1AKSA

Crystal structure of the first active autolysate form of the porcine alpha trypsin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
125
structure length
125
Chain Sequence
b'IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA TRYPSIN
publication title The first structure at 1.8 A resolution of an active autolysate form of porcine alpha-trysoin.
pubmed doi rcsb
molecule tags Serine protease
total genus 17
structure length 125
sequence length 125
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1996-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1aksA00
4JMYA 5HGGA 1ARCA 3SOSA 4HTCH 2UUJB 2BY8X 3HPTB 2VIPA 1EX3A 1V2LT 5H4IB 3D62A 1DUEA 1DWDH 1CA8B 5T6GA 1CGJE 1SGEE 2P8OB 3SV8A 1WQVH 1T8LA 2CGAA 2PTNA 3RXKA 1NTPA 5F8XA 1UTKA 2VH6A 4MNVA 2ZC9H 1ESTA 4AG2A 5AHGH 1GBIA 1QIXB 3SUFA 1O2OA 4Q7YA 4JZEH 2FI3E 1MTSA 2WPJS 4ZKNU 1YPKH 1ZPCA 2BLVA 1ZR0A 2ZFPH 1NRSH 3P8GA 3O8RA 1CHOG 1ZLRA 2HNTE 4NZLA 1V3XA 3EA7A 2KAIA 1C5YB 1W7XH 4WH8A 5F6MA 3ZZBA 1LHEH 4OS2A 2FODA 2A31A 4YOJA 3STJA 1C2DA 1T32A 4BNRA 1RS0A 1ZHRA 1FY1A 2FX6A 3S0NA 2GX4A 4OGXA 5LGOA 2ANWA 1AWFH 3SU2A 5A09A 3M61U 2FI5E 5A8ZA 1BBRK 1FUJA 4OS5A 2F9OA 3LT3A 3T2NA 5C1YA 1SR5C 2A1DB 2H9TH 3D49H 1D9IA 2R3UA 3SJKA 1J16A 1C5RA 3BG4C 3M37A 1AZZA 5HYOA 1MQ6A 1NROH 1GBDA 3V7TA 1D3QB 1MQ5A 2ZIQH 1FY4A 2ZFTA 2HWLB 4MPVA 3T25A 3F68H 3MOCA 1LPZB 2G52A 1EAIA 1ZSLA 1P11E 2R0KA 2BD5A 1GL1A 1AVWA 2IJOB 2J92A 2VVUA 1IQMA 1V2ST 2PHBA 2PR3A 4X1PU 1TGCA 1DDJA 1GJ8B 4F49A 1QA7A 4RSPA 2CXVA 1AVGH 1FAKH 1MKWK 4JZDH 2NU2E 3RU4D 3D23A 3STIA 4K5ZA 1O3MA 1O3GA 1YCPM 3UUZA 5EXLA 2ZU3A 1SGRE 1C1WH 1F0TA 4UFDH 1UJ1A 2ZQ2A 1GVLA 2XC5A 4R0IA 5HM9A 3F9HA 1E35B 1OYQA 7GCHF 1S0RA 2BQ6B 4HZHA 2FLBH 4GHTA 3I77A 1D4PB 1QQ4A 1T31A 3MU1A 2WPLS 3RXLA 1QRWA 3ATMA 3TGJE 2OC0A 3MI4A 4Q2KA 1T8NA 5J4QA 1O3NA 1S81A 2V0BA 2ZFQH 1E0FD 1YM0A 2OC1A 1K1IA 1W14U 2AYWA 1GPZA 2FOFA 1AU8A 8ESTE 2R3YA 1MZAA 1P3CA 4I8KA 4HI3A 3T5FH 3EA9A 3FFGA 2NU3E 2WPIS 1O3PB 3TPIZ 1IQNA 1O3DA 1EQ9A 4NA7A 4AYYB 3TGIE 2PKSC 1SI5H 2YOLA 1HB0B 2ZCHP 4ZKRU 4MVNA 1KXAA 1TMUH 4D8NA 1GMDF 1O2RA 1N8OB 1PPEE 3GCOA 3MH7A 1SGPE 2FYQA 2FESH 2Y7XA 2PV9B 1FAXA 5DO4H 3MWIU 5CMXH 1GHVH 2Z9GA 1TAWA 4SGBE 3TNSA 1G32B 3M36A 1BRAA 2ZECA 2BD4A 2OUAA 3S9AA 1TQ7B 1L1NA 1UVSH 5EXMA 5AVDA 4AYVB 4DJZB 1OPHB 3VEQB 3P92A 3SZNA 4D76A 1BJUA 2WYGA 1C2EA 3EDXB 1EB2A 2CJIA 3V13A 1HV7A 1T7CA 2BZ6H 3TJNA 3BF6H 1H1BA 1SFQB 5DK1A 1V2UT 3L33A 5AF9H 3SI3H 1TRYA 3T27A 4B1TA 1MD8A 1HUTH 1ANDA 1LVYA 1UVTH 3GDVA 1B5GH 1ANBA 1W8BH 3GY8A 2A5AA 3QLPH 2Z9JA 1YPLH 2PLXA 1HXFH 5GCHF 2HNTF 5IDKA 1NU9A 2A45B 1WSSH 1BDAA 2PGQB 1P04A 1A5GH 1KYNA 2EI7A 2OQUA 3OU0A 4K1EA 3ENSB 1RIWC 4AFZA 1Z6EA 1CA0B 1ABJH 1ORFA 2OD3B 3RUOA 2P93A 1NESE 1Y59T 2A4OA 1GMDG 1ESBA 2QXJA 3ZYDA 4J2YB 6CHAB 3P70B 3SJIA 4A1VA 1OXGA 1YBWA 1P2IA 3SV6A 2H9HA 1C1VH 2ZDLA 3URCA 1DLKB 2VIWA 1O3HA 2NU1E 2Z9IA 2AMDA 4BAKB 3CENA 2F9BH 3Q3KA 2Q6DA 3HK3B 3UY9A 4AG1A 3LPRA 2G00A 1G2LA 1O3LA 4OS4A 1K28D 4GLYA 1DT2A 3SU5A 3SV2H 4RKOB 2QA9E 4IN2A 4ZH8A 2M5TA 5T3HA 3HKIB 1ELEE 1BBRE 4NFEA 4B2CA 1ZTKA 1HGTH 3RXVA 3RM0H 1GHXH 4JYUH 2P94A 4XBCA 1HDTH 1RJXB 1PQ5A 9LPRA 5J4SA 1ANCA 2CF9H 5GCHG 3R0FA 4O03A 1P01A 3E3TA 1SHYA 4CRAA 5BPEA 1O2TA 1A2CH 3NWUA 1YPJH 2GZ9A 5E0JA 1BMAA 3BTQE 1FY8E 5ESBA 1TNLA 1O2LA 4AX9H 1GHAF 2G5VA 5A0AE 1C1SA 1L1GA 1RTLA 1EP5A 1W3CA 2CHAC 3U1IB 4CRCA 2AGGX 2BOKA 2C8XB 1OWKA 1EPTB 2LNCA 2GDDA 3PLPA 4KTCA 5CE1A 4VGCB 1C9PA 2Y81A 3RXTA 1K1NA 4K60A 5FPYA 2STAE 3RXJA 4NWKA 1WCZA 2P95A 1WAYB 3QTOH 2ODPA 2FWWA 3NUMA 1BB0B 2A7HA 4CRBA 1MTUA 3M35A 1EAUA 1GI3A 3TU7H 1TMBH 4TYDA 1ELGA 1AO5A 1HJAC 1GI2A 1C5MD 2BDYA 2I6QA 3SV7A 4J1YA 5EW1H 1P0SH 1AIXH 1QURH 4NWLA 1V2QT 1YC0A 1BTWA 3SU6A 5JB9S 2FZZA 1BT7A 1O2WA 1TONA 1G36A 1UHBB 1UTQA 1ELVA 4X8TH 1NRRH 3A88A 1YLDA 3UOUA 2AEIH 5HXFA 3SBKA 4FU8A 1OWHA 4MNXA 3LONA 3SNEA 1KXFA 1CBWC 2QN5T 3OX7U 3ZVBA 1D3DB 4B2AA 3MU0A 1AFEH 1FY5A 1MTNB 4OS1A 5DP8A 2JH5D 1P2NA 1E34B 4X0WU 1XUJA 4ZKSU 2A32A 3S7KB 1QR3E 3NXPA 3M3TA 4FUJA 1GI0A 1ZYOA 3MH6A 1C5NH 3TH4H 1BTZA 2BLQA 1Y5AT 2FTLE 2ZFSA 3UNSA 5FX6A 1BCUH 3E0PB 5HM2A 5JPMH 1O3KA 1IOEA 4HFPB 2A7CA 1G9IE 1BTYA 1YPHC 4ISNA 2BX4A 2BY7X 1P2JA 2WPMS 2TGAA 3S69A 1ZHPA 2ZF0H 3T29A 4ISIH 1K1OA 1BZXE 2BD2A 5TCAA 3AAVA 1CSOE 3GY2A 1GJ7B 1SGDE 3ZZCA 4BXSA 2H9EH 1BBRH 1JMOH 1HIAB 2F9VA 2Y82A 2P3FH 1UK3A 4YT6H 1TA6A 1NFUA 1TX6A 3M7TA 2NWNA 3CS0A 1EOLA 5DP3A 1AGJA 3GY5A 1H9IE 2VINA 1BITA 1TQ0B 1GBFA 3TJVA 2ZGXH 2GTBA 2OLGA 5GIBA 4UD9H 5EODA 4O3TA 3JZ2B 4AB9A 1LPKB 3GCHB 1FV9A 1E37B 4O9VA 4E7NA 3A8AA 1Y3WA 3U9AH 2HALA 4IMQA 2J95A 5K7RA 1YPGH 2O8UA 1LKAA 2P3UB 3SUDA 1O2IA 4CRDA 1IHTH 1CE5A 1DUAA 2AGEX 1W7GH 4MPXA 2R0LA 3C27B 1C1MA 1KDQA 4FVDA 5C2ZA 2VIVA 4K8BA 2J2UA 2F9PA 1LVBA 2HNTC 3M3VA 3IG6B 4ABGA 4WMDA 3SHCH 1O5FH 1H9HE 3FZDA 3DT0H 1DWCH 4K1TA 1MH0A 2UUKB 3SN8A 2AS9A 3MNXA 5DP4A 5EPYA 3KNXA 1SBWA 3FP6E 3ZZ3A 4JK6A 1GMHF 1YGCH 2HOBA 2R2WU 2WUBA 3MO9A 3SHAH 3ZZ9A 2XRCA 3LGUA 2PKAB 1C1OA 3P8FA 1EATA 1ZJKA 1QRXA 1CT0E 1WUNH 4H6TA 4B71A 3ITIA 1ZTLA 2Q6FA 2AFQB 3RMOH 