4U2WA

Atomic resolution crystal structure of hv-bbi protease inhibitor from amphibian skin in complex with bovine trypsin
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bowman-Birk trypsin inhibitor
publication title Atomic resolution crystal structure of HV-BBI protease inhibitor from amphibian skin in complex with bovine trypsin.
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 60
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2014-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u2wA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4u2wA02
4KTUA 1FONA 3HK3B 3GDVA 1HAHH 1K21H 2WPKS 4Y0ZE 3TK9A 4UFDH 3UUZA 1JWTA 1AZ8A 2VWLA 3LC5A 2AGIX 5LGOA 1LMWB 3RU4T 1Z71A 1DM4B 4KGAA 1GHWH 4TY7A 2F9PA 1AN1E 2P3TB 1NN6A 1XXDA 3E0NB 2A31A 5A2MH 1KYNA 2F9OA 1FAKH 3NWUA 1H8DH 2SGAA 3SZNA 4ZMAH 3VGCB 4LZ4B 3O8RA 4B73A 1MMJN 2P93A 1BZXE 4FUEA 2ZEBA 5A09A 3A86A 1P57B 1YCPK 1TGTA 1XKAC 2C8ZB 1HIAA 3TGJE 3MNCA 1GI0A 2H9EH 1EPTC 1C2KA 1EAWA 2QF0A 4KTSA 5LPFA 3PROA 1G2MA 4I8LA 1O2PA 3HKJB 3PTNA 3NPSA 2YNBA 3UY9A 1MAYA 2PKAB 1HXFH 4OGYA 4FUHA 4IBLH 4KELA 1DE7H 1K1NA 5I25A 1GHVH 2FOEA 1ESTA 3MU0A 1QL7A 4BAKB 1RFNA 2Z6BD 2FOCA 2GV6A 1DPOA 2NU4E 3T5FH 3TGKE 4WMDA 4ISOA 1QGFA 1ZSKA 2ANMH 2PHBA 2PR3A 4BTIB 3ZZAA 3QZRA 3S69A 3UWJH 1G2LA 1KXCA 4CH2B 1L0ZA 3P6ZB 1MTVA 1VZQH 3O8CA 2LPRA 4NSYA 1Y5UT 2J9NA 1TPAE 3SV9A 2BD3A 2FPZA 2VU8E 4AFUA 3ATIA 3RXKA 3N7OA 1H9HE 1C5VA 3RXLA 2G55A 5G4BA 1QY6A 5DP3A 4D8NA 1NRRH 3KL6A 3OU0A 3GCTG 1PFXC 3BTWE 5EODA 3RC5A 1Z7KA 2H5CA 1QA0A 2VH6A 1OWKA 3RXOA 1L2EA 2TGPZ 4Q7YA 3I78A 2R3UA 3IITA 4A1TA 3Q3YA 3B9FH 1CT0E 2A4QA 1QJ7B 5C1UA 4ZKOU 1GBLA 2PWXA 1YPMH 3SV8A 4IGDA 1ANEA 2WPMS 2ILNA 2B0FA 3GY8A 3EAJA 3QUMP 1C2MA 1O35A 3RUOA 2DE9A 1SSXA 1F0UA 2CGAA 1L4DA 1GMHG 1KDQB 3A80A 4IN1A 2FDAA 1DITH 3E8LA 3TLOA 3BEFB 1B5GH 3RXDA 1BUIA 6LPRA 4MPWA 2FOBA 2JH6D 1O2TA 1XKBC 1BTWA 1GBHA 2RG3A 4D9QA 1J17T 1PPHE 2OC8A 1N8OB 2ZNKH 4ABIA 3T28A 2VIWA 1BTZA 4ASHA 4ZKNU 2AIPA 3LH1A 3QLPH 1MU6B 1TPOA 4WMEA 3AAUA 3L6PA 4B74A 1ZRBA 1FNIA 1EB1H 4ZH8A 3M7TA 1CA0B 1YC0A 1S0QA 2G8TA 2VH0A 3QK1A 2GT8A 1V3XA 1CHOF 2F9NA 3U98H 2D2DA 1DT2A 3PTBA 3MNXA 1MQ6A 2NWNA 4ZHMU 1C1RA 3TH2H 3LJOA 3VPKA 4RSPA 2AIQA 2AEIH 3DFJA 2ZFPH 1NTPA 1O31A 1RXPA 3PLKA 2GDEH 1DWDH 1AIXH 3KIDU 1F0SA 1GGDC 2FI3E 3M7UA 1LTOA 2HLCA 2ZFTA 4GCHF 1OXGA 1OPHB 1EP5A 1DVAH 1TWXB 3PMBB 1C4U2 2GMTB 4I8HA 1V2LT 2YOLA 3SU0A 2G4UA 3TJUA 1ZMLA 1HUTH 2XNIA 1FMGA 2BY9X 1BRBE 4NIVA 1ESBA 4I33A 1TGCA 3RXCA 4JZFH 1KSNA 5DPAA 2ZGCA 4Q80A 3QTVH 4B76A 1EQ9A 4I8GA 4AG2A 2ZHWH 3VB6A 1O34A 1UVUH 4X1QU 1AGJA 3KHVA 2M5TA 2TPIZ 1W8BH 2ZZUH 1C4V2 2ZIQH 1YM0A 2BX4A 4JYUH 1HJAC 1P02A 1MKWK 3BEIB 3EA7A 3OTJE 1ZHPA 1GBTA 3SNCA 1GMDG 3BTQE 2THFB 4ABJA 4ZXXH 2A4OA 3SHAH 2IN2A 1CGHA 1QL9A 4I8JA 2HPQH 3PO1B 3F9FA 1EOJA 1O32A 4UDWH 2C90B 1VITF 3E0PB 2FZZA 2A32A 4FUJA 3SJOA 3EYDA 8GCHF 2F3CE 4E06H 3PYHA 4MPVA 1LHDH 1W7XH 3S9CA 2CN0H 3UWIA 3SO3A 1EB2A 4AFSA 4D7FA 5EXMA 1EKBB 1C4Y2 1Y5AT 5A8YA 1HAIH 3UR9A 3U1JB 3PM3A 3F9GA 3TH4H 2Z3CA 2FIRH 4MVNA 1O2HA 1RIWC 1O2RA 2QC2A 4Y8ZA 3FP7E 2ZCKP 2VIPA 3EA9A 3IWMA 5IDKA 3MH4A 1C5NH 1GBMA 1D6WA 1NFUA 1T8NA 4MLFB 1KXFA 1EAIA 3GY7A 4NFFA 2ZA5A 1K1MA 2WV5A 1GI5A 3MNBA 4GHTA 3RC4A 2XC5A 5HMAA 1ANCA 3BIVH 1QTFA 1CO7E 1K28D 1DANH 2P8OC 3ZVAA 2J38A 3SGQE 1C5RA 2Y7XA 3CS7A 4HGCA 3W95A 4JCNA 2ZU3A 5JBCS 2R0LA 1MKXK 2ZF0H 3QTOH 8ESTE 3L3TA 1N6XA 2RCEA 3H7OA 4X8VH 2ZHQH 2FOFA 2ZGHA 2GZ8A 2IOTA 1NRPH 2QYIA 1EPTA 2XTTB 3SQHE 4MNXA 5ETXA 2P95A 1P3CA 3MH5A 2FOAA 5TJXA 1W2KH 1WOFA 1A61H 3P8OA 1DUEA 1XVOA 3SI4H 2FLBH 2GCTB 1SI5H 2D1JA 3E90B 3A7VA 1LVMA 3V7TA 1FY1A 4A92A 3P8NA 1PYTC 3RMOH 2UUFB 1TGBA 4X2VA 2FOHA 4NWKA 2F83A 2VIDA 1DFPA 1TMUH 1RJXB 4JZIA 5T6GA 1ZHMA 1M9UA 1AB9B 2GV7A 2RA0A 1IHSH 4DOQA 3ITIA 3SU4A 1BMLA 2O8LA 1BRAA 1QBNA 3FFGA 3KCGH 3ZV8A 1XUGA 1E35B 1AI8H 1T31A 1P2MA 2GVFA 3SUGA 1NFWA 1EZQA 2ESTE 1CU1A 1D3DB 3D23A 2GD4B 1SQTA 4CREA 4BTUB 1K9OE 1GHBF 1FQ3A 4AORA 4O97A 1W13U 2QGRA 1GHXH 1MBMA 4JZ1A 3BTDE 1GI3A 2ZHDA 2CV3A 4ABFA 2ZHEH 4CRDA 1TPSA 4BAOB 4Q2KA 1UTMA 1XMNB 1TALA 5CE1A 2W7UA 1ACBE 2R9PA 3TJOA 1AFQB 1A0LA 1CGJE 2EI7A 5AHGH 5CHAB 1LHEH 1JBUH 1EATA 1ELEE 1ZTKA 2Z9KA 3P70B 1ZHRA 1TIOA 3SV2H 3FANA 3M61U 2BDIA 3Q3XA 3SQEE 1K22H 2KAIB 1TBQH 1MTNB 4U01A 1ZTJA 3VB5A 1QHRB 1C5PA 2A2QH 4DGJA 3NK8A 1LPZB 2FXRA 5LH8A 3MO9A 1THRH 3KQBA 1F5KU 2BD7A 1ZR0A 2BY7X 1EJNA 7ESTE 4SGBE 2OC0A 3GY4A 2RA3A 1GVLA 5C20A 2ZU5A 7LPRA 1O39A 2EC9H 1Y3UA 2UWPA 4UE7H 1UVOA 2OQ5A 2F91A 1ELFA 2BDGA 1GBDA 3BTEE 3ODFA 2OQUA 2PGBB 4ZKSU 1LQEA 1UHBB 2XBWA 1BQYA 1P06A 4Z6AH 1P8VC 1ZRKA 2PKSB 3UQVA 3A8CA 3ZZ3A 1SGIB 3A84A 5F8TA 2ZDVH 1O2ZA 3GCNA 3A81A 1VJ9U 4ZROA 1ZPCA 1VCQA 1TYNA 2GKVE 4NA8A 1GI4A 4JZDH 3KNXA 1QBVH 4Y0YE 1Z8JB 1LO6A 2BB4A 3LKWA 1AUJA 5JPMH 1NPMA 1LVBA 5GDSH 4SGAE 4YLQH 2P3UB 3DA9B 3RU4D 4OS6A 1SGQE 3E1XB 4DCDA 3RXBA 3SNBA 1TBZH 3KGPA 4WY3A 1HJ8A 3AASA 2O9QA 1GJ6A 1Y3VA 4LOYH 1CVWH 1QFKH 1T4VH 4ABGA 4CRBA 4MPUA 5HM9A 3W94A 1H1BA 3IG6B 1F92A 1Z6EA 3LU9B 2FOMB 1T7CA 1SG8B 4NFEA 3LGIA 4CHAB 