2R3UA

Crystal structure of the pdz deletion mutant of degs
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
202
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKETPEGIGFAIPFQLATKIMDKLIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Protease degS
publication title Regulation of the sigmaE stress response by DegS: how the PDZ domain keeps the protease inactive in the resting state and allows integration of different OMP-derived stress signals upon folding stress.
pubmed doi rcsb
source organism Escherichia coli
total genus 40
structure length 202
sequence length 210
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3uA02
3NCLA 4XE4A 1BTHH 1O2YA 2I6SA 3LDXH 2HRVA 1DVAH 1TBZH 3P8OA 1PJPA 1UJ1A 4GHTA 1K1PA 2ALVA 4KP0A 3EAJA 3MH4A 2FEQH 5LPFA 4SGBE 1FZZA 1C5MD 3LC3A 1GI8B 5C20A 1AHTH 4NGAH 2FWWA 3TGKE 4I31A 1H9IE 1RS0A 2BY6X 1MKXH 2TGDA 2ZWLH 4TWWA 1GHAG 3QTVH 1SR5C 2UUFB 2OP9A 2QXGA 1O3KA 3ZZ8A 1UVPA 2FLRH 3D49H 5DK1A 2WPLS 1AZ8A 3MH6A 1C5LH 1C2FA 1AN1E 2FX4A 2NWNA 2GX4A 3A8DA 1Q2WA 3I77A 3TK5A 4R0IA 1OP8A 1YPKH 1GCTC 2GDDA 2ZPRA 1ELVA 4A7IB 5JBAS 1LMWB 4FUJA 1L4ZA 3SJ9A 1E35B 1K1LA 3T27A 3UY9A 4ZAEA 1UK3A 2XCNA 4IS5A 4CH2B 4ISHH 2ZHQH 3BG4B 2SGFE 1ELAA 2J34A 2AMDA 1A1RA 3ZZ3A 2TBSA 2FYQA 1THRH 1UTMA 1XX9A 3QUMP 3B23B 2ZCHP 1QBNA 4IMZA 2C8ZB 5C5NA 3KL6A 3KIDU 3SGQE 4ASHA 3RC6A 1HGTH 4OS4A 1HB0B 1V2OT 1JRSA 4WMFA 1EZSC 2VWMA 1YPGH 1FAKH 1AWHB 1NFYA 1TA2A 4AB8A 3CP7A 1GJCB 1P12E 1AGJA 4BAQB 1YPLH 4ISIH 1MAYA 4CRGA 4Q7XA 4FUEA 3E90B 3TJOA 2Y5GA 1EZXC 1GGDC 4ISLA 1DLKB 4DG4A 1DT2A 4AFSA 4B2CA 1SHHB 4E7NA 2THFB 2XC4A 2ZI2H 3BG4C 2ZNKH 5DJ7A 1Z8RA 1NFUA 3PM3A 2AIPA 1GJBB 1BTWA 4NIWA 3ATLA 3AAUA 2ZHFH 1C5SA 4XDEA 1OS8A 2V35A 2FS8A 2VH0A 3NUMA 3PV4A 3MNSA 3OY6U 3RXUA 1P03A 1YP9A 3RLWH 1GJ5H 2HNTF 1AKSA 4NWLA 2VGCB 1NM6A 1HBTH 3CS0A 3M7UA 2BDYA 1VZQH 1DM4B 5ESBA 1O2QA 4DOQA 3M61U 1O32A 3ZZAA 1C5ZB 2DUCA 1PPCE 3DHKH 3PMJA 4MNWA 1CVWH 1EP5A 1LVMA 3RXIA 3LGYA 2JH5D 1NRRH 2YNBA 5LPRA 1TMUH 3SU5A 1O2KA 1C5PA 2ANYA 2OUAA 1QRXA 3TK9A 1DS2E 3UNQA 2RG3A 1Q3XA 1S83A 1CHOF 2R3UA 2TGPZ 4NZQA 4IC5A 4NA8A 4ABJA 1L2EA 2D1JA 3SU0A 4ZKRU 4ISOA 2VWLA 3ZZ9A 4JZEH 4XBDA 3ATIA 1O5GH 2R0LA 2VGCC 1TX8A 2GZ8A 1W14U 2PUXB 1GBIA 2VNTA 1U6QA 1ELGA 5FHTA 1FIZA 4ABGA 2F9BH 1A5GH 2C93B 2EI8A 3ZZCA 1EASA 4ABAA 1TA6A 5FX5A 3BV9B 2B0FA 1O3PB 4D9QA 4E7RG 1C1QA 4RKOB 1O3GA 1YYY1 6GCHG 2BD5A 1GJ7B 2RDLA 3QN7A 4Y0YE 1W7XH 1TOMH 3QDZB 1GVKB 1X7AC 2XC5A 1C2EA 1QRWA 3HKJB 1BITA 5AVDA 5JB9S 5EU8A 1YBWA 1CU1A 1SGRE 2D26C 2XCFA 2H2ZA 4OS1A 1TNIA 1IQIA 4I8GA 3SI3H 1J8AA 5K7RA 2VIOA 2ODQA 1G36A 1ZHRA 3SHAH 3VPKA 3ZZ7A 1JOUB 4I8HA 2ZFPH 3UNSA 2Z3CA 3A8CA 5A2MH 1A4WH 3QZRA 1Z6EA 1YCPK 2GCHG 7GCHF 1O5BB 4AGJA 1DSTA 1F0RA 1Z1JA 1LKBA 1FPCH 3A8AA 4TYDA 2A4GA 3JZ2B 1EKBB 3MNXA 8GCHG 1F7ZA 4YZUA 3E3TA 4Q7YA 1SBWA 1DITH 2ZU1A 3KN2A 4WH6A 3RXLA 1XUGA 1C1RA 1W11U 1NRQH 1BCUH 1C4U2 2PLXA 5DKMA 3PO1B 4Q80A 2D2DA 3W94A 1G9IE 2WUBA 2A2QH 4YOIA 3WY8A 1DWDH 3VB4A 4AOQA 1KYNA 1GBEA 1GI3A 3BEIB 3IG6B 4WH8A 4A92A 2F9PA 4LK4A 4K3JA 4ZHMU 5LH8A 3TK6A 1Y3VA 1Q31A 3LC5A 4OS5A 4UEHH 4KGAA 1QY6A 3QO6A 4NIXA 2OLGA 5G4BA 3RXBA 2P95A 1QL8A 1LHDH 1WTHD 2R9PA 2ZU2A 1E38B 2GZ7A 4H4FA 1JBUH 3U1IB 1T8NA 1O30A 1FN8A 3LGVA 3RDZA 3TJUA 5GPIB 