H5DA 4MPWA 3QGJA 3TIUA 4KTSA 2A1DB 1NRPH 2NU4E 1C1OA 2PKSC 2Y5GA 1AE8H 1C1UH 3FAOA 3SHCH 2F4LA 2P8OB 3TJUA 2QF4A 3E0NB 3DUXH 3VGCC 2EQNA 4UE7H 2PR3A 2P3UB 2I6SA 3A88A 2BD9A 2BY6X 1OPHB 3K65B 1L1JA 3LKWA 1EASA 2V3OH 4YXWD 3VB7A 3GY6A 3S7KB 2SGQE 3HPTB 3LGYA 3BV9B 3ZZ7A 3VFEA 1GHZA 1G36A 4Q63A 1SGFA 1C5RA 1W13U 1EAWA 5EJLA 3FKSD 1QL7A 3WW7A 1P02A 2WPLS 5JBCS 2BYAX 2YMSB 2V35A 1MBMA 1F7ZA 2ODPA 3ENSB 1SGIB 3AAUA 2GX4A 3KL6A 4ZAEA 4DCDA 5AFZH 3LGVA 4MPVA 1BA8B 1KMHB 2ZU1A 1GJ4H 1C2KA 1AMHA 4VGCB 2ZC9H 9ESTA 4ZHLU 2FXRA 5G4BA 3SUDA 1XVMA 1AGJA 1QIXB 4I31A 3RLYH 1C1MA 2PKAA 4FU8A 2VIVA 1XUHA 1E1QD 1AZ8A 1VZQH 1RTLA 5CHAB 2A5AA 3ATLA 1XUGA 3SNBA 2FIRH 1BJVA 2W26A 2ZU3A 4GUXA 5GNDA 4I8HA 3ZIAD 2DUCA 4JYTA 3V12A 2ZTZA 4KKDA 1MKWH 3T5FH 2QV1A 1ELCA 4K5ZA 2O8MA 5A8XA 5A0CA 2GKVE 1TNIA 1COWD 1AVWA 1HAVA 2TGPZ 1SLXB 4A92A 1JMOH 3HKJB 1QQUA 1D3PB 3MNBA 3EYDA 4FOUC 1HAYB 1O2VA 2G8TA 4KTUA 5EQRA 3SU5A 1GVLA 3T29A 6LPRA 2VINA 1EAIA 1FV9A 3DSPA 1K1PA 2ASUB 3H09A 1PPFE 1TA6A 3M7TA 3TNTA 3KF2A 1T32A 5GWZA 1P3CA 1O33A 4Y7AA 1OXGA 1NRRH 1YKTA 4MNVA 1BMMH 1MTWA 3RXPA 1C1NA 5K7RA 5JB8S 3F1SB
chains in the Genus database with same CATH topology
3ZZDA 6CHAB 1MZAA 1NESE 2BY9X 1DLKB 1UMAH 4I32A 3UR9A 2EC9H 2PKAB 1DS2E 4ZROA 2UWOA 1GI0A 5DP5A 1LPGB 2ZHWH 1C1WH 1T4VH 4DY7B 3M5LA 3NXPA 3SU0A 3T27A 3VXFH 4ZKOU 2VWOA 2ZGJA 1P2NA 1CVWH 1JOUB 1OYQA 3ZZ6A 3KQDA 1G37A 4YO9A 1WSSH 3U1IB 3ODDA 1KTTB 1VJAU 1OS8A 3LGUA 5ESBA 1HAVB 1TRYA 1J8AA 4B1TA 3UWIA 1WYKA 4ABDA 2FX6A 1RGQA 1JBUH 2W3KA 3A8CA 3HGNA 4BAHB 2Y5FA 4O9VA 1BRCE 1TIOA 3GOVB 1O34A 1P8VC 3RC4A 1BTWA 1EATA 3MYWA 2Z94A 3P95A 4YZUA 3TITA 4NA7A 4UFFH 4WMFA 2R3UA 3L6PA 1SHYA 5E2PA 4HGCA 4IN2A 4WXVA 1A4WH 1DE7H 4JZIA 3O8CA 3VB3A 1MKWK 1XXFA 3TK5A 2OC1A 3LGIA 4AGJA 4BXWA 1C5VA 2SNVA 