3RP2A 2H6MA 1PPGE 2ANYA 3BSQA 4NWLA 2BVXH 1PYTD 1A5IA 1IQJA 2AH4X 3KQCA 4NGAH 3P17H 1TFXA 1W0ZU 1EZUC 3QZQA 4RN6A 2Z9GA 3R3GB 3ZV9A 2BDYA 4MQAA 1QB1A 4DW2U 1UMAH 1Y8TA 6CHAC 5FPTA 1K1JA 2ANKH 4GPGA 4B2BA 5EXNA 5LPEA 1BJVA 3SORA 3ZVBA 4X8SH 3DUXH 1FDPA 5DGJA 1TABE 3LJJA 5C5OA 1GI1A 4AOQA 1YBWA 1OP8A 1D9IA 1NESE 1NT1A 1PJPA 1CSOE 1HAVA 4INLA 1MAXA 1HLTH 1V2JT 5GCHG 4YT7H 1YPEH 5TCAA 1TRNA 1C2LA 4HFPB 3F68H 1KXBA 2G5NA 2PTNA 1U6QA 4O03A 4RKOB 2OC1A 2ZWLH 4UFFH 1XVMA 4HTCH 3T29A 5J4SA 2R2MB 4IN2A 5A0BA 1TRMA 6GCHG 1ABJH 2BD8A 1A0JA 1UK2A 3ELAH 1DWBH 1EASA 1P12E 1GHAF 5C3NA 2QXJA 1FY5A 5JB9S 3GY5A 2VIQA 3A8BA 1F5LA 1ZPZA 3DT0H 3T2NA 2VGCB 4ABAA 5L30H 1XUIA 1EX3A 4D76A 5A0CA 4DIHH 1J15A 1C5QA 5LPRA 1NRSH 4NIXA 1SLWB 2HNTE 1L1JA 3TNTA 1NFYA 4FUIA 1MCVA 2ZECA 3RXJA 1O2VA 3BTGE 1F0TA 4FUDA 3MHWU 2XCNA 1CBWB 4J2YB 1G37A 1TNIA 1IAUA 2WV4A 4MPXA 1GI7B 2JH5D 1GJ7B 1GDQA 3E16B 3SOSA 3T62A 3KEEA 1O3MA 1QNJA 2P16A 1QQUA 1IQKA 1A7SA 1B0FA 2AS9A 3A87A 1WV7H 1OYQA 3UNRA 2BZAA 3BTKE 1EZXC 2Z9IA 2B7DH 1W11U 1C2GA 5BRRE 4FVBA 1Z1JA 5JDUB 1TOMH 3PWCA 5E0JA 4BXWA 2D8WA 2J95A 1LKBA 4AFZA 2LNCA 1O3NA 1T8OA 1V2QT 5EGMA 3V13A 4XOJA 1TGNA 1YF4A 4AZ2B 4WJG2 2B8OH 3PV4A 2XW9A 5FHTA 3SI3H 1C1MA 3SUDA 1GCTB 1AVWA 3SU6A 5C67A 4YTAA 2TBSA 4ZHAA 1D3PB 2ZDAH 4DIIH 1F5RA 5EQRA 2XBVA 2P59A 3BN9A 1FI8A 4K8BA 2UWOA 1GI9B 1TONA 5DJ7A 3TNSA 4GLYA 3A7WA 3MU8A 2R3YA 1E36B 1Y59T 2QXGA 1O5CB 3MO6A 1GDNA 2A2XH 1CHGA 1ANBA 3ZVDA 3ATLA 4H6TA 4ZHLU 1UVPA 1IQLA 1O3OA 3LT3A 1HYLA 2VWOA 1C5SA 4X6MA 2DUCA 2FYRA 2PW8H 1VCWA 2STAE 2R2WU 4AN7A 3EDXB 2Y7ZA 3O8DA 1SPJA 1AO5A 2CHAB 1G3EA 1DOJA 5EU8A 3A7ZA 3GCHC 4J1YA 1BTUA 1C9PA 1V2MT 3AAVA 4MNWA 2GCHG 2FM2A 2Z9LA 4ZUHA 3BF6H 2OC7A 1QBOA 4U30A 1O0DH 1O3HA 4WXIA 3V12A 9ESTA 4Y71A 4BAQB 1LDTT 2CF8H 1C1PA 1NROH 1ZJDA 3M5MA 4K60A 3UOPA 3RM2H 2HALA 3ATMA 1A0HB 1KIGH 4X8TH 1RTFB 3SGBE 1YGCH 1A4WH 1G32B 5FAHA 3TGIE 1TNKA 3RXQA 2HVXA 1E37B 1RD3B 5HGGA 1ZSLA 3JZ2B 4YM9A 2OLGA 2A7CA 1UTOA 2WPLS 2ZKSA 4TYDA 2ZU4A 2ZHFH 1ZGVA 2Q6FA 3V0XA 1B7XB 4NIYA 3PLBA 1LVYA 2QXIA 4VGCC 1BBRH 1J9CH 5SGAE 1Q2WA 3A82A 1F7ZA 2V35A 3SUFA 1V2PT 1LHGH 3JZ1B 4OGXA 1ID5H 5DP7A 1E0FD 5E0HA 4AG1A 2QXHA 4B75A 3VXEH 3ESTA 1ELDE 2ZPSA 1C1TA 1TQ7B 1S83A 2H1UA 2VNTA 4YESB 1TAWA 1YPJH 2SGQE 5A0AE 1KY9A 1SGEE 2GX4A 2SNVA 1K1LA 2Z9JA 3NUMA 1P9UA 1O2MA 2A0QB 3U9AH 4XDEA 4IC5A 5T3HA 1GJAB 1GJDB 1N1LA 2EI8A 1HFDA 5F8XA 3ZVFA 1AUTC 3GY2A 1SGYE 2ZTZA 3V3MA 1L1GA 1SC8U 1TLDA 1GJ8B 1GBAA 3NCLA 2F9BH 2ZCHP 1QJ6B 1ELVA 1GBJA 1G3DA 3RC6A 1SHYA 1TE0A 1WBGB 1TOCB 5I46H 3Q76A 5FBIA 1LPKB 4FU9A 2TGTA 1C5XB 1KXEA 5GJ4B 1HB0B 5BPEA 3A7YA 1DS2E 4X6PA 1MTUA 1AFEH 2I6QA 1O2WA 2ZI2H 1O3GA 2JETC 2ZTXA 4Q7XA 3TH3H 4AFQA 4AGJA 4FUFA 1ETSH 3MOCA 1VGCB 1W0YH 3LH3A 1O38A 1LPGB 2ZFSA 4JMYA 2HNTC 1VITG 1DUAA 2OINA 4Y7AA 2ZFRH 1JMOH 2ZDLA 5A8ZA 2OBQA 1O30A 1AE5A 3EQ0H 4U2WA 1C2EA 4QT8C 1NS3A 3TU7H 4B2CA 1AMHA 1UTQA 3ZZ7A 2O8UA 1GMDF 5B6OA 4ISLA 1RTKA 4Y8XA 1BA8B 4K1EA 1S85A 3S0NA 3SU5A 2TGAA 2ZTYA 1TBRH 2UUYA 1NU7B 4YLUA 3D49H 1V2UT 1S81A 3TPIZ 3F9HA 5JBAS 2ASUB 5GPIB 3GY3A 1P04A 1S6FA 3RXIA 3RXPA 1DWCH 4BXSA 1NC6A 2ALPA 1O5AB 2ZDKA 2C3SA 4K8YA 2H9TH 5PTPA 1C2JA 4BANB 1GHZA 1AE8H 4A6LA 1LKAA 3D65E 1C1SA 1TX8A 1ELTA 2Y6TA 2WPIS 3M35A 2BXTH 4R8TB 4AB8A 1EPTB 1BHXB 3SNAA 1A46H 1OP0A 2Y5FA 2QCYA 2UUKB 3E6PH 1A2CH 3SU3A 4Z0KA 4E7NA 4I32A 2FO9A 1TMTH 1BDAA 1ABIH 4TPYA 1YCPM 5HXFA 1H9LB 5DO4H 3BG4C 5H4IB 1IQNA 3ZVEA 1EUFA 2JH0D 1SGFG 3ZZ5A 2FP7B 2Z94A 3RXEA 2GT7A 4ISNA 4XFQA 1FN8A 1FY4A 1OOKB 2NU3E 2PUXB 5ESBA 2BLWA 3Q3KA 4FUGA 2NU1E 1OWJA 3MTYA 2V3OH 1SLUB 2ZPRA 1O3IA 2GZ9A 2STBE 1C1NA 3PMHB 3M37A 2ZC9H 2VGCC 2XC4A 2C4FH 1SGRE 3Q00A 1YPLH 4ABEA 1C5TA 1IHTH 1ANDA 1QB9A 4HZHA 1XUKA 2G51A 1L4ZA 1P0SH 2BYAX 1PQ8A 1PPBH 1UK4A 3LDXH 1WQSA 1WUNH 3VGCC 3SNEA 2HRVA 2VVCA 1ZPBA 2BY5X 1HBTH 1GHBG 3LGYA 1MZAA 1MZDA 3BTFE 4UONA 2AERH 2QAAA 5AVDA 5FCRA 1T32A 2C8XB 4X8UH 3K6YA 3S9AA 4K1SA 1TNJA 1FPCH 4MTBA 1C1QA 3TIUA 4FXGH 4Y76A 2PSYA 4BAMB 1DY8A 4AYVB 4MNVA 5T6FA 5ESTE 1YLDA 3A88A 1OWDA 2A7HA 1CGIE 3GYMA 2WUCA 1GJCB 1GI8B 3ZZBA 5FPSA 5K0HA 3M3SA 1HPGA 1IQHA 1O2GH 3EE0B 3PB1E 3LGUA 3WY8A 2VJ1A 5L6NH 2SFAA 1P2KA 1FLEE 3FP8E 3M5OA 1EP6A 1Z1IA 3P8FA 4YOJA 1O3PB 1Z8IB 1O37A 1QR3E 1SHHB 1OWHA 3GDSA 1UCYK 1NU9A 4Y79A 4YZUA 2KAIA 4MNYA 1S5SA 3MWIU 1TPPA 3URDA 1BTHH 1P2IA 5FX6A 1V2ST 2PLXA 2P3FH 2TGDA 4MG3A 1ELGA 1Y5BT 3F1SB 2ZPQA 2ZG0H 2YNAA 5GXPA 1MTSA 2GTBA 5F03A 4X6NA 1ESAA 3DHKH 3M5LA 4K2YA 1GGDB 4B1TA 4BNRA 5AFYH 5AF9H 3HGNA 1BJUA 3B23B 3HKIB 1TA2A 3H5CB 3K65B 4ABBA 4INHA 7GCHF 4Y8YA 4BOHA 2F9UA 5FCKA 1TNLA 2UUJB 1UHBA 1P09A 1VITH 4YT6H 1E38B 2FX6A 1FPHH 1FXYA 4IC6A 4Y10E 1O33A 1YYY1 1C1OA 1FIZA 2AMPA 5CMXH 2F9VA 1S0RA 3AVZA 1N8OC 1PQAA 2WYJA 1QCPA 3MU5A 3SJ8A 3R0FA 1XUJA 2PGQB 4ISHH 3SGAE 2B9LA 2ZU1A 3P95A 1C9TA 4F4OC 1GBKA 1GBCA 1HJAB 2G81E 5EXLA 3T25A 1GL0E 1GBEA 4ABHA 1P03A 2FYQA 2K1QA 1NY22 1CA0C 1P10A 1LHCH 1YPKH 2VVUA 1BMAA 2ZFFH 3GCOA 4X2WA 2A4GA 1E34B 2W3IA 2WUBA 1C2DA 4U32A 1ARCA 1ETRH 2Z3EA 4KKDA 3A8DA 1UTKA 2IPHA 1EJMA 3FP6E 