2PFEA 1MZDA 1PJPA 4I8JA 1P10A 1Y3VA 1SLWB 3HATH 5FX5A 1QB1A 2NU0E 1EOJA 2QF0A 3KEEA 1A4WH 3SI4H 2G51A 2V3HH 1QJ7B 1Q31A 1LCYA 1RRKA 1UCYH 1C4Y2 1AFQB 2ZG0H 3ZVCA 1O2QA 1P57B 3PV4A 1A3EH 5JBTA 2XNIA 5FPTA 3E6PH 1UMAH 1JWTA 4ISLA 1OP2A 3A7YA 2Z3CA 1LHGH 3RMNH 1O2YA 1C5TA 1NN6A 3VGCB 1ACBE 2GCHG 4UFEH 2ZHWH 2ZTXA 1DITH 1VGCC 5TCCA 1LQEA 5E2PA 2G55A 1JIMA 4UDWH 3VPKA 3BEFB 3DUXH 3K9XB 1H8IH 1RTKA 3SJ8A 2OC8A 4FVBA 1GI4A 1TPAE 3PO1C 4D7FA 4WJG2 3Q3YA 1H4WA 3JZ1B 1O0DH 1SQOA 1GI1A 3LGWA 2FMJA 1BMLA 2OBQA 1GHBG 3F1SB 1BMMH 4O97A 4R8TB 5LPFA 1C1QA 3B9FH 1B7XB 1QBVH 2ZFRH 1C1PA 1TRNA 1K1MA 1S6FA 3LGYA 2H2ZA 1GHZA 2QIQA 1HAYB 3UR9A 1BRUP 1N6XA 1CHOF 3AVZA 2AGIX 1EJAA 1P06A 5I25A 3BTDE 1MAXA 1J15A 4INHA 3QGJA 3S7HB 4A7IB 1O2JA 2AERH 1GBCA 1Z8RA 4Y79A 1C5UA 4CH8B 1YYY1 2ODYB 1ZOMA 4Y0ZE 3RXOA 3F9EA 5A2MH 2AIPA 1C5VA 1U6QA 2VVCA 4NSVA 4AN7A 2SGQE 2SNVA 1P2QA 1BTXA 2FPZA 1HLTH 5T6FA 2ZGCA 8GCHF 1C5OH 1YLCA 5A0CA 1AKSA 2GT7A 3QGNB 3TK5A 3OY5U 5B6OA 1AB9B 2ULLA 5CHAB 1PPZA 1XVMA 1O2KA 1B0EA 1FPHH 4IC5A 2ZZUH 3EAJA 6GCHG 2HGTH 3DFJA 5GJ4B 2UUYA 3PWBA 4XSKU 1C2LA 1OOKB 2O8LA 3KCGH 4MDSA 1G37A 4I31A 1O2MA 3RXPA 3A86A 1QL7A 1Y5BT 4YO9A 3SNBA 2SGEE 1DLEA 5DKMA 4AOQA 5FBEA 3MU5A 5DP6A 1O5DH 2BD7A 4X1QU 4ZUHA 3RC6A 1MU8B 5LPRA 2Q1JA 1GJAB 1FMGA 1C2KA 3B23B 4Y6DA 5GPIB 1EUFA 3LIWA 4JZ1A 1ZHMA 1O30A 4FUGA 4IS5A 4BTIB 3CP7A 2ZU5A 3EYDA 1O3AA 1NY22 3HKJB 1V6DA 4JK5A 4Q7XA 2QC2A 3BSQA 1GBJA 1C2HA 3RXGA 1N6YA 3UWIA 1QNJA 3TK9A 1GWAA 2O8WA 1TX7A 3KQCA 4B2BA 3VB4A 2GDEH 1ZMNA 3NPSA 4Y7AA 3S9CA 3LC3A 8GCHG 1CT2E 3P95A 1O3EA 4AGKA 4FU7A 2A4GA 3H7TA 2ZNKH 1AWHB 3ESTA 1T8MA 4Y8XA 1T4VH 4AB8A 3O8CA 3P17H 1BUIA 5GDSH 3KQEA 1O38A 4LK4A 1A61H 2AMQA 2GCTC 4JCNA 3M7QA 2PSXA 4DGJA 5C5OA 1GVKB 1DM4B 1L4ZA 1GG6B 2EI8A 1F5RA 2FP7B 1TOCB 1S6HA 1JOUB 2XWBI 1QHRB 1PPHE 2V35A 4ISOA 2GP9B 4MPUA 1A5HA 4Y8YA 5EGMA 1ZMJA 4I8LA 5AFZH 3TK6A 2UWLA 2IN2A 4GHQA 2ZKSA 2Y5HA 1NT1A 1F7ZA 2EC9H 5ESTE 2HPQH 1LO6A 4ZHLU 2AH4X 5JDUB 1ZJDA 4H6SB 3PMJA 3T28A 1W0YH 2ANMH 4VGCC 1GI8B 1L2EA 3HGPA 4ZHAA 3GY3A 2BXTH 1V2TT 1KLIH 5E2OA 1EAXA 4DT7B 1F0RA 1GJ6A 1SFIA 4A6LA 3SNAA 1UK4A 1KLJH 1FLEE 2ZFFH 4LZ1H 2FDAA 2PGBB 5I46H 3UOPA 1GI5A 2ALPA 2G8TA 4Y8ZA 2O8TA 1TPSA 1BTHH 1EAWA 1C1TA 2FOCA 3BTHE 3A7WA 1RGQA 2ZU2A 1C4U2 1SB1H 5JBCS 3B8JA 1QQUA 1LPGB 2ZQ1A 2HPPH 4ZHMU 3MO3A 2ZTYA 1MTWA 1HAZB 3LGTA 5L2ZH 3A8DA 1O34A 1KIGH 2LPRA 4Y7BA 1F92A 1DICA 1C1UH 5FBIA 4X6PA 3U69H 2XBWA 2JETB 3ATLA 1MTVA 4DCDA 1UCYK 5G4BA 3D65E 3QX5H 1VITH 1K1JA 2GV6A 1WTHD 1O5EH 2B7DH 1P2KA 2F9NA 2BVRH 3BEUA 1FONA 3IITA 5PTPA 4XBDA 1SVPA 2K1QA 2F9UA 3LDXH 1Y3UA 5C3NA 1PQAA 1GCDA 4ASHA 3SGQE 1FIZA 4YESB 1YP9A 3MNSA 1UTJA 1O2PA 3KGPA 5L30H 5EG4A 1O31A 1TOMH 1BQYA 2GMTC 5DPAA 1Z1JA 3A81A 1DWEH 5EQQA 1VITF 2BY6X 1O32A 4I32A 2TIOA 3HGNA 1GJ5H 5EPNA 4A92A 5JB8S 2WV4A 4WH6A 1EASA 1PFXC 4YLQH 1YPEH 3NCLA 3TLOA 2ZPRA 1RXPA 2CMYA 4ZROA 1DXWA 1D6WA 3LC5A 1TFXA 1XVOA 5EW2H 1CT4E 5C5NA 3M5LA 1PPCE 4CRGA 1NM6A 1SOZA 3MU4A 1XXFA 2Y7ZA 3ZZAA 4THNH 3TH2H 2RDLA 4LZ4B 1M9UA 1Z71A 2B0FA 1TPOA 2D8WA 1GI7B 2ZDAH 5F8ZA 1AE8H 1G2MA 2OCVB 1P8VC 1KXEA 4DG4A 1Z7KA 1VITG 2BOHB 1N1LA 4GUXA 4YOIA 4IC6A 3LU9B 2XBYA 4UFFH 4FUEA 5A8YA 3VB7A 1O2UA 4ZMAH 2HVXA 1TPPA 1K2I1 4ABBA 4DIIH 2BM2A 1WTGH 4F4OC 1JIRA 2H5CA 4CBOA 4B73A 2BDBA 3QUMP 2I6SA 2VGCC 3AAUA 3PLBA 1KXDA 1G3DA 1TX8A 2UUFB 4TPYA 2W3IA 1O2HA 1S83A 1UTOA 2VB0A 2F3CE 3F9FA 4IBLH 2A4RA 3TVJB 4WF8A 1A5IA 1SQTA 3GY6A 4JZFH 5K0HA 1BTUA 3BG4B 1JRTA 3PMBB 2ZPSA 1GGDC 1TNKA 4ABJA 1UVOA 1D6RA 1ELDE 2RCEA 4BTTB 3GY7A 4WMFA 1MCVA 1H8DH 2TGTA 3I78A 1WOFA 1GMCG 2RA0A 1NRQH 4U30A 8LPRA 2VWLA 3QDZB 3GY4A 1NRNH 4ABDA 1F2SE 2Y80A 5E8EH 1QTFA 1CGHA 3KN2A 1GCTC 1HAPH 4QT8C 5EU8A 3RXIA 3MNCA 1UO6A 1EXFA 4X1SU 4ZKOU 1ID5H 1P9UA 2BY9X 2FOHA 4WWYA 3HK6B 1EJMA 2QXGA 3UPEA 4TWYA 4ABAA 1FN8A 1GI9B 3IWMA 4ZAEA 5BRRE 4TPIZ 3RXEA 5JYIA 1KY9A 5F8TA 1ETRH 1L4DA 1DFPA 1S82A 4DVAU 3QWCH 1NS3A 1VCQA 1G3BA 6LPRA 1SGNE 2QXHA 1ZRBA 1TYNA 2FS9A 1J8AA 4O3UA 1QY6A 1HAHH 3DA9B 1DVAH 1V2MT 4B75A 3EE0B 1XM1A 1AE5A 2OP9A 5A0BA 2W3KA 1ELTA 3VB3A 4BAHB 4YOGA 5HMAA 2ZGJA 3ZV8A 1UCYE 2XYAA 2FEQH 4OS7A 2A7JA 4CBNA 1HNEE 1EPTA 1MAYA 2OC7A 4X2YA 1KXBA 2GV7A 1O33A 4DW2U 3V3MA 2PKSB 3MH5A 2V6NA 1IQGA 2PUXB 4GCHG 2SGFE 5C20A 4CHAC 1Z8GA 1IQHA 4TY6A 1SGTA 2WYJA 1TABE 3UWJH 1V2KT 5GXPA 4ABFA 1G30B 3RU4T 2A5IA 2ZCKP 1OSSA 3A80A 4Y11E 1K21H 4GVUA 3FP7E 3UNQA 3M5OA 3K65B 3VB6A 1V2VT 2ALVA 3A7TA 1XUIA 1EJNA 2GVFA 3MU8A 5EQSA 1HAVB 1NFXA 2RG3A 2SGPE 3BN9A 1NZQH 2SGAA 1C2JA 3EA8A 4LXBH 3RXRA 2Z94A 3W94A 1GHYH 2BLOA 5JBAS 1DWBH 1UHBA 2W26A 1O5BB 1FJSA 3M5NA 2P8OC 4XDEA 3SJ9A 3GICB 2NU4E 2DUCA 2W7SA 2TBSA 4FUFA 2BX3A 1BHXB 1DE7H 2BVXH 1C2FA 1ELBA 3QZQA 4YLUA 1VJ9U 1RIWB 3SUEA 1S5SA 1SLVB 1DY8A 3P8OA 2Y5GA 1TWXB 2AMPA 2BD9A 2EA3A 1BTPA 1JRSA 4RKJB 1DXPA 2BTCE 4Y76A 2UWOA 1ETSH 2FTMA 5FCRA 2GZ7A 1P02A 1X7AC 2VWNA 5E0HA 4Y10E 5T6DA 1XUHA 1C1NA 1BRCE 4IN1A 3LGVA 3A89A 3GDUA 3A8CA 1SSXA 3ATIA 1ZGIA 1NPMA 3KHVA 4TY7A 2OXSA 2Z7FE 2GCHF 1SGCA 3ATWA 3O8BA 1AQ7A 4WXVA 3SU4A 2FOMB 1GVZA 1HIAA 1TNGA 