1F5KU

Urokinase plasminogen activator b-chain-benzamidine complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of the urokinase type plasminogen activator variant beta(c)-uPAin complex with small molecule inhibitors open the way towards structure-based drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5kU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5kU01
2FYQA 3ZV9A 1Q2WA 3UREA 1GJ5H 5F8TA 3BG8A 2K1QA 1RS0A 2WYGA 3ZV8A 3ZYEA 5K7RA 1VCWA 5B6OA 1UCYH 1OWDA 1UK4A 3ELAH 5EQQA 1QR3E 1E36B 4J2YB 2NU4E 1V2OT 2A4OA 2VNTA 1GJDB 4BTUB 1ZHMA 1ESAA 1H4WA 1TBZH 3VXFH 1O2ZA 1V2KT 3LGTA 2WPLS 2C90B 5SGAE 1O3LA 1ZMLA 1H8IH 4WJG2 1SMFE 1KXAA 1UK2A 1LHDH 4IBLH 2UUKB 2ZI2H 4HI3A 4YOGA 1GMHG 5ESTE 3ZVAA 4DURA 4ABFA 4WF8A 1O2MA 1ELDE 2G5NA 1AKSB 3SNDA 3S7HB 1C5TA 1GI5A 1BB0B 2XC5A 1P11E 1LMWB 2ZHEH 1C4V2 1ZPBA 2H6MA 3QX5H 1LHGH 1TBRH 4AFQA 1HJ9A 2OC0A 3DFJA 5HMAA 8ESTE 1XUIA 3QO6A 1BMNH 1EAXA 4O03A 4FUDA 3A7VA 1EUFA 2BYAX 5FX6A 1ZSKA 4GUXA 2XWBI 2WINI 3SGBE 1O2GH 1TNLA 4ZHMU 2XNIA 2PLXA 1SC8U 5FX5A 4JZ1A 1FY4A 2A2QH 3ATIA 1EZQA 2LPRA 2FOCA 2Z3EA 3BTGE 2A7JA 3P6ZB 1B0FA 1FONA 1HJAB 4XBBA 1CHOG 5E0JA 1V2NT 3K6ZA 1NFXA 2ZFSA 1YC0A 4Y8XA 2Z94A 2W7UA 2VWLA 1QJ1B 1QL8A 2CGAA 1C2MA 4B73A 5AFYH 3DUXH 2BLWA 1ELVA 1P2NA 3RC6A 1C5SA 5F8XA 3BEIB 4BANB 1AI8H 2VJ1A 2WV5A 1ANDA 2PKSB 4O97A 1BTHH 4JMYA 1G3EA 3PO1B 3ATKA 1TNGA 1P0SH 2ODYB 1S85A 3SHAH 3ZVBA 1VJAU 1TMBH 4HFPB 3TJVA 5BPEA 1P2KA 2VVUA 4H42U 3S9BA 1NPMA 4ZH8A 3SU1A 1AMHA 3VB7A 5A0BA 1OKXA 2ZFRH 1K1LA 3TH4H 3Q3KA 1UJ1A 3E0PB 4UFGH 2WPKS 2OUAA 4NFFA 3MU8A 1T8OA 1P01A 5A2MH 1BJVA 5FCKA 1ZYOA 3RUOA 2ZTXA 1MD8A 2FPZA 2IOTA 1A0JA 2LNCA 2XW9A 3KGPA 4BXWA 2QF3A 3TU7H 3F6UH 2VIWA 1AD8H 4Y6DA 3AASA 3SV6A 2W7SA 1UHBA 3DHKH 2BX4A 2F3CE 1GI9B 1FY8E 1MKXK 1LPKB 3E16B 1D6RA 1O3MA 4B71A 1KYNA 1GDNA 1UCYE 1WYKA 1UVSH 1Z1JA 2SGFE 1XXFA 3ZZ7A 2F9UA 1S84A 4Y7BA 5GJ4B 2ZGCA 1O36A 5DO4H 3MH4A 1BOQA 4BTTB 1ZHPA 4AN7A 4AOQA 3KIDU 4DOQA 1EPTC 3UTUH 3UIRA 2D26C 1CVWH 1Z6JH 2NU1E 1G32B 2I6SA 1IQHA 1OWHA 1YPJH 1SB1H 3A8CA 1O3PB 3EYDA 1P05A 4DG4A 3BSQA 4AFUA 1ABJH 4B2AA 4FXGH 4RN6A 3L6PA 1GJ7B 1KDQB 3D62A 2ASUB 2VH0A 4FVDA 4GSOA 4ZHLU 3E1XB 2ZCKP 1WU1A 1SGQE 1TX7A 3F68H 2J92A 2STBE 1NRNH 2Y82A 2FLRH 2NU0E 1GMCF 4E7NA 1P02A 1O3KA 1BMMH 3FANA 2ZEBA 3HGPA 1SR5C 1IQNA 4WMFA 1GI2A 2HNTC 1JRSA 2B0FA 2ZHFH 2CHAB 1O5CB 5GCHF 1KDQA 4DVAU 1HAZB 5EXNA 4TWWA 1HPGA 4MG3A 1GVZA 3VB6A 4D8NA 1J8AA 2QYIA 4TY7A 4X6PA 2AGGX 5C20A 2BXUH 1BA8B 3SUFA 5EPYA 5AHGH 1GG6C 4X8VH 2GMTC 1FQ3A 2GV7A 1T8NA 5JPMH 1AWHB 3IITA 4R8TB 1O2PA 3VEQB 2ZPSA 4SGBE 3HK6B 2XBWA 2Z9JA 2GCTC 3CP7A 5CHAC 2P3UB 1GI6A 2WPMS 2OCVB 2C4FH 5GDSH 4KTUA 4XFQA 2XCFA 2Z9LA 4K1EA 3MO6A 1DDJA 4X2XA 1SOTA 2AERH 5DP5A 3BTDE 1IQMA 1N1LA 1CA8B 3M3VA 1HIAB 1IHTH 2JKHA 2FOEA 2VIPA 2QXIA 4Q80A 1XUKA 3M3TA 3PM3A 4UFEH 3PMAB 1GMCG 2ZHDA 3BEUA 2QXGA 3GCTF 2H5DA 1SSXA 3CS0A 2GZ9A 3LGWA 3KNXA 5GCHG 4E7RG 3HGNA 2P3TB 2H5CA 3MI4A 1DOJA 1BBRH 1NFUA 1ZJDA 2QXJA 3FAOA 1C5MD 5I25A 1P10A 1A46H 1KY9A 1KXCA 1V2RT 5DK1A 2A5AA 4JZDH 2VWNA 1QGFA 4XBDA 1ZR0A 5J4QA 3F1SB 2PW8H 3OTJE 1Z8JB 1GDQA 3RXGA 1O3GA 3RXPA 3G01A 2ANMH 1V2JT 2PKAB 1TGNA 4X1QU 2FOGA 4Y79A 4AYYB 2QN5T 1GBFA 2HVXA 2AYWA 3S69A 2PSXA 4Y8YA 1UCYK 5FBIA 4X8SH 2P16A 2FMJA 2TBSA 2G52A 4B76A 1S82A 1O38A 3MNSA 3UNRA 3STJA 2XBVA 3GCHB 1QHRB 2ZZUH 3EQ0H 4Y76A 2PKAA 3MNXA 1LO6A 1DWDH 3UQVA 3U8TH 3RXOA 4IC6A 1ANEA 3SGQE 1YCPH 1BUIA 1BHXB 3RXEA 2ZU1A 2G5VA 3GCTG 1GBJA 2ZGXH 3RXUA 4ZKSU 1S0RA 4FUIA 1P9SA 4Z0KA 1AN1E 1HAYB 1TALA 1MTUA 1G9IE 2A5IA 5JBAS 2BDIA 1TMTH 3ZVEA 1KTTB 1O2VA 2ANKH 5DPAA 3LOXA 3UOPA 5BRRE 1MTVA 1W2KH 3URDA 2R3UA 2KAIA 2OP9A 2UUFB 1D3QB 1AFEH 1GI1A 1GVLA 1PQ7A 3A82A 4GAWA 3T26A 2OINA 2CJIA 1O2KA 4YLUA 5E2PA 8KME2 1DWBH 3ATLA 1GGDB 3SU3A 2V6NA 1AUTC 3ITIA 4JZFH 3URCA 1MCVA 3ESTA 5E2OA 4KTCA 3RDZA 1C5ZB 2WPHS 3U8OH 1G36A 4D7FA 4FUJA 3P92A 5K0HA 1Y3UA 3TLOA 2OC8A 3JZ2B 3AAUA 4CRBA 1YCPM 1CT4E 3KQEA 3PV4A 1O5GH 4GVUA 2BY8X 2W26A 1V2PT 4FU8A 3SU2A 1NESE 2FOAA 1LHCH 3QDZB 4TYDA 1BRCE 2PTNA 1SQTA 1TAWA 3M7QA 2Z9KA 4F49A 2BXTH 2ZCLP 3U1IB 4B74A 2PKSC 2J9NA 3EGKH 4TY6A 3A89A 4IMQA 1O3JA 1TYNA 2GD4B 4Y11E 2FOHA 1QRZA 1MCTA 1BMLA 3TPIZ 3QZRA 4ABDA 4E06H 1TPSA 1K1NA 1PQ5A 1G2MA 2FX4A 5ESBA 1ELEE 1VR1H 2J95A 5HM2A 1RIWB 1C1PA 1GVKB 4WWYA 1FPHH 1C4U2 1QQ4A 3P8GA 4CRGA 1DT2A 1ELCA 2FP7B 1LQDB 1Z71A 1GHAF 4Y7AA 1D4PB 3GDUA 1RGQA 2ZIQH 4MPWA 2WV4A 4CRAA 1IQEA 5AFZH 4KGAA 2O8WA 3DT0H 4WMDA 4TPYA 3MWIU 4GPGA 4NIYA 1J17T 1W11U 4Z6AH 2PHBA 1E38B 1GBLA 1JIRA 1D3TB 2A4QA 2BZ6H 1TBQH 1RXPA 4ISNA 2HNTF 1T7CA 3PLBA 1VITH 2BD8A 5TCCA 7KMEH 5EW2H 4ISOA 4A1VA 2PUQH 5EU8A 3SNAA 1O2OA 2F9PA 3RXVA 1ZJKA 4X0WU 1SFIA 4VGCC 2BVSH 1VZQH 3NWUA 1P12E 3GY7A 4MQAA 5DGJA 1DANH 1NRPH 1O2RA 2JH5D 2UWPA 2IPHA 2BOKA 2GDEH 4BTIB 1C5YB 1O39A 1GG6B 1A3EH 3KQDA 3PMJA 4H6TA 4KTSA 1QRXA 2XYAA 1GHAG 1C5QA 3RXTA 3VGCB 1K2I1 2STAE 3Q76A 4CH8B 2WYJA 1ZRBA 1A0HB 1SQOA 2ESTE 5CHAB 3QLPH 1GJ9B 1Y3WA 1KLTA 3WY8A 3RXSA 5JYIA 1ORFA 1ZTLA 3SV7A 1KTSB 3RU4T 4GCHF 