1BBRE 1OYTH 4JK6A 2SGFE 3RXFA 1W3CA 2ODYB 1FY8E 2HOBA 4HI3A 3HGPA 3OY5U 1BBRK 2FEQH 4D7GA 1IQIA 1GMCF 3LPRA 1LQDB 1O2JA 1G36A 1DWEH 1HDTH 3FZDA 1RIWB 3KQEA 4WXVA 4JK5A 1GCDA 7KMEH 1FUJA 1NFXA 2GMTC 3OSYA 1RRKA 1DXPA 2BDHA 5DP8A 5T6DA 2J4IA 2ULLA 2WINI 4X1PU 3UR6A 2BQWB 1WCZA 1QJ1B 1HAVB 2BD4A 2P8OB 3GOVB 1GJBB 1AZZA 3F9EA 4FUBA 1DSTA 1MQ5A 1FJSA 1BT7A 3QGNB 3RLYH 1RGQA 5E8EH 1ZMNA 2V6NA 1G9IE 1AKSA 8KME2 1IQGA 2EI6A 2C8YB 2FX4A 2R0KA 2BD5A 3K6ZA 1Z8GA 4NA7A 3DD2H 1DY9A 1UTPA 1SQAA 3OY6U 1KLJH 4IMQA 1SOTA 4ABDA 4GVUA 4UFGH 1UTJA 2JKHA 2ZGJA 2QV1A 1C5WB 1GG6B 2J2UA 1K1OA 1C5OH 1PPZA 3A83A 4NIWA 3I77A 4RKJB 1KLTA 3TJVA 3E3TA 3PO1C 3MNSA 4WH8A 3MFJA 3UTUH 1OSSA 4OS1A 3NZIA 4A5TS 3VXFH 4JYTA 2QF3A 3HK6B 3BTME 2BDCA 3BG8A 4OS7A 6GCHF 1O2OA 4BAHB 2BX3A 1T4UH 2H2ZA 2AGGX 1P3EA 1P2NA 3DFLA 2TRMA 2RDLA 3NKKA 1HIAB 2W3KA 2BD2A 2Y81A 3K2UA 4CRCA 4THNH 1GVZA 2OUAA 1SBWA 4IMZA 3QWCH 1QL8A 1AWHB 2HNTF 3STIA 5DP9A 1XX9A 2BOKA 3AW0A 2ZP0H 3M3TA 1H8IH 3OYPA 1UCYH 1WSSH 2FS8A 2ODQA 4CBOA 1KLIH 2H9HA 1W7GH 1V2KT 2O8WA 1O5DH 2CJIA 1FIWA 1IQFA 1ZJKA 1Z8RA 1NRNH 1V2RT 2PKAA 1GBFA 5FX5A 1RTLA 1HAOH 4ZAEA 2GCTC 1OP2A 1C5YB 2ODPA 1GDUA 3KN2A 3M36A 1A5HA 1BCUH 5JBTA 1PQ5A 1CT4E 3BIUH 1NO9H 2G00A 1XUHA 3VB7A 4DURA 1XXFA 5DP5A 2V3HH 1DICA 3T27A 4H6SB 3P8GA 2IJOB 2ZGXH 4KP0A 4AYYB 1QRZA 3TK5A 1P9SA 1ARBA 2ZO3H 3RU4E 1GWAA 1AB9C 1GJ4H 3B8JA 2FTMA 1WAYB 1ZSJA 1GVKB 3RXUA 1YPHE 4K1TA 2QIQA 1BMMH 2BZ6H 1P11E 3A89A 1AVGH 4FUCA 4R0IA 2VVVA 3ATWA 5L2YH 1F2SE 4PROA 1QURH 1LVOA 3SN8A 2BOHB 5EOKA 3L33A 1HNEE 1IOEA 1N6YA 3SJKA 5F6MA 4LXBH 1BIOA 4GHQA 2SNWA 3BTTE 4O3TA 1Y3WA 3VB3A 3RMLH 5JBBS 1PQ7A 1A1RA 1QQ4A 4YOIA 1T8LA 2FESH 2PUQH 3GCTF 2ZDNA 2O8TA 4GUXA 2FWWA 1ZYOA 2XWBI 4FU8A 4LZ1H 3U69H 3UFAA 1HAZB 3SW2B 3VEQB 3GICB 4CRFA 3LONA 2BD9A 4JYVH 2VIOA 2BVSH 1UK3A 1AFQC 2FOGA 5FBEA 1W10U 5CHAC 1NZQH 4INKA 3GYLB 4TY6A 3QDZB 1QRWA 2BHGA 4CR5A 1YPGH 1K2I1 4OS5A 1FY3A 3RXTA 4WF8A 4GAWA 4Y11E 1KDQA 2GCHF 1GHYH 3BEUA 1WYKA 1MTNC 3HPTB 1CHOG 1SLXB 2ZDMA 1O3EA 1GMHF 1O2NA 2HPPH 2BQ6B 5HM2A 3EA8A 3MI4A 3SJ9A 1D6RA 3TJNA 1DX5M 1WTHD 4YO9A 2EEKA 1EAUA 3OX7U 2O8MA 3SHCH 1D3TB 1O2QA 1AWFH 1JIMA 3M7QA 1ZMJA 3QN7A 4O9VA 1YLCA 4NG9H 3RLWH 4I7YH 1A3EH 5EW1H 2OXSA 3LGTA 4GCHG 1FV9A 1GPZA 1NRQH 1HCGA 3P92A 8LPRA 1LHFH 3RXAA 3UQOA 2SGEE 4X1NU 3U8RH 5DP6A 5IYTA 2A4RA 5E2OA 2CXVA 1UO6A 2XYAA 1OWEA 1A3BH 3SV6A 1D4PB 4XBDA 2XRCA 1P2OA 5JYIA 2VINA 2ANWA 4TWWA 2V0BA 2VB0A 5DG6A 4UD9H 2Q6DA 2ZGBH 3HATH 3G01A 3QGJA 6CHAB 2AGEX 1HV7A 2PKSC 1DSUA 2VIVA 2SGPE 3TK6A 1SGNE 4XSKU 1XM1A 4NZLA 3A8AA 3MH6A 2G5VA 4BTTB 4NCYA 1BRCE 3RXHA 2XBYA 9LPRA 1P2JA 2BY8X 2QY0B 1GL1A 2BVRH 2ZQ2A 3M3VA 3KF2A 3PMJA 4WVPE 1MU8B 4Y7BA 1SGFA 1QB6A 3S9BA 1L1NA 1O3CA 5EPYA 1CE5A 1JXPA 1KTTB 3MO3A 1JOUB 1KTSB 1SLVB 1DDJA 1C1UH 1ZOMA 1ZGIA 2Z3DA 8GCHG 1EZSC 2A7JA 1SMFE 4H42U 4ZXYH 1CA8B 1BTPA 3D62A 4K69A 5GIBA 3SJIA 5HYOA 1C1WH 1W14U 2XC0A 1ZZZA 3RXMA 4CHAC 1O2LA 3ZVCA 1GBIA 1BTXA 3LC3A 3TITA 2GP9B 1D3QB 2A5KA 1YCPH 1P2QA 3ENSB 2A5IA 5EQSA 2QN5T 4NSVA 5C1YA 2D26C 1O2IA 4X1SU 1HAYB 2OTVA 1Q31A 3UREA 1MD7A 1FAXA 1SOZA 1ZTLA 1O5BB 2BLOA 1O3DA 1MCTA 2BY6X 1BTYA 2BQ7B 1C2HA 3RM0H 4F49A 2AMQA 3K9XB 1AHTH 4CRGA 4H4FA 3MU4A 2W26A 1MH0A 4A1VA 1TNGA 3QO6A 1PPEE 5C1XA 5FXLA 4CRAA 1EOLA 1DXWA 1Q3XA 3A7XA 2BLQA 1OKXA 2UWLA 3E91A 2W7SA 1MUEB 3TVJB 1O3JA 1ETTH 1O2KA 1O5EH 1TB6H 3BV9B 5L2ZH 1SL3A 3CP7A 1SVPA 1THSH 3RMNH 1DLKB 4FU7A 5AFZH 3F6UH 1C2FA 4DJZB 1K1PA 1MD8A 4K3JA 4Y6DA 1INCA 1V2OT 1C5LH 3UPEA 1EAXA 1AY6H 3ATKA 2SGDE 1ORFA 1SFIA 3SNDA 3S7KB 4WH6A 1YPHC 2A45B 2QA9E 2C8WB 1C2IA 2BM2A 3LGWA 1GI2A 2HWLB 4CBNA 1H9IE 1GG6C 4A7IB 1HAXB 1WU1A 1W12U 3RMMH 2ZCLP 1BMNH 1O3FA 1OS8A 1TGSZ 5EG4A 5EW2H 3S7HB 1BITA 3FAOA 1ELCA 5FPYA 4OS2A 1MBQA 4I31A 3U8OH 4UFEH 3BTHE 4AB9A 1TQ0B 1V2VT 4XBCA 1QA7A 1SQOA 1TRYA 2XBXA 5GWZA 4X0WU 1O5FH 3URCA 1CBWC 3MMGA 2FI5E 1HJ9A 3GISB 1CQQA 1S6HA 2FMJA 2ZU2A 5EQQA 3SBKA 3PWBA 2DE8A 3ZYEA 1ELBA 1SGTA 5J4QA 5DKMA 1O2YA 2G52A 1GJ9B 1RS0A 3ZZDA 2FODA 1C5MD 4I8KA 1AQ7A 3VFEA 4NZQA 4A1XA 5JB8S 3T26A 4TWYA 2WYGA 3GCHB 3QX5H 4TPIZ 2XCFA 4WWYA 4B71A 2OP9A 1O2UA 1PPFE 3NXPA 3MU1A 2BMGB 3RXGA 3RXVA 4DVAU 4AGKA 2CF9H 2J92A 4O3UA 1SB1H 3PLPA 2PSXA 3CS0A 1F0RA 2NU0E 4WMFA 5C2ZA 1GJ5H 3PMAB 1HAGE 1UCYE 4ZKRU 1CT2E 1GCTC 2BDBA 2Y80A 3KQDA 3UIRA 1A5GH 2OBOA 2A1DB 2VWMA 4OS4A 3LGVA 2ZFQH 3A7TA 1O36A 4VGCB 2Y5GA 1PPCE 2GDDA 2J94A 3M5NA 3RDZA 1C5ZB 1J8AA 2Q1JA 1S82A 4X2XA 2BXUH 3GY6A 3U1IB 1NM6A 3C27B 1C1VH 1TMBH 2NU2E 3A85A 5DP4A 3CENA 1VR1H 1WQVH 4E05H 1UJ1A 4FVDA 4NA9H 1G3BA 1BHXF 4M7GA 3O8BA 1IQEA 1AVXA 1TA6A 4GSOA 2AMDA 4AX9H 1QRXA 1HGTH 7GCHG 3LIWA 2CHAC 2ZQ1A 3C1KA 4X1RU 2P94A 4ESTE 2VWNA 4E7RG 4DT7B 2J34A 3ZVGA 4B2AA 1SGDE 1OWIA 1O3AA 2PV9B 3UNSA 1FN6A 1MKWH 2BTCE 3STJA 3ZZ8A 1K1IA 5K7RA 5EPNA 1T8MA 1THPB 1BRUP 1SFQB 2I6SA 2FI4E 1GI6A 1EXFA 3ZZ6A 1BOQA 1OX1A 4D9RA 1YKTA 1SGPE 1UTLM 3EGKH 2WPHS 5DK1A 2GZ7A 1P01A 1SGCA 1BB0B 2JETB 3FVFB 4KTCA 4XE4A 1TX7A 4DY7B 3MH7A 2W5EA 4JZEH 1ZLRA 1O5GH 5F8ZA 3ODDA 2XWAA 1O3KA 1IQMA 1S84A 3SU2A 3MYWA 1X7AC 