2R3UA

Crystal structure of the pdz deletion mutant of degs
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
202
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKETPEGIGFAIPFQLATKIMDKLIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Regulation of the sigmaE stress response by DegS: how the PDZ domain keeps the protease inactive in the resting state and allows integration of different OMP-derived stress signals upon folding stress.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 40
structure length 202
sequence length 210
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3uA02
1A3EH 4WXIA 5HMAA 4TY6A 2GZ9A 1CO7E 1MQ5A 5A0AE 1BBRE 1C1OA 4UFGH 3QGNB 3QN7A 2ALVA 1LPGB 2XYAA 3F1SB 3UWIA 5A8ZA 3PV4A 1TA6A 4I8HA 1XVOA 2XC5A 3VPKA 3A7VA 1P06A 1SLVB 1TLDA 4CHAB 1THPB 3UWJH 3PMAB 1NC6A 1EP5A 2A4GA 1KSNA 1GBCA 1FIWA 1TONA 1C5YB 3EDXB 4D7GA 1FN8A 1GBAA 3A7WA 1AVXA 4I8KA 3BTTE 1GHYH 5E2OA 4B2BA 2RCEA 1VCQA 5E8EH 1V2KT 3URCA 3ZVFA 2NU1E 4X6OA 3ELAH 2ZU3A 3RXJA 4FUCA 1GJBB 4JZ1A 1L1JA 3BSQA 4WF8A 4XBCA 1VZQH 1IHSH 1CE5A 1EZXC 3CP7A 1TBZH 5EPNA 1UTKA 1TMBH 3U1JB 4UFFH 2TIOA 1O2RA 2Y80A 4OS1A 3M5OA 3TVJB 2QIQA 3ZVBA 4NG9H 1O37A 3M3SA 1RIWC 2VH6A 2AEIH 1ORFA 2B5TB 4NA9H 1H9HE 1K1NA 2CGAA 1GCTC 3EGKH 1XVMA 2JH0D 3MHWU 2FTMA 1N8OB 1CA0C 1TNIA 1LVYA 1C9PA 1PPZA 3T29A 1F5LA 3HK6B 1ZHRA 2RA3A 2J38A 4YOJA 8ESTE 1M9UA 4BXWA 1LTOA 4YLQH 4O9VA 4SGBE 1ZSKA 4Z6AH 3MNCA 3LKWA 1DSUA 2G52A 1C9TA 1QB9A 2BXUH 5C5OA 4Y7AA 4BAHB 3EE0B 1AE8H 1EJNA 1OWHA 1PPGE 3FZDA 3KHVA 1KXCA 4BNRA 3D23A 5B6OA 1GHZA 2C8WB 2HGTH 1J14A 1S0QA 3ZYDA 1SR5C 2ANKH 3SU1A 2CHAB 2IN2A 1GBKA 1S85A 1F92A 1G36A 4RN6A 1YLCA 3O8RA 1FJSA 1EAIA 2PR3A 1TRYA 3IITA 2H5CA 1Z6EA 3T26A 1BMMH 3RXSA 2F9UA 1C1MA 1T31A 1O5DH 4CRAA 4D8NA 1W10U 1C2FA 1MUEB 2BVXH 2OTVA 4MPVA 1KTTB 3SU3A 1EUFA 1QR3E 2FEQH 4FU7A 1DICA 2WPKS 3RXUA 1G3CA 1K1MA 2FESH 1QBOA 2TGPZ 3PWBA 1F5RA 2C90B 1QBVH 1UTLM 3ZYEA 4MNYA 4TPYA 2P94A 1GVZA 3SBKA 3P8FA 3QTOH 3SU6A 3RXAA 3NPSA 4ISIH 2PFEA 2XXLA 4Q7YA 3MH7A 3OTJE 1P3EA 1MU6B 4AORA 5LPEA 6GCHG 1C2MA 2BD3A 3U9AH 5DPAA 1G2LA 1LHFH 1SQTA 3EYDA 4VGCC 1P01A 2B0FA 1TX8A 1A4WH 1NS3A 3VEQB 3QO6A 1P8VC 2P95A 2RA0A 1VGCB 3MU1A 1J16A 4DJZB 3MH6A 1Y5AT 2ZU1A 2BVRH 1IQGA 1NRSH 1AZZA 2OCVB 2UWLA 1KLTA 2DE9A 3BEFB 2BOKA 2BY5X 1AN1E 2ZHEH 2IJOB 2YNBA 4NA7A 2WUBA 3UQVA 2P93A 4FUGA 5GPIB 1HAYB 1SB1H 2KAIA 3I77A 1KTSB 1DXWA 1FONA 1BHXB 2R0LA 2Y5FA 2O8MA 5PTPA 1HRTH 1AIXH 1DM4B 3BTHE 5E0GA 1Y59T 4BAMB 1W7GH 3STIA 5JBCS 1W11U 1L4DA 1T32A 3PLBA 1UVSH 3H5CB 5DP4A 1GI3A 1DUEA 4B73A 3UNQA 3GYMA 1IOEA 6GCHF 3TJNA 5LPFA 1HIAA 1WU1A 3M61U 5JB9S 3TGKE 3RUOA 1C1NA 1LQEA 2I6QA 3RU4D 4NWLA 4FUEA 5FBEA 2SGFE 1VCPA 2A1DB 1GHBG 3TNTA 4ZHAA 2FPZA 2A0QB 1HAVA 5HM2A 5TCCA 2JKHA 4F49A 4WVPE 3SJKA 5A0CA 2PTCE 6CHAB 3ZVGA 1AUTC 4Y79A 1HAIH 1FY5A 1YPKH 1GBLA 2XC4A 2BDIA 3ODDA 1GL1A 2ZCKP 3ZZ8A 1MMJN 1UTNA 4B76A 3I78A 1GI5A 3KQDA 1BMLA 1TPPA 1OP8A 1KLJH 5EODA 3RP2A 4ABIA 1UHBB 1A7SA 3EA7A 5DO4H 1OP2A 3A80A 3M3TA 2H9HA 3BTQE 1GBMA 2Z3CA 1CU1A 3HGNA 1D3TB 4E7RG 1O38A 1K1LA 1O2GH 1P2QA 2M5TA 2W5EA 4CRFA 5DJ7A 3QDZB 4AFQA 3EQ0H 1BMAA 1O3DA 1GJ8B 3SU0A 5FX6A 2F3CE 4JZIA 1YCPH 2R3UA 4AGJA 5LPRA 1A0LA 2O8TA 3K65B 5CHAC 1ZRBA 2BB4A 4ABJA 1GHBF 1F5KU 1MTNB 3UNRA 1NRQH 4B71A 1JRSA 2VIPA 4NIWA 2ZDNA 1DPOA 1SL3A 1EAUA 3PROA 2OD3B 3A8CA 4XFQA 4OGXA 1FMGA 1V2NT 1X7AC 4Q2KA 3RXHA 5SGAE 1GL0E 5GIBA 2SGEE 1NRRH 1OWKA 3GY5A 1OX1A 1QURH 1THRH 1Z8GA 1ZZZA 4AX9H 2PV9B 2BD9A 1BTHH 4D76A 5EOKA 1TPOA 1PQ7A 1FV9A 5T6DA 1HJ9A 3LIWA 1C5SA 3A8DA 1C5TA 2VGCB 2ZFTA 1AMHA 2F9BH 2Z7FE 1QY6A 1NTPA 1O2SA 4ZXYH 5A0BA 1LHGH 4JYTA 1G3DA 1F0RA 4GHQA 1EAXA 3PMJA 1AGJA 1O3PB 2NU3E 2ZCLP 2OBQA 1PYTD 1UJ1A 1SGNE 5GJ4B 4X8UH 1FDPA 2KAIB 4UFDH 3GY3A 4X6MA 1YCPM 2Y7XA 1GBEA 1O2VA 2TGDA 3ZZ3A 1ID5H 1GBFA 2BDAA 5FHTA 3SUGA 4X2XA 3GY4A 4X8SH 2H9EH 1P09A 1P2MA 2STBE 5AVDA 1YPMH 3SQHE 2W7SA 2BD8A 3BIUH 3RMMH 1SMFE 4ISOA 5EU8A 2V3HH 3HKIB 4MNVA 1SVPA 4Y0ZE 2K1QA 1V2RT 1LVBA 3BTWE 3HGPA 1K22H 1V2LT 3K6ZA 4ABEA 1MQ6A 1ELBA 4X1NU 1C4V2 2SGAA 4DOQA 2WPIS 1LO6A 4O97A 2BLVA 1H9LB 4Y7BA 3V7TA 3O8CA 2BY7X 2FTLE 3SU2A 2ZQ2A 4IMQA 4IW4E 3SGBE 3TH2H 1DANH 1Y3UA 1P12E 1XUJA 5EQRA 4NSYA 1J8AA 1BT7A 2P3TB 2HPPH 4WJG2 1KLIH 4I8LA 2BQ7B 3FAOA 2A4QA 1BJVA 1PPEE 1MU8B 1O3IA 3AW1A 1TMTH 1AU8A 4AFUA 3FP8E 2ZDMA 1IQMA 2ZFPH 4AG2A 1KY9A 2BMGB 4ZHMU 3E1XB 3E3TA 4X6NA 1MBMA 1WQVH 1FY3A 4UDWH 2VIVA 2I6SA 3UIRA 1LDTT 1E34B 3QLPH 3S7KB 3RXIA 1XKBC 7GCHG 1FIZA 1YPHC 3LC5A 2QXHA 1GJCB 1RIWB 2R3YA 3SHCH 3T2NA 4NFFA 2BLQA 1GCTB 1DWCH 4WH8A 4CBNA 3RXCA 2C4FH 1SHHB 1CA0B 1G3BA 1LHDH 1WAYB 3RXLA 3S69A 2W26A 3F9HA 3URDA 3Q3KA 4RSPA 2VIOA 1IQHA 1T4VH 1EJAA 4MNXA 1WSSH 1H1BA 1GHAG 1TMUH 1O36A 4FUFA 3SNAA 1SPJA 3S9BA 3P8GA 2TRMA 5E2PA 2BX3A 4UE7H 2VB0A 4ASHA 4AYYB 4BAQB 3PB1E 4AYVB 3U69H 4WMEA 1NRNH 3UQOA 2ASUB 1PJPA 1K21H 1ZOMA 4U30A 3P6ZB 2QCYA 1IQJA 3AVZA 1GDQA 3A85A 1DLEA 4FXGH 2UWPA 1AQ7A 3BV9B 4AB8A 1TB6H 5DK1A 2G5NA 1O0DH 3L6PA 2FZZA 1BB0B 1MAYA 2FI3E 2FOEA 1BCUH 1O2MA 4GHTA 4YO9A 2F91A 2FM2A 