2EI6A 2Q1JA 1BRUP 2ZGXH 2BDGA 1O37A 2QCYA 1PYTD 1K2I1 2M5TA 3GYMA 2OCVB 1TRMA 1O5FH 4O97A 1H9HE 1EXFA 1NTPA 2F9OA 3BF6H 5IDKA 1C4V2 1BQYA 3PO1C 2RA0A 1OP2A 3F9GA 4ESTE 3STJA 3FFGA 2GT8A 1XUHA 5DP6A 2I6QA 3MH5A 1NROH 3SJIA 3SO3A 1AMHA 1HJAB 7KMEH 1WQVH 2ZKSA 4ZHAA 3M36A 2XYAA 4ZH8A 1OWKA 3BTEE 3U8RH 4BAHB 2VIPA 2BQWB 3ATKA 1WCZA 1THPB 3PROA 2R0KA 2BYAX 2WINI 3LT3A 1O2NA 2F3CE 3H7OA 3PTNA 4A5TS 3HGPA 1GHWH 3SI4H 1BMAA 1GI9B 5GIBA 3BTME 5J4QA 2VWNA 4B73A 2CF9H 1OP0A 1ESAA 1W12U 3LOXA 1G30B 1WQSA 1WTGH 3KHVA 5JB8S 1ANDA 1L1NA 3S69A 1VITG 5A8ZA 1V2PT 5EXLA 2Y6TA 4DURA 2ZCKP 4NSVA 5I25A 4RSPA 4F4OC 1VCQA 2W3IA 2ZC9H 2H5DA 3URDA 1LVBA 1O2MA 3P70B 1BRAA 1HJAC 1GDNA 5C3NA 1GMHF 1V2JT 1Z6JH 2ANKH 1DUAA 4Y8YA 3SUDA 3W95A 1C5RA 3D23A 1PPFE 3KEEA 3D65E 1B7XB 3A80A 1FUJA 1ZSKA 3KQCA 1V2ST 2Y82A 3GCHB 1MCTA 2BX3A 2ZIQH 1HCGA 1PPBH 4DT7B 3P8GA 2R2WU 1NU9A 1P0SH 2G81E 4K1EA 1O2IA 2ZA5A 5FBEA 1ZTJA 1XXFA 1HAXB 1UTPA 1WAYB 1HXFH 4X2VA 1GBDA 5FCRA 1AB9B 4BANB 3KQDA 3MTYA 3MU5A 1Z8GA 1V2RT 2ZQ2A 4AN7A 3S7HB 1AVXA 1E34B 3LU9B 1Z7KA 2G4TA 3I29A 5CHAB 2ZGBH 4IBLH 1UO6A 2AERH 3SNBA 4RN6A 5B6OA 2C4FH 3SJ8A 2PR3A 1A61H 3GCHC 4HTCH 1W3CA 3GCTF 3AASA 1VCPA 1OWHA 1NRNH 1BMLA 1H1BA 3RXJA 3GCNA 1N6YA 1HAGE 5FXLA 1AB9C 1TGNA 3QGJA 4IW4E 1TQ0B 1DLEA 1B5GH 1PQ5A 3A83A 1FDPA 3TVJB 2CGAA 2ZHDA 1TNLA 4D9RA 5LGOA 3RXVA 4XBCA 7ESTE 1AO5A 5A8XA 1HAIH 1MQ5A 1SFIA 5CHAC 3GOVB 5L2ZH 1KLJH 3A7ZA 2D8WA 1AVWA 1VCWA 2GMTB 1CQQA 4X6OA 3RU4D 2VVCA 3MU8A 1SQOA 4DY7B 2ZFQH 3A82A 4GAWA 2BDBA 2Z9GA 4R8TB 4AGKA 4X1RU 1GHBF 3TH3H 4CREA 3GDSA 1O3NA 4BAKB 5CMXH 1RFNA 2PKAA 2G4UA 2B7DH 2F91A 2GKVE 9ESTA 3FAOA 1ELCA 3EQ0H 2GGVB 1HIAB 5DO4H 1TRYA 2ZP0H 1XUFA 3F6UH 3SU4A 5JBTA 2CV3A 5JPMH 1K9OE 3ESTA 4INHA 3AVZA 1SMFE 1HUTH 1N8OB 2STBE 2GMTC 1FJSA 3ZVGA 1ACBE 4TWYA 4YM9A 3SJOA 1ZPBA 2HLCA 3O8DA 3E1XB 1OXGA 1SLVB 1W10U 1PFXC 3SUEA 1C1WH 1HAPH 1HAOH 5AF9H 2P3TB 1YPJH 1C2GA 1HPGA 2Y7ZA 4MG3A 3A85A 2STAE 1GJAB 4X8VH 5F8TA 4U2WA 2A5KA 3K2UA 1ZMLA 3VXEH 2Q6FA 1P04A 1K1MA 1CHOG 3SV2H 3R0FA 4K1SA 1FXYA 1O33A 4CH8B 1GMDF 1BT7A 1DWCH 3BTDE 3U1JB 1LHGH 4NFEA 1QL7A 3MU4A 3PLPA 2KAIA 4YOJA 1BZXE 1N8OC 2R2MB 3SU2A 2OC8A 1RJXB 2HNTE 4B74A 1Z8JB 3VFEA 1GHVH 2EI7A 2V6NA 1V2MT 4MPWA 1JIMA 3LPRA 1C1SA 3TJVA 2BDAA 1OWJA 2Z7FE 1OYTH 4LOYH 1S6FA 2VVUA 2XWBI 4TPIZ 2ZZUH 2SGEE 4FUGA 4XSKU 2OBQA 2ZG0H 1A5HA 4ABDA 2BLWA 1ESBA 3MH7A 1C1PA 1UCYK 2OC1A 5EOKA 2HWLB 2J92A 4Y6DA 1RGQA 3ZZ4A 3VGCB 3LGUA 3O8RA 2TGTA 2ZCLP 9LPRA 5JBCS 5EGMA 4A1XA 4Y76A 1C9TA 1WYKA 2H6MA 3KQBA 2BX4A 1GBMA 2CHAB 1JMOH 1P2IA 1V6DA 7GCHG 3T25A 1P2JA 3OYPA 2G52A 1Y5UT 1DFPA 2AGGX 1EJAA 2Q6DA 3TIUA 4I8LA 1LTOA 4X2YA 2CN0H 3O8CA 1MD7A 4X2WA 1EX3A 4AG1A 4MNXA 1GJ8B 2BOKA 1AD8H 3ZVEA 1TOCB 1ZSLA 1UHBB 4CR9A 4WY3A 2VU8E 1DSUA 4IN1A 1T4VH 2GTBA 4IN2A 3ZYDA 4AB9A 3VGCC 1ZZZA 3RXTA 3RM2H 3M3SA 4HGCA 3T29A 2PGQB 2ZGCA 4MQAA 2Y80A 2CHAC 3DUXH 2FLBH 2A7CA 1GI6A 2FTLE 1C5UA 1O2HA 3M35A 3MFJA 3DA9B 4RKJB 1S5SA 3K6YA 4NWKA 1V2LT 2BY5X 2C3SA 1CE5A 2FMJA 1RTLA 3SBKA 1TGTA 1WU1A 3RXDA 1TIOA 4UDWH 3TLOA 1OWDA 2NU0E 1O34A 4JCNA 1O3EA 2PW8H 3GCOA 2ZTYA 3MOCA 2FOGA 1FY8E 2BTCE 1EJMA 2GCTB 1TPSA 1F5LA 2PSYA 3C1KA 1DANH 4D7GA 3RP2A 1N6XA 4B75A 4CR5A 1LPZB 1AU8A 2Y5HA 1PPGE 3EE0B 1O31A 1GBJA 3RXMA 3Q3KA 1LKAA 