1F5KU

Urokinase plasminogen activator b-chain-benzamidine complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
247
structure length
247
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of the urokinase type plasminogen activator variant beta(c)-uPAin complex with small molecule inhibitors open the way towards structure-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5kU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5kU01
3SUEA 1C2DA 3PM3A 1HAIH 2NWNA 4NSVA 1P2QA 5AFZH 4K5ZA 1O37A 5CHAC 4ZH8A 1FPHH 3A7XA 3NKKA 5J4SA 3N7OA 2ZECA 1TWXB 2XBXA 4FUIA 3RU4D 4B74A 2GV6A 3GY3A 1SBWA 4O3UA 1C1QA 5H4IB 2A5KA 4UFGH 1T8MA 2F3CE 3MOCA 4WY3A 3PYHA 4BXWA 3TU7H 4FU8A 1OKXA 1IQJA 2J38A 2FLBH 5DPAA 1XUIA 4MPXA 2HOBA 1CT4E 1P2MA 1EJAA 1CSOE 3RUOA 2Y5GA 1ESBA 1VGCB 3LIWA 1SPJA 5JBAS 1O2YA 1GJ9B 4YOGA 5G4BA 1EB2A 1Y5AT 2I6SA 3BEUA 2ZU1A 3SNCA 4HI3A 2W7UA 4TPIZ 3ZZCA 1C9PA 3ENSB 1XXFA 3RU4E 2BD3A 4HTCH 2OUAA 1DDJA 1F5LA 5DK1A 2FIRH 4D7GA 5FHTA 3MTYA 1FAKH 3VFEA 1THRH 2ZHQH 1ARCA 1LDTT 2ZGXH 4TWYA 1BDAA 3MMGA 3P70B 3ATIA 1BTUA 4AFZA 2GVFA 1SI5H 1W7XH 3B23B 1VCQA 3VGCC 1MAXA 4Y0ZE 1J17T 2PLXA 1BRUP 1NFWA 5DG6A 4GHTA 3RXTA 1G3BA 5C2ZA 5EPYA 1SGFG 3SBKA 4Z6AH 4ABGA 5EPNA 2FX4A 4KP0A 1LHFH 4I8JA 2KAIB 4H42U 1AKSB 1K1PA 3GDUA 5FBEA 3RXBA 4FXGH 4TY7A 1EOLA 4AB8A 1BHXF 2CHAC 2A7HA 3ESTA 3SV6A 5DO4H 1QL7A 5SGAE 1FI8A 2ZGCA 1L2EA 1DWEH 1QL8A 1MTNB 1N6XA 3ZZDA 5J4QA 1MKWH 1K1IA 1NC6A 1TNHA 3TVJB 5E0GA 1P12E 2HPPH 1LO6A 4DCDA 2FZZA 1OXGA 3QUMP 4LXBH 2FOEA 1H9IE 1GMCF 3BIUH 4U32A 4ABBA 1ZMJA 5A0AE 3E0NB 1HXFH 1Z1JA 1HB0B 4OS6A 1LMWB 3GY6A 3OYPA 4AOQA 1GBDA 4IN2A 4JZFH 5A0CA 2ANKH 3VPKA 6LPRA 1MQ6A 2FWWA 5T6FA 1Z8JB 1HFDA 1NU7B 2A2XH 5DP9A 1CHOF 1D4PB 1QIXB 1IHSH 1DANH 2CN0H 3M5MA 1LVYA 1ESTA 1D3QB 2SGQE 3QTOH 2VNTA 1RS0A 1W0YH 2BD8A 1AUTC 1O3PB 1P2IA 4D9QA 4YT7H 1RGQA 1TGCA 2GMTB 1P01A 2OTVA 3LGUA 3T5FH 1K1LA 2FI4E 1E34B 2BB4A 1SVPA 3KEEA 1GBJA 4Y6DA 5F8ZA 3SZNA 5JBTA 4B2AA 3P8OA 3MH5A 5BRRE 4MNYA 4Q80A 1K2I1 3LU9B 1XKAC 1GBAA 4D8NA 1E35B 1MU8B 1LPGB 2O9QA 2PR3A 3PMJA 2G5NA 3C1KA 1CGHA 5A8ZA 4FVDA 1SC8U 3F68H 2XC5A 3M35A 1TYNA 1C2JA 1RTKA 2H5DA 1NESE 3HATH 1V2NT 1XUKA 1MTNC 3ZZ8A 2FYRA 3HGNA 4NGAH 3HKIB 1P2NA 4AZ2B 5HYOA 2AMDA 1HAVA 1CGJE 2R3YA 1S84A 1WV7H 1TPPA 2TRMA 4AGJA 2UUFB 2THFB 1CGIE 3MNXA 1IQKA 1EZQA 2BX3A 3ZZAA 1DLKB 4JYUH 2EA3A 2ZTYA 5K0HA 1UVOA 4HFPB 2OXSA 2BLQA 1ZTKA 1C5SA 1HAOH 4A92A 1Y3YA 4R8TB 1NTPA 1LHGH 2B7DH 3UNQA 2ALVA 4U30A 1WQSA 1GHWH 1V2VT 1SGYE 1V2MT 1UTLM 2QF3A 2ANWA 1P8VC 3EA7A 1O2KA 3WY8A 3QLPH 2F9NA 3F9EA 3LC3A 1JXPA 1BB0B 4U2WA 2H6MA 4PROA 5TCCA 1XM1A 2ZTZA 5E0JA 1HGTH 3BTME 1BJVA 2A0QB 3Q3XA 4O03A 1SQAA 1D9IA 3VEQB 1E38B 1QL9A 3HKJB 3MU8A 1P0SH 1ETSH 1HAYB 1F5RA 2Z9GA 2V0BA 3CP7A 2WPLS 4OGYA 1V2KT 1ANCA 3HGPA 2D8WA 1OWHA 1C4Y2 1UCYK 3RMOH 1C5RA 1WUNH 1DXPA 2PWXA 1GMCG 3TK9A 2TGTA 4ABJA 4A6LA 4ZKRU 1TNKA 2HALA 4ZHLU 1AQ7A 2FOAA 3M7TA 3E90B 3ZZ9A 1CHGA 1NRSH 2ZZUH 3SJKA 3LJOA 1SOTA 1YPKH 3CS0A 4GVUA 3MH4A 3I78A 1UTOA 5DP6A 2RG3A 9LPRA 4NA9H 1CHOG 1ANDA 3E0PB 1ID5H 1RRKA 2QCYA 1BJUA 5A09A 1BTYA 1LVOA 2C93B 4MG3A 2B5TB 4YLQH 1GBBA 1TGBA 1UJ1A 2Z7FE 4HGCA 4I33A 3RDZA 2AS9A 3M5NA 4ABAA 4WMEA 3MHWU 3ZYDA 1O5CB 2P3TB 1J8AA 4LZ1H 1QRWA 5TJXA 3PMAB 1SGFA 2C8XB 4UDWH 1X7AC 3A8DA 1V6DA 1KXBA 3PMHB 2AFQB 5FPYA 2ZFRH 2AGEX 3NCLA 2ZO3H 3SHAH 1G9IE 1PQ8A 3P95A 4ABHA 1WAYB 4XBBA 4CRBA 1C5WB 4CBNA 5FPSA 4MPVA 3E91A 1A61H 1IQIA 1O33A 3IG6B 1NU9A 4UONA 1P10A 2VIDA 3EAJA 2ANMH 1QQ4A 3TNSA 4NG9H 1IQNA 2VU8E 2VVCA 1ZJKA 1JOUB 3SV8A 1F2SE 3A7VA 1VJ9U 2BQWB 5AHGH 3IWMA 1C5NH 2VIVA 1GI9B 4JMYA 3LOXA 1A5GH 1GHYH 1NS3A 2P94A 5HM9A 1K1NA 1AY6H 1C5YB 3G01A 2QAAA 7GCHF 2R2MB 3T26A 3KL6A 1UO6A 1XKBC 2A5AA 1MU6B 2P59A 2QGRA 2WPHS 2O8LA 3ZVBA 1YBWA 1GJBB 2OINA 4A1TA 7LPRA 1OWEA 3UFAA 3O8CA 1IQLA 1DWBH 1G32B 2AERH 1TFXA 2ZDMA 4CH2B 1UVSH 4D9RA 1D3DB 2KAIA 1GJ5H 1LPKB 4MQAA 1GI6A 2GDEH 1DOJA 5AF9H 1C4V2 4TYDA 2ZPRA 1V2WT 1QURH 1IQGA 3SNDA 1DXWA 4XE4A 3SU1A 2R0KA 3GY4A 4FUCA 1BCUH 5EODA 4ZAEA 3LH1A 1A2CH 3ATWA 3K6YA 1V2RT 2VIPA 1PPGE 2VWNA 5HM2A 2K1QA 1BBRE 2NU3E 1TMBH 3SJ9A 3DUXH 1YM0A 4CRGA 4ZKSU 1IHTH 1GBIA 1BRCE 2Y6TA 3SJIA 3TJOA 4DIIH 1DFPA 1O35A 2PKSC 1AVGH 4THNH 1EAXA 1BOQA 1GPZA 3SU3A 4I32A 1TX7A 5JB9S 4X8SH 3SU0A 1S0QA 2ZWLH 3F9HA 5C1YA 4X8UH 2H9EH 2BHGA 3KCGH 1C5PA 5GXPA 1H9HE 3C27B 3SUDA 1AZ8A 1AB9B 1YCPM 1YCPH 6CHAB 1W7GH 3RXMA 1N6YA 2BLWA 5A0BA 2GX4A 1ZYOA 2JETB 3V7TA 5EW1H 1BTXA 2J4IA 1J16A 1UTNA 1SGDE 4Q2KA 1FIWA 1SQOA 2ZFQH 2VGCB 2A4QA 2QYIA 1P03A 3A7TA 1GJ6A 2QC2A 3V13A 4ESTE 1G30B 1HXEH 1FONA 1GBFA 1FJSA 2WUBA 3DHKH 3L6PA 1C5LH 5E8EH 1G3CA 3MI4A 1MKXK 2F91A 2GZ8A 1OP2A 3M5OA 2QXJA 3PTNA 3U69H 1VR1H 2F83A 3ATMA 4Y10E 1TLDA 1NO9H 1KXEA 1YCPK 3GCHB 1GVLA 4WH6A 1H4WA 3TH4H 2W3KA 2ULLA 4XOJA 4Y7BA 1MMJN 3ZYEA 3SUGA 1EJMA 2GGVB 2VIOA 4KTCA 1S6FA 3LKWA 1UVUH 1O3OA 2D2DA 3RC5A 4B75A 1O5EH 3QK1A 3BF6H 3AW1A 3URDA 2LNCA 3SI4H 3TH2H 3UOUA 2YOLA 2UUYA 1SL3A 3RXLA 3GY7A 1Q2WA 2Q6FA 3GOVB 4X6PA 4E06H 3QGJA 1G2LA 3QTVH 1O2WA 4UD9H 3TNTA 