1XUFA 1LCYA 1AD8H 1O2XA 1TX6A 3RXSA 3LOXA 2Z7FE 3AW1A 2GGVB 1B0EA 1EJAA 3FZZA 1DLEA 2A5AA 1GBBA 1Z6JH 3I29A 1KXAA 1GMCG 3GDUA 1V2NT 1YP9A 2XXLA 4X2YA 1VJAU 5C5NA 1UVTH 2TIOA 4IW4E 6ESTA 1MKXH 2FS9A 3RXRA 2EA3A 1O3BA 2OD3B 1HRTH 1TNHA 2PTCE 1V2WT 2BLVA 5A8XA 4K5ZA 1V2TT 3Q77A 5E2PA 2B5TB 2FLRH 1HXEH 3SV7A 2WPJS 1Y3XA 4LK4A 3UOUA 3ZZ4A 2BDAA 1MTWA 4ISIH 3SUEA 2HGTH 1J16A 1P05A 1UVSH 4XBBA 4YOGA 4X6OA 1JIRA 5TCCA 3ZZ9A 2ALVA 1ELAA 4MDSA 1AKSB 2CMYA 1QIXB 2C93B 1AU8A 1GHAG 2Q6GA 4CR9A 3ZZCA 3SU1A 4Q7ZA 1JRSA 1J14A 1SR5C 3ZYDA 3VB4A 2G4TA 1JRTA 1VGCC 1WTGH 2OCVB 3H7TA 5E0GA 1KXDA 2AFQB 5GCHF 2H5DA 3BG4B 4CH8B 4IS5A 1V6DA 4UEHH 1G3CA 1O2SA 2FTLE 2Y5HA 3UNQA 1FZZA 1Y3YA 1C5UA 1VCPA 2Y82A 1H4WA 2AYWA 1UTNA 1HAPH 2PFEA 1O3LA 5ABWA 1G30B 3U8TH 4DG4A
chains in the Genus database with same CATH superfamily
1NBME 4KTUA 1FONA 3HK3B 3GDVA 1HAHH 1K21H 2WPKS 4Y0ZE 3TK9A 4UFDH 3UUZA 1JWTA 1AZ8A 2VWLA 3LC5A 2AGIX 5LGOA 1WDIA 1LMWB 3RU4T 1Z71A 1DM4B 4KGAA 1GHWH 4TY7A 2F9PA 1AN1E 2P3TB 1NN6A 1XXDA 3E0NB 2A31A 5A2MH 1WXRA 1KYNA 2F9OA 1FAKH 3NWUA 1H8DH 2SGAA 3SZNA 4ZMAH 3VGCB 4LZ4B 3O8RA 4B73A 1MMJN 2P93A 1BZXE 4FUEA 2ZEBA 4B6FA 5A09A 3A86A 1P57B 1YCPK 1TGTA 2WHXA 1XKAC 2C8ZB 1HIAA 3TGJE 3MNCA 2YMSC 1GI0A 2H9EH 1EPTC 1C2KA 1EAWA 2QF0A 4KTSA 5LPFA 3PROA 1G2MA 4I8LA 1O2PA 3HKJB 4P02A 3PTNA 3NPSA 2YNBA 3UY9A 1MAYA 2PKAB 1HXFH 1EFRD 4OGYA 4FUHA 4IBLH 4KELA 1DE7H 1K1NA 5I25A 1GHVH 2FOEA 1ESTA 3MU0A 1QL7A 4BAKB 1RFNA 2Z6BD 4ACAA 2FOCA 2GV6A 1DPOA 2NU4E 3T5FH 3TGKE 4WMDA 4ISOA 1QGFA 1ZSKA 2ANMH 2PHBA 2PR3A 4BTIB 3ZZAA 3QZRA 3S69A 3UWJH 1G2LA 1KXCA 4CH2B 1L0ZA 3P6ZB 1MTVA 1VZQH 3O8CA 2LPRA 4NSYA 1Y5UT 2J9NA 1TPAE 3SV9A 2BD3A 2FPZA 2VU8E 4AFUA 3ATIA 3RXKA 3N7OA 1H9HE 1C5VA 3RXLA 2G55A 5G4BA 1QY6A 5DP3A 4D8NA 1NRRH 3KL6A 3OU0A 3GCTG 1PFXC 3BTWE 5EODA 3RC5A 1Z7KA 2H5CA 1QA0A 2VH6A 1OWKA 3RXOA 1L2EA 2TGPZ 4Q7YA 3I78A 2R3UA 3IITA 4A1TA 3Q3YA 3B9FH 1CT0E 2A4QA 1QJ7B 5C1UA 4ZKOU 1GBLA 2PWXA 1YPMH 3SV8A 4IGDA 1ANEA 2WPMS 2ILNA 2B0FA 3GY8A 3EAJA 3QUMP 1C2MA 1O35A 3RUOA 2DE9A 1SSXA 1F0UA 2CGAA 1L4DA 1GMHG 1KDQB 3A80A 4IN1A 2FDAA 1DITH 3E8LA 4ASUD 3TLOA 3BEFB 1B5GH 3RXDA 1BUIA 3OFND 6LPRA 4MPWA 2FOBA 2JH6D 1O2TA 1XKBC 2HLDD 1BTWA 1GBHA 2RG3A 4D9QA 1J17T 1PPHE 2OC8A 1N8OB 2ZNKH 2KCAA 4ABIA 3T28A 2VIWA 1BTZA 4ASHA 4ZKNU 2AIPA 3LH1A 3QLPH 1MU6B 1TPOA 4WMEA 3AAUA 3L6PA 4B74A 1ZRBA 1FNIA 1EB1H 4ZH8A 3M7TA 1CA0B 1YC0A 1S0QA 2G8TA 2VH0A 3KYGA 1FX0B 3QK1A 3VG8A 2GT8A 1V3XA 1CHOF 2F9NA 3U98H 2D2DA 1DT2A 3PTBA 2LP6A 3MNXA 1MQ6A 2NWNA 4ZHMU 1C1RA 3TH2H 3LJOA 3FN8A 3VPKA 5IK2D 4RSPA 2AIQA 2AEIH 3DFJA 1QZ8A 2ZFPH 1NTPA 1O31A 1RXPA 3PLKA 2GDEH 1DWDH 3SZEA 1AIXH 3KIDU 1F0SA 1GGDC 2FI3E 3M7UA 1LTOA 2HLCA 2ZFTA 4GCHF 1OXGA 1OPHB 1EP5A 1DVAH 1TWXB 3PMBB 4FETA 1C4U2 2GMTB 4I8HA 1V2LT 2KR7A 2YOLA 3SU0A 2G4UA 3TJUA 1ZMLA 1HUTH 2XNIA 1FMGA 2BY9X 1BRBE 4NIVA 1ESBA 4I33A 1COWD 1TGCA 3RXCA 4JZFH 1KSNA 5DPAA 2ZGCA 4Q80A 3QTVH 4B76A 5HIZA 1EQ9A 2YMSD 4I8GA 4AG2A 2ZHWH 3VB6A 1O34A 3OEHD 1UVUH 4X1QU 1AGJA 3KHVA 2KCPA 2M5TA 1W8BH 2TPIZ 2ZZUH 1C4V2 2ZIQH 1YM0A 2BX4A 4JYUH 1HJAC 1P02A 1MKWK 3BEIB 3EA7A 3OTJE 1ZHPA 1GBTA 3SNCA 1GMDG 3BTQE 2THFB 4ABJA 2JJ2D 4ZXXH 2A4OA 3SHAH 2IN2A 1CGHA 1QL9A 4I8JA 2HPQH 3GS9A 3PO1B 3F9FA 1EOJA 1O32A 4UDWH 2C90B 1VITF 3E0PB 2FZZA 2A32A 4FUJA 3SJOA 3EYDA 8GCHF 2F3CE 4E06H 3PYHA 4MPVA 1LHDH 1W7XH 3S9CA 2CN0H 3UWIA 3SO3A 1EB2A 4AFSA 4D7FA 5EXMA 1EKBB 1C4Y2 1Y5AT 5A8YA 1HAIH 3UR9A 3U1JB 3PM3A 3F9GA 3TH4H 2Z3CA 2FIRH 4MVNA 1O2HA 1RIWC 4OM9A 1O2RA 2QC2A 4Y8ZA 3FP7E 2ZCKP 2VIPA 3EA9A 3IWMA 5IDKA 3MH4A 1C5NH 1GBMA 1D6WA 1NFUA 1T8NA 2VBCA 4MLFB 1KXFA 1EAIA 3GY7A 4NFFA 2ZA5A 1K1MA 2WV5A 1GI5A 3MNBA 4GHTA 3RC4A 2XC5A 5HMAA 1ANCA 3BIVH 1QTFA 1CO7E 1K28D 1DANH 2P8OC 3ZVAA 2J38A 3SGQE 5CDFE 1C5RA 2Y7XA 3CS7A 4HGCA 3W95A 4JCNA 2ZU3A 5JBCS 2R0LA 1MKXK 1E1QD 2ZF0H 3QTOH 8ESTE 3L3TA 1N6XA 2RCEA 5B6LA 3H7OA 4X8VH 2ZHQH 2FOFA 2ZGHA 2GZ8A 2IOTA 1NRPH 2QYIA 1EPTA 2XTTB 3SQHE 4MNXA 5ETXA 2P95A 1P3CA 3MH5A 2FOAA 5TJXA 1W2KH 1WOFA 1A61H 3P8OA 1DUEA 1XVOA 3SI4H 2FLBH 2GCTB 1SI5H 2D1JA 3E90B 3A7VA 1LVMA 3V7TA 1FY1A 4A92A 3P8NA 1PYTC 1S6LA 3RMOH 2UUFB 1TGBA 4X2VA 1MABB 2FOHA 4NWKA 2F83A 2VIDA 1DFPA 1TMUH 1RJXB 4JZIA 1E79D 5T6GA 1ZHMA 1M9UA 1AB9B 2GV7A 2RA0A 1IHSH 3WW7A 4DOQA 3ITIA 3SU4A 1BMLA 2O8LA 1BRAA 1QBNA 3FFGA 3KCGH 3ZV8A 1XUGA 1E35B 1AI8H 1T31A 1P2MA 2GVFA 3SUGA 1NFWA 1EZQA 2ESTE 1CU1A 1D3DB 3D23A 2GD4B 2M2AA 1SQTA 4CREA 4BTUB 1K9OE 1GHBF 1FQ3A 4AORA 4O97A 1W13U 2QGRA 1GHXH 1MBMA 4JZ1A 3BTDE 1GI3A 4DT4A 2ZHDA 2CV3A 4ABFA 2ZHEH 4CRDA 1TPSA 4BAOB 4Q2KA 1UTMA 1XMNB 1TALA 5CE1A 2W7UA 1ACBE 2R9PA 3TJOA 1AFQB 1A0LA 1CGJE 2EI7A 5AHGH 5CHAB 3F3BA 1LHEH 1JBUH 1EATA 1ELEE 1ZTKA 2Z9KA 3P70B 1ZHRA 1TIOA 3SV2H 3FANA 3M61U 2BDIA 3Q3XA 3SQEE 1K22H 2F4LA 2KAIB 1TBQH 3F2GA 1MTNB 4U01A 1ZTJA 3VB5A 1QHRB 1C5PA 2A2QH 4DGJA 3NK8A 1LPZB 2FXRA 5LH8A 3MO9A 1THRH 3KQBA 1F5KU 2BD7A 1ZR0A 2BY7X 1EJNA 2HVYB 7ESTE 4SGBE 2OC0A 3GY4A 2RA3A 1GVLA 5C20A 2ZU5A 7LPRA 1O39A 2EC9H 1Y3UA 2UWPA 4UE7H 1UVOA 2OQ5A 2F91A 1ELFA 2BDGA 1GBDA 