4JMYA 1SLXB 3T26A 1O38A 5DG6A 1P05A 3BTHE 1QB9A 1KXDA 1GDUA 3PWCA 2WPKS 4IC6A 4ZUHA 1ELFA 3ZVDA 3BTQE 4I8KA 3ODFA 5TCCA 1EUFA 3UUZA 4UD9H 1G37A 1NESE 1BIOA 1F2SE 1DWEH 4YLUA 4YO9A 3RXFA 3SU6A 1ANBA 1DWBH 3K65B 2FIRH 3L3TA 1LHEH 1BBRE 2V0BA 4XFQA 3PTBA 4U30A 2Z3EA 1C5OH 3F1SB 4LZ4B 2ZHWH 1MTVA 3BEFB 1PYTC 5HM2A 2DE9A 2ZFFH 1GBAA 1C2KA 4FU8A 1SGDE 4AORA 4WVPE 5ESTE 1O2XA 1SGNE 1BBRH 1DOJA 3PMHB 1MD8A 3RMNH 1GBKA 2A7HA 3E0NB 4AFUA 2GD4B 4DIHH 2ZPQA 3S9CA 1TWXB 3RC5A 1T7CA 1IQMA 2ZDVH 5AFYH 3TJNA 1MZDA 3RXSA 2VB0A 1FPHH 1C9PA 3PMBB 1F5KU 1XUKA 1ELTA 1YPEH 2PWXA 1ZYOA 2WV4A 1PPEE 3SNAA 1AE8H 3GY8A 2ESTE 2FDAA 4FU7A 2BVXH 1D3DB 1GMCF 3QX5H 1CA0B 3ZVFA 5EQQA 1TNJA 4TPYA 4GCHF 3V3MA 3GICB 1GVZA 2ZFSA 3UNRA 5GCHF 4FVDA 1IQEA 5LPEA 3GCTG 1GBLA 1C5QA 1QURH 1GJDB 3NKKA 1T8LA 1IQHA 3AW0A 1HAYB 2Z9LA 4ZKOU 2QAAA 2SGAA 2IPHA 3HGNA 3TITA 1AY6H 1HJ8A 3SUGA 4BOHA 1TE0A 1O2ZA 4K69A 2ILNA 3RM0H 1ABIH 1O3MA 2XWAA 1V2TT 4X2XA 1DY8A 3FP6E 3HKIB 4Q7ZA 2SNWA 4KTCA 1KXEA 1XKBC 1CA0C 1TGSZ 2PFEA 1DDJA 1YF4A 1QHRB 1GBHA 3RXPA 3T62A 1TPAE 3I78A 1RXPA 3IITA 2W5EA 1GHBG 5DP7A 3M7QA 1EP6A 2P16A 1P2OA 2FOCA 1Z1IA 2VIVA 2FOMB 4INKA 5DPAA 4DJZB 3NK8A 1UK4A 2GT7A 4BXWA 4ZHLU 3A88A 1DY9A 1NZQH 4FXGH 3SNDA 2PUQH 1EQ9A 5T3HA 1EAIA 1NU7B 3SGAE 3RMLH 1NS3A 2B9LA 1MKWK 5HGGA 1O2OA 1YPHE 3N7OA 3TH2H 2TIOA 2BXUH 5DP4A 1TX6A 3GDUA 3MI4A 1E37B 2XNIA 5F6MA 1QB6A 1OKXA 2PV9B 4Y8XA 1BOQA 4O9VA 1AFQB 2TRMA 3OTJE 1C2LA 4E05H 4NIVA 5TJXA 2AMPA 4K8BA 2CMYA 1GMDG 1XVOA 1TAWA 4BNRA 3QK1A 4CRCA 2O8MA 2O8LA 5GJ4B 2PHBA 1IQLA 1VJAU 1FMGA 4O3TA 1BTXA 2P93A 1BRBE 4QT8C 2FI3E 1TBRH 1THSH 2CXVA 3VB3A 3ZV8A 4BAOB 4VGCB 1D6WA 3M5MA 2GVFA 3QLPH 1AFQC 1ZTKA 2QY0B 1ZRBA 2EC9H 5C5OA 2BD8A 1K1NA 3FANA 2FZZA 1EB1H 2ZGHA 3SGBE 2ZFRH 3UQOA 2QIQA 5GDSH 4MNYA 3SZNA 3P6ZB 3ATMA 2Y7XA 1Y3UA 1XMNB 1O0DH 2FTMA 3MO6A 4OS2A 4X1PU 2NU1E 3U69H 1BJVA 1O2RA 1C1OA 1SQAA 1IAUA 1G3CA 1O5DH 1PPHE 1KDQB 3RXGA 5GXPA 3HATH 2BVSH 1TFXA 3JZ1B 1D4PB 4FU9A 3ENSB 2ZPSA 4AYYB 1A7SA 1P2KA 3O8BA 1O3HA 5HXFA 4CRAA 1FN6A 2Q6GA 1MAXA 1G32B 4VGCC 1MTNB 1SGFA 1UTNA 4WXVA 3HK3B 5BPEA 4X1SU 4X6MA 1QFKH 4WJG2 4Y71A 1P09A 3AW1A 4DIIH 2VVVA 3UIRA 3F9FA 2OQ5A 1DICA 3Q00A 1A0HB 3SV6A 5A8YA 2BD7A 5PTPA 5HYOA 3SW2B 1FONA 2O8TA 1C1NA 3BTGE 2ZFTA 4JYVH 3SUFA 3UWJH 1LVYA 3BTWE 3RXRA 3EDXB 3ELAH 1O2VA 3E0PB 2VJ1A 4Y10E 1QQUA 3KCGH 2BQ6B 2J9NA 2TGAA 1VGCB 4NG9H 1MTNC 1NRSH 1BMNH 1BB0B 2QN5T 1CSOE 1CHGA 1CBWB 1SL3A 3L33A 1B0EA 1BHXB 1P01A 4I33A 3UREA 1Y5BT 1HFDA 1HAVB 3FZZA 3SU3A 4BTIB 3A7XA 5F03A 3B9FH 1W7GH 4M7GA 8KME2 3IWMA 1MKXK 1WUNH 3FP7E 4NCYA 2XBVA 5E0JA 1C5YB 1UVOA 5E2OA 2H9HA 2HGTH 3G01A 1EPTB 1C2DA 1EAUA 1AUTC 2P3UB 1BMMH 2CJIA 4I8JA 2PKSB 3FZDA 2WPMS 1WBGB 2H1UA 1TGCA 1GG6B 2PSXA 1VGCC 4OS6A 1NO9H 3EA9A 1MTSA 2UWOA 1S82A 4H42U 1IQNA 1SG8B 1QB1A 1O35A 1T31A 1PQ8A 2XBWA 3M3VA 2XC0A 2AYWA 1G2LA 4YOGA 1FI8A 1YLDA 5A0AE 3ZVAA 2BD3A 1BTUA 1L1GA 1G3DA 1O3LA 1EPTC 1O3JA 3A7WA 3GY3A 1FNIA 2C8XB 2V3HH 1TGBA 1KXAA 3A81A 2PKSC 1YCPH 3U8TH 1F0TA 3MO9A 1Y3YA 1UK2A 5L30H 3M5OA 3QZQA 1SOTA 4X6PA 2BD9A 1S81A 2FOBA 5AFZH 4X1NU 1GG6C 1TYNA 3NPSA 2FODA 4HI3A 4MDSA 3UFAA 1GDQA 4BTTB 2OTVA 3OSYA 1D6RA 4XBBA 1O2TA 5CE1A 1SGIB 3LKWA 1SOZA 1A5IA 1T4UH 4YT6H 1ELEE 4D8NA 5EODA 5EQSA 1ANCA 1G2MA 1OX1A 