1AKSA

Crystal structure of the first active autolysate form of the porcine alpha trypsin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA TRYPSIN
publication title The first structure at 1.8 A resolution of an active autolysate form of porcine alpha-trysoin.
pubmed doi rcsb
molecule tags Serine protease
total genus 17
structure length 125
sequence length 125
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksA00
2FPZA 1DFPA 4U01A 1FN6A 2EI6A 3A82A 2G4TA 4CR5A 2NU0E 4CRCA 1BDAA 4I8HA 2UWLA 5CE1A 2C8XB 1HGTH 4ZKOU 1O2WA 1SQTA 5C3NA 3MWIU 4ISNA 3UIRA 4ZXXH 2B0FA 1O3GA 4Y76A 1UVTH 4Y8XA 2H6MA 4Y6DA 1O3KA 3SNBA 1O3MA 2NU1E 3R0FA 3U98H 1BHXF 2BDCA 2IJOB 4Q7ZA 2KAIB 1NC6A 4FUEA 3RMLH 4ASHA 1OWEA 2BX3A 1HAXB 3QTOH 2FXRA 3BN9A 1QA7A 1O2NA 4B74A 1O36A 1BITA 1DWBH 1GCTB 3L33A 2VWOA 5AVDA 4VGCB 3RXVA 3A80A 4H42U 3SUEA 1BOQA 2FEQH 3RXQA 1DSUA 1CBWC 2VH6A 3MU4A 2V3OH 1NRRH 1TA2A 1O2MA 4DURA 1O2HA 1P03A 1OWDA 1FZZA 2Z94A 3BG8A 5GCHF 4Y79A 4BAKB 4O3UA 1GVZA 1EB2A 2XC0A 2P94A 1TIOA 3MO9A 1P2NA 5C67A 2G5NA 3A87A 1ZOMA 1C5UA 2IPHA 2M5TA 5EW1H 1HAGE 4NSVA 2XC4A 5GWZA 1AUTC 1FIWA 5FXLA 1O2ZA 1Q3XA 3BG4B 1N1LA 5A09A 2ZG0H 3FZDA 1IQLA 3Q3XA 4ABHA 3A8BA 1GBCA 1T7CA 4IBLH 3RU4E 1Y3WA 1GGDB 4GCHG 1QJ6B 1C5SA 2BHGA 3ESTA 1F5RA 1WOFA 1J14A 2BDYA 3ZZAA 3A84A 1YC0A 3BTFE 3UNSA 3SN8A 2JH6D 1F7ZA 1HAPH 3UREA 1C2LA 4YLUA 3F68H 6CHAB 1XUJA 1ZTLA 2VWMA 4ABEA 4NZLA 1SL3A 4I8GA 3EE0B 2XW9A 1VCPA 3NPSA 1AKSA 1C5PA 1BJVA 3S9CA 2FI3E 2PUQH 4K60A 3FP7E 4ESTE 2OINA 1O31A 1TWXB 5EQSA 3S0NA 1IQFA 2QXIA 1LVBA 4X8VH 1S0QA 2B8OH 2STBE 3CENA 3DT0H 1WQSA 4GPGA 3GCHB 1W14U 2XWAA 3PLBA 2QXGA 1JRTA 2R2WU 3DHKH 4XSKU 3VFEA 1WTGH 1AZZA 1QIXB 3I29A 2GT7A 1EAIA 4NIXA 3K6YA 3S9AA 4ZUHA 3FFGA 2VIWA 1NY22 1QGFA 4SGBE 2W7SA 4YOJA 4Q7XA 1XUFA 1Y3YA 5DK1A 4D7GA 2O8TA 4Y0YE 1DWDH 3RP2A 4BOHA 3M35A 3QK1A 2NU3E 1GJ4H 3VB3A 3M3SA 3BTQE 3BSQA 1VCQA 1XVMA 3TGJE 1FQ3A 4DIHH 4D9QA 3RC5A 1JOUB 1B0EA 1QJ1B 2SNVA 4INKA 4WMDA 2HNTF 1KLTA 1FNIA 4ABIA 1QURH 2P8OC 4GUXA 1C5NH 2GCHG 4TPYA 1V2NT 2H1UA 1ANCA 1SFQB 3I78A 3TH4H 3UPEA 3A7TA 5C5OA 1DE7H 1GBJA 1CHGA 1GCTC 1Y3UA 5SGAE 2LNCA 3GYLB 5DG6A 1LHDH 1FXYA 1EPTB 1CHOF 2OC1A 4LXBH 1BBRE 4XBBA 3RXCA 1C1SA 1GHWH 2A4OA 3MU1A 3AASA 1FY4A 2H9HA 1AE8H 1C5YB 1KLJH 1TMBH 2ZC9H 4AX9H 1XUHA 1SI5H 1NN6A 3MOCA 2FIRH 1OP2A 1SSXA 3KQBA 1CA0B 2ODQA 3MH7A 4AFZA 2WINI 2AMQA 3ZVBA 1CGHA 2QXHA 3BG4C 1V2OT 5C5NA 3ZVFA 1C2JA 1W0YH 3A8AA 4DIIH 1XVOA 5AF9H 1C5ZB 1TX6A 2PGBB 1ESBA 2DUCA 1MTNB 2VWNA 1SG8B 1GGDC 2GZ8A 3E8LA 3HKJB 1WU1A 3OY6U 1N6XA 2PLXA 2HNTC 1PJPA 3SUDA 1EX3A 3PLPA 3ATMA 1C5LH 1QQUA 2Y6TA 2JETB 1NRPH 3JZ1B 5H4IB 2HGTH 4LZ1H 1LMWB 2W7UA 2OBQA 3K65B 3F9HA 3SORA 2OQUA 4E7NA 5DJ7A 2V35A 3MYWA 5GDSH 1GMCG 4K3JA 1K1JA 1O3BA 1SGCA 2HNTE 3A85A 1O3AA 1GJ6A 5EU8A 1B5GH 4DVAU 1NFYA 1HJAC 4BAHB 1A7SA 3S7HB 1NRQH 2QY0B 5A0CA 3LC3A 2F9PA 4X8SH 1EZXC 3QGJA 2ZECA 3O8RA 2BD8A 2ZIQH 2ZFSA 1Z8IB 1TALA 4KGAA 5DP7A 3M5LA 3RXBA 3LGYA 1MQ5A 2Y5FA 2BX4A 1ABJH 2D26C 3TH3H 3AW1A 3P17H 4ISIH 5IDKA 1YPHC 1VJAU 2JH0D 3KQDA 3MTYA 5G4BA 2G51A 4E05H 1BA8B 1LVYA 2QCYA 3Q77A 1SC8U 5A0AE 3DFLA 1DX5M 4X2VA 4O97A 3TJUA 1ARBA 4OS7A 1YPHE 3HKIB 3V3MA 4CH8B 1C2MA 1O5CB 1P9SA 4NCYA 1C1RA 5EXLA 3S9BA 1O2IA 3VGCB 2F9OA 2WPIS 3TK9A 3SGBE 2J4IA 1ZHPA 2A32A 1GDNA 3LH1A 5DP3A 1HAVA 1BUIA 2F9BH 3A83A 3ZV9A 1SLXB 1SBWA 2Z9LA 1H8DH 2ZCHP 4MG3A 1P2KA 2OXSA 3ATKA 4AFSA 1C5XB 1ELFA 3GICB 1RIWB 4NIYA 3RXIA 3SU4A 3RLYH 3VEQB 1EPTC 1O2VA 1C2KA 2H9TH 4MTBA 2BY9X 3UQOA 3T5FH 1SR5C 1MZAA 3QO6A 3GDSA 1YLCA 1GI1A 4X6PA 1V2RT 3RXFA 1S82A 2CXVA 5DP4A 3STJA 3RXKA 3WY8A 4U2WA 3KF2A 3NK8A 3BIVH 1L1JA 2A7CA 4JCNA 1EUFA 4MPUA 1CSOE 1C1WH 1UHBB 1YPGH 1UTLM 2OC0A 4F49A 1V2QT 3LONA 4J2YB 4OGXA 3LU9B 4DW2U 1F0SA 3MU5A 1P0SH 1WUNH 2VVUA 3A86A 3EYDA 6GCHG 2WV4A 1MU6B 3SJ8A 5T3HA 4B73A 1BTXA 4ABDA 3SBKA 1O2XA 2OP9A 1N6YA 3SO3A 5I25A 4XE4A 3TIUA 5FX5A 1VITH 5F8TA 4OGYA 3S69A 1PPFE 3M36A 1G3DA 2Z7FE 3RXHA 4WXVA 5E8EH 2FOAA 4ZH8A 2AGGX 4KELA 1P2QA 1C5MD 1RGQA 1GL1A 1O2RA 3P6ZB 1IQMA 1THSH 1TBZH 1BTZA 3URDA 4BXWA 3LIWA 2QYIA 1NRSH 2VGCC 3LC5A 3PMAB 1BMLA 3VXEH 1PPCE 1KIGH 3GDVA 2BD9A 1SQOA 1QA0A 1G30B 1MTSA 1LHCH 1TNKA 2O9QA 4NWLA 1A0HB 1GMHG 1LKBA 2SNWA 4K2YA 1MTVA 7KMEH 4YT6H 1ZPBA 4AG1A 1D3PB 2THFB 3A81A 1CGJE 1QHRB 2V0BA 3UOUA 3CS7A 2Z3EA 4K1EA 5EXMA 5PTPA 1GJ5H 4ABGA 3SNDA 1GMDG 4X1SU 3IG6B 2BOHB 3P70B 2BD2A 1L1NA 1K28D 1SGFG 3MH6A 1RJXB 3KQCA 3W94A 5JBAS 2F91A 4ISOA 1QJ7B 1GCDA 3KEEA 2CV3A 5C1XA 3GY6A 4UEHH 2BD7A 2XBWA 2HALA 4NFFA 4MVNA 2J2UA 1GBLA 2Y5GA 1YCPK 3SUGA 1GBMA 7GCHF 1GHBF 1KSNA 1W0ZU 3A89A 3R3GB 1AQ7A 3UUZA 5HM2A 2Q6FA 4AFQA 1KXEA 3GY2A 1ANDA 4NIVA 2G55A 5FHTA 1RXPA 3RDZA 1KTSB 1TGSZ 3LGUA 1YPMH 1ZSLA 1OP8A 1HIAB 4UD9H 3SU6A 1LQEA 1GDUA 2ZU5A 1ORFA 3HGNA 4ZROA 2D2DA 1G2MA 4BTUB 4AB8A 4FU9A 1UTPA 4HI3A 4K5ZA 3P8GA 5ESTE 3SV6A 2J95A 1O5FH 1S6FA 1BTYA 2UWPA 2BQ6B 1ELBA 4X6MA 5JBTA 2I6QA 2FM2A 5GCHG 2GMTB 1THPB 1GG6C 1P01A 2F9NA 4I8KA 4D9RA 1A0LA 1D3DB 4A7IB 1Z7KA 3GY3A 3MU0A 5ABWA 5T6GA 2WPHS 1DSTA 2FDAA 1W7XH 3KIDU 