1AKSA 2C8ZB 4Y8XA 3PTNA 2ZIQH 4A1XA 1EB2A 3K9XB 1O5AB 5C67A 1QL7A 3BG4C 2Z9KA 1GBJA 2BDHA 2HVXA 1P9UA 4JMYA 2FOAA 1V2ST 3FP6E 4GLYA 2LNCA 3KNXA 3RLWH 2ZC9H 4WH6A 1HGTH 1K28D 1T4UH 4HZHA 2AGEX 1IAUA 1SI5H 1S6FA 1YYY1 1O5FH 4FUIA 3BEUA 1P2NA 3PMHB 1YGCH 1C5WB 1AHTH 3V12A 1GHAF 2PKSC 2ZCHP 1O3HA 1ANCA 1VJ9U 2P3UB 2IPHA 3RXKA 1WUNH 1UTMA 1FQ3A 1E0FD 1UCYE 4X0WU 1ABJH 1JIRA 1C5NH 2H2ZA 1CQQA 4NSVA 5J4SA 3U98H 3S7HB 2QA9E 2ODPA 4OS2A 1PPFE 1AWFH 2FOGA 2AFQB 4IC6A 3GYLB 1RTFB 2HWLB 4VGCB 1AFQC 1V3XA 4JZEH 1OPHB 1V2PT 1TA2A 2F9PA 2ZGJA 3SUDA 5AF9H 4I7YH 1O5GH 1WQSA 3SU4A 2GZ8A 4ISLA 4DVAU 3SORA 3GCOA 4X1PU 1F0TA 4M7GA 3MH5A 3A81A 1C1RA 1YPGH 1GI6A 3NCLA 4GUXA 4MPXA 3ZVDA 1TNJA 1MBQA 3ZVEA 1O2JA 1AO5A 1O3FA 1D6RA 2BM2A 1C1VH 2GKVE 2Z9JA 1ESAA 3CS7A 1ESTA 2WINI 4GSOA 1O2TA 5DP8A 3ATWA 3LH1A 1QQ4A 4U01A 2EI6A 3V0XA 3PMBB 3M7UA 3KL6A 1YPHE 2QY0B 1TGNA 1ZTLA 1AE5A 1O3LA 3D65E 2CN0H 3LH3A 1CGHA 2EEKA 2ZGCA 1OOKB 3E6PH 4LK4A 1P02A 1PQ5A 1A3BH 1ELEE 2YNAA 4NWKA 1P3CA 1GCDA 2AS9A 4Q7ZA 1WBGB 1YPJH 2EI8A 2QF0A 1YF4A 1EOLA 2TPIZ 1V2UT 2OQUA 4IN1A 3BTME 4I31A 3SV9A 1Y3VA 4MDSA 4KP0A 1O2PA 2OC8A 4NZQA 4FVDA 5JBBS 1EOJA 1HDTH 1HJ8A 2QV1A 2FIRH 4XBDA 3P70B 5JPMH 2GDEH 1P10A 4KTUA 2A31A 1A1RA 3F9GA 9LPRA 5I46H 1BJUA 1O2WA 2H1UA 4KELA 2BD5A 1C5RA 2UWOA 4E7NA 2O8WA 1ZSJA 1N6XA 1OSSA 1RRKA 2C8YB 1TRNA 1NN6A 3MFJA 1BTYA 1GI8B 2PKAA 1P0SH 2BY9X 3A83A 4KKDA 1CA8B 3V3MA 1TGCA 1QTFA 1AKSB 4B1TA 1MTSA 1TABE 3NWUA 1FPHH 1ELCA 1BIOA 1YPEH 3BIVH 1RJXB 1K1IA 1CT4E 2W3KA 1W13U 2BDGA 2ULLA 3NK8A 1TE0A 1ESBA 4XDEA 3KGPA 2BDBA 3GCTG 2ZPRA 4D7FA 1YP9A 1V2VT 3HK3B 3MNSA 2NU4E 3NKKA 2FO9A 2OLGA 4X1QU 1HAPH 1GGDC 2HRVA 3RXBA 1ELDE 4FUBA 4ZUHA 2ZU2A 3ZZ7A 1SLWB 1OWIA 1OXGA 5ABWA 3F9FA 4GVUA 3DA9B 1H8DH 1SOZA 1SLUB 1W0YH 4INLA 3GY8A 4U2WA 3GCHB 2DE8A 1AD8H 1O32A 4ABGA 4F4OC 1CGJE 1SFQB 1G9IE 1S82A 4NFEA 1O3GA 5FPTA 4PROA 1KDQA 4X8TH 5DP7A 1TAWA 1ZGVA 2VWOA 1ZSLA 1V2MT 3BEIB 3TJUA 1NM6A 1A46H 3LGVA 1CHOG 3C27B 3SNDA 2VJ1A 3ODFA 2PGQB 1NT1A 2O8UA 1XUKA 1EZSC 4INHA 3MU8A 2D2DA 1EP6A 3M5MA 3MOCA 5K0HA 4R0IA 2J94A 1MKWH 3PTBA 2G8TA 2WYJA 1UK4A 3QK1A 1A0JA 4Q7XA 3GCTF 2FXRA 5EW2H 3E8LA 1VITG 4YTAA 3STJA 1OYTH 3RXEA 4CR5A 4Y10E 1EASA 4H6TA 3DFJA 1GI1A 4CBOA 1O34A 1TRMA 1CBWC 1DVAH 2R2MB 1ETSH 2A5KA 1BQYA 3UOUA 1LHEH 2FP7B 1GJ7B 2FI4E 1QCPA 4DIHH 2SFAA 2ZFQH 2TGTA 3PYHA 1ZTKA 1EJMA 1MTUA 1NY22 3LU9B 2ZPSA 1D4PB 2Z9IA 1Y5BT 8KME2 1L4ZA 1QIXB 4AB9A 3Q77A 3BN9A 1GJ4H 4OS5A 5I25A 5GCHG 3LJOA 4JK6A 2PUQH 1ZJDA 2HOBA 4Y71A 1KYNA 1H4WA 1MKWK 1ZLRA 3ZZ6A 1CHOF 2G81E 1BTZA 3ESTA 1FY8E 1HJAC 2NU2E 2GV6A 1SSXA 1ZYOA 1CT0E 1O3KA 1ETRH 3SJ8A 5LH8A 2VVCA 2AERH 4YT7H 5JB8S 4AOQA 1TBRH 4RKJB 2ODQA 3F6UH 4TYDA 3LGYA 1YM0A 1GG6B 1T8NA 2A32A 2GD4B 1VITF 2XBYA 5JDUB 1GHVH 2C8XB 1G37A 1XUGA 2PKAB 1LQDB 4OS4A 4WMFA 2ZGBH 3RC5A 4ZXXH 1EXFA 2FI5E 1O2LA 3A82A 1O31A 3T27A 3AW0A 1O2OA 1H9IE 1Y3WA 2ZWLH 2EA3A 5A09A 2EI7A 3QUMP 2H9TH 4WWYA 2B7DH 1HXEH 1C4U2 4IBLH 1O39A 2BDYA 1Y8TA 3A86A 3NXPA 5FBIA 1D3QB 2Z9LA 3A7TA 5GCHF 1QNJA 1TGBA 2ZEBA 2SNWA 3SJ9A 4IC5A 5HM9A 4NIYA 1NESE 5EQSA 3LGWA 4DG4A 3FVFB 3EA8A 1O2ZA 3SGQE 3BTDE 2GP9B 1UTPA 1QGFA 1ZHPA 2O8LA 3HPTB 1ELAA 3A87A 1BRBE 4BTIB 1DDJA 3QX5H 1GPZA 3KQCA 2ZTXA 3RXPA 1YLDA 1SGTA 5EXLA 5FCRA 3OX7U 1E35B 1CHGA 1C5PA 2NWNA 5EXMA 4K8BA 1MD7A 4XSKU 3UREA 1HCGA 1RXPA 1SGRE 3KF2A 2GV7A 2ZU4A 3BG8A 4UEHH 1W7XH 1GJAB 1C1SA 1W12U 4ZAEA 5C1UA 1XUHA 3UUZA 1RTKA 3FP7E 2JETC 1KIGH 5CE1A 1A2CH 4RKOB 2G00A 2BHGA 1E36B 2P16A 1OYQA 7ESTE 4DCDA 3BG4B 1F7ZA 2CJIA 2FDAA 2FOCA 1D9IA 1TOCB 5EW1H 4MPWA 4IS5A 1ANBA 3RMNH 3IWMA 4CRDA 1K1JA 1VITH 5GDSH 1ARBA 1O33A 3UR9A 1KXAA 4X6PA 1NROH 2V0BA 1QFKH 5E0HA 1Z8IB 3SI3H 1KXFA 1FAKH 2PKSB 3M35A 3E16B 5EG4A 1ARCA 2Z3EA 1P04A 2BDCA 2HPQH 2DUCA 2GMTB 2RDLA 3CENA 4B75A 3QWCH 1BTUA 1DWBH 1S5SA 1A0HB 3SHAH 4UFEH 1V2JT 1O2KA 4AFZA 2IOTA 4Y76A 4BOHA 4ZROA 2AGIX 1WCZA 3TK6A 2PUXB 2O9QA 4K1TA 1Z71A 1P57B 1T8MA 1XXDA 1AFQB 2VWLA 5GWZA 1THSH 2WPHS 5TCAA 3UY9A 2UUFB 2AMPA 2PWXA 1LPZB 2H5DA 5DP6A 1HIAB 3RM0H 1V2WT 1SQOA 5FXLA 1O2QA 4ISNA 5C3NA 3UPEA 3TGIE 2R0KA 3TNSA 7KMEH 1CVWH 4X2YA 1HAVB 1BRUP 1SOTA 1LVOA 4INKA 1QJ7B 5F8TA 2GDDA 2V3OH 4OGYA 4WY3A 1DOJA 1W0ZU 3RMLH 1GI0A 1JRTA 4XBBA 1C1UH 1K9OE 1TIOA 1SLXB 1AVWA 1SGEE 2Q6FA 2PGBB 4B74A 3LDXH 4ABAA 3Q3XA 1C2LA 1BBRH 2ZO3H 4I32A 1HB0B 1MTVA 5EQQA 4BTUB 2XCNA 2THFB 5F8XA 2ZDKA 3UTUH 3RXMA 4Y11E 1ZTJA 4UD9H 1PPHE 2OINA 4JZFH 5E0JA 3AAUA 4AGKA 3RLYH 5G4BA 2BLWA 1PQ8A 5JBTA 5HYOA 1C5OH 1FNIA 5GXPA 1C5LH 2QAAA 1HPGA 5DG6A 5F03A 5L6NH 2ZFRH 1JMOH 1PYTC 5DP9A 1TOMH 1GHWH 2BD7A 2BYAX 1XKAC 1JXPA 1HUTH 3ZZBA 1UVTH 4QT8C 1A5IA 3LGIA 3TJVA 1JWTA 4CRBA 1HXFH 2WPLS 1Z1IA 1C4Y2 2GX4A 5BRRE 4K69A 4CR9A 3D62A 4H6SB 1O2NA 1U6QA 2PSYA 1GJ5H 2VWNA 3BTEE 1C2JA 1UO6A 3P17H 1BBRK 3DFLA 4TWWA 2ZP0H 3FFGA 4E05H 2OUAA 4AG1A 1TNLA 6LPRA 1P2IA 2Y81A 5EGMA 3RU4E 5L2YH 3MI4A 1A5GH 2XBWA 3A7YA 4ZKOU 3OSYA 3ZZDA 2RG3A 4K1EA 2B8OH 2ZGXH 3E90B 4O3UA 1O35A 1OWJA 1ZRKA 4X2WA 1O2UA 2Q6GA 1C1QA 1UMAH 4FVBA 1NFXA 1HAGE 1YBWA 1GGDB 4YOGA 1UK2A 4YLUA 2AIQA 