1ZTJA 1ELFA 2NU0E 1CBWB 1HAVB 7GCHG 2J34A 3AAVA 3SI3H 2F9OA 6CHAC 1ZJDA 3SU2A 4Y8ZA 2RDLA 4XDEA 4K60A 3TJUA 2GP9B 1ELCA 4MPUA 2YNBA 1P3CA 4UE7H 1E36B 2VGCC 1DPOA 4GHQA 4FUGA 2ZU5A 1Q3XA 2ZCKP 2B8OH 2J92A 4XSKU 2VWLA 1DVAH 1C2IA 2FI3E 2BY9X 2PFEA 1O3FA 5DP5A 1O2JA 4AX9H 1TQ7B 2STBE 4IMQA 5EXLA 2O8WA 1ZGIA 1Y5UT 3FZZA 1B0FA 1UVPA 3GISB 2QN5T 2OQ5A 1TPOA 1THSH 3FP7E 1DUEA 2Z9JA 1W3CA 3GCNA 3GCHC 2HNTF 4NCYA 2BD7A 1QQUA 3RU4T 1GGDC 2W3IA 2FPZA 2C3SA 4ZROA 4ZMAH 2I6QA 3SOSA 2HGTH 3RXFA 1GDQA 2P3UB 1V2LT 1SGQE 3ZV9A 1QNJA 1GWAA 4X1PU 2ZFPH 3U8RH 1C1SA 1OP0A 3NWUA 1W11U 3I29A 1C9TA 1WU1A 1GJDB 1XX9A 1AMHA 2WPIS 2W7SA 3TK6A 2EEKA 4BAOB 2BY7X 1OWKA 1FUJA 1ANBA 3FAOA 2ZDAH 2B9LA 1P9SA 1IQMA 1LKAA 1FY4A 3BSQA 3ELAH 5IYTA 1CBWC 2CHAB 1BQYA 3UTUH 2UWLA 2BVXH 3SGAE 4K1TA 1QGFA 2Z94A 4NIXA 3LDXH 3MFJA 2PGQB 1QBVH 1JMOH 3M36A 5A8XA 4FUFA 1YLDA 3LGTA 3RXHA 2FEQH 2YNAA 2OC7A 1SGPE 1ZMNA 2BQ7B 1IOEA 1YPEH 1NPMA 1O2UA 1V2TT 4DG4A 4ZKOU 7KMEH 1GBHA 1FN8A 4K2YA 1Z6EA 3A89A 5C20A 2ZHWH 1ZHPA 4OS2A 5FCRA 3ZVFA 2R3UA 1GHAF 2WV4A 3U8TH 3M3TA 2CV3A 2PTCE 1L1GA 1EKBB 3MNBA 1AN1E 3M3VA 1AWFH 1VZQH 1EUFA 5LH8A 1XUGA 1UTKA 1NFUA 2ZA5A 2XC0A 2VIWA 2J95A 1DY9A 1YLCA 1LKBA 5EQQA 1JIMA 1H9LB 4NFFA 1P57B 3GICB 1RFNA 3RXIA 3KF2A 4Y71A 2FO9A 2TGAA 2XCNA 3CS7A 1EZSC 1O2HA 5C3NA 1C5ZB 2NU4E 5GCHF 3OX7U 1O2OA 3M7QA 3V3MA 3E3TA 1TONA 4NFEA 2ZG0H 1BBRK 1F0RA 4WVPE 2PUXB 4NZLA 1Y8TA 1Y3WA 3U8OH 1V2JT 5B6OA 2OD3B 1QJ6B 1YPJH 9ESTA 1VITF 3BTTE 3GY8A 2AYWA 3S7KB 2V3HH 2Y5FA 4KTUA 3O8BA 3RXOA 2FM2A 2G8TA 3P17H 1CA0C 3K6ZA 1O36A 1EZXC 1WBGB 3FZDA 3PMBB 3M61U 2BD2A 2Z3CA 3SGBE 3RMLH 1RXPA 3K2UA 1QJ1B 3UIRA 1V2QT 2TGPZ 5EXNA 5T6GA 1OX1A 1ZZZA 2Z9IA 4X1QU 5JYIA 1ZHMA 1TOMH 1DX5M 2XC4A 8LPRA 1S81A 3EYDA 5C5OA 3SGQE 4IC6A 4CR5A 3O8DA 4WMFA 2AH4X 1RD3B 2BLVA 4TY6A 4WH8A 4YZUA 1QRZA 1MTSA 1O34A 2O8MA 3SQHE 1PFXC 3ZZBA 1C5MD 1G2MA 2ODYB 1K1OA 3F9GA 4BAHB 5AFYH 1XXDA 4DJZB 4SGAE 4WF8A 3T29A 3MO3A 2BOKA 3UQOA 3TJVA 4DY7B 1B0EA 4AG1A 1IQHA 1SOZA 1EQ9A 2HVXA 1XUHA 1CT2E 4Y8YA 1O3EA 4D7FA 4CR9A 2TGDA 4MNVA 2BY8X 1GL1A 2HNTC 4DVAU 1KXAA 3RC6A 4AG2A 2C8WB 1ZOMA 1HIAB 1DM4B 1BRAA 1CT0E 2FODA 2SGPE 3ZVDA 4ASHA 2DUCA 1P2JA 1RTLA 3MYWA 2HRVA 1O2TA 1YC0A 2HNTE 3UNRA 1EAUA 1OWIA 1O3LA 2ZNKH 4MNXA 3BIVH 1GL0E 1IQEA 1ZHRA 3TITA 1GHAG 2FX6A 2HWLB 4KTSA 1C2MA 1G36A 3F9FA 3S7HB 2P8OB 1T8OA 1PPCE 1BHXB 1XVOA 2PW8H 3KN2A 1O30A 1TABE 1C5OH 3BV9B 3P8NA 1GJ7B 1YPLH 3KGPA 2STAE 2R9PA 5HXFA 4KGAA 1ESAA 1FPCH 2FXRA 2ZGBH 3DA9B 2OQUA 1S83A 3ATLA 2BQ6B 5L2YH 1W12U 3DFLA 4CBOA 5HMAA 3M5LA 1EPTC 1PPBH 3ATKA 4RN6A 2F9PA 1PPFE 5GCHG 1EAWA 1AU8A 1MBMA 2FOGA 3F1SB 1UCYH 2GCTC 4NIYA 2BOHB 1TA2A 1KY9A 1O3IA 1O5BB 1S6HA 4OS5A 3DT0H 1HRTH 1LVBA 2QA9E 2Y81A 2W5EA 2VJ1A 1UVTH 1SQTA 1MCTA 1VITG 1GCDA 1A4WH 3FVFB 4MTBA 5DJ7A 4ISHH 1BMAA 2BDCA 5FBIA 2UUKB 1QHRB 4LZ4B 3QGNB 1SGIB 2DE9A 3PO1C 1LPZB 5JDUB 2FTMA 1C2HA 3MH7A 3FP8E 1EP6A 2A4GA 1L1NA 1YP9A 1MTVA 2DE8A 1O3KA 1GJ4H 2C8ZB 1QA0A 3QDZB 1ZRKA 2BDBA 4VGCB 4SGBE 5T3HA 1Z6JH 1NN6A 4H4FA 4X0WU 4RSPA 1ZRBA 1ZSJA 3VB5A 1E0FD 3R0FA 2VWOA 3SNBA 2F9BH 4X1SU 1KSNA 4M7GA 5I25A 1ELTA 2P8OC 4ISIH 5C67A 1BA8B 2ZPQA 2GZ9A 1W10U 3RM0H 1C2LA 1O5FH 4WXIA 1FY8E 3BTDE 1O2GH 1EATA 4ZXXH 2Y82A 2WPKS 2WYJA 2CGAA 5GIBA 1NT1A 3VB6A 8ESTE 3SQEE 1OOKB 1SR5C 3ZZ5A 1G3DA 1A0HB 2PKAB 2O8UA 2PKSB 3ZV8A 2OBOA 1GVZA 2SGFE 1O2ZA 4NWLA 1DS2E 2V6NA 1TRNA 1HJAC 4DURA 1Y5BT 2LPRA 5ESBA 1J15A 3T25A 1AWHB 1XVMA 3D23A 3BTGE 1QJ7B 1F92A 3MU5A 2EC9H 3RP2A 1FMGA 2R2WU 1LQEA 4I8KA 3BTQE 2AEIH 4X2VA 1GI1A 3BG8A 4TWWA 1ELAA 3E16B 1INCA 1MAYA 3ZZ7A 1C1RA 3RMNH 3A80A 1GMDF 4CRDA 2BD5A 1O5GH 4VGCC 3H5CB 1C4U2 3HK3B 3U9AH 4GPGA 1GHXH 4IBLH 1TAWA 4F4OC 2NU1E 1K21H 3MO6A 2A7JA 3TLOA 2SGDE 3PB1E 3T2NA 1O3MA 2C90B 3MNSA 3M7UA 4BAQB 3B9FH 2BVSH 6GCHF 3R3GB 5F6MA 3BTHE 3OU0A 2H9TH 1ZPBA 1TALA 2OC0A 1TBZH 1SGEE 1QRXA 4INLA 2HLCA 1GBCA 1LHDH 1QBNA 3V12A 1O2NA 4FUDA 2A1DB 2PTNA 3SUFA 1TX8A 2AMQA 2AGIX 1O2XA 2GTBA 3PWBA 1YYY1 1GHBF 2BZ6H 1B5GH 5FAHA 1MKXH 4JYTA 1C1WH 4AFUA 4ZHAA 5F8TA 1EPTA 1EB1H 1YF4A 3RXSA 3TGKE 3A8BA 2WINI 3LT3A 4K3JA 1ZMLA 2VWMA 3LGVA 5DKMA 3SU6A 1TMUH 2FLRH 3L3TA 7ESTE 1Z8IB 5GWZA 1AE5A 2FOMB 3VB7A 2A45B 2BM2A 5PTPA 2H1UA 1EAIA 1HAGE 1ELDE 2ZF0H 4BNRA 3S9AA 2IN2A 5DP3A 3U98H 5EG4A 2Z6BD 1HIAA 3FFGA 4ABDA 2BY6X 2VINA 4FU9A 1H8DH 1TNJA 2PUQH 1BZXE 1F7ZA 5EOKA 4JK6A 1WCZA 1M9UA 3RM2H 1HJ8A 1ELGA 4AORA 3Q00A 4QT8C 1P2OA 3GCTF 3SV9A 3BG4B 8GCHF 1TPAE 4FUBA 1GGDB 2FI5E 3E1XB 3VB3A 4RKOB 3P92A 1O39A 4YM9A 1GI5A 5FXLA 3LC5A 1GBKA 3L33A 1ARBA 1QCPA 3W94A 3ZVCA 1F0SA 1AHTH 1O3DA 1AFQB 1BMLA 1GI4A 3O8RA 3V0XA 1EP5A 1EZUC 4UEHH 1TIOA 2FTLE 1BT7A 3T28A 1MTUA 2ZCHP 1ANEA 2JKHA 3RXDA 2UWOA 3RXCA 2G52A 2Z3DA 1WYKA 3NUMA 5FPTA 1A7SA 1FV9A 1GBTA 1GMDG 2OBQA 3BTWE 1MZDA 4I8LA 2B0FA 1HPGA 2ZQ2A 1GHVH 1PQ5A 3S9BA 2ZQ1A 5EW2H 5C1XA 4IGDA 1W14U 1FY5A 3A88A 4X6OA 1Z8GA 1NM6A 2ZFFH 3OTJE 1TNIA 2G4TA 5K7RA 3SJ8A 1T31A 1L1JA 1KLJH 2ZKSA 2ZGHA 1WTHD 1O3CA 1V2OT 1LHCH 1DITH 3BN9A 1TGSZ 1S5SA 2ZP0H 1SLVB 2RCEA 3UR9A 6GCHG 2FESH 4JZDH 