3PWCA 1LPGB 4U32A 1TQ7B 1DLEA 1MQ6A 3LH3A 2SGQE 1OP0A 1O3LA 4K1SA 1ID5H 2J34A 3Q3YA 1GHYH 3RU4D 5AHGH 1S81A 4Z0KA 1IQKA 3UR6A 2W5EA 1BMMH 2PTNA 3T62A 1GBBA 1UTJA 4I8LA 4H4FA 3M61U 3RC6A 1TPAE 1F92A 3RXOA 1RRKA 2A4RA 3E6PH 2BYAX 3T2NA 4GAWA 4A92A 5EODA 2VVCA 1O3NA 1P2JA 1C4Y2 2NWNA 3ELAH 1SB1H 2EI7A 1O2PA 2ZU1A 1QTFA 1HXFH 5A8ZA 4OS5A 1WYKA 1AY6H 2VJ1A 2F83A 1GJAB 5EGMA 3ZZBA 1C1OA 2BZAA 1VZQH 4UE7H 2AMDA 1O5DH 1QBOA 2BD5A 6ESTA 2FTMA 2Q1JA 2QC2A 5A0BA 2TBSA 1T4UH 4NFEA 1AO5A 2GTBA 2PTCE 3KHVA 3FVFB 2AFQB 1EXFA 1HFDA 1FMGA 4XDEA 1HJ9A 1V2KT 2KAIA 4X2XA 2FP7B 2QA9E 3SV7A 4INLA 1T31A 4TPIZ 4ABFA 5LPEA 1ZPCA 3CS0A 3RXEA 1HYLA 2ZDKA 2VIPA 5A8YA 1AMHA 1K9OE 1WSSH 1RD3B 3NUMA 2CN0H 4WY3A 4ZKRU 3FP6E 2ZU3A 3SU1A 1A46H 2XCFA 3FP8E 3SV8A 3SV9A 2ZCLP 2Z9JA 3RXMA 1TQ0B 1L1GA 1TLDA 3S7KB 4I32A 1WTHD 4ABBA 2BVXH 3EAJA 1AZ8A 1OWJA 2ZKSA 2VU8E 1F0TA 4FUDA 5T6FA 2HPPH 2QAAA 1GI9B 1J16A 2C4FH 1ZJKA 2PGQB 1F2SE 1GL0E 1ABIH 3B8JA 3RLWH 1TABE 2P3FH 1ZR0A 2ZGJA 3BTGE 2ANYA 4LZ4B 1CHOG 1A2CH 1O2JA 1PQ7A 2A4GA 3VPKA 1YPLH 1TOCB 1LPKB 1C4U2 3MNXA 1K1NA 1JIRA 1Y3XA 2ZQ2A 3PV4A 3H7TA 4XBDA 3ZVEA 1G37A 2G81E 1TE0A 1ELTA 1FJSA 1CQQA 1UTMA 3VB4A 3AVZA 4AYYB 4WF8A 1GBKA 4NSYA 1OXGA 2RDLA 1UMAH 4FUGA 1SMFE 4UFFH 1UK2A 1ZMNA 1L2EA 5GIBA 1QL8A 3RXDA 3T27A 1O0DH 1P57B 5FBIA 4DOQA 4JZIA 3M5NA 1O2TA 5JBCS 4I8JA 3DUXH 4THNH 3ZYEA 2BDBA 4DT7B 1KXAA 3D23A 1O3OA 4ZKSU 2C8WB 5FPYA 2UUJB 2OC8A 2ZHDA 1EZQA 2HVXA 2IOTA 2BLWA 1UTNA 1MKWH 2IN2A 1O3PB 1DXWA 1EAUA 1S0RA 3HK6B 3T25A 1O5GH 2ODPA 5JBBS 1BTWA 1P2MA 4UFGH 1PYTD 4DJZB 1A5IA 2YNBA 1UJ1A 1O2YA 3MNCA 4FUIA 1Z71A 1AGJA 2J92A 3ZZ4A 1GJCB 1NPMA 4IGDA 5JYIA 1D9IA 4U30A 2GV7A 1MMJN 3UY9A 5C1YA 2H5CA 1XM1A 4GSOA 3UWJH 1SGIB 2EC9H 4NA7A 1AB9B 1O2OA 1Y5UT 2BMGB 1E35B 2AEIH 1P06A 2GX4A 5C20A 1TYNA 4NGAH 4AB9A 1IQHA 1S5SA 1OWHA 3MO3A 1BRUP 1QBVH 2V6NA 1OX1A 1H8IH 2SFAA 3ATLA 1K1IA 1SGNE 3K6ZA 1AWHB 2FOEA 1P09A 3SJOA 2GP9B 4TYDA 1J9CH 3E0PB 4UONA 1ZMJA 2A7JA 1FN8A 1W12U 3V0XA 3KCGH 4YM9A 1DXPA 3AAUA 1P8VC 2BOKA 1P04A 2UUYA 3PTNA 5FAHA 1EPTA 1NFXA 2ASUB 2BZ6H 1A3BH 2PKAA 3BTDE 1CT0E 3A7YA 4FUHA 1C5QA 1OPHB 2ZTZA 1UCYH 4NZQA 2TGDA 3SU2A 3LPRA 3OSYA 5A8XA 1C1VH 4DY7B 1DPOA 4VGCC 1HPGA 1FY1A 1CGIE 1GI3A 1UVUH 2Z9GA 2BTCE 2TRMA 2TGPZ 5I46H 3TGKE 1YPJH 2O8UA 3GOVB 2HPQH 3K2UA 1C1TA 2ZCKP 3ZZ7A 3BTME 1FAKH 3MHWU 1FY8E 1F5LA 2H9EH 2ZTYA 3NCLA 3M7UA 4SGAE 1GJ8B 3ENSB 1TRNA 1AD8H 1E34B 1C1NA 4CR9A 1RTKA 3QUMP 1GI4A 4O3TA 3SU0A 5LPFA 5F8XA 2YNAA 1E37B 4HFPB 3E3TA 1O32A 5L2YH 3A8DA 1C2GA 1C5OH 1GI0A 3HATH 1G3CA 4RKJB 1P2IA 4DG4A 1YP9A 3L6PA 2ZWLH 2Q6DA 2HWLB 2ZFRH 2CJIA 1YPEH 2HRVA 1V3XA 4IN1A 5L6NH 2WPKS 5GXPA 1PYTC 4OS2A 2B5TB 4JYVH 4GCHF 4JZEH 5E0GA 3OYPA 2UUKB 1FLEE 3FAOA 1LQDB 4FUJA 3PTBA 1L0ZA 1A1RA 1K1LA 4D8NA 3SI3H 3SV2H 3B23B 2ZHWH 3MH4A 2GGVB 2ZNKH 3NWUA 6CHAC 3M3VA 2ZFPH 3U8RH 1PQAA 1SFIA 3LJOA 1BIOA 2BDAA 4MDSA 1TX8A 1ZGVA 2WUBA 2CF8H 1U6QA 1XKBC 4GHQA 1KDQA 1ZGIA 1YLDA 3ZVCA 1JIMA 8GCHG 1VCWA 4IC5A 3CP7A 1OKXA 2ZDAH 1TNLA 4CBNA 3QZQA 3GCHC 2PV9B 1C2EA 1DICA 3QX5H 5DP9A 5L30H 2AS9A 3ODFA 1ZTJA 1NFUA 2A7HA 1IOEA 5GJ4B 1H9HE 5EQQA 1AB9C 2Y82A 5JPMH 4CREA 2O8WA 3BEFB 3OY5U 1LTOA 1VR1H 4Y10E 4ABAA 4PROA 1F0UA 1DOJA 4R8TB 1SHYA 1TONA 1OSSA 3GCTG 6LPRA 1TAWA 4Y7AA 2ZP0H 1W3CA 2QV1A 2ZDLA 3NZIA 5LGOA 2D1JA 2BLOA 1PPEE 1D3QB 4B2BA 3PYHA 2ULLA 4IS5A 4MPXA 1HLTH 1BTUA 1V2WT 1SLUB 1V2MT 4YT7H 1UO6A 3RMNH 2BXUH 1C9TA 4F4OC 2CF9H 1HRTH 3P95A 3DA9B 2VIVA 4BXSA 1SGEE 3AW0A 1AFQB 1CO7E 5DO4H 1F0RA 1TNJA 1HBTH 2WPMS 3O8DA 2GCHF 1D4PB 1S85A 4KTSA 1MD7A 5GPIB 1W11U 3F1SB 4CRDA 4X0WU 4MPWA 1UHBA 4TY7A 1XKAC 3QZRA 1GBDA 3SOSA 3UR9A 2WYGA 3HGPA 1GI7B 1P9UA 1C5WB 1NU9A 2OUAA 4NG9H 4YLQH 1NROH 1NESE 1BRCE 1ESTA 2VNTA 1TA6A 2SGPE 2A5IA 3OU0A 1CA0C 2A5KA 3RXRA 2EI8A 4UDWH 2P3UB 3I77A 4OS1A 3RMMH 2GVFA 2R3UA 5HMAA 3VB6A 1QBNA 1TRMA 3TITA 1UK4A 3KNXA 3E16B 1IQGA 1TGNA 1MTNC 1ETTH 1K22H 3N7OA 1THRH 3QTVH 1ESAA 2FOBA 1GHAG 4JZDH 5BPEA 1B0FA 1N8OB 2W3KA 2FESH 1EZSC 2ZTXA 1AE5A 2JETC 1LCYA 2ZPQA 1DWEH 3ZVGA 3EDXB 2SGDE 3GDUA 4BANB 3GY8A 4KP0A 3UTUH 1V6DA 1W7GH 1A5GH 3D65E 8ESTE 4XFQA 2CHAB 5DP5A 1V2PT 2BXTH 1Z6JH 1QCPA 1GBTA 1YCPM 1P3EA 4BTIB 3LKWA 3C27B 1BBRK 1EJNA 1PPHE 3TJVA 1GJDB 5F03A 1C1UH 1MU8B 5J4SA 4KKDA 5AFYH 1C5TA 2GZ9A 2VWLA 1A5HA 1G2LA 3HPTB 4J1YA 1O38A 2ZDVH 1EAXA 1J8AA 4TWWA 1W8BH 5CHAB 4AGKA 1PPBH 2BDGA 3URCA 1GDQA 1TBRH 1T8NA 2G5VA 2F3CE 1MKXH 1LKAA 1O3HA 1Z1JA 4FVDA 8KME2 4A1VA 4IW4E 1UCYE 1GI6A 1UK3A 2PR3A 1OS8A 2P95A 2ILNA 4AN7A 1PQ5A 1A3EH 4BAQB 4ZXYH 1EJMA 2LPRA 5FPTA 2YOLA 2PSXA 2FZZA 3E90B 3VGCC 1FPHH 1V2JT 1QR3E 2PUXB 1NRNH 2GCTB 3M7TA 2ANMH 1SGPE 1ZTKA 2BD3A 2BVRH 3ZZ9A 1HAYB 2OCVB 1EP5A 5EG4A 4AFUA 2R0LA 4WVPE 3RC4A 2SGAA 4GVUA 5JB8S 3BTWE 4KTCA 1HAZB 1HIAA 5L2ZH 1AFEH 3TVJB 1TOMH 1TMUH 4RN6A 1AFQC 1NM6A 2FO9A 2FOCA 1UTOA 1QFKH 1RIWC 1E38B 1DWCH 1NS3A 2ZI2H 1SGDE 1O5BB 1AVGH 1ZJDA 2A31A 4FUCA 3O8CA 3A88A 1GBAA 3U69H 8LPRA 4ZAEA 4XOJA 1CVWH 4WH8A 1C9PA 1JMOH 1LVOA 2A2QH 3PMBB 1D6RA 1O5EH 4NWKA 1SVPA 1SGQE 1SGRE 4X2YA 3VXFH 2PWXA 