2FI4E 2XCNA 2ZPRA 1QQUA 1ABIH 1ZGIA 2FXRA 1EP5A 1G30B 1W7XH 3QK1A 1XMNB 4X8UH 2HOBA 2W3KA 4RKJB 4FUHA 3BTWE 5FBEA 1GI3A 2ZHWH 3CS7A 2BLQA 5C3NA 1T8LA 1LVMA 2ZFPH 3OU0A 1EP6A 4MPXA 1GBBA 1SI5H 4X6NA 1N8OB 1RRKA 3BG4B 4SGAE 1W14U 5CE1A 1UHBB 3ODFA 2A4GA 2TGPZ 1ZSLA 1O5BB 1GI4A 2A0QB 2UWOA 3MU1A 4IC5A 2ZDVH 1AFQB 4RKOB 2O8LA 5DG6A 1ELAA 1DLEA 4I8GA 3M37A 2AIPA 1GBCA 2H9EH 3LONA 1VJ9U 3GICB 3BTTE 5G4BA 2R0LA 2XTTB 2J94A 3EA7A 1J16A 2G55A 2I6QA 1C5LH 1PQ8A 1XKBC 4WMEA 1TNKA 4AG2A 1YKTA 1YPLH 3O8CA 1O34A 3GOVB 3F9EA 2GTBA 4GCHG 1DY8A 3ZZ4A 4CREA 1XUFA 2A7HA 1MQ5A 4U01A 4LK4A 6LPRA 3PTBA 3TK9A 3RXCA 4JYUH 3V0XA 2UWLA 1CHGA 4INKA 3E8LA 1HAHH 4XSKU 4MPVA 4DGJA 5FPYA 1BBRK 2B8OH 2HWLB 5C67A 4JK6A 1RFNA 3FP6E 3SQHE 4CRDA 6ESTA 1D6WA 1NS3A 1OYTH 1MZAA 1C5PA 1AIXH 1FDPA 4BXSA 3MH6A 1UTPA 2P94A 4ABIA 4BNRA 3PLPA 4PROA 1DS2E 1BDAA 3DFLA 2ZDNA 2EI8A 3MNBA 2D2DA 2BZAA 1CBWB 2F9NA 1C5NH 1FIWA 4NIWA 1VCPA 1DX5M 1EAUA 1RD3B 3ZZCA 8LPRA 5L2ZH 1HLTH 1SLWB 3KN2A 1HYLA 3GCHC 4OGXA 2OQ5A 4DIHH 4BAHB 1ARBA 4OS7A 4U2WA 1UTNA 4UONA 1C9TA 5JBCS 2H9HA 3RXHA 1SGIB 1TRNA 1L4ZA 1QURH 1HAIH 4WXVA 2Q6DA 1LVYA 1P2QA 1DM4B 4NZLA 1CA0B 1O3IA 4X2WA 1YPMH 1GHVH 3RXFA 2ZKSA 4D9QA 1GJ4H 1AE5A 2SGAA 2F83A 1ZLRA 3TH3H 5LGOA 2QCYA 3QGNB 4CRCA 2VH6A 2NU3E 3ZZ5A 5DP9A 3MO9A 4DIIH 4M7GA 1Q31A 5C5NA 3SBKA 1TLDA 1V2MT 3SI3H 7ESTE 1RJXB 1P9UA 1SGYE 1O30A 4D76A 3A7TA 1OP0A 2ZECA 3EAJA 5A09A 3P95A 3U8RH 2GZ7A 3M36A 1DITH 1GGDC 2BDGA 3TGIE 1GHBF 3SV8A 1LHEH 3FFGA 4ABJA 1L1GA 4IN2A 4ZROA 5A8YA 1LKBA 3A8BA 4YTAA 5AF9H 3BTFE 2ZO3H 2PV9B 2ODPA 3TJOA 5EXLA 1O2WA 1W3CA 3RP2A 1BTWA 2M5TA 1A1RA 2V3OH 1IQLA 3PLKA 1E37B 1OYQA 1KXDA 3HPTB 1IQFA 1QBNA 3TK6A 1C2FA 1C9PA 2AMQA 3L33A 8GCHF 3FVFB 3VPKA 1NO9H 2BD4A 2ZDMA 3E91A 1FLEE 1NFYA 1G3CA 3PMHB 3RXBA 1OOKB 4FVBA 5HGGA 3TJNA 1P2IA 2Z3CA 2QF0A 3RC4A 2BQ6B 1YPEH 3A7WA 1CGJE 1O2TA 4B2BA 4NIXA 1QJ6B 5C5OA 1M9UA 4VGCB 4NIVA 4X6OA 1O3NA 1NRQH 3GY2A 4UFDH 1UTJA 2FODA 4Q7XA 1RIWC 3R3GB 1HB0B 1DFPA 4X2VA 1W0YH 1C5VA 2OXSA 1GJAB 1GWAA 1O2UA 1ZOMA 2YOLA 3GCOA 3GY8A 3PROA 1O2XA 4OS4A 4MVNA 4ZMAH 1G37A 3QZQA 1SLUB 2Y5GA 1NN6A 1K1JA 3SV9A 1TFXA 1ZPCA 1TIOA 1X7AC 2BQWB 5F6MA 2SGDE 8GCHG 3P8FA 1TNIA 5DP6A 4BOHA 1HAGE 2QXHA 1UTQA 1K28D 1MD7A 2A5KA 1UTMA 5EG4A 2XC0A 3SNEA 5FPTA 1W7GH 2Y80A 1GBMA 1O35A 2B7DH 1Y8TA 3TK5A 1T8MA 4WY3A 1IQGA 1SOZA 2H9TH 1JRTA 2WUBA 2ZU4A 2PTCE 2RA3A 4YM9A 3OY6U 2TPIZ 2ZGBH 3FZDA 4UEHH 5PTPA 2J34A 3RU4D 4FUEA 2G4TA 3PYHA 1QB6A 3NPSA 3LC3A 3S9AA 3S9CA 3QWCH 1AZ8A 5TCAA 1LTOA 1UVTH 2UUJB 3VGCC 5FPSA 3F9GA 1O2JA 2W5EA 3Q77A 2P8OB 1BITA 1HGTH 4FU9A 2BQ7B 1O5AB 3MU5A 1WV7H 1JMOH 1F5LA 3RXAA 4AFSA 2XWAA 3SUEA 3LKWA 2ZFFH 1C2KA 1TX6A 3RLWH 1HAVB 4NG9H 1A5HA 1THSH 2VWMA 1FPCH 3LT3A 1C2LA 2VIDA 1L4DA 1MH0A 2VIQA 2BOHB 1DLKB 9LPRA 1XUHA 3SI4H 4Q7YA 4GHTA 3SJ8A 1N8OC 3BG4C 5C1UA 3M7TA 4X8TH 2B5TB 3BN9A 1ETRH 1V2QT 1HAVA 1ELFA 4Y10E 2HGTH 2ZNKH 1BT7A 1S0QA 1GMDF 2P3FH 3UFAA 1GJBB 1AFQC 3SORA 5EQRA 2OQUA 1EZXC 5EPNA 3RMNH 1SGTA 4INHA 2ZU5A 5F03A 3M3SA 1Y5UT 2D1JA 2VU8E 3ZZBA 3P8NA 3M5MA 1YP9A 2FM2A 3RXQA 1IOEA 1GHZA 1SGPE 2V3HH 2BDYA 1G3BA 1YPKH 1NC6A 3VB3A 3MO3A 3V7TA 4NA8A 2V35A 2Y7ZA 4K1TA 3AW0A 4UFFH 4BAQB 2BMGB 2ZDLA 2EC9H 1O2IA 3HATH 5L2YH 1QTFA 1UVUH 5IYTA 3K6YA 1H9LB 2GDDA 1F0SA 2ZF0H 1UVOA 1O2QA 1MMJN 1GDUA 3MFJA 4IW4E 1FIZA 3F9FA 1AQ7A 2BHGA 4MPUA 1U6QA 3ZZ8A 2VVVA 1WTHD 1PQAA 2ZQ2A 1AVGH 3EA8A 3ATMA 2KAIB 5EW1H 1FMGA 1BZXE 2QGRA 3TITA 1TMUH 3NXPA 1MTSA 4A1XA 3SUGA 2C93B 1GMDG 1W10U 2BX3A 3V3MA 4E05H 1ZTJA 1OX1A 1S6FA 1EZSC 2BVRH 1LPGB 2D8WA 3P8OA 1D3DB 4ASHA 2ZWLH 3GISB 1CBWC 1F5RA 4ZKRU 1PPBH 2HLCA 2Y5FA 2PWXA 3UY9A 1CGIE 1CT2E 2IN2A 5FHTA 3CENA 3SJOA 4CH2B 5JBTA 1SGFA 5EQSA 1HAXB 3MHWU 4LZ4B 3BEFB 1XVMA 1Z8RA 2FWWA 3M5OA 3SW2B 2QC2A 3LH1A 3MMGA 1F0UA 1AB9C 1KSNA 2BDHA 1GHYH 1TOMH 4I7YH 3C1KA 1AVWA 1GCTB 3UR9A 3RXDA 1HJ8A 3GDSA 4DT7B 1CA0C 3SU4A 2FOMB 3A88A 4ZAEA 1MAXA 4XBCA 3U1JB 2CV3A 1L1JA 1O2YA 2VB0A 2FX6A 3SU5A 2JH6D 2ZGHA 1SGFG 1L0ZA 1TQ0B 2UUYA 2F9BH 2FOFA 1GJCB 3UNSA 1ZMNA 3AVZA 4ABBA 1PYTC 2PR3A 4ESTE 1NT1A 1HCGA 4UD9H 3KEEA 2GKVE 1C1UH 2SFAA 1HFDA 3UOUA 1TGCA 1YBWA 2VGCC 1YPHE 1PJPA 1OS8A 3A85A 3SZNA 4OS5A 5FAHA 1QL7A 3D65E 2PGQB 1C5WB 4HGCA 1O31A 1O2LA 2ZFTA 1J15A 1FY5A 1QBVH 2CMYA 1AWFH 1EAIA 1N6XA 1TGTA 2FESH 5E0HA 3RXJA 1PPGE 4KKDA 1OP2A 2GVFA 3S0NA 1LQEA 4AFZA 3ENSB 3RXKA 3OYPA 1NRSH 1ACBE 1Y3XA 1BQYA 1P09A 3BV9B 3RC5A 5T3HA 1C2JA 3RM0H 1O33A 2BD3A 1V2LT 3DD2H 2BD2A 4AYVB 1LVOA 2FOBA 3GYMA 1PPHE 4KELA 1MQ6A 3T5FH 1PPEE 4XOJA 5DP8A 1GBKA 3M35A 2XBYA 2Y81A 2Q1JA 1BJUA 3ZZAA 1EOJA 4DW2U 1C5XB 4FUGA 1Y5BT 2AH4X 3A8DA 4Y71A 3SNBA 1BTYA 4I33A 3MH5A 1TRMA 2Q6FA 3NCLA 5TJXA 1FUJA 1YLDA 4MNXA 1VCQA 2Y7XA 2C8ZB 1A7SA 1OSSA 3LJOA 3SOSA 1L1NA 2BY6X 2A4RA 1EATA 3LGIA 1FNIA 1L2EA 2AMPA 2FI3E 3TGKE 2BDCA 3IG6B 3UWIA 1RTFB 1K1PA 1PPFE 1Y59T 1O5EH 3ATWA 2RA0A 4MLFB 5LH8A 1O3BA 1CE5A 1XUGA 4AB8A 2OC1A 1GHWH 1P3CA 1S81A 2H1UA 2Y5HA 3W95A 4QT8C 4I8JA 1OXGA 1WCZA 3N7OA 4X1RU 1WSSH 2ANWA 1YPGH 1AGJA 2F9OA 2QAAA 3E6PH 2CF9H 