1AZZA 2BDGA 5JBBS 1RTFB 2BDHA 3S9CA 4Q7ZA 2V35A 1Y3XA 1C2EA 5A2MH 2ZI2H 2TIOA 1ELBA 1TBRH 3RLWH 2BXTH 1OWJA 1WQVH 1MTWA 3EQ0H 3FANA 1IAUA 5HGGA 1O3JA 4XFQA 2QF0A 1CU1A 4B2CA 2FMJA 1DICA 3BG4C 1GHBG 1BMNH 1BTPA 4AYVB 1RIWC 1ZR0A 2BTCE 1Z71A 1XUJA 2SGAA 1SHHB 1AGJA 1DLEA 1XMNB 1GHZA 1GDUA 2P95A 1WSSH 1SGTA 4Y76A 1QB6A 3T27A 4FVBA 2FDAA 3A84A 2ALPA 3E6PH 4Y11E 3SO3A 2P16A 4A1VA 1AFQC 1S0RA 2SNVA 3A7WA 2ZU3A 2GZ7A 1MBQA 5EQRA 1VCWA 3H7TA 2GCHF 4X8VH 1O32A 1F5KU 5AVDA 1C2FA 4ABFA 2BZAA 2AIQA 1HLTH 4JZIA 4BTIB 3BTEE 2FS8A 2GDDA 2ZU2A 2PKAA 1FDPA 5EQSA 1ELEE 2P93A 1Z1IA 4NA8A 4WXVA 1C5QA 1GJ8B 1KDQB 1SMFE 4CRCA 1CA0B 1S82A 4O97A 2ASUB 4LOYH 3SV7A 5LPFA 1A3BH 2G51A 5C1UA 1FZZA 3GCTG 3TH3H 8GCHG 1DY8A 1GG6C 2XBYA 2VIQA 4E7NA 1NRRH 3NPSA 4CREA 2XNIA 1MD7A 5CMXH 2ODQA 1TBQH 1UTMA 2G4UA 3OSYA 4OGXA 1NZQH 1TB6H 1BBRH 1CQQA 4YOJA 2ZGJA 1T8LA 6ESTA 1V3XA 3D65E 1P09A 3ZZ4A 1D3TB 1T4UH 2XYAA 2ZHFH 4MDSA 4I7YH 1O3HA 2ZDKA 1Z8RA 3BEFB 3RLYH 4IC5A 3A81A 4IW4E 4NWKA 1TNGA 4O9VA 5L2ZH 3STIA 4A1XA 1Y59T 2ODPA 1H1BA 1OPHB 1PQAA 1QFKH 1QB9A 4AB9A 2GD4B 3BTKE 3UUZA 2Y7ZA 4BANB 2XCFA 3I77A 1O2PA 1OYQA 4INKA 1YKTA 1D6RA 1GI2A 1N8OB 4D76A 1KTTB 2BLOA 2G55A 3SHCH 1A5HA 1HYLA 4BAKB 2ZHEH 4B76A 4FU7A 4ISNA 4K1SA 2R0LA 2F9UA 4XBDA 2PV9B 3EA9A 3RXQA 1B7XB 1OSSA 1KYNA 1TA6A 5GJ4B 2G5VA 2OLGA 1TNLA 4H6SB 3AAUA 2CF8H 1W2KH 1PPEE 3TIUA 1AIXH 1TOCB 1GMHF 1UMAH 1ZSLA 4IN1A 2F9VA 1UTJA 1H8IH 4ZXYH 3MO9A 1GI3A 4MPWA 2EI6A 3AVZA 1ZTLA 3QO6A 1SGNE 3EGKH 4YTAA 4K8YA 4MVNA 2BDAA 3EA8A 1SGCA 2RA3A 3A8AA 3A86A 1O3AA 4YESB 2IOTA 3TK5A 4X2XA 1HAHH 5E0HA 4AYYB 1GI8B 3DFJA 1VCPA 1WTGH 3GDVA 2XBWA 1P9UA 4I31A 4WJG2 1EPTB 1P04A 1SFQB 1GI7B 2C4FH 3LPRA 3M3SA 2NU2E 1CVWH 4UFFH 2GCTB 1W13U 3RXPA 4K69A 1TQ0B 1C1TA 3NZIA 4UFEH 3U1IB 1OWDA 4WWYA 1EASA 5ABWA 1C5UA 2WYGA 3SU4A 3P6ZB 1EOJA 2GCHG 1ZPZA 5IDKA 1ABJH 1SLWB 1W8BH 3MU1A 4B71A 3ZVGA 4GAWA 1MQ5A 1UHBB 1VGCC 3BEIB 3PO1B 1CE5A 1LHEH 1G3EA 2PSXA 4Q7XA 1K28D 2GKVE 1N8OC 2G81E 1FY1A 4WMDA 3UQVA 2D1JA 1QB1A 2ZDLA 5ESTE 3W95A 1DE7H 4ABIA 1MKWK 4GSOA 5DP8A 1D3PB 1JIRA 5C5NA 1V2ST 2XTTB 3A8CA 2SGEE 1U6QA 2IPHA 2PSYA 1C1UH 1TRMA 1O0DH 1YGCH 1O2MA 2JH5D 1V2UT 2J2UA 2OC8A 4KELA 1O38A 4U01A 1Q31A 3SORA 3SJOA 1GVKB 3STJA 2AMPA 1HUTH 4I8HA 2A32A 2BY5X 4ISLA 2QY0B 1TGNA 2A31A 3FP6E 1SLXB 1BIOA 3UOPA 1K1JA 4DT7B 3PLPA 2ZDVH 4NZQA 4X8TH 3UNSA 1PYTD 4JZEH 2V3OH 1N1LA 2RA0A 4ZUHA 1MH0A 4AN7A 1PPZA 1TPSA 1GDNA 1NFXA 2WPMS 5F03A 2Q6DA 1FIZA 1HJAB 3OY6U 3ODDA 2W26A 4ABEA 1AUJA 5A8YA 3EE0B 1A0JA 2OC1A 4Y0YE 1O2QA 1PYTC 1SFIA 3NXPA 1KLIH 5EXMA 3TJNA 1DWDH 5E2PA 3SW2B 3RXKA 2FYQA 3A82A 1LTOA 4IS5A 3VB4A 1L4DA 1PPHE 1GMHG 2ZHDA 1AD8H 3AASA 2CJIA 4FUEA 2UUJB 3RC4A 1LQDB 3KQDA 2ESTE 5DGJA 3RXEA 1IQFA 1YPHC 2Y5HA 3AW0A 1T7CA 2BVRH 1AVWA 1DWCH 3NK8A 3GY2A 4Y7AA 3P8FA 1FAXA 2GT7A 4TPYA 4JCNA 1C1MA 1OS8A 4K8BA 1BTHH 1HNEE 2GMTC 1KXFA 1KTSB 2QXHA 2GV7A 3HPTB 5GDSH 3M37A 1SG8B 4HZHA 1HV7A 1YPHE 1BTZA 2ZFTA 2A4RA 2O8TA 4FUHA 3UWJH 1E37B 1KLTA 1J9CH 2BD9A 4I8GA 4NSYA 2ZEBA 2BXUH 1O31A 1PQ7A 2H5CA 4YLUA 3A7YA 2WUCA 1PJPA 4FUJA 1ZLRA 3PROA 1FNIA 1C1OA 1KDQA 4NIVA 3QX5H 2Z3EA 3BTFE 3QZRA 2H2ZA 3GYMA 3TGJE 1NRQH 3ZVAA 1GCTB 1CA8B 2Z9LA 1DSUA 2FOBA 2Q6GA 1ORFA 1SLUB 2XRCA 1UTQA 1O5AB 4DOQA 3UWIA 2VB0A 1K1MA 2VVUA 5TCAA 3MU4A 1WOFA 2XWAA 2JH0D 3K9XB 5FX5A 4GLYA 1GJCB 1BTWA 3RXJA 3KQEA 1CO7E 2BMGB 4KKDA 2XXLA 1VJAU 2J94A 1SGRE 2BDIA 1A0LA 1HAPH 4X2WA 5LGOA 1TGTA 1P3EA 2J9NA 4X2YA 1LCYA 4B2BA 2QV1A 4E05H 4Y79A 1XUFA 1T8NA 1T32A 5L6NH 2D26C 3SV2H 3S69A 1GI0A 3A85A 1C2KA 4YOIA 2QIQA 4CH8B 5LPEA 2XWBI 4X6NA 1JRSA 4B1TA 4JZ1A 5FCKA 2CMYA 3ODFA 3U1JB 1A46H 8KME2 2CF9H 2A5IA 4ZHMU 4JK5A 3SNEA 3GYLB 1YPMH 1SB1H 4Y8XA 3F6UH 1ZPCA 2M5TA 3SU5A 3OY5U 1P06A 2GT8A 3H7OA 1JWTA 4BXSA 1TX6A 1MD8A 1T4VH 1DT2A 3ITIA 4INHA 1NFYA 3K65B 1O3BA 2XW9A 4GCHF 3ZZ6A 4X6MA 1NRNH 1FLEE 1GCTC 1O3NA 4CHAB 4NIWA 1KXCA 5T6DA 3LJJA 1FN6A 2AIPA 2BYAX 1AKSA 3UY9A 1D6WA 2ZC9H 4H6TA 1KXDA 2BX4A 4ISOA 3D49H 1ZGVA 2C8YB 1BUIA 4IMZA 3SNAA 5I46H 3ZVEA 5JB8S 1P2KA 2ZCLP 4GUXA 4BTUB 1O3GA 3A83A 1QA7A 4YT6H 5DP4A 4A7IB 5E2OA 1MCVA 4UFDH 5GPIB 3TGIE 5LPRA 1SSXA 5FX6A 2FOCA 1G37A 2ZU4A 4DGJA 3RXAA 1O5DH 1UHBA 1ETRH 2QXIA 2FOFA 2EI8A 1HCGA 1W0ZU 1F0UA 5JBCS 1P02A 1C5XB 1HAZB 5EGMA 3T62A 5EU8A 1UK2A 1Z7KA 1TE0A 1HBTH 2QXGA 3RXRA 2PGBB 1ETTH 1UK3A 2BDYA 2H9HA 4XBCA 2IJOB 3ZZ3A 2FOHA 4BOHA 3KIDU 3RMMH 1FY3A 4OS1A 2SFAA 1O2IA 2VH6A 2XBVA 5F8XA 1RIWB 1THPB 4E7RG 1AVXA 4MNWA 2TBSA 1UTPA 3MH6A 2ANYA 3Q3YA 2ZFSA 4CHAC 2A7CA 1ACBE 1JBUH 3PV4A 2EI7A 1DUAA 3VXFH 4BTTB 1FQ3A 4CRFA 1C1NA 1K22H 3Q76A 4B73A 1GJAB 1NY22 2HPQH 1QY6A 4MLFB 1LVMA 1S85A 4NA7A 1F0TA 3PTBA 3LGWA 1ABIH 1NROH 4AFSA 2A4OA 1J14A 3LGYA 3GCOA 1RJXB 1ELVA 2ZPSA 1O2LA 3JZ1B 3KQCA 4JYVH 1HDTH 1C2GA 1O2RA 1YPGH 2FP7B 1L0ZA 1O2VA 3A87A 1V2PT 1SHYA 1TMTH 1TRYA 1K9OE 3RXVA 3RXUA 3DD2H 3VXEH 5BPEA 2Q1JA 4A5TS 2CXVA 1P11E 3HK6B 1BRBE 1FXYA 3B8JA 3GY5A 2P3FH 1GG6B 4X1RU 1GBEA 3A7ZA 1VITH 4RKJB 1GBMA 1AFEH 2OP9A 5CHAB 1A1RA 4J1YA 4GCHG 4R0IA 5JPMH 1AB9C 1JRTA 2TPIZ 3LGIA 3Q77A 1OP8A 4OS4A 4DW2U 2JETC 3KQBA 3D62A 3PLKA 1QBOA 3LH3A 1OYTH 1Y3UA 2ILNA 3MU0A 2FS9A 4F49A 3CENA 2Z9KA 1HAXB 1Y3VA 3KNXA 2AGGX 1DSTA 1AI8H 2ZDNA 1ZSKA 4Q7YA 1KIGH 1C5TA 3SN8A 2VH0A 2Y80A 1GBLA 1AO5A 3QN7A 4OS7A 2UWPA 4YO9A 2G00A 3KHVA 3UPEA 2VVVA 4J2YB 3MNCA 1HJ9A 3PLBA 4LK4A 3UR6A 2OCVB 1UK4A 4BAMB 2BD4A 4O3TA 3TPIZ 2A2QH 4ZKNU 1AE8H 2ZIQH 2JH6D 2WV5A 3URCA 3Q3KA 1C5VA 4K1EA 1QTFA 3PWCA 5CE1A 3LONA 1QR3E 3JZ2B 1A5IA 4AGKA 3S0NA 1O2SA 3IITA 3EDXB 4CRAA 1C1PA 2ZTXA 1MZAA 3GDSA 4X1NU 3UREA 3VGCB 1C1VH 1EX3A 2PHBA 5ETXA 2SNWA 4AFQA 3QZQA 2Y7XA 3P8GA 1EXFA 1NRPH 3E8LA 1L4ZA 3RXGA 1BITA 1BMMH 2WPJS 1UCYE 4DIHH 1A3EH 1P05A 4Z0KA 3MWIU 5DP7A 3QWCH 1MUEB 1EJNA 5L30H