1HDTH 5BRRE 1FAXA 3D62A 1CBWB 3Q76A 4B71A 4X6OA 2Z3CA 3SUFA 3UNQA 1O3EA 2Y7ZA 1ZPZA 1EOLA 2FI5E 3AAVA 3SGAE 1NO9H 1FIZA 4X1QU 1N8OC 2QF3A 6GCHF 1NT1A 2VIDA 3M5MA 3K9XB 4I31A 2F9UA 5EQRA 1AUJA 3Q3KA 1KXDA 1GBFA 7ESTE 1P05A 4IMZA 3MI4A 2VIQA 2C90B 3LGIA 4YOGA 1HAIH 3QN7A 1Y8TA 2P93A 1AIXH 1C5VA 2XTTB 1GHZA 1BHXB 4YESB 3RXPA 1QL9A 1O2KA 2ZQ1A 2G4UA 9ESTA 4K1TA 1ZRKA 2BVSH 4JMYA 4DGJA 1BRAA 4NA8A 1VITF 5FCRA 4IC6A 2FOHA 4ISHH 5CHAC 4CHAB 1TX7A 1HNEE 1MTWA 1GVLA 2G8TA 1DY9A 1K1OA 1C1PA 2RG3A 1JWTA 2R0KA 2TIOA 3O8BA 4CH2B 1QRXA 5CMXH 1WQVH 1T8LA 1WAYB 2K1QA 2WYJA 1KTTB 2RCEA 1BTHH 3E91A 3U9AH 2AYWA 3A7ZA 5EOKA 3SQHE 1DANH 3E0NB 3TJOA 1ACBE 1TPSA 2PKSB 1A0JA 3U8OH 1J15A 4CRFA 3ZYDA 2G00A 3SW2B 2A0QB 2FTLE 3G01A 4JYTA 3GCOA 1KLIH 3P8NA 2O8LA 1UTKA 3SU3A 4E06H 3VB5A 1JBUH 2GDEH 4CRAA 1TPOA 1OYQA 2ZGHA 2ZGBH 2Q6GA 3STIA 1KYNA 3ZZ3A 4Q7YA 2AGEX 4JZ1A 3MMGA 3BIUH 5EPYA 1HUTH 4RKOB 4AORA 1TNIA 2EA3A 1C2DA 1DM4B 1P12E 1V2TT 1Z1IA 2C8ZB 4ZMAH 1TMTH 1LDTT 2A4QA 3GCNA 1SGTA 3EA8A 3DD2H 2Z9KA 1C5RA 1D6WA 2P8OB 2ZPSA 3ZZ6A 1SPJA 1C1QA 2FX6A 3BEIB 1TNGA 1SHHB 1IHSH 2GKVE 1AU8A 4YZUA 1DUEA 1UCYK 4KTUA 1FV9A 1HAHH 1BJUA 5HYOA 1PFXC 1CT2E 1O5AB 1BT7A 1FY5A 2GMTC 1JRSA 3RXTA 1Y3VA 3GYMA 3NXPA 4MQAA 3PMHB 1TRYA 2B9LA 3NKKA 2SGEE 4BAMB 1X7AC 4JZFH 1C2HA 3GY7A 2XRCA 2GZ7A 1GI8B 5FCKA 2C8YB 4CBOA 4DCDA 3MNSA 1W10U 5T6DA 1XUKA 3EA7A 1QY6A 2FYRA 5FBEA 1G36A 1EKBB 1BZXE 1GJBB 1O2UA 5IYTA 3GY5A 1O33A 1B7XB 1O30A 4NIWA 1P02A 1O3DA 2XYAA 3OTJE 2ZGCA 1EOJA 1LHEH 4FUFA 1V2VT 1LO6A 2WPLS 4D7FA 5C1UA 1O3JA 5E0JA 3UOPA 4CHAC 2ZHEH 1L4ZA 3LGWA 3F6UH 2OD3B 1YKTA 4M7GA 1MTUA 4X1RU 1S6HA 1HJAB 2OC7A 3KN2A 3U1IB 3UNRA 5F8ZA 2PHBA 5LPRA 3LJJA 3TPIZ 3D49H 4YO9A 4BNRA 2UUFB 3A7VA 3BTKE 2ZPRA 2PKSC 2TGTA 2WV5A 5E2PA 3ATWA 4FXGH 1ELCA 3SGQE 5DP8A 1QQ4A 4ZHMU 1YYY1 2G52A 1AKSB 4WMFA 3RU4T 1G3EA 2ZFTA 3A7XA 1Z8GA 1DS2E 3T28A 3JZ2B 1ELAA 1ETRH 1DDJA 1K2I1 2WPJS 1EQ9A 4CRBA 4UFEH 1UVOA 1ELDE 1YGCH 1AWFH 2ALPA 4QT8C 5TCCA 2BY6X 1O39A 2H2ZA 2BQWB 2W26A 1AVXA 4YOIA 4INHA 1XX9A 2H5DA 3F9FA 2ZFQH 4B2AA 5DKMA 1TPPA 1YPKH 4X1PU 1GI2A 1WBGB 4X8TH 1MBQA 5FX6A 1O37A 5DP6A 2ZU2A 1MCTA 1Y5BT 4YTAA 3TNTA 1EJAA 2BDIA 1BQYA 2BY7X 2OBOA 3SZNA 2XBYA 4FU8A 1GHVH 2PKAB 2ANWA 1NZQH 3A8CA 5TCAA 3MU8A 1SQAA 2AMPA 3TH2H 2FOFA 3T26A 1BMNH 1TGBA 4H6SB 5ESBA 1ZRBA 4MLFB 1A61H 1HV7A 3UFAA 3VB7A 4K8YA 2UWOA 3PB1E 2Y5HA 4FVBA 1NFWA 1EB1H 2FX4A 2A5AA 1DITH 5DPAA 5A2MH 1O2QA 5C2ZA 2P59A 3TK6A 1FY3A 1EATA 1W2KH 2ZU4A 4AGJA 2GV6A 3SNAA 1ANEA 2FODA 2Z3DA 4X6NA 5FPSA 4D76A 3V13A 5F6MA 1Z8RA 2VIOA 1UVSH 1BCUH 1GVKB 3SJKA 2ZDMA 2PFEA 3UQVA 2W3IA 1XUGA 3HK3B 1BMAA 2XC5A 3KGPA 3PROA 1GI5A 1AN1E 3LOXA 4AZ2B 4Y8ZA 3TK5A 3M37A 1D3TB 4A5TS 2AERH 3BTTE 1E36B 3LGTA 2BQ7B 1FPCH 2F9VA 1MCVA 2R3YA 2R9PA 2BD4A 3TNSA 3M3TA 3ZZ8A 1P3CA 1DT2A 2FLRH 1YBWA 1PPZA 1YF4A 1BRBE 3SI4H 4WXIA 3C1KA 1DVAH 1V2ST 1ZHMA 5LH8A 2VGCB 9LPRA 4Z6AH 1KXBA 1H1BA 2ZZUH 1K21H 3E1XB 3EQ0H 1OWKA 1Y5AT 4MNVA 1P10A 4WMEA 2CMYA 1TB6H 4ZKNU 1HAOH 2FOMB 1INCA 4OS6A 4UFDH 2FS9A 4FUBA 1ELEE 1GJ7B 2QXJA 1QB9A 1NU7B 3GY4A 1IHTH 4MNWA 3KL6A 2EEKA 1ETSH 3MO6A 1KDQB 1LVMA 1FONA 4IN2A 5EPNA 2AIQA 2JH5D 3BF6H 1Z6EA 1MKXK 1VJ9U 1O35A 4B76A 4WWYA 4X2WA 3QLPH 3F9GA 1BTPA 2PW8H 1IAUA 3TGIE 2Z6BD 2ZO3H 4B75A 4H6TA 2RA3A 1LPZB 1XXFA 2XBVA 2BY8X 2QN5T 1S84A 1GHXH 1K1MA 2NU2E 5ETXA 2V3HH 2GT8A 4Y11E 7GCHG 3RXLA 1GHBG 1QL7A 1TNHA 3FZZA 2ZFFH 2VH0A 3EGKH 1O3IA 2BM2A 3RXSA 1CU1A 3L3TA 2R2MB 5AFZH 1HB0B 2ZGXH 2XCNA 1C4V2 2ZHFH 1IQEA 2XNIA 1S83A 2Y7XA 3B9FH 3SQEE 3ITIA 4E7RG 1HAVB 4RSPA 5JDUB 4X8UH 4FU7A 3RMOH 2A45B 1SLWB 2Y81A 1MBMA 2FS8A 1GBHA 1IQNA 4JK6A 4AG2A 1M9UA 1K1PA 4Q2KA 1SGYE 2ZEBA 1ZYOA 3TJNA 1ZMLA 4ZHLU 2ZDNA 1G9IE 2J38A 2STAE 2GDDA 4Y7BA 5K0HA 1GPZA 2BB4A 3P8FA 1OYTH 1G3BA 1SOTA 3QDZB 1GG6B 4MNYA 2HOBA 1TFXA 3ZZ5A 1EASA 4TWYA 3V12A 4NA9H 4A1TA 2ZHQH 1W13U 1C2FA 1SLVB 1XMNB 1QB6A 1GMCF 3RXAA 5EW2H 1RTFB 2OLGA 3TU7H 1VGCB 1EZUC 5E2OA 3ZZDA 3DFJA 2WUCA 1P2OA 1Q31A 4MPVA 1QNJA 2DE9A 5B6OA 1O3CA 4LK4A 1Y59T 3SNCA 3SJIA 1DLKB 4HGCA 4I33A 5JB9S 2OTVA 4BAOB 8GCHF 2NU4E 3RUOA 1VITG 2GD4B 1QRWA 1WCZA 2XWBI 2P16A 2DE8A 3ZZCA 2O8MA 2HLCA 1OOKB 4WJG2 1Q2WA 1IQJA 3P8OA 1GWAA 3SU5A 1GBEA 1GJ9B 1QRZA 3ZV8A 2AGIX 1RTLA 3SNEA 2ODYB 2P3TB 1O34A 1MAYA 2AIPA 1E0FD 4TY6A 1RFNA 3GCTF 3RXJA 3PLKA 1O2LA 2AH4X 4GLYA 2QF0A 1TBQH 5E0HA 3PO1B 2PSYA 3RXUA 5K7RA 2TGAA 1HJ8A 1O2SA 2FWWA 1UVPA 2Z9IA 4A1XA 3T29A 4ISLA 1V2LT 4AOQA 1MD8A 3BTHE 3OX7U 2QGRA 1CA8B 4O9VA 1FUJA 1HXEH 4I7YH 1AHTH 1NTPA 1ZHRA 3MFJA 4XBCA 2FYQA 5HGGA 2BDHA 4Y8YA 1ZLRA 1DUAA 2A2XH 1V2UT 3PWBA 3RM0H 1QB1A 4O03A 3RXGA 4ZHAA 3UWIA 1DY8A 5EXNA 3RM2H 3SHAH 1HCGA 3H5CB 1AVWA 1ZSKA 3LDXH 4BTTB 1KY9A 1L4DA 3QWCH 4R0IA 3LGVA 3IITA 4ABJA 4B1TA 1ARCA 1SGFA 2A1DB 1H4WA 3FANA 3H7OA 2BLQA 3U8TH 1MAXA 4Q80A 1T4VH 1H9LB 1MUEB 2VINA 3SHCH 3V7TA 1O2GH 2FMJA 2C93B 1J17T 1LHGH 4IMQA 3KQEA 4A6LA 3IWMA 3M5OA 1ZSJA 1IQIA 2RA0A 1CT4E 4B2CA 3BV9B 3BEUA 4CRGA 5DGJA 1MH0A 4GHTA 1O3FA 1JXPA 2J9NA 4HTCH 4OS4A 2ALVA 4X1NU 1GHAF 2XXLA 3Q00A 2ZF0H 4K69A 4Y0ZE 3W95A 1FDPA 1T32A 1Z8JB 2CHAC 3LT3A 1C1MA 1BBRH 5J4QA 1OWIA 4LOYH 1T8OA 2CGAA 4AYVB 3PMJA 2BY5X 3ATIA 3F9EA 3BTEE 2ESTE 2XBXA 1P11E 1YM0A 1VGCC 1EAWA 1GBIA 3GISB 1RS0A 1F5KU 1LHFH 2Y80A 3P92A 1XUIA 3M7QA 1CE5A 3SJ9A 4WH6A 1H9IE 1ELVA 4HZHA 5TJXA 2VVVA 1ZZZA 3TLOA 3ZVAA 1FI8A 4Y71A 2BLVA 2JKHA 1SOZA 2J94A 2FOGA 2SGFE 1G32B 1MKWK 4JK5A 1GMHF 4MNXA 3MNBA 3QGNB 2C3SA 2QIQA 3A7WA 2TPIZ 1PPGE 1T8MA 2I6SA 1UTQA 3ODDA 2FI4E 3MH5A 1KXCA 3EA9A 7LPRA 1AI8H 1TGCA 2OQ5A 2D8WA 1C2IA 2GCTC 4JYUH 1PQ8A 1ELGA 1GMDF 2VB0A 1ANBA 2B7DH 3PM3A 1BB0B 2FLBH 1XXDA 5HXFA 1TGTA 3PO1C 1A4WH 3ZVDA 2ANKH 1KXFA 1WV7H 3U1JB 1EP6A 1YCPH 1MZDA 2ZA5A 4K8BA 5HM9A