3BTEE 3ODFA 2KCYA 2OQUA 2PGBB 4ZKSU 1LQEA 1UHBB 2XBWA 1BQYA 1P06A 4Z6AH 1P8VC 1ZRKA 3OEED 2PKSB 3UQVA 3A8CA 3ZZ3A 1SGIB 3A84A 5F8TA 1BMFD 2ZDVH 1O2ZA 3GCNA 3A81A 1VJ9U 4ZROA 1ZPCA 1VCQA 1TYNA 2GKVE 4NA8A 1GI4A 5T1VA 4JZDH 3KNXA 1QBVH 4Y0YE 1K0HA 1Z8JB 4HG6A 1LO6A 2BB4A 3LKWA 1AUJA 5JPMH 2PP6A 1NPMA 1LVBA 5GDSH 4SGAE 2EY4C 4YLQH 2P3UB 3DA9B 3RU4D 4OS6A 1SGQE 3E1XB 4DCDA 3RXBA 3SNBA 1TBZH 3KGPA 4WY3A 1HJ8A 3AASA 2O9QA 1GJ6A 1Y3VA 4LOYH 1CVWH 1QFKH 1T4VH 4ABGA 4CRBA 4MPUA 5HM9A 3W94A 1H1BA 3IG6B 1F92A 1Z6EA 3LU9B 2FOMB 1T7CA 1SG8B 4NFEA 3LGIA 4CHAB 3RP2A 2H6MA 2J98B 2WV9A 1PPGE 2ANYA 3BSQA 4NWLA 2BVXH 1PYTD 1A5IA 1IQJA 2AH4X 3KQCA 4NGAH 3P17H 1TFXA 1W0ZU 1EZUC 3QZQA 4RN6A 2Z9GA 3R3GB 3ZV9A 2BDYA 4MQAA 1QB1A 4DW2U 1UMAH 1Y8TA 6CHAC 5FPTA 1K1JA 2ANKH 2JJ1D 4GPGA 4B2BA 5EXNA 5LPEA 1BJVA 3SORA 3ZVBA 2QF5A 4X8SH 3DUXH 1FDPA 5DGJA 1TABE 3LJJA 5C5OA 1GI1A 4AOQA 1YBWA 1OP8A 1D9IA 1NESE 1NT1A 1PJPA 1CSOE 1HAVA 2KM0A 4INLA 1MAXA 1HLTH 1V2JT 5GCHG 4YT7H 1YPEH 5TCAA 1TRNA 1C2LA 4HFPB 3F68H 1KXBA 2G5NA 2PTNA 1U6QA 4O03A 4RKOB 2OC1A 2ZWLH 4UFFH 1XVMA 4HTCH 3T29A 5J4SA 2R2MB 4IN2A 5A0BA 1TRMA 6GCHG 1ABJH 2BD8A 1A0JA 1UK2A 3ELAH 1DWBH 1EASA 1P12E 1GHAF 5C3NA 1YWUA 2QXJA 1FY5A 3UAIC 5JB9S 3GY5A 2VIQA 3A8BA 1F5LA 1ZPZA 3DT0H 3T2NA 2VGCB 4FOUC 4ABAA 5L30H 1XUIA 1EX3A 2IPQX 4D76A 4AC9A 5A0CA 4DIHH 1J15A 1C5QA 5LPRA 4F48B 1NRSH 4NIXA 1SLWB 2HNTE 1L1JA 3TNTA 1NFYA 4FUIA 1MCVA 2ZECA 3RXJA 1O2VA 3BTGE 1F0TA 4FUDA 3MHWU 5KECA 2XCNA 3ZIAD 1CBWB 4J2YB 1G37A 1TNIA 1IAUA 2WV4A 4MPXA 1GI7B 2JH5D 1GJ7B 1GDQA 3E16B 3SOSA 3T62A 3KEEA 1O3MA 1QNJA 2P16A 1QQUA 1IQKA 5HKKD 1A7SA 1B0FA 2AS9A 3A87A 1WV7H 1OYQA 2WZQA 3UNRA 2BZAA 3BTKE 4Z1MD 1EZXC 2Z9IA 3U28C 2B7DH 1W11U 1C2GA 5BRRE 4FVBA 1Z1JA 5JDUB 1TOMH 3PWCA 5E0JA 4BXWA 2D8WA 2J95A 1LKBA 4AFZA 2LNCA 1O3NA 1T8OA 1V2QT 5EGMA 3V13A 4XOJA 1TGNA 1YF4A 4AZ2B 4WJG2 2B8OH 3PRDA 3PV4A 2XW9A 5FHTA 3SI3H 1C1MA 3SUDA 1GCTB 1AVWA 3SU6A 5C67A 4YTAA 2TBSA 3PV2A 4ZHAA 1D3PB 2ZDAH 4DIIH 1F5RA 5EQRA 2XBVA 2RDEA 2P59A 3BN9A 1FI8A 4K8BA 2UWOA 1GI9B 1TONA 5DJ7A 3TNSA 4GLYA 3A7WA 3MU8A 2R3YA 1E36B 1Y59T 2QXGA 1O5CB 3MO6A 1GDNA 2A2XH 1CHGA 1ANBA 3ZVDA 3ATLA 4H6TA 4ZHLU 1UVPA 1IQLA 1O3OA 3LT3A 1HYLA 2VWOA 1C5SA 4X6MA 2DUCA 2FYRA 2PW8H 3PRBA 1VCWA 2STAE 2R2WU 4AN7A 3EDXB 2Y7ZA 3O8DA 3N7DA 5KEDA 1SPJA 1AO5A 2CHAB 1G3EA 1DOJA 3N7EA 5EU8A 3A7ZA 3GCHC 4J1YA 1BTUA 1C9PA 1V2MT 3AAVA 4MNWA 2GCHG 2FM2A 2Z9LA 4ZUHA 3BF6H 2OC7A 1QBOA 3FKSD 1O0DH 1O3HA 4U30A 4WXIA 3V12A 9ESTA 4Y71A 4BAQB 1LDTT 2CF8H 1C1PA 1NROH 1ZJDA 3M5MA 4K60A 3UOPA 3RM2H 2HALA 3ATMA 1A0HB 1KIGH 4X8TH 1RTFB 3SGBE 1YGCH 1A4WH 1G32B 5FAHA 3TGIE 1TNKA 3RXQA 2HVXA 1E37B 1RD3B 5HGGA 1ZSLA 3JZ2B 4YM9A 2OLGA 1UW7A 1UTOA 2A7CA 2WPLS 2ZKSA 4TYDA 2ZU4A 2ZHFH 3DSGA 4Q63A 1ZGVA 2Q6FA 3V0XA 1B7XB 4NIYA 3PLBA 1LVYA 2QXIA 4VGCC 1BBRH 1J9CH 5SGAE 1Q2WA 3A82A 1F7ZA 2V35A 3SUFA 3KYFA 1V2PT 4TT3D 1LHGH 3JZ1B 4OGXA 2KX4A 1ID5H 5DP7A 1E0FD 5E0HA 4AG1A 2QXHA 4B75A 3VXEH 3ESTA 1ELDE 2ZPSA 1C1TA 1TQ7B 1S83A 2H1UA 2VNTA 4YESB 1TAWA 1YPJH 2SGQE 5A0AE 1KY9A 1SGEE 2GX4A 2SNVA 1K1LA 2Z9JA 3NUMA 1P9UA 1O2MA 2A0QB 3U9AH 4XDEA 4IC5A 3DCLA 5T3HA 1GJAB 1GJDB 1N1LA 2EI8A 1HFDA 5F8XA 3ZVFA 1AUTC 3GY2A 1SGYE 2ZTZA 5GNDA 3V3MA 1L1GA 1SC8U 1TLDA 1GJ8B 1GBAA 3NCLA 2F9BH 2ZCHP 1QJ6B 1ELVA 1GBJA 1G3DA 3RC6A 1SHYA 1TE0A 1WBGB 1TOCB 5I46H 2WPDD 3Q76A 5FBIA 1LPKB 4FU9A 2TGTA 1C5XB 1KXEA 5GJ4B 1HB0B 5BPEA 3A7YA 1DS2E 4X6PA 1MTUA 1AFEH 2I6QA 1O2WA 2ZI2H 1O3GA 2JETC 2ZTXA 5CHBA 4Q7XA 3TH3H 4AFQA 4AGJA 4FUFA 1ETSH 3MOCA 1VGCB 1W0YH 3LH3A 1O38A 1LPGB 2ZFSA 4JMYA 2HNTC 1VITG 1DUAA 2OINA 4Y7AA 2ZFRH 1JMOH 2ZDLA 3OTPA 5A8ZA 2OBQA 1SQRA 1O30A 1AE5A 3EQ0H 4U2WA 1C2EA 4QT8C 1NS3A 3TU7H 4B2CA 1AMHA 1UTQA 3ZZ7A 2O8UA 1GMDF 5B6OA 4ISLA 1RTKA 4Y8XA 1BA8B 4K1EA 1S85A 3S0NA 3SU5A 2TGAA 2ZTYA 5EJZA 1TBRH 2UUYA 1NU7B 4YLUA 3D49H 1V2UT 1S81A 3TPIZ 2LELA 3F9HA 5JBAS 2ASUB 5GPIB 3GY3A 1P04A 1S6FA 3RXIA 4P00A 1DWCH 3RXPA 1NC6A 2ALPA 4BXSA 1O5AB 2ZDKA 2C3SA 4K8YA 2H9TH 5PTPA 1C2JA 4BANB 1GHZA 1AE8H 4A6LA 2QE7D 1LKAA 3D65E 1C1SA 1TX8A 1ELTA 2Y6TA 2WPIS 3M35A 2BXTH 4R8TB 4AB8A 1EPTB 1BHXB 1VKYA 3SNAA 1A46H 1OP0A 2Y5FA 2QCYA 2UUKB 3E6PH 1A2CH 3SU3A 4Z0KA 4E7NA 4I32A 2FO9A 1TMTH 1BDAA 1ABIH 4TPYA 1YCPM 5HXFA 1H9LB 5DO4H 3BG4C 5H4IB 1IQNA 3ZVEA 1EUFA 2RFKC 2JH0D 1SGFG 3ZZ5A 2FP7B 2Z94A 3RXEA 2GT7A 4ISNA 4XFQA 1FN8A 1FY4A 1OOKB 2NU3E 2PUXB 5ESBA 2BLWA 3Q3KA 4FUGA 2AHME 2NU1E 1OWJA 3MTYA 2V3OH 1SLUB 2ZPRA 1O3IA 2GZ9A 2STBE 1C1NA 3PMHB 3M37A 2ZC9H 2VGCC 2XC4A 2C4FH 1SGRE 3Q00A 1YPLH 2GJGA 1C5TA 1IHTH 4ABEA 1ANDA 1QB9A 4HZHA 1XUKA 2G51A 1L4ZA 1P0SH 2BYAX 1PQ8A 1PPBH 1UK4A 3LDXH 1WQSA 1WUNH 3VGCC 3SNEA 2HRVA 2VVCA 1ZPBA 2BY5X 3F0PA 1HBTH 1GHBG 3LGYA 1MZAA 1MZDA 3BTFE 4UONA 2AERH 3F0OA 2QAAA 4XD7D 5FCRA 5AVDA 1T32A 2C8XB 4YXWD 4X8UH 3K6YA 3S9AA 4K1SA 1TNJA 1FPCH 4MTBA 1C1QA 3TIUA 3H09A 3W1EA 4FXGH 4Y76A 5FL7D 2PSYA 4BAMB 1DY8A 4AYVB 4MNVA 5T6FA 5ESTE 1YLDA 3A88A 1OWDA 2A7HA 1CGIE 3GYMA 2WUCA 1GJCB 1GI8B 3ZZBA 5FPSA 5K0HA 3M3SA 1HPGA 1IQHA 1O2GH 3EE0B 3PB1E 3LGUA 3WY8A 2VJ1A 