3BTGE 4GAWA 2ZCLP 4X1RU 1C2MA 3F9GA 4IW4E 2Z3EA 1FQ3A 1LHDH 1BRBE 3OSYA 1O2SA 2VIDA 3LKWA 2YNAA 4A5TS 1OWEA 3SU0A 2XC0A 4Z6AH 1GHBF 3VB5A 3QN7A 2VWOA 3NKKA 1DY9A 3SNDA 4TWWA 1AI8H 1E38B 2XXLA 2XCFA 4U01A 1ELAA 4Q80A 1MUEB 2BXUH 4X8VH 3ZZ7A 2CHAB 4E05H 1HPGA 4WY3A 1IHSH 3ODFA 3GCTG 4MNWA 1C9TA 5E0GA 1WV7H 1G3CA 3M3SA 3BTWE 2Z3DA 3SGAE 3OTJE 4BAQB 5A8XA 3PLKA 3TGKE 3N7OA 1AZ8A 1IQJA 3SU3A 4OS6A 2C93B 1YCPH 2GGVB 2VWMA 3RLYH 1TNJA 1ZSKA 4I7YH 3MYWA 1ELFA 4BAMB 3MO6A 3UQOA 1QFKH 2IPHA 2ZU4A 4AFQA 1HJAB 2CN0H 1Z6JH 5ABWA 1JXPA 1O5AB 1SOTA 2ZDNA 2PKAA 1DS2E 1OP0A 3U98H 1V2OT 3RP2A 1QRZA 1UVPA 2ZGBH 1Y3XA 5C1XA 3FANA 1A7SA 1UTMA 4KTUA 4E06H 4GSOA 1THSH 1HAIH 2THFB 3TJUA 6GCHF 1O3CA 3A7XA 1GJ9B 1CVWH 1DPOA 1DANH 1Y3YA 4CR5A 2FIRH 2BMGB 1C5SA 2TGPZ 1P05A 3EQ0H 3SQHE 3ZZDA 3KIDU 2B5TB 1C5ZB 2J4IA 5JBBS 2J34A 1CBWB 7KMEH 1N8OC 2BDGA 2FOEA 2F83A 4NG9H 2CF8H 3PM3A 1EKBB 2DE9A 3EGKH 1PQ7A 1Z1IA 1S85A 2EI6A 1A1RA 2V3OH 2DE8A 2ZGHA 3SW2B 1ZMLA 3MTYA 1GBMA 5ETXA 1VJAU 2KAIB 1GI6A 4YT7H 1IAUA 3A87A 2OBOA 2BZAA 2C8WB 1PPGE 5LH8A 3C1KA 4X2VA 4X1NU 1L0ZA 1O2NA 1W10U 3CS7A 4NIYA 2VNTA 1HAOH 1CGIE 2ZHEH 1TNIA 3ODDA 4K1SA 1ABIH 2FI4E 1HAGE 3RXQA 3R3GB 1UK2A 5DJ7A 4KP0A 3U1JB 4YZUA 1C5PA 1FPCH 1C5WB 1EZUC 1Q3XA 1D3PB 3A7VA 1GDUA 2ZU1A 2FLRH 3M7UA 1NC6A 1P9SA 1OWDA 3OYPA 1CA0C 3TNTA 1J17T 3RXHA 3U8OH 5DGJA 1ELCA 1Q2WA 2WPKS 6CHAC 4NA9H 1XKBC 1FY3A 2GT8A 4ISHH 1NRPH 2WPHS 2XC4A 3ZVFA 4XE4A 1SMFE 1NFWA 3Q76A 4D9QA 1WYKA 4XOJA 4UE7H 4KGAA 3LGIA 4UFGH 2ZHFH 4MQAA 1PQ8A 4FUCA 1V2WT 2UWPA 3ZV9A 1SG8B 3LJOA 1O3BA 2A4QA 5FAHA 1Z8JB 3QTVH 3SU1A 2QY0B 1VCPA 1OS8A 1BOQA 5FXLA 2QYIA 3BTKE 1WBGB 2TPIZ 2BDCA 2CV3A 5LPEA 1MMJN 1QL9A 1TGNA 1LQDB 1GJBB 2BDHA 1MKXK 1OP8A 2BLWA 2J38A 4X6NA 5L2YH 2XWAA 1KTTB 2XTTB 2GZ8A 1SPJA 1LTOA 3KQDA 4I8HA 3TH3H 3A82A 2FOAA 5F03A 1TBQH 1UTLM 3GISB 3V12A 1O2XA 3PTBA 1A3BH 1LKBA 3FZZA 4WMEA 2ZDVH 2P59A 1CHGA 2D1JA 1EPTC 1HJ9A 3BTFE 3PB1E 3E1XB 1W12U 3MNBA 3SV9A 2P16A 3RXCA 1F0SA 2W7UA 4IGDA 1MU6B 1J9CH 1INCA 1WU1A 1FNIA 4SGAE 4FUBA 3K6ZA 2Z6BD 1EP6A 2FM2A 1FZZA 3K6YA 2SFAA 3DHKH 4MNYA 2TGDA 4A1TA 1O3FA 2VH0A 1TGSZ 1YPMH 1TB6H 5L6NH 1GBBA 3PROA 3RXMA 2SNWA 3I29A 1VGCB 1QBNA 3ZZ8A 1MCTA 1GBHA 2GKVE 4E7RG 2TRMA 3E90B 1SC8U 2ANYA 2PW8H 1HXEH 2ASUB 5EOKA 4BANB 1O2GH 3PO1B 5DP7A 3SUGA 4MTBA 1TBZH 1HRTH 1O37A 1XUKA 3F6UH 4AZ2B 2XBXA 1MBQA 3OY6U 1O2ZA 1EZXC 3H7OA 3ATKA 2ZPQA 3URDA 4WXIA 4NIVA 4YTAA 4BTUB 1KLTA 1YCPK 3QK1A 4X8UH 3PTNA 3O8DA 1K1LA 1S84A 1MTNC 1LDTT 1C5QA 1B0FA 1SGYE 2FS8A 2ZI2H 2SGDE 2HLCA 1O3JA 2PUQH 2ZTZA 2FO9A 1P12E 1NU7B 1O3OA 1P2OA 1BJVA 3RM2H 1TGTA 2Z9KA 2B9LA 4U32A 2J94A 1C5XB 1WQSA 4ZXXH 3QO6A 4ESTE 3ZVAA 3RDZA 1YKTA 4X8SH 3BG8A 7GCHG 3MH4A 2BDAA 4FU9A 3H5CB 5FHTA 2HRVA 4KKDA 3RXSA 1OX1A 2A2QH 3E16B 1GDQA 2FOBA 3RC4A 1RFNA 1T8OA 1F5KU 2ESTE 2WINI 2RA3A 3Q00A 1BMNH 2WV5A 2BD3A 2H5DA 3K2UA 4CRFA 1RTFB 1TE0A 4NFFA 1K1PA 1THRH 1HJ8A 2C90B 4NCYA 1SL3A 2IOTA 1EZSC 1IQLA 3E0NB 3NK8A 2ZO3H 3M5MA 1GMCF 3E8LA 1VCWA 2ZDKA 5EXNA 3GCHC 1C2GA 3ZVEA 1V2PT 3RXUA 3DD2H 2H6MA 4BOHA 1GBTA 1HBTH 3WY8A 1SGQE 2AIQA 4BXWA 5TJXA 3PMAB 2ILNA 2C8YB 8KME2 1TBRH 2Z9LA 1IQIA 3TIUA 3U8TH 1Z8IB 3BIVH 1PYTD 3RC5A 4YM9A 3Q77A 3ZVDA 1O36A 3TJOA 1PYTC 2BYAX 3VXEH 1QJ1B 1THPB 4D9RA 2F91A 4GPGA 1OWIA 2JKHA 1AMHA 2VIQA 1VR1H 3RXFA 3RXAA 4JYTA 1OWJA 2W5EA 5GWZA 1W13U 4AFSA 1CO7E 1A0HB 1GL0E 4H4FA 1ZZZA 4CR9A 4KELA 2GCTB 4X6OA 3PMHB 3BEIB 1C4V2 3PYHA 3RU4E 3ZVGA 3UREA 1BIOA 3U8RH 1SLUB 4NA8A 1GJ4H 1AN1E 3P8NA 4RN6A 4GCHF 1TMTH 1V2RT 4FUIA 2G4UA 1DOJA 3A7ZA 3E91A 4B74A 2G5NA 3LJJA 1AFQC 3AW1A 1TA2A 1XKAC 1V2NT 3UTUH 4NGAH 1L1JA 1TNHA 1O39A 3ZZ6A 1ZTJA 1XMNB 3DFLA 1H9LB 2FYRA 3PWCA 1O5CB 4X2WA 1AUTC 1KTSB 1C1RA 1FI8A 3AW0A 1AUJA 1SGFA 2C3SA 3UNRA 7LPRA 3VGCC 2D2DA 1BA8B 1TALA 1LHFH 3RLWH 1FIWA 3FVFB 1W2KH 1O2VA 2R2MB 2EEKA 1KSNA 1SLXB 1K22H 1P2MA 3TITA 2JH6D 3KL6A 1A46H 2QGRA 1QCPA 4K2YA 1GBLA 1GJDB 2BHGA 4D7GA 1C5LH 4H42U 4XBBA 1GBEA 3FAOA 1O35A 2P3TB 4AGJA 3LOXA 4DOQA 3A8BA 1ARBA 1G3EA 1GHAG 3UIRA 1ZPZA 2FX4A 2BQWB 2GD4B 4K3JA 4X2XA 2J9NA 1HAXB 4Y71A 4AORA 3VXFH 1HFDA 4ABIA 5FCKA 5IYTA 2XW9A 1LVOA 1W11U 2YNBA 4U2WA 3RMMH 4DURA 1FN6A 1FDPA 4K8YA 2A5KA 2BD8A 2XBVA 1K9OE 1P09A 2VJ1A 2ODQA 3MHWU 2GMTB 6ESTA 3BIUH 2QF3A 1XX9A 3VFEA 4M7GA 4KTSA 1XUGA 2G81E 2JH0D 4FXGH 1KDQB 3ZYEA 3T62A 2QAAA 2BVSH 2FOGA 1CU1A 1A0LA 2OQ5A 2QV1A 2A0QB 2ZWLH 4FUDA 1AB9C 5CHAC 4INKA 1TLDA 1S0QA 1HCGA 4MPWA 3RMLH 2OINA 1UTPA 1LMWB 1XXDA 1IQFA 1MKXH 4ABHA 1MBMA 1ZSJA 3L6PA 2VVVA 2BDIA 1ZPBA 3GYMA 4K69A 1AHTH 2WUCA 3T26A 2VU8E 1A0JA 2ANKH 2PTCE 2PSYA 2Q6GA 4XFQA 1NFYA 2QXIA 1QJ6B 3GCTF 1DSTA 3SNCA 1TIOA 5DP5A 4Y0YE 4BAOB 4UONA 3SO3A 1JBUH 2O8MA 4Q7ZA 1HAVA 4UEHH 2C8ZB 3ELAH 1ESAA 4HGCA 4JZIA 4LOYH 1QGFA 2A2XH 2Y5FA 1MKWH 2FXRA 4X6MA 2ZEBA 3Q3XA 1V2JT 1ZGVA 5FPSA 2ZA5A 4MG3A 1ETTH 2VGCB 1T4UH 1PPFE 3BV9B 1DX5M 5DP9A 1XUFA 1FXYA 3LH1A 5SGAE 1SGFG 1IQKA 1GBAA 3A83A 2VIOA 1GG6C 1MD7A 1GGDB 1LHCH 4INLA 2ZHDA 4WVPE 4DY7B 2STBE 1Y5UT 2BY5X 1KXCA 1DSUA 1PPBH 1HYLA 1AVXA 4OGYA 3W95A 4FUHA 1AD8H 3GCNA 1QB9A 3ZZ4A 1VZQH 