chains in the Genus database with same CATH superfamily
2FPZA 1DFPA 4U01A 1FN6A 2EI6A 3A82A 2G4TA 4CR5A 2NU0E 4CRCA 1BDAA 4I8HA 2UWLA 5CE1A 2C8XB 1HGTH 4ZKOU 1O2WA 1SQTA 5C3NA 3MWIU 4ISNA 3UIRA 4ZXXH 2B0FA 1O3GA 4Y76A 1UVTH 4Y8XA 2H6MA 4Y6DA 1O3KA 3SNBA 1O3MA 2NU1E 3R0FA 5T1VA 1BHXF 3U98H 2BDCA 2IJOB 4Q7ZA 2KAIB 1NC6A 4FUEA 3RMLH 4ASHA 1OWEA 1VKYA 2BX3A 1HAXB 3QTOH 2LELA 2FXRA 3BN9A 1QA7A 1O2NA 4B74A 1O36A 1BITA 1DWBH 1GCTB 3L33A 2VWOA 5AVDA 4VGCB 3RXVA 3A80A 4H42U 3SUEA 5DN6D 1BOQA 2FEQH 3RXQA 1DSUA 1CBWC 2VH6A 3MU4A 2V3OH 1NRRH 1TA2A 1O2MA 4DURA 1O2HA 1P03A 1OWDA 1FZZA 2Z94A 3BG8A 5GCHF 4Y79A 4BAKB 4O3UA 1GVZA 1EB2A 2XC0A 2P94A 1TIOA 2QF4A 3MO9A 1P2NA 5C67A 2G5NA 3A87A 1ZOMA 1C5UA 2IPHA 2M5TA 5EW1H 1S6LA 1HAGE 4NSVA 2XC4A 5GWZA 1AUTC 1FIWA 5FXLA 1O2ZA 1Q3XA 1UW7A 3BG4B 1N1LA 5A09A 2ZG0H 3FZDA 1IQLA 3Q3XA 4OM9A 4ABHA 3A8BA 1GBCA 1T7CA 4IBLH 3RU4E 2EY4C 1Y3WA 1GGDB 5KGOA 4GCHG 1QJ6B 1C5SA 2BHGA 3H09A 3ESTA 1F5RA 1WOFA 1J14A 2BDYA 3ZZAA 5C0UA 5B6LA 3A84A 1YC0A 3BTFE 3UNSA 3SN8A 2JH6D 1F7ZA 1HAPH 3UREA 1MABB 1C2LA 4YLUA 3F68H 6CHAB 1XUJA 1ZTLA 2VWMA 4ABEA 4NZLA 1SL3A 4I8GA 3EE0B 2XW9A 2KCOA 1VCPA 3NPSA 1AKSA 1C5PA 1BJVA 2YMSC 3S9CA 2FI3E 2PUQH 4K60A 3FP7E 4ESTE 2OINA 1O31A 1TWXB 3OE7D 5EQSA 3S0NA 1IQFA 2QXIA 1LVBA 4X8VH 1S0QA 2B8OH 2STBE 3CENA 3DT0H 3WW7A 1WQSA 4GPGA 3GCHB 1W14U 2XWAA 3PLBA 2QXGA 1JRTA 2R2WU 3DHKH 4XSKU 3VFEA 1WTGH 2XNDD 1AZZA 1QIXB 3I29A 2GT7A 1EAIA 4NIXA 3K6YA 3S9AA 4ZUHA 3FFGA 2VIWA 1NY22 1QGFA 4SGBE 2W7SA 4YOJA 4Q7XA 1XUFA 1Y3YA 5DK1A 4D7GA 2O8TA 4Y0YE 1DWDH 3RP2A 3WWFA 3M35A 4BOHA 3QK1A 2NU3E 1GJ4H 3VB3A 3M3SA 3BTQE 3BSQA 1VCQA 1XVMA 3TGJE 1FQ3A 4DIHH 4D9QA 3RC5A 1JOUB 1B0EA 1QJ1B 2SNVA 4INKA 4WMDA 2HNTF 1KLTA 1SKYE 1FNIA 4ABIA 1QURH 2P8OC 4GUXA 1C5NH 2GCHG 4TPYA 1V2NT 2H1UA 1ANCA 1SFQB 3I78A 3TH4H 3UPEA 3A7TA 5C5OA 1DE7H 1GBJA 1CHGA 1GCTC 1Y3UA 5SGAE 2LNCA 3GYLB 5DG6A 1LHDH 1FXYA 1EPTB 1CHOF 2OC1A 4LXBH 1BBRE 4XBBA 3RXCA 1C1SA 1GHWH 2A4OA 3MU1A 3AASA 1FY4A 2H9HA 1AE8H 1C5YB 1KLJH 1TMBH 2ZC9H 4AX9H 1XUHA 1SI5H 1NN6A 3MOCA 2FIRH 1OP2A 1SSXA 3KQBA 1CA0B 2KX4A 2ODQA 3MH7A 4AFZA 2WINI 2AMQA 3ZVBA 1CGHA 2QXHA 3BG4C 1SQRA 1V2OT 5C5NA 3ZVFA 1C2JA 1W0YH 3A8AA 4DIIH 1XVOA 5AF9H 1C5ZB 1TX6A 2PGBB 1ESBA 2DUCA 1MTNB 2VWNA 1SG8B 1GGDC 2GZ8A 3E8LA 3HKJB 1WU1A 3OY6U 1N6XA 2PLXA 2HNTC 1PJPA 3SUDA 1EX3A 3PLPA 3ATMA 1C5LH 1QQUA 4FETA 2Y6TA 2JETB 1NRPH 3JZ1B 5H4IB 2HGTH 2XOKD 4LZ1H 1LMWB 2W7UA 2OBQA 3K65B 3F9HA 3SORA 2OQUA 4E7NA 5DJ7A 2V35A 3MYWA 5GDSH 1GMCG 4K3JA 1K1JA 1O3BA 1SGCA 2HNTE 3A85A 1O3AA 1GJ6A 5EU8A 4F55A 1B5GH 4DVAU 1NFYA 1HJAC 4BAHB 1A7SA 3S7HB 1NRQH 2QY0B 5A0CA 3LC3A 2F9PA 4X8SH 1EZXC 3QGJA 2ZECA 5C0TA 3O8RA 2BD8A 2ZIQH 2ZFSA 1Z8IB 1TALA 4KGAA 5DP7A 3M5LA 3RXBA 3UAIC 3VG8A 3LGYA 1MQ5A 2Y5FA 2KFWA 2BX4A 1ABJH 2D26C 3TH3H 3AW1A 3P17H 4ISIH 5IDKA 2J98B 1YPHC 1VJAU 2JH0D 3KQDA 3MTYA 3OEHD 5G4BA 2G51A 4E05H 1BA8B 1LVYA 2QCYA 3Q77A 1SC8U 5A0AE 3DFLA 1DX5M 4X2VA 4O97A 3TJUA 1ARBA 4OS7A 1YPHE 3HKIB 3V3MA 4CH8B 1C2MA 1O5CB 1P9SA 4NCYA 1C1RA 5EXLA 3S9BA 1O2IA 4ZCNA 3VGCB 2F9OA 2WPIS 3TK9A 3SGBE 2J4IA 1ZHPA 2A32A 1GDNA 3LH1A 5DP3A 1HAVA 1BUIA 2F9BH 3A83A 3AK5A 2KR7A 3ZV9A 1SLXB 1SBWA 2Z9LA 1H8DH 3F3BA 2ZCHP 4MG3A 5GNDA 1P2KA 2OXSA 3ATKA 4AFSA 1C5XB 1ELFA 3GICB 1RIWB 4NIYA 3RXIA 3SU4A 3RLYH 3VEQB 1EPTC 1O2VA 1C2KA 2H9TH 4MTBA 2BY9X 3UQOA 3T5FH 1SR5C 1MZAA 3QO6A 3GDSA 4RI0A 1YLCA 1GI1A 3ZIAD 4X6PA 1V2RT 3RXFA 1S82A 2CXVA 5DP4A 3STJA 3RXKA 3FN8A 4U2WA 3WY8A 3KF2A 3NK8A 3BIVH 1L1JA 2A7CA 4JCNA 1EUFA 4MPUA 1CSOE 1C1WH 1UHBB 1YPGH 1UTLM 2OC0A 4F49A 1V2QT 3LONA 4J2YB 4OGXA 3LU9B 4DW2U 1F0SA 3MU5A 2J5UA 1P0SH 1WUNH 2VVUA 3A86A 3EYDA 6GCHG 2WV4A 1MU6B 3SJ8A 5T3HA 4B73A 1BTXA 4ABDA 3SBKA 1O2XA 2OP9A 1N6YA 3SO3A 5I25A 4XE4A 3TIUA 5FX5A 1VITH 5F8TA 4OGYA 3S69A 1PPFE 3M36A 1G3DA 2Z7FE 3RXHA 4WXVA 5E8EH 2FOAA 4ZH8A 2AGGX 4KELA 1P2QA 1C5MD 1RGQA 1GL1A 1O2RA 3P6ZB 1IQMA 1THSH 1TBZH 1BTZA 3URDA 4BXWA 3LIWA 2QYIA 1NRSH 2VGCC 3LC5A 3PMAB 1BMLA 3VXEH 1PPCE 4ACBA 1KIGH 3GDVA 2BD9A 1SQOA 1QA0A 1G30B 1MTSA 1LHCH 1TNKA 2O9QA 5IK2D 4NWLA 1A0HB 1GMHG 1LKBA 5FL7D 2SNWA 4K2YA 1MTVA 7KMEH 4YT6H 1ZPBA 4AG1A 1D3PB 2THFB 3A81A 1CGJE 1QHRB 2V0BA 3UOUA 3CS7A 2Z3EA 4K1EA 5EXMA 5PTPA 1GJ5H 4ABGA 3SNDA 1GMDG 4X1SU 3IG6B 2BOHB 3P70B 2BD2A 1L1NA 1K28D 1SGFG 3MH6A 4I86A 1RJXB 3KQCA 3W94A 5JBAS 2F91A 4ISOA 1QJ7B 1GCDA 3KEEA 2CV3A 5C1XA 