1O5CB 3TGJE 1Z1JA 3Q76A 4Q80A 5EXNA 4MNWA 7GCHF 3TH4H 3ZZ4A 1AVGH 2CF9H 1F2SE 2ZF0H 3TK9A 1GBDA 4JK5A 4NGAH 3U8RH 2P8OC 3I29A 3M7TA 1ELFA 2QXJA 2SGPE 2BLOA 2UUKB 3RC4A 3VB3A 4I33A 2G4UA 4K5ZA 2J2UA 1TNHA 2G4TA 2J92A 3M5NA 1SQAA 2R9PA 1G30B 1HFDA 2Y5GA 3TU7H 2BQ6B 4ABBA 4UONA 2ODYB 4MVNA 4E06H 1OWDA 1O5EH 2WV5A 1GBTA 1E37B 3F68H 1HBTH 2GVFA 3S9CA 4Y0YE 1BITA 5DP3A 2H6MA 2WPJS 2XBXA 1HV7A 1FLEE 2ANMH 1WTGH 3VB6A 1D3DB 1MH0A 1XMNB 1FN6A 2XTTB 3NZIA 2PTNA 4SGAE 1T7CA 3VGCC 1OS8A 1CSOE 1O3AA 3QZQA 3JZ1B 2VU8E 3TITA 3MU0A 3T25A 1P2KA 1TQ0B 5HGGA 4J2YB 1GJ6A 3JZ2B 3KN2A 4ABFA 3VB5A 1CBWB 1QJ1B 3PM3A 1O2XA 1HNEE 2FYRA 1DT2A 2BY8X 1GVKB 2GZ7A 1L2EA 3GCNA 1KXBA 4ZKNU 4JZDH 1TFXA 2XWAA 2OXSA 1QRXA 1BA8B 4KTCA 4AN7A 1GBIA 3L3TA 1V2OT 3UNSA 1EPTC 1W14U 4I8GA 5AFYH 4YZUA 2XC0A 4A92A 4XOJA 3LJJA 3IG6B 1BUIA 1UVOA 1EATA 2WPMS 3QZRA 1J9CH 5AHGH 1HJAB 1YKTA 7LPRA 5A8YA 1O5BB 3E0PB 2AH4X 2ZI2H 3TLOA 2OC1A 1PPBH 1QJ6B 5FCKA 1ACBE 1T8LA 5ESTE 1GMDG 1C5XB 3A88A 5ESBA 3MU5A 5L30H 3PLKA 1C5MD 1QL9A 3ZZ5A 2QF3A 1NPMA 1T8OA 4ZH8A 3LGTA 1DS2E 4FUJA 1IQNA 1GJDB 2OQ5A 5HXFA 1MAXA 1NFYA 4MTBA 3SW2B 4GAWA 1QA7A 1ZGIA 4CH2B 1AWHB 1Q2WA 2HNTC 4DT7B 2AMDA 1TNGA 3ZVCA 2BZ6H 1P9SA 3RXDA 1EKBB 2R2WU 4OS6A 3BTKE 2FYQA 3RXVA 3SUFA 3SU5A 3WY8A 1IHTH 5T3HA 2V35A 1RFNA 1B0EA 4U32A 3DT0H 1J17T 5FPSA 1S84A 5C1XA 4LXBH 1A61H 2A45B 4B2CA 1UTJA 1UVPA 1TYNA 3KCGH 2XBVA 1W8BH 3MMGA 4I8JA 1HYLA 3L33A 1GI2A 1GJ9B 2ALPA 4LOYH 3M5LA 2XW9A 2OBOA 4DW2U 3MNXA 3DUXH 2BD2A 1ELTA 2ZECA 2CMYA 2GCTC 3TJOA 4A5TS 1C1PA 3GICB 1FZZA 3B9FH 1FUJA 1RS0A 1DWEH 2VVUA 1GMDF 2CF8H 2ZHWH 1ZMNA 3PLPA 1UTQA 4D9QA 3MO3A 3SI4H 1ZPZA 5CMXH 1HAZB 1WTHD 1SGFG 5ETXA 1LPKB 1WOFA 1HLTH 4TPIZ 4BAKB 3N7OA 2PLXA 1F0UA 2VNTA 4IN2A 1AFEH 3MU4A 2YOLA 5CHAB 1GI4A 4ZMAH 1DITH 3U8OH 3QGJA 5AFZH 3MO6A 2Z6BD 1AB9C 2NU0E 1SG8B 1O3JA 1IQIA 2Q6DA 1Z6JH 3M3VA 1CT2E 2JETB 4MPUA 1C2DA 1GDUA 1C2EA 2F83A 3D49H 3OU0A 4JCNA 1LKBA 1EQ9A 8GCHG 1O3NA 3VB4A 1N6YA 1PQAA 5C20A 4KTSA 2FOFA 1SFIA 3SJIA 4CH8B 3SV8A 3W94A 2C93B 2VH0A 3KQBA 3Q00A 1UHBA 4HFPB 4NIXA 2VINA 4Y8ZA 1RGQA 1O3CA 3ZZCA 5C1YA 4ZKRU 3PO1C 1ZPCA 3P8OA 4FU8A 1O2YA 3LGUA 4CREA 1QB6A 1G32B 2ZDVH 1TBQH 3RU4T 1SBWA 2FS9A 3U1IB 2WV4A 1C5VA 1BOQA 1GVLA 1VCWA 2BXTH 3K2UA 2QGRA 4MQAA 2QXIA 1C2HA 5F8ZA 4ZKSU 3R0FA 3RMOH 3MWIU 3K6YA 4H42U 2SGDE 4LZ4B 2F9NA 2A7CA 3ITIA 3U8TH 1TNKA 1TPAE 5FPYA 3EAJA 1GI7B 1GI9B 3M37A 4HGCA 5A8XA 4YM9A 1TQ7B 1YPLH 1LMWB 3DD2H 1L1NA 3KIDU 8GCHF 2HNTE 2JH5D 4FUHA 1DXPA 4A7IB 1AUJA 1WV7H 2Y6TA 3ATLA 5FAHA 1SGIB 1XUIA 2QXGA 1WYKA 2GCHG 1SGPE 4DGJA 3TK5A 1OKXA 2VIDA 1LHCH 2FS8A 1D3PB 3SJOA 3TPIZ 1DUAA 1GMCG 3M7QA 1ZMJA 1VJAU 3W95A 1EZQA 1C5ZB 2Q1JA 6ESTA 1O2HA 3GISB 1FPCH 1GBBA 3GY6A 1IQEA 2BD4A 2ZZUH 4MLFB 4DURA 4CHAC 4YOIA 3SZNA 3TIUA 3RM2H 1H8IH 1E38B 4IGDA 4K1SA 1AY6H 4MG3A 1TGTA 1RTLA 1NRPH 2BOHB 2BY6X 2Y7ZA 1EPTA 2FOHA 1BZXE 1MD8A 1NFWA 1EB1H 3OYPA 4GPGA 1P03A 3HATH 3MO9A 3EA9A 2ZGHA 2FX4A 1MZDA 2C3SA 2A4RA 2FWWA 2VIQA 2G5VA 5L2ZH 4BTTB 2FX6A 3ZV8A 1NZQH 1ELVA 3ZV9A 2ZHFH 3ZZAA 2ZKSA 2WUCA 4O03A 3SO3A 5H4IB 2QYIA 1ZHMA 1ELGA 2GCHF 1L0ZA 4CRGA 3GDVA 1DLKB 2XCFA 3FANA 3KEEA 1GMCF 3ZVAA 2ANYA 2D8WA 1BDAA 3E0NB 2AIPA 3HKJB 3P8NA 3T28A 1Q3XA 1DFPA 1NU9A 1KDQB 5JYIA 1N8OC 4ESTE 4DIIH 2ZDLA 9ESTA 1P05A 2P3FH 3LPRA 1C5UA 1LKAA 1GDNA 4LZ1H 3SUEA 3ATKA 5DKMA 2AGGX 2ZU5A 1P2OA 3VXFH 3R3GB 1GHXH 4FU9A 4KGAA 1BHXF 2A2QH 2QC2A 2UUYA 5C2ZA 1O3BA 2ZA5A 3S9AA 1G3EA 2J4IA 1DX5M 3RXRA 1C1TA 5J4QA 1XX9A 3RXFA 1Y3XA 2CXVA 3P92A 3A8BA 4HTCH 4A1TA 1NO9H 1W3CA 2FODA 1P2JA 3PWCA 1LCYA 4A6LA 2SNVA 4ABHA 1QRZA 2P8OB 5C5NA 4R8TB 1V2QT 2TBSA 3A8AA 3GDUA 2OC7A 3GY2A 5JBAS 3P95A 3C1KA 4A1VA 1BRAA 1J15A 3S0NA 2CHAC 4K3JA 1O30A 2TGAA 2BTCE 3GCHC 2PHBA 1FY1A 4AZ2B 3MYWA 2CV3A 1XXFA 2HALA 5DP5A 1JIMA 2GTBA 2EC9H 1EAWA 2ZFSA 1UVUH 2FLBH 4NIVA 4FUDA 3SV7A 1K1OA 3VGCB 2ZNKH 1PFXC 3Q3YA 1DSTA 1C2GA 4DY7B 3RDZA 1TPSA 1HAOH 1TALA 1GMHG 2A5AA 1P11E 4BANB 2AYWA 2QN5T 4BAOB 1CGIE 1MCTA 3G01A 4X8VH 1YCPK 2BX4A 2J95A 3B8JA 3SGAE 1MKXH 2Y5HA 2PSXA 1QQUA 3LONA 3LC3A 4X1SU 4ABDA 1FAXA 4JYUH 3OY6U 1UCYH 1BRCE 2FOMB 5IYTA 3MH4A 3V13A 4NCYA 1ANDA 1BTPA 2ZFFH 1L1GA 1Q31A 5T6FA 3SV2H 1NFUA 2ZG0H 1EPTB 4YESB 1XM1A 1VGCC 1Z7KA 4Y6DA 1D6WA 4HI3A 1MZAA 2FMJA 3TH3H 2ZHDA 2W7UA 1SGYE 2A5IA 3UOPA 3O8BA 1TX6A 1QA0A 1HAHH 3GOVB 3VXEH 1JBUH 2ZQ1A 3LOXA 1V2TT 3T62A 2HLCA 2XNIA 1XUFA 5FX5A 2GT8A 1F0SA 5A2MH 2FOBA 2J34A 3RXOA 1AI8H 4X2VA 5K7RA 1SGCA 2P59A 1V6DA 2PW8H 1ZMLA 1B5GH 1GMHF 1MKXK 3DHKH 5DGJA 3T5FH 4OS7A 4Y8YA 5T6GA 3ENSB 2VWMA 1G2MA 1UCYK 2ZPQA 3SOSA 1K1PA 4NA8A 3ZZ9A 3O8DA 1GG6C 1C2IA 3GY7A 1SGDE 1O3EA 1DE7H 1Z8RA 4GCHG 1GWAA 1IQFA 1TX7A 3M36A 2XWBI 4IMZA 1OP0A 1GBHA 1DWDH 2SGQE 2UUJB 5BPEA 1TGSZ 1QBNA 4D9RA 2BZAA 3UR6A 3MNBA 2G55A 3RXQA 5LGOA 2XRCA 6CHAC 1AZ8A 3SV6A 2GCTB 1OWEA 1KXDA 3MTYA 2ZHQH 1W2KH 3QTVH 1K2I1 1LVMA 1YC0A 3AAVA 1UTOA 3LT3A 5TJXA 1ANEA 1FI8A 2VVVA 3BF6H 4JYVH 1EZUC 4K8YA 2OP9A 1TWXB 3NUMA 3FZZA 2ESTE 2ZTZA 3A89A 2V6NA 3OY5U 2ZTYA 4H4FA 1A5HA 1DY9A 2BQWB 1DY8A 2W3IA 2F9VA 1Y5UT 2HNTF 4BXSA 