1ORFA 1O2JA 1DPOA 4Y7BA 3GY7A 3QGNB 1LDTT 2GCHF 5EPNA 5FPTA 1QJ6B 4KTSA 3RUOA 2ODYB 3A8BA 1OSSA 1LQEA 1INCA 2A31A 3P92A 3ZZ6A 2SGPE 5TCAA 4MVNA 2P59A 2LNCA 1GMCG 2W7SA 5FCKA 1ZJKA 1OYQA 1KLTA 4FUDA 3P17H 2SFAA 3DFLA 2BD4A 5A0BA 4Q2KA 3GY5A 3P8NA 4MNVA 5GCHG 5A09A 1L0ZA 2PTCE 4CRDA 1CT2E 3BIVH 3M37A 1JRTA 5T6DA 2VIDA 1SI5H 5EQRA 3OU0A 1LO6A 2QV1A 1QR3E 2NU4E 1ZLRA 2Z9KA 1V2UT 1CA8B 1NC6A 2WUCA 1L1JA 1AI8H 1TB6H 1FLEE 1GL1A 4ISNA 2QA9E 2JKHA 2ZTXA 2QYIA 1O36A 4X1QU 1J16A 1O2GH 2WPHS 4JZDH 3TGJE 5EW2H 2FOHA 2UUJB 2UWPA 3VB7A 3EA8A 1ETTH 4UFDH 1DX5M 1MU8B 1P57B 3GY2A 1GJ6A 1GHZA 2VIWA 2HPQH 1C5NH 2VWOA 1NFWA 3TH4H 1FIWA 4OGXA 2PTNA 2ASUB 4YT7H 2IOTA 4JK5A 1KIGH 4GLYA 1FY3A 3R3GB 4THNH 1D3QB 1MCVA 3ZVBA 4JZIA 1TONA 4X8SH 1OWEA 2FI5E 4D7FA 3CENA 1ELDE 4AFQA 2C90B 1V2WT 2GV6A 6CHAB 1P9UA 2Z9IA 1O3OA 1ZHMA 4IMQA 1GBTA 2WYGA 2QXHA 4OGYA 2J94A 4B1TA 2B8OH 1UMAH 1ZSJA 4A6LA 2J38A 2P94A 3V13A 4WXIA 1EATA 2OC0A 1BDAA 1HLTH 2BZAA 2F83A 1C1VH 2Y81A 1AVGH 1J15A 3MHWU 1EAXA 2A4QA 1GVLA 1ETSH 1SGCA 3UR9A 4ZKSU 2BXTH 2XRCA 1HIAA 3SORA 2XXLA 1N1LA 1QJ7B 1OPHB 3RXOA 2BM2A 1Z71A 1AKSB 3OY5U 4O03A 3H5CB 4X8UH 4FUBA 1K1JA 2FS9A 3SNCA 6CHAC 1TNKA 3KNXA 2A0QB 1M9UA 1IOEA 2ZGJA 3M5LA 4CRFA 4AZ2B 1L4DA 4PROA 1ZJDA 2TPIZ 1GCTB 3UOPA 2OINA 1P2MA 4CHAB 1VR1H 2Z6BD 1C1TA 3MYWA 1TMBH 1UTLM 2W26A 1TPOA 4CRBA 1P02A 1YPMH 3Q76A 3SV9A 1AFEH 3VXFH 1TABE 3Q3XA 4NSYA 5DP5A 3HPTB 1CGJE 4E06H 1K21H 3BTFE 3UR6A 2Y5FA 3FVFB 6ESTA 5DGJA 1HAZB 1PQAA 4BTUB 2BD2A 2OQUA 2JH0D 1BJUA 1LPKB 1Y5AT 4K2YA 5DP8A 2QXIA 2BQ7B 1O39A 1BA8B 1RTFB 1MTUA 3MNCA 1C5TA 4H6TA 3BN9A 1DUEA 1P2NA 2HNTC 2FOEA 3S9BA 2BDCA 2FI4E 4OS7A 1GGDB 4CHAC 3D62A 2G8TA 3GISB 2FXRA 1SGFG 2BY9X 3KQEA 3A7YA 2SGQE 2ZF0H 1JIRA 3PB1E 4ZMAH 1ZPZA 2GCTC 4JYTA 4WF8A 3GY6A 4DVAU 1C4Y2 2QF3A 4Y0ZE 1ANEA 1FAXA 3RXCA 1EOJA 4I32A 2ZDKA 1P06A 1WSSH 3A7TA 1PPZA 3PMAB 1GMHG 1O2PA 1ETRH 4MPVA 2G5VA 3BTKE 4NZLA 1FY1A 3FP8E 2BDHA 2WYJA 2HVXA 2XW9A 2UWLA 1V2QT 1Y3XA 4B2BA 1TPPA 2W3KA 4BAMB 1AIXH 2A5AA 1FV9A 1XKAC 2VH6A 5K0HA 3RXAA 1JWTA 4ABBA 4X0WU 4X6NA 5HM9A 1J17T 1G3BA 3STIA 1WOFA 3GYLB 5JYIA 2DE8A 4WMEA 1UHBA 4IGDA 1HV7A 1ABJH 3A86A 1A2CH 3RU4E 1BUIA 3ODDA 4K1TA 1IQFA 1QGFA 3A7VA 1ZOMA 3A89A 4YLQH 1QBVH 3S0NA 2G5NA 5BRRE 4UFGH 1BTZA 5IYTA 2VINA 2ZDNA 1EOLA 1K28D 2FESH 5F8ZA 4GHQA 1NY22 1NFXA 2Z94A 1YCPM 3LGTA 4AG2A 3ZZDA 4AX9H 3K9XB 1MU6B 4LXBH 4A1TA 1QA7A 3T5FH 5JBBS 1IHTH 1EZUC 1UCYE 2ZU4A 1T8MA 2PGBB 1P3CA 1KSNA 1RRKA 4FUCA 2HALA 1GI5A 1SVPA 1UTQA 1P11E 3ZZBA 2OD3B 4KELA 4JZFH 2BLOA 3M7TA 5A0CA 1H8IH 3SV7A 1KTTB 1ZR0A 1MQ6A 1C5WB 2UUKB 3DD2H 1QQ4A 3AAVA 1TX7A 3VB5A 3P8FA 5FX6A 1KLIH 2ZECA 5C67A 1UCYH 4WWYA 3S9AA 3U98H 1KXBA 2QC2A 2BZ6H 4FUHA 4JZ1A 3URCA 1S85A 4H6SB 3E8LA 4J1YA 1C2HA 1NPMA 2AGEX 5SGAE 4GUXA 3GDVA 1GI0A 1GBFA 3PLBA 1UVTH 1RD3B 1ZTLA 3OX7U 1O3IA 3TNTA 3DFJA 3BSQA 2ZDLA 1SQTA 1VJ9U 2F9NA 5DP3A 5C1XA 1KY9A 1Y3WA 2RCEA 1AWFH 1TRNA 1C5XB 1EJNA 1JXPA 1W13U 2FO9A 1QTFA 1H4WA 2ZTZA 1ZMJA 4FUFA 1V2KT 1XXDA 2WPIS 2BLQA 5GWZA 1YM0A 1A0LA 1AZZA 4B71A 2BOHB 1O3CA 4Y11E 1KXFA 1HDTH 3ITIA 2BDIA 1D9IA 4ABFA 1CT4E 1K1OA 1MH0A 1ELBA 2UUYA 1HYLA 3E6PH 5EXNA 1IQKA 1O2SA 1GBCA 1GL0E 3P95A 4ZXYH 1FY5A 1SGYE 2F9UA 1MUEB 3ATWA 3GY4A 1SSXA 4GSOA 1LPGB 1SPJA 1ZGVA 1GWAA 4XOJA 