3GY6A 1E1RD 4UEHH 2BD7A 2XBWA 2HALA 4NFFA 4MVNA 2J2UA 1GBLA 2Y5GA 1YCPK 3SUGA 1GBMA 7GCHF 1GHBF 1KSNA 1W0ZU 3A89A 3R3GB 1AQ7A 3UUZA 5HM2A 2Q6FA 4AFQA 1KXEA 3GY2A 1ANDA 4NIVA 2G55A 5FHTA 1RXPA 3RDZA 1KTSB 1TGSZ 3LGUA 1YPMH 1ZSLA 1OP8A 1HIAB 4UD9H 3SU6A 4DT4A 1LQEA 4Q4LA 1GDUA 2ZU5A 1ORFA 3HGNA 4ZROA 2D2DA 1G2MA 4BTUB 1E79D 4AB8A 4FU9A 1UTPA 4HI3A 4K5ZA 3P8GA 5ESTE 3SV6A 2J95A 1O5FH 1S6FA 1BTYA 2UWPA 2BQ6B 1ELBA 4X6MA 5JBTA 2I6QA 2FM2A 5GCHG 2GMTB 1THPB 1GG6C 1P01A 2F9NA 4I8KA 4D9RA 1A0LA 1D3DB 2JJ1D 4A7IB 1Z7KA 5KEDA 3GY3A 3MU0A 1KMHB 5ABWA 5T6GA 2W6ID 2WPHS 1DSTA 2FDAA 1W7XH 3KIDU 3PWCA 1LPGB 4U32A 1TQ7B 1DLEA 1MQ6A 3LH3A 2SGQE 1OP0A 1O3LA 4K1SA 1ID5H 2J34A 3Q3YA 1GHYH 3RU4D 5AHGH 1S81A 4Z0KA 1IQKA 3UR6A 2W5EA 1BMMH 2PTNA 3T62A 1GBBA 1UTJA 4I8LA 4H4FA 3M61U 3RC6A 1TPAE 1F92A 3RXOA 1RRKA 2A4RA 3E6PH 2BYAX 1OHHD 3T2NA 4GAWA 4A92A 5EODA 2VVCA 1O3NA 1P2JA 1C4Y2 2NWNA 3ELAH 1SB1H 2EI7A 1O2PA 2ZU1A 1QTFA 1HXFH 5A8ZA 4OS5A 1WYKA 1AY6H 2VJ1A 2F83A 1GJAB 5EGMA 3ZZBA 1C1OA 2BZAA 1VZQH 4UE7H 2AMDA 1O5DH 1QBOA 2BD5A 6ESTA 2FTMA 2Q1JA 2QC2A 3KQ5A 2TBSA 3KYGA 5A0BA 1T4UH 2YMSD 4NFEA 1AO5A 2GTBA 2PTCE 3KHVA 3FVFB 2AFQB 1EXFA 1HFDA 1FMGA 4XDEA 1HJ9A 1V2KT 2KAIA 4X2XA 2FP7B 2QA9E 3SV7A 4INLA 1T31A 4TPIZ 4ABFA 5LPEA 1ZPCA 3CS0A 3RXEA 1HYLA 2ZDKA 2VIPA 5A8YA 1AMHA 4XRNA 1K9OE 1WSSH 1RD3B 3NUMA 2WSSD 2CN0H 4WY3A 4ZKRU 3FP6E 2ZU3A 3SU1A 1A46H 2XCFA 3FP8E 3SV8A 2OK5A 3SV9A 2ZCLP 2Z9JA 3RXMA 1TQ0B 1L1GA 1TLDA 3S7KB 4I32A 1WTHD 4ABBA 2BVXH 3EAJA 1AZ8A 1OWJA 2ZKSA 2VU8E 1F0TA 4FUDA 5T6FA 2HPPH 2QAAA 1GI9B 1J16A 2C4FH 1ZJKA 2PGQB 1F2SE 1GL0E 1ABIH 3B8JA 3RLWH 1TABE 2P3FH 2KM0A 1ZR0A 2ZGJA 3BTGE 2ANYA 4LZ4B 1CHOG 1A2CH 1O2JA 1PQ7A 2A4GA 3VPKA 1YPLH 1TOCB 1LPKB 1C4U2 3MNXA 1K1NA 1JIRA 1Y3XA 2ZQ2A 3PV4A 3H7TA 4XBDA 3ZVEA 1G37A 2G81E 1TE0A 1ELTA 1FJSA 1CQQA 1UTMA 3VB4A 3AVZA 4AYYB 4WF8A 1GBKA 4NSYA 1OXGA 2RDLA 1UMAH 4FUGA 1SMFE 4UFFH 1UK2A 4RT0A 1ZMNA 1L2EA 5GIBA 1QL8A 4FOUC 3RXDA 3T27A 1O0DH 3WWBA 1P57B 5FBIA 4DOQA 5HKKD 4JZIA 3M5NA 1O2TA 5JBCS 4I8JA 3DUXH 4THNH 3ZYEA 2BDBA 4DT7B 1KXAA 3D23A 1O3OA 4ZKSU 2C8WB 5FPYA 2UUJB 2OC8A 2ZHDA 1EZQA 2HVXA 2IOTA 2BLWA 1UTNA 1MKWH 2IN2A 1O3PB 1DXWA 1EAUA 1S0RA 3HK6B 1NBMD 3T25A 1O5GH 2ODPA 5JBBS 1BTWA 1P2MA 3W1EA 4UFGH 1PYTD 4DJZB 1A5IA 2YNBA 1UJ1A 1O2YA 3MNCA 4FUIA 1Z71A 1AGJA 2J92A 3ZZ4A 1GJCB 1NPMA 4IGDA 5JYIA 1D9IA 4U30A 3U28C 2GV7A 1MMJN 3UY9A 3PV2A 5C1YA 2H5CA 1XM1A 4GSOA 3UWJH 1SGIB 2IPQX 2EC9H 4NA7A 1AB9B 1O2OA 1Y5UT 2BMGB 4AC9A 5C94A 1E35B 2AEIH 1P06A 2GX4A 5C20A 1TYNA 4NGAH 4AB9A 1IQHA 1S5SA 1OWHA 3MO3A 2K8IA 1BRUP 1QBVH 2V6NA 1OX1A 1H8IH 2SFAA 3ATLA 1K1IA 1SGNE 3K6ZA 1AWHB 2FOEA 1P09A 3SJOA 2GP9B 4TYDA 1J9CH 2L74A 3E0PB 4UONA 1ZMJA 2A7JA 1FN8A 5HIYA 1W12U 3V0XA 3KCGH 4YM9A 1DXPA 3AAUA 1P8VC 2BOKA 1P04A 2UUYA 3PTNA 5FAHA 1EPTA 1NFXA 2ASUB 2BZ6H 3DSGA 1A3BH 2PKAA 3BTDE 1CT0E 3A7YA 4FUHA 1C5QA 1OPHB 2ZTZA 1UCYH 1YLNA 4NZQA 2TGDA 3SU2A 3LPRA 2KCYA 3DCLA 2KZ4A 3OSYA 5A8XA 1C1VH 4DY7B 1DPOA 4VGCC 1HPGA 3DSOA 1FY1A 1CGIE 1GI3A 1UVUH 2Z9GA 2BTCE 2J97A 2TGPZ 2TRMA 5I46H 3TGKE 1YPJH 2O8UA 1YY3A 3GOVB 2HPQH 3K2UA 1C1TA 2ZCKP 3ZZ7A 1H8HD 3BTME 1FAKH 3MHWU 1FY8E 1F5LA 2H9EH 2ZTYA 3NCLA 3M7UA 4SGAE 1GJ8B 3ENSB 1TRNA 1AD8H 1E34B 1C1NA 4CR9A 1RTKA 3QUMP 1GI4A 4O3TA 3SU0A 5LPFA 5F8XA 2YNAA 1E37B 4HFPB 3E3TA 1O32A 5L2YH 3A8DA 1C2GA 1C5OH 1GI0A 3HATH 1G3CA 4RKJB 1P2IA 4DG4A 1YP9A 3L6PA 2ZWLH 2Q6DA 2HWLB 2ZFRH 2CJIA 1YPEH 2HRVA 1V3XA 4IN1A 5L6NH 2WPKS 5GXPA 1PYTC 4OS2A 2B5TB 4JYVH 4GCHF 4JZEH 5E0GA 3OYPA 2UUKB 1FLEE 3FAOA 1LQDB 1NBME 3PTBA 1L0ZA 4FUJA 1A1RA 1K1LA 4D8NA 3SI3H 3SV2H 3B23B 2ZHWH 3MH4A 2GGVB 2ZNKH 3NWUA 6CHAC 3M3VA 2ZFPH 3U8RH 1PQAA 1SFIA 3LJOA 1BIOA 2BDAA 4MDSA 1TX8A 1ZGVA 2WUBA 2J98A 2CF8H 1U6QA 1XKBC 4GHQA 1KDQA 1ZGIA 1YLDA 3ZVCA 1JIMA 8GCHG 1VCWA 4IC5A 3CP7A 1OKXA 2ZDAH 1TNLA 4CBNA 3QZQA 3FKSD 3GCHC 2PV9B 1C2EA 1DICA 3QX5H 5DP9A 5L30H 2AS9A 3ODFA 1ZTJA 1NFUA 2A7HA 1IOEA 5GJ4B 1H9HE 5EQQA 1AB9C 2Y82A 5JPMH 4CREA 2O8WA 3BEFB 3OY5U 1LTOA 1VR1H 4Y10E 4ABAA 4PROA 1F0UA 1DOJA 4R8TB 1SHYA 1TONA 1OSSA 3GCTG 6LPRA 1TAWA 4Y7AA 2ZP0H 1W3CA 2QV1A 2ZDLA 3NZIA 5LGOA 2D1JA 2BLOA 1PPEE 1D3QB 4B2BA 3PYHA 2ULLA 4IS5A 4MPXA 1HLTH 1BTUA 1V2WT 1SLUB 1V2MT 4YT7H 1E1QD 1UO6A 3RMNH 2BXUH 2JIZD 1C9TA 4F4OC 2CF9H 4M9FA 1HRTH 3P95A 3DA9B 2VIVA 2QF5A 4BXSA 1SGEE 3AW0A 1AFQB 1CO7E 5DO4H 1F0RA 1TNJA 1HBTH 2WPMS 3O8DA 1COWD 2GCHF 1D4PB 1S85A 4KTSA 1MD7A 5EJZA 1W11U 3F1SB 5GPIB 4X0WU 4MPWA 1UHBA 4TY7A 4CRDA 1XKAC 3QZRA 1GBDA 3SOSA 3UR9A 2WYGA 3HGPA 1GI7B 1P9UA 1C5WB 1NU9A 2OUAA 4NG9H 4YLQH 1NROH 1NESE 1BRCE 3CNRA 1ESTA 2VNTA 1TA6A 3OAAD 2SGPE 2A5IA 3OU0A 1BMFD 1CA0C 4RT1A 2A5KA 3RXRA 2EI8A 4UDWH 2P3UB 3I77A 4OS1A 3RMMH 2GVFA 2R3UA 5HMAA 3VB6A 1QBNA 5EJ1A 1TRMA 3TITA 1UK4A 2WV9A 3KNXA 3NRLA 3E16B 1IQGA 1TGNA 1MTNC 1ETTH 1K22H 3N7OA 1THRH 3QTVH 1ESAA 2FOBA 1GHAG 4JZDH 5BPEA 1B0FA 1N8OB 2W3KA 2FESH 1EZSC 2ZTXA 1AE5A 2JETC 1LCYA 2ZPQA 1DWEH 3ZVGA 3EDXB 2SGDE 3GDUA 4BANB 3GY8A 4KP0A 3UTUH 1V6DA 1W7GH 1A5GH 3D65E 8ESTE 4XFQA 2CHAB 5DP5A 1V2PT 4B6EA 