3H7OA 4AFSA 1S81A 1MTWA 1QL8A 1ZR0A 1AB9B 2ZDAH 2ANWA 3B23B 4GCHF 2GGVB 5F6MA 2STAE 3VFEA 3KQEA 1ZJKA 1QHRB 1SGFA 2GT7A 1MTNC 2A7JA 1Y3YA 2Y82A 4J1YA 2JH6D 1HAXB 2F9OA 1RD3B 1ETTH 1S0RA 2LPRA 1SHYA 1IQLA 1MCVA 1Z8JB 2VIWA 3ATMA 3H7TA 1JOUB 1FXYA 2BVSH 4YT6H 2A7HA 4WMDA 1N1LA 1B0FA 3E91A 1FY4A 3SN8A 3PO1B 4B2AA 2J9NA 2FLRH 3A7XA 1O2IA 8LPRA 1BMNH 2B9LA 1ABIH 4K60A 1SC8U 2Z94A 3CS0A 4O3TA 1B7XB 2AMQA 2VGCC 2A4OA 4WXVA 1EX3A 1S83A 1VR1H 1KXEA 2A2XH 2WYGA 3RC6A 3RXGA 4XE4A 3A7ZA 3ATIA 1QRWA 1ZPBA 4TWYA 2Z3DA 2GMTC 4Z0KA 3SNEA 4NZLA 3SNCA 2Z9GA 4X1RU 1S6HA 1BTXA 3UFAA 1C1WH 4CRCA 2D26C 4THNH 3AASA 1C2KA 1SGQE 1IQKA 1PPCE 4ISHH 4K2YA 1BTWA 1INCA 1C5QA 1UK3A 4TY7A 2ILNA 3A84A 1QB1A 3RXTA 1O3OA 5IDKA 4ZHLU 2G51A 3BTFE 2OC0A 3GDSA 3SNBA 3VB7A 3BTGE 2D1JA 3F9EA 1NU7B 1O3MA 3SQEE 5EPYA
chains in the Genus database with same CATH superfamily
2KCYA 1A3EH 4WXIA 5HMAA 4TY6A 3U28C 2GZ9A 1CO7E 1MQ5A 5A0AE 3F0OA 1BBRE 1C1OA 4UFGH 2VBCA 3QGNB 2ALVA 3QN7A 1LPGB 2XYAA 3F1SB 3UWIA 1BMFD 3PV4A 5A8ZA 1TA6A 4I8HA 1XVOA 2XC5A 5FL7D 3VPKA 3A7VA 1P06A 1SLVB 1TLDA 4CHAB 1THPB 3UWJH 3PMAB 1NC6A 1EP5A 2A4GA 1KSNA 1GBCA 1FIWA 1TONA 1C5YB 3EDXB 4D7GA 1FN8A 1GBAA 3A7WA 1AVXA 4I8KA 3BTTE 1GHYH 5E2OA 4B2BA 2RCEA 1VCQA 5E8EH 1V2KT 3URCA 3ZVFA 2NU1E 4X6OA 3ELAH 2WV9A 2ZU3A 3RXJA 4FUCA 1GJBB 4JZ1A 1L1JA 3BSQA 4WF8A 4XBCA 1VZQH 1IHSH 1CE5A 1EZXC 3CP7A 1TBZH 5EPNA 1UTKA 1TMBH 3U1JB 4UFFH 2TIOA 1O2RA 2Y80A 4OS1A 3FOAA 3M5OA 3TVJB 2QIQA 3ZVBA 4NG9H 1O37A 3M3SA 1RIWC 2VH6A 2AEIH 1ORFA 2B5TB 4NA9H 1H9HE 1K1NA 2CGAA 1GCTC 3EGKH 1XVMA 2JH0D 3MHWU 2FTMA 1N8OB 1CA0C 1TNIA 1LVYA 1C9PA 1PPZA 3T29A 1F5LA 3HK6B 5DN6D 1ZHRA 2RA3A 2J38A 4YOJA 8ESTE 1M9UA 4BXWA 1LTOA 4YLQH 4O9VA 4SGBE 2J97A 1ZSKA 4Z6AH 3MNCA 3LKWA 1DSUA 2G52A 1C9TA 1QB9A 2BXUH 5C5OA 5F53A 4Y7AA 4BAHB 3EE0B 1AE8H 1EJNA 1OWHA 1PPGE 3FZDA 3KHVA 1KXCA 4BNRA 3D23A 5B6OA 1GHZA 3SYJA 2C8WB 1WDIA 2HGTH 1J14A 1S0QA 3ZYDA 2WHXA 1SR5C 2ANKH 3SU1A 2CHAB 2IN2A 1GBKA 1S85A 1F92A 1G36A 4RN6A 1YLCA 3O8RA 1FJSA 1EAIA 3DSOA 2PR3A 1TRYA 3IITA 2H5CA 1Z6EA 3T26A 1BMMH 3RXSA 2F9UA 1C1MA 1T31A 2LELA 3GS9A 1O5DH 4CRAA 4D8NA 1W10U 1C2FA 1MUEB 2BVXH 2OTVA 4MPVA 1KTTB 3SU3A 1EUFA 1QR3E 2FEQH 4FU7A 1DICA 2K0QA 2WPKS 3RXUA 1G3CA 1K1MA 2FESH 1QBOA 2TGPZ 3PWBA 1F5RA 2C90B 1QBVH 1UTLM 3ZYEA 4MNYA 4TPYA 2P94A 1GVZA 3SBKA 3P8FA 3QTOH 3SU6A 3RXAA 3NPSA 4ISIH 2PFEA 2XXLA 4Q7YA 3MH7A 3OTJE 1P3EA 1MU6B 4AORA 5LPEA 6GCHG 3WWBA 1C2MA 2BD3A 3U9AH 5DPAA 1G2LA 1LHFH 1SQTA 3EYDA 4VGCC 1P01A 2B0FA 1TX8A 1A4WH 1NS3A 3VEQB 3QO6A 1P8VC 2P95A 2RA0A 1VGCB 3MU1A 1J16A 4DJZB 3MH6A 1Y5AT 2ZU1A 2BVRH 1IQGA 1NRSH 1AZZA 2OCVB 2UWLA 1KLTA 2DE9A 3BEFB 2BOKA 2BY5X 1AN1E 2ZHEH 2IJOB 2YNBA 4NA7A 2WUBA 3UQVA 2P93A 4FUGA 5GPIB 1HAYB 2JIZD 1SB1H 2KAIA 3I77A 1KTSB 1DXWA 1FONA 2YMSC 1BHXB 2R0LA 2Y5FA 2O8MA 3AK5A 5PTPA 1HRTH 1AIXH 1DM4B 3BTHE 5E0GA 2WZQA 1Y59T 4BAMB 1W7GH 3STIA 5JBCS 1W11U 1L4DA 1T32A 3PLBA 1UVSH 3PV2A 3H5CB 5DP4A 1GI3A 1DUEA 4B73A 3UNQA 3GYMA 1IOEA 6GCHF 4HG6A 3TJNA 1W0JD 5LPFA 2KFWA 1HIAA 1WU1A 3M61U 5JB9S 3TGKE 3RUOA 1C1NA 1LQEA 2I6QA 3RU4D 4RI0A 4NWLA 4FUEA 5FBEA 2SGFE 1VCPA 2A1DB 1GHBG 3TNTA 4ZHAA 2FPZA 2A0QB 1HAVA 5HM2A 2QE7D 5TCCA 2JKHA 4F49A 4WVPE 3SJKA 5A0CA 2PTCE 6CHAB 3ZVGA 1AUTC 4Y79A 1HAIH 4Q4LA 1FY5A 1YPKH 1GBLA 2XC4A 2BDIA 3ODDA 1GL1A 2ZCKP 3ZZ8A 1MMJN 1UTNA 4B76A 3I78A 1GI5A 3KQDA 3ZIAD 5EJLA 1BMLA 1TPPA 1OP8A 1KLJH 5EODA 3RP2A 4ABIA 1UHBB 2KM0A 1A7SA 4Z1MD 3EA7A 5DO4H 1OP2A 3A80A 3M3TA 2H9HA 3BTQE 1GBMA 2Z3CA 1CU1A 3HGNA 4TT3D 1D3TB 4E7RG 1O38A 1K1LA 1O2GH 1P2QA 2M5TA 2W5EA 4CRFA 5DJ7A 3QDZB 4AFQA 3UAIC 3EQ0H 1BMAA 1O3DA 1GJ8B 3SU0A 5FX6A 2F3CE 4JZIA 1YCPH 2R3UA 4AGJA 3MQKC 5LPRA 1A0LA 2O8TA 3K65B 5CHAC 1ZRBA 2BB4A 4ABJA 1GHBF 1F5KU 1MTNB 3UNRA 1NRQH 4B71A 1JRSA 2VIPA 4NIWA 4I86A 2ZDNA 1DPOA 1SL3A 1EAUA 3PROA 2OD3B 3A8CA 4XFQA 4OGXA 1FMGA 1V2NT 1X7AC 4Q2KA 3RXHA 5SGAE 1GL0E 5GIBA 2SGEE 1NRRH 1OWKA 3GY5A 1OX1A 1QURH 1THRH 1Z8GA 1ZZZA 4AX9H 1S6LA 2BD9A 2PV9B 1BTHH 4D76A 5EOKA 1TPOA 1PQ7A 1FV9A 2JJ2D 5T6DA 1HJ9A 3LIWA 3F2GA 1C5SA 3A8DA 1C5TA 2VGCB 2ZFTA 1AMHA 2F9BH 3EE7A 2Z7FE 1QY6A 1NTPA 1O2SA 4ZXYH 5A0BA 1LHGH 4JYTA 1G3DA 1F0RA 1SQRA 1EAXA 4GHQA 3PMJA 1AGJA 1O3PB 2NU3E 2ZCLP 2OBQA 1PYTD 1UJ1A 1SGNE 5GJ4B 4X8UH 1FDPA 2KAIB 4UFDH 3GY3A 4X6MA 1YCPM 2Y7XA 1GBEA 1O2VA 2TGDA 3ZZ3A 1ID5H 2HLDD 1GBFA 2BDAA 5FHTA 3SUGA 4X2XA 3GY4A 4X8SH 2JJ1D 3UB0A 2H9EH 1P09A 1P2MA 2STBE 5AVDA 1YPMH 3SQHE 2W7SA 2BD8A 3BIUH 3RMMH 5C17A 1SMFE 4ISOA 5EU8A 2V3HH 3HKIB 4MNVA 1SVPA 4Y0ZE 1NBMD 2K1QA 1V2RT 1LVBA 3BTWE 3HGPA 1K22H 1V2LT 3K6ZA 4ABEA 1MQ6A 1ELBA 4X1NU 1C4V2 2SGAA 4DOQA 2WPIS 1LO6A 4O97A 2BLVA 1H9LB 4Y7BA 3V7TA 3O8CA 2BY7X 2FTLE 3SU2A 2ZQ2A 4IMQA 4IW4E 3SGBE 3TH2H 1DANH 1Y3UA 1P12E 1XUJA 5EQRA 4NSYA 2M2AA 1J8AA 1BT7A 2P3TB 2HPPH 4WJG2 1KLIH 4I8LA 2BQ7B 3FAOA 2A4QA 1BJVA 1PPEE 1MU8B 1O3IA 3AW1A 1TMTH 1AU8A 4AFUA 3FP8E 2ZDMA 1IQMA 2ZFPH 4AG2A 1KY9A 2BMGB 4ZHMU 3E1XB 3E3TA 4X6NA 1MBMA 1WQVH 1FY3A 4UDWH 2VIVA 2I6SA 3UIRA 1LDTT 2KX4A 1E34B 3QLPH 3S7KB 3RXIA 1XKBC 7GCHG 1FIZA 1YPHC 3LC5A 