1BBRE 1K22H 1GHAG 2BQWB 1OWJA 1RIWC 2J9NA 5GXPA 4YLQH 3GCTF 3HKIB 3KIDU 1T4UH 1GBBA 1ELEE 5AVDA 3A83A 1NFUA 1GJDB 1VCPA 1XVOA 1YGCH 2G52A 3BTDE 2F3CE 5JBAS 4DGJA 2BM2A 2G5NA 4YESB 3SU6A 1D3DB 1ARCA 5C5NA 1EAXA 1EQ9A 3RMNH 4RKOB 3PB1E 2O8UA 1HAHH 8KME2 1V2WT 4BNRA 2VVVA 1AFQB 1WBGB 2HRVA 3U8RH 1AUJA 1TWXB 3QLPH 3A7WA 2F9OA 3SHAH 2FDAA 4FXGH 2BZ6H 1LPKB 2AIQA 4CH2B 1KDQB 2Y80A 2BB4A 1HJ8A 4F4OC 3PMBB 2ANWA 3GY8A 3BSQA 3MO9A 3ITIA 1QJ1B 2BTCE 3NUMA 4BTUB 1C5OH 2O8TA 3AASA 3M3SA 1UHBA 1UTOA 1YPJH 1KLTA 2AMDA 3A7VA 1CA0B 1Y5AT 2A32A 1QBOA 1GWAA 1IQGA 1KLJH 1VCQA 5LPRA 2VWNA 3Q3YA 3TU7H 1GJ8B 1TX7A 5A0BA 3BTME 4LOYH 4D8NA 1IOEA 3A7TA 3I78A 1C5PA 1FY3A 2AIPA 2RDLA 2ZCHP 1EPTA 2VH0A 3H5CB 5DP6A 3S9CA 2TGTA 4VGCC 1UCYK 1FPHH 1FN8A 2W3IA 2A7HA 1S0QA 2O9QA 1NO9H 4OS4A 2ZKSA 1BIOA 1O2YA 3M61U 4X8UH 5CHAC 1QJ6B 1Y3UA 2FLBH 4HZHA 2ZFSA 3D65E 1AFEH 4UD9H 2AMQA 1ZSJA 3KQEA 3NKKA 1CE5A 1C1VH 3EE0B 1LMWB 1BDAA 1BTYA 1MQ5A 4UFEH 2BOKA 2FTLE 4B76A 1PQAA 1W7GH 1BB0B 2V0BA 1G32B 4Y71A 1ELDE 2Z9IA 3GYLB 2QXHA 4ABHA 4FUHA 5FBIA 4IMQA 1ETRH 1IQEA 3UUZA 3RXIA 1AB9C 2VIQA 1O2UA 1C5NH 1UHBB 3TH3H 1TGTA 4B2BA 1SBWA 3RUOA 1O2SA 1RTKA 2G4UA 4R8TB 1AY6H 4HI3A 3B8JA 5EXMA 2GZ9A 1U6QA 3S69A 4A1VA 1G3BA 2XC5A 2AYWA 1LVOA 2R0KA 1EPTB 4DIIH 1RD3B 3BTWE 3CS0A 2VB0A 3MH7A 1MAXA 5FAHA 1GHVH 1PFXC 2F9PA 2FS9A 3A86A 1NT1A 3FZDA 4FU7A 3RXMA 3P6ZB 1GI2A 3RP2A 4BOHA 2STBE 5GPIB 1SGFG 3U8TH 3URDA 1G3EA 1TNHA 1YPMH 1MTUA 2WV5A 2ZG0H 5GCHG 4Y0YE 1HAPH 1GJAB 1O3AA 5ESTE 2VH6A 3MMGA 1GBDA 2H9EH 3PMAB 2ESTE 3OSYA 3UOPA 4CRDA 3UNSA 7KMEH 3LC3A 2J94A 3RDZA 3MNCA 2PKSB 4FUBA 1DSUA 2WPMS 3DFJA 3RXBA 3RMMH 5LH8A 1DANH 3P17H 5E2OA 2ZGCA 1P04A 1K1LA 1O3DA 1WOFA 2VVCA 5FHTA 3K6ZA 1SPJA 2VNTA 2Z9LA 5DP4A 4B71A 4IW4E 1GBCA 1O5AB 2KAIA 3MNSA 1O0DH 4DVAU 2EI6A 