5T6FA 4WVPE 1RTKA 1NROH 4R0IA 1QBOA 2PSYA 4CHAB 5HM9A 5JB8S 3UPEA 2WPIS 2A45B 1H1BA 4BAKB 1MBQA 5C2ZA 1DE7H 4BAOB 2ZTZA 3LIWA 3RMOH 5T6DA 1ZPZA 2O9QA 2VIVA 3A81A 4JZEH 4JK5A 1H9IE 1DXWA 3RM2H 2SNVA 1SL3A 2P95A 1SFQB 1C2DA 2BD9A 1C2EA 2P59A 1Y5AT 4BAMB 5GWZA 2BY5X 2P8OC 1BTXA 1XM1A 1O5FH 3A84A 1ETSH 1C1NA 2SNWA 2ZU2A 2VINA 1OWKA 7GCHF 2BLVA 1TABE 4DJZB 4YLQH 7LPRA 4NWKA 2YNBA 4ISHH 2ALPA 4K5ZA 2C8WB 5DP4A 1INCA 5A8XA 1DSUA 1YGCH 1H9HE 3LGUA 3AW1A 2SGQE 2ZC9H 1O2NA 3I78A 1K1MA 1QFKH 2Z6BD 3RXLA 4ISLA 1VGCB 1O2SA 1TWXB 2G81E 2PGBB 5GXPA 1CT0E 4WH8A 1GBHA 3H7OA 5FXLA 1UTLM 2R2MB 1ZTKA 1A0LA 3EE0B 1ARCA 2O8MA 1GJ6A 3ZZ6A 1TRYA 1EB2A 2NWNA 1TB6H 1XUJA 3FP7E 4AB9A 1CHOF 1HAPH 2XC4A 3DA9B 2EA3A 4ZUHA 3VXEH 1E35B 1W13U 2R2WU 3RLYH 3K65B 4YT6H 4ZXYH 3LC5A 1QY6A 3Q3XA 1ELTA 1A5GH 2ZG0H 1P2JA 1CU1A 1SGRE 1O0DH 4OS2A 1MKWH 3T25A 1JBUH 1FV9A 4UDWH 3JZ1B 4AGKA 1K9OE 4OS6A 1PPCE 7GCHG 2OBQA 2FZZA 2HRVA 5GIBA 3MH7A 2THFB 1FN6A 2A32A 1ELGA 1ZMJA 3QGJA 3KF2A 3MTYA 4OGYA 1DXPA 2BY9X 1BTUA 4X1PU 4X2YA 4YOJA 3UR6A 1NM6A 2OBOA 1AB9B 1YCPK 5EGMA 1GJ8B 1DWCH 4I32A 2O8UA 5IDKA 1A61H 1C1WH 1V2ST 2DE9A 1AKSA 1NTPA 1P2MA 3KCGH 4WXIA 3GY6A 4H6SB 3LH3A 5DKMA 1F2SE 1UO6A 1K22H 1YM0A 2RCEA 2F91A 1ELBA 1QB9A 1JWTA 2ZQ1A 1E34B 5EODA 1TX8A 1V2VT 1P04A 2BD7A 1NY22 2AIQA 2ULLA 3UUZA 2VGCB 3AAVA 2AGEX 3ZZ9A 1E0FD 1AU8A 1QB1A 3UQOA 3PWBA 3TH2H 3VB5A 3C27B 2BLOA 3KL6A 1AVXA 1W0ZU 1IHSH 4LZ1H 3Q3YA 2ZCHP 4ZKNU 1DPOA 3QTOH 6CHAB 3TNTA 4NA7A 1EOLA 4YT7H 1IAUA 4IMZA 5JBBS 1SGCA 4THNH 5A0AE 3OX7U 2HPQH 3HKJB 1GCTC 1O3EA 3PWCA 3TNSA 4I31A 3TGJE 1AE8H 1WQSA 3HKIB 3GDVA 1OWIA 1V2TT 2C8XB 1ANCA 1TA2A 1C1OA 4FUFA 1JXPA 4ISIH 2C3SA 1QL9A 3QUMP 2DE8A 1Z7KA 1TGBA 4K69A 1DUAA 1CO7E 1B7XB 1ZRKA 2CF8H 2ANYA 2FO9A 2FYRA 3LU9B 3SU6A 3BIVH 3NK8A 1QJ7B 2HPPH 2TGTA 4NA9H 2A1DB 4CR5A 4ABHA 2IJOB 1GPZA 3A86A 3T27A 5A0CA 3ZVDA 3O8RA 3K2UA 1SPJA 2RG3A 1BMAA 1UK3A 1HUTH 5HXFA 3VFEA 1B0EA 1HV7A 1EASA 4ABGA 1PYTD 4FU7A 3FZZA 4NCYA 1THPB 3O8BA 1TNJA 1GBTA 4A5TS 1G3DA 1BTZA 2ZPQA 1EXFA 3SO3A 4O3TA 1H8DH 3EDXB 5C1XA 1QIXB 2FS8A 2GV6A 1V3XA 2HNTE 1GHBG 3ZYDA 3RMMH 1QA7A 1UTOA 3HK3B 4HZHA 2GGVB 2BTCE 1FI8A 4A92A 3SQEE 1WUNH 2AS9A 1HXEH 1ANBA 3BTME 3B23B 2FIRH 2PFEA 2Z9GA 2ODQA 2TIOA 3SJKA 1K21H 3GCNA 2DUCA 1ID5H 1FJSA 2R3YA 1O2HA 1C4Y2 1HDTH 2BD5A 4YESB 2B9LA 1XKAC 4X1NU 1F7ZA 4Y0ZE 3A83A 1T31A 1V6DA 4CBNA 3B8JA 4TPIZ 1N6YA 1DWEH 4JCNA 1SG8B 1SHYA 4NGAH 1ZHRA 2ZGJA 1S83A 1GI7B 1BRBE 1JIMA 1C2GA 1WOFA 1FAXA 2ZU3A 1LVBA 1V2WT 1XX9A 1P06A 3BTKE 1EJNA 1ZZZA 1AZZA 1D3PB 2FDAA 5J4SA 4Y0YE 3H7TA 4IN1A 1K1IA 2GT7A 3M61U 3KQBA 5LPRA 1T32A 2RDLA 3NKKA 3T28A 1ZGVA 3UNQA 4ZXXH 2FS9A 3PMBB 2JETC 1TONA 4MNWA 1TQ7B 1C1QA 1J14A 1UTKA 3ZVCA 1SGDE 1C2IA 1O3AA 3PTNA 4J1YA 3V12A 2VVCA 2G4UA 4I8HA 4YO9A 4NZQA 1KLIH 5EXMA 1LCYA 1C1VH 1MAYA 2WUCA 2ZDKA 4B2CA 3OSYA 3RMLH 2EI6A 1HRTH 3MU4A 4O9VA 1A3BH 4DCDA 5JB9S 4FUBA 1MTNC 3QTVH 2SGEE 3GY4A 4GHQA 1CQQA 1EX3A 1Z8GA 4CHAC 1HBTH 2VWOA 1TOCB 4D9RA 3KHVA 1Z8IB 2BM2A 4YOIA 4CBOA 2Y6TA 4MNVA 1FAKH 5L30H 2J4IA 2J38A 1DVAH 4LXBH 3LDXH 1GBAA 1LPZB 1EJAA 1TPPA 3STIA 2ZDAH 1THRH 3S7KB 4INLA 4U32A 5DP3A 3A7XA 5ETXA 4B1TA 1C1MA 1PPZA 2SGPE 2ZFQH 3NUMA 3A7YA 2BVXH 1EKBB 1HIAA 3LGVA 3SNCA 1LHFH 4H4FA 5I46H 5EOKA 4K1SA 5F8ZA 1SHHB 5A8ZA 5LPFA 1Q3XA 2AFQB 2ZTYA 1F92A 1EJMA 1SLVB 4AG1A 3KQCA 3I77A 2BB4A 1EB1H 3RXIA 1S6HA 3RXRA 5LPEA 4UE7H 1CSOE 1O3DA 2ILNA 3GY5A 4ABAA 1G2LA 1YYY1 1DICA 1SLXB 3Q00A 3SJIA 3ZZ3A 1EZUC 1O3HA 1C1TA 3OY5U 2TGDA 4ABEA 5JDUB 2XBXA 1VGCC 1Y3VA 1GCDA 4A6LA 1MTWA 3MU0A 1F0TA 1P3EA 1IQJA 5C1YA 1BHXF 4RSPA 9ESTA 2JH0D 4ZKOU 1P03A 3SGAE 1C5RA 3UWJH 4NFEA 1EQ9A 1MZDA 4DY7B 3QN7A 1UVPA 1MKWK 1JOUB 3O8DA 4AZ2B 1LKAA 1FY1A 4JYTA 3BTHE 1Z1IA 1W8BH 2A31A 2AGIX 1AHTH 4MNYA 1NFWA 1AUJA 1SVPA 2J2UA 1VITF 1P57B 3TIUA 2G00A 1MU8B 1B5GH 1WQVH 3ZZDA 4TWYA 1O3OA 5CMXH 4NSYA 1MUEB 1KLJH 3U98H 2W3IA 3BIUH 4K8BA 3M7UA 4ZHAA 1T4UH 1DUEA 3ZVFA 5DP7A 2GZ8A 2GT8A 1WBGB 2Z7FE 1UMAH 1C5UA 3LGYA 4KP0A 2GCHF 3P17H 2QV1A 2OC7A 1GBIA 1EAWA 5DJ7A 1S5SA 3K9XB 3M5LA 1YLCA 1FY3A 1HJAC 3GYLB 5GPIB 3PB1E 4K60A 1SBWA 1A4WH 1KXBA 1KXFA 4I8LA 5T6GA 4D7GA 1C2HA 1OWJA 4U30A 1YF4A 3NZIA 1O5DH 3SN8A 4NWLA 1GBDA 2G51A 4LOYH 1TGSZ 1P8VC 2V0BA 1QNJA 3SUDA 6CHAC 1ESTA 3MOCA 1TNHA 2FEQH 5ABWA 1RTLA 4JZIA 1FN8A 4HTCH 1FXYA 3TVJB 2Z3DA 4K2YA 2OLGA 1VITG 4NSVA 1SQAA 1MKXH 3RU4E 3PO1C 3B9FH 1W12U 2ZP0H 2HALA 3SU0A 1BCUH 2BDAA 4A7IB 2FI5E 1HNEE 1GBEA 2TRMA 4CR9A 3R0FA 4I8KA 3VB4A 3BF6H 3I29A 6GCHF 2AEIH 3MYWA 4X1SU 1SGEE 2GCHG 3E3TA 3LPRA 3ODDA 1EPTB 1P2OA 3BTEE 3T29A 4YZUA 1F5KU 1NRRH 2R0KA 2FLBH 1A5IA 1BBRE 3GY3A 3IWMA 1HXFH 3F9HA 1NZQH 1BIOA 4IGDA 2TGAA 2OTVA 1GI0A 1GL1A 2BY7X 1C5OH 2PUXB 3W94A 1TPOA 1IQKA 2GX4A 4GLYA 3ZVGA 2CXVA 1IQIA 1YPHC 1EPTA 4Q2KA 1SGNE 1FZZA 1XXDA 2AMDA 5FCRA 5HYOA 1OPHB 1ESBA 2A7CA 4XE4A 3T62A 1C1SA 1PFXC 1Z6EA 2R9PA 1OP8A 4X6MA 3LJJA 3SJ9A 1A2CH 3A7ZA 3V13A 1DY9A 1QRWA 3MNCA 2QIQA 1ETTH 1DSTA 2JETB 2A2XH 1GI8B 1LDTT 4FUCA 2O8TA 1AY6H 1O32A 1C1RA 1NU7B 2BDBA 2EEKA 3D23A 5AVDA 3SV2H 3D49H 2C8YB 5E8EH 3M5NA 2F9VA 1ZSJA 2GMTB 4Y8ZA 1QCPA 1BRAA 6GCHG 4F4OC 2XRCA 1HAOH 1T4VH 5E0GA 1WTGH 2QA9E 3FP8E 4K3JA 3U69H 4MTBA 1CGHA 1MTNB 1D9IA 4AX9H 1O37A 2GCTB 1AO5A 4XDEA 3A87A 3SHCH 4AGJA 1V2UT 2FTLE 1NU9A 2GP9B 4B75A 4CRFA 2VIOA 3E90B 2ZA5A 4O3UA 3L3TA 2NU2E 1QA0A 3A80A 1GL0E 1GHXH 3U9AH 2EI7A 1WAYB 1KXEA 2Q6GA 1MBMA 2ALVA 1TPAE 3H5CB 1F0RA 2H2ZA 3A8AA 4Q7ZA 3EA9A 2CHAC 5L6NH 4WH6A 1K1OA 5H4IB 2WPJS 4A1TA 2YNAA 4IS5A 2OD3B 2FTMA 2QY0B 1OWEA 1MU6B 1J9CH 1GMHF 1KIGH 2ZHQH 4OS1A 3RXMA 1XVOA 1Y3YA 3E0NB 2XXLA 4K8YA 2Z9IA 1O3CA 4MDSA 3BTQE 1O3FA 2CN0H 1BTPA 2P93A 3P70B 1TE0A 4JYVH 1BRUP 1TA6A 3T2NA 4AORA 3TJUA 2G8TA