2QXHA 1GJCB 1RIWB 2R3YA 4AC9A 3SHCH 3T2NA 4NFFA 2BLQA 1GCTB 2RDEA 1DWCH 4WH8A 4CBNA 3RXCA 3VG8A 2C4FH 2IJD1 1SHHB 1CA0B 1G3BA 1LHDH 1WAYB 3RXLA 3S69A 2W26A 3F9HA 3URDA 3Q3KA 4RSPA 2IPQX 2VIOA 1IQHA 1T4VH 1EJAA 4MNXA 1WSSH 1H1BA 1GHAG 1TMUH 1O36A 4FUFA 3SNAA 1SPJA 3S9BA 3P8GA 5HIYA 5CDFE 2TRMA 5E2PA 2BX3A 4UE7H 2VB0A 4ASHA 4AYYB 4BAQB 3PB1E 1E1QD 4AYVB 3U69H 4WMEA 1NRNH 3UQOA 2ASUB 1PJPA 1K21H 1ZOMA 4U30A 3P6ZB 2QCYA 1IQJA 3AVZA 1GDQA 3A85A 1DLEA 4FXGH 2UWPA 1AQ7A 3BV9B 4AB8A 1TB6H 5DK1A 2G5NA 1O0DH 3L6PA 2FZZA 1BB0B 1MAYA 2FI3E 2FOEA 1BCUH 1O2MA 4GHTA 4YO9A 2F91A 2FM2A 1AKSA 2C8ZB 4Y8XA 3PTNA 2ZIQH 4A1XA 1EB2A 3K9XB 1O5AB 5C67A 1QL7A 3KYFA 3BG4C 2Z9KA 1GBJA 2BDHA 2HVXA 1P9UA 4JMYA 2FOAA 1V2ST 3FP6E 4GLYA 2LNCA 3KNXA 3RLWH 2ZC9H 4WH6A 1HGTH 1K28D 1T4UH 4HZHA 2AGEX 1IAUA 1SI5H 1S6FA 1YYY1 1O5FH 4FUIA 3BEUA 1P2NA 3PMHB 1YGCH 1C5WB 1AHTH 3V12A 1GHAF 2PKSC 2ZCHP 1O3HA 1ANCA 1VJ9U 2CK3D 2P3UB 2IPHA 3RXKA 1WUNH 1UTMA 1FQ3A 1E0FD 1UCYE 4X0WU 1ABJH 1JIRA 1C5NH 2H2ZA 3OAAD 1CQQA 4NSVA 5J4SA 3U98H 3S7HB 2QA9E 2ODPA 4OS2A 1PPFE 1AWFH 2FOGA 2AFQB 4IC6A 3GYLB 1RTFB 2HWLB 4VGCB 1AFQC 1V3XA 4JZEH 1OPHB 1V2PT 1TA2A 2F9PA 2ZGJA 3SUDA 5AF9H 4I7YH 1O5GH 1WQSA 3SU4A 2GZ8A 4ISLA 4DVAU 3SORA 3GCOA 4X1PU 1F0TA 4M7GA 3MH5A 3A81A 5GNDA 1C1RA 1YPGH 1GI6A 3NCLA 4GUXA 4MPXA 2KZ4A 2F43B 2QF4A 3ZVDA 1TNJA 1MBQA 3FN8A 1O2JA 3ZVEA 1AO5A 1O3FA 1D6RA 2BM2A 1C1VH 2GKVE 2Z9JA 1ESAA 3CS7A 1ESTA 2WINI 4GSOA 1O2TA 5DP8A 3ATWA 3LH1A 1QQ4A 4U01A 2EI6A 3V0XA 3PMBB 3M7UA 3KL6A 1YPHE 2QY0B 1TGNA 1ZTLA 1AE5A 1O3LA 3D65E 2CN0H 3LH3A 2F4LA 1CGHA 2EEKA 2ZGCA 1OOKB 3E6PH 4LK4A 1P02A 1PQ5A 1A3BH 1ELEE 2YNAA 4NWKA 1P3CA 1GCDA 2AS9A 4Q7ZA 1WBGB 2KR7A 1YPJH 2EI8A 2QF0A 1YF4A 1EOLA 2TPIZ 1V2UT 2OQUA 4IN1A 3BTME 4I31A 3SV9A 1Y3VA 4MDSA 2PP6A 4KP0A 1O2PA 2OC8A 4NZQA 4FVDA 5JBBS 4B6EA 1EOJA 1HDTH 1HJ8A 2QV1A 2FIRH 4XBDA 3P70B 5JPMH 2GDEH 1P10A 4KTUA 4XD7D 2A31A 1A1RA 3F9GA 9LPRA 5I46H 1BJUA 1O2WA 2H1UA 4KELA 2BD5A 1C5RA 2UWOA 4E7NA 2O8WA 1ZSJA 1N6XA 1OSSA 1RRKA 2C8YB 1TRNA 1NN6A 3MFJA 1BTYA 1GI8B 2PKAA 1P0SH 2BY9X 3A83A 4KKDA 1CA8B 3V3MA 1TGCA 4M9FA 1QTFA 1AKSB 4B1TA 1MTSA 1TABE 3NWUA 1FPHH 1ELCA 1BIOA 1YPEH 3BIVH 1RJXB 1MABB 1K1IA 1CT4E 2W3KA 1W13U 2BDGA 2ULLA 3NK8A 1TE0A 1ESBA 4XDEA 3KGPA 2BDBA 3GCTG 5KEDA 2ZPRA 4D7FA 1YP9A 1V2VT 3HK3B 4RT1A 3MNSA 2NU4E 3NKKA 2FO9A 2OLGA 4X1QU 1HAPH 1GGDC 2HRVA 3RXBA 1ELDE 4FUBA 4ZUHA 2ZU2A 3ZZ7A 1SLWB 1OWIA 1OXGA 5ABWA 3SZEA 3F9FA 4GVUA 3DA9B 1H8DH 1SOZA 1SLUB 1W0YH 4INLA 3GY8A 4U2WA 2KCAA 3GCHB 3PV5A 2DE8A 1AD8H 1O32A 4ABGA 4F4OC 1CGJE 1SFQB 1G9IE 1S82A 4NFEA 1O3GA 5FPTA 4PROA 1KDQA 4X8TH 5DP7A 1TAWA 1ZGVA 2VWOA 1ZSLA 1V2MT 3BEIB 3TJUA 1NM6A 1A46H 3LGVA 1CHOG 3C27B 3SNDA 4F55A 2VJ1A 3ODFA 2PGQB 1NT1A 2O8UA 1XUKA 1EZSC 4INHA 3MU8A 2D2DA 1EP6A 3M5MA 3MOCA 5K0HA 4R0IA 2J94A 1MKWH 3PTBA 2G8TA 2WYJA 1UK4A 3QK1A 1A0JA 4Q7XA 3GCTF 2FXRA 2XNDD 5EW2H 3E8LA 1VITG 4YTAA 3STJA 1OYTH 3RXEA 4CR5A 4Y10E 1EASA 4H6TA 3DFJA 1GI1A 4CBOA 1O34A 1TRMA 1CBWC 1DVAH 2R2MB 1ETSH 2A5KA 1BQYA 3UOUA 1LHEH 2FP7B 1GJ7B 2FI4E 1QCPA 4DIHH 2SFAA 2ZFQH 2TGTA 3PYHA 1ZTKA 1EJMA 1MTUA 1NY22 3LU9B 2ZPSA 1D4PB 2Z9IA 1Y5BT 8KME2 1L4ZA 1QIXB 4AB9A 3Q77A 3BN9A 1GJ4H 4OS5A 5I25A 5GCHG 3LJOA 4JK6A 2PUQH 1ZJDA 2HOBA 4Y71A 1KYNA 1H4WA 1MKWK 1ZLRA 3ZZ6A 1CHOF 2G81E 1BTZA 3ESTA 1FY8E 1HJAC 2NU2E 2GV6A 1SSXA 1ZYOA 1CT0E 1O3KA 1ETRH 3SJ8A 5LH8A 2VVCA 2AERH 4YT7H 5JB8S 1YWUA 4AOQA 1TBRH 4RKJB 1E1RD 2ODQA 3F6UH 4TYDA 3LGYA 1YM0A 2J5UA 1GG6B 1T8NA 2A32A 2GD4B 1VITF 2XBYA 5JDUB 1GHVH 2C8XB 1G37A 1XUGA 2PKAB 1LQDB 4OS4A 4WMFA 1UW7A 2ZGBH 3RC5A 4ZXXH 1EXFA 2FI5E 1O2LA 3A82A 1O31A 3T27A 3PRDA 3AW0A 1O2OA 1H9IE 1Y3WA 2ZWLH 2EA3A 5A09A 2EI7A 3QUMP 2H9TH 4WWYA 2B7DH 1HXEH 1C4U2 4IBLH 1O39A 2BDYA 2EQNA 1Y8TA 3A86A 3NXPA 5FBIA 1D3QB 2Z9LA 3A7TA 5GCHF 1QNJA 1TGBA 2ZEBA 3KQ5A 2SNWA 3SJ9A 4IC5A 5HM9A 4NIYA 1NESE 5EQSA 3LGWA 3OFND 4DG4A 3FVFB 3EA8A 1O2ZA 3SGQE 3BTDE 2GP9B 1UTPA 1QGFA 1ZHPA 2O8LA 3HPTB 1ELAA 2KCOA 3A87A 1BRBE 4BTIB 1DDJA 3QX5H 1GPZA 2W6JD 3KQCA 2ZTXA 3F0PA 3RXPA 1YLDA 1SGTA 5EXLA 5FCRA 3OX7U 1E35B 1CHGA 1C5PA 2NWNA 5EXMA 4K8BA 1MD7A 4XSKU 3UREA 1HCGA 1RXPA 1SGRE 3KF2A 4F48B 2GV7A 2ZU4A 3BG8A 4UEHH 1W7XH 1GJAB 1C1SA 1W12U 4ZAEA 5C1UA 1XUHA 3UUZA 1RTKA 3FP7E 2JETC 1KIGH 5CE1A 1A2CH 4RKOB 2G00A 2BHGA 1E36B 2P16A 1OYQA 7ESTE 4DCDA 3BG4B 1F7ZA 2CJIA 2FDAA 2FOCA 1D9IA 1TOCB 5EW1H 4MPWA 4IS5A 1ANBA 3RMNH 3IWMA 4CRDA 1K1JA 1VITH 5GDSH 1ARBA 1O33A 3UR9A 1KXAA 4X6PA 1NROH 2V0BA 2QF5A 1QFKH 5E0HA 1Z8IB 3SI3H 1KXFA 2GJGA 3F2FA 1FAKH 5C94A 2PKSB 3M35A 3E16B 5EG4A 1ARCA 2Z3EA 1P04A 2BDCA 2HPQH 2DUCA 2GMTB 2RDLA 3CENA 4B75A 3NRLA 1BTUA 3QWCH 1DWBH 1S5SA 1A0HB 4TSFD 3SHAH 4UFEH 1V2JT 1O2KA 4AFZA 2IOTA 2RFKC 4Y76A 4BOHA 4ZROA 2AGIX 1WCZA 3TK6A 2PUXB 2O9QA 2AHME 4K1TA 4ZCNA 1Z71A 1P57B 1T8MA 1XXDA 1AFQB 2VWLA 5GWZA 5DSFA 5T1VA 1THSH 2WPHS 5TCAA 3UY9A 2UUFB 2AMPA 2PWXA 1LPZB 2H5DA 2KCPA 5DP6A 1HIAB 3RM0H 1V2WT 1SQOA 5FXLA 1O2QA 4ISNA 5C3NA 3UPEA 3TGIE 2R0KA 3TNSA 7KMEH 1CVWH 4X2YA 1HAVB 1BRUP 1SOTA 1LVOA 4INKA 1QJ7B 5F8TA 