5FCRA 3SI4H 4X8TH 4ZXYH 1OP8A 1XKBC 1YPGH 4X8SH 3MH6A 3VB6A 7GCHF 4CREA 4J1YA 3MU5A 5DGJA 4K1SA 1B7XB 1GPZA 3BEIB 4YM9A 3K2UA 3R3GB 3MI4A 2Z7FE 2NU1E 5EXNA 4I8JA 2ZGHA 1UTMA 1J15A 1O35A 1V2ST 3ESTA 1TNJA 2ZHDA 3RXHA 4NIXA 1QBVH 1OP2A 4AB9A 1C4Y2 5BRRE 1IQNA 1UVOA 1DWCH 3E0PB 2GP9B 4GLYA 1AFQC 1EP6A 1ZPBA 2B8OH 3MO3A 2BXTH 1A7SA 1LKAA 2Y7ZA 3RXUA 3AW0A 3R0FA 4FUDA 2BX4A 5EOKA 5C1XA 2ZQ1A 1HV7A 1TBQH 1T8OA 4K69A 2XCNA 2ZIQH 1RFNA 1QB9A 1TX8A 1OX1A 1V2QT 2G55A 2FOFA 4ISOA 4TPIZ 3PLBA 2WPHS 2KAIB 4O03A 1SQAA 2OD3B 3UREA 4YT7H 1ETSH 1V2TT 1V6DA 1MBQA 1FAKH 4KELA 3W95A 3PLPA 2J92A 1A5GH 3NK8A 1P09A 3HK3B 4E05H 2NU2E 2F91A 4ABGA 1AI8H 5TJXA 4MG3A 1HCGA 4NGAH 3ZVCA 3SU3A 3P8OA 3RXGA 1ARBA 1W3CA 1J14A 2FWWA 4UONA 3SU2A 1BUIA 2K1QA 1EJNA 3S7HB 2WYJA 3MOCA 1NS3A 1C2DA 1QL9A 2BD2A 1HRTH 1RXPA 4F49A 4Y76A 3UTUH 3DT0H 5A2MH 5J4QA 3BIUH 3A85A 9LPRA 2PHBA 3MHWU 1FY4A 3SJIA 1EKBB 5T3HA 4DT7B 1SGQE 1V2JT 3T25A 4CBOA 1IQHA 1YF4A 1B0EA 3UOUA 4YT6H 2GDEH 2GT8A 3ZVEA 4A7IB 2P95A 1UTJA 1CT0E 1ZTKA 3GCTG 4XFQA 3M5NA 3KEEA 3D23A 3LPRA 4R0IA 1GBEA 1NRQH 1O2OA 4UFDH 1P0SH 1Q3XA 1THRH 4LXBH 4DOQA 3PWCA 1EOJA 4XSKU 3BEFB 1BTPA 2VIDA 1TPSA 1P11E 1O37A 2IPHA 3LJJA 3SQEE 1QRXA 1O3JA 1C2IA 4FUCA 4IBLH 5IDKA 1TBZH 4TWWA 1ABIH 4ZHMU 1TA2A 3BTEE 4LZ4B 1Y8TA 4CRAA 1TE0A 4FU9A 1MH0A 2CJIA 1O2IA 5CMXH 3ZZBA 4INHA 5LPEA 5FCKA 1MTNC 1GBTA 1NROH 2BLOA 5FBEA 3EGKH 1Z6EA 1TNKA 3I29A 2HGTH 4DURA 4AZ2B 1SG8B 3A87A 2SGAA 1JIRA 4WMEA 1D9IA 2O8WA 2ZNKH 4IMZA 1Z6JH 2D1JA 2C8YB 8GCHF 3ZV8A 1TONA 1V3XA 2GCHF 2Z9JA 1NFWA 3RC6A 3W94A 2OQ5A 2BVRH 1QB1A 4BTIB 4SGBE 1AE5A 5H4IB 3ZZ5A 1EP5A 1QCPA 1CGHA 1F92A 1T31A 1ACBE 1C4V2 3E1XB 1W0YH 1GBIA 1K1OA 1ZHPA 1SLUB 4D9RA 1C5WB 1L4DA 1UCYE 4ASHA 1YC0A 3GY7A 2FOEA 2THFB 2FX4A 1K9OE 3BTQE 4GHQA 1S84A 1KYNA 2FOAA 1NFXA 