chains in the Genus database with same CATH superfamily
2FYQA 1NBME 3ZV9A 1Q2WA 3UREA 1GJ5H 5F8TA 3BG8A 2K1QA 1RS0A 2WYGA 3ZV8A 3ZYEA 5K7RA 1VCWA 5B6OA 1UCYH 1OWDA 1UK4A 3ELAH 5EQQA 1QR3E 1E36B 4J2YB 2NU4E 1V2OT 2A4OA 2VNTA 1GJDB 4BTUB 1ZHMA 1ESAA 1H4WA 1TBZH 3VXFH 1O2ZA 1V2KT 3LGTA 2WPLS 2C90B 5SGAE 1O3LA 1ZMLA 1H8IH 4WJG2 1SMFE 1KXAA 1UK2A 1LHDH 4IBLH 2UUKB 2ZI2H 4HI3A 4YOGA 1GMHG 5ESTE 3ZVAA 4DURA 4ABFA 4WF8A 1O2MA 1ELDE 2G5NA 1AKSB 3SNDA 3S7HB 1C5TA 1GI5A 1BB0B 2XC5A 1P11E 1LMWB 2ZHEH 1C4V2 1ZPBA 2H6MA 3QX5H 1LHGH 1TBRH 4AFQA 1HJ9A 2F4LA 2OC0A 3DFJA 5HMAA 8ESTE 1XUIA 3QO6A 1BMNH 1EAXA 4O03A 4FUDA 3A7VA 1EUFA 2BYAX 5FX6A 1ZSKA 4GUXA 2XWBI 2WINI 3SGBE 1O2GH 1TNLA 4ZHMU 2XNIA 2PLXA 1SC8U 5FX5A 4JZ1A 1FY4A 2A2QH 3ATIA 1EFRD 1EZQA 2LPRA 2FOCA 2Z3EA 3BTGE 2A7JA 3P6ZB 1B0FA 1FONA 1HJAB 4XBBA 1CHOG 5E0JA 1V2NT 3K6ZA 1NFXA 2ZFSA 3F2HA 1YC0A 4Y8XA 2Z94A 2W7UA 2VWLA 2KFWA 1QJ1B 1QL8A 2CGAA 1C2MA 4B73A 5AFYH 3FN8A 3DUXH 2BLWA 1ELVA 5CDFE 1P2NA 3RC6A 1C5SA 5F8XA 3BEIB 4BANB 1AI8H 2VJ1A 2WV5A 1ANDA 2PKSB 4O97A 1BTHH 4JMYA 1G3EA 3PO1B 3ATKA 1TNGA 1P0SH 2ODYB 1S85A 3SHAH 3ZVBA 1VJAU 1TMBH 4HFPB 3TJVA 5BPEA 1P2KA 2VVUA 4H42U 2QE7D 3S9BA 1NPMA 4ZH8A 3SU1A 1AMHA 3VB7A 5A0BA 1OKXA 2ZFRH 1K1LA 3TH4H 3Q3KA 1UJ1A 3E0PB 4UFGH 2WPKS 2OUAA 4NFFA 3MU8A 1T8OA 1P01A 5A2MH 1BJVA 5FCKA 2KCYA 1ZYOA 3RUOA 2ZTXA 1MD8A 2FPZA 2IOTA 1A0JA 2LNCA 2XW9A 3KGPA 4BXWA 2QF3A 3TU7H 3F6UH 2VIWA 1AD8H 4Y6DA 3AASA 3SV6A 2W7SA 1UHBA 3DHKH 2BX4A 2OK5A 2F3CE 1GI9B 1FY8E 1MKXK 3PV5A 1LPKB 3E16B 1D6RA 1O3MA 4B71A 1KYNA 1E1RD 1GDNA 1UCYE 1WYKA 1UVSH 1Z1JA 2SGFE 1XXFA 3ZZ7A 2F9UA 1S84A 4Y7BA 5GJ4B 2ZGCA 1O36A 5DO4H 3MH4A 1BOQA 4BTTB 1ZHPA 4AN7A 4AOQA 3KIDU 4DOQA 1EPTC 3UTUH 3UIRA 2D26C 1CVWH 5EIYA 1Z6JH 2NU1E 1G32B 2I6SA 1IQHA 1OWHA 1YPJH 1SB1H 3A8CA 1O3PB 3EYDA 1P05A 4DG4A 3BSQA 4AFUA 1ABJH 4B2AA 4FXGH 4RN6A 3L6PA 1GJ7B 1KDQB 3D62A 3PV2A 2ASUB 2VH0A 4FVDA 4GSOA 4ZHLU 3E1XB 2ZCKP 1WU1A 1SGQE 1TX7A 3F68H 2J92A 2STBE 1NRNH 2Y82A 2FLRH 2NU0E 1GMCF 4E7NA 1P02A 1O3KA 1BMMH 3FANA 4XRNA 2ZEBA 3HGPA 1SR5C 1IQNA 4WMFA 1GI2A 2HNTC 1JRSA 2B0FA 2ZHFH 2CHAB 1O5CB 5GCHF 1KDQA 3OAAD 4DVAU 1HAZB 5EXNA 4TWWA 1HPGA 4MG3A 1GVZA 3VB6A 4D8NA 1J8AA 2QYIA 4TY7A 4X6PA 2AGGX 5HIYA 5C20A 2BXUH 1BA8B 3SUFA 5EPYA 5AHGH 1GG6C 4X8VH 2GMTC 1FQ3A 2GV7A 1T8NA 5JPMH 1AWHB 3IITA 4R8TB 1O2PA 3VEQB 2ZPSA 4SGBE 3HK6B 2XBWA 2Z9JA 2GCTC 3CP7A 5CHAC 2P3UB 1GI6A 2WPMS 2OCVB 2C4FH 5GDSH 4KTUA 4XFQA 2XCFA 2Z9LA 4K1EA 3MO6A 1DDJA 4X2XA 1SOTA 2AERH 5DP5A 3BTDE 1IQMA 1N1LA 1CA8B 3M3VA 1HIAB 3F0OA 1IHTH 2JKHA 2FOEA 2VIPA 2QXIA 4Q80A 1XUKA 3M3TA 3PM3A 4UFEH 3PMAB 1GMCG 2ZHDA 3BEUA 2QXGA 3GCTF 2H5DA 1SSXA 3CS0A 2GZ9A 3LGWA 3KNXA 5GCHG 4E7RG 3HGNA 2P3TB 2H5CA 3MI4A 1DOJA 1BBRH 1NFUA 1ZJDA 2QXJA 3FAOA 3U28C 1C5MD 5I25A 1P10A 1A46H 1KY9A 1KXCA 1V2RT 5DK1A 2A5AA 4JZDH 2VWNA 1QGFA 4XBDA 1ZR0A 5J4QA 3F1SB 2PW8H 3OTJE 1Z8JB 1GDQA 3RXGA 1O3GA 3RXPA 3G01A 2ANMH 1V2JT 2PKAB 1TGNA 4X1QU 2FOGA 4Y79A 3FKSD 4AYYB 2QN5T 1GBFA 2HVXA 2AYWA 3S69A 2PSXA 4Y8YA 1UCYK 5FBIA 4X8SH 2P16A 2FMJA 2TBSA 3OTPA 2G52A 4B76A 1S82A 1O38A 3MNSA 3UNRA 3STJA 2XBVA 3GCHB 1QHRB 2ZZUH 3EQ0H 4Y76A 2PKAA 4M9FA 3MNXA 2WZQA 3DSPA 1LO6A 1DWDH 3UQVA 3U8TH 3RXOA 4IC6A 1ANEA 3SGQE 1YCPH 1BUIA 1BHXB 3RXEA 2ZU1A 2G5VA 3GCTG 1GBJA 2ZGXH 3RXUA 4ZKSU 1S0RA 4FUIA 1P9SA 5EJZA 4Z0KA 1AN1E 1HAYB 1TALA 4RT1A 1MTUA 4ACBA 1G9IE 2A5IA 5JBAS 2BDIA 4FETA 1TMTH 3DSGA 3ZVEA 1KTTB 1O2VA 2ANKH 5DPAA 3LOXA 3UOPA 5BRRE 1MTVA 4FOUC 1W2KH 3URDA 2R3UA 3DSOA 2KAIA 2OP9A 2UUFB 1D3QB 1AFEH 1GI1A 1GVLA 1PQ7A 3A82A 4GAWA 3T26A 2OINA 2CJIA 1O2KA 4YLUA 5E2PA 8KME2 1DWBH 3ATLA 1GGDB 3SU3A 2V6NA 1AUTC 3ITIA 4JZFH 3URCA 1MCVA 3ESTA 5E2OA 4KTCA 3RDZA 1C5ZB 2WPHS 3U8OH 1G36A 4D7FA 4FUJA 3P92A 5K0HA 1Y3UA 3TLOA 4RT0A 2OC8A 3JZ2B 3AAUA 4CRBA 1YCPM 1CT4E 3KQEA 3PV4A 1O5GH 4GVUA 2BY8X 2W26A 3UB0A 1V2PT 4FU8A 3SU2A 1NESE 2FOAA 1LHCH 3QDZB 4TYDA 5EJ1A 1BRCE 2PTNA 1SQTA 1TAWA 3M7QA 2Z9KA 4F49A 2BXTH 2J98B 2ZCLP 3U1IB 4B74A 2PKSC 2J9NA 3EGKH 4TY6A 3A89A 4IMQA 1O3JA 1TYNA 2GD4B 4Y11E 2FOHA 1QRZA 1MCTA 1BMLA 3TPIZ 3QZRA 4ABDA 4E06H 1TPSA 1K1NA 1PQ5A 1G2MA 2FX4A 5ESBA 1ELEE 1VR1H 2J95A 3OFND 1RIWB 5HM2A 4ZCNA 1C1PA 1COWD 1GVKB 4WWYA 1FPHH 1C4U2 1QQ4A 3P8GA 2J98A 4CRGA 1DT2A 1ELCA 2FP7B 1LQDB 1Z71A 1GHAF 4Y7AA 1D4PB 3GDUA 1RGQA 4F55A 2ZIQH 4MPWA 2WV4A 4CRAA 1IQEA 5AFZH 4KGAA 2O8WA 