2BXTH 1Z6JH 1QCPA 1GBTA 1YCPM 1P3EA 4BTIB 3LKWA 3C27B 1BBRK 1EJNA 1PPHE 3TJVA 1GJDB 5F03A 1C1UH 1MU8B 5J4SA 4KKDA 3SYJA 5AFYH 1C5TA 2GZ9A 4P00A 2VWLA 1A5HA 1G2LA 3HPTB 4J1YA 1O38A 2ZDVH 1EAXA 1J8AA 4TWWA 1W8BH 5CHAB 4AGKA 1PPBH 2BDGA 3URCA 1GDQA 1TBRH 1T8NA 2V7QD 2G5VA 2F3CE 1MKXH 1LKAA 1O3HA 1Z1JA 4FVDA 8KME2 4A1VA 4IW4E 1W0KD 1UCYE 1GI6A 1UK3A 2PR3A 1OS8A 2P95A 3PRBA 2ILNA 4AN7A 1PQ5A 1A3EH 4BAQB 4ZXYH 1EJMA 3SZEA 2LPRA 5FPTA 2YOLA 2PSXA 2RDEA 2FZZA 3E90B 3VGCC 1FPHH 1V2JT 1QR3E 2PUXB 1NRNH 2GCTB 3M7TA 2ANMH 1SGPE 1ZTKA 2BD3A 2BVRH 3ZZ9A 1HAYB 2OCVB 1EP5A 5EG4A 4AFUA 2R0LA 4WVPE 3RC4A 2SGAA 4GVUA 5JB8S 3N99A 3BTWE 4KTCA 1HAZB 1HIAA 5L2ZH 1AFEH 3TVJB 1TOMH 1TMUH 4RN6A 1AFQC 1W0JD 1NM6A 2FO9A 2FOCA 1UTOA 3F2HA 1QFKH 1RIWC 1E38B 2RFKC 2JJ2D 1DWCH 1NS3A 2ZI2H 1SGDE 1O5BB 1AVGH 1ZJDA 2A31A 4FUCA 3O8CA 3A88A 5EIYA 1GBAA 3U69H 8LPRA 4ZAEA 4XOJA 1CVWH 2F4LA 5CHBA 4WH8A 1C9PA 1JMOH 1LVOA 2A2QH 3PMBB 1D6RA 1O5EH 4NWKA 1SVPA 1SGQE 1SGRE 4X2YA 3VXFH 2PWXA 1HDTH 5BRRE 1FAXA 3D62A 1CBWB 1YWUA 3Q76A 4B71A 4X6OA 2Z3CA 3SUFA 3UNQA 1O3EA 2Y7ZA 1ZPZA 1EOLA 2FI5E 3N7EA 3AAVA 3SGAE 1NO9H 2KCAA 1FIZA 4X1QU 1N8OC 2QF3A 6GCHF 1NT1A 2VIDA 3M5MA 3K9XB 4I31A 2F9UA 5EQRA 1AUJA 3Q3KA 1KXDA 3PV5A 2VBCA 1GBFA 7ESTE 1P05A 4IMZA 3MI4A 2VIQA 2C90B 3LGIA 4YOGA 1HAIH 3QN7A 4YXWD 1Y8TA 2P93A 1AIXH 1C5VA 2XTTB 1GHZA 1BHXB 4YESB 3RXPA 1QL9A 1O2KA 2ZQ1A 2G4UA 9ESTA 4K1TA 1ZRKA 2BVSH 4JMYA 4DGJA 1BRAA 3OEED 2V3MA 4NA8A 1VITF 5FCRA 4IC6A 3FOAA 2FOHA 4ISHH 5CHAC 4CHAB 1TX7A 1HNEE 1MTWA 1GVLA 2G8TA 1DY9A 1K1OA 1C1PA 2RG3A 4TT3D 1JWTA 2R0KA 5CDFE 2TIOA 3O8BA 4CH2B 1QRXA 5CMXH 1WQVH 1T8LA 1WAYB 2K1QA 2WYJA 1KTTB 2RCEA 1BTHH 3E91A 3U9AH 2AYWA 3A7ZA 3DSPA 5EOKA 3SQHE 1DANH 3E0NB 3TJOA 1ACBE 1TPSA 2PKSB 1A0JA 3U8OH 1J15A 4CRFA 3ZYDA 2G00A 3SW2B 2A0QB 2FTLE 3G01A 4JYTA 3GCOA 1KLIH 3P8NA 4HG6A 2O8LA 1UTKA 3SU3A 4E06H 3VB5A 1JBUH 2GDEH 4CRAA 1TPOA 1OYQA 2CK3D 2ZGHA 2ZGBH 2Q6GA 4XD7D 3STIA 1KYNA 3ZZ3A 4Q7YA 2AGEX 4JZ1A 3MMGA 3BIUH 5EPYA 1HUTH 4RKOB 4AORA 1TNIA 2IJD1 2EA3A 1C2DA 1DM4B 1P12E 1V2TT 1Z1IA 2C8ZB 4ZMAH 1TMTH 1LDTT 2A4QA 3GCNA 1SGTA 3EA8A 3DD2H 3GS9A 2Z9KA 1C5RA 1D6WA 2EQNA 2P8OB 2ZPSA 3ZZ6A 1SPJA 1C1QA 2FX6A 3BEIB 3FO8D 4Q63A 1TNGA 1SHHB 1IHSH 2GKVE 1AU8A 4YZUA 1DUEA 1UCYK 4KTUA 5EJLA 1FV9A 1HAHH 1BJUA 5HYOA 3OFND 1PFXC 1CT2E 1O5AB 1BT7A 1FY5A 2GMTC 1JRSA 4ASUD 2M2AA 3RXTA 1Y3VA 3GYMA 3NXPA 4MQAA 3PMHB 1TRYA 2B9LA 3NKKA 2SGEE 4BAMB 1X7AC 4JZFH 1C2HA 3GY7A 2QE7D 2XRCA 1WXRA 2GZ7A 1GI8B 5FCKA 1K0HA 2C8YB 4CBOA 4DCDA 3MNSA 1W10U 5T6DA 1XUKA 3EA7A 1QY6A 2FYRA 5FBEA 1G36A 1EKBB 1BZXE 1GJBB 1O2UA 5IYTA 4B6FA 3GY5A 1O33A 1B7XB 1O30A 4NIWA 1P02A 1O3DA 2XYAA 3OTJE 2ZGCA 1EOJA 1LHEH 4FUFA 1V2VT 1LO6A 2WPLS 4D7FA 5C1UA 1O3JA 5E0JA 3UOPA 4CHAC 2ZHEH 1L4ZA 3LGWA 3F6UH 2GJGA 2L6OA 2OD3B 1YKTA 4M7GA 1MTUA 4X1RU 1S6HA 1HJAB 2OC7A 3KN2A 3U1IB 3UNRA 5F8ZA 2PHBA 5LPRA 3LJJA 3TPIZ 3D49H 4YO9A 4BNRA 2UUFB 3A7VA 3BTKE 2ZPRA 2PKSC 2TGTA 2WV5A 5E2PA 3ATWA 4FXGH 1ELCA 3SGQE 5DP8A 1QQ4A 4ZHMU 1YYY1 2G52A 1AKSB 4WMFA 3RU4T 1G3EA 2ZFTA 3A7XA 1Z8GA 1DS2E 3T28A 3JZ2B 1ELAA 1ETRH 1DDJA 1K2I1 2WPJS 1EQ9A 4CRBA 4UFEH 1UVOA 1ELDE 1YGCH 1AWFH 2ALPA 4QT8C 5TCCA 2BY6X 1O39A 2H2ZA 2BQWB 2W26A 1AVXA 4YOIA 4INHA 1XX9A 2H5DA 3F9FA 2ZFQH 4B2AA 5DKMA 1TPPA 1EFRD 1YPKH 4X1PU 1GI2A 1WBGB 4X8TH 1MBQA 5FX6A 1O37A 5DP6A 2ZU2A 1FX0B 1MCTA 1Y5BT 4YTAA 3TNTA 1EJAA 2BDIA 1BQYA 2BY7X 2OBOA 3SZNA 2XBYA 4FU8A 4F48B 1GHVH 2PKAB 2ANWA 1NZQH 3A8CA 2K0QA 5TCAA 3PRDA 3MU8A 1SQAA 2AMPA 3TH2H 2FOFA 3T26A 1BMNH 1TGBA 4H6SB 5ESBA 1ZRBA 2LP6A 4MLFB 1A61H 1HV7A 3UFAA 3VB7A 4K8YA 2UWOA 3PB1E 2Y5HA 4FVBA 1NFWA 1EB1H 2FX4A 2A5AA 1DITH 5DPAA 5A2MH 1O2QA 5C2ZA 2P59A 3TK6A 1FY3A 1EATA 1W2KH 2ZU4A 4AGJA 2GV6A 3SNAA 1ANEA 2FODA 2Z3DA 4X6NA 5FPSA 4D76A 3V13A 5F6MA 1Z8RA 2VIOA 1UVSH 1BCUH 1GVKB 3SJKA 2ZDMA 2PFEA 5DSFA 1H8ED 3UQVA 2W3IA 1XUGA 3HK3B 1BMAA 2XC5A 3KGPA 4Z1MD 5F53A 3PROA 1GI5A 1AN1E 3LOXA 4TSFD 4AZ2B 4Y8ZA 3TK5A 3M37A 2WPDD 1D3TB 4A5TS 2AERH 3BTTE 1E36B 3LGTA 2BQ7B 1FPCH 2F9VA 1MCVA 2R3YA 2R9PA 2BD4A 3TNSA 3M3TA 3ZZ8A 1P3CA 1DT2A 2FLRH 1YBWA 1PPZA 1YF4A 5C17A 1BRBE 3SI4H 4WXIA 3C1KA 1DVAH 1V2ST 1ZHMA 5LH8A 2VGCB 9LPRA 4Z6AH 1KXBA 1H1BA 2ZZUH 1K21H 3E1XB 3EQ0H 1OWKA 1Y5AT 4MNVA 1P10A 4WMEA 2CMYA 1TB6H 4ZKNU 1HAOH 2FOMB 1INCA 4OS6A 4UFDH 2FS9A 4FUBA 1ELEE 1GJ7B 2HLDD 2QXJA 1QB9A 1NU7B 3GY4A 1IHTH 4MNWA 3KL6A 2EEKA 1ETSH 3MO6A 1KDQB 1LVMA 1FONA 3F0PA 4IN2A 2AIQA 2JH5D 5EPNA 3BF6H 1Z6EA 1MKXK 1VJ9U 1O35A 4B76A 4WWYA 4X2WA 3QLPH 3F9GA 1BTPA 2PW8H 1IAUA 3TGIE 2Z6BD 2ZO3H 4B75A 4H6TA 2RA3A 1LPZB 1XXFA 2XBVA 2BY8X 2QN5T 1S84A 1GHXH 1K1MA 2NU2E 5ETXA 2V3HH 2GT8A 4Y11E 7GCHG 3RXLA 1GHBG 1QL7A 1TNHA 3FZZA 2ZFFH 4ACAA 2VH0A 3EGKH 1O3IA 2BM2A 3RXSA 1CU1A 3L3TA 2R2MB 5AFZH 1HB0B 2ZGXH 2XCNA 1C4V2 4P02A 2ZHFH 1IQEA 2XNIA 1S83A 2Y7XA 3B9FH 3SQEE 3ITIA 4E7RG 1HAVB 4RSPA 5JDUB 4X8UH 4FU7A 3RMOH 2A45B 1SLWB 2Y81A 1MBMA 2FS8A 1GBHA 1IQNA 4JK6A 4AG2A 1M9UA 3KYFA 1K1PA 4Q2KA 1SGYE 2ZEBA 1ZYOA 3TJNA 1ZMLA 4ZHLU 2ZDNA 1G9IE 2J38A 2STAE 2GDDA 4Y7BA 