1W11U 3EDXB 1O2PA 3A8DA 3FP7E 3PTBA 2Y82A 1YBWA 5EPYA 3Q00A 3ZZ3A 5GCHF 2TBSA 4I8GA 1A1RA 1WQVH 1DLEA 2BDYA 3ZVDA 1SHHB 5A8ZA 4H6TA 5DP3A 1TNLA 5F03A 1ZRBA 5HXFA 1PPHE 4NG9H 2XBYA 1UK3A 3GCOA 5AFYH 4XOJA 4MPXA 1O5GH 1NRNH 1H4WA 1A46H 4YOGA 4ABAA 2EI7A 3ZZAA 2FOMB 4CHAB 1HNEE 1A5IA 1KXCA 1UK4A 2WV4A 2OC8A 5LPFA 3UNQA 4ZHAA 1ELGA 2WYGA 3RXQA 1DUAA 2ZU5A 1BQYA 2H1UA 5EG4A 4K60A 4OGYA 3CS7A 2QF0A 4JYVH 1YPKH 1HAGE 2JETB 4FUIA 3SU4A 2WPKS 4D7FA 2QIQA 1A0LA 4AGKA 2XYAA 1SFQB 2BHGA 1L0ZA 1ZZZA 1NRSH 4TPYA 2IJOB 1S85A 2FI3E 1N6XA 1WUNH 1BITA 1UO6A 3ELAH 4K3JA 5DG6A 1OWIA 2Y81A 4B74A 4ZMAH 1O3HA 1V2UT 3KCGH 2W7SA 2ZCLP 1YYY1 2EEKA 1HUTH 1AB9B 1UTNA 1FY5A 4U01A 1ZSKA 3A89A 4Y8XA 1W8BH 5FPSA 2Z3DA 2AFQB 1PPZA 4E7RG 1MU8B 2H2ZA 3EA7A 1V2KT 4MDSA 4NIVA 4GCHF 2STAE 3PYHA 4XBDA 1P9UA 1E36B 1SGCA 5EGMA 3NZIA 2FLRH 3GY4A 2XBXA 3RU4D 2GD4B 3BTTE 5C1UA 1D6WA 1CHOF 2F9UA 1QGFA 1IQMA 1GCTB 3TGJE 2ZGBH 2VU8E 1YPEH 4JZDH 4IC5A 1K2I1 2OINA 1MTSA 1XMNB 4NSVA 4H42U 1LHFH 4AORA 7GCHG 5K0HA 2OQUA 1ZR0A 1BRAA 3DD2H 3MU4A 2R2MB 3E3TA 3RXSA 1GMDF 1OWEA 4CRCA 1GL0E 2A2QH 3RXKA 5I46H 1N1LA 3OYPA 1KIGH 5T6FA 1LCYA 4MQAA 1OSSA 1FN6A 1NN6A 4Y0ZE 1GI6A 4TWYA 3LT3A 2QCYA 1KDQA 5E8EH 1G3CA 3T2NA 3VXEH 1UCYH 1GHXH 1QB6A 4H4FA 2BLWA 5HM9A 1C1RA 1C5LH 1H9HE 1O2JA 1CGJE 1WQSA 5F8TA 1O2GH 4Q7YA 3BTGE 1NTPA 2AEIH 1K1JA 4K1EA 1GI1A 5FXLA 3LONA 5FPYA 3P92A 1ELVA 4GVUA 5EODA 2PWXA 3GY2A 1FNIA 1RRKA 1Z1IA 1EX3A 5AF9H 1KXDA 1W14U 3T28A 2FEQH 1ANDA 1YCPM 1TABE 6ESTA 3O8DA 1T8MA 4Q80A 3TJOA 1QTFA 1BHXF 1EZQA 2P93A 3P8GA 1RTFB 2M5TA 3EQ0H 4A6LA 1P05A 3OU0A 2GGVB 1DWBH 1IAUA 5HYOA 1S83A 3T62A 1ZHMA 2BDGA 1NU9A 3DFLA 4NSYA 2ODQA 1HXEH 2EA3A 4IS5A 1UTLM 3SUGA 1G9IE 1XM1A 3IWMA 1H8IH 4ESTE 3G01A 5DJ7A 3L33A 3Q3KA 1QRZA 3S0NA 4AYYB 2QN5T 2D2DA 2JH6D 1T7CA 