5L6NH 2SFAA 1P2KA 1FLEE 3FP8E 1NBMD 3M5OA 1EP6A 5EJ1A 1Z1IA 3P8FA 4YOJA 1O3PB 2K0QA 1Z8IB 1O37A 1QR3E 1SHHB 1OWHA 3GDSA 1UCYK 1NU9A 4Y79A 4YZUA 2KAIA 4MNYA 1S5SA 3MWIU 1TPPA 3URDA 2XOKD 1BTHH 1P2IA 5FX6A 1V2ST 3NRLA 2PLXA 2P3FH 2TGDA 4MG3A 1ELGA 1Y5BT 3F1SB 2ZPQA 2ZG0H 2YNAA 5GXPA 1MTSA 2GTBA 5F03A 4X6NA 4Q4LA 1ESAA 3DHKH 3M5LA 1W0KD 4K2YA 1GGDB 4B1TA 4BNRA 5AFYH 5AF9H 3HGNA 1BJUA 4F55A 3B23B 3HKIB 1TA2A 3H5CB 3K65B 4ABBA 4INHA 7GCHF 4Y8YA 4BOHA 2F9UA 5FCKA 1TNLA 2UUJB 1UHBA 1P09A 1VITH 4YT6H 1E38B 2FX6A 1FPHH 1FXYA 4IC6A 4Y10E 1O33A 1YYY1 4I86A 1C1OA 1FIZA 2AMPA 5CMXH 2F9VA 1S0RA 3AVZA 1N8OC 1PQAA 2WYJA 5DSFA 1QCPA 3MU5A 3SJ8A 3R0FA 1XUJA 2PGQB 4ISHH 3SGAE 2B9LA 2ZU1A 3DSOA 3P95A 1C9TA 4F4OC 1GBKA 1GBCA 1HJAB 2G81E 5EXLA 3T25A 1GL0E 1GBEA 2KZ4A 4ABHA 1P03A 2FYQA 2K1QA 1NY22 1CA0C 1P10A 1LHCH 1YPKH 2VVUA 1BMAA 2ZFFH 3GCOA 4X2WA 2A4GA 1YY3A 1E34B 1H8ED 3SYJA 2W3IA 2WUBA 1C2DA 4U32A 1ARCA 1ETRH 2Z3EA 4KKDA 3A8DA 2V3MA 1UTKA 5DN6D 2IPHA 1EJMA 3FP6E 1BBRE 1OYTH 4JK6A 2SGFE 3RXFA 1W3CA 2ODYB 1FY8E 2HOBA 4HI3A 3HGPA 3OY5U 1BBRK 2FEQH 4D7GA 1IQIA 1GMCF 3LPRA 1LQDB 1O2JA 1G36A 1DWEH 1HDTH 3FZDA 1RIWB 3KQEA 4WXVA 3F2FA 4JK5A 1GCDA 7KMEH 1FUJA 1NFXA 2GMTC 3OSYA 1RRKA 1DXPA 2BDHA 5DP8A 5T6DA 2J4IA 2ULLA 2WINI 4X1PU 3UR6A 2BQWB 1WCZA 1QJ1B 1HAVB 2BD4A 2P8OB 3GOVB 1GJBB 1AZZA 3F9EA 4FUBA 1DSTA 1MQ5A 1FJSA 1BT7A 3QGNB 3RLYH 3F2HA 1RGQA 5E8EH 1ZMNA 2V6NA 1G9IE 1AKSA 8KME2 1IQGA 2EI6A 2C8YB 2FX4A 2R0KA 2BD5A 3K6ZA 1Z8GA 4NA7A 3DD2H 1DY9A 1UTPA 3PV5A 1SQAA 3OY6U 1KLJH 4IMQA 1SOTA 4ABDA 4GVUA 4UFGH 1UTJA 2JKHA 2ZGJA 2QV1A 1C5WB 1GG6B 2J2UA 1K1OA 1C5OH 1PPZA 3A83A 4NIWA 3I77A 4RKJB 1KLTA 3TJVA 3E3TA 3PO1C 3MNSA 4WH8A 3MFJA 3UTUH 1OSSA 4OS1A 3NZIA 4A5TS 3VXFH 4JYTA 4ZCNA 2QF3A 3HK6B 3BTME 2BDCA 3BG8A 4OS7A 6GCHF 1YLNA 1O2OA 4BAHB 2BX3A 1T4UH 2H2ZA 2AGGX 1P3EA 1P2NA 3DFLA 2TRMA 2RDLA 3NKKA 1HIAB 2W3KA 2BD2A 2Y81A 3K2UA 4CRCA 4THNH 3KQ5A 1GVZA 1KMHB 2OUAA 1SBWA 4IMZA 3QWCH 1QL8A 1AWHB 2HNTF 3STIA 5C94A 2OK5A 5DP9A 1XX9A 2BOKA 3AW0A 2ZP0H 3M3TA 1H8IH 1OHHD 3OYPA 1UCYH 1WSSH 2FS8A 2K8IA 4B6EA 2ODQA 4CBOA 1KLIH 2H9HA 1W7GH 3FOAA 1V2KT 2O8WA 1O5DH 2CJIA 1W0JD 1FIWA 1IQFA 1ZJKA 1Z8RA 1NRNH 1V2RT 2PKAA 1GBFA 5FX5A 1RTLA 1HAOH 4ZAEA 2GCTC 1OP2A 1C5YB 2ODPA 1GDUA 3KN2A 3M36A 1A5HA 1BCUH 5JBTA 1PQ5A 1CT4E 3BIUH 1NO9H 2G00A 1XUHA 3VB7A 4DURA 1XXFA 5DP5A 2V3HH 3WWBA 1DICA 3T27A 4H6SB 2WSSD 3P8GA 2IJOB 2ZGXH 4KP0A 4AYYB 1QRZA 3TK5A 1P9SA 1ARBA 2ZO3H 3RU4E 1GWAA 1AB9C 1GJ4H 3B8JA 2FTMA 1WAYB 1ZSJA 1GVKB 3RXUA 1YPHE 4K1TA 2QIQA 1BMMH 2BZ6H 1P11E 3A89A 1AVGH 4FUCA 4R0IA 2VVVA 3ATWA 5L2YH 1F2SE 4PROA 1QURH 1LVOA 3SN8A 2BOHB 5EOKA 3L33A 1HNEE 5EJLA 1IOEA 1N6YA 3SJKA 5F6MA 4LXBH 1BIOA 4GHQA 2SNWA 3BTTE 4O3TA 1Y3WA 3VB3A 3RMLH 5JBBS 1PQ7A 1A1RA 1QQ4A 4YOIA 1T8LA 2FESH 2PUQH 3GCTF 2ZDNA 2O8TA 4GUXA 2FWWA 1ZYOA 2XWBI 4FU8A 4LZ1H 2J5UA 3U69H 3UFAA 1HAZB 3SW2B 3VEQB 3GICB 4CRFA 3LONA 5EIYA 2BD9A 5C0TA 4JYVH 2VIOA 2BVSH 1UK3A 1AFQC 2FOGA 5FBEA 1W10U 5CHAC 1NZQH 4INKA 3GYLB 4TY6A 3QDZB 1QRWA 2BHGA 4CR5A 1YPGH 2KCOA 1E1RD 1K2I1 2JDID 4OS5A 1FY3A 3RXTA 4WF8A 4GAWA 4Y11E 1KDQA 2GCHF 1GHYH 3BEUA 1WYKA 1MTNC 3HPTB 1CHOG 1SLXB 2ZDMA 1O3EA 1GMHF 1O2NA 2HPPH 2BQ6B 5HM2A 3EA8A 3MI4A 3SJ9A 1D6RA 3TJNA 1DX5M 1WTHD 4YO9A 2EEKA 1EAUA 3OX7U 2O8MA 3SHCH 1D3TB 1O2QA 1AWFH 1JIMA 3M7QA 1ZMJA 3QN7A 4O9VA 1YLCA 4NG9H 3RLWH 4I7YH 1A3EH 5EW1H 2OXSA 3LGTA 4GCHG 1FV9A 1GPZA 1NRQH 1HCGA 3P92A 8LPRA 1LHFH 3RXAA 3UQOA 2SGEE 4X1NU 3U8RH 5DP6A 5IYTA 2A4RA 5E2OA 2CXVA 1UO6A 2XYAA 1OWEA 1A3BH 3SV6A 1D4PB 4XBDA 3MQKC 2XRCA 1P2OA 5JYIA 2VINA 2ANWA 4TWWA 2V0BA 2VB0A 2V7QD 5DG6A 4UD9H 2Q6DA 2ZGBH 3HATH 3G01A 3QGJA 6CHAB 2AGEX 1HV7A 2PKSC 1DSUA 2VIVA 2SGPE 3TK6A 1SGNE 4XSKU 1XM1A 4NZLA 3A8AA 3MH6A 2G5VA 4BTTB 4NCYA 1BRCE 3RXHA 4TSFD 2XBYA 9LPRA 1P2JA 2BY8X 2QY0B 1GL1A 2BVRH 2ZQ2A 3M3VA 3KF2A 3PMJA 4WVPE 1MU8B 4Y7BA 5C0UA 1SGFA 1QB6A 3S9BA 1L1NA 1O3CA 5EPYA 1CE5A 1JXPA 1KTTB 3MO3A 1JOUB 3UB0A 1KTSB 1SLVB 1DDJA 4M9FA 1C1UH 1ZOMA 1ZGIA 2Z3DA 8GCHG 1EZSC 2A7JA 1SMFE 4H42U 4ZXYH 1CA8B 1BTPA 3D62A 4K69A 5GIBA 3SJIA 5HYOA 2KFWA 1C1WH 3OE7D 1W14U 2XC0A 1ZZZA 3RXMA 4CHAC 1O2LA 3ZVCA 1GBIA 1BTXA 3LC3A 3TITA 2GP9B 1D3QB 2A5KA 2XNDD 1YCPH 1P2QA 2F43B 3ENSB 2A5IA 5EQSA 2QN5T 4NSVA 5C1YA 2D26C 1O2IA 4X1SU 1HAYB 2OTVA 1Q31A 3UREA 1MD7A 1FAXA 1SOZA 1ZTLA 1O5BB 2BLOA 1O3DA 1MCTA 2BY6X 1BTYA 2BQ7B 1C2HA 3RM0H 4F49A 2AMQA 3K9XB 1AHTH 4CRGA 4H4FA 3MU4A 2W26A 4RT1A 1MH0A 3OAAD 4A1VA 5C17A 1TNGA 3QO6A 1PPEE 5C1XA 5FXLA 4CRAA 1EOLA 1DXWA 1Q3XA 3A7XA 2BLQA 1OKXA 2UWLA 3E91A 2W7SA 2CK3D 1MUEB 2YMSB 1O3JA 3TVJB 1ETTH 1O2KA 2L74A 1O5EH 1TB6H 3BV9B 5L2ZH 1SL3A 3CP7A 1SVPA 1THSH 3RMNH 1DLKB 4FU7A 5AFZH 3F6UH 1C2FA 4DJZB 1K1PA 1MD8A 4K3JA 4Y6DA 1INCA 1V2OT 1C5LH 3UPEA 1EAXA 1AY6H 3ATKA 2SGDE 1ORFA 1SFIA 3SNDA 3S7KB 4WH6A 1YPHC 2A45B 2W6ID 2QA9E 2C8WB 1C2IA 2BM2A 3LGWA 1GI2A 1SKYE 2HWLB 4CBNA 1H9IE 1GG6C 4A7IB 1HAXB 1WU1A 1W12U 3RMMH 2ZCLP 1BMNH 1O3FA 1OS8A 5KGOA 1TGSZ 3N99A 5EG4A 5EW2H 3S7HB 1BITA 3FAOA 5HIYA 1ELCA 5FPYA 4OS2A 1MBQA 4I31A 3U8OH 