3DT0H 2V3MA 4Q63A 4WMDA 3NRLA 4TPYA 3MWIU 4GPGA 4NIYA 1J17T 1W11U 4Z6AH 2PHBA 1E38B 1GBLA 1JIRA 1D3TB 2A4QA 2BZ6H 1TBQH 1RXPA 4ISNA 2XNDD 2HNTF 1T7CA 3PLBA 1VITH 2BD8A 5TCCA 7KMEH 5EW2H 4ISOA 4A1VA 2PUQH 5EU8A 3SNAA 1O2OA 2F9PA 3RXVA 1ZJKA 4X0WU 1SFIA 4VGCC 2BVSH 1VZQH 2RFKC 3NWUA 1P12E 3GY7A 4MQAA 5DGJA 1DANH 1NRPH 1O2RA 2JH5D 2UWPA 2IPHA 1YWUA 2BOKA 2GDEH 4BTIB 1C5YB 1O39A 1GG6B 1A3EH 3KQDA 3PMJA 4H6TA 4KTSA 1QRXA 3W1EA 2XYAA 1GHAG 1C5QA 3RXTA 3VGCB 1K2I1 2STAE 3Q76A 4CH8B 2WYJA 1ZRBA 1A0HB 1SQOA 2ESTE 5CHAB 3QLPH 3N7DA 1GJ9B 1Y3WA 1KLTA 3WY8A 3RXSA 5JYIA 1ORFA 1ZTLA 3SV7A 1KTSB 3RU4T 4GCHF 2FI4E 2XCNA 2ZPRA 1QQUA 1ABIH 1ZGIA 2FXRA 1EP5A 1G30B 1W7XH 3QK1A 1XMNB 4X8UH 2HOBA 2W3KA 4RKJB 4FUHA 3BTWE 5FBEA 1SQRA 3ZIAD 1GI3A 2ZHWH 3CS7A 2BLQA 5C3NA 1T8LA 1LVMA 2ZFPH 3OU0A 1EP6A 1SKYE 2CK3D 1YLNA 4MPXA 1GBBA 1SI5H 2PP6A 4Z1MD 4X6NA 1N8OB 1RRKA 2IJD1 3BG4B 4SGAE 1W14U 5CE1A 1UHBB 3ODFA 2A4GA 2TGPZ 1ZSLA 1O5BB 1GI4A 2A0QB 2UWOA 3MU1A 4IC5A 2ZDVH 1AFQB 4RKOB 2O8LA 5DG6A 1ELAA 1DLEA 3KYGA 4I8GA 3M37A 2AIPA 1GBCA 2H9EH 3LONA 1VJ9U 3GICB 3BTTE 1W0JD 5G4BA 2R0LA 2XTTB 2J94A 3EA7A 1J16A 2G55A 2I6QA 3WWFA 1C5LH 1PQ8A 1XKBC 4WMEA 1TNKA 4AG2A 1YKTA 1YPLH 2WV9A 3O8CA 1O34A 3GOVB 3F9EA 2GTBA 4GCHG 1DY8A 3ZZ4A 4CREA 1XUFA 2A7HA 1MQ5A 4U01A 4LK4A 6LPRA 3PTBA 3TK9A 3RXCA 4JYUH 3V0XA 2UWLA 1CHGA 4INKA 3E8LA 3SZEA 1HAHH 4XSKU 4MPVA 4DGJA 5FPYA 2RDEA 1BBRK 2B8OH 2HWLB 2XOKD 4JK6A 5C67A 1RFNA 3FP6E 3SQHE 1YY3A 4CRDA 4RI0A 6ESTA 1D6WA 1NS3A 1OYTH 1MZAA 2V7QD 1C5PA 1AIXH 1FDPA 4BXSA 3MH6A 1UTPA 2P94A 4ABIA 4BNRA 3PLPA 4PROA 1DS2E 1BDAA 3DFLA 1BMFD 2ZDNA 2EI8A 3MNBA 2D2DA 2BZAA 1CBWB 2F9NA 2QF4A 1C5NH 1FIWA 4NIWA 1VCPA 1FX0B 2KZ4A 1DX5M 1EAUA 1RD3B 3ZZCA 8LPRA 5L2ZH 2WPDD 1HLTH 1SLWB 3KN2A 1HYLA 3GCHC 4OGXA 2OQ5A 4DIHH 4BAHB 1ARBA 2KR7A 4OS7A 4U2WA 1UTNA 4UONA 1C9TA 5JBCS 2H9HA 3RXHA 1SGIB 1TRNA 1L4ZA 1QURH 1HAIH 4WXVA 2Q6DA 1LVYA 1P2QA 1DM4B 4NZLA 1CA0B 1O3IA 4X2WA 1YPMH 1GHVH 3RXFA 4DT4A 2ZKSA 4D9QA 1GJ4H 1AE5A 2SGAA 2F83A 1ZLRA 3TH3H 5LGOA 4F48B 2QCYA 3QGNB 4CRCA 2VH6A 2NU3E 3ZZ5A 5DP9A 3MO9A 4DIIH 4M7GA 1Q31A 3OE7D 5C5NA 3SBKA 1TLDA 1V2MT 3SI3H 7ESTE 1RJXB 1P9UA 2IPQX 1SGYE 1O30A 4D76A 2F43B 3A7TA 1OP0A 2ZECA 3EAJA 5A09A 3P95A 3U8RH 2GZ7A 3M36A 1DITH 1GGDC 2BDGA 3TGIE 1GHBF 3SV8A 1LHEH 3FFGA 4ABJA 1L1GA 4IN2A 4ZROA 5A8YA 1LKBA 3A8BA 4YTAA 2LP6A 5AF9H 3BTFE 2ZO3H 3N99A 2PV9B 2ODPA 3TJOA 5EXLA 1O2WA 1W3CA 3RP2A 1BTWA 2M5TA 1A1RA 2V3OH 1IQLA 3PLKA 1E37B 1OYQA 1KXDA 3HPTB 1IQFA 1QBNA 3TK6A 2KCAA 1C2FA 1C9PA 4B6FA 2AMQA 3L33A 8GCHF 3FVFB 3VPKA 5KEDA 1NO9H 2BD4A 2ZDMA 3E91A 1W0KD 1FLEE 1NFYA 4ASUD 1G3CA 3PMHB 3RXBA 1OOKB 4FVBA 5HGGA 3TJNA 1P2IA 2Z3CA 2QF0A 3RC4A 2BQ6B 1YPEH 3A7WA 1CGJE 1O2TA 4B2BA 4NIXA 1QJ6B 5C5OA 1M9UA 4VGCB 4NIVA 4X6OA 1O3NA 1NRQH 3GY2A 4UFDH 1UTJA 2FODA 4Q7XA 1RIWC 3R3GB 1HB0B 5C17A 1DFPA 4X2VA 1W0YH 1C5VA 2OXSA 1GJAB 1GWAA 1O2UA 1ZOMA 2YOLA 3GCOA 2JIZD 3GY8A 3PROA 1O2XA 4OS4A 4MVNA 4ZMAH 1G37A 3QZQA 1SLUB 2Y5GA 1NN6A 1H8ED 1K1JA 3SV9A 1TFXA 1ZPCA 2K8IA 1TIOA 1X7AC 2BQWB 5F6MA 2SGDE 8GCHG 3P8FA 1TNIA 5DP6A 4BOHA 1HAGE 2QXHA 1UTQA 1K28D 1MD7A 1WDIA 3PRBA 2A5KA 1UTMA 5EG4A 2XC0A 3SNEA 5FPTA 1W7GH 2Y80A 1GBMA 1O35A 2B7DH 1Y8TA 3TK5A 1T8MA 4WY3A 1IQGA 1SOZA 2H9TH 1JRTA 2WUBA 2ZU4A 2PTCE 2RA3A 4OM9A 4YM9A 3OY6U 2TPIZ 2ZGBH 5KGOA 3FZDA 4UEHH 5PTPA 2J34A 3RU4D 4FUEA 2G4TA 3PYHA 1QB6A 3NPSA 3LC3A 3S9AA 3S9CA 3QWCH 3H09A 1AZ8A 5TCAA 1LTOA 1UVTH 2UUJB 3VGCC 5FPSA 3F9GA 1O2JA 2W5EA 3Q77A 2P8OB 1BITA 1HGTH 4FU9A 2BQ7B 2JJ2D 1O5AB 3MU5A 1WV7H 1JMOH 1F5LA 3RXAA 2WSSD 4AFSA 2XWAA 3SUEA 3LKWA 2ZFFH 1C2KA 1TX6A 3RLWH 1HAVB 4NG9H 1A5HA 1THSH 2VWMA 1FPCH 3LT3A 1C2LA 2VIDA 1L4DA 1MH0A 2VIQA 2BOHB 1DLKB 9LPRA 1XUHA 3SI4H 4Q7YA 4GHTA 3SJ8A 1N8OC 3BG4C 5C1UA 3M7TA 4X8TH 2JDID 2B5TB 3BN9A 1ETRH 1V2QT 1HAVA 1ELFA 4Y10E 2HGTH 2ZNKH 1BT7A 1S0QA 1GMDF 2P3FH 3UFAA 1GJBB 1AFQC 3SORA 5EQRA 2OQUA 1EZXC 5EPNA 2HVYB 3RMNH 1SGTA 4INHA 2ZU5A 5F03A 3M3SA 1Y5UT 2D1JA 2VU8E 3ZZBA 3P8NA 3M5MA 1YP9A 2FM2A 3RXQA 1IOEA 1GHZA 3VG8A 1SGPE 2V3HH 2BDYA 1G3BA 1YPKH 1NC6A 5C94A 3VB3A 3MO3A 3V7TA 4NA8A 2V35A 2Y7ZA 4K1TA 3AW0A 1K0HA 4UFFH 4BAQB 2BMGB 2ZDLA 2EC9H 1O2IA 3HATH 5L2YH 1QTFA 1UVUH 5IYTA 4TT3D 3K6YA 1H9LB 2GDDA 1F0SA 2ZF0H 1UVOA 1O2QA 1MMJN 1GDUA 3MFJA 4IW4E 1FIZA 5EJLA 3F9FA 1AQ7A 2BHGA 4MPUA 1U6QA 3KQ5A 3ZZ8A 2VVVA 1WTHD 1PQAA 2ZQ2A 1AVGH 3EA8A 3ATMA 2KAIB 5EW1H 1FMGA 1BZXE 2QGRA 3TITA 1TMUH 3NXPA 1MTSA 4A1XA 3SUGA 2C93B 3UAIC 1GMDG 1W10U 2BX3A 3V3MA 4E05H 1ZTJA 1OX1A 1S6FA 1EZSC 2BVRH 1LPGB 2D8WA 3P8OA 1D3DB 4ASHA 2W6ID 2ZWLH 3GISB 1CBWC 1F5RA 4ZKRU 1PPBH 2HLCA 2Y5FA 2PWXA 3UY9A 1CGIE 1CT2E 2IN2A 5FHTA 3CENA 3SJOA 4CH2B 5JBTA 1SGFA 5EQSA 1NBMD 1HAXB 3MHWU 4LZ4B 3BEFB 1XVMA 1Z8RA 2FWWA 3M5OA 3SW2B 2QC2A 3LH1A 3MMGA 1F0UA 1AB9C 1KSNA 2BDHA 1GHYH 1TOMH 4I7YH 3CNRA 3C1KA 1AVWA 1GCTB 3UR9A 3RXDA 1HJ8A 3GDSA 4DT7B 1CA0C 3SU4A 2FOMB 3A88A 4ZAEA 1MAXA 4XBCA 3U1JB 2CV3A 1L1JA 1O2YA 2VB0A 2FX6A 3SU5A 2JH6D 2ZGHA 1SGFG 1L0ZA 1TQ0B 2UUYA 2F9BH 2FOFA 1GJCB 3UNSA 1ZMNA 