2Y6TA 5EQRA 2C4FH 3L3TA 5DG6A 4I8GA 1ZRKA 1GCTB 3KQBA 1OKXA 2ZDMA 3FP8E 4PROA 2PWXA 3GYLB 1SQAA 1QB6A 4ZXYH 3A85A 3UFAA 3BTTE 1Y8TA 3UQVA 1GDNA 1RD3B 4NZQA 3GDSA 4NIWA 3RXBA 1QBOA 4Z0KA 1TRMA 3SORA 1F0UA 4JYVH 2OTVA 3G01A 2H1UA 4I33A 3GOVB 1GHWH 1GBKA 1O5GH 1EZQA 2O9QA 5C67A 1AY6H 5C1UA 1SHHB 2BB4A 1EB1H 3ZZ5A 4AFUA 3RXDA 5AFYH 1GMHG 1O3IA 2B8OH 1YF4A 3LH3A 1AKSB 2JETC 3SQEE 1OYTH 4A1XA 1CQQA 7ESTE 3NZIA 1QA0A 2ZHQH 1TGBA 2ZP0H 3AASA 3BTME 3UR6A 1UVUH 1IQEA 1UTNA 4DIHH 2BQ7B 2XCNA 1LVMA 1F5LA 1C2IA 2G4TA 2R9PA 1QL8A 1BHXF 1GJCB 4CHAB 2D26C 1J14A 1P3EA 1YPHE 4B76A 1W0ZU 3MMGA 1ANEA 4IMZA 3A84A 2QCYA 4ABEA 4CH2B 3V0XA 1NO9H 1P03A 3SJOA 3BTEE 3MFJA 4MLFB 3S9BA 1E36B 3P6ZB 4CREA 3KF2A 3SGBE 4NIXA 3QZRA 1D3TB 1SGIB 9ESTA 4NSYA
chains in the Genus database with same CATH superfamily
4JMYA 5HGGA 1ARCA 3SOSA 4B6EA 4HTCH 2UUJB 2BY8X 3HPTB 2VIPA 1EX3A 1V2LT 5H4IB 3D62A 1DUEA 1DWDH 1CA8B 4P00A 5T6GA 1CGJE 1SGEE 2P8OB 3SV8A 1WQVH 1T8LA 2CGAA 2PTNA 3RXKA 1NTPA 5F8XA 1UTKA 2VH6A 1KMHB 4MNVA 1H8ED 2ZC9H 1ESTA 4AG2A 5AHGH 1GBIA 1QIXB 3SUFA 1O2OA 4Q7YA 4JZEH 2FI3E 1MTSA 2WPJS 4ZKNU 1YPKH 1ZPCA 2BLVA 1ZR0A 2ZFPH 1NRSH 3P8GA 3O8RA 1CHOG 1ZLRA 2HNTE 4NZLA 1V3XA 3EA7A 2KAIA 1C5YB 1W7XH 4WH8A 5F6MA 3ZZBA 1LHEH 4OS2A 2FODA 2A31A 4YOJA 3STJA 1C2DA 1T32A 4BNRA 1RS0A 1ZHRA 1FY1A 2FX6A 3S0NA 2GX4A 4OGXA 5LGOA 2ANWA 1AWFH 3SU2A 3DSPA 5A09A 3M61U 2FI5E 3FKSD 5A8ZA 1BBRK 1FUJA 4OS5A 2F9OA 3LT3A 3T2NA 2K0QA 5C1YA 1SR5C 2A1DB 2H9TH 3D49H 1D9IA 2R3UA 3SJKA 1J16A 1C5RA 3BG4C 3M37A 1AZZA 5HYOA 4YXWD 1MQ6A 1NROH 1GBDA 3V7TA 1D3QB 1MQ5A 2ZIQH 1FY4A 2ZFTA 2HWLB 4MPVA 3T25A 3F68H 3MOCA 1LPZB 2G52A 1EAIA 1ZSLA 1P11E 2R0KA 2BD5A 4F55A 1GL1A 1AVWA 2IJOB 2J92A 1OHHD 2VVUA 1IQMA 4ASUD 2W6ID 1V2ST 2PHBA 2PR3A 4X1PU 1TGCA 1DDJA 1GJ8B 3PRBA 1QA7A 4F49A 2CXVA 1AVGH 4RSPA 1FAKH 1MKWK 4JZDH 2NU2E 3RU4D 3D23A 3STIA 4K5ZA 1O3MA 1O3GA 4RT0A 1YCPM 2J98A 5C17A 3UUZA 3CNRA 5EXLA 2IPQX 2ZU3A 1E79D 1SGRE 1C1WH 3OAAD 1F0TA 4UFDH 1UJ1A 2ZQ2A 1GVLA 2XC5A 4R0IA 5HM9A 3F9HA 1E35B 1OYQA 7GCHF 1S0RA 2BQ6B 4HZHA 2FLBH 4GHTA 3NRLA 1VKYA 3I77A 1D4PB 1QQ4A 1T31A 3MU1A 2WPLS 3RXLA 1QRWA 3ATMA 3TGJE 2OC0A 3MI4A 4Q2KA 1T8NA 5J4QA 1O3NA 1S81A 2V0BA 2ZFQH 1E0FD 1YM0A 1K1IA 1W14U 2OC1A 2AYWA 1GPZA 2FOFA 1AU8A 8ESTE 2R3YA 1MZAA 2RDEA 1P3CA 4I8KA 1W0JD 4HI3A 3EA9A 3FFGA 2NU3E 2WPIS 3T5FH 1O3PB 3TPIZ 1IQNA 1O3DA 1EQ9A 4NA7A 4AYYB 3TGIE 2PKSC 1SI5H 2YOLA 3DSGA 5FL7D 1HB0B 2ZCHP 4ZKRU 4MVNA 1KXAA 1TMUH 4D8NA 1GMDF 1O2RA 1N8OB 1PPEE 3GCOA 3MH7A 1SGPE 2FYQA 2FESH 2Y7XA 2PV9B 1FAXA 2YMSD 5DO4H 3MWIU 5CMXH 1GHVH 2Z9GA 1TAWA 5KECA 4SGBE 3TNSA 1G32B 3M36A 1BRAA 2ZECA 2BD4A 2OUAA 3S9AA 1TQ7B 1L1NA 1UVSH 5EXMA 5AVDA 4AYVB 4DJZB 1OPHB 3VEQB 3PRDA 3P92A 3SZNA 4D76A 1BJUA 2WYGA 1C2EA 3EDXB 1EB2A 2CJIA 3V13A 1HV7A 1T7CA 2BZ6H 3TJNA 2J97A 3BF6H 1H1BA 1SFQB 5DK1A 1V2UT 3L33A 5AF9H 3SI3H 1TRYA 3T27A 4B1TA 1MD8A 1HUTH 2HLDD 1ANDA 1LVYA 1UVTH 3GDVA 1B5GH 1ANBA 1W8BH 3GY8A 2A5AA 3QLPH 2Z9JA 1YPLH 2PLXA 1HXFH 5GCHF 2HNTF 2XNDD 5IDKA 1NU9A 2A45B 1WSSH 1BDAA 2PGQB 1P04A 1A5GH 1KYNA 2EI7A 2OQUA 3OU0A 3UB0A 4K1EA 3ENSB 1RIWC 4AFZA 1Z6EA 1QZ8A 1CA0B 1ABJH 1ORFA 2OD3B 3RUOA 2P93A 4M9FA 1NESE 1Y59T 2A4OA 1GMDG 1ESBA 2QXJA 3ZYDA 4J2YB 6CHAB 3P70B 3SJIA 4A1VA 1OXGA 1YBWA 1P2IA 3SV6A 2H9HA 3OTPA 1C1VH 2ZDLA 3URCA 1DLKB 2VIWA 1O3HA 2NU1E 2Z9IA 2JDID 2AMDA 4BAKB 3CENA 2F9BH 3Q3KA 2Q6DA 3HK3B 3UY9A 4AG1A 3LPRA 2G00A 1G2LA 1O3LA 4OS4A 5T1VA 1K28D 4GLYA 1DT2A 3SU5A 3SV2H 4RKOB 2QA9E 4IN2A 4ZH8A 2M5TA 5T3HA 3HKIB 1ELEE 1BBRE 4NFEA 4B2CA 1ZTKA 2XOKD 1HGTH 3RXVA 3RM0H 1GHXH 4JYUH 2P94A 4XBCA 1HDTH 5B6LA 1RJXB 1PQ5A 9LPRA 2OK5A 5J4SA 1ANCA 2AHME 2CF9H 5GCHG 3R0FA 4O03A 1P01A 3KYGA 3E3TA 1SHYA 3F0PA 4CRAA 5BPEA 1O2TA 1A2CH 3NWUA 1YPJH 2GZ9A 5E0JA 1BMAA 5F53A 3BTQE 1FY8E 5ESBA 1TNLA 1O2LA 4AX9H 1GHAF 2G5VA 5A0AE 1C1SA 1L1GA 1RTLA 1EP5A 1W3CA 2CHAC 3U1IB 4CRCA 2AGGX 2BOKA 2C8XB 1OWKA 4OM9A 1EPTB 2LNCA 2GDDA 3PLPA 4KTCA 5CE1A 4VGCB 1C9PA 2Y81A 3RXTA 1K1NA 4K60A 5FPYA 2STAE 3RXJA 4NWKA 1WCZA 2P95A 2KX4A 1WAYB 3QTOH 2ODPA 2FWWA 3NUMA 1BB0B 2A7HA 4CRBA 1MTUA 3M35A 1EAUA 1GI3A 3TU7H 1TMBH 4ZCNA 4TYDA 4AC9A 1ELGA 1E1QD 1AO5A 2PP6A 1HJAC 1GI2A 1C5MD 2BDYA 2I6QA 3SV7A 4J1YA 5EW1H 1P0SH 1AIXH 1QURH 4NWLA 1V2QT 1YC0A 1BTWA 3SU6A 5JB9S 2FZZA 1BT7A 1O2WA 1TONA 1G36A 1UHBB 1UTQA 1ELVA 4X8TH 1NRRH 3A88A 1YLDA 3UOUA 2AEIH 5HXFA 3SBKA 4FU8A 1OWHA 4MNXA 3LONA 3SNEA 1KXFA 1CBWC 2QN5T 3OX7U 3WWBA 3ZVBA 1D3DB 4B2AA 3MU0A 1AFEH 1FY5A 1MTNB 4OS1A 5DP8A 5HIYA 2JH5D 1P2NA 1E34B 4X0WU 1XUJA 4ZKSU 2A32A 3S7KB 1QR3E 3NXPA 3M3TA 4FUJA 1GI0A 1ZYOA 3MH6A 1C5NH 3TH4H 1BTZA 2BLQA 1Y5AT 2FTLE 2ZFSA 3UNSA 2YMSB 5FX6A 1BCUH 3E0PB 5HM2A 5JPMH 1O3KA 1IOEA 4HFPB 2A7CA 1YWUA 1G9IE 1BTYA 1YPHC 4ISNA 2BX4A 2BY7X 1P2JA 2WPMS 2TGAA 3S69A 1ZHPA 2ZF0H 3T29A 4ISIH 1K1OA 4I86A 1BZXE 2BD2A 5TCAA 3AAVA 1CSOE 3GY2A 3AK5A 1GJ7B 1SGDE 3ZZCA 4BXSA 2H9EH 1BBRH 1JMOH 1HIAB 2F9VA 2Y82A 2P3FH 1UK3A 3OEHD 4YT6H 1TA6A 1NFUA 1TX6A 3M7TA 2NWNA 3CS0A 1EOLA 5DP3A 1AGJA 3GY5A 1H9IE 2VINA 1BITA 1TQ0B 1GBFA 3TJVA 2ZGXH 2GTBA 