chains in the Genus database with same CATH superfamily
3SUEA 1C2DA 3PM3A 1HAIH 2NWNA 4NSVA 1P2QA 2IPQX 5AFZH 4K5ZA 1O37A 5CHAC 4ZH8A 1FPHH 3A7XA 3NKKA 5J4SA 3UAIC 3N7OA 4AC9A 2ZECA 1TWXB 2XBXA 4FUIA 3RU4D 2K0QA 4B74A 2GV6A 3GY3A 1SBWA 4Q63A 3KQ5A 4O3UA 1C1QA 5H4IB 2A5KA 4UFGH 1T8MA 2KX4A 2F3CE 3MOCA 4WY3A 3OAAD 3PYHA 4BXWA 3TU7H 4FU8A 1OKXA 1IQJA 2J38A 2FLBH 5DPAA 1XUIA 4MPXA 2HOBA 1CT4E 1P2MA 1EJAA 1CSOE 3RUOA 2Y5GA 1ESBA 1VGCB 3LIWA 1SPJA 5JBAS 1O2YA 1GJ9B 4YOGA 5G4BA 1EB2A 1Y5AT 2I6SA 3BEUA 2ZU1A 3SNCA 4HI3A 2W7UA 4TPIZ 3ZZCA 1C9PA 3ENSB 1XXFA 3RU4E 2BD3A 1E79D 4HTCH 2OUAA 1DDJA 1F5LA 5DK1A 2FIRH 4D7GA 5FHTA 3MTYA 1FAKH 3VFEA 1THRH 2ZHQH 1ARCA 1LDTT 2ZGXH 4TWYA 1BDAA 5EJ1A 3MMGA 3P70B 5C0TA 3ATIA 1BTUA 4AFZA 2GVFA 1SI5H 1W7XH 3B23B 1VCQA 3SYJA 3VGCC 1MAXA 4Y0ZE 1J17T 2PLXA 1BRUP 1NFWA 5DG6A 4GHTA 3RXTA 2HVYB 1G3BA 5EIYA 5C2ZA 5EPYA 1SGFG 3SBKA 4ZCNA 4Z6AH 4ABGA 5EPNA 3MQKC 2FX4A 4KP0A 1LHFH 4I8JA 2KAIB 4H42U 1AKSB 1K1PA 3GDUA 5FBEA 3RXBA 4FXGH 4TY7A 1EOLA 4AB8A 1BHXF 2CHAC 2A7HA 3ESTA 3SV6A 5DO4H 1QL7A 5SGAE 1FI8A 2ZGCA 1L2EA 1YLNA 1DWEH 1QL8A 1MTNB 1N6XA 3ZZDA 5J4QA 1MKWH 1K1IA 1NC6A 1TNHA 3TVJB 5E0GA 1K0HA 1P12E 2HPPH 1LO6A 4DCDA 2FZZA 1OXGA 3QUMP 4LXBH 2FOEA 1H9IE 1GMCF 3BIUH 4U32A 4ABBA 1ZMJA 5A0AE 3E0NB 1HXFH 1Z1JA 1HB0B 4OS6A 1LMWB 3DSPA 3GY6A 3OYPA 4AOQA 1GBDA 4IN2A 4JZFH 5A0CA 2ANKH 3VPKA 6LPRA 1MQ6A 2FWWA 5T6FA 1Z8JB 1HFDA 1NU7B 2A2XH 5DP9A 1CHOF 1D4PB 2CK3D 1QIXB 1IHSH 1DANH 2CN0H 2L74A 3M5MA 1LVYA 1ESTA 1D3QB 2SGQE 3QTOH 2VNTA 1RS0A 1W0YH 2BD8A 1AUTC 1O3PB 1P2IA 4D9QA 4YT7H 1RGQA 1TGCA 2GMTB 1P01A 2OTVA 3LGUA 3T5FH 1K1LA 2FI4E 1E34B 2BB4A 1SVPA 3KEEA 1GBJA 4Y6DA 5F8ZA 3SZNA 5JBTA 4B2AA 3P8OA 3MH5A 5BRRE 4MNYA 4Q80A 1K2I1 3LU9B 1XKAC 1GBAA 4D8NA 1E35B 1MU8B 1LPGB 2O9QA 2PR3A 3PMJA 2G5NA 3C1KA 1CGHA 5A8ZA 4FVDA 1SC8U 3F68H 1BMFD 2XC5A 3M35A 1TYNA 1C2JA 1RTKA 2H5DA 1NESE 3HATH 1V2NT 1XUKA 1MTNC 3ZZ8A 2FYRA 3HGNA 4NGAH 1UW7A 1P2NA 3HKIB 4AZ2B 5HYOA 2AMDA 1HAVA 1CGJE 2R3YA 1S84A 2J98A 1WV7H 1TPPA 2TRMA 4AGJA 2UUFB 2THFB 1CGIE 3MNXA 1IQKA 1EZQA 2KFWA 2BX3A 3ZZAA 1DLKB 4JYUH 2EA3A 2ZTYA 5K0HA 1UVOA 4HFPB 2OXSA 2BLQA 1ZTKA 1C5SA 1HAOH 4A92A 1Y3YA 4R8TB 1NTPA 1LHGH 2B7DH 3UNQA 2ALVA 4U30A 1WQSA 1GHWH 1V2VT 1SGYE 1V2MT 1UTLM 2QF3A 3U28C 2ANWA 1P8VC 3EA7A 1O2KA 3WY8A 3QLPH 2F9NA 1KMHB 3F9EA 3LC3A 1JXPA 1BB0B 4U2WA 2H6MA 4PROA 5TCCA 1XM1A 2ZTZA 5E0JA 1HGTH 3BTME 1BJVA 2A0QB 3Q3XA 4O03A 1SQAA 1D9IA 3VEQB 1E38B 1QL9A 3HKJB 3MU8A 1P0SH 1ETSH 1HAYB 1F5RA 2Z9GA 2V0BA 3CP7A 1W0KD 2WPLS 4OGYA 1V2KT 1ANCA 3HGPA 2D8WA 5C0UA 1OWHA 1C4Y2 1UCYK 3RMOH 1C5RA 1WUNH 1DXPA 2PWXA 1GMCG 3TK9A 2TGTA 4ABJA 4A6LA 4ZKRU 1TNKA 3DSOA 2HALA 4ZHLU 1AQ7A 2PP6A 2FOAA 3M7TA 3E90B 3ZZ9A 1CHGA 1NRSH 2ZZUH 3SJKA 3LJOA 1SOTA 1YPKH 3CS0A 4GVUA 3MH4A 3I78A 1UTOA 5DP6A 1COWD 2RG3A 9LPRA 4NA9H 1CHOG 1ANDA 3E0PB 1ID5H 1RRKA 2QCYA 1BJUA 5A09A 1BTYA 1LVOA 2C93B 4MG3A 2B5TB 4YLQH 1GBBA 1TGBA 1UJ1A 2Z7FE 4HGCA 4I33A 3RDZA 2AS9A 3M5NA 4ABAA 4WMEA 3MHWU 3ZYDA 1O5CB 2P3TB 1J8AA 4LZ1H 1QRWA 5TJXA 3PMAB 1SGFA 2LP6A 2C8XB 4UDWH 1X7AC 2LELA 1V6DA 3A8DA 1KXBA 3PMHB 2AFQB 5FPYA 2ZFRH 2AGEX 3NCLA 2ZO3H 3SHAH 1G9IE 1PQ8A 3P95A 4ABHA 1WAYB 4XBBA 4CRBA 1C5WB 4CBNA 5FPSA 4MPVA 3E91A 1A61H 1IQIA 1O33A 3IG6B 1NU9A 4UONA 1P10A 1YWUA 2VIDA 3EAJA 2ANMH 5GNDA 1QQ4A 3TNSA 4NG9H 1IQNA 2VU8E 2VVCA 1ZJKA 1JOUB 3SV8A 1F2SE 3A7VA 1VJ9U 2BQWB 2K8IA 5AHGH 3IWMA 1C5NH 2VIVA 1GI9B 4JMYA 3LOXA 1A5GH 1GHYH 1NS3A 2P94A 5HM9A 1K1NA 3W1EA 5HKKD 1AY6H 1C5YB 3G01A 2QAAA 7GCHF 2R2MB 3T26A 3KL6A 1UO6A 1XKBC 2A5AA 1MU6B 2P59A 2QGRA 2WPHS 2O8LA 3ZVBA 1YBWA 1GJBB 2OINA 4A1TA 7LPRA 1OWEA 3UFAA 3O8CA 1IQLA 1DWBH 1G32B 2AERH 1TFXA 2ZDMA 4CH2B 1UVSH 4D9RA 1D3DB 2KAIA 1GJ5H 1LPKB 4MQAA 1GI6A 2GDEH 1DOJA 5AF9H 1C4V2 4TYDA 2ZPRA 1V2WT 1QURH 1IQGA 3SNDA 1DXWA 4XE4A 3SU1A 2R0KA 3GY4A 4FUCA 1BCUH 5EODA 4ZAEA 3LH1A 2KR7A 1A2CH 3CNRA 3ATWA 3K6YA 1V2RT 2VIPA 1PPGE 2VWNA 5HM2A 2K1QA 1BBRE 2NU3E 1TMBH 3SJ9A 3DUXH 1YM0A 4CRGA 4ZKSU 1IHTH 1GBIA 1BRCE 2Y6TA 3SJIA 3TJOA 4DIIH 4F55A 1DFPA 1O35A 2PKSC 1AVGH 2JIZD 4THNH 1EAXA 1BOQA 1GPZA 3SU3A 4I32A 1TX7A 5JB9S 4X8SH 3SU0A 1S0QA 2ZWLH 3F9HA 5C1YA 4X8UH 2H9EH 2BHGA 3KCGH 1C5PA 5GXPA 1H9HE 3C27B 3SUDA 1AZ8A 1AB9B 1YCPM 1YCPH 6CHAB 1W7GH 3RXMA 1N6YA 2BLWA 5A0BA 2GX4A 1ZYOA 2JETB 3V7TA 5EW1H 1BTXA 2J4IA 1J16A 