1CT0E 5F8XA 2K1QA 2WPJS 1LQDB 5H4IB 1D3TB 4NIYA 3MNBA 1XUJA 1O5EH 4ABIA 2H5CA 1GHXH 2ALPA 3S7KB 1LCYA 1YC0A 4CBOA 3LH3A 1V2NT 1O2LA 2GV7A 4NA7A 1LHFH 3LGIA 1FY4A 1ZMNA 3RXHA 2LPRA 1LHCH 1S0QA 1GHAF 2FP7B 5E0HA 5FBIA 2AFQB 2Z9JA 1LVOA 1HJ9A 1ARBA 1O3AA 3TNSA 2RA3A 3MO3A 3T2NA 1RTKA 2Z3DA 1TNHA 2XBXA 1QCPA 3EGKH 3RMMH 4D76A 1TNGA 3A87A 3U9AH 2WV5A 5C1UA 1ZPCA 2ANWA 2J4IA 2YNAA 4LZ1H 1TQ7B 1NRPH 4A1VA 4SGAE 4UE7H 1W0ZU 1P2QA 3L6PA 2ZEBA 4I7YH 1Y8TA 3LJOA 2G55A 1EAWA 5HMAA 4HFPB 1UVUH 4MLFB 3M3TA 1SGQE 1AUJA 1FQ3A 5C2ZA 1UVSH 2QF0A 4K8YA 2OBOA 1NT1A 1SGEE 1SB1H 1ZRKA 4GVUA 2JH6D 2ZDMA 2OXSA 1SC8U 1E36B 2O9QA 4KKDA 3LONA 1GI1A 1HRTH 8LPRA 1P8VC 2V3OH 2PKAB 3QWCH 1QBOA 2ZU3A 1F0SA 2NU2E 2AH4X 4HZHA 2QXJA 1QA0A 2A32A 2FYRA 5EPYA 2OC7A 1A3EH 1SHYA 4Y8ZA 4YESB 1O5AB 3E16B 1SLUB 2O8UA 1SGTA 1GBBA 3SQHE 3TU7H 1P9SA 2BY8X 1K22H 3NWUA 1YLCA 3SU1A 1YKTA 1K1IA 3K6ZA 3MWIU 3VEQB 1QL9A 2J2UA 2BHGA 1H8DH 2A4RA 2ZU5A 4MPXA 1H9LB 1W0YH 1YGCH 1P3EA 3C27B 3LGWA 1C2JA 1PQ7A 3ZYEA 3SQEE 2FM2A 1RIWB 2EA3A 4UFEH 3UPEA 1YPHC 2XBYA 5DP9A 1QNJA 2A45B 3V12A 1DXWA 1C2MA 4K60A 1XM1A 3Q77A 4AYVB 2JETB 2BY7X 1CGIE 3UWIA 4ZROA 1KXCA 3NZIA 4GPGA 1GHYH 1V2VT 5L6NH 4YTAA 2KAIB 3RLYH 2GZ9A 2IN2A 3ZVCA 1Y59T 2CF8H 3BEUA 1D3PB 3ZZ5A 3T28A 3UOUA 3BIUH 5EW1H 1O5CB 1O3FA 4Z6AH 8ESTE 5ABWA 1IHSH 1ARCA 2ZQ1A 1BTPA 1DXPA 3VB6A 4ABHA 1IQGA 1MBMA 1RIWC 4NA9H 3RXKA 2A5IA 2BMGB 1O3BA 1UTKA 1SLWB 1TMTH 1CBWC 5FPSA 1VITH 4INLA 2H9TH 2FOFA 3ZV9A 1S6HA 1MZAA 2ODPA 4J2YB 1F92A 1C1UH 1QJ1B 2SNVA 2JETC 4JYUH 1CO7E 3KGPA 3QTOH 1HAHH 1J9CH 1O2WA 2ULLA 1V3XA 2FX6A 2H9EH 3M5NA 5L2YH 1A3BH 3HK6B 3MU0A 5JDUB 1O2UA 1T8OA 3BG8A 5FPYA 1GCDA 5E8EH 2FOAA 4DGJA 5EXMA 6GCHF 4TY6A 2FPZA 4DW2U 1KDQA 3PLKA 4ZKNU 3LIWA 2A7JA 2VIQA 5T6GA 3PWBA 1W8BH 3SV8A 4WMDA 4JK6A 1XUIA 1GI7B 1EB2A 3EYDA 2F9VA 5EG4A 1MKWH 3UTUH 4Y79A 2AGIX 2ZHEH 3A84A 2BLVA 4NFFA 3LH1A 1E0FD 3NXPA 1OOKB 2G51A 2ANMH 5FAHA 1ZHPA 3MU1A 2A4OA 1UTJA 3RU4T 1ZGIA 3KF2A 4UFFH 3TGIE 2XTTB 1BTYA 4U32A 2J95A 3LJJA 1BBRK 3SJKA 4FUIA 8GCHF 1MMJN 3CS7A 2AEIH 1NN6A 6LPRA 3RMOH 1IQJA 1O3DA 3E91A 2NU3E 3PYHA 4GCHG 1BHXF 2R3YA 1OWIA 1SFQB 2HPPH 5T6FA 4Z0KA 2AMQA 3H7TA 2O8WA 5E0GA 1ESTA 2HOBA 1B0FA 2A2XH 2AS9A 3SOSA 1MBQA 2BB4A 1C5VA 4UONA 2EEKA 3F9HA 5C1YA 3U8OH 1HAVA 1W2KH 1BRCE 1F5RA 4X8TH 1ID5H 1TBQH 4O3UA 5I46H 2YOLA 3SN8A 4B76A 4TY7A 3B8JA 2C8YB 4MTBA 1C1MA 3BTTE 3Q3YA 1G3EA 2AIQA 1EPTA 4FVBA 1XVMA 2ZO3H 3DT0H 4DCDA 2SGDE 2GP9B 3F68H 3RC4A 3SNEA 1GPZA 4ZXXH 2B5TB 1F0UA 1HXEH 1S84A 4B2AA 2P8OB 4Y7AA 1J14A 2P3FH 1GI4A 1SGPE 3UQVA 1GJ9B 1DE7H 3MMGA 3V0XA 1KTSB 1CGHA 4BXSA 1MTWA 1QIXB 1A0JA 1TALA 4AFZA 4KTUA 1UTOA 1A46H 2ZDAH 1GJ4H 1QRZA 1WV7H 1GI2A 3F9EA 1P10A 2C8WB 5ETXA 4F49A 2A1DB 5AHGH 2QGRA 1T32A 4U01A 2IJOB 1AE5A 3EA7A 1Z8IB 3RXQA 4K5ZA 3SHCH 1TLDA 1AQ7A 1HNEE 2W7UA 1EZQA 4CBNA 5E2PA 3RXEA 4MPUA 4ABEA 5J4SA 2BVRH 2GDEH 7LPRA 3V7TA 2P8OC 3TPIZ 1S0RA 1VITF 1C2IA 2G00A
chains in the Genus database with same CATH superfamily