4BAQB 1HJAC 1CBWC 3IG6B 3ZZ4A 1GHBF 4RSPA 2GZ8A 4BXSA 3OY6U 3SN8A 5E0JA 5L6NH 1V2MT 3UIRA 1MU6B 4ABBA 2FP7B 4OS7A 1BTXA 3LJOA 5DO4H 1THPB 1EB2A 3M7UA 3BG8A 3GDVA 4CHAC 3Q77A 1CU1A 4Y8YA 4CBNA 2IN2A 2PUQH 2UUJB 3VEQB 4JZFH 1P57B 1QURH 2YOLA 2F9NA 2ZFPH 2SGDE 3RM0H 2ZU2A 4MNWA 1TMBH 2QC2A 2ZDAH 2BLQA 1P2KA 2FM2A 2JETC 2Z9GA 1ZHRA 1F0SA 4HFPB 1W0ZU 1LHDH 1TB6H 1K1NA 3SJKA 3SNDA 2ZHEH 2GT7A 4B2CA 1Y59T 2ZF0H 3LGWA 2PGBB 2ALPA 3NCLA 1BHXB 4XDEA 2QY0B 2XBWA 4NCYA 3BN9A 4LK4A 1IQFA 3E90B 5JBBS 1V2PT 1L4ZA 1TOMH 1Y3YA 2ZECA 3SU1A 3VB4A 3SUFA 1FAXA 1PQ8A 1O3GA 1QFKH 4AFUA 2HVXA 1YM0A 4X2VA 2RCEA 4MNYA 2CF9H 1MD8A 1IHSH 2OXSA 1D4PB 4TYDA 1P06A 2F83A 3LIWA 1GG6C 2J34A 1EZUC 1DSTA 4I33A 1F5LA 3M35A 5EQQA 5FX5A 8GCHG 2GCHG 1MZDA 1FQ3A 1XUFA 3FZZA 1BMAA 1PJPA 5JYIA 2AGGX 2FI5E 3SV7A 1G30B 2SNWA 2WUCA 3KGPA 1F5KU 3TVJB 5HGGA 3GISB 3MU8A 3TJVA 5DP7A 3O8BA 1KXFA 4U30A 1GCTC 2UUKB 3OX7U 1CT4E 1JXPA 1MTNB 3ZYEA 4DJZB 3U1JB 1H9IE 3LH3A 5FPTA 2XW9A 1WTGH 3B23B 2C93B 2BDIA 1O3IA 5E0GA 3PO1B 2HLCA 4X8VH 1FONA 3SGBE 2AERH 1BZXE 3LC5A 1SGTA 3ATKA 5ABWA 1N6YA 2H9TH 1TLDA 2FZZA 1SLWB 1S82A 2ULLA 1AVGH 4UEHH 2Q1JA 1PYTC 1P2JA 3E8LA 3QN7A 2DE8A 4THNH 3MNXA 4K8BA 4JZEH 4OGXA 1YPHE 2VWLA 4JCNA 1O2KA 1Z1JA 3SV6A 2BY8X 1DXPA 1ELBA 1KXEA 1Y5UT 1FMGA 4A5TS 1QRWA 1GMCF 2AMPA 2BD5A 3SZNA 4TY7A 3OTJE 4ABJA 1NY22 4O3TA 1P3EA 3MFJA 1XXDA 1K1IA 2GV7A 3SO3A 1UK2A 4I8LA 1UVPA 3E16B 1NC6A 1MD7A 2FYQA 3TGKE 2TGAA 1O3LA 4Z6AH 4FUJA 3GICB 1BJUA 1KXBA 2NU0E 3A7XA 3PMJA 1SMFE 1EZSC 1GDNA 1LPZB 2NU3E 2ZP0H 4ISNA 2O8LA 2A5KA 1F5RA 2SGPE 1OWKA 2BDCA 2FO9A 1WAYB 4WWYA 3MH5A 2R3YA 1P2QA 5DP9A 4IGDA 3GY3A 3UNRA 1VITF 3BG4C 8ESTE 3M5MA 1C1TA 3HATH 4E06H 3N7OA 3QWCH 4CRBA 1O39A 2RG3A 5JDUB 3QUMP 5A0AE 2PLXA 2A4RA 3C27B 2WINI 4SGAE 4LZ1H 1FY1A 1YLCA 1A3E