2OLGA 5GIBA 4UD9H 5EODA 2WPDD 4O3TA 3JZ2B 4AB9A 1LPKB 3GCHB 2IJD1 1FV9A 1E37B 4O9VA 4E7NA 3A8AA 1Y3WA 3U9AH 2HALA 4IMQA 2J95A 5K7RA 1YPGH 2O8UA 1LKAA 2P3UB 3SUDA 1O2IA 4CRDA 1IHTH 1CE5A 4TT3D 1DUAA 2AGEX 1W7GH 4MPXA 2R0LA 3C27B 1C1MA 1KDQA 4FVDA 5C2ZA 2VIVA 4K8BA 2J2UA 2F9PA 1LVBA 2HNTC 3M3VA 3IG6B 4ABGA 4WMDA 3SHCH 1O5FH 1H9HE 3FZDA 3DT0H 1DWCH 4K1TA 1MH0A 2UUKB 3SN8A 2AS9A 3MNXA 5DP4A 5EPYA 3KNXA 1SBWA 3FP6E 3ZZ3A 4JK6A 1GMHF 1YGCH 2HOBA 2R2WU 2WUBA 3MO9A 3SHAH 3ZZ9A 2XRCA 3LGUA 2PKAB 1C1OA 3P8FA 1EATA 1ZJKA 1QRXA 1CT0E 1WUNH 4H6TA 4B71A 4ACAA 3ITIA 1ZTLA 2Q6FA 2AFQB 3RMOH 2PFEA 1MZDA 1PJPA 4I8JA 1P10A 1Y3VA 1SLWB 3HATH 5FX5A 1QB1A 2NU0E 1EOJA 2QF0A 3KEEA 3OEED 1A4WH 3SI4H 2G51A 2V3HH 1QJ7B 2M2AA 1Q31A 1S6LA 1LCYA 1RRKA 1UCYH 1C4Y2 1AFQB 2ZG0H 3ZVCA 1O2QA 1P57B 3PV4A 1A3EH 1COWD 5JBTA 2XNIA 5FPTA 3E6PH 1UMAH 1JWTA 4ISLA 1OP2A 3A7YA 2Z3CA 1LHGH 3RMNH 1O2YA 1C5TA 1NN6A 3VGCB 1ACBE 2GCHG 4UFEH 2ZHWH 2ZTXA 1DITH 1VGCC 5TCCA 1LQEA 1W0KD 5E2PA 2G55A 2GJGA 4DT4A 1JIMA 4UDWH 3VPKA 3BEFB 3DUXH 3K9XB 1H8IH 1RTKA 3SJ8A 2OC8A 4FVBA 1GI4A 1NBME 1TPAE 3PO1C 1YY3A 4D7FA 4WJG2 3Q3YA 1H4WA 3JZ1B 1O0DH 1SQOA 1GI1A 3LGWA 2FMJA 1BMLA 2OBQA 1GHBG 3F1SB 1BMMH 4O97A 4R8TB 5LPFA 1C1QA 3B9FH 1B7XB 1QBVH 2ZFRH 1C1PA 1TRNA 1K1MA 1S6FA 3LGYA 2H2ZA 1GHZA 2QIQA 1HAYB 3UR9A 1BRUP 2EY4C 1N6XA 1CHOF 3AVZA 2AGIX 1EJAA 1P06A 5I25A 3BTDE 1MAXA 1J15A 4XRNA 4INHA 3QGJA 3S7HB 4A7IB 1O2JA 2AERH 1GBCA 1Z8RA 4Y79A 1C5UA 4CH8B 1YYY1 2ODYB 1ZOMA 4Y0ZE 3RXOA 3F9EA 5A2MH 2AIPA 1C5VA 1U6QA 2VVCA 4NSVA 4AN7A 2SGQE 2SNVA 1P2QA 1BTXA 2FPZA 2F43B 1HLTH 5T6FA 2ZGCA 8GCHF 1C5OH 1YLCA 5A0CA 1AKSA 2GT7A 3QGNB 3TK5A 3OY5U 5B6OA 1AB9B 2ULLA 5CHAB 1PPZA 1XVMA 1O2KA 1B0EA 1FPHH 4IC5A 2JIZD 2ZZUH 3EAJA 6GCHG 2HGTH 3DFJA 5GJ4B 2UUYA 3PWBA 4XSKU 1C2LA 1OOKB 2O8LA 3KCGH 4MDSA 1G37A 4I31A 1O2MA 3RXPA 3A86A 1QL7A 2K8IA 1Y5BT 4YO9A 3SNBA 2SGEE 1DLEA 5DKMA 4AOQA 5FBEA 3MU5A 5DP6A 1O5DH 2BD7A 4X1QU 4ZUHA 3RC6A 1MU8B 5LPRA 2JJ2D 2Q1JA 1GJAB 1FMGA 1C2KA 3B23B 4Y6DA 1H8HD 5GPIB 1EUFA 3LIWA 4JZ1A 1ZHMA 1O30A 4FUGA 4IS5A 4BTIB 3CP7A 2ZU5A 3EYDA 1O3AA 1NY22 3HKJB 1V6DA 4JK5A 4Q7XA 2QC2A 3BSQA 1GBJA 1C2HA 3RXGA 1N6YA 3UWIA 1QNJA 3TK9A 1GWAA 2O8WA 1TX7A 3KQCA 2QF5A 4B2BA 3VB4A 2GDEH 1ZMNA 3NPSA 4Y7AA 3S9CA 3LC3A 8GCHG 1CT2E 3OFND 1O3EA 3P95A 4FU7A 4AGKA 2A4GA 3H7TA 2ZNKH 1AWHB 3ESTA 1T8MA 4Y8XA 1T4VH 4AB8A 3O8CA 3P17H 3MQKC 1BUIA 5GDSH 3KQEA 1O38A 4LK4A 1A61H 2AMQA 2GCTC 4JCNA 3M7QA 2PSXA 4DGJA 5C5OA 1GVKB 1DM4B 3SYJA 1BMFD 1L4ZA 1GG6B 2EI8A 1F5RA 2FP7B 1TOCB 1S6HA 1JOUB 2XWBI 1QHRB 1PPHE 2V35A 4ISOA 2GP9B 4MPUA 1A5HA 4Y8YA 5EGMA 1ZMJA 4I8LA 5AFZH 3TK6A 2UWLA 2IN2A 4GHQA 2ZKSA 2Y5HA 1NT1A 1F7ZA 2EC9H 5ESTE 2HPQH 1LO6A 4ZHLU 2AH4X 5JDUB 1ZJDA 4H6SB 1EFRD 3PMJA 3T28A 1W0YH 2ANMH 3DSOA 4VGCC 1GI8B 1L2EA 3HGPA 4ZHAA 3GY3A 2BXTH 1V2TT 1KLIH 5E2OA 3W1EA 1EAXA 4DT7B 1F0RA 1GJ6A 1SFIA 4A6LA 3SNAA 1UK4A 1KLJH 1FLEE 2ZFFH 4LZ1H 2FDAA 2PGBB 5I46H 3UOPA 1GI5A 2ALPA 2G8TA 4Y8ZA 2O8TA 1TPSA 1BTHH 2F4LA 1EAWA 1C1TA 2FOCA 3BTHE 3A7WA 3KQ5A 4RT1A 1RGQA 2ZU2A 1C4U2 1SB1H 5JBCS 3B8JA 1QQUA 1LPGB 2ZQ1A 2HPPH 4ZHMU 3MO3A 2ZTYA 1MTWA 1HAZB 2LP6A 3LGTA 5L2ZH 2L6OA 3A8DA 1O34A 1KIGH 2LPRA 4Y7BA 3U28C 1F92A 1DICA 1C1UH 5FBIA 4X6PA 3U69H 2XBWA 2JETB 3ATLA 1MTVA 4DCDA 1UCYK 5G4BA 3D65E 3QX5H 1VITH 1K1JA 2GV6A 1WTHD 1O5EH 2B7DH 1P2KA 2F9NA 2BVRH 3BEUA 1FONA 3IITA 5PTPA 4XBDA 1SVPA 2K1QA 2F9UA 2KCPA 3LDXH 1Y3UA 5C3NA 1PQAA 1GCDA 4ASHA 3SGQE 1FIZA 4YESB 1YP9A 3MNSA 1UTJA 3SZEA 1O2PA 3KGPA 5L30H 5EG4A 1O31A 1TOMH 1BQYA 2GMTC 5DPAA 1Z1JA 3A81A 1DWEH 5EQQA 1VITF 2BY6X 1O32A 4I32A 2TIOA 3HGNA 1GJ5H 5EPNA 4A92A 5JB8S 2WV4A 4WH6A 1EASA 1PFXC 4YLQH 1YPEH 3NCLA 3TLOA 2ZPRA 1RXPA 2CMYA 4ZROA 1DXWA 5EJLA 1D6WA 3LC5A 3PV2A 1TFXA 1XVOA 5EW2H 1CT4E 5C5NA 3M5LA 1PPCE 4CRGA 1NM6A 1SOZA 3MU4A 1XXFA 2Y7ZA 3ZZAA 4THNH 3TH2H 2RDLA 4LZ4B 1M9UA 1Z71A 2B0FA 1TPOA 2D8WA 1GI7B 2ZDAH 5F8ZA 2WHXA 1AE8H 1G2MA 2OCVB 1P8VC 1KXEA 4DG4A 1Z7KA 1VITG 2BOHB 1N1LA 4GUXA 4YOIA 4IC6A 2WZQA 3LU9B 2XBYA 4UFFH 3DCLA 4FUEA 5A8YA 3VB7A 1O2UA 4ZMAH 2HVXA 1TPPA 1K2I1 4ABBA 4DIIH 2BM2A 1WTGH 4F4OC 1JIRA 2H5CA 4CBOA 4B73A 5EIYA 2BDBA 3QUMP 2I6SA 2VGCC 3AAUA 3PLBA 1KXDA 1G3DA 1TX8A 2UUFB 4TPYA 2W3IA 1O2HA 1S83A 1UTOA 2VB0A 2F3CE 3F9FA 4IBLH 2A4RA 3TVJB 4WF8A 1A5IA 1SQTA 3GY6A 4JZFH 5K0HA 1BTUA 3BG4B 1JRTA 3PMBB 2ZPSA 1GGDC 1TNKA 4ABJA 1UVOA 1D6RA 1ELDE 2RCEA 4BTTB 3GY7A 4WMFA 1MCVA 1H8DH 2TGTA 3I78A 1WOFA 1GMCG 2RA0A 1NRQH 4U30A 8LPRA 2VWLA 3QDZB 3GY4A 1NRNH 4ABDA 1F2SE 2Y80A 5E8EH 1QTFA 1CGHA 5KGOA 3KN2A 1GCTC 1HAPH 4QT8C 5EU8A 3RXIA 3MNCA 1UO6A 1EXFA 4X1SU 4ZKOU 1ID5H 1P9UA 2BY9X 2FOHA 1MABB 4WWYA 3HK6B 1EJMA 4FETA 2QXGA 3UPEA 4TWYA 4ABAA 1FN8A 1GI9B 3IWMA 4ZAEA 5BRRE 4TPIZ 3RXEA 5JYIA 1KY9A 5F8TA 1ETRH 1L4DA 1DFPA 1S82A 4DVAU 3QWCH 1NS3A 1VCQA 1G3BA 6LPRA 1SGNE 2QXHA 1ZRBA 5HIZA 1TYNA 2FS9A 1J8AA 4O3UA 1QY6A 1HAHH 3DA9B 1DVAH 1V2MT 4B75A 3EE0B 1XM1A 1AE5A 2OP9A 5A0BA 2W3KA 1ELTA 3VB3A 4BAHB 4YOGA 5HMAA 2ZGJA 3ZV8A 1UCYE 2XYAA 2FEQH 4OS7A 2A7JA 4CBNA 1HNEE 1EPTA 3WW7A 3F0OA 1MAYA 2OC7A 1NBMD 