3NCLA 4XE4A 1BTHH 1O2YA 2I6SA 3LDXH 2HRVA 1DVAH 1TBZH 3P8OA 1PJPA 1UJ1A 4GHTA 5HIZA 1K1PA 2ALVA 4KP0A 3EAJA 3MH4A 2FEQH 5LPFA 4SGBE 1FZZA 1C5MD 3LC3A 1GI8B 5C20A 1AHTH 2RFKC 4NGAH 2FWWA 2KCOA 3TGKE 4I31A 1H9IE 1RS0A 3KQ5A 2BY6X 1MKXH 2TGDA 2ZWLH 4TWWA 1GHAG 3QTVH 1SR5C 2UUFB 3WWBA 2OP9A 2QXGA 1O3KA 3ZZ8A 1UVPA 2FLRH 3D49H 5DK1A 2WPLS 1AZ8A 3MH6A 3UB0A 1C5LH 1C2FA 1AN1E 2FX4A 2NWNA 4ASUD 2GX4A 3A8DA 1Q2WA 3I77A 3TK5A 4R0IA 1OP8A 1YPKH 1GCTC 2GDDA 4FOUC 2ZPRA 1ELVA 4A7IB 5JBAS 1LMWB 4FUJA 1L4ZA 3SJ9A 1E35B 1K1LA 3T27A 3UY9A 4ZAEA 1UK3A 2XCNA 4IS5A 4CH2B 4ISHH 2ZHQH 3BG4B 2SGFE 1ELAA 2J34A 2AMDA 1A1RA 3ZZ3A 2TBSA 2FYQA 1THRH 1UTMA 1XX9A 3QUMP 3B23B 2ZCHP 1QBNA 2WV9A 4IMZA 2C8ZB 5C5NA 3KL6A 3KIDU 3SGQE 4ASHA 3RC6A 1HGTH 4OS4A 1HB0B 1V2OT 1JRSA 4WMFA 1EZSC 2VWMA 1YPGH 4OM9A 1FAKH 1AWHB 1NFYA 1TA2A 4AB8A 3CP7A 1GJCB 1P12E 1AGJA 4BAQB 1W0JD 1YPLH 4ISIH 1MAYA 4CRGA 3OTPA 4FUEA 3E90B 4Q7XA 3TJOA 2Y5GA 2KZ4A 1EZXC 5KEDA 1GGDC 4ISLA 1DLKB 4DG4A 1DT2A 4AFSA 4B2CA 1SHHB 4E7NA 2THFB 2XC4A 2ZI2H 3BG4C 2ZNKH 5DJ7A 1Z8RA 1NFUA 3PM3A 2AIPA 4RI0A 1GJBB 1BTWA 4NIWA 3ATLA 3AAUA 2ZHFH 1C5SA 4XDEA 1OS8A 2V35A 2FS8A 2VH0A 3NUMA 3PV4A 3MNSA 3OY6U 3RXUA 1P03A 1YP9A 3RLWH 1GJ5H 2HNTF 1AKSA 4NWLA 2VGCB 1NM6A 1HBTH 3CS0A 3M7UA 2BDYA 1VZQH 1DM4B 1SQRA 5ESBA 1O2QA 4DOQA 3M61U 1O32A 3ZZAA 1C5ZB 4HG6A 2DUCA 1PPCE 3DHKH 3PMJA 4MNWA 1CVWH 1EP5A 1LVMA 3RXIA 3LGYA 2JH5D 1NRRH 2YNBA 5LPRA 1TMUH 3SU5A 1O2KA 1C5PA 2ANYA 2OUAA 1QRXA 3TK9A 1DS2E 3UNQA 2RG3A 1YWUA 1Q3XA 1S83A 1CHOF 2R3UA 2TGPZ 4NZQA 4IC5A 4NA8A 4ABJA 1L2EA 2D1JA 3SU0A 4ZKRU 4ISOA 2VWLA 3ZZ9A 4JZEH 4XBDA 3ATIA 1O5GH 2R0LA 2VGCC 2QF4A 1TX8A 2GZ8A 1W14U 2PUXB 1GBIA 2VNTA 1U6QA 1ELGA 5FHTA 1FIZA 4ABGA 2F9BH 1A5GH 2C93B 2EI8A 3ZZCA 1EASA 4ABAA 1TA6A 5FX5A 3BV9B 2B0FA 1O3PB 4D9QA 4E7RG 1C1QA 4RKOB 1O3GA 1YYY1 6GCHG 3MQKC 2BD5A 1GJ7B 2RDLA 2K8IA 3QN7A 4Y0YE 4TSFD 1W7XH 1TOMH 3QDZB 1GVKB 2CK3D 1X7AC 2XC5A 1C2EA 1QRWA 3HKJB 1BITA 5AVDA 5JB9S 5EU8A 1YBWA 1CU1A 1SGRE 2D26C 2XCFA 2H2ZA 4OS1A 1TNIA 1IQIA 4I8GA 3SI3H 1J8AA 5K7RA 2VIOA 2ODQA 1G36A 1ZHRA 3SHAH 3VPKA 3ZZ7A 1JOUB 4I8HA 2ZFPH 3UNSA 2Z3CA 3A8CA 4AC9A 5A2MH 1A4WH 3QZRA 1Z6EA 1YCPK 2GCHG 2KX4A 7GCHF 1O5BB 4AGJA 1DSTA 1F0RA 1Z1JA 1LKBA 5DN6D 1FPCH 3A8AA 4TYDA 2A4GA 3JZ2B 1EKBB 3MNXA 8GCHG 1F7ZA 4YZUA 3E3TA 3FN8A 4Q7YA 1SBWA 1DITH 2ZU1A 3KN2A 4WH6A 3RXLA 1XUGA 5C17A 1C1RA 1W11U 1NRQH 1BCUH 1C4U2 2PLXA 5DKMA 3PO1B 4Q80A 2D2DA 3W94A 1G9IE 2WUBA 2A2QH 4YOIA 3WY8A 1DWDH 3VB4A 4AOQA 1KYNA 1GBEA 1GI3A 3BEIB 3IG6B 4WH8A 4A92A 2F9PA 4LK4A 4K3JA 4ZHMU 5LH8A 3TK6A 1Y3VA 1Q31A 3LC5A 4OS5A 4UEHH 4KGAA 1QY6A 3QO6A 4NIXA 2OLGA 5G4BA 3RXBA 2P95A 1QL8A 1LHDH 1WTHD 2R9PA 2ZU2A 2LP6A 1E38B 2GZ7A 4H4FA 1JBUH 3UAIC 3U1IB 1T8NA 1OHHD 1O30A 1FN8A 3LGVA 3RDZA 3TJUA 5GPIB 2EI6A 2Q1JA 1BRUP 2ZGXH 2BDGA 1O37A 2QCYA 1PYTD 1K2I1 2M5TA 3GYMA 2OCVB 1TRMA 1O5FH 4O97A 1H9HE 1EXFA 1NTPA 2F9OA 3BF6H 5IDKA 1C4V2 1BQYA 3PO1C 2RA0A 1OP2A 3F9GA 4ESTE 3STJA 3FFGA 1W0KD 2GT8A 1XUHA 5DP6A 2I6QA 3MH5A 1NROH 3SJIA 3SO3A 1AMHA 1HJAB 7KMEH 1WQVH 2ZKSA 4ZHAA 3M36A 2XYAA 4ZH8A 1OWKA 3BTEE 5GNDA 3U8RH 4BAHB 2VIPA 2BQWB 3ATKA 1WCZA 1THPB 3PROA 2R0KA 2BYAX 2WINI 3LT3A 1O2NA 2F3CE 3H7OA 3PTNA 4A5TS 3HGPA 1GHWH 3PRBA 3SI4H 1BMAA 1GI9B 5GIBA 3BTME 5J4QA 2VWNA 4B73A 2CF9H 1OP0A 1ESAA 1W12U 3LOXA 1G30B 1WQSA 1WTGH 3KHVA 5JB8S 1ANDA 1L1NA 3S69A 1VITG 5A8ZA 1V2PT 5EXLA 2Y6TA 4DURA 2ZCKP 4NSVA 5I25A 4RSPA 4F4OC 1VCQA 2W3IA 2ZC9H 2H5DA 3URDA 1LVBA 2L6OA 1O2MA 3P70B 1BRAA 1HJAC 1GDNA 5C3NA 1GMHF 1V2JT 1Z6JH 2ANKH 1DUAA 