5K0HA 1GPZA 5KECA 2BB4A 3P8FA 1OYTH 1G3BA 1SOTA 3QDZB 1GG6B 4MNYA 2HOBA 1TFXA 3ZZ5A 1EASA 4TWYA 3V12A 4NA9H 4A1TA 2ZHQH 1W13U 1C2FA 1SLVB 1XMNB 1QB6A 1GMCF 3RXAA 5EW2H 1RTFB 2OLGA 3TU7H 1VGCB 1EZUC 5E2OA 3ZZDA 3DFJA 2WUCA 1P2OA 1Q31A 4MPVA 1QNJA 2DE9A 5B6OA 1O3CA 4LK4A 1Y59T 3SNCA 3SJIA 1DLKB 4HGCA 4I33A 5JB9S 1QZ8A 2OTVA 4BAOB 8GCHF 2NU4E 3RUOA 1VITG 2GD4B 1QRWA 1WCZA 2XWBI 2P16A 2DE8A 3ZZCA 2O8MA 2HLCA 1OOKB 4WJG2 1Q2WA 1IQJA 3P8OA 1GWAA 3SU5A 1GBEA 1GJ9B 3OTPA 1QRZA 3ZV8A 2AGIX 1RTLA 3SNEA 2ODYB 2P3TB 1O34A 1MAYA 2AIPA 1E0FD 4TY6A 1RFNA 3GCTF 3RXJA 3PLKA 1O2LA 2AH4X 3F0OA 4GLYA 2QF0A 1TBQH 5E0HA 3PO1B 2PSYA 2WHXA 3RXUA 2KCPA 5K7RA 2TGAA 1HJ8A 1O2SA 2FWWA 1UVPA 2Z9IA 4A1XA 3EE7A 3T29A 4ISLA 1V2LT 4AOQA 1MD8A 3BTHE 3OX7U 2QGRA 1CA8B 4O9VA 1FUJA 1HXEH 4I7YH 1AHTH 1NTPA 1ZHRA 3MFJA 4XBCA 2FYQA 5HGGA 2BDHA 4Y8YA 1ZLRA 1DUAA 2A2XH 1V2UT 3PWBA 3RM0H 1QB1A 4O03A 3RXGA 4ZHAA 3UWIA 1DY8A 3MQKC 5EXNA 3RM2H 3SHAH 1HCGA 3H5CB 1AVWA 1ZSKA 3LDXH 4BTTB 1KY9A 1L4DA 3QWCH 4R0IA 3LGVA 3IITA 4ABJA 4B1TA 3F2FA 2HVYB 1ARCA 1SGFA 2A1DB 1H4WA 3FANA 3H7OA 2BLQA 3U8TH 1MAXA 2PP6A 1T4VH 1H9LB 4Q80A 1MUEB 2VINA 3SHCH 3V7TA 1O2GH 2FMJA 2C93B 1J17T 1LHGH 4IMQA 3KQEA 4A6LA 3IWMA 3M5OA 1WDIA 1ZSJA 1IQIA 2RA0A 1CT4E 4B2CA 3BV9B 3BEUA 4CRGA 5DGJA 1MH0A 3UB0A 4GHTA 1O3FA 1JXPA 2J9NA 4HTCH 2WZQA 4OS4A 2ALVA 4X1NU 1GHAF 2XXLA 3Q00A 2ZF0H 4K69A 4Y0ZE 3W95A 1FDPA 1T32A 1Z8JB 2W6JD 2CHAC 3LT3A 1C1MA 1BBRH 5J4QA 1OWIA 4LOYH 1T8OA 2CGAA 4AYVB 3PMJA 2BY5X 3ATIA 3F9EA 3BTEE 2ESTE 2XBXA 1P11E 1YM0A 1VGCC 1EAWA 1GBIA 3GISB 1RS0A 1F5KU 1LHFH 2Y80A 2AHME 3P92A 1XUIA 3M7QA 1CE5A 2F43B 4WH6A 1H9IE 3SJ9A 1ELVA 4HZHA 5TJXA 2VVVA 1ZZZA 3TLOA 3ZVAA 1FI8A 4Y71A 3F2GA 2BLVA 2JKHA 1SOZA 2J94A 2FOGA 2SGFE 1G32B 1MKWK 4JK5A 1GMHF 4MNXA 3MNBA 3QGNB 2C3SA 2QIQA 2YMSB 3A7WA 2TPIZ 1PPGE 1T8MA 2I6SA 1UTQA 5HIZA 3ODDA 2FI4E 3MH5A 1KXCA 3EA9A 7LPRA 1AI8H 1TGCA 2JDID 2OQ5A 2D8WA 1C2IA 2GCTC 4JYUH 3N7DA 1PQ8A 1ELGA 1GMDF 2VB0A 1ANBA 2B7DH 3PM3A 1BB0B 2FLBH 1XXDA 5HXFA 1TGTA 3PO1C 1A4WH 3ZVDA 2ANKH 1KXFA 1WV7H 3U1JB 1EP6A 1YCPH 1MZDA 2ZA5A 4K8BA 5HM9A
chains in the Genus database with same CATH topology
2FPZA 1DFPA 4U01A 1FN6A 2EI6A 3A82A 2G4TA 4CR5A 2NU0E 4CRCA 1BDAA 4I8HA 2UWLA 5CE1A 2C8XB 1HGTH 4ZKOU 1O2WA 1SQTA 5C3NA 3MWIU 4ISNA 3UIRA 4ZXXH 2B0FA 1O3GA 4Y76A 1UVTH 4Y8XA 2H6MA 4Y6DA 1O3KA 3SNBA 1O3MA 2NU1E 3R0FA 3U98H 1BHXF 2BDCA 2IJOB 4Q7ZA 2KAIB 1NC6A 4FUEA 3RMLH 4ASHA 1OWEA 2BX3A 1HAXB 3QTOH 2FXRA 3BN9A 1QA7A 1O2NA 4B74A 1O36A 1BITA 1DWBH 1GCTB 3L33A 2VWOA 5AVDA 4VGCB 3RXVA 3A80A 4H42U 3SUEA 1BOQA 2FEQH 3RXQA 1DSUA 1CBWC 2VH6A 3MU4A 2V3OH 1NRRH 1TA2A 1O2MA 4DURA 1O2HA 1P03A 1OWDA 1FZZA 2Z94A 3BG8A 5GCHF 4Y79A 4BAKB 4O3UA 1GVZA 1EB2A 2XC0A 2P94A 1TIOA 3MO9A 1P2NA 5C67A 2G5NA 3A87A 1ZOMA 1C5UA 2IPHA 2M5TA 5EW1H 1HAGE 4NSVA 2XC4A 5GWZA 1AUTC 1FIWA 5FXLA 1O2ZA 1Q3XA 3BG4B 1N1LA 5A09A 2ZG0H 3FZDA 1IQLA 3Q3XA 4ABHA 3A8BA 1GBCA 1T7CA 4IBLH 3RU4E 1Y3WA 1GGDB 4GCHG 1QJ6B 1C5SA 2BHGA 3ESTA 1F5RA 1WOFA 1J14A 2BDYA 3ZZAA 3A84A 1YC0A 3BTFE 3UNSA 3SN8A 2JH6D 1F7ZA 1HAPH 3UREA 1C2LA 4YLUA 3F68H 6CHAB 1XUJA 1ZTLA 2VWMA 4ABEA 4NZLA 1SL3A 4I8GA 3EE0B 2XW9A 1VCPA 3NPSA 1AKSA 1C5PA 1BJVA 3S9CA 2FI3E 2PUQH 4K60A 3FP7E 4ESTE 2OINA 1O31A 1TWXB 5EQSA 3S0NA 1IQFA 2QXIA 1LVBA 4X8VH 1S0QA 2B8OH 2STBE 3CENA 3DT0H 1WQSA 4GPGA 3GCHB 1W14U 2XWAA 3PLBA 2QXGA 1JRTA 2R2WU 3DHKH 4XSKU 3VFEA 1WTGH 1AZZA 1QIXB 3I29A 2GT7A 1EAIA 4NIXA 3K6YA 3S9AA 4ZUHA 3FFGA 2VIWA 1NY22 1QGFA 4SGBE 2W7SA 4YOJA 4Q7XA 1XUFA 1Y3YA 5DK1A 4D7GA 2O8TA 4Y0YE 1DWDH 3RP2A 4BOHA 3M35A 3QK1A 2NU3E 1GJ4H 3VB3A 3M3SA 3BTQE 3BSQA 1VCQA 1XVMA 3TGJE 1FQ3A 4DIHH 4D9QA 3RC5A 1JOUB 1B0EA 1QJ1B 2SNVA 4INKA 4WMDA 2HNTF 1KLTA 1FNIA 4ABIA 1QURH 2P8OC 4GUXA 1C5NH 2GCHG 4TPYA 1V2NT 2H1UA 1ANCA 1SFQB 3I78A 3TH4H 3UPEA 3A7TA 5C5OA 1DE7H 1GBJA 1CHGA 1GCTC 1Y3UA 5SGAE 2LNCA 3GYLB 5DG6A 1LHDH 1FXYA 1EPTB 1CHOF 2OC1A 4LXBH 1BBRE 4XBBA 3RXCA 1C1SA 1GHWH 2A4OA 3MU1A 3AASA 1FY4A 2H9HA 1AE8H 1C5YB 1KLJH 1TMBH 2ZC9H 4AX9H 1XUHA 1SI5H 1NN6A 3MOCA 2FIRH 1OP2A 1SSXA 3KQBA 1CA0B 2ODQA 3MH7A 4AFZA 2WINI 2AMQA 3ZVBA 1CGHA 2QXHA 3BG4C 1V2OT 5C5NA 3ZVFA 1C2JA 1W0YH 3A8AA 4DIIH 1XVOA 5AF9H 1C5ZB 1TX6A 2PGBB 1ESBA 2DUCA 1MTNB 2VWNA 1SG8B 1GGDC 2GZ8A 3E8LA 3HKJB 1WU1A 3OY6U 1N6XA 2PLXA 2HNTC 1PJPA 3SUDA 1EX3A 3PLPA 3ATMA 1C5LH 1QQUA 2Y6TA 2JETB 1NRPH 3JZ1B 5H4IB 2HGTH 4LZ1H 1LMWB 2W7UA 2OBQA 3K65B 3F9HA 3SORA 2OQUA 4E7NA 5DJ7A 2V35A 3MYWA 5GDSH 1GMCG 4K3JA 1K1JA 1O3BA 1SGCA 2HNTE 3A85A 1O3AA 1GJ6A 5EU8A 1B5GH 4DVAU 1NFYA 1HJAC 4BAHB 1A7SA 3S7HB 1NRQH 2QY0B 5A0CA 3LC3A 2F9PA 4X8SH 1EZXC 3QGJA 2ZECA 3O8RA 2BD8A 2ZIQH 2ZFSA 1Z8IB 1TALA 4KGAA 5DP7A 3M5LA 3RXBA 3LGYA 1MQ5A 2Y5FA 2BX4A 1ABJH 2D26C 3TH3H 3AW1A 3P17H 4ISIH 5IDKA 1YPHC 1VJAU 2JH0D 3KQDA 3MTYA 5G4BA 2G51A 4E05H 1BA8B 1LVYA 2QCYA 3Q77A 1SC8U 5A0AE 3DFLA 1DX5M 4X2VA 4O97A 3TJUA 1ARBA 4OS7A 1YPHE 3HKIB 3V3MA 4CH8B 1C2MA 1O5CB 1P9SA 4NCYA 1C1RA 5EXLA 3S9BA 1O2IA 3VGCB 2F9OA 2WPIS 3TK9A 3SGBE 2J4IA 1ZHPA 2A32A 1GDNA 3LH1A 5DP3A 1HAVA 