4X2YA 1KXBA 2GV7A 1O33A 4DW2U 3V3MA 2PKSB 3MH5A 2V6NA 1IQGA 2PUXB 1E1RD 2SGFE 4GCHG 5C20A 4CHAC 1Z8GA 1IQHA 4TY6A 1SGTA 2WYJA 1TABE 4B6FA 3UWJH 1V2KT 5GXPA 4ABFA 1G30B 3RU4T 2A5IA 2ZCKP 1OSSA 3A80A 4Y11E 1K21H 4GVUA 3FP7E 3UNQA 3M5OA 3K65B 3VB6A 1V2VT 2ALVA 3A7TA 1XUIA 1EJNA 2GVFA 3MU8A 5EQSA 1HAVB 1NFXA 2RG3A 2SGPE 3BN9A 1NZQH 2SGAA 1C2JA 3EA8A 4LXBH 3RXRA 2Z94A 3W94A 1GHYH 2BLOA 5JBAS 1DWBH 1UHBA 2W26A 1O5BB 1FJSA 3M5NA 2P8OC 4XDEA 2JJ1D 3SJ9A 3GICB 2NU4E 2DUCA 2W7SA 2TBSA 4FUFA 2BX3A 1BHXB 1DE7H 2BVXH 1C2FA 1ELBA 3QZQA 4YLUA 1VJ9U 1RIWB 3SUEA 1S5SA 1SLVB 1DY8A 4FOUC 3P8OA 2Y5GA 1TWXB 2AMPA 2BD9A 2EA3A 1BTPA 1JRSA 4RKJB 3UAIC 1DXPA 4Z1MD 2BTCE 4Y76A 2UWOA 1ETSH 2FTMA 5FCRA 2GZ7A 1P02A 1X7AC 2VWNA 5E0HA 4Y10E 5T6DA 1XUHA 1C1NA 1BRCE 4IN1A 3LGVA 3A89A 5C0TA 3GDUA 3A8CA 1SSXA 3ATIA 1ZGIA 1NPMA 3KHVA 4TY7A 2OXSA 2Z7FE 2GCHF 1SGCA 3ATWA 5GNDA 3O8BA 1AQ7A 4WXVA 3SU4A 2FOMB 2KCYA 1GVZA 1HIAA 1TNGA 3BTGE 4GAWA 2ZCLP 4X1RU 1C2MA 3F9GA 4IW4E 2Z3EA 1FQ3A 5KEDA 1LHDH 1BRBE 3OSYA 1O2SA 2VIDA 3LKWA 2YNAA 4A5TS 1OWEA 3SU0A 2XC0A 4Z6AH 1GHBF 3VB5A 3QN7A 2VWOA 3NKKA 1DY9A 3SNDA 4TWWA 1AI8H 1E38B 2XXLA 2XCFA 3KYFA 4U01A 1ELAA 4Q80A 1MUEB 2BXUH 4X8VH 3ZZ7A 2CHAB 4E05H 1HPGA 4WY3A 1IHSH 3ODFA 3GCTG 4MNWA 1C9TA 5E0GA 1WV7H 1G3CA 3M3SA 3BTWE 2QF4A 2Z3DA 3SGAE 3OTJE 4BAQB 5A8XA 3PLKA 2CK3D 3TGKE 3N7OA 1AZ8A 1IQJA 3SU3A 4OS6A 2C93B 1YCPH 2GGVB 2VWMA 3RLYH 1TNJA 1ZSKA 4I7YH 3MYWA 1ELFA 4BAMB 3MO6A 3UQOA 1QFKH 2IPHA 5IK2D 2ZU4A 4AFQA 1HJAB 2CN0H 2EQNA 1WDIA 1Z6JH 5ABWA 1JXPA 1O5AB 1SOTA 2ZDNA 2J5UA 2PKAA 1DS2E 1OP0A 3U98H 1UW7A 1V2OT 3RP2A 1QRZA 1UVPA 2ZGBH 1Y3XA 5C1XA 3FANA 2KCAA 1A7SA 4Q63A 1UTMA 4KTUA 4E06H 4GSOA 1THSH 1HAIH 2THFB 3TJUA 6GCHF 1O3CA 3A7XA 1GJ9B 1CVWH 1DPOA 1DANH 2KCOA 1Y3YA 4CR5A 2FIRH 2BMGB 1C5SA 2TGPZ 1P05A 3EQ0H 3SQHE 3ZZDA 5HKKD 3KIDU 2B5TB 1C5ZB 2J4IA 5JBBS 2J34A 1CBWB 7KMEH 1N8OC 2BDGA 2FOEA 2F83A 4NG9H 2CF8H 3PM3A 1EKBB 2DE9A 3EGKH 1PQ7A 1Z1IA 1S85A 2EI6A 1A1RA 2V3OH 2DE8A 2ZGHA 3SW2B 1ZMLA 3MTYA 1GBMA 5ETXA 1VJAU 2KAIB 1GI6A 4YT7H 1IAUA 3A87A 2OBOA 2BZAA 2C8WB 3PV5A 1PPGE 5LH8A 3C1KA 4X2VA 3VG8A 4X1NU 1L0ZA 1O2NA 1W10U 3CS7A 4NIYA 2VNTA 1HAOH 1CGIE 2ZHEH 1TNIA 3ODDA 4K1SA 1ABIH 2FI4E 1HAGE 3RXQA 3R3GB 1UK2A 5DJ7A 4KP0A 3U1JB 4YZUA 1C5PA 1FPCH 1C5WB 1EZUC 1Q3XA 1D3PB 3A7VA 1GDUA 2ZU1A 2FLRH 3M7UA 1NC6A 1P9SA 1OWDA 3OYPA 1CA0C 3TNTA 1J17T 3RXHA 3U8OH 5DGJA 1ELCA 1Q2WA 2WPKS 6CHAC 4NA9H 1XKBC 1FY3A 2GT8A 4ISHH 1NRPH 2WPHS 2XC4A 3ZVFA 4XE4A 1SMFE 1NFWA 3Q76A 4D9QA 1WYKA 4XOJA 4UE7H 4KGAA 3LGIA 4UFGH 2ZHFH 4MQAA 1PQ8A 4FUCA 1V2WT 2UWPA 3ZV9A 1SG8B 3LJOA 1O3BA 5CDFE 2A4QA 2V3MA 2J98B 1Z8JB 2KM0A 3QTVH 5FAHA 3SU1A 2QY0B 1VCPA 1OS8A 1BOQA 5FXLA 2QYIA 3BTKE 1WXRA 1YLNA 1WBGB 2TPIZ 2BDCA 2CV3A 2LELA 1MMJN 5LPEA 1QL9A 1TGNA 1LQDB 1GJBB 2BDHA 1MKXK 1OP8A 2BLWA 2J38A 4X6NA 5L2YH 2XWAA 4XD7D 1KTTB 2XTTB 2GZ8A 1SPJA 1LTOA 3KQDA 4I8HA 3TH3H 3A82A 2FOAA 5F03A 1TBQH 1UTLM 3GISB 3V12A 1O2XA 3PTBA 1A3BH 1LKBA 3FZZA 4WMEA 2ZDVH 2P59A 1CHGA 2D1JA 1EPTC 1HJ9A 3BTFE 3PB1E 5DN6D 3E1XB 1W12U 3MNBA 4ACBA 3SV9A 2P16A 3RXCA 1F0SA 2W7UA 4IGDA 4P02A 1MU6B 1J9CH 1INCA 1WU1A 1FNIA 4SGAE 4FUBA 3K6ZA 2Z6BD 1EP6A 2FM2A 1FZZA 3K6YA 2SFAA 3DHKH 4MNYA 2TGDA 3OE7D 4A1TA 1O3FA 2VH0A 1TGSZ 1YPMH 1TB6H 5L6NH 1GBBA 3PROA 3RXMA 2SNWA 3I29A 1VGCB 1QBNA 3ZZ8A 1MCTA 1GBHA 2GKVE 4E7RG 2TRMA 3E90B 1SC8U 2ANYA 3N7DA 5C94A 2PW8H 1HXEH 2ASUB 5EOKA 4BANB 1O2GH 3PO1B 5DP7A 3SUGA 4MTBA 1TBZH 1HRTH 1O37A 1XUKA 3F6UH 4AZ2B 2XBXA 2RFKC 1MBQA 3OY6U 1O2ZA 1EZXC 3H7OA 3ATKA 2ZPQA 3URDA 4WXIA 2L74A 4NIVA 4YTAA 4BTUB 1KLTA 1YCPK 3QK1A 4X8UH 3PTNA 3O8DA 1K1LA 1S84A 1MTNC 1LDTT 1C5QA 1B0FA 1SGYE 2FS8A 2ZI2H 2SGDE 5DSFA 4F48B 2HLCA 1O3JA 2PUQH 2ZTZA 2FO9A 1P12E 1NU7B 1O3OA 1P2OA 1BJVA 3RM2H 1TGTA 2Z9KA 2B9LA 4U32A 2J94A 1C5XB 1WQSA 4ZXXH 3QO6A 4ESTE 2YMSC 3ZVAA 3RDZA 1YKTA 4X8SH 3BG8A 7GCHG 3MH4A 2BDAA 4FU9A 3H5CB 5FHTA 2HRVA 4KKDA 3RXSA 1OX1A 2A2QH 3E16B 1GDQA 2FOBA 3RC4A 1RFNA 1T8OA 1F5KU 2ESTE 2WINI 2RA3A 3Q00A 1BMNH 3N99A 2WV5A 2BD3A 2H5DA 3K2UA 4CRFA 1RTFB 1TE0A 4NFFA 1K1PA 1THRH 1HJ8A 2C90B 4NCYA 1SL3A 2IOTA 1EZSC 1IQLA 3E0NB 3NK8A 2ZO3H 3M5MA 1GMCF 3FO8D 3E8LA 1VCWA 2ZDKA 5EXNA 3GCHC 3F3BA 1C2GA 3ZVEA 1V2PT 3RXUA 3DD2H 2H6MA 4BOHA 1GBTA 1HBTH 3F2FA 3WY8A 1SGQE 2AIQA 4BXWA 5TJXA 3PMAB 2ILNA 2C8YB 8KME2 1TBRH 2Z9LA 1IQIA 3TIUA 3U8TH 1Z8IB 3BIVH 1PYTD 3RC5A 4YM9A 3Q77A 3ZVDA 1O36A 3TJOA 1PYTC 2BYAX 3VXEH 1QJ1B 1THPB 4D9RA 2F91A 4GPGA 1OWIA 5CHBA 2JKHA 1AMHA 2VIQA 1VR1H 3RXFA 3RXAA 4JYTA 4TSFD 1OWJA 2W5EA 5GWZA 1W13U 4AFSA 1CO7E 1A0HB 1GL0E 4H4FA 1ZZZA 4CR9A 3EE7A 4KELA 2GCTB 4X6OA 3PMHB 3BEIB 1C4V2 3PYHA 3RU4E 3ZVGA 3UREA 1BIOA 3U8RH 1SLUB 4NA8A 1GJ4H 1AN1E 3P8NA 4RN6A 4GCHF 1TMTH 1V2RT 4FUIA 2G4UA 1DOJA 5EJ1A 3A7ZA 3E91A 4B74A 2G5NA 3LJJA 1AFQC 3AW1A 1TA2A 1XKAC 1V2NT 3UTUH 2VBCA 4NGAH 1L1JA 1TNHA 1O39A 3ZZ6A 1ZTJA 1XMNB 3DFLA 1H9LB 2FYRA 3PWCA 1O5CB 2W6JD 4X2WA 1AUTC 1KTSB 1C1RA 1FI8A 3AW0A 1AUJA 1SGFA 2C3SA 3UNRA 7LPRA 3VGCC 2D2DA 1BA8B 1TALA 1LHFH 3RLWH 1FIWA 3FVFB 1W2KH 1O2VA 2R2MB 2EEKA 1KSNA 1SLXB 