2GDDA 2V3OH 4OGYA 4WY3A 1DOJA 1W0ZU 3RMLH 5EIYA 1GI0A 1JRTA 4XBBA 1C1UH 1K9OE 1TIOA 1SLXB 1AVWA 1SGEE 2Q6FA 2PGBB 4B74A 3LDXH 4ABAA 3Q3XA 1C2LA 1BBRH 2ZO3H 4I32A 1HB0B 1MTVA 5EQQA 4BTUB 2XCNA 2THFB 5F8XA 3WWFA 2ZDKA 3UTUH 3RXMA 4Y11E 1ZTJA 5CHBA 4UD9H 1PPHE 2OINA 2V3MA 4JZFH 5E0JA 3AAUA 4AGKA 3RLYH 5G4BA 2BLWA 1PQ8A 5JBTA 5HYOA 1C5OH 1FNIA 5GXPA 1C5LH 2QAAA 1HPGA 5DG6A 5F03A 5L6NH 2ZFRH 1JMOH 1PYTC 5DP9A 1TOMH 1GHWH 2BD7A 2BYAX 4B6FA 1XKAC 1JXPA 1HUTH 3ZZBA 1UVTH 4QT8C 1A5IA 3LGIA 3TJVA 1JWTA 4CRBA 1HXFH 2WPLS 2WPDD 1Z1IA 1C4Y2 2GX4A 5BRRE 4K69A 4CR9A 3D62A 4H6SB 1O2NA 1U6QA 2PSYA 1GJ5H 2VWNA 3BTEE 1C2JA 1UO6A 3P17H 1BBRK 1OHHD 3DFLA 5C0UA 4TWWA 2ZP0H 3FFGA 4E05H 2OUAA 4AG1A 1TNLA 1YLNA 6LPRA 1P2IA 2Y81A 5EGMA 3RU4E 5L2YH 3MI4A 2W6ID 1A5GH 2XBWA 3A7YA 4ZKOU 3OSYA 3ZZDA 2RG3A 4K1EA 2B8OH 2ZGXH 3E90B 4O3UA 3KYGA 1O35A 1OWJA 1ZRKA 4X2WA 1O2UA 2Q6GA 1C1QA 1UMAH 4FVBA 1NFXA 1HAGE 1YBWA 1GGDB 4YOGA 1UK2A 4YLUA 2AIQA 1O5CB 3TGJE 1Z1JA 3Q76A 4Q80A 1H8ED 5EXNA 4MNWA 7GCHF 3TH4H 3ZZ4A 1AVGH 2J98A 2CF9H 1F2SE 2ZF0H 3TK9A 1GBDA 4JK5A 4NGAH 3N7DA 3U8RH 2P8OC 3I29A 3M7TA 1ELFA 2QXJA 2SGPE 2BLOA 2UUKB 3RC4A 5EJZA 3VB3A 4I33A 2G4UA 4K5ZA 2J2UA 1TNHA 2G4TA 2J92A 3M5NA 1SQAA 2R9PA 1G30B 1HFDA 2Y5GA 3TU7H 2BQ6B 4ABBA 4UONA 2ODYB 4MVNA 4E06H 1OWDA 1O5EH 2WV5A 2WSSD 1GBTA 1E37B 3F68H 1HBTH 2GVFA 3S9CA 4Y0YE 1BITA 5DP3A 2H6MA 2WPJS 2XBXA 1HV7A 1FLEE 2ANMH 1WTGH 3VB6A 1D3DB 1MH0A 1XMNB 1FN6A 2XTTB 3NZIA 2PTNA 4SGAE 1T7CA 3VGCC 1OS8A 1CSOE 1O3AA 3QZQA 3JZ1B 2VU8E 3TITA 3MU0A 3T25A 1P2KA 1TQ0B 5HGGA 4J2YB 1GJ6A 3JZ2B 3KN2A 4ABFA 3VB5A 1CBWB 1QJ1B 3PM3A 1O2XA 1HNEE 2FYRA 4ACAA 1DT2A 2BY8X 1GVKB 2GZ7A 1L2EA 3GCNA 1KXBA 4ZKNU 4JZDH 1TFXA 2XWAA 2OXSA 1QRXA 1BA8B 4KTCA 4AN7A 1GBIA 3L3TA 1V2OT 3UNSA 1EPTC 1W14U 4I8GA 5AFYH 4YZUA 2XC0A 4A92A 4XOJA 3LJJA 3IG6B 1BUIA 1UVOA 1EATA 2WPMS 3QZRA 1J9CH 5AHGH 1HJAB 2YMSB 1YKTA 7LPRA 5A8YA 1O5BB 4ASUD 3WW7A 3E0PB 5HKKD 2AH4X 2ZI2H 3TLOA 2OC1A 1PPBH 1QJ6B 5FCKA 1ACBE 1T8LA 5ESTE 1GMDG 1C5XB 3A88A 5ESBA 3MU5A 1QZ8A 5L30H 3PLKA 1C5MD 1QL9A 3ZZ5A 2QF3A 1NPMA 1T8OA 4ZH8A 1VKYA 3LGTA 1DS2E 4FUJA 1IQNA 1GJDB 2OQ5A 5HXFA 1MAXA 1NFYA 4MTBA 3SW2B 4GAWA 1QA7A 1ZGIA 4CH2B 1AWHB 1Q2WA 2HNTC 4DT7B 2AMDA 1TNGA 3ZVCA 2BZ6H 1P9SA 3RXDA 1EKBB 2R2WU 4OS6A 3BTKE 1NBME 4P00A 2FYQA 3RXVA 3SUFA 3SU5A 3WY8A 1IHTH 5T3HA 2V35A 1RFNA 1B0EA 4U32A 3DT0H 1J17T 5FPSA 1S84A 3F2HA 5C1XA 4LXBH 1A61H 2A45B 4OM9A 4B2CA 1UTJA 1UVPA 1TYNA 3KCGH 2XBVA 1W8BH 3MMGA 4I8JA 1HYLA 3L33A 1GI2A 1GJ9B 2ALPA 4LOYH 3M5LA 2XW9A 2OBOA 4FETA 4DW2U 3MNXA 3DUXH 2BD2A 1ELTA 2ZECA 2CMYA 2GCTC 3TJOA 4A5TS 1C1PA 3GICB 1FZZA 3B9FH 2J98B 1FUJA 1RS0A 1DWEH 2VVUA 1GMDF 2CF8H 2ZHWH 1ZMNA 3PLPA 1UTQA 4D9QA 3MO3A 4P02A 1ZPZA 3SI4H 1HAZB 1WTHD 5CMXH 1SGFG 5ETXA 1LPKB 1WOFA 1HLTH 4TPIZ 4BAKB 3N7OA 2PLXA 1F0UA 2VNTA 4IN2A 1AFEH 3MU4A 2YOLA 5CHAB 1GI4A 4ZMAH 1DITH 3U8OH 3FO8D 3QGJA 5AFZH 3MO6A 2Z6BD 1AB9C 2NU0E 1SG8B 1O3JA 5HIZA 1IQIA 2Q6DA 1Z6JH 3M3VA 1CT2E 2JETB 5KGOA 4MPUA 1C2DA 1GDUA 1C2EA 2F83A 3D49H 3OU0A 4JCNA 1LKBA 1EQ9A 8GCHG 1O3NA 3VB4A 1N6YA 1PQAA 5C20A 4KTSA 2FOFA 1SFIA 3SJIA 4CH8B 3SV8A 3W94A 2C93B 2VH0A 3KQBA 3Q00A 1UHBA 4HFPB 4NIXA 2VINA 4Y8ZA 2YMSD 1RGQA 1O3CA 3ZZCA 5C1YA 2L6OA 4ZKRU 3PO1C 1ZPCA 3P8OA 4FU8A 1O2YA 3LGUA 4CREA 3DSPA 1QB6A 1G32B 2ZDVH 1TBQH 3RU4T 1SBWA 2FS9A 3U1IB 2WV4A 1C5VA 1BOQA 1GVLA 1VCWA 2BXTH 3K2UA 2QGRA 4MQAA 2QXIA 1C2HA 5F8ZA 4ZKSU 3R0FA 3RMOH 3MWIU 3K6YA 4H42U 2SGDE 4LZ4B 3N99A 2F9NA 2A7CA 3ITIA 3U8TH 2L74A 1TNKA 1TPAE 5FPYA 3EAJA 1GI7B 1GI9B 3M37A 4HGCA 5A8XA 4YM9A 1TQ7B 1YPLH 1LMWB 3DD2H 1L1NA 3KIDU 8GCHF 2HNTE 2JH5D 4FUHA 1DXPA 4A7IB 1AUJA 1WV7H 2Y6TA 3ATLA 1EFRD 5FAHA 1SGIB 1XUIA 2QXGA 1WYKA 2GCHG 1SGPE 4DGJA 3TK5A 1OKXA 2VIDA 1LHCH 2FS8A 1D3PB 3SJOA 3TPIZ 1DUAA 1GMCG 3M7QA 1ZMJA 4Q63A 1VJAU 3W95A 1EZQA 1C5ZB 2Q1JA 6ESTA 1O2HA 3GISB 1FPCH 2XOKD 1GBBA 3GY6A 1IQEA 2BD4A 2ZZUH 4MLFB 4RT0A 4DURA 4CHAC 4YOIA 3SZNA 3TIUA 3RM2H 1H8IH 1E38B 4IGDA 4K1SA 1AY6H 4MG3A 1TGTA 1RTLA 1NRPH 2BOHB 2BY6X 2Y7ZA 1EPTA 2FOHA 1BZXE 1MD8A 1NFWA 1EB1H 2EY4C 3OYPA 4GPGA 1P03A 3HATH 3MO9A 3EA9A 2ZGHA 2FX4A 1MZDA 2C3SA 2A4RA 2FWWA 2VIQA 2G5VA 5L2ZH 4BTTB 2FX6A 3ZV8A 1NZQH 1ELVA 3ZV9A 2ZHFH 3DCLA 3ZZAA 2ZKSA 2WUCA 3F3BA 4O03A 3SO3A 5H4IB 5EJ1A 2QYIA 1ZHMA 1ELGA 2GCHF 1L0ZA 4CRGA 3GDVA 1DLKB 2XCFA 3FANA 3KEEA 1GMCF 3ZVAA 2ANYA 2D8WA 1BDAA 3E0NB 2AIPA 3HKJB 3P8NA 1E79D 3T28A 1Q3XA 1DFPA 1NU9A 1KDQB 5JYIA 1N8OC 4ESTE 4DIIH 2ZDLA 9ESTA 1COWD 1P05A 2P3FH 3LPRA 1C5UA 2V7QD 1LKAA 1GDNA 4LZ1H 3SUEA 3ATKA 5DKMA 2AGGX 2ZU5A 1P2OA 3VXFH 3R3GB 1GHXH 4FU9A 4KGAA 1BHXF 2A2QH 2QC2A 2UUYA 5C2ZA 1O3BA 2ZA5A 3S9AA 1G3EA 2J4IA 1DX5M 3RXRA 1C1TA 5J4QA 1XX9A 3RXFA 1Y3XA 2CXVA 3P92A 3A8BA 3N7EA 4HTCH 4A1TA 1NO9H 1W3CA 2FODA 1P2JA 3PWCA 1LCYA 4A6LA 2SNVA 4ABHA 1QRZA 2P8OB 5C5NA 1FX0B 1V2QT 2TBSA 3A8AA 3GDUA 2OC7A 3GY2A 4R8TB 5JBAS 3P95A 3C1KA 4A1VA 1BRAA 1J15A 3S0NA 2CHAC 4FOUC 4K3JA 1KMHB 1O30A 2TGAA 4ACBA 2BTCE 3GCHC 2PHBA 1FY1A 4AZ2B 3MYWA 2JDID 2CV3A 1XXFA 2HALA 5DP5A 1JIMA 2GTBA 2EC9H 1EAWA 1YY3A 2ZFSA 