3AVZA 4ABBA 1PYTC 2PR3A 4ESTE 1NT1A 1HCGA 4UD9H 3KEEA 2GKVE 1C1UH 2AHME 2SFAA 1HFDA 3UOUA 1TGCA 1YBWA 2VGCC 1YPHE 1PJPA 1OS8A 3A85A 3SZNA 4OS5A 5FAHA 1QL7A 3D65E 2PGQB 1C5WB 4HGCA 1O31A 1O2LA 2ZFTA 1J15A 1FY5A 5HKKD 1QBVH 2CMYA 1AWFH 1EAIA 1N6XA 1TGTA 2FESH 5E0HA 3RXJA 1PPGE 4KKDA 1OP2A 2GVFA 3S0NA 1LQEA 4AFZA 3ENSB 3RXKA 2EY4C 3OYPA 1NRSH 1ACBE 1Y3XA 1BQYA 1P09A 2VBCA 3BV9B 3RC5A 3F0PA 5T3HA 1C2JA 3RM0H 1O33A 2BD3A 1V2LT 3DD2H 2BD2A 4AYVB 1LVOA 2FOBA 3GYMA 1PPHE 4KELA 1MQ6A 3T5FH 1PPEE 4XOJA 5DP8A 1GBKA 3M35A 2XBYA 2Y81A 2Q1JA 1BJUA 3ZZAA 1EOJA 4DW2U 1C5XB 4FUGA 1Y5BT 2AH4X 3A8DA 4Y71A 3SNBA 1BTYA 4I33A 3MH5A 1TRMA 2Q6FA 3NCLA 5TJXA 1FUJA 1YLDA 4MNXA 5CHBA 2L6OA 1VCQA 2Y7XA 2C8ZB 1A7SA 1OSSA 3LJOA 3SOSA 1L1NA 2BY6X 2A4RA 1EATA 3LGIA 1FNIA 1L2EA 2AMPA 2FI3E 3TGKE 2BDCA 3IG6B 3UWIA 1RTFB 1K1PA 1PPFE 1Y59T 1O5EH 3ATWA 2RA0A 4MLFB 5LH8A 2KX4A 1O3BA 1CE5A 1XUGA 4AB8A 2OC1A 1GHWH 1P3CA 1S81A 2H1UA 2Y5HA 3W95A 4QT8C 4I8JA 1OXGA 1WCZA 3N7OA 4X1RU 3AK5A 4AC9A 1WSSH 2ANWA 1YPGH 1AGJA 2F9OA 2QAAA 3E6PH 2CF9H 1UW7A 5T6FA 4WVPE 1RTKA 1NROH 4R0IA 1QBOA 2PSYA 4CHAB 3SYJA 5HM9A 5JB8S 3UPEA 2WPIS 2A45B 1H1BA 4BAKB 1MBQA 5C2ZA 1DE7H 4BAOB 2ZTZA 3LIWA 3RMOH 4TSFD 5T6DA 1ZPZA 4P00A 2O9QA 2VIVA 3WW7A 3A81A 4JZEH 4JK5A 1H9IE 1DXWA 3RM2H 2SNVA 1SL3A 2P95A 1SFQB 1C2DA 2BD9A 1C2EA 2P59A 1Y5AT 4BAMB 5GWZA 2BY5X 2P8OC 1BTXA 1XM1A 1O5FH 3A84A 1ETSH 1C1NA 2SNWA 2ZU2A 2VINA 1OWKA 7GCHF 2BLVA 1TABE 4DJZB 4YLQH 7LPRA 4NWKA 2YNBA 4ISHH 2ALPA 4K5ZA 2HLDD 2C8WB 5DP4A 1INCA 5A8XA 1DSUA 3F2GA 1YGCH 3PRDA 1H9HE 3LGUA 3AW1A 2SGQE 2ZC9H 5C0UA 1O2NA 3I78A 1K1MA 1QFKH 2Z6BD 3EE7A 3RXLA 4ISLA 1VGCB 3N7EA 1O2SA 1TWXB 2G81E 2PGBB 5GXPA 1CT0E 4WH8A 1GBHA 3H7OA 5FXLA 1UTLM 2R2MB 1ZTKA 1A0LA 3EE0B 1ARCA 2O8MA 1GJ6A 3ZZ6A 1TRYA 1EB2A 2GJGA 2NWNA 1TB6H 1XUJA 3FP7E 4AB9A 1CHOF 1HAPH 2XC4A 3DA9B 2EA3A 4ZUHA 3VXEH 1E35B 1W13U 2R2WU 3RLYH 3K65B 4YT6H 4ZXYH 3LC5A 1QY6A 3Q3XA 1ELTA 1A5GH 2ZG0H 1P2JA 1CU1A 2M2AA 1SGRE 1O0DH 4OS2A 1MKWH 3T25A 1JBUH 5DSFA 1FV9A 4UDWH 3JZ1B 4AGKA 1K9OE 4OS6A 1PPCE 4HG6A 2OBQA 7GCHG 2FZZA 2HRVA 5GIBA 3MH7A 2THFB 1FN6A 2A32A 1ELGA 1ZMJA 3QGJA 3KF2A 3MTYA 4OGYA 1DXPA 2BY9X 1BTUA 4X1PU 4X2YA 4YOJA 3UR6A 1NM6A 2OBOA 1AB9B 1YCPK 1KMHB 5EGMA 1GJ8B 1DWCH 4I32A 2O8UA 4YXWD 5IDKA 1A61H 1C1WH 1V2ST 2DE9A 1AKSA 1NTPA 1P2MA 3KCGH 4WXIA 3GY6A 4H6SB 3LH3A 5DKMA 1F2SE 1UO6A 1K22H 1YM0A 2RCEA 2F91A 1ELBA 1QB9A 1JWTA 2ZQ1A 1E34B 5EODA 1TX8A 1V2VT 1P04A 2BD7A 1NY22 2AIQA 2ULLA 3KYFA 3UUZA 2VGCB 3AAVA 2AGEX 3ZZ9A 1E0FD 1AU8A 1QB1A 3UQOA 3PWBA 3TH2H 3VB5A 3C27B 2BLOA 3KL6A 1AVXA 1W0ZU 1IHSH 4LZ1H 3Q3YA 2ZCHP 4ZKNU 1DPOA 1VKYA 3QTOH 6CHAB 3TNTA 4NA7A 1EOLA 4YT7H 1IAUA 4IMZA 5JBBS 1SGCA 4THNH 5A0AE 3OX7U 2HPQH 3HKJB 1GCTC 1O3EA 3PWCA 3TNSA 4I31A 3TGJE 1AE8H 1WQSA 3HKIB 3GDVA 1OWIA 1V2TT 2C8XB 1ANCA 1TA2A 1C1OA 4FUFA 1JXPA 4ISIH 2C3SA 1QL9A 3QUMP 2DE8A 1Z7KA 5F53A 1TGBA 4K69A 2K0QA 1DUAA 1CO7E 1B7XB 1ZRKA 2ANYA 2CF8H 2FO9A 2FYRA 3LU9B 3SU6A 3BIVH 3NK8A 1QJ7B 2HPPH 2TGTA 4NA9H 2A1DB 4CR5A 5HIZA 4ABHA 2IJOB 1GPZA 3A86A 3T27A 5A0CA 3ZVDA 3O8RA 3K2UA 1SPJA 2RG3A 1BMAA 1UK3A 1HUTH 5HXFA 3VFEA 1B0EA 1HV7A 1EASA 4ABGA 1PYTD 4FU7A 3FZZA 4NCYA 1THPB 3O8BA 1TNJA 1GBTA 4A5TS 1G3DA 1BTZA 2ZPQA 2YMSB 1EXFA 3SO3A 4O3TA 1H8DH 3EDXB 5C1XA 2KCOA 1QIXB 2FS8A 2GV6A 1V3XA 2HNTE 4ACAA 1GHBG 3ZYDA 2J5UA 3RMMH 1QA7A 1UTOA 3HK3B 4HZHA 2GGVB 2BTCE 1FI8A 4A92A 3SQEE 1WUNH 2AS9A 1HXEH 1ANBA 3FOAA 1OHHD 3BTME 3B23B 2FIRH 2PFEA 2Z9GA 2ODQA 2TIOA 3SJKA 1K21H 3GCNA 2DUCA 1ID5H 1FJSA 2R3YA 1O2HA 1C4Y2 1HDTH 2BD5A 4YESB 2B9LA 1XKAC 4X1NU 1F7ZA 4Y0ZE 3A83A 1T31A 1V6DA 4CBNA 3B8JA 4TPIZ 1N6YA 1DWEH 4B6EA 4JCNA 1SG8B 1SHYA 4NGAH 1ZHRA 2ZGJA 1S83A 1GI7B 1BRBE 1JIMA 1C2GA 1WOFA 1FAXA 1MABB 2ZU3A 1LVBA 1V2WT 1XX9A 1P06A 3BTKE 1EJNA 1ZZZA 1AZZA 1D3PB 2FDAA 5DN6D 4Y0YE 5J4SA 3H7TA 4IN1A 1K1IA 2YMSD 2GT7A 3M61U 3KQBA 5LPRA 1T32A 2RDLA 3NKKA 3T28A 1ZGVA 3UNQA 3DCLA 4ZXXH 2FS9A 3PMBB 2JETC 1TONA 4MNWA 1TQ7B 1C1QA 1J14A 1UTKA 3ZVCA 1SGDE 1C2IA 1O3AA 3PTNA 4J1YA 3V12A 2VVCA 2G4UA 4I8HA 4YO9A 4NZQA 1KLIH 5EXMA 1LCYA 1C1VH 1MAYA 2WUCA 2ZDKA 3FO8D 4B2CA 3OSYA 3RMLH 2EI6A 1HRTH 3MU4A 4O9VA 1A3BH 4DCDA 5JB9S 4FUBA 1MTNC 3QTVH 2SGEE 3GY4A 4GHQA 1CQQA 1EX3A 1Z8GA 4CHAC 1HBTH 2VWOA 1TOCB 4D9RA 2EQNA 3KHVA 1S6LA 1Z8IB 2BM2A 4YOIA 4CBOA 2Y6TA 4MNVA 1FAKH 2JJ1D 5L30H 2J4IA 2J38A 1DVAH 4LXBH 3LDXH 1GBAA 1LPZB 1EJAA 1TPPA 3STIA 2KCPA 2ZDAH 1THRH 3S7KB 4INLA 4U32A 5DP3A 3A7XA 5ETXA 4B1TA 1C1MA 1PPZA 2SGPE 2ZFQH 3NUMA 3A7YA 2BVXH 1EKBB 5C0TA 1HIAA 3LGVA 3F3BA 3SNCA 1LHFH 4H4FA 5I46H 5EOKA 4K1SA 5F8ZA 1SHHB 5A8ZA 5LPFA 1Q3XA 2AFQB 2KM0A 2ZTYA 1F92A 1EJMA 1SLVB 3WWBA 4AG1A 3KQCA 3I77A 2BB4A 1EB1H 3RXIA 1S6HA 3RXRA 5LPEA 4UE7H 1CSOE 1O3DA 2ILNA 3GY5A 4ABAA 1G2LA 1YYY1 1DICA 1SLXB 3Q00A 3SJIA 3ZZ3A 1EZUC 1O3HA 1C1TA 3OY5U 2TGDA 4P02A 4ABEA 5JDUB 2XBXA 1VGCC 1Y3VA 1GCDA 4A6LA 1MTWA 3MU0A 1WXRA 1F0TA 1H8HD 1P3EA 1IQJA 5C1YA 1BHXF 4RSPA 9ESTA 2JH0D 4ZKOU 1P03A 3SGAE 1C5RA 3UWJH 1E1QD 4NFEA 1EQ9A 1MZDA 4DY7B 3QN7A 1UVPA 1MKWK 