1K22H 1P2MA 3TITA 2JH6D 3KL6A 1A46H 2QGRA 1QCPA 4K2YA 1GBLA 1GJDB 2BHGA 4D7GA 1C5LH 4H42U 4XBBA 1GBEA 3FAOA 1O35A 2P3TB 4AGJA 1FX0B 3LOXA 4DOQA 3A8BA 1ARBA 2WV9A 1G3EA 1GHAG 3UIRA 1ZPZA 2FX4A 2BQWB 2GD4B 4K3JA 4X2XA 5EJZA 2J9NA 1HAXB 4Y71A 4AORA 3VXFH 1HFDA 4ABIA 5FCKA 5IYTA 2XW9A 1LVOA 1W11U 2YNBA 4HG6A 4U2WA 3RMMH 4DURA 1FN6A 3FOAA 1FDPA 4K8YA 2A5KA 2BD8A 2XBVA 3GS9A 1K9OE 1P09A 2VJ1A 2ODQA 3MHWU 2GMTB 6ESTA 3BIUH 2QF3A 1XX9A 3FN8A 4M7GA 3VFEA 4KTSA 3F2GA 1XUGA 2G81E 2JH0D 4FXGH 5C0UA 1KDQB 3ZYEA 3T62A 2QAAA 2BVSH 2FOGA 1CU1A 1A0LA 2OQ5A 2QV1A 2A0QB 2ZWLH 4FUDA 1AB9C 5CHAC 4INKA 1TLDA 1S0QA 1HCGA 4MPWA 3RMLH 2OINA 1UTPA 1LMWB 1XXDA 1IQFA 1MKXH 4ABHA 3WWFA 1MBMA 1ZSJA 3L6PA 2VVVA 2BDIA 1ZPBA 3GYMA 4K69A 1AHTH 2WUCA 3T26A 2VU8E 1A0JA 2ANKH 2PTCE 2PSYA 2Q6GA 4XFQA 1NFYA 2QXIA 1QJ6B 3GCTF 1DSTA 3SNCA 1TIOA 5DP5A 4Y0YE 4BAOB 4UONA 2HVYB 3SO3A 1JBUH 2O8MA 4Q7ZA 4Q4LA 1HAVA 4UEHH 2C8ZB 2QE7D 3ELAH 1ESAA 4HGCA 4JZIA 4LOYH 1QGFA 2A2XH 2Y5FA 1MKWH 2FXRA 4RI0A 4X6MA 2ZEBA 1SKYE 3Q3XA 1V2JT 1ZGVA 5FPSA 2ZA5A 4MG3A 1ETTH 2VGCB 1T4UH 1PPFE 3BV9B 1DX5M 5DP9A 1XUFA 1FXYA 3LH1A 5SGAE 1SGFG 1IQKA 1GBAA 3A83A 2VIOA 1GG6C 1MD7A 1GGDB 1LHCH 4INLA 2ZHDA 4WVPE 4DY7B 2STBE 1Y5UT 2BY5X 1KXCA 1DSUA 1PPBH 1HYLA 1AVXA 4OGYA 3W95A 4FUHA 1AD8H 1K0HA 3GCNA 1QB9A 3ZZ4A 1VZQH 2Y6TA 5EQRA 2C4FH 3L3TA 5DG6A 4I8GA 3ZIAD 1ZRKA 1GCTB 3KQBA 1OKXA 2ZDMA 3FP8E 4PROA 2V7QD 2PWXA 3GYLB 1SQAA 1QB6A 4ZXYH 3A85A 3UFAA 3BTTE 3H09A 2KZ4A 1Y8TA 3UQVA 1GDNA 1RD3B 4NZQA 3GDSA 4NIWA 3RXBA 1QBOA 4Z0KA 2WSSD 1TRMA 3SORA 1F0UA 4JYVH 2OTVA 3G01A 2H1UA 4I33A 3GOVB 1GHWH 1GBKA 1O5GH 1EZQA 2O9QA 1SQRA 5C67A 1AY6H 5C1UA 1SHHB 2BB4A 1EB1H 3ZZ5A 4AFUA 3RXDA 5AFYH 1GMHG 1O3IA 2B8OH 1YF4A 3LH3A 3N7EA 1AKSB 2JETC 3SQEE 1OYTH 4A1XA 1CQQA 7ESTE 3NZIA 1QA0A 2ZHQH 1TGBA 2ZP0H 3AASA 3BTME 3UR6A 1UVUH 1IQEA 1UTNA 4DIHH 2BQ7B 2XCNA 1LVMA 1F5LA 1C2IA 2G4TA 2R9PA 2KFWA 3F2HA 1QL8A 1BHXF 1GJCB 4CHAB 2D26C 1J14A 1P3EA 1YPHE 4B76A 1W0ZU 3MMGA 1ANEA 4IMZA 3A84A 2QCYA 4ABEA 4CH2B 3V0XA 1NO9H 2KR7A 1P03A 3SJOA 3BTEE 3MFJA 4MLFB 3S9BA 1E36B 3P6ZB 4CREA 3KF2A 3SGBE 4NIXA 3QZRA 1D3TB 1SGIB 9ESTA 4NSYA
chains in the Genus database with same CATH topology
4JMYA 5HGGA 1ARCA 3SOSA 4HTCH 2UUJB 2BY8X 3HPTB 2VIPA 1EX3A 1V2LT 5H4IB 3D62A 1DUEA 1DWDH 1CA8B 5T6GA 1CGJE 1SGEE 2P8OB 3SV8A 1WQVH 1T8LA 2CGAA 2PTNA 3RXKA 1NTPA 5F8XA 1UTKA 2VH6A 4MNVA 2ZC9H 1ESTA 4AG2A 5AHGH 1GBIA 1QIXB 3SUFA 1O2OA 4Q7YA 4JZEH 2FI3E 1MTSA 2WPJS 4ZKNU 1YPKH 1ZPCA 2BLVA 1ZR0A 2ZFPH 1NRSH 3P8GA 3O8RA 1CHOG 1ZLRA 2HNTE 4NZLA 1V3XA 3EA7A 2KAIA 1C5YB 1W7XH 4WH8A 5F6MA 3ZZBA 1LHEH 4OS2A 2FODA 2A31A 4YOJA 3STJA 1C2DA 1T32A 4BNRA 1RS0A 1ZHRA 1FY1A 2FX6A 3S0NA 2GX4A 4OGXA 5LGOA 2ANWA 1AWFH 3SU2A 5A09A 3M61U 2FI5E 5A8ZA 1BBRK 1FUJA 4OS5A 2F9OA 3LT3A 3T2NA 5C1YA 1SR5C 2A1DB 2H9TH 3D49H 1D9IA 2R3UA 3SJKA 1J16A 1C5RA 3BG4C 3M37A 1AZZA 5HYOA 1MQ6A 1NROH 1GBDA 3V7TA 1D3QB 1MQ5A 2ZIQH 1FY4A 2ZFTA 2HWLB 4MPVA 3T25A 3F68H 3MOCA 1LPZB 2G52A 1EAIA 1ZSLA 1P11E 2R0KA 2BD5A 1GL1A 1AVWA 2IJOB 2J92A 2VVUA 1IQMA 1V2ST 2PHBA 2PR3A 4X1PU 1TGCA 1DDJA 1GJ8B 4F49A 1QA7A 4RSPA 2CXVA 1AVGH 1FAKH 1MKWK 4JZDH 2NU2E 3RU4D 3D23A 3STIA 4K5ZA 1O3MA 1O3GA 1YCPM 3UUZA 5EXLA 2ZU3A 1SGRE 1C1WH 1F0TA 4UFDH 1UJ1A 2ZQ2A 1GVLA 2XC5A 4R0IA 5HM9A 3F9HA 1E35B 1OYQA 7GCHF 1S0RA 2BQ6B 4HZHA 2FLBH 4GHTA 3I77A 1D4PB 1QQ4A 1T31A 3MU1A 2WPLS 3RXLA 1QRWA 3ATMA 3TGJE 2OC0A 3MI4A 4Q2KA 1T8NA 5J4QA 1O3NA 1S81A 2V0BA 2ZFQH 1E0FD 1YM0A 2OC1A 1K1IA 1W14U 2AYWA 1GPZA 2FOFA 1AU8A 8ESTE 2R3YA 1MZAA 1P3CA 4I8KA 4HI3A 3T5FH 3EA9A 3FFGA 2NU3E 2WPIS 1O3PB 3TPIZ 1IQNA 1O3DA 1EQ9A 4NA7A 4AYYB 3TGIE 2PKSC 1SI5H 2YOLA 1HB0B 2ZCHP 4ZKRU 4MVNA 1KXAA 1TMUH 4D8NA 1GMDF 1O2RA 1N8OB 1PPEE 3GCOA 3MH7A 1SGPE 2FYQA 2FESH 2Y7XA 2PV9B 1FAXA 5DO4H 3MWIU 5CMXH 1GHVH 2Z9GA 1TAWA 4SGBE 3TNSA 1G32B 3M36A 1BRAA 2ZECA 2BD4A 2OUAA 3S9AA 1TQ7B 1L1NA 1UVSH 5EXMA 5AVDA 4AYVB 4DJZB 1OPHB 3VEQB 3P92A 3SZNA 4D76A 1BJUA 2WYGA 1C2EA 3EDXB 1EB2A 2CJIA 3V13A 1HV7A 1T7CA 2BZ6H 3TJNA 3BF6H 1H1BA 1SFQB 5DK1A 1V2UT 3L33A 5AF9H 3SI3H 1TRYA 3T27A 4B1TA 1MD8A 1HUTH 1ANDA 1LVYA 1UVTH 3GDVA 1B5GH 1ANBA 1W8BH 3GY8A 2A5AA 3QLPH 2Z9JA 1YPLH 2PLXA 1HXFH 5GCHF 2HNTF 5IDKA 1NU9A 2A45B 1WSSH 1BDAA 2PGQB 1P04A 1A5GH 1KYNA 2EI7A 2OQUA 3OU0A 4K1EA 3ENSB 1RIWC 4AFZA 1Z6EA 1CA0B 1ABJH 1ORFA 2OD3B 3RUOA 2P93A 1NESE 1Y59T 2A4OA 1GMDG 1ESBA 2QXJA 3ZYDA 4J2YB 6CHAB 3P70B 3SJIA 4A1VA 1OXGA 1YBWA 1P2IA 3SV6A 2H9HA 1C1VH 2ZDLA 3URCA 1DLKB 2VIWA 1O3HA 2NU1E 2Z9IA 2AMDA 4BAKB 3CENA 2F9BH 3Q3KA 2Q6DA 3HK3B 3UY9A 4AG1A 3LPRA 2G00A 1G2LA 1O3LA 4OS4A 1K28D 4GLYA 1DT2A 3SU5A 3SV2H 4RKOB 2QA9E 4IN2A 4ZH8A 2M5TA 5T3HA 3HKIB 1ELEE 1BBRE 4NFEA 4B2CA 1ZTKA 1HGTH 3RXVA 3RM0H 1GHXH 4JYUH 2P94A 4XBCA 1HDTH 1RJXB 1PQ5A 9LPRA 5J4SA 1ANCA 2CF9H 5GCHG 3R0FA 4O03A 1P01A 3E3TA 1SHYA 4CRAA 5BPEA 1O2TA 1A2CH 3NWUA 1YPJH 2GZ9A 5E0JA 1BMAA 3BTQE 1FY8E 5ESBA 1TNLA 1O2LA 4AX9H 1GHAF 2G5VA 5A0AE 1C1SA 1L1GA 1RTLA 1EP5A 1W3CA 2CHAC 3U1IB 4CRCA 2AGGX 2BOKA 2C8XB 1OWKA 1EPTB 2LNCA 2GDDA 3PLPA 4KTCA 5CE1A 4VGCB 1C9PA 