1UVUH 2FLBH 4NIVA 4FUDA 3SV7A 1K1OA 3VGCB 2ZNKH 1PFXC 3Q3YA 1DSTA 1C2GA 4DY7B 3RDZA 2LP6A 1TPSA 1HAOH 1TALA 1GMHG 2A5AA 1P11E 4BANB 2AYWA 2QN5T 4BAOB 5B6LA 1CGIE 1MCTA 3G01A 4X8VH 1YCPK 2BX4A 1WXRA 2J95A 3B8JA 3SGAE 1MKXH 2Y5HA 2PSXA 1QQUA 3LONA 3LC3A 4X1SU 4ABDA 1FAXA 4JYUH 3OY6U 1UCYH 1BRCE 2FOMB 5IYTA 2K8IA 4DT4A 3MH4A 3V13A 4NCYA 1ANDA 1BTPA 2ZFFH 1L1GA 1Q31A 5T6FA 3SV2H 1NFUA 2ZG0H 1EPTB 4YESB 1XM1A 1VGCC 2OK5A 1Z7KA 4Y6DA 1D6WA 4HI3A 1MZAA 2FMJA 3TH3H 2ZHDA 2W7UA 1SGYE 2A5IA 3UOPA 3O8BA 1TX6A 1QA0A 1HAHH 3GOVB 3OEED 3VXEH 1JBUH 2ZQ1A 3LOXA 1V2TT 3T62A 2HLCA 2XNIA 1XUFA 5FX5A 2GT8A 1F0SA 1SKYE 5A2MH 2FOBA 1K0HA 2J34A 3RXOA 1AI8H 4X2VA 5K7RA 1SGCA 2P59A 1V6DA 2PW8H 1ZMLA 1B5GH 1GMHF 1MKXK 3DHKH 5DGJA 1H8HD 3T5FH 4OS7A 4Y8YA 5T6GA 3ENSB 2VWMA 1G2MA 1UCYK 2ZPQA 3SOSA 1K1PA 4NA8A 5KECA 3ZZ9A 3O8DA 1GG6C 1C2IA 3GY7A 1SGDE 1O3EA 1DE7H 1Z8RA 3CNRA 4GCHG 4XRNA 1GWAA 1IQFA 1TX7A 3M36A 2XWBI 4IMZA 1W0KD 1OP0A 1GBHA 1DWDH 2SGQE 2UUJB 5BPEA 1TGSZ 1QBNA 4D9RA 2BZAA 3UR6A 3MNBA 2G55A 3RXQA 5LGOA 2XRCA 6CHAC 1AZ8A 3SV6A 2GCTB 1OWEA 1KXDA 3MTYA 2ZHQH 1W2KH 3QTVH 1K2I1 1LVMA 1YC0A 3AAVA 1UTOA 3LT3A 5TJXA 1ANEA 3H09A 1FI8A 2VVVA 3BF6H 4JYVH 1EZUC 4K8YA 2OP9A 1TWXB 3NUMA 3FZZA 2ESTE 2ZTZA 3PRBA 3A89A 2V6NA 3OY5U 2ZTYA 4H4FA 1A5HA 1DY9A 3W1EA 2BQWB 1DY8A 2W3IA 2F9VA 1Y5UT 2HNTF 4BXSA 3H7OA 4AFSA 1S81A 1MTWA 1QL8A 1ZR0A 1AB9B 2ZDAH 2ANWA 3B23B 4GCHF 2GGVB 5F6MA 2STAE 3VFEA 3KQEA 1ZJKA 1QHRB 1SGFA 2GT7A 1MTNC 2A7JA 1Y3YA 2Y82A 4J1YA 2JH6D 1HAXB 2F9OA 1RD3B 1ETTH 1S0RA 2LPRA 1SHYA 1IQLA 1MCVA 1Z8JB 2VIWA 3ATMA 5IK2D 3H7TA 1JOUB 1FXYA 2BVSH 4YT6H 2A7HA 4WMDA 1N1LA 1B0FA 3E91A 1FY4A 3SN8A 3PO1B 4B2AA 2J9NA 2FLRH 3OE7D 3A7XA 1O2IA 8LPRA 1BMNH 2B9LA 1ABIH 4K60A 1SC8U 2Z94A 3CS0A 4O3TA 1B7XB 2AMQA 2VGCC 2A4OA 4WXVA 1EX3A 1S83A 1VR1H 1KXEA 2A2XH 2WYGA 3RC6A 3RXGA 4XE4A 3A7ZA 3ATIA 1QRWA 1ZPBA 3DSGA 4TWYA 2Z3DA 4YXWD 2GMTC 4Z0KA 3SNEA 2HVYB 4NZLA 3SNCA 3OEHD 2Z9GA 5C0TA 4X1RU 1S6HA 1BTXA 3UFAA 1C1WH 4CRCA 2D26C 4THNH 3OTPA 3AASA 1C2KA 1SGQE 1IQKA 1PPCE 4ISHH 4K2YA 1BTWA 1INCA 1C5QA 1UK3A 4TY7A 2ILNA 3A84A 1QB1A 3RXTA 1O3OA 5IDKA 4ZHLU 2G51A 3BTFE 2OC0A 3GDSA 3SNBA 3FKSD 3VB7A 3BTGE 2D1JA 3F9EA 1NU7B 1O3MA 3SQEE 5EPYA
chains in the Genus database with same CATH topology
1A3EH 4WXIA 5HMAA 4TY6A 2GZ9A 1CO7E 1MQ5A 5A0AE 1BBRE 1C1OA 4UFGH 3QGNB 3QN7A 2ALVA 1LPGB 2XYAA 3F1SB 3UWIA 5A8ZA 3PV4A 1TA6A 4I8HA 1XVOA 2XC5A 3VPKA 3A7VA 1P06A 1SLVB 1TLDA 4CHAB 1THPB 3UWJH 3PMAB 1NC6A 1EP5A 2A4GA 1KSNA 1GBCA 1FIWA 1TONA 1C5YB 3EDXB 4D7GA 1FN8A 1GBAA 3A7WA 1AVXA 4I8KA 3BTTE 1GHYH 5E2OA 4B2BA 2RCEA 1VCQA 5E8EH 1V2KT 3URCA 3ZVFA 2NU1E 4X6OA 3ELAH 2ZU3A 3RXJA 4FUCA 1GJBB 4JZ1A 1L1JA 3BSQA 4WF8A 4XBCA 1VZQH 1IHSH 1CE5A 1EZXC 3CP7A 1TBZH 5EPNA 1UTKA 1TMBH 3U1JB 4UFFH 2TIOA 1O2RA 2Y80A 4OS1A 3M5OA 3TVJB 2QIQA 3ZVBA 4NG9H 1O37A 3M3SA 1RIWC 2VH6A 2AEIH 1ORFA 2B5TB 4NA9H 1H9HE 1K1NA 2CGAA 1GCTC 3EGKH 1XVMA 2JH0D 3MHWU 2FTMA 1N8OB 1CA0C 1TNIA 1LVYA 1C9PA 1PPZA 3T29A 1F5LA 3HK6B 1ZHRA 2RA3A 2J38A 4YOJA 8ESTE 1M9UA 4BXWA 1LTOA 4YLQH 4O9VA 4SGBE 1ZSKA 4Z6AH 3MNCA 3LKWA 1DSUA 2G52A 1C9TA 1QB9A 2BXUH 5C5OA 4Y7AA 4BAHB 3EE0B 1AE8H 1EJNA 1OWHA 1PPGE 3FZDA 3KHVA 1KXCA 4BNRA 3D23A 5B6OA 1GHZA 2C8WB 2HGTH 1J14A 1S0QA 3ZYDA 1SR5C 2ANKH 3SU1A 2CHAB 2IN2A 1GBKA 1S85A 1F92A 1G36A 4RN6A 1YLCA 3O8RA 1FJSA 1EAIA 2PR3A 1TRYA 3IITA 2H5CA 1Z6EA 3T26A 1BMMH 3RXSA 2F9UA 1C1MA 1T31A 1O5DH 4CRAA 4D8NA 1W10U 1C2FA 1MUEB 2BVXH 2OTVA 4MPVA 1KTTB 3SU3A 1EUFA 1QR3E 2FEQH 4FU7A 1DICA 2WPKS 3RXUA 1G3CA 1K1MA 2FESH 1QBOA 2TGPZ 3PWBA 1F5RA 2C90B 1QBVH 1UTLM 3ZYEA 4MNYA 4TPYA 2P94A 1GVZA 3SBKA 3P8FA 3QTOH 3SU6A 3RXAA 3NPSA 4ISIH 2PFEA 2XXLA 4Q7YA 3MH7A 3OTJE 1P3EA 1MU6B 4AORA 5LPEA 6GCHG 1C2MA 2BD3A 3U9AH 5DPAA 1G2LA 1LHFH 1SQTA 3EYDA 4VGCC 1P01A 2B0FA 1TX8A 1A4WH 1NS3A 3VEQB 3QO6A 1P8VC 2P95A 2RA0A 1VGCB 3MU1A 1J16A 4DJZB 3MH6A 1Y5AT 2ZU1A 2BVRH 1IQGA 1NRSH 1AZZA 2OCVB 2UWLA 1KLTA 2DE9A 3BEFB 2BOKA 2BY5X 1AN1E 2ZHEH 2IJOB 2YNBA 4NA7A 2WUBA 3UQVA 2P93A 4FUGA 5GPIB 1HAYB 1SB1H 2KAIA 3I77A 1KTSB 1DXWA 1FONA 1BHXB 2R0LA 2Y5FA 2O8MA 5PTPA 1HRTH 1AIXH 1DM4B 3BTHE 5E0GA 1Y59T 4BAMB 1W7GH 3STIA 5JBCS 1W11U 1L4DA 1T32A 3PLBA 1UVSH 3H5CB 5DP4A 1GI3A 1DUEA 4B73A 3UNQA 3GYMA 1IOEA 6GCHF 3TJNA 5LPFA 1HIAA 1WU1A 3M61U 5JB9S 3TGKE 3RUOA 1C1NA 1LQEA 2I6QA 3RU4D 4NWLA 4FUEA 5FBEA 2SGFE 1VCPA 2A1DB 1GHBG 3TNTA 4ZHAA 2FPZA 2A0QB 1HAVA 5HM2A 5TCCA 2JKHA 4F49A 4WVPE 3SJKA 5A0CA 2PTCE 6CHAB 3ZVGA 1AUTC 4Y79A 1HAIH 1FY5A 1YPKH 1GBLA 2XC4A 2BDIA 3ODDA 1GL1A 2ZCKP 3ZZ8A 1MMJN 1UTNA 4B76A 3I78A 1GI5A 3KQDA 1BMLA 1TPPA 1OP8A 1KLJH 5EODA 3RP2A 4ABIA 1UHBB 1A7SA 3EA7A 5DO4H 1OP2A 3A80A 3M3TA 2H9HA 3BTQE 1GBMA 2Z3CA 1CU1A 3HGNA 1D3TB 4E7RG 1O38A 1K1LA 1O2GH 1P2QA 2M5TA 2W5EA 4CRFA 5DJ7A 3QDZB 4AFQA 3EQ0H 1BMAA 1O3DA 1GJ8B 3SU0A 5FX6A 2F3CE 4JZIA 1YCPH 2R3UA 4AGJA 5LPRA 1A0LA 2O8TA 3K65B 5CHAC 1ZRBA 2BB4A 4ABJA 1GHBF 1F5KU 1MTNB 3UNRA 1NRQH 4B71A 1JRSA 2VIPA 4NIWA 2ZDNA 1DPOA 1SL3A 1EAUA 3PROA 2OD3B 3A8CA 4XFQA 4OGXA 1FMGA 1V2NT 1X7AC 4Q2KA 3RXHA 