4Y8YA 3SUDA 3W95A 1C5RA 3D23A 1PPFE 3KEEA 3D65E 1B7XB 3A80A 1FUJA 1ZSKA 3KQCA 1V2ST 2Y82A 3GCHB 1MCTA 2YMSD 2BX3A 2ZIQH 1HCGA 1PPBH 4DT7B 3P8GA 2R2WU 1NU9A 1P0SH 2G81E 4K1EA 1O2IA 2ZA5A 5FBEA 1ZTJA 4B6FA 1XXFA 1HAXB 1UTPA 1WAYB 1HXFH 4X2VA 3KYFA 1GBDA 5FCRA 1AB9B 4BANB 3KQDA 5CDFE 3MTYA 3MU5A 1Z8GA 1V2RT 2ZQ2A 4AN7A 3S7HB 1AVXA 1E34B 3LU9B 4P00A 1Z7KA 2G4TA 3I29A 5CHAB 2ZGBH 4IBLH 1UO6A 2AERH 3SNBA 4RN6A 5B6OA 2C4FH 1NBME 4XD7D 3SJ8A 2PR3A 1A61H 3GCHC 4HTCH 3EE7A 1W3CA 4F48B 3GCTF 3AASA 1VCPA 1OWHA 1NRNH 1BMLA 1H1BA 3RXJA 2W6ID 3GCNA 1N6YA 1HAGE 5FXLA 1AB9C 1TGNA 3QGJA 4IW4E 1TQ0B 1DLEA 1B5GH 1PQ5A 3A83A 1FDPA 3TVJB 2CGAA 2ZHDA 1TNLA 4D9RA 5LGOA 3RXVA 4XBCA 7ESTE 1AO5A 5A8XA 1HAIH 1MQ5A 1SFIA 5CHAC 3GOVB 5L2ZH 1KLJH 3A7ZA 2D8WA 1AVWA 1VCWA 2GMTB 1CQQA 4X6OA 3RU4D 2VVCA 3MU8A 1SQOA 3OFND 4DY7B 2ZFQH 3A82A 4GAWA 2BDBA 2Z9GA 4R8TB 4AGKA 4X1RU 1GHBF 3TH3H 4CREA 3GDSA 1O3NA 4BAKB 5CMXH 1RFNA 2PKAA 2G4UA 2B7DH 2F91A 2GKVE 9ESTA 3FAOA 1ELCA 3EQ0H 2GGVB 1HIAB 5DO4H 2F43B 3DCLA 1TRYA 2ZP0H 1XUFA 3F6UH 3SU4A 5JBTA 2CV3A 5JPMH 1K9OE 3ESTA 2JJ1D 4INHA 3PRDA 3AVZA 1SMFE 1HUTH 1N8OB 2STBE 2GMTC 1FJSA 3ZVGA 1ACBE 4TWYA 4YM9A 3SJOA 1ZPBA 2HLCA 3O8DA 3E1XB 1OXGA 1SLVB 1W10U 1PFXC 3SUEA 1C1WH 1HAPH 1HAOH 5AF9H 2P3TB 1YPJH 1C2GA 1HPGA 2Y7ZA 2QF5A 4MG3A 3A85A 2STAE 1GJAB 4X8VH 5F8TA 4U2WA 2A5KA 3K2UA 1ZMLA 3VXEH 2Q6FA 3NRLA 1P04A 1K1MA 1CHOG 3SV2H 3R0FA 4K1SA 1FXYA 1O33A 4CH8B 1GMDF 1BT7A 1DWCH 3FO8D 3BTDE 3U1JB 1LHGH 4NFEA 3F2HA 1QL7A 3MU4A 3PLPA 2KAIA 4YOJA 1BZXE 1N8OC 2R2MB 3WWFA 3SU2A 2OC8A 1RJXB 2HNTE 4B74A 1Z8JB 3VFEA 1GHVH 2EI7A 2V6NA 1V2MT 4MPWA 1JIMA 3LPRA 1C1SA 3TJVA 2BDAA 1OWJA 2Z7FE 1OYTH 4LOYH 1S6FA 2VVUA 2XWBI 4TPIZ 2ZZUH 2SGEE 4FUGA 4XSKU 2OBQA 2ZG0H 1A5HA 4ABDA 2BLWA 1ESBA 3MH7A 1C1PA 1UCYK 2OC1A 5EOKA 2HWLB 2J92A 4Y6DA 1RGQA 2J98B 3ZZ4A 3VGCB 3LGUA 3O8RA 2TGTA 2ZCLP 9LPRA 5JBCS 5EGMA 4A1XA 4Y76A 1C9TA 1WYKA 2H6MA 3KQBA 2JJ2D 3U28C 2BX4A 1GBMA 2CHAB 1JMOH 4F55A 1S6LA 1P2IA 1V6DA 7GCHG 1SKYE 3T25A 1P2JA 3OYPA 2G52A 1Y5UT 1DFPA 5KGOA 2AGGX 1EJAA 2Q6DA 3TIUA 4I8LA 1LTOA 4X2YA 2CN0H 2IPQX 1MD7A 3O8CA 4X2WA 1EX3A 4AG1A 4MNXA 1GJ8B 2BOKA 1AD8H 3ZVEA 1TOCB 1ZSLA 1UHBB 4CR9A 4WY3A 2VU8E 1DSUA 4IN1A 1T4VH 2GTBA 4IN2A 3ZYDA 4AB9A 3VGCC 1ZZZA 3RXTA 3RM2H 3M3SA 4HGCA 4P02A 3T29A 2PGQB 2ZGCA 4MQAA 2Y80A 2CHAC 3DUXH 2FLBH 4Q4LA 2A7CA 1GI6A 2FTLE 1C5UA 1O2HA 3M35A 3MFJA 1E79D 3DA9B 4RKJB 1S5SA 3K6YA 4NWKA 1V2LT 2BY5X 2C3SA 1CE5A 2FMJA 1RTLA 3SBKA 1TGTA 1WU1A 3RXDA 1TIOA 4UDWH 3TLOA 1OWDA 2NU0E 1O34A 4JCNA 1O3EA 2PW8H 3GCOA 2ZTYA 3MOCA 2FOGA 1FY8E 2BTCE 1EJMA 2GCTB 1TPSA 1F5LA 2PSYA 3C1KA 1DANH 4D7GA 3RP2A 1KMHB 1N6XA 4B75A 4CR5A 1LPZB 1AU8A 2Y5HA 5C0UA 1PPGE 3EE0B 1O31A 1GBJA 3RXMA 3Q3KA 1LKAA 4JMYA 1SLXB 3T26A 1O38A 5DG6A 1P05A 3BTHE 1QB9A 1KXDA 1GDUA 3PWCA 2WPKS 4IC6A 4ZUHA 1ELFA 3ZVDA 3BTQE 4I86A 3ODFA 4I8KA 5TCCA 4Z1MD 1EUFA 3UUZA 4UD9H 1G37A 1NESE 1BIOA 3DSPA 1F2SE 1DWEH 4YLUA 4YO9A 3RXFA 3SU6A 1ANBA 1DWBH 3K65B 2FIRH 3L3TA 1LHEH 1BBRE 5F53A 2V0BA 4XFQA 3PTBA 4U30A 2Z3EA 1C5OH 3F1SB 4LZ4B 2ZHWH 1MTVA 3BEFB 2JIZD 1PYTC 5HM2A 2DE9A 2ZFFH 1GBAA 1C2KA 1WDIA 4FU8A 1SGDE 4AORA 4WVPE 5ESTE 1O2XA 1SGNE 2GJGA 1BBRH 1DOJA 3PMHB 1MD8A 3RMNH 1GBKA 2KFWA 2A7HA 3E0NB 1MABB 4AFUA 2GD4B 4DIHH 2ZPQA 