4UFEH 3BTHE 4AB9A 1TQ0B 1V2VT 4XBCA 1QA7A 1SQOA 1TRYA 2XBXA 5GWZA 4X0WU 1O5FH 3URCA 1CBWC 3MMGA 2FI5E 1HJ9A 3GISB 1CQQA 1S6HA 2FMJA 2ZU2A 5EQQA 3SBKA 1H8HD 3PWBA 2DE8A 3ZYEA 1ELBA 1SGTA 5J4QA 5DKMA 1O2YA 2G52A 1GJ9B 1RS0A 3ZZDA 2FODA 1C5MD 4I8KA 1AQ7A 3VFEA 4NZQA 4A1XA 4RI0A 5JB8S 3T26A 4TWYA 2WYGA 3GCHB 3QX5H 4TPIZ 2XCFA 4WWYA 4B71A 2OP9A 1O2UA 1PPFE 3NXPA 3MU1A 2BMGB 4RT0A 3RXGA 3RXVA 3CNRA 4DVAU 4AGKA 4ACBA 2CF9H 2J92A 4O3UA 1SB1H 3PLPA 2PSXA 3CS0A 1F0RA 3WWFA 2NU0E 4WMFA 5C2ZA 1GJ5H 3PMAB 1HAGE 1UCYE 2JIZD 4ZKRU 1CT2E 1GCTC 2BDBA 2Y80A 3KQDA 3UIRA 1A5GH 2OBOA 2A1DB 2VWMA 4OS4A 3LGVA 2ZFQH 3A7TA 1O36A 4VGCB 2Y5GA 1PPCE 2GDDA 2J94A 3M5NA 3RDZA 1C5ZB 1J8AA 2Q1JA 1S82A 4X2XA 2BXUH 2J97A 3GY6A 3U1IB 1NM6A 3C27B 1C1VH 1TMBH 2NU2E 3A85A 5DP4A 3CENA 1VR1H 1WQVH 4E05H 1UJ1A 4FVDA 4NA9H 1G3BA 1BHXF 4M7GA 3O8BA 1IQEA 1AVXA 1TA6A 4GSOA 2AMDA 4AX9H 1QRXA 1HGTH 7GCHG 3LIWA 2CHAC 2ZQ1A 3C1KA 4X1RU 2P94A 4ESTE 2VWNA 4E7RG 4DT7B 2J34A 3ZVGA 4B2AA 1SGDE 1OWIA 1O3AA 2PV9B 5F53A 3AK5A 3UNSA 1FN6A 1MKWH 2BTCE 2EQNA 3STJA 3ZZ8A 1K1IA 5K7RA 5EPNA 1T8MA 1THPB 2W6JD 3EE7A 1BRUP 1SFQB 2I6SA 2FI4E 1GI6A 1EXFA 3ZZ6A 1BOQA 1OX1A 4D9RA 1YKTA 1SGPE 1UTLM 3EGKH 2WPHS 5DK1A 2GZ7A 1P01A 1SGCA 1BB0B 2JETB 3FVFB 4KTCA 4XE4A 1TX7A 2L6OA 4DY7B 3MH7A 2W5EA 4JZEH 2IJD1 1ZLRA 1O5GH 5F8ZA 3ODDA 2XWAA 1O3KA 1IQMA 1S84A 3SU2A 3MYWA 1X7AC 1XUFA 1LCYA 1AD8H 1O2XA 1TX6A 3RXSA 3LOXA 2Z7FE 3AW1A 2GGVB 1B0EA 1EJAA 3FZZA 1DLEA 2A5AA 1GBBA 1Z6JH 3I29A 1KXAA 1GMCG 3GDUA 1V2NT 1YP9A 2XXLA 2J98A 4X2YA 1VJAU 5C5NA 1UVTH 2TIOA 4IW4E 6ESTA 1MKXH 2FS9A 3RXRA 2EA3A 1O3BA 2OD3B 1HRTH 1TNHA 2PTCE 1V2WT 2BLVA 5A8XA 4K5ZA 1V2TT 3Q77A 5E2PA 2B5TB 2FLRH 1HXEH 3SV7A 2WPJS 1Y3XA 4LK4A 3UOUA 3ZZ4A 2BDAA 1MTWA 4ISIH 3SUEA 2HGTH 1J16A 1P05A 1UVSH 4XBBA 4YOGA 4X6OA 1JIRA 5TCCA 3FO8D 3ZZ9A 2ALVA 1ELAA 4MDSA 1AKSB 2CMYA 1QIXB 2C93B 1AU8A 1GHAG 2Q6GA 4CR9A 3ZZCA 3SU1A 4Q7ZA 1JRSA 1J14A 1SR5C 3ZYDA 3VB4A 4XRNA 2G4TA 1JRTA 1VGCC 1WTGH 2OCVB 3H7TA 5E0GA 1KXDA 2AFQB 3DSPA 2H5DA 3BG4B 5GCHF 4CH8B 4IS5A 1V6DA 4UEHH 1G3CA 1O2SA 2FTLE 2Y5HA 3UNQA 2QF4A 1FZZA 1Y3YA 1C5UA 1VCPA 2Y82A 1H4WA 2AYWA 1UTNA 1HAPH 2PFEA 1O3LA 5ABWA 1G30B 3U8TH 4DG4A
chains in the Genus database with same CATH topology
4KTUA 1FONA 3HK3B 3GDVA 1HAHH 1K21H 2WPKS 4Y0ZE 3TK9A 4UFDH 3UUZA 1JWTA 1AZ8A 2VWLA 3LC5A 2AGIX 5LGOA 1LMWB 3RU4T 1Z71A 1DM4B 4KGAA 1GHWH 4TY7A 2F9PA 1AN1E 2P3TB 1NN6A 1XXDA 3E0NB 2A31A 5A2MH 1KYNA 2F9OA 1FAKH 3NWUA 1H8DH 2SGAA 3SZNA 4ZMAH 3VGCB 4LZ4B 3O8RA 4B73A 1MMJN 2P93A 1BZXE 4FUEA 2ZEBA 5A09A 3A86A 1P57B 1YCPK 1TGTA 1XKAC 2C8ZB 1HIAA 3TGJE 3MNCA 1GI0A 2H9EH 1EPTC 1C2KA 1EAWA 2QF0A 4KTSA 5LPFA 3PROA 1G2MA 4I8LA 1O2PA 3HKJB 3PTNA 3NPSA 2YNBA 3UY9A 1MAYA 2PKAB 1HXFH 4OGYA 4FUHA 4IBLH 4KELA 1DE7H 1K1NA 5I25A 1GHVH 2FOEA 1ESTA 3MU0A 1QL7A 4BAKB 1RFNA 2Z6BD 2FOCA 2GV6A 1DPOA 2NU4E 3T5FH 3TGKE 4WMDA 4ISOA 1QGFA 1ZSKA 2ANMH 2PHBA 2PR3A 4BTIB 3ZZAA 3QZRA 3S69A 3UWJH 1G2LA 1KXCA 4CH2B 1L0ZA 3P6ZB 1MTVA 1VZQH 3O8CA 2LPRA 4NSYA 1Y5UT 2J9NA 1TPAE 3SV9A 2BD3A 2FPZA 2VU8E 4AFUA 3ATIA 3RXKA 3N7OA 1H9HE 1C5VA 3RXLA 2G55A 5G4BA 1QY6A 5DP3A 4D8NA 1NRRH 3KL6A 3OU0A 3GCTG 1PFXC 3BTWE 5EODA 3RC5A 1Z7KA 2H5CA 1QA0A 2VH6A 1OWKA 3RXOA 1L2EA 2TGPZ 4Q7YA 3I78A 2R3UA 3IITA 4A1TA 3Q3YA 3B9FH 1CT0E 2A4QA 1QJ7B 5C1UA 4ZKOU 1GBLA 2PWXA 1YPMH 3SV8A 4IGDA 1ANEA 2WPMS 2ILNA 2B0FA 3GY8A 3EAJA 3QUMP 1C2MA 1O35A 3RUOA 2DE9A 1SSXA 1F0UA 2CGAA 1L4DA 1GMHG 1KDQB 3A80A 4IN1A 2FDAA 1DITH 3E8LA 3TLOA 3BEFB 1B5GH 3RXDA 1BUIA 6LPRA 4MPWA 2FOBA 2JH6D 1O2TA 1XKBC 1BTWA 1GBHA 2RG3A 4D9QA 1J17T 1PPHE 2OC8A 1N8OB 2ZNKH 4ABIA 3T28A 2VIWA 1BTZA 4ASHA 4ZKNU 2AIPA 3LH1A 3QLPH 1MU6B 1TPOA 4WMEA 3AAUA 3L6PA 4B74A 1ZRBA 1FNIA 1EB1H 4ZH8A 3M7TA 1CA0B 1YC0A 1S0QA 2G8TA 2VH0A 3QK1A 2GT8A 1V3XA 1CHOF 2F9NA 3U98H 2D2DA 1DT2A 3PTBA 3MNXA 1MQ6A 2NWNA 4ZHMU 1C1RA 3TH2H 3LJOA 3VPKA 4RSPA 2AIQA 2AEIH 3DFJA 2ZFPH 1NTPA 1O31A 1RXPA 3PLKA 2GDEH 1DWDH 1AIXH 3KIDU 1F0SA 1GGDC 2FI3E 3M7UA 1LTOA 2HLCA 2ZFTA 4GCHF 1OXGA 1OPHB 1EP5A 1DVAH 1TWXB 3PMBB 1C4U2 2GMTB 4I8HA 1V2LT 2YOLA 3SU0A 2G4UA 3TJUA 1ZMLA 1HUTH 2XNIA 1FMGA 2BY9X 1BRBE 4NIVA 1ESBA 4I33A 1TGCA 3RXCA 4JZFH 1KSNA 5DPAA 2ZGCA 4Q80A 3QTVH 4B76A 1EQ9A 4I8GA 4AG2A 2ZHWH 3VB6A 1O34A 1UVUH 4X1QU 1AGJA 3KHVA 2M5TA 2TPIZ 1W8BH 2ZZUH 1C4V2 2ZIQH 1YM0A 2BX4A 4JYUH 1HJAC 1P02A 1MKWK 3BEIB 3EA7A 3OTJE 1ZHPA 1GBTA 3SNCA 1GMDG 3BTQE 2THFB 4ABJA 4ZXXH 2A4OA 3SHAH 2IN2A 1CGHA 1QL9A 4I8JA 2HPQH 3PO1B 3F9FA 1EOJA 1O32A 4UDWH 2C90B 1VITF 3E0PB 2FZZA 2A32A 4FUJA 3SJOA 3EYDA 8GCHF 2F3CE 4E06H 3PYHA 4MPVA 1LHDH 1W7XH 3S9CA 2CN0H 3UWIA 3SO3A 1EB2A 4AFSA 4D7FA 5EXMA 1EKBB 1C4Y2 1Y5AT 5A8YA 1HAIH 3UR9A 3U1JB 3PM3A 3F9GA 3TH4H 2Z3CA 2FIRH 4MVNA 1O2HA 1RIWC 1O2RA 2QC2A 4Y8ZA 3FP7E 2ZCKP 2VIPA 3EA9A 3IWMA 5IDKA 3MH4A 1C5NH 1GBMA 1D6WA 1NFUA 1T8NA 4MLFB 1KXFA 1EAIA 3GY7A 4NFFA 2ZA5A 1K1MA 2WV5A 1GI5A 3MNBA 4GHTA 3RC4A 2XC5A 5HMAA 1ANCA 3BIVH 1QTFA 1CO7E 1K28D 1DANH 2P8OC 3ZVAA 2J38A 3SGQE 1C5RA 2Y7XA 3CS7A 4HGCA 3W95A 4JCNA 2ZU3A 5JBCS 2R0LA 1MKXK 2ZF0H 3QTOH 8ESTE 