1JOUB 3O8DA 4AZ2B 1LKAA 1FY1A 4JYTA 2QF5A 3BTHE 1Z1IA 1W8BH 2A31A 2AGIX 1AHTH 4MNYA 1NFWA 1AUJA 1SVPA 2J2UA 1VITF 1P57B 3TIUA 2G00A 1MU8B 1B5GH 1WQVH 3ZZDA 4TWYA 1O3OA 5CMXH 4NSYA 1MUEB 1KLJH 3U98H 2W3IA 3BIUH 3OEHD 4K8BA 3M7UA 4ZHAA 1T4UH 1DUEA 3ZVFA 5DP7A 2GZ8A 2GT8A 1WBGB 2Z7FE 1UMAH 1C5UA 3LGYA 4KP0A 3MQKC 2GCHF 3P17H 2QV1A 2OC7A 1GBIA 1EAWA 5DJ7A 1S5SA 3K9XB 3M5LA 3F2FA 1YLCA 1FY3A 1HJAC 3GYLB 5GPIB 3PB1E 4K60A 1SBWA 1A4WH 1KXBA 1KXFA 4I8LA 5T6GA 4D7GA 1C2HA 1OWJA 4U30A 1YF4A 3NZIA 1O5DH 3SN8A 4NWLA 1GBDA 2G51A 4I86A 4LOYH 1TGSZ 1P8VC 2V0BA 1QNJA 3SUDA 6CHAC 1ESTA 3MOCA 1TNHA 2FEQH 5ABWA 1RTLA 4JZIA 2L74A 1FN8A 4HTCH 1FXYA 3TVJB 2Z3DA 4K2YA 2OLGA 5B6LA 1VITG 4NSVA 1SQAA 1MKXH 3RU4E 3GS9A 3PO1C 3B9FH 1W12U 2ZP0H 2HALA 3SU0A 5T1VA 1BCUH 2BDAA 4A7IB 2FI5E 5GNDA 1HNEE 1GBEA 2TRMA 4CR9A 3R0FA 4I8KA 3VB4A 3BF6H 3I29A 6GCHF 2AEIH 3MYWA 4X1SU 1SGEE 2GCHG 3E3TA 3LPRA 3ODDA 1EPTB 2WHXA 1P2OA 3BTEE 3T29A 4YZUA 1F5KU 1NRRH 4XD7D 2R0KA 2FLBH 1A5IA 1BBRE 3GY3A 3IWMA 1HXFH 3F9HA 1NZQH 1BIOA 4IGDA 2TGAA 2OTVA 1GI0A 1GL1A 2BY7X 1C5OH 2PUXB 3W94A 1TPOA 1IQKA 2GX4A 4GLYA 3ZVGA 2CXVA 1IQIA 1E79D 1YPHC 2YMSC 1EPTA 4Q2KA 1SGNE 1FZZA 1XXDA 2AMDA 5FCRA 5HYOA 1OPHB 1ESBA 2A7CA 4XE4A 3T62A 1C1SA 1PFXC 1Z6EA 2R9PA 1OP8A 4X6MA 3LJJA 3SJ9A 1A2CH 3A7ZA 3V13A 1DY9A 1QRWA 3MNCA 2QIQA 1ETTH 1DSTA 2JETB 2A2XH 1GI8B 1LDTT 4FUCA 5KECA 2O8TA 1AY6H 1O32A 4Q4LA 1C1RA 1NU7B 2BDBA 2EEKA 3D23A 5AVDA 3SV2H 3D49H 2C8YB 5E8EH 3M5NA 2F9VA 1ZSJA 2GMTB 4Y8ZA 1QCPA 1BRAA 6GCHG 4F4OC 2XRCA 1HAOH 1T4VH 5E0GA 1WTGH 2QA9E 3FP8E 4K3JA 3U69H 4MTBA 1CGHA 1QZ8A 1MTNB 5FL7D 1D9IA 4AX9H 1O37A 2GCTB 1AO5A 4XDEA 3A87A 3SHCH 4AGJA 1V2UT 2FTLE 3OEED 1NU9A 2GP9B 4B75A 4CRFA 2VIOA 3E90B 5IK2D 2ZA5A 4O3UA 3L3TA 2NU2E 1QA0A 3A80A 1GL0E 1GHXH 3U9AH 2EI7A 1WAYB 1KXEA 2Q6GA 1MBMA 2ALVA 1TPAE 3H5CB 1F0RA 2H2ZA 3A8AA 4Q7ZA 3EA9A 2CHAC 5L6NH 4WH6A 1K1OA 5H4IB 2WPJS 4A1TA 2YNAA 4IS5A 2OD3B 2FTMA 2QY0B 1OWEA 1MU6B 1J9CH 1GMHF 1KIGH 2ZHQH 2LELA 4OS1A 3RXMA 1XVOA 1Y3YA 3E0NB 2XXLA 4K8YA 2Z9IA 1O3CA 4MDSA 3BTQE 2J97A 1O3FA 2CN0H 1BTPA 2P93A 2W6JD 3P70B 1TE0A 4JYVH 1BRUP 1TA6A 3T2NA 4AORA 3TJUA 2G8TA
chains in the Genus database with same CATH topology
2FYQA 3ZV9A 1Q2WA 3UREA 1GJ5H 5F8TA 3BG8A 2K1QA 1RS0A 2WYGA 3ZV8A 3ZYEA 5K7RA 1VCWA 5B6OA 1UCYH 1OWDA 1UK4A 3ELAH 5EQQA 1QR3E 1E36B 4J2YB 2NU4E 1V2OT 2A4OA 2VNTA 1GJDB 4BTUB 1ZHMA 1ESAA 1H4WA 1TBZH 3VXFH 1O2ZA 1V2KT 3LGTA 2WPLS 2C90B 5SGAE 1O3LA 1ZMLA 1H8IH 4WJG2 1SMFE 1KXAA 1UK2A 1LHDH 4IBLH 2UUKB 2ZI2H 4HI3A 4YOGA 1GMHG 5ESTE 3ZVAA 4DURA 4ABFA 4WF8A 1O2MA 1ELDE 2G5NA 1AKSB 3SNDA 3S7HB 1C5TA 1GI5A 1BB0B 2XC5A 1P11E 1LMWB 2ZHEH 1C4V2 1ZPBA 2H6MA 3QX5H 1LHGH 1TBRH 4AFQA 1HJ9A 2OC0A 3DFJA 5HMAA 8ESTE 1XUIA 3QO6A 1BMNH 1EAXA 4O03A 4FUDA 3A7VA 1EUFA 2BYAX 5FX6A 1ZSKA 4GUXA 2XWBI 2WINI 3SGBE 1O2GH 1TNLA 4ZHMU 2XNIA 2PLXA 1SC8U 5FX5A 4JZ1A 1FY4A 2A2QH 3ATIA 1EZQA 2LPRA 2FOCA 2Z3EA 3BTGE 2A7JA 3P6ZB 1B0FA 1FONA 1HJAB 4XBBA 1CHOG 5E0JA 1V2NT 3K6ZA 1NFXA 2ZFSA 1YC0A 4Y8XA 2Z94A 2W7UA 2VWLA 1QJ1B 1QL8A 2CGAA 1C2MA 4B73A 5AFYH 3DUXH 2BLWA 1ELVA 1P2NA 3RC6A 1C5SA 5F8XA 3BEIB 4BANB 1AI8H 2VJ1A 2WV5A 1ANDA 2PKSB 4O97A 1BTHH 4JMYA 1G3EA 3PO1B 3ATKA 1TNGA 1P0SH 2ODYB 1S85A 3SHAH 3ZVBA 1VJAU 1TMBH 4HFPB 3TJVA 5BPEA 1P2KA 2VVUA 4H42U 3S9BA 1NPMA 4ZH8A 3SU1A 1AMHA 3VB7A 5A0BA 1OKXA 2ZFRH 1K1LA 3TH4H 3Q3KA 1UJ1A 3E0PB 4UFGH 2WPKS 2OUAA 4NFFA 3MU8A 1T8OA 1P01A 5A2MH 1BJVA 5FCKA 1ZYOA 3RUOA 2ZTXA 1MD8A 2FPZA 2IOTA 1A0JA 2LNCA 2XW9A 3KGPA 4BXWA 2QF3A 3TU7H 3F6UH 2VIWA 1AD8H 4Y6DA 3AASA 3SV6A 2W7SA 1UHBA 3DHKH 2BX4A 2F3CE 1GI9B 1FY8E 1MKXK 1LPKB 3E16B 1D6RA 1O3MA 4B71A 1KYNA 1GDNA 1UCYE 1WYKA 1UVSH 1Z1JA 2SGFE 1XXFA 3ZZ7A 2F9UA 1S84A 4Y7BA 5GJ4B 2ZGCA 1O36A 5DO4H 3MH4A 1BOQA 4BTTB 1ZHPA 4AN7A 4AOQA 3KIDU 4DOQA 1EPTC 3UTUH 3UIRA 2D26C 1CVWH 1Z6JH 2NU1E 1G32B 2I6SA 1IQHA 1OWHA 1YPJH 1SB1H 3A8CA 1O3PB 3EYDA 1P05A 4DG4A 3BSQA 4AFUA 1ABJH 4B2AA 4FXGH 4RN6A 3L6PA 1GJ7B 1KDQB 3D62A 2ASUB 2VH0A 4FVDA 4GSOA 4ZHLU 3E1XB 2ZCKP 1WU1A 1SGQE 1TX7A 3F68H 2J92A 2STBE 1NRNH 2Y82A 2FLRH 2NU0E 1GMCF 4E7NA 1P02A 1O3KA 1BMMH 3FANA 2ZEBA 3HGPA 1SR5C 1IQNA 4WMFA 1GI2A 2HNTC 1JRSA 2B0FA 2ZHFH 2CHAB 1O5CB 5GCHF 1KDQA 4DVAU 1HAZB 5EXNA 4TWWA 1HPGA 4MG3A 1GVZA 3VB6A 4D8NA 1J8AA 2QYIA 4TY7A 4X6PA 2AGGX 5C20A 2BXUH 1BA8B 3SUFA 5EPYA 5AHGH 1GG6C 4X8VH 2GMTC 1FQ3A 2GV7A 1T8NA 5JPMH 1AWHB 3IITA 4R8TB 1O2PA 3VEQB 2ZPSA 4SGBE 3HK6B 2XBWA 2Z9JA 2GCTC 3CP7A 5CHAC 2P3UB 1GI6A 2WPMS 2OCVB 2C4FH 5GDSH 4KTUA 4XFQA 2XCFA 2Z9LA 4K1EA 3MO6A 1DDJA 4X2XA 1SOTA 2AERH 5DP5A 3BTDE 1IQMA 1N1LA 1CA8B 3M3VA 1HIAB 1IHTH 2JKHA 2FOEA 2VIPA 2QXIA 4Q80A 1XUKA 3M3TA 3PM3A 4UFEH 3PMAB 1GMCG 2ZHDA 3BEUA 2QXGA 3GCTF 2H5DA 1SSXA 3CS0A 2GZ9A 3LGWA 3KNXA 5GCHG 4E7RG 3HGNA 2P3TB 2H5CA 3MI4A 1DOJA 1BBRH 1NFUA 1ZJDA 2QXJA 3FAOA 1C5MD 5I25A 1P10A 1A46H 1KY9A 1KXCA 1V2RT 5DK1A 2A5AA 4JZDH 2VWNA 1QGFA 4XBDA 1ZR0A 5J4QA 3F1SB 2PW8H 3OTJE 1Z8JB 1GDQA 3RXGA 1O3GA 3RXPA 3G01A 2ANMH 1V2JT 2PKAB 1TGNA 4X1QU 2FOGA 4Y79A 4AYYB 2QN5T 1GBFA 