2J97A 1UTNA 1SGDE 4Q2KA 1FIWA 1SQOA 2ZFQH 2VGCB 2A4QA 2QYIA 1P03A 3A7TA 1GJ6A 2QC2A 3V13A 4ESTE 1G30B 1HXEH 1FONA 1GBFA 1FJSA 2WUBA 3DHKH 3L6PA 1C5LH 5E8EH 1G3CA 3MI4A 1MKXK 2F91A 2GZ8A 1OP2A 3M5OA 2QXJA 3PTNA 3U69H 1VR1H 2F83A 2HLDD 3ATMA 4Y10E 1TLDA 1NO9H 1KXEA 1YCPK 3GCHB 1GVLA 4WH6A 1H4WA 3TH4H 2W3KA 1H8ED 2ULLA 4XOJA 4Y7BA 1MMJN 3ZYEA 3SUGA 1EJMA 2GGVB 2KCPA 2VIOA 4KTCA 1S6FA 3LKWA 1UVUH 1O3OA 2D2DA 3RC5A 4B75A 1O5EH 3QK1A 3OEED 3BF6H 3AW1A 3URDA 2LNCA 3SI4H 3TH2H 3UOUA 2YOLA 2UUYA 1SL3A 5CHBA 3RXLA 3GY7A 1Q2WA 2Q6FA 3GOVB 4X6PA 4E06H 3QGJA 1G2LA 3QTVH 1O2WA 4UD9H 3TNTA 1ZTJA 1ELFA 2NU0E 1CBWB 1HAVB 7GCHG 2J34A 3AAVA 3SI3H 2F9OA 6CHAC 2KCAA 1ZJDA 4ACBA 3SU2A 4Y8ZA 2RDLA 4XDEA 4K60A 3TJUA 2GP9B 1ELCA 4MPUA 2YNBA 1P3CA 4UE7H 1E36B 2VGCC 1DPOA 4GHQA 4FUGA 2ZU5A 1Q3XA 2ZCKP 2B8OH 2J92A 4XSKU 2VWLA 1DVAH 1C2IA 2FI3E 2BY9X 2PFEA 1O3FA 5DP5A 1O2JA 4AX9H 1TQ7B 2STBE 4IMQA 5EXLA 2O8WA 1ZGIA 1Y5UT 3FZZA 1B0FA 1UVPA 3GISB 2QN5T 2OQ5A 1TPOA 1THSH 3FP7E 3F2FA 1DUEA 2Z9JA 1W3CA 3GCNA 3GCHC 2HNTF 4NCYA 2BD7A 1QQUA 3RU4T 3F3BA 1GGDC 2W3IA 2FPZA 2C3SA 4ZROA 4ZMAH 2I6QA 3SOSA 2HGTH 3RXFA 1GDQA 2P3UB 1V2LT 1SGQE 3ZV9A 1QNJA 1GWAA 2KZ4A 4X1PU 2ZFPH 3U8RH 4Q4LA 1C1SA 1OP0A 3NWUA 1W11U 3I29A 1C9TA 1WU1A 1GJDB 1XX9A 1AMHA 2WPIS 2W7SA 3TK6A 2EEKA 4BAOB 2BY7X 1OWKA 2M2AA 1FUJA 1ANBA 3FAOA 2ZDAH 2B9LA 4FOUC 1P9SA 1IQMA 1LKAA 1FY4A 3BSQA 3ELAH 5IYTA 1CBWC 2CHAB 1BQYA 3UTUH 2UWLA 2BVXH 3SGAE 4K1TA 1QGFA 2Z94A 4NIXA 2KCYA 3LDXH 2PGQB 1QBVH 1JMOH 3M36A 3MFJA 4FUFA 5A8XA 1YLDA 3LGTA 3RXHA 2FEQH 2YNAA 2OC7A 1MABB 1SGPE 1ZMNA 2BQ7B 1IOEA 3KYFA 1YPEH 1NPMA 1O2UA 4P00A 1V2TT 4DG4A 1VKYA 4ZKOU 7KMEH 1GBHA 1FN8A 1OHHD 4K2YA 1Z6EA 3A89A 5C20A 2ZHWH 1ZHPA 4OS2A 5FCRA 5KEDA 3ZVFA 2R3UA 1GHAF 2WV4A 3U8TH 3M3TA 2CV3A 2PTCE 1L1GA 1EKBB 3MNBA 1AN1E 3M3VA 1AWFH 1VZQH 2J5UA 1EUFA 5LH8A 1XUGA 1UTKA 1NFUA 3NRLA 2ZA5A 2XC0A 2VIWA 2J95A 1DY9A 1YLCA 1LKBA 5EQQA 1JIMA 1H9LB 4NFFA 1P57B 3GICB 2EY4C 1RFNA 4I86A 3RXIA 3KF2A 4Y71A 2FO9A 2TGAA 2XCNA 3CS7A 1EZSC 2JDID 1O2HA 5C3NA 1C5ZB 2NU4E 5GCHF 3OX7U 1O2OA 3M7QA 3V3MA 3E3TA 1TONA 4NFEA 2ZG0H 1BBRK 1F0RA 4WVPE 2PUXB 4NZLA 1Y8TA 1Y3WA 3U8OH 1V2JT 5B6OA 2OD3B 1QJ6B 1YPJH 9ESTA 1VITF 3BTTE 3GY8A 2AYWA 3S7KB 2V3HH 2Y5FA 4KTUA 3O8BA 3RXOA 2FM2A 2G8TA 3P17H 1CA0C 3K6ZA 1O36A 1EZXC 1WBGB 3FZDA 3PMBB 3M61U 2BD2A 2Z3CA 3SGBE 3RMLH 1RXPA 3DCLA 3K2UA 1QJ1B 3UIRA 1V2QT 2TGPZ 5EXNA 5T6GA 1OX1A 1ZZZA 2Z9IA 4X1QU 5JYIA 1ZHMA 1TOMH 1DX5M 2XC4A 8LPRA 1S81A 3EYDA 5C5OA 3SGQE 4IC6A 4CR5A 3O8DA 4WMFA 2AH4X 2YMSB 1RD3B 2BLVA 4TY6A 4WH8A 4YZUA 1QRZA 1MTSA 1O34A 2O8MA 3F0PA 1PFXC 3SQHE 1C5MD 1G2MA 3ZZBA 2ODYB 1K1OA 3F9GA 4BAHB 5AFYH 1XXDA 4DJZB 4SGAE 4WF8A 3T29A 3MO3A 2BOKA 3UQOA 3TJVA 4DY7B 1B0EA 4AG1A 1IQHA 1SOZA 1EQ9A 2HVXA 1XUHA 1CT2E 4Y8YA 4RT0A 1O3EA 4D7FA 4CR9A 2TGDA 4MNVA 2BY8X 1GL1A 2HNTC 4DVAU 1KXAA 3RC6A 4AG2A 2C8WB 1ZOMA 1HIAB 1DM4B 1BRAA 1CT0E 2FODA 2SGPE 3ZVDA 4ASHA 2DUCA 1P2JA 1RTLA 3MYWA 2HRVA 1O2TA 1YC0A 2HNTE 3UNRA 2W6JD 1EAUA 3WW7A 1OWIA 1O3LA 2ZNKH 4MNXA 3BIVH 1GL0E 1IQEA 3WWFA 1ZHRA 3TITA 1GHAG 2FX6A 2HWLB 4KTSA 1C2MA 1G36A 3F9FA 3S7HB 2P8OB 1T8OA 1PPCE 1BHXB 1XVOA 4HG6A 2PW8H 3KN2A 1O30A 1TABE 2YMSD 1C5OH 3BV9B 3P8NA 1GJ7B 3EE7A 1YPLH 3KGPA 2STAE 2R9PA 5HXFA 4KGAA 1ESAA 1FPCH 2FXRA 4ACAA 2ZGBH 3DA9B 2OQUA 1S83A 3ATLA 2BQ6B 5L2YH 1W12U 3DFLA 4CBOA 5HMAA 3M5LA 1EPTC 1PPBH 3ATKA 2YMSC 3N7DA 4RN6A 2F9PA 1PPFE 5GCHG 1EAWA 1AU8A 1MBMA 2FOGA 3F1SB 1UCYH 2GCTC 4NIYA 2BOHB 1H8HD 1TA2A 1KY9A 1O3IA 1O5BB 1S6HA 4OS5A 3DT0H 1HRTH 1LVBA 2QA9E 2Y81A 2W5EA 2VJ1A 1UVTH 1SQTA 1MCTA 1VITG 1GCDA 1A4WH 3FVFB 4MTBA 5DJ7A 4ISHH 1BMAA 2BDCA 5FBIA 2UUKB 1QHRB 4LZ4B 3QGNB 1SGIB 2DE9A 3PO1C 1LPZB 5JDUB 2FTMA 1C2HA 3MH7A 3FP8E 1EP6A 2A4GA 1L1NA 1WDIA 1MTVA 1YP9A 2DE8A 1O3KA 1GJ4H 2C8ZB 1QA0A 3QDZB 1ZRKA 2BDBA 3WWBA 4VGCB 4SGBE 5T3HA 1SQRA 1NN6A 1Z6JH 4H4FA 4X0WU 4RSPA 1ZRBA 1ZSJA 3VB5A 1E0FD 3R0FA 2VWOA 3SNBA 2F9BH 4X1SU 1KSNA 2QF4A 4TT3D 4M7GA 5I25A 1ELTA 2P8OC 4ISIH 5C67A 1BA8B 5C94A 2ZPQA 2GZ9A 1W10U 3RM0H 1C2LA 1O5FH 4WXIA 1FY8E 3BTDE 1O2GH 1EATA 2KCOA 4ZXXH 2Y82A 2WPKS 2WYJA 2CGAA 5GIBA 1NT1A 3VB6A 8ESTE 3SQEE 1OOKB 1SR5C 3ZZ5A 1G3DA 1A0HB 2V3MA 2PKAB 2O8UA 2PKSB 3ZV8A 2OBOA 1GVZA 2SGFE 1O2ZA 4NWLA 1DS2E 2V6NA 1TRNA 1HJAC 4DURA 1Y5BT 2LPRA 5ESBA 1J15A 3T25A 1AWHB 1XVMA 3D23A 3BTGE 2JJ2D 1QJ7B 2AHME 3FO8D 3OEHD 1F92A 3MU5A 2EC9H 3RP2A 1FMGA 5IK2D 2R2WU 1LQEA 4I8KA 3BTQE 2AEIH 4X2VA 1GI1A 3BG8A 4TWWA 1ELAA 3E16B 1INCA 1MAYA 3ZZ7A 1C1RA 3RMNH 3A80A 1GMDF 4CRDA 2BD5A 1O5GH 3PV5A 4VGCC 3H5CB 1C4U2 3HK3B 3U9AH 4GPGA 1GHXH 4IBLH 3N99A 1TAWA 4F4OC 2NU1E 1K21H 3MO6A 2A7JA 3TLOA 2SGDE 3PB1E 3T2NA 1O3MA 2C90B 3MNSA 3M7UA 4BAQB 3B9FH 2BVSH 6GCHF 3R3GB 5F6MA 3BTHE 3OU0A 2H9TH 1ZPBA 1S6LA 1TALA 2OC0A 1TBZH 1SGEE 1QRXA 4INLA 2HLCA 1GBCA 1LHDH 1QBNA 3V12A 1O2NA 4FUDA 2A1DB 2PTNA 3SUFA 1TX8A 2AMQA 2AGIX 1O2XA 2GTBA 3PWBA 1YYY1 1GHBF 2BZ6H 1B5GH 5FAHA 4XD7D 1MKXH 4JYTA 1C1WH 2VBCA 4AFUA 4ZHAA 5F8TA 1EPTA 1EB1H 1YF4A 3RXSA 3TGKE 3A8BA 1EFRD 2QE7D 2WINI 3LT3A 4K3JA 