5SGAE 1GL0E 5GIBA 2SGEE 1NRRH 1OWKA 3GY5A 1OX1A 1QURH 1THRH 1Z8GA 1ZZZA 4AX9H 2PV9B 2BD9A 1BTHH 4D76A 5EOKA 1TPOA 1PQ7A 1FV9A 5T6DA 1HJ9A 3LIWA 1C5SA 3A8DA 1C5TA 2VGCB 2ZFTA 1AMHA 2F9BH 2Z7FE 1QY6A 1NTPA 1O2SA 4ZXYH 5A0BA 1LHGH 4JYTA 1G3DA 1F0RA 4GHQA 1EAXA 3PMJA 1AGJA 1O3PB 2NU3E 2ZCLP 2OBQA 1PYTD 1UJ1A 1SGNE 5GJ4B 4X8UH 1FDPA 2KAIB 4UFDH 3GY3A 4X6MA 1YCPM 2Y7XA 1GBEA 1O2VA 2TGDA 3ZZ3A 1ID5H 1GBFA 2BDAA 5FHTA 3SUGA 4X2XA 3GY4A 4X8SH 2H9EH 1P09A 1P2MA 2STBE 5AVDA 1YPMH 3SQHE 2W7SA 2BD8A 3BIUH 3RMMH 1SMFE 4ISOA 5EU8A 2V3HH 3HKIB 4MNVA 1SVPA 4Y0ZE 2K1QA 1V2RT 1LVBA 3BTWE 3HGPA 1K22H 1V2LT 3K6ZA 4ABEA 1MQ6A 1ELBA 4X1NU 1C4V2 2SGAA 4DOQA 2WPIS 1LO6A 4O97A 2BLVA 1H9LB 4Y7BA 3V7TA 3O8CA 2BY7X 2FTLE 3SU2A 2ZQ2A 4IMQA 4IW4E 3SGBE 3TH2H 1DANH 1Y3UA 1P12E 1XUJA 5EQRA 4NSYA 1J8AA 1BT7A 2P3TB 2HPPH 4WJG2 1KLIH 4I8LA 2BQ7B 3FAOA 2A4QA 1BJVA 1PPEE 1MU8B 1O3IA 3AW1A 1TMTH 1AU8A 4AFUA 3FP8E 2ZDMA 1IQMA 2ZFPH 4AG2A 1KY9A 2BMGB 4ZHMU 3E1XB 3E3TA 4X6NA 1MBMA 1WQVH 1FY3A 4UDWH 2VIVA 2I6SA 3UIRA 1LDTT 1E34B 3QLPH 3S7KB 3RXIA 1XKBC 7GCHG 1FIZA 1YPHC 3LC5A 2QXHA 1GJCB 1RIWB 2R3YA 3SHCH 3T2NA 4NFFA 2BLQA 1GCTB 1DWCH 4WH8A 4CBNA 3RXCA 2C4FH 1SHHB 1CA0B 1G3BA 1LHDH 1WAYB 3RXLA 3S69A 2W26A 3F9HA 3URDA 3Q3KA 4RSPA 2VIOA 1IQHA 1T4VH 1EJAA 4MNXA 1WSSH 1H1BA 1GHAG 1TMUH 1O36A 4FUFA 3SNAA 1SPJA 3S9BA 3P8GA 2TRMA 5E2PA 2BX3A 4UE7H 2VB0A 4ASHA 4AYYB 4BAQB 3PB1E 4AYVB 3U69H 4WMEA 1NRNH 3UQOA 2ASUB 1PJPA 1K21H 1ZOMA 4U30A 3P6ZB 2QCYA 1IQJA 3AVZA 1GDQA 3A85A 1DLEA 4FXGH 2UWPA 1AQ7A 3BV9B 4AB8A 1TB6H 5DK1A 2G5NA 1O0DH 3L6PA 2FZZA 1BB0B 1MAYA 2FI3E 2FOEA 1BCUH 1O2MA 4GHTA 4YO9A 2F91A 2FM2A 1AKSA 2C8ZB 4Y8XA 3PTNA 2ZIQH 4A1XA 1EB2A 3K9XB 1O5AB 5C67A 1QL7A 3BG4C 2Z9KA 1GBJA 2BDHA 2HVXA 1P9UA 4JMYA 2FOAA 1V2ST 3FP6E 4GLYA 2LNCA 3KNXA 3RLWH 2ZC9H 4WH6A 1HGTH 1K28D 1T4UH 4HZHA 2AGEX 1IAUA 1SI5H 1S6FA 1YYY1 1O5FH 4FUIA 3BEUA 1P2NA 3PMHB 1YGCH 1C5WB 1AHTH 3V12A 1GHAF 2PKSC 2ZCHP 1O3HA 1ANCA 1VJ9U 2P3UB 2IPHA 3RXKA 1WUNH 1UTMA 1FQ3A 1E0FD 1UCYE 4X0WU 1ABJH 1JIRA 1C5NH 2H2ZA 1CQQA 4NSVA 5J4SA 3U98H 3S7HB 2QA9E 2ODPA 4OS2A 1PPFE 1AWFH 2FOGA 2AFQB 4IC6A 3GYLB 1RTFB 2HWLB 4VGCB 1AFQC 1V3XA 4JZEH 1OPHB 1V2PT 1TA2A 2F9PA 2ZGJA 3SUDA 5AF9H 4I7YH 1O5GH 1WQSA 3SU4A 2GZ8A 4ISLA 4DVAU 3SORA 3GCOA 4X1PU 1F0TA 4M7GA 3MH5A 3A81A 1C1RA 1YPGH 1GI6A 3NCLA 4GUXA 4MPXA 3ZVDA 1TNJA 1MBQA 3ZVEA 1O2JA 1AO5A 1O3FA 1D6RA 2BM2A 1C1VH 2GKVE 2Z9JA 1ESAA 3CS7A 1ESTA 2WINI 4GSOA 1O2TA 5DP8A 3ATWA 3LH1A 1QQ4A 4U01A 2EI6A 3V0XA 3PMBB 3M7UA 3KL6A 1YPHE 2QY0B 1TGNA 1ZTLA 1AE5A 1O3LA 3D65E 2CN0H 3LH3A 1CGHA 2EEKA 2ZGCA 1OOKB 3E6PH 4LK4A 1P02A 1PQ5A 1A3BH 1ELEE 2YNAA 4NWKA 1P3CA 1GCDA 2AS9A 4Q7ZA 1WBGB 1YPJH 2EI8A 2QF0A 1YF4A 1EOLA 2TPIZ 1V2UT 2OQUA 4IN1A 3BTME 4I31A 3SV9A 1Y3VA 4MDSA 4KP0A 1O2PA 2OC8A 4NZQA 4FVDA 5JBBS 1EOJA 1HDTH 1HJ8A 2QV1A 2FIRH 4XBDA 3P70B 5JPMH 2GDEH 1P10A 4KTUA 2A31A 1A1RA 3F9GA 9LPRA 5I46H 1BJUA 1O2WA 2H1UA 4KELA 2BD5A 1C5RA 2UWOA 4E7NA 2O8WA 1ZSJA 1N6XA 1OSSA 1RRKA 2C8YB 1TRNA 1NN6A 3MFJA 1BTYA 1GI8B 2PKAA 1P0SH 2BY9X 3A83A 4KKDA 1CA8B 3V3MA 1TGCA 1QTFA 1AKSB 4B1TA 1MTSA 1TABE 3NWUA 1FPHH 1ELCA 1BIOA 1YPEH 3BIVH 1RJXB 1K1IA 1CT4E 2W3KA 1W13U 2BDGA 2ULLA 3NK8A 1TE0A 1ESBA 4XDEA 3KGPA 2BDBA 3GCTG 2ZPRA 4D7FA 1YP9A 1V2VT 3HK3B 3MNSA 2NU4E 3NKKA 2FO9A 2OLGA 4X1QU 1HAPH 1GGDC 2HRVA 3RXBA 1ELDE 4FUBA 4ZUHA 2ZU2A 3ZZ7A 1SLWB 1OWIA 1OXGA 5ABWA 3F9FA 4GVUA 3DA9B 1H8DH 1SOZA 1SLUB 1W0YH 4INLA 3GY8A 4U2WA 3GCHB 2DE8A 1AD8H 1O32A 4ABGA 4F4OC 1CGJE 1SFQB 1G9IE 1S82A 4NFEA 1O3GA 5FPTA 4PROA 1KDQA 4X8TH 5DP7A 1TAWA 1ZGVA 2VWOA 1ZSLA 1V2MT 3BEIB 3TJUA 1NM6A 1A46H 3LGVA 1CHOG 3C27B 3SNDA 2VJ1A 3ODFA 2PGQB 1NT1A 2O8UA 1XUKA 1EZSC 4INHA 3MU8A 2D2DA 1EP6A 3M5MA 3MOCA 5K0HA 4R0IA 2J94A 1MKWH 3PTBA 2G8TA 2WYJA 1UK4A 3QK1A 1A0JA 4Q7XA 3GCTF 2FXRA 5EW2H 3E8LA 1VITG 4YTAA 3STJA 1OYTH 3RXEA 4CR5A 4Y10E 1EASA 4H6TA 3DFJA 1GI1A 4CBOA 1O34A 1TRMA 1CBWC 1DVAH 2R2MB 1ETSH 2A5KA 1BQYA 3UOUA 1LHEH 2FP7B 1GJ7B 2FI4E 1QCPA 4DIHH 2SFAA 2ZFQH 2TGTA 3PYHA 1ZTKA 1EJMA 1MTUA 1NY22 3LU9B 2ZPSA 1D4PB 2Z9IA 1Y5BT 8KME2 1L4ZA 1QIXB 4AB9A 3Q77A 3BN9A 1GJ4H 4OS5A 5I25A 5GCHG 3LJOA 4JK6A 2PUQH 1ZJDA 2HOBA 4Y71A 1KYNA 1H4WA 1MKWK 1ZLRA 3ZZ6A 1CHOF 2G81E 1BTZA 3ESTA 1FY8E 1HJAC 2NU2E 2GV6A 1SSXA 1ZYOA 1CT0E 1O3KA 1ETRH 3SJ8A 5LH8A 2VVCA 2AERH 4YT7H 5JB8S 4AOQA 1TBRH 4RKJB 2ODQA 3F6UH 4TYDA 3LGYA 1YM0A 1GG6B 1T8NA 2A32A 2GD4B 1VITF 2XBYA 5JDUB 1GHVH 2C8XB 1G37A 1XUGA 2PKAB 1LQDB 4OS4A 4WMFA 2ZGBH 3RC5A 4ZXXH 1EXFA 2FI5E 1O2LA 3A82A 1O31A 3T27A 3AW0A 1O2OA 1H9IE 1Y3WA 2ZWLH 2EA3A 5A09A 2EI7A 3QUMP 2H9TH 4WWYA 2B7DH 1HXEH 1C4U2 4IBLH 1O39A 2BDYA 1Y8TA 3A86A 3NXPA 5FBIA 1D3QB 2Z9LA 3A7TA 5GCHF 1QNJA 1TGBA 2ZEBA 2SNWA 3SJ9A 4IC5A 5HM9A 4NIYA 1NESE 5EQSA 3LGWA 4DG4A 3FVFB 3EA8A 1O2ZA 3SGQE 3BTDE 2GP9B 1UTPA 1QGFA 1ZHPA 2O8LA 3HPTB 1ELAA 3A87A 1BRBE 4BTIB 1DDJA 3QX5H 1GPZA 3KQCA 2ZTXA 3RXPA 1YLDA 1SGTA 5EXLA 5FCRA 3OX7U 1E35B 1CHGA 1C5PA 2NWNA 5EXMA 4K8BA 1MD7A 4XSKU 3UREA 1HCGA 1RXPA 1SGRE 3KF2A 2GV7A 2ZU4A 3BG8A 4UEHH 1W7XH 1GJAB 1C1SA 1W12U 4ZAEA