2HVXA 2AYWA 3S69A 2PSXA 4Y8YA 1UCYK 5FBIA 4X8SH 2P16A 2FMJA 2TBSA 2G52A 4B76A 1S82A 1O38A 3MNSA 3UNRA 3STJA 2XBVA 3GCHB 1QHRB 2ZZUH 3EQ0H 4Y76A 2PKAA 3MNXA 1LO6A 1DWDH 3UQVA 3U8TH 3RXOA 4IC6A 1ANEA 3SGQE 1YCPH 1BUIA 1BHXB 3RXEA 2ZU1A 2G5VA 3GCTG 1GBJA 2ZGXH 3RXUA 4ZKSU 1S0RA 4FUIA 1P9SA 4Z0KA 1AN1E 1HAYB 1TALA 1MTUA 1G9IE 2A5IA 5JBAS 2BDIA 1TMTH 3ZVEA 1KTTB 1O2VA 2ANKH 5DPAA 3LOXA 3UOPA 5BRRE 1MTVA 1W2KH 3URDA 2R3UA 2KAIA 2OP9A 2UUFB 1D3QB 1AFEH 1GI1A 1GVLA 1PQ7A 3A82A 4GAWA 3T26A 2OINA 2CJIA 1O2KA 4YLUA 5E2PA 8KME2 1DWBH 3ATLA 1GGDB 3SU3A 2V6NA 1AUTC 3ITIA 4JZFH 3URCA 1MCVA 3ESTA 5E2OA 4KTCA 3RDZA 1C5ZB 2WPHS 3U8OH 1G36A 4D7FA 4FUJA 3P92A 5K0HA 1Y3UA 3TLOA 2OC8A 3JZ2B 3AAUA 4CRBA 1YCPM 1CT4E 3KQEA 3PV4A 1O5GH 4GVUA 2BY8X 2W26A 1V2PT 4FU8A 3SU2A 1NESE 2FOAA 1LHCH 3QDZB 4TYDA 1BRCE 2PTNA 1SQTA 1TAWA 3M7QA 2Z9KA 4F49A 2BXTH 2ZCLP 3U1IB 4B74A 2PKSC 2J9NA 3EGKH 4TY6A 3A89A 4IMQA 1O3JA 1TYNA 2GD4B 4Y11E 2FOHA 1QRZA 1MCTA 1BMLA 3TPIZ 3QZRA 4ABDA 4E06H 1TPSA 1K1NA 1PQ5A 1G2MA 2FX4A 5ESBA 1ELEE 1VR1H 2J95A 5HM2A 1RIWB 1C1PA 1GVKB 4WWYA 1FPHH 1C4U2 1QQ4A 3P8GA 4CRGA 1DT2A 1ELCA 2FP7B 1LQDB 1Z71A 1GHAF 4Y7AA 1D4PB 3GDUA 1RGQA 2ZIQH 4MPWA 2WV4A 4CRAA 1IQEA 5AFZH 4KGAA 2O8WA 3DT0H 4WMDA 4TPYA 3MWIU 4GPGA 4NIYA 1J17T 1W11U 4Z6AH 2PHBA 1E38B 1GBLA 1JIRA 1D3TB 2A4QA 2BZ6H 1TBQH 1RXPA 4ISNA 2HNTF 1T7CA 3PLBA 1VITH 2BD8A 5TCCA 7KMEH 5EW2H 4ISOA 4A1VA 2PUQH 5EU8A 3SNAA 1O2OA 2F9PA 3RXVA 1ZJKA 4X0WU 1SFIA 4VGCC 2BVSH 1VZQH 3NWUA 1P12E 3GY7A 4MQAA 5DGJA 1DANH 1NRPH 1O2RA 2JH5D 2UWPA 2IPHA 2BOKA 2GDEH 4BTIB 1C5YB 1O39A 1GG6B 1A3EH 3KQDA 3PMJA 4H6TA 4KTSA 1QRXA 2XYAA 1GHAG 1C5QA 3RXTA 3VGCB 1K2I1 2STAE 3Q76A 4CH8B 2WYJA 1ZRBA 1A0HB 1SQOA 2ESTE 5CHAB 3QLPH 1GJ9B 1Y3WA 1KLTA 3WY8A 3RXSA 5JYIA 1ORFA 1ZTLA 3SV7A 1KTSB 3RU4T 4GCHF 2FI4E 2XCNA 2ZPRA 1QQUA 1ABIH 1ZGIA 2FXRA 1EP5A 1G30B 1W7XH 3QK1A 1XMNB 4X8UH 2HOBA 2W3KA 4RKJB 4FUHA 3BTWE 5FBEA 1GI3A 2ZHWH 3CS7A 2BLQA 5C3NA 1T8LA 1LVMA 2ZFPH 3OU0A 1EP6A 4MPXA 1GBBA 1SI5H 4X6NA 1N8OB 1RRKA 3BG4B 4SGAE 1W14U 5CE1A 1UHBB 3ODFA 2A4GA 2TGPZ 1ZSLA 1O5BB 1GI4A 2A0QB 2UWOA 3MU1A 4IC5A 2ZDVH 1AFQB 4RKOB 2O8LA 5DG6A 1ELAA 1DLEA 4I8GA 3M37A 2AIPA 1GBCA 2H9EH 3LONA 1VJ9U 3GICB 3BTTE 5G4BA 2R0LA 2XTTB 2J94A 3EA7A 1J16A 2G55A 2I6QA 1C5LH 1PQ8A 1XKBC 4WMEA 1TNKA 4AG2A 1YKTA 1YPLH 3O8CA 1O34A 3GOVB 3F9EA 2GTBA 4GCHG 1DY8A 3ZZ4A 4CREA 1XUFA 2A7HA 1MQ5A 4U01A 4LK4A 6LPRA 3PTBA 3TK9A 3RXCA 4JYUH 3V0XA 2UWLA 1CHGA 4INKA 3E8LA 1HAHH 4XSKU 4MPVA 4DGJA 5FPYA 1BBRK 2B8OH 2HWLB 5C67A 4JK6A 1RFNA 3FP6E 3SQHE 4CRDA 6ESTA 1D6WA 1NS3A 1OYTH 1MZAA 1C5PA 1AIXH 1FDPA 4BXSA 3MH6A 1UTPA 2P94A 4ABIA 4BNRA 3PLPA 4PROA 1DS2E 1BDAA 3DFLA 2ZDNA 2EI8A 3MNBA 2D2DA 2BZAA 1CBWB 2F9NA 1C5NH 1FIWA 4NIWA 1VCPA 1DX5M 1EAUA 1RD3B 3ZZCA 8LPRA 5L2ZH 1HLTH 1SLWB 3KN2A 1HYLA 3GCHC 4OGXA 2OQ5A 4DIHH 4BAHB 1ARBA 4OS7A 4U2WA 1UTNA 4UONA 1C9TA 5JBCS 2H9HA 3RXHA 1SGIB 1TRNA 1L4ZA 1QURH 1HAIH 4WXVA 2Q6DA 1LVYA 1P2QA 1DM4B 4NZLA 1CA0B 1O3IA 4X2WA 1YPMH 1GHVH 3RXFA 2ZKSA 4D9QA 1GJ4H 1AE5A 2SGAA 2F83A 1ZLRA 3TH3H 5LGOA 2QCYA 3QGNB 4CRCA 2VH6A 2NU3E 3ZZ5A 5DP9A 3MO9A 4DIIH 4M7GA 1Q31A 5C5NA 3SBKA 1TLDA 1V2MT 3SI3H 7ESTE 1RJXB 1P9UA 1SGYE 1O30A 4D76A 3A7TA 1OP0A 2ZECA 3EAJA 5A09A 3P95A 3U8RH 2GZ7A 3M36A 1DITH 1GGDC 2BDGA 3TGIE 1GHBF 3SV8A 1LHEH 3FFGA 4ABJA 1L1GA 4IN2A 4ZROA 5A8YA 1LKBA 3A8BA 4YTAA 5AF9H 3BTFE 2ZO3H 2PV9B 2ODPA 3TJOA 5EXLA 1O2WA 1W3CA 3RP2A 1BTWA 2M5TA 1A1RA 2V3OH 1IQLA 3PLKA 1E37B 1OYQA 1KXDA 3HPTB 1IQFA 1QBNA 3TK6A 1C2FA 1C9PA 2AMQA 3L33A 8GCHF 3FVFB 3VPKA 1NO9H 2BD4A 2ZDMA 3E91A 1FLEE 1NFYA 1G3CA 3PMHB 3RXBA 1OOKB 4FVBA 5HGGA 3TJNA 1P2IA 2Z3CA 2QF0A 3RC4A 2BQ6B 1YPEH 3A7WA 1CGJE 1O2TA 4B2BA 4NIXA 1QJ6B 5C5OA 1M9UA 4VGCB 4NIVA 4X6OA 1O3NA 1NRQH 3GY2A 4UFDH 1UTJA 2FODA 4Q7XA 1RIWC 3R3GB 1HB0B 1DFPA 4X2VA 1W0YH 1C5VA 2OXSA 1GJAB 1GWAA 1O2UA 1ZOMA 2YOLA 3GCOA 3GY8A 3PROA 1O2XA 4OS4A 4MVNA 4ZMAH 1G37A 3QZQA 1SLUB 2Y5GA 1NN6A 1K1JA 3SV9A 1TFXA 1ZPCA 1TIOA 1X7AC 2BQWB 5F6MA 2SGDE 8GCHG 3P8FA 1TNIA 5DP6A 4BOHA 1HAGE 2QXHA 1UTQA 1K28D 1MD7A 2A5KA 1UTMA 5EG4A 2XC0A 3SNEA 5FPTA 1W7GH 2Y80A 1GBMA 1O35A 2B7DH 1Y8TA 3TK5A 1T8MA 4WY3A 1IQGA 1SOZA 2H9TH 1JRTA 2WUBA 2ZU4A 2PTCE 2RA3A 4YM9A 3OY6U 2TPIZ 2ZGBH 3FZDA 4UEHH 5PTPA 2J34A 3RU4D 4FUEA 2G4TA 3PYHA 1QB6A 3NPSA 3LC3A 3S9AA 3S9CA 3QWCH 1AZ8A 5TCAA 1LTOA 1UVTH 2UUJB 3VGCC 5FPSA 3F9GA 1O2JA 2W5EA 3Q77A 2P8OB 1BITA 1HGTH 4FU9A 2BQ7B 1O5AB 3MU5A 1WV7H 1JMOH 1F5LA 3RXAA 4AFSA 2XWAA 3SUEA 3LKWA 2ZFFH 1C2KA 1TX6A 3RLWH 1HAVB 4NG9H 1A5HA 1THSH 2VWMA 1FPCH 3LT3A 1C2LA 2VIDA 1L4DA 1MH0A 2VIQA 2BOHB 1DLKB 9LPRA 1XUHA 3SI4H 4Q7YA 4GHTA 3SJ8A 1N8OC 3BG4C 5C1UA 3M7TA 4X8TH 2B5TB 3BN9A 1ETRH 1V2QT 1HAVA 1ELFA 4Y10E 2HGTH 2ZNKH 1BT7A 1S0QA 1GMDF 2P3FH 3UFAA 1GJBB 1AFQC 3SORA 5EQRA 2OQUA 1EZXC 5EPNA 3RMNH 1SGTA 4INHA 2ZU5A 5F03A 3M3SA 1Y5UT 2D1JA 2VU8E 3ZZBA 3P8NA 3M5MA 1YP9A 2FM2A 3RXQA 1IOEA 1GHZA 1SGPE 2V3HH 2BDYA 1G3BA 1YPKH 1NC6A 3VB3A 3MO3A 3V7TA 4NA8A 2V35A 2Y7ZA 4K1TA 3AW0A 4UFFH 4BAQB 2BMGB 2ZDLA 2EC9H