1ZMLA 2VWMA 3LGVA 2IJD1 5DKMA 3SU6A 1TMUH 2FLRH 3L3TA 7ESTE 1Z8IB 5GWZA 1AE5A 2FOMB 3VB7A 2A45B 2BM2A 5PTPA 2H1UA 1EAIA 1HAGE 1ELDE 2ZF0H 4BNRA 1NBMD 2GJGA 3S9AA 1E1RD 2IN2A 5DP3A 3U98H 5HIZA 5EG4A 2Z6BD 1HIAA 3FFGA 4ABDA 2BY6X 2VINA 4FU9A 1H8DH 1TNJA 2PUQH 1BZXE 1F7ZA 5EOKA 4JK6A 1WCZA 1M9UA 3RM2H 2WHXA 1HJ8A 1ELGA 4AORA 3Q00A 3ZIAD 4QT8C 1P2OA 3GCTF 3SV9A 3BG4B 8GCHF 1TPAE 4FUBA 1NBME 1GGDB 2FI5E 3E1XB 3VB3A 4RKOB 3P92A 1O39A 3PRBA 4YM9A 1GI5A 5FXLA 3LC5A 1GBKA 3L33A 1ARBA 1QCPA 3W94A 3ZVCA 1F0SA 2WV9A 1AHTH 1O3DA 1AFQB 1BMLA 1GI4A 3O8RA 3V0XA 1EP5A 1EZUC 4UEHH 1TIOA 2FTLE 1BT7A 3T28A 4Z1MD 1MTUA 2ZCHP 1ANEA 2JKHA 3RXDA 2UWOA 4FETA 3GS9A 2G52A 2Z3DA 3RXCA 1WYKA 3NUMA 5FPTA 5EJZA 1A7SA 1E1QD 1FV9A 1GBTA 1GMDG 2OBQA 1MZDA 3BTWE 2B0FA 3H09A 4I8LA 1HPGA 2ZQ2A 1GHVH 1PQ5A 3S9BA 2ZQ1A 5EW2H 5C1XA 4IGDA 1W14U 1QZ8A 1FY5A 3A88A 4X6OA 1Z8GA 1NM6A 2ZFFH 3OTJE 1TNIA 2G4TA 1YY3A 5K7RA 3SJ8A 1T31A 3F2HA 1L1JA 1KLJH 2ZKSA 2ZGHA 1WTHD 1O3CA 1V2OT 1LHCH 1DITH 3BN9A 1TGSZ 1S5SA 2ZP0H 1SLVB 2RCEA 3UR9A 6GCHG 2FESH 4JZDH 1AZZA 2BDGA 5FL7D 5JBBS 1RTFB 2BDHA 2JJ1D 3S9CA 5KGOA 4Q7ZA 2V35A 1Y3XA 1C2EA 5A2MH 2ZI2H 2TIOA 1ELBA 1TBRH 3RLWH 2BXTH 1OWJA 1WQVH 1MTWA 3EQ0H 3FANA 1IAUA 5HGGA 1O3JA 4XFQA 2QF0A 1CU1A 4B2CA 2FMJA 1DICA 3BG4C 1GHBG 1BMNH 1BTPA 4XRNA 4AYVB 1RIWC 1ZR0A 2BTCE 1Z71A 1XUJA 2SGAA 1SHHB 1AGJA 1DLEA 1XMNB 1GHZA 1GDUA 2P95A 1WSSH 1SGTA 4Y76A 1QB6A 4RT1A 3T27A 4FVBA 2FDAA 3A84A 2ALPA 3E6PH 4Y11E 3SO3A 2P16A 4A1VA 1AFQC 1S0RA 2SNVA 3A7WA 2ZU3A 2GZ7A 1MBQA 5EQRA 1VCWA 3H7TA 2GCHF 4X8VH 1O32A 1F5KU 5AVDA 3FN8A 1C2FA 4ABFA 2BZAA 2AIQA 1HLTH 4JZIA 4BTIB 2L6OA 3BTEE 2FS8A 3F2GA 2GDDA 2ZU2A 1FDPA 2PKAA 5EQSA 1ELEE 2P93A 1Z1IA 4NA8A 4WXVA 1C5QA 1GJ8B 1KDQB 1SMFE 3FOAA 4CRCA 1CA0B 1S82A 4O97A 2ASUB 4LOYH 4P02A 3SV7A 5LPFA 1A3BH 2G51A 5C1UA 1FZZA 3GCTG 3TH3H 8GCHG 1DY8A 1GG6C 2XBYA 2VIQA 4E7NA 1NRRH 3NPSA 4CREA 2XNIA 1MD7A 5CMXH 2ODQA 1TBQH 1UTMA 2G4UA 3OSYA 4OGXA 1NZQH 1TB6H 1BBRH 1CQQA 4YOJA 2ZGJA 4RI0A 1T8LA 6ESTA 1V3XA 3D65E 1P09A 3ZZ4A 1D3TB 1T4UH 2XYAA 2ZHFH 4MDSA 4I7YH 1O3HA 2ZDKA 1Z8RA 3BEFB 3RLYH 4IC5A 3A81A 4IW4E 4NWKA 1TNGA 4O9VA 5L2ZH 3STIA 4A1XA 1FX0B 1Y59T 2ODPA 1H1BA 1OPHB 1PQAA 1QFKH 1QB9A 4AB9A 2GD4B 3BTKE 3UUZA 2Y7ZA 4BANB 2XCFA 3I77A 1O2PA 1OYQA 4INKA 1YKTA 2EQNA 1D6RA 1GI2A 1N8OB 4D76A 4ASUD 1KTTB 2BLOA 2G55A 3SHCH 1A5HA 1HYLA 4BAKB 2ZHEH 4B76A 4FU7A 4ISNA 4K1SA 2R0LA 2F9UA 4XBDA 2PV9B 3EA9A 3RXQA 1B7XB 1OSSA 1KYNA 1TA6A 5GJ4B 2G5VA 2OLGA 1TNLA 4H6SB 3AAUA 2CF8H 1W2KH 1PPEE 3TIUA 1AIXH 1TOCB 1GMHF 1UMAH 1ZSLA 4IN1A 2F9VA 1UTJA 1H8IH 4ZXYH 3MO9A 5F53A 1GI3A 4MPWA 2EI6A 3AVZA 1ZTLA 3VG8A 3QO6A 1SGNE 3EGKH 4YTAA 3UB0A 4K8YA 4MVNA 2BDAA 3EA8A 1SGCA 2RA3A 5EJLA 3A8AA 3A86A 1O3AA 4YESB 2IOTA 3N7EA 3TK5A 4X2XA 4B6FA 1HAHH 1WXRA 5E0HA 4AYYB 1GI8B 3DFJA 1VCPA 1WTGH 3GDVA 2XBWA 1P9UA 4I31A 4WJG2 1EPTB 1P04A 1SFQB 1GI7B 2C4FH 3LPRA 3M3SA 2NU2E 1CVWH 4UFFH 2GCTB 1W13U 3RXPA 4K69A 1TQ0B 1C1TA 3NZIA 4UFEH 3U1IB 1OWDA 4WWYA 1EASA 5ABWA 1C5UA 2WYGA 3SU4A 3P6ZB 1EOJA 2GCHG 1ZPZA 5IDKA 1ABJH 1SLWB 1W8BH 3MU1A 4B71A 3ZVGA 4GAWA 1MQ5A 1UHBB 1VGCC 3BEIB 3PO1B 1CE5A 1LHEH 1G3EA 2PSXA 4Q7XA 1K28D 2GKVE 1N8OC 2G81E 1FY1A 4WMDA 3UQVA 2D1JA 1QB1A 2ZDLA 5ESTE 3W95A 1DE7H 4ABIA 1MKWK 4GSOA 5DP8A 1D3PB 1JIRA 5C5NA 1V2ST 2XTTB 3A8CA 2SGEE 1U6QA 2IPHA 2PSYA 1C1UH 1TRMA 5T1VA 1O0DH 1YGCH 1O2MA 2JH5D 1V2UT 2J2UA 2OC8A 3OTPA 4KELA 1O38A 4U01A 1Q31A 3SORA 3SJOA 1GVKB 3STJA 2AMPA 1HUTH 4I8HA 2A32A 2BY5X 4ISLA 2QY0B 1TGNA 4F48B 2A31A 3FP6E 2RFKC 1SLXB 1BIOA 3UOPA 1K1JA 4DT7B 3PLPA 2ZDVH 4NZQA 4X8TH 3UNSA 1PYTD 4JZEH 2V3OH 1N1LA 2RA0A 2WPDD 4ZUHA 1MH0A 4AN7A 1PPZA 1TPSA 1GDNA 1NFXA 2WPMS 5F03A 2Q6DA 1FIZA 1HJAB 3OY6U 3ODDA 2W26A 4ABEA 1AUJA 5A8YA 3EE0B 1A0JA 2OC1A 4Y0YE 1O2QA 1PYTC 1SFIA 5KECA 3NXPA 1KLIH 5EXMA 3TJNA 1DWDH 5E2PA 3SW2B 3RXKA 2FYQA 2W6ID 3A82A 1LTOA 4IS5A 3VB4A 1L4DA 4OM9A 1PPHE 1GMHG 2ZHDA 1AD8H 3AASA 2CJIA 4FUEA 2UUJB 2OK5A 3RC4A 1LQDB 3KQDA 2ESTE 5DGJA 3RXEA 1IQFA 1YPHC 2Y5HA 3AW0A 1T7CA 2BVRH 1AVWA 1DWCH 3NK8A 3GY2A 4Y7AA 3P8FA 1FAXA 2GT7A 4TPYA 4JCNA 1C1MA 1OS8A 4K8BA 1BTHH 1HNEE 2GMTC 1KXFA 1KTSB 2QXHA 2GV7A 3HPTB 5GDSH 3M37A 1SG8B 4HZHA 1HV7A 1YPHE 1BTZA 2ZFTA 2A4RA 2O8TA 4FUHA 3UWJH 1E37B 1KLTA 1J9CH 2BD9A 3PRDA 4I8GA 4NSYA 2ZEBA 2BXUH 1O31A 4B6EA 1PQ7A 2H5CA 4YLUA 3A7YA 2WUCA 1PJPA 4FUJA 1ZLRA 3PROA 1FNIA 5HIYA 1C1OA 1KDQA 4NIVA 3QX5H 2Z3EA 3BTFE 3QZRA 2H2ZA 3GYMA 5DSFA 1NRQH 3ZVAA 1GCTB 3TGJE 1CA8B 2Z9LA 1DSUA 2FOBA 2Q6GA 1ORFA 1SLUB 2XRCA 1UTQA 1O5AB 4DOQA 3UWIA 2VB0A 1K1MA 2VVUA 5TCAA 3MU4A 1WOFA 2XWAA 2JH0D 3K9XB 5FX5A 4GLYA 1GJCB 1BTWA 3RXJA 3KQEA 1CO7E 2BMGB 4KKDA 2XXLA 1VJAU 2J94A 5DN6D 1SGRE 2BDIA 1A0LA 1HAPH 2V7QD 4X2WA 5LGOA 1TGTA 1P3EA 1W0JD 2J9NA 4X2YA 1LCYA 4B2BA 2QV1A 2F43B 4E05H 4Y79A 1XUFA 1T8NA 1T32A 5L6NH 2D26C 3SV2H 3S69A 1GI0A 2XNDD 3A85A 1C2KA 4YOIA 2QIQA 4CH8B 5LPEA 2XWBI 4X6NA 1JRSA 4B1TA 4JZ1A 5FCKA 2CMYA 3ODFA 3U1JB 1A46H 8KME2 2CF9H 2A5IA 4ZHMU 4JK5A 3SNEA 3GYLB 1YPMH 1SB1H 4Y8XA 3F6UH 4YXWD 1ZPCA 2M5TA 3SU5A 