2Y81A 3RXTA 1K1NA 4K60A 5FPYA 2STAE 3RXJA 4NWKA 1WCZA 2P95A 1WAYB 3QTOH 2ODPA 2FWWA 3NUMA 1BB0B 2A7HA 4CRBA 1MTUA 3M35A 1EAUA 1GI3A 3TU7H 1TMBH 4TYDA 1ELGA 1AO5A 1HJAC 1GI2A 1C5MD 2BDYA 2I6QA 3SV7A 4J1YA 5EW1H 1P0SH 1AIXH 1QURH 4NWLA 1V2QT 1YC0A 1BTWA 3SU6A 5JB9S 2FZZA 1BT7A 1O2WA 1TONA 1G36A 1UHBB 1UTQA 1ELVA 4X8TH 1NRRH 3A88A 1YLDA 3UOUA 2AEIH 5HXFA 3SBKA 4FU8A 1OWHA 4MNXA 3LONA 3SNEA 1KXFA 1CBWC 2QN5T 3OX7U 3ZVBA 1D3DB 4B2AA 3MU0A 1AFEH 1FY5A 1MTNB 4OS1A 5DP8A 2JH5D 1P2NA 1E34B 4X0WU 1XUJA 4ZKSU 2A32A 3S7KB 1QR3E 3NXPA 3M3TA 4FUJA 1GI0A 1ZYOA 3MH6A 1C5NH 3TH4H 1BTZA 2BLQA 1Y5AT 2FTLE 2ZFSA 3UNSA 5FX6A 1BCUH 3E0PB 5HM2A 5JPMH 1O3KA 1IOEA 4HFPB 2A7CA 1G9IE 1BTYA 1YPHC 4ISNA 2BX4A 2BY7X 1P2JA 2WPMS 2TGAA 3S69A 1ZHPA 2ZF0H 3T29A 4ISIH 1K1OA 1BZXE 2BD2A 5TCAA 3AAVA 1CSOE 3GY2A 1GJ7B 1SGDE 3ZZCA 4BXSA 2H9EH 1BBRH 1JMOH 1HIAB 2F9VA 2Y82A 2P3FH 1UK3A 4YT6H 1TA6A 1NFUA 1TX6A 3M7TA 2NWNA 3CS0A 1EOLA 5DP3A 1AGJA 3GY5A 1H9IE 2VINA 1BITA 1TQ0B 1GBFA 3TJVA 2ZGXH 2GTBA 2OLGA 5GIBA 4UD9H 5EODA 4O3TA 3JZ2B 4AB9A 1LPKB 3GCHB 1FV9A 1E37B 4O9VA 4E7NA 3A8AA 1Y3WA 3U9AH 2HALA 4IMQA 2J95A 5K7RA 1YPGH 2O8UA 1LKAA 2P3UB 3SUDA 1O2IA 4CRDA 1IHTH 1CE5A 1DUAA 2AGEX 1W7GH 4MPXA 2R0LA 3C27B 1C1MA 1KDQA 4FVDA 5C2ZA 2VIVA 4K8BA 2J2UA 2F9PA 1LVBA 2HNTC 3M3VA 3IG6B 4ABGA 4WMDA 3SHCH 1O5FH 1H9HE 3FZDA 3DT0H 1DWCH 4K1TA 1MH0A 2UUKB 3SN8A 2AS9A 3MNXA 5DP4A 5EPYA 3KNXA 1SBWA 3FP6E 3ZZ3A 4JK6A 1GMHF 1YGCH 2HOBA 2R2WU 2WUBA 3MO9A 3SHAH 3ZZ9A 2XRCA 3LGUA 2PKAB 1C1OA 3P8FA 1EATA 1ZJKA 1QRXA 1CT0E 1WUNH 4H6TA 4B71A 3ITIA 1ZTLA 2Q6FA 2AFQB 3RMOH 2PFEA 1MZDA 1PJPA 4I8JA 1P10A 1Y3VA 1SLWB 3HATH 5FX5A 1QB1A 2NU0E 1EOJA 2QF0A 3KEEA 1A4WH 3SI4H 2G51A 2V3HH 1QJ7B 1Q31A 1LCYA 1RRKA 1UCYH 1C4Y2 1AFQB 2ZG0H 3ZVCA 1O2QA 1P57B 3PV4A 1A3EH 5JBTA 2XNIA 5FPTA 3E6PH 1UMAH 1JWTA 4ISLA 1OP2A 3A7YA 2Z3CA 1LHGH 3RMNH 1O2YA 1C5TA 1NN6A 3VGCB 1ACBE 2GCHG 4UFEH 2ZHWH 2ZTXA 1DITH 1VGCC 5TCCA 1LQEA 5E2PA 2G55A 1JIMA 4UDWH 3VPKA 3BEFB 3DUXH 3K9XB 1H8IH 1RTKA 3SJ8A 2OC8A 4FVBA 1GI4A 1TPAE 3PO1C 4D7FA 4WJG2 3Q3YA 1H4WA 3JZ1B 1O0DH 1SQOA 1GI1A 3LGWA 2FMJA 1BMLA 2OBQA 1GHBG 3F1SB 1BMMH 4O97A 4R8TB 5LPFA 1C1QA 3B9FH 1B7XB 1QBVH 2ZFRH 1C1PA 1TRNA 1K1MA 1S6FA 3LGYA 2H2ZA 1GHZA 2QIQA 1HAYB 3UR9A 1BRUP 1N6XA 1CHOF 3AVZA 2AGIX 1EJAA 1P06A 5I25A 3BTDE 1MAXA 1J15A 4INHA 3QGJA 3S7HB 4A7IB 1O2JA 2AERH 1GBCA 1Z8RA 4Y79A 1C5UA 4CH8B 1YYY1 2ODYB 1ZOMA 4Y0ZE 3RXOA 3F9EA 5A2MH 2AIPA 1C5VA 1U6QA 2VVCA 4NSVA 4AN7A 2SGQE 2SNVA 1P2QA 1BTXA 2FPZA 1HLTH 5T6FA 2ZGCA 8GCHF 1C5OH 1YLCA 5A0CA 1AKSA 2GT7A 3QGNB 3TK5A 3OY5U 5B6OA 1AB9B 2ULLA 5CHAB 1PPZA 1XVMA 1O2KA 1B0EA 1FPHH 4IC5A 2ZZUH 3EAJA 6GCHG 2HGTH 3DFJA 5GJ4B 2UUYA 3PWBA 4XSKU 1C2LA 1OOKB 2O8LA 3KCGH 4MDSA 1G37A 4I31A 1O2MA 3RXPA 3A86A 1QL7A 1Y5BT 4YO9A 3SNBA 2SGEE 1DLEA 5DKMA 4AOQA 5FBEA 3MU5A 5DP6A 1O5DH 2BD7A 4X1QU 4ZUHA 3RC6A 1MU8B 5LPRA 2Q1JA 1GJAB 1FMGA 1C2KA 3B23B 4Y6DA 5GPIB 1EUFA 3LIWA 4JZ1A 1ZHMA 1O30A 4FUGA 4IS5A 4BTIB 3CP7A 2ZU5A 3EYDA 1O3AA 1NY22 3HKJB 1V6DA 4JK5A 4Q7XA 2QC2A 3BSQA 1GBJA 1C2HA 3RXGA 1N6YA 3UWIA 1QNJA 3TK9A 1GWAA 2O8WA 1TX7A 3KQCA 4B2BA 3VB4A 2GDEH 1ZMNA 3NPSA 4Y7AA 3S9CA 3LC3A 8GCHG 1CT2E 3P95A 1O3EA 4AGKA 4FU7A 2A4GA 3H7TA 2ZNKH 1AWHB 3ESTA 1T8MA 4Y8XA 1T4VH 4AB8A 3O8CA 3P17H 1BUIA 5GDSH 3KQEA 1O38A 4LK4A 1A61H 2AMQA 2GCTC 4JCNA 3M7QA 2PSXA 4DGJA 5C5OA 1GVKB 1DM4B 1L4ZA 1GG6B 2EI8A 1F5RA 2FP7B 1TOCB 1S6HA 1JOUB 2XWBI 1QHRB 1PPHE 2V35A 4ISOA 2GP9B 4MPUA 1A5HA 4Y8YA 5EGMA 1ZMJA 4I8LA 5AFZH 3TK6A 2UWLA 2IN2A 4GHQA 2ZKSA 2Y5HA 1NT1A 1F7ZA 2EC9H 5ESTE 2HPQH 1LO6A 4ZHLU 2AH4X 5JDUB 1ZJDA 4H6SB 3PMJA 3T28A 1W0YH 2ANMH 4VGCC 1GI8B 1L2EA 3HGPA 4ZHAA 3GY3A 2BXTH 1V2TT 1KLIH 5E2OA 1EAXA 4DT7B 1F0RA 1GJ6A 1SFIA 4A6LA 3SNAA 1UK4A 1KLJH 1FLEE 2ZFFH 4LZ1H 2FDAA 2PGBB 5I46H 3UOPA 1GI5A 2ALPA 2G8TA 4Y8ZA 2O8TA 1TPSA 1BTHH 1EAWA 1C1TA 2FOCA 3BTHE 3A7WA 1RGQA 2ZU2A 1C4U2 1SB1H 5JBCS 3B8JA 1QQUA 1LPGB 2ZQ1A 2HPPH 4ZHMU 3MO3A 2ZTYA 1MTWA 1HAZB 3LGTA 5L2ZH 3A8DA 1O34A 1KIGH 2LPRA 4Y7BA 1F92A 1DICA 1C1UH 5FBIA 4X6PA 3U69H 2XBWA 2JETB 3ATLA 1MTVA 4DCDA 1UCYK 5G4BA 3D65E 3QX5H 1VITH 1K1JA 2GV6A 1WTHD 1O5EH 2B7DH 1P2KA 2F9NA 2BVRH 3BEUA 1FONA 3IITA 5PTPA 4XBDA 1SVPA 2K1QA 2F9UA 3LDXH 1Y3UA 5C3NA 1PQAA 1GCDA 4ASHA 3SGQE 1FIZA 4YESB 1YP9A 3MNSA 1UTJA 1O2PA 3KGPA 5L30H 5EG4A 1O31A 1TOMH 1BQYA 2GMTC 5DPAA 1Z1JA 3A81A 1DWEH 5EQQA 1VITF 2BY6X 1O32A 4I32A 2TIOA 3HGNA 1GJ5H 5EPNA 4A92A 5JB8S 2WV4A 4WH6A 1EASA 1PFXC 4YLQH 1YPEH 3NCLA 3TLOA 2ZPRA 1RXPA 2CMYA 4ZROA 1DXWA 1D6WA 3LC5A 1TFXA 1XVOA 5EW2H 1CT4E 5C5NA 3M5LA 1PPCE 4CRGA 1NM6A 1SOZA 3MU4A 1XXFA 2Y7ZA 3ZZAA 4THNH 3TH2H 2RDLA 4LZ4B 1M9UA 1Z71A 2B0FA 1TPOA 2D8WA 1GI7B 2ZDAH 5F8ZA 1AE8H 1G2MA 2OCVB 1P8VC 1KXEA 4DG4A 1Z7KA 1VITG 2BOHB 1N1LA 4GUXA 4YOIA 4IC6A 3LU9B 2XBYA 4UFFH 4FUEA 5A8YA 3VB7A 1O2UA 4ZMAH 2HVXA 1TPPA 1K2I1 4ABBA 4DIIH 2BM2A 1WTGH 4F4OC 1JIRA 2H5CA 4CBOA 4B73A 2BDBA 3QUMP 2I6SA 2VGCC 3AAUA 3PLBA 1KXDA 1G3DA 1TX8A 2UUFB 4TPYA 2W3IA 1O2HA 1S83A 1UTOA 2VB0A 2F3CE 3F9FA 4IBLH 2A4RA 3TVJB 4WF8A 1A5IA 1SQTA 3GY6A 4JZFH 5K0HA