3S9CA 1TWXB 1H8HD 1E1RD 3RC5A 1NBMD 1T7CA 1IQMA 2ZDVH 5AFYH 3TJNA 1MZDA 3RXSA 2YMSB 2VB0A 1FPHH 1C9PA 3PMBB 1F5KU 1XUKA 1ELTA 1YPEH 2PWXA 1ZYOA 2WV4A 1PPEE 3SNAA 1AE8H 3GY8A 2ESTE 2FDAA 4FU7A 2BVXH 1D3DB 2XNDD 2KM0A 1GMCF 3QX5H 1CA0B 3ZVFA 5DSFA 5EQQA 1TNJA 4TPYA 4GCHF 3V3MA 3GICB 1GVZA 2ZFSA 3UNRA 5GCHF 4FVDA 1IQEA 5LPEA 3GCTG 1GBLA 1C5QA 1QURH 1GJDB 3NKKA 1T8LA 1IQHA 3AW0A 1HAYB 2Z9LA 4ZKOU 2QAAA 2SGAA 2IPHA 2YMSC 3HGNA 3TITA 1AY6H 1HJ8A 3SUGA 4BOHA 1TE0A 1O2ZA 4K69A 2ILNA 3RM0H 1ABIH 1O3MA 2XWAA 1V2TT 4X2XA 1DY8A 3FP6E 3HKIB 4Q7ZA 2SNWA 4KTCA 1KXEA 1XKBC 1CA0C 3N7DA 1TGSZ 2PFEA 1DDJA 1YF4A 3KYGA 1QHRB 1GBHA 3RXPA 3T62A 1TPAE 3I78A 1RXPA 3IITA 2W5EA 1GHBG 5DP7A 3M7QA 1EP6A 3ZIAD 2P16A 1P2OA 2FOCA 1Z1IA 2VIVA 2FOMB 4INKA 5DPAA 4DJZB 3NK8A 2RDEA 1UK4A 2GT7A 4BXWA 4ZHLU 3A88A 1DY9A 1NZQH 4FXGH 3SNDA 2PUQH 1EQ9A 5T3HA 1EAIA 1NU7B 3SGAE 3RMLH 1NS3A 2B9LA 4YXWD 5EJLA 1MKWK 5HGGA 1O2OA 1YPHE 3N7OA 3TH2H 2TIOA 2BXUH 5DP4A 1TX6A 3GDUA 3MI4A 1E37B 2XNIA 2EY4C 5F6MA 1QB6A 4RT0A 1OKXA 2PV9B 4Y8XA 1BOQA 2WHXA 4O9VA 1AFQB 2TRMA 3OTJE 1C2LA 4ZCNA 4E05H 4NIVA 5TJXA 2AMPA 4K8BA 2CMYA 1GMDG 1XVOA 1TAWA 1E1QD 4BNRA 3QK1A 4CRCA 2O8MA 2O8LA 5GJ4B 2PHBA 1IQLA 1VJAU 1FMGA 4O3TA 1BTXA 2P93A 1BRBE 4QT8C 2FI3E 1C2IA 1TBRH 1THSH 2CXVA 2V7QD 3VB3A 3ZV8A 4BAOB 4VGCB 1D6WA 3M5MA 2PP6A 2GVFA 3CNRA 3QLPH 1AFQC 1ZTKA 2QY0B 1ZRBA 2EC9H 5C5OA 2BD8A 1K1NA 3FANA 2FZZA 1EB1H 2ZGHA 3SGBE 2ZFRH 3UQOA 2KCYA 2QIQA 5GDSH 4MNYA 3SZNA 4RT1A 3P6ZB 3ATMA 2Y7XA 3DSOA 1Y3UA 1XMNB 1O0DH 2FTMA 5CHBA 3MO6A 4OS2A 1YY3A 4X1PU 2NU1E 3U69H 1BJVA 1O2RA 1C1OA 1SQAA 1BMFD 1IAUA 1G3CA 1O5DH 1PPHE 1KDQB 3RXGA 5GXPA 3HATH 2BVSH 1TFXA 3JZ1B 2KCPA 1D4PB 4FU9A 3ENSB 2ZPSA 4AYYB 1A7SA 1P2KA 3O8BA 1O3HA 5HXFA 2J97A 4CRAA 1FN6A 2Q6GA 1MAXA 1G32B 4VGCC 2IJD1 1MTNB 1SGFA 1UTNA 4WXVA 3HK3B 5BPEA 2WZQA 4X1SU 1QFKH 4WJG2 4X6MA 1P09A 3AW1A 4Y71A 4DIIH 2VVVA 3UIRA 3F9FA 2OQ5A 1DICA 3Q00A 1A0HB 3SV6A 5A8YA 3PV5A 2BD7A 5PTPA 5HYOA 3SW2B 1FONA 2O8TA 1C1NA 2EQNA 3BTGE 2ZFTA 4JYVH 3SUFA 3UWJH 1LVYA 3BTWE 3RXRA 3EDXB 3ELAH 1O2VA 3E0PB 2VJ1A 4Y10E 1QQUA 3KCGH 2BQ6B 2J9NA 2TGAA 1VGCB 4NG9H 1MTNC 3AK5A 1NRSH 1BMNH 2WSSD 1BB0B 2QN5T 1CSOE 1CHGA 1CBWB 1SL3A 3L33A 1B0EA 1BHXB 1P01A 4I33A 3UREA 1Y5BT 1HFDA 1HAVB 3FZZA 3SU3A 4BTIB 3A7XA 5F03A 3B9FH 1W7GH 4M7GA 8KME2 3IWMA 1MKXK 1WUNH 3FP7E 4NCYA 2XBVA 5E0JA 1C5YB 1UVOA 5E2OA 2H9HA 2HGTH 3G01A 1EPTB 1C2DA 1EAUA 1AUTC 2P3UB 1BMMH 2CJIA 4I8JA 2PKSB 3N7EA 3FZDA 2WPMS 1WBGB 2H1UA 1TGCA 1GG6B 2PSXA 1VGCC 4OS6A 1NO9H 3EA9A 1MTSA 2UWOA 1S82A 4H42U 1IQNA 1SG8B 1QB1A 1O35A 1T31A 1PQ8A 2XBWA 3M3VA 2XC0A 2AYWA 1G2LA 4YOGA 1FI8A 1YLDA 5A0AE 3ZVAA 2BD3A 1BTUA 1L1GA 1G3DA 1O3LA 1EPTC 1O3JA 3A7WA 3GY3A 1FNIA 2C8XB 2V3HH 1TGBA 1KXAA 3A81A 2PKSC 2L74A 1YCPH 3U8TH 1F0TA 3MO9A 1Y3YA 3H09A 1UK2A 3F0OA 5L30H 3M5OA 3QZQA 1SOTA 2VBCA 4X6PA 2BD9A 1S81A 2FOBA 5AFZH 4X1NU 1GG6C 1TYNA 3NPSA 2FODA 4HI3A 4MDSA 3UFAA 1GDQA 4BTTB 2OTVA 4XRNA 3OSYA 1D6RA 4XBBA 1O2TA 5CE1A 3FOAA 1SGIB 3LKWA 1SOZA 1A5IA 1T4UH 4YT6H 2OK5A 1ELEE 4D8NA 5EODA 5EQSA 1ANCA 1G2MA 5EJZA 1OX1A 1ORFA 1O2JA 1DPOA 4Y7BA 3GY7A 3QGNB 1LDTT 2GCHF 5EPNA 5FPTA 1QJ6B 4KTSA 3RUOA 2ODYB 3A8BA 1OSSA 4DT4A 1LQEA 1INCA 2A31A 3P92A 3ZZ6A 2SGPE 5TCAA 4MVNA 2LNCA 2P59A 1GMCG 2W7SA 5