3L3TA 1N6XA 2RCEA 3H7OA 4X8VH 2ZHQH 2FOFA 2ZGHA 2GZ8A 2IOTA 1NRPH 2QYIA 1EPTA 2XTTB 3SQHE 4MNXA 5ETXA 2P95A 1P3CA 3MH5A 2FOAA 5TJXA 1W2KH 1WOFA 1A61H 3P8OA 1DUEA 1XVOA 3SI4H 2FLBH 2GCTB 1SI5H 2D1JA 3E90B 3A7VA 1LVMA 3V7TA 1FY1A 4A92A 3P8NA 1PYTC 3RMOH 2UUFB 1TGBA 4X2VA 2FOHA 4NWKA 2F83A 2VIDA 1DFPA 1TMUH 1RJXB 4JZIA 5T6GA 1ZHMA 1M9UA 1AB9B 2GV7A 2RA0A 1IHSH 4DOQA 3ITIA 3SU4A 1BMLA 2O8LA 1BRAA 1QBNA 3FFGA 3KCGH 3ZV8A 1XUGA 1E35B 1AI8H 1T31A 1P2MA 2GVFA 3SUGA 1NFWA 1EZQA 2ESTE 1CU1A 1D3DB 3D23A 2GD4B 1SQTA 4CREA 4BTUB 1K9OE 1GHBF 1FQ3A 4AORA 4O97A 1W13U 2QGRA 1GHXH 1MBMA 4JZ1A 3BTDE 1GI3A 2ZHDA 2CV3A 4ABFA 2ZHEH 4CRDA 1TPSA 4BAOB 4Q2KA 1UTMA 1XMNB 1TALA 5CE1A 2W7UA 1ACBE 2R9PA 3TJOA 1AFQB 1A0LA 1CGJE 2EI7A 5AHGH 5CHAB 1LHEH 1JBUH 1EATA 1ELEE 1ZTKA 2Z9KA 3P70B 1ZHRA 1TIOA 3SV2H 3FANA 3M61U 2BDIA 3Q3XA 3SQEE 1K22H 2KAIB 1TBQH 1MTNB 4U01A 1ZTJA 3VB5A 1QHRB 1C5PA 2A2QH 4DGJA 3NK8A 1LPZB 2FXRA 5LH8A 3MO9A 1THRH 3KQBA 1F5KU 2BD7A 1ZR0A 2BY7X 1EJNA 7ESTE 4SGBE 2OC0A 3GY4A 2RA3A 1GVLA 5C20A 2ZU5A 7LPRA 1O39A 2EC9H 1Y3UA 2UWPA 4UE7H 1UVOA 2OQ5A 2F91A 1ELFA 2BDGA 1GBDA 3BTEE 3ODFA 2OQUA 2PGBB 4ZKSU 1LQEA 1UHBB 2XBWA 1BQYA 1P06A 4Z6AH 1P8VC 1ZRKA 2PKSB 3UQVA 3A8CA 3ZZ3A 1SGIB 3A84A 5F8TA 2ZDVH 1O2ZA 3GCNA 3A81A 1VJ9U 4ZROA 1ZPCA 1VCQA 1TYNA 2GKVE 4NA8A 1GI4A 4JZDH 3KNXA 1QBVH 4Y0YE 1Z8JB 1LO6A 2BB4A 3LKWA 1AUJA 5JPMH 1NPMA 1LVBA 5GDSH 4SGAE 4YLQH 2P3UB 3DA9B 3RU4D 4OS6A 1SGQE 3E1XB 4DCDA 3RXBA 3SNBA 1TBZH 3KGPA 4WY3A 1HJ8A 3AASA 2O9QA 1GJ6A 1Y3VA 4LOYH 1CVWH 1QFKH 1T4VH 4ABGA 4CRBA 4MPUA 5HM9A 3W94A 1H1BA 3IG6B 1F92A 1Z6EA 3LU9B 2FOMB 1T7CA 1SG8B 4NFEA 3LGIA 4CHAB 3RP2A 2H6MA 1PPGE 2ANYA 3BSQA 4NWLA 2BVXH 1PYTD 1A5IA 1IQJA 2AH4X 3KQCA 4NGAH 3P17H 1TFXA 1W0ZU 1EZUC 3QZQA 4RN6A 2Z9GA 3R3GB 3ZV9A 2BDYA 4MQAA 1QB1A 4DW2U 1UMAH 1Y8TA 6CHAC 5FPTA 1K1JA 2ANKH 4GPGA 4B2BA 5EXNA 5LPEA 1BJVA 3SORA 3ZVBA 4X8SH 3DUXH 1FDPA 5DGJA 1TABE 3LJJA 5C5OA 1GI1A 4AOQA 1YBWA 1OP8A 1D9IA 1NESE 1NT1A 1PJPA 1CSOE 1HAVA 4INLA 1MAXA 1HLTH 1V2JT 5GCHG 4YT7H 1YPEH 5TCAA 1TRNA 1C2LA 4HFPB 3F68H 1KXBA 2G5NA 2PTNA 1U6QA 4O03A 4RKOB 2OC1A 2ZWLH 4UFFH 1XVMA 4HTCH 3T29A 5J4SA 2R2MB 4IN2A 5A0BA 1TRMA 6GCHG 1ABJH 2BD8A 1A0JA 1UK2A 3ELAH 1DWBH 1EASA 1P12E 1GHAF 5C3NA 2QXJA 1FY5A 5JB9S 3GY5A 2VIQA 3A8BA 1F5LA 1ZPZA 3DT0H 3T2NA 2VGCB 4ABAA 5L30H 1XUIA 1EX3A 4D76A 5A0CA 4DIHH 1J15A 1C5QA 5LPRA 1NRSH 4NIXA 1SLWB 2HNTE 1L1JA 3TNTA 1NFYA 4FUIA 1MCVA 2ZECA 3RXJA 1O2VA 3BTGE 1F0TA 4FUDA 3MHWU 2XCNA 1CBWB 4J2YB 1G37A 1TNIA 1IAUA 2WV4A 4MPXA 1GI7B 2JH5D 1GJ7B 1GDQA 3E16B 3SOSA 3T62A 3KEEA 1O3MA 1QNJA 2P16A 1QQUA 1IQKA 1A7SA 1B0FA 2AS9A 3A87A 1WV7H 1OYQA 3UNRA 2BZAA 3BTKE 1EZXC 2Z9IA 2B7DH 1W11U 1C2GA 5BRRE 4FVBA 1Z1JA 5JDUB 1TOMH 3PWCA 5E0JA 4BXWA 2D8WA 2J95A 1LKBA 4AFZA 2LNCA 1O3NA 1T8OA 1V2QT 5EGMA 3V13A 4XOJA 1TGNA 1YF4A 4AZ2B 4WJG2 2B8OH 3PV4A 2XW9A 5FHTA 3SI3H 1C1MA 3SUDA 1GCTB 1AVWA 3SU6A 5C67A 4YTAA 2TBSA 4ZHAA 1D3PB 2ZDAH 4DIIH 1F5RA 5EQRA 2XBVA 2P59A 3BN9A 1FI8A 4K8BA 2UWOA 1GI9B 1TONA 5DJ7A 3TNSA 4GLYA 3A7WA 3MU8A 2R3YA 1E36B 1Y59T 2QXGA 1O5CB 3MO6A 1GDNA 2A2XH 1CHGA 1ANBA 3ZVDA 3ATLA 4H6TA 4ZHLU 1UVPA 1IQLA 1O3OA 3LT3A 1HYLA 2VWOA 1C5SA 4X6MA 2DUCA 2FYRA 2PW8H 1VCWA 2STAE 2R2WU 4AN7A 3EDXB 2Y7ZA 3O8DA 1SPJA 1AO5A 2CHAB 1G3EA 1DOJA 5EU8A 3A7ZA 3GCHC 4J1YA 1BTUA 1C9PA 1V2MT 3AAVA 4MNWA 2GCHG 2FM2A 2Z9LA 4ZUHA 3BF6H 2OC7A 1QBOA 4U30A 1O0DH 1O3HA 4WXIA 3V12A 9ESTA 4Y71A 4BAQB 1LDTT 2CF8H 1C1PA 1NROH 1ZJDA 3M5MA 4K60A 3UOPA 3RM2H 2HALA 3ATMA 1A0HB 1KIGH 4X8TH 1RTFB 3SGBE 1YGCH 1A4WH 1G32B 5FAHA 3TGIE 1TNKA 3RXQA 2HVXA 1E37B 1RD3B 5HGGA 1ZSLA 3JZ2B 4YM9A 2OLGA 2A7CA 1UTOA 2WPLS 2ZKSA 4TYDA 2ZU4A 2ZHFH 1ZGVA 2Q6FA 3V0XA 1B7XB 4NIYA 3PLBA 1LVYA 2QXIA 4VGCC 1BBRH 1J9CH 5SGAE 1Q2WA 3A82A 1F7ZA 2V35A 3SUFA 1V2PT 1LHGH 3JZ1B 4OGXA 1ID5H 5DP7A 1E0FD 5E0HA 4AG1A 2QXHA 4B75A 3VXEH 3ESTA 1ELDE 2ZPSA 1C1TA 1TQ7B 1S83A 2H1UA 2VNTA 4YESB 1TAWA 1YPJH 2SGQE 5A0AE 1KY9A 1SGEE 2GX4A 2SNVA 1K1LA 2Z9JA 3NUMA 1P9UA 1O2MA 2A0QB 3U9AH 4XDEA 4IC5A 5T3HA 1GJAB 1GJDB 1N1LA 2EI8A 1HFDA 5F8XA 3ZVFA 1AUTC 3GY2A 1SGYE 2ZTZA 3V3MA 1L1GA 1SC8U 1TLDA 1GJ8B 1GBAA 3NCLA 2F9BH 2ZCHP 1QJ6B 1ELVA 1GBJA 1G3DA 3RC6A 1SHYA 1TE0A 1WBGB 1TOCB 5I46H 3Q76A 5FBIA 1LPKB 4FU9A 2TGTA 1C5XB 1KXEA 5GJ4B 1HB0B 5BPEA 3A7YA 1DS2E 4X6PA 1MTUA 1AFEH 2I6QA 1O2WA 2ZI2H 1O3GA 2JETC 2ZTXA 4Q7XA 3TH3H 4AFQA 4AGJA 4FUFA 1ETSH 3MOCA 1VGCB 1W0YH 3LH3A 1O38A 1LPGB 2ZFSA 4JMYA 2HNTC 1VITG 1DUAA 2OINA 4Y7AA 2ZFRH 1JMOH 2ZDLA 5A8ZA 2OBQA 1O30A 1AE5A 3EQ0H 4U2WA 1C2EA 4QT8C 1NS3A 3TU7H 4B2CA 1AMHA 1UTQA 3ZZ7A 2O8UA 1GMDF 5B6OA 4ISLA 1RTKA 4Y8XA 1BA8B 4K1EA 1S85A 3S0NA 3SU5A 2TGAA 2ZTYA 1TBRH 2UUYA 1NU7B 4YLUA 3D49H 1V2UT 1S81A 3TPIZ 3F9HA 5JBAS 2ASUB 5GPIB 3GY3A 1P04A 1S6FA 3RXIA 3RXPA 1DWCH 4BXSA 1NC6A 2ALPA 1O5AB 2ZDKA 2C3SA 4K8YA 2H9TH 5PTPA 1C2JA 4BANB 1GHZA 1AE8H 4A6LA 1LKAA 3D65E 1C1SA 1TX8A 1ELTA 2Y6TA 2WPIS 3M35A 2BXTH 4R8TB 4AB8A 1EPTB 1BHXB 3SNAA 1A46H 1OP0A 2Y5FA 2QCYA 2UUKB 3E6PH 1A2CH 3SU3A 4Z0KA 4E7NA 4I32A 2FO9A 1TMTH 1BDAA 1ABIH 4TPYA 1YCPM 5HXFA