1BUIA 2F9BH 3A83A 3ZV9A 1SLXB 1SBWA 2Z9LA 1H8DH 2ZCHP 4MG3A 1P2KA 2OXSA 3ATKA 4AFSA 1C5XB 1ELFA 3GICB 1RIWB 4NIYA 3RXIA 3SU4A 3RLYH 3VEQB 1EPTC 1O2VA 1C2KA 2H9TH 4MTBA 2BY9X 3UQOA 3T5FH 1SR5C 1MZAA 3QO6A 3GDSA 1YLCA 1GI1A 4X6PA 1V2RT 3RXFA 1S82A 2CXVA 5DP4A 3STJA 3RXKA 3WY8A 4U2WA 3KF2A 3NK8A 3BIVH 1L1JA 2A7CA 4JCNA 1EUFA 4MPUA 1CSOE 1C1WH 1UHBB 1YPGH 1UTLM 2OC0A 4F49A 1V2QT 3LONA 4J2YB 4OGXA 3LU9B 4DW2U 1F0SA 3MU5A 1P0SH 1WUNH 2VVUA 3A86A 3EYDA 6GCHG 2WV4A 1MU6B 3SJ8A 5T3HA 4B73A 1BTXA 4ABDA 3SBKA 1O2XA 2OP9A 1N6YA 3SO3A 5I25A 4XE4A 3TIUA 5FX5A 1VITH 5F8TA 4OGYA 3S69A 1PPFE 3M36A 1G3DA 2Z7FE 3RXHA 4WXVA 5E8EH 2FOAA 4ZH8A 2AGGX 4KELA 1P2QA 1C5MD 1RGQA 1GL1A 1O2RA 3P6ZB 1IQMA 1THSH 1TBZH 1BTZA 3URDA 4BXWA 3LIWA 2QYIA 1NRSH 2VGCC 3LC5A 3PMAB 1BMLA 3VXEH 1PPCE 1KIGH 3GDVA 2BD9A 1SQOA 1QA0A 1G30B 1MTSA 1LHCH 1TNKA 2O9QA 4NWLA 1A0HB 1GMHG 1LKBA 2SNWA 4K2YA 1MTVA 7KMEH 4YT6H 1ZPBA 4AG1A 1D3PB 2THFB 3A81A 1CGJE 1QHRB 2V0BA 3UOUA 3CS7A 2Z3EA 4K1EA 5EXMA 5PTPA 1GJ5H 4ABGA 3SNDA 1GMDG 4X1SU 3IG6B 2BOHB 3P70B 2BD2A 1L1NA 1K28D 1SGFG 3MH6A 1RJXB 3KQCA 3W94A 5JBAS 2F91A 4ISOA 1QJ7B 1GCDA 3KEEA 2CV3A 5C1XA 3GY6A 4UEHH 2BD7A 2XBWA 2HALA 4NFFA 4MVNA 2J2UA 1GBLA 2Y5GA 1YCPK 3SUGA 1GBMA 7GCHF 1GHBF 1KSNA 1W0ZU 3A89A 3R3GB 1AQ7A 3UUZA 5HM2A 2Q6FA 4AFQA 1KXEA 3GY2A 1ANDA 4NIVA 2G55A 5FHTA 1RXPA 3RDZA 1KTSB 1TGSZ 3LGUA 1YPMH 1ZSLA 1OP8A 1HIAB 4UD9H 3SU6A 1LQEA 1GDUA 2ZU5A 1ORFA 3HGNA 4ZROA 2D2DA 1G2MA 4BTUB 4AB8A 4FU9A 1UTPA 4HI3A 4K5ZA 3P8GA 5ESTE 3SV6A 2J95A 1O5FH 1S6FA 1BTYA 2UWPA 2BQ6B 1ELBA 4X6MA 5JBTA 2I6QA 2FM2A 5GCHG 2GMTB 1THPB 1GG6C 1P01A 2F9NA 4I8KA 4D9RA 1A0LA 1D3DB 4A7IB 1Z7KA 3GY3A 3MU0A 5ABWA 5T6GA 2WPHS 1DSTA 2FDAA 1W7XH 3KIDU 3PWCA 1LPGB 4U32A 1TQ7B 1DLEA 1MQ6A 3LH3A 2SGQE 1OP0A 1O3LA 4K1SA 1ID5H 2J34A 3Q3YA 1GHYH 3RU4D 5AHGH 1S81A 4Z0KA 1IQKA 3UR6A 2W5EA 1BMMH 2PTNA 3T62A 1GBBA 1UTJA 4I8LA 4H4FA 3M61U 3RC6A 1TPAE 1F92A 3RXOA 1RRKA 2A4RA 3E6PH 2BYAX 3T2NA 4GAWA 4A92A 5EODA 2VVCA 1O3NA 1P2JA 1C4Y2 2NWNA 3ELAH 1SB1H 2EI7A 1O2PA 2ZU1A 1QTFA 1HXFH 5A8ZA 4OS5A 1WYKA 1AY6H 2VJ1A 2F83A 1GJAB 5EGMA 3ZZBA 1C1OA 2BZAA 1VZQH 4UE7H 2AMDA 1O5DH 1QBOA 2BD5A 6ESTA 2FTMA 2Q1JA 2QC2A 5A0BA 2TBSA 1T4UH 4NFEA 1AO5A 2GTBA 2PTCE 3KHVA 3FVFB 2AFQB 1EXFA 1HFDA 1FMGA 4XDEA 1HJ9A 1V2KT 2KAIA 4X2XA 2FP7B 2QA9E 3SV7A 4INLA 1T31A 4TPIZ 4ABFA 5LPEA 1ZPCA 3CS0A 3RXEA 1HYLA 2ZDKA 2VIPA 5A8YA 1AMHA 1K9OE 1WSSH 1RD3B 3NUMA 2CN0H 4WY3A 4ZKRU 3FP6E 2ZU3A 3SU1A 1A46H 2XCFA 3FP8E 3SV8A 3SV9A 2ZCLP 2Z9JA 3RXMA 1TQ0B 1L1GA 1TLDA 3S7KB 4I32A 1WTHD 4ABBA 2BVXH 3EAJA 1AZ8A 1OWJA 2ZKSA 2VU8E 1F0TA 4FUDA 5T6FA 2HPPH 2QAAA 1GI9B 1J16A 2C4FH 1ZJKA 2PGQB 1F2SE 1GL0E 1ABIH 3B8JA 3RLWH 1TABE 2P3FH 1ZR0A 2ZGJA 3BTGE 2ANYA 4LZ4B 1CHOG 1A2CH 1O2JA 1PQ7A 2A4GA 3VPKA 1YPLH 1TOCB 1LPKB 1C4U2 3MNXA 1K1NA 1JIRA 1Y3XA 2ZQ2A 3PV4A 3H7TA 4XBDA 3ZVEA 1G37A 2G81E 1TE0A 1ELTA 1FJSA 1CQQA 1UTMA 3VB4A 3AVZA 4AYYB 4WF8A 1GBKA 4NSYA 1OXGA 2RDLA 1UMAH 4FUGA 1SMFE 4UFFH 1UK2A 1ZMNA 1L2EA 5GIBA 1QL8A 3RXDA 3T27A 1O0DH 1P57B 5FBIA 4DOQA 4JZIA 3M5NA 1O2TA 5JBCS 4I8JA 3DUXH 4THNH 3ZYEA 2BDBA 4DT7B 1KXAA 3D23A 1O3OA 4ZKSU 2C8WB 5FPYA 2UUJB 2OC8A 2ZHDA 1EZQA 2HVXA 2IOTA 2BLWA 1UTNA 1MKWH 2IN2A 1O3PB 1DXWA 1EAUA 1S0RA 3HK6B 3T25A 1O5GH 2ODPA 5JBBS 1BTWA 1P2MA 4UFGH 1PYTD 4DJZB 1A5IA 2YNBA 1UJ1A 1O2YA 3MNCA 4FUIA 1Z71A 1AGJA 2J92A 3ZZ4A 1GJCB 1NPMA 4IGDA 5JYIA 1D9IA 4U30A 2GV7A 1MMJN 3UY9A 5C1YA 2H5CA 1XM1A 4GSOA 3UWJH 1SGIB 2EC9H 4NA7A 1AB9B 1O2OA 1Y5UT 2BMGB 1E35B 2AEIH 1P06A 2GX4A 5C20A 1TYNA 4NGAH 4AB9A 1IQHA 1S5SA 1OWHA 3MO3A 1BRUP 1QBVH 2V6NA 1OX1A 1H8IH 2SFAA 3ATLA 1K1IA 1SGNE 3K6ZA 1AWHB 2FOEA 1P09A 3SJOA 2GP9B 4TYDA 1J9CH 3E0PB 4UONA 1ZMJA 2A7JA 1FN8A 1W12U 3V0XA 3KCGH 4YM9A 1DXPA 3AAUA 1P8VC 2BOKA 1P04A 2UUYA 3PTNA 5FAHA 1EPTA 1NFXA 2ASUB 2BZ6H 1A3BH 2PKAA 3BTDE 1CT0E 3A7YA 4FUHA 1C5QA 1OPHB 2ZTZA 1UCYH 4NZQA 2TGDA 3SU2A 3LPRA 3OSYA 5A8XA 1C1VH 4DY7B 1DPOA 4VGCC 1HPGA 1FY1A 1CGIE 1GI3A 1UVUH 2Z9GA 2BTCE 2TRMA 2TGPZ 5I46H 3TGKE 1YPJH 2O8UA 3GOVB 2HPQH 3K2UA 1C1TA 2ZCKP 3ZZ7A 3BTME 1FAKH 3MHWU 1FY8E 1F5LA 2H9EH 2ZTYA 3NCLA 3M7UA 4SGAE 1GJ8B 3ENSB 1TRNA 1AD8H 1E34B 1C1NA 4CR9A 1RTKA 3QUMP 1GI4A 4O3TA 3SU0A 5LPFA 5F8XA 2YNAA 1E37B 4HFPB 3E3TA 1O32A 5L2YH 3A8DA 1C2GA 1C5OH 1GI0A 3HATH 1G3CA 4RKJB 1P2IA 4DG4A 1YP9A 3L6PA 2ZWLH 2Q6DA 2HWLB 2ZFRH 2CJIA 1YPEH 2HRVA 1V3XA 4IN1A 5L6NH 2WPKS 5GXPA 1PYTC 4OS2A 2B5TB 4JYVH 4GCHF 4JZEH 5E0GA 3OYPA 2UUKB 1FLEE 3FAOA 1LQDB 4FUJA 3PTBA 1L0ZA 1A1RA 1K1LA 4D8NA 3SI3H 3SV2H 3B23B 2ZHWH 3MH4A 2GGVB 2ZNKH 3NWUA 6CHAC 3M3VA 2ZFPH 3U8RH 1PQAA 1SFIA 3LJOA 1BIOA 2BDAA 4MDSA 1TX8A 1ZGVA 2WUBA 2CF8H 1U6QA 1XKBC 4GHQA 1KDQA 1ZGIA 1YLDA 3ZVCA 1JIMA 8GCHG 1VCWA 4IC5A 3CP7A 1OKXA 2ZDAH 1TNLA 4CBNA 3QZQA 3GCHC 2PV9B 1C2EA 1DICA 3QX5H 5DP9A 5L30H 2AS9A 3ODFA 1ZTJA 1NFUA 2A7HA 1IOEA 5GJ4B 1H9HE 5EQQA 1AB9C 2Y82A 5JPMH 4CREA 2O8WA 3BEFB 3OY5U 1LTOA 1VR1H 4Y10E 4ABAA 4PROA 1F0UA 1DOJA 4R8TB 1SHYA 1TONA 1OSSA 3GCTG 6LPRA 1TAWA 4Y7AA 2ZP0H 1W3CA 2QV1A 2ZDLA 3NZIA 5LGOA 2D1JA 2BLOA 1PPEE