3OY5U 1P06A 2GT8A 3H7OA 1JWTA 4BXSA 1TX6A 1MD8A 1T4VH 1DT2A 3ITIA 4INHA 1NFYA 3K65B 1O3BA 2XW9A 4GCHF 3ZZ6A 4X6MA 1NRNH 5B6LA 1FLEE 1GCTC 2KM0A 1O3NA 4CHAB 4NIWA 1KXCA 5T6DA 3LJJA 2WSSD 1FN6A 2AIPA 2BYAX 1AKSA 3UY9A 1D6WA 2ZC9H 4H6TA 1KXDA 2BX4A 4ISOA 3D49H 1ZGVA 2C8YB 5CDFE 1BUIA 4IMZA 3SNAA 5I46H 3ZVEA 5JB8S 1P2KA 2ZCLP 4GUXA 4BTUB 1O3GA 3SZEA 3A83A 1QA7A 4YT6H 5DP4A 4A7IB 5E2OA 1MCVA 4UFDH 5GPIB 3F0OA 3TGIE 5LPRA 1SSXA 5FX6A 2FOCA 3OE7D 1G37A 2ZU4A 4DGJA 3RXAA 1O5DH 1UHBA 1ETRH 2QXIA 2FOFA 2EI8A 1HCGA 1W0ZU 1F0UA 5JBCS 1P02A 1C5XB 1HAZB 5EGMA 3T62A 5EU8A 1UK2A 1Z7KA 1TE0A 1HBTH 2QXGA 3RXRA 2PGBB 1ETTH 1UK3A 2BDYA 2H9HA 4XBCA 2IJOB 3ZZ3A 5C17A 2FOHA 4BOHA 3KIDU 3RMMH 1FY3A 4OS1A 3OFND 2SFAA 1O2IA 2VH6A 2XBVA 5F8XA 1RIWB 3DSGA 1THPB 4E7RG 1AVXA 4MNWA 2TBSA 1UTPA 3MH6A 2ANYA 3Q3YA 2ZFSA 4CHAC 2WZQA 2A7CA 3FKSD 1ACBE 1JBUH 3PV4A 2EI7A 1DUAA 3VXFH 4BTTB 2QF5A 1FQ3A 4CRFA 4DT4A 1C1NA 1K22H 3Q76A 4B73A 1GJAB 1NY22 2HPQH 1QY6A 2RDEA 4MLFB 1LVMA 1S85A 4NA7A 1F0TA 3PTBA 3LGWA 1ABIH 1NROH 4AFSA 2A4OA 1J14A 3LGYA 3GCOA 1RJXB 1ELVA 2ZPSA 1O2LA 3JZ1B 3KQCA 4JYVH 1HDTH 1C2GA 1O2RA 1YPGH 2FP7B 1L0ZA 1O2VA 3A87A 1V2PT 1SHYA 1TMTH 1TRYA 1K9OE 3RXVA 3RXUA 3DD2H 3VXEH 5BPEA 2Q1JA 4A5TS 2CXVA 1P11E 3HK6B 1BRBE 3KYGA 1FXYA 2F4LA 3B8JA 3GY5A 2P3FH 3AK5A 1GG6B 4M9FA 4X1RU 1GBEA 3A7ZA 1VITH 4RKJB 1GBMA 1AFEH 2OP9A 2J98B 5CHAB 1A1RA 4J1YA 4GCHG 4R0IA 5JPMH 1AB9C 1JRTA 2TPIZ 3LGIA 3Q77A 3PV2A 1OP8A 4OS4A 4DW2U 2JETC 3KQBA 3D62A 3PLKA 1QBOA 3LH3A 1OYTH 1Y3UA 2ILNA 3MU0A 2FS9A 4F49A 3CENA 2Z9KA 1HAXB 1Y3VA 3KNXA 2AGGX 1DSTA 1AI8H 2ZDNA 1ZSKA 4Q7YA 1KIGH 1C5TA 3SN8A 2VH0A 2Y80A 1GBLA 1AO5A 3QN7A 4OS7A 2UWPA 4YO9A 2G00A 3KHVA 3UPEA 2VVVA 4J2YB 3MNCA 1HJ9A 3PLBA 4LK4A 2XOKD 3UR6A 2OCVB 1UK4A 4TSFD 4BAMB 2BD4A 4O3TA 3TPIZ 2A2QH 4ZKNU 1AE8H 2ZIQH 2JH6D 2WV5A 3URCA 3Q3KA 1C5VA 4K1EA 1QTFA 3PWCA 5CE1A 3LONA 1QR3E 3JZ2B 1SKYE 1A5IA 4AGKA 3S0NA 1O2SA 3IITA 3EDXB 4CRAA 1C1PA 2ZTXA 1MZAA 3GDSA 4X1NU 3UREA 3VGCB 1C1VH 1EX3A 2PHBA 5ETXA 2SNWA 4AFQA 3QZQA 2Y7XA 3P8GA 1EXFA 1NRPH 3E8LA 1L4ZA 3RXGA 1BITA 1BMMH 2WPJS 1UCYE 4DIHH 1A3EH 1P05A 4Z0KA 3MWIU 5DP7A 3QWCH 1MUEB 1EJNA 5L30H
chains in the Genus database with same CATH topology
3SUEA 1C2DA 3PM3A 1HAIH 2NWNA 4NSVA 1P2QA 5AFZH 4K5ZA 1O37A 5CHAC 4ZH8A 1FPHH 3A7XA 3NKKA 5J4SA 3N7OA 2ZECA 1TWXB 2XBXA 4FUIA 3RU4D 4B74A 2GV6A 3GY3A 1SBWA 4O3UA 1C1QA 5H4IB 2A5KA 4UFGH 1T8MA 2F3CE 3MOCA 4WY3A 3PYHA 4BXWA 3TU7H 4FU8A 1OKXA 1IQJA 2J38A 2FLBH 5DPAA 1XUIA 4MPXA 2HOBA 1CT4E 1P2MA 1EJAA 1CSOE 3RUOA 2Y5GA 1ESBA 1VGCB 3LIWA 1SPJA 5JBAS 1O2YA 1GJ9B 4YOGA 5G4BA 1EB2A 1Y5AT 2I6SA 3BEUA 2ZU1A 3SNCA 4HI3A 2W7UA 4TPIZ 3ZZCA 1C9PA 3ENSB 1XXFA 3RU4E 2BD3A 4HTCH 2OUAA 1DDJA 1F5LA 5DK1A 2FIRH 4D7GA 5FHTA 3MTYA 1FAKH 3VFEA 1THRH 2ZHQH 1ARCA 1LDTT 2ZGXH 4TWYA 1BDAA 3MMGA 3P70B 3ATIA 1BTUA 4AFZA 2GVFA 1SI5H 1W7XH 3B23B 1VCQA 3VGCC 1MAXA 4Y0ZE 1J17T 2PLXA 1BRUP 1NFWA 5DG6A 4GHTA 3RXTA 1G3BA 5C2ZA 5EPYA 1SGFG 3SBKA 4Z6AH 4ABGA 5EPNA 2FX4A 4KP0A 1LHFH 4I8JA 2KAIB 4H42U 1AKSB 1K1PA 3GDUA 5FBEA 3RXBA 4FXGH 4TY7A 1EOLA 4AB8A 1BHXF 2CHAC 2A7HA 3ESTA 3SV6A 5DO4H 1QL7A 5SGAE 1FI8A 2ZGCA 1L2EA 1DWEH 1QL8A 1MTNB 1N6XA 3ZZDA 5J4QA 1MKWH 1K1IA 1NC6A 1TNHA 3TVJB 5E0GA 1P12E 2HPPH 1LO6A 4DCDA 2FZZA 1OXGA 3QUMP 4LXBH 2FOEA 1H9IE 1GMCF 3BIUH 4U32A 4ABBA 1ZMJA 5A0AE 3E0NB 1HXFH 1Z1JA 1HB0B 4OS6A 1LMWB 3GY6A 3OYPA 4AOQA 1GBDA 4IN2A 4JZFH 5A0CA 2ANKH 3VPKA 6LPRA 1MQ6A 2FWWA 5T6FA 1Z8JB 1HFDA 1NU7B 2A2XH 5DP9A 1CHOF 1D4PB 1QIXB 1IHSH 1DANH 2CN0H 3M5MA 1LVYA 1ESTA 1D3QB 2SGQE 3QTOH 2VNTA 1RS0A 1W0YH 2BD8A 1AUTC 1O3PB 1P2IA 4D9QA 4YT7H 1RGQA 1TGCA 2GMTB 1P01A 2OTVA 3LGUA 3T5FH 1K1LA 2FI4E 1E34B 2BB4A 1SVPA 3KEEA 1GBJA 4Y6DA 5F8ZA 3SZNA 5JBTA 4B2AA 3P8OA 3MH5A 5BRRE 4MNYA 4Q80A 1K2I1 3LU9B 1XKAC 1GBAA 4D8NA 1E35B 1MU8B 1LPGB 2O9QA 2PR3A 3PMJA 2G5NA 3C1KA 1CGHA 5A8ZA 4FVDA 1SC8U 3F68H 2XC5A 3M35A 1TYNA 1C2JA 1RTKA 2H5DA 1NESE 3HATH 1V2NT 1XUKA 1MTNC 3ZZ8A 2FYRA 3HGNA 4NGAH 3HKIB 1P2NA 4AZ2B 5HYOA 2AMDA 1HAVA 1CGJE 2R3YA 1S84A 1WV7H 1TPPA 2TRMA 4AGJA 2UUFB 2THFB 1CGIE 3MNXA 1IQKA 1EZQA 2BX3A 3ZZAA 1DLKB 4JYUH 2EA3A 2ZTYA 5K0HA 1UVOA 4HFPB 2OXSA 2BLQA 1ZTKA 1C5SA 1HAOH 4A92A 1Y3YA 4R8TB 1NTPA 1LHGH 2B7DH 3UNQA 2ALVA 4U30A 1WQSA 1GHWH 1V2VT 1SGYE 1V2MT 1UTLM 2QF3A 2ANWA 1P8VC 3EA7A 1O2KA 3WY8A 3QLPH 2F9NA 3F9EA 3LC3A 1JXPA 1BB0B 4U2WA 2H6MA 4PROA 5TCCA 1XM1A 2ZTZA 5E0JA 1HGTH 3BTME 1BJVA 2A0QB 3Q3XA 4O03A 1SQAA 1D9IA 3VEQB 1E38B 1QL9A 3HKJB 3MU8A 1P0SH 1ETSH 1HAYB 1F5RA 2Z9GA 2V0BA 3CP7A 2WPLS 4OGYA 1V2KT 1ANCA 3HGPA 2D8WA 1OWHA 1C4Y2 1UCYK 3RMOH 1C5RA 1WUNH 1DXPA 2PWXA 1GMCG 3TK9A 2TGTA 4ABJA 4A6LA 4ZKRU 1TNKA 2HALA 4ZHLU 1AQ7A 2FOAA 3M7TA 3E90B 3ZZ9A 1CHGA 1NRSH 2ZZUH 3SJKA 3LJOA 1SOTA 1YPKH 3CS0A 4GVUA 3MH4A 3I78A 1UTOA 5DP6A 2RG3A 9LPRA 4NA9H 1CHOG 1ANDA 3E0PB 1ID5H 1RRKA 2QCYA 1BJUA 5A09A 1BTYA 1LVOA 2C93B 4MG3A 2B5TB 4YLQH 1GBBA 1TGBA 1UJ1A 2Z7FE 4HGCA 4I33A 3RDZA 2AS9A 3M5NA 4ABAA 4WMEA 3MHWU 3ZYDA 1O5CB 2P3TB 1J8AA 4LZ1H 1QRWA 5TJXA 3PMAB 1SGFA 2C8XB 4UDWH 1X7AC 3A8DA 1V6DA 1KXBA 3PMHB 2AFQB 5FPYA 2ZFRH 2AGEX 3NCLA 2ZO3H 3SHAH 1G9IE 1PQ8A 3P95A 4ABHA 1WAYB 4XBBA 4CRBA 1C5WB 4CBNA 5FPSA 4MPVA 3E91A 1A61H 1IQIA 1O33A 3IG6B 1NU9A 4UONA 1P10A 2VIDA 3EAJA 2ANMH 1QQ4A 3TNSA 4NG9H 1IQNA 2VU8E 2VVCA 1ZJKA 1JOUB 3SV8A 1F2SE 3A7VA 1VJ9U 2BQWB 5AHGH 3IWMA 1C5NH 2VIVA 1GI9B 4JMYA 3LOXA 1A5GH 1GHYH 1NS3A 2P94A 5HM9A 1K1NA 1AY6H 1C5YB 3G01A 2QAAA 7GCHF 2R2MB 3T26A 3KL6A 1UO6A 1XKBC 2A5AA 1MU6B 2P59A 2QGRA 2WPHS 2O8LA 3ZVBA 1YBWA 1GJBB 2OINA 4A1TA 7LPRA 1OWEA 3UFAA 3O8CA 1IQLA 1DWBH 1G32B 2AERH 1TFXA 2ZDMA 4CH2B 1UVSH 4D9RA 1D3DB 2KAIA 1GJ5H 1LPKB 4MQAA 1GI6A 2GDEH 1DOJA 5AF9H 1C4V2 4TYDA 2ZPRA 1V2WT 1QURH 1IQGA 3SNDA 1DXWA 4XE4A 3SU1A 2R0KA 3GY4A 4FUCA 1BCUH 5EODA 4ZAEA 3LH1A 1A2CH 3ATWA 3K6YA 1V2RT 2VIPA 1PPGE 2VWNA 5HM2A 2K1QA 1BBRE 2NU3E 1TMBH 3SJ9A 3DUXH 1YM0A 4CRGA 4ZKSU 1IHTH 1GBIA 1BRCE 2Y6TA 3SJIA 3TJOA 4DIIH 1DFPA 1O35A 2PKSC 1AVGH 4THNH 1EAXA 1BOQA 1GPZA 3SU3A 4I32A 1TX7A 5JB9S 4X8SH 3SU0A 1S0QA 2ZWLH 3F9HA 5C1YA 4X8UH 2H9EH 2BHGA 3KCGH 1C5PA 5GXPA 1H9HE 3C27B 3SUDA 1AZ8A 1AB9B 1YCPM 1YCPH 6CHAB 1W7GH 3RXMA 1N6YA 2BLWA 5A0BA 2GX4A 1ZYOA 2JETB 3V7TA 5EW1H 1BTXA 2J4IA 1J16A 1UTNA 1SGDE 4Q2KA 1FIWA 1SQOA 2ZFQH 2VGCB 2A4QA 2QYIA 1P03A 3A7TA 1GJ6A 2QC2A 3V13A 4ESTE 1G30B 1HXEH 1FONA 1GBFA 1FJSA 2WUBA 3DHKH 3L6PA 1C5LH 5E8EH 1G3CA 3MI4A 1MKXK 2F91A 2GZ8A 1OP2A 3M5OA 2QXJA 3PTNA 3U69H 1VR1H 2F83A 3ATMA 4Y10E 1TLDA 1NO9H 1KXEA 1YCPK 3GCHB 1GVLA 4WH6A 1H4WA 3TH4H 2W3KA 2ULLA 4XOJA 4Y7BA 1MMJN 3ZYEA 3SUGA 1EJMA 2GGVB 2VIOA 4KTCA 1S6FA 3LKWA 1UVUH 1O3OA 2D2DA 3RC5A 4B75A 1O5EH 3QK1A 3BF6H 3AW1A 3URDA 2LNCA 3SI4H 3TH2H 3UOUA 2YOLA 2UUYA 1SL3A 3RXLA 3GY7A 1Q2WA 2Q6FA 3GOVB 4X6PA 4E06H 3QGJA 1G2LA 3QTVH 1O2WA 4UD9H 3TNTA 1ZTJA 1ELFA 2NU0E 1CBWB 1HAVB 7GCHG 2J34A 3AAVA 3SI3H 2F9OA 6CHAC 1ZJDA 3SU2A 4Y8ZA 2RDLA 4XDEA 4K60A 3TJUA 2GP9B 1ELCA 4MPUA 2YNBA 1P3CA 4UE7H 1E36B 2VGCC 1DPOA 4GHQA 4FUGA 2ZU5A 1Q3XA 2ZCKP 2B8OH 2J92A 4XSKU 2VWLA 1DVAH 1C2IA 2FI3E 2BY9X 2PFEA 1O3FA 5DP5A 1O2JA 4AX9H 1TQ7B 2STBE 4IMQA 5EXLA 2O8WA 1ZGIA 1Y5UT 3FZZA 1B0FA 1UVPA 3GISB 2QN5T 2OQ5A 1TPOA 1THSH 3FP7E 1DUEA 2Z9JA 1W3CA 3GCNA 3GCHC 2HNTF 4NCYA 2BD7A 1QQUA 3RU4T 1GGDC 2W3IA 2FPZA 2C3SA 4ZROA 4ZMAH 2I6QA 3SOSA 2HGTH 3RXFA 1GDQA 2P3UB 1V2LT 1SGQE 3ZV9A 1QNJA 1GWAA 4X1PU 2ZFPH 3U8RH 1C1SA 1OP0A 3NWUA 1W11U 3I29A 1C9TA 1WU1A 1GJDB 1XX9A 1AMHA 2WPIS 2W7SA 3TK6A 2EEKA 4BAOB 2BY7X 1OWKA 1FUJA 1ANBA 3FAOA 2ZDAH 2B9LA 1P9SA 1IQMA 1LKAA 1FY4A 3BSQA 3ELAH 5IYTA 1CBWC 2CHAB 1BQYA 3UTUH 2UWLA 2BVXH 3SGAE 4K1TA 1QGFA 2Z94A 4NIXA 3LDXH 3MFJA 2PGQB 1QBVH 1JMOH 3M36A 5A8XA 4FUFA 1YLDA 3LGTA 3RXHA 2FEQH 2YNAA 2OC7A 1SGPE 1ZMNA 2BQ7B 1IOEA 1YPEH 1NPMA 1O2UA 1V2TT 4DG4A 4ZKOU 7KMEH 1GBHA 1FN8A 4K2YA 1Z6EA 3A89A 5C20A 2ZHWH 1ZHPA 4OS2A 5FCRA 3ZVFA 2R3UA 1GHAF 2WV4A 3U8TH 3M3TA 2CV3A 2PTCE 1L1GA 1EKBB 3MNBA 1AN1E 3M3VA 1AWFH 1VZQH 1EUFA 5LH8A 1XUGA 1UTKA 1NFUA 2ZA5A 2XC0A 2VIWA 2J95A 1DY9A 1YLCA 1LKBA 5EQQA 1JIMA 1H9LB 4NFFA 1P57B 3GICB 1RFNA 3RXIA 3KF2A 4Y71A 2FO9A 2TGAA 2XCNA 3CS7A 1EZSC 1O2HA 5C3NA 1C5ZB 2NU4E 5GCHF 3OX7U 1O2OA 3M7QA 3V3MA 3E3TA 1TONA 4NFEA 2ZG0H 1BBRK 1F0RA 4WVPE 2PUXB 4NZLA 1Y8TA 1Y3WA 3U8OH 1V2JT 5B6OA 2OD3B 1QJ6B 1YPJH 9ESTA 1VITF 3BTTE 3GY8A 2AYWA 3S7KB 2V3HH 2Y5FA 4KTUA 3O8BA 3RXOA 2FM2A 2G8TA 3P17H 1CA0C 3K6ZA 1O36A 1EZXC 1WBGB 3FZDA 3PMBB 3M61U 2BD2A 2Z3CA 3SGBE 3RMLH 1RXPA 3K2UA 1QJ1B 3UIRA 1V2QT 2TGPZ 5EXNA 5T6GA 1OX1A 1ZZZA 2Z9IA 4X1QU 5JYIA 1ZHMA 1TOMH 1DX5M 2XC4A 8LPRA 1S81A 3EYDA 5C5OA 3SGQE 4IC6A 4CR5A 3O8DA 4WMFA 2AH4X 1RD3B 2BLVA 4TY6A 4WH8A 4YZUA 1QRZA 1MTSA 1O34A 2O8MA 3SQHE 1PFXC 3ZZBA 1C5MD 1G2MA 2ODYB 1K1OA 3F9GA 4BAHB 5AFYH 1XXDA 4DJZB 4SGAE 4WF8A 3T29A 3MO3A 2BOKA 3UQOA 3TJVA 4DY7B 1B0EA 4AG1A 1IQHA 1SOZA 1EQ9A 2HVXA 1XUHA 1CT2E 4Y8YA 1O3EA 4D7FA 4CR9A 2TGDA 4MNVA 2BY8X 1GL1A 2HNTC 4DVAU 1KXAA 3RC6A 4AG2A 2C8WB 1ZOMA 1HIAB 1DM4B 1BRAA 1CT0E 2FODA 2SGPE 3ZVDA 4ASHA 2DUCA 1P2JA 1RTLA 3MYWA 2HRVA 1O2TA 1YC0A 2HNTE 3UNRA 1EAUA 1OWIA 1O3LA 2ZNKH 4MNXA 3BIVH 1GL0E 1IQEA 1ZHRA 3TITA 1GHAG 2FX6A 2HWLB 4KTSA 1C2MA 1G36A 3F9FA 3S7HB 2P8OB 1T8OA 1PPCE 1BHXB 1XVOA 2PW8H 3KN2A 1O30A 1TABE 1C5OH 3BV9B 3P8NA 1GJ7B 1YPLH 3KGPA 2STAE 2R9PA 5HXFA 4KGAA 1ESAA 1FPCH 2FXRA 2ZGBH 3DA9B 2OQUA 1S83A 3ATLA 2BQ6B 5L2YH 1W12U 3DFLA 4CBOA 5HMAA 3M5LA 1EPTC 1PPBH 3ATKA 4RN6A 2F9PA 1PPFE 5GCHG 1EAWA 1AU8A 1MBMA 2FOGA 3F1SB 1UCYH 2GCTC 4NIYA 2BOHB 1TA2A 1KY9A 1O3IA 1O5BB 1S6HA 4OS5A 3DT0H 1HRTH 1LVBA 2QA9E 2Y81A 2W5EA 2VJ1A 1UVTH 1SQTA 1MCTA 1VITG 1GCDA 1A4WH 3FVFB 4MTBA 5DJ7A 4ISHH 1BMAA 2BDCA 5FBIA 2UUKB 1QHRB 4LZ4B 3QGNB 1SGIB 2DE9A 3PO1C 1LPZB 5JDUB 2FTMA 1C2HA 3MH7A 3FP8E 1EP6A 2A4GA 1L1NA 1YP9A 1MTVA 2DE8A 1O3KA 1GJ4H 2C8ZB 1QA0A 3QDZB 1ZRKA 2BDBA 4VGCB 4SGBE 5T3HA 1Z6JH 1NN6A 4H4FA 4X0WU 4RSPA 1ZRBA 1ZSJA 3VB5A 1E0FD 3R0FA 2VWOA 3SNBA 2F9BH 4X1SU 1KSNA 4M7GA 5I25A 1ELTA 2P8OC 4ISIH 5C67A 1BA8B 2ZPQA 2GZ9A 1W10U 3RM0H 1C2LA 1O5FH 4WXIA 1FY8E 3BTDE 1O2GH 1EATA 4ZXXH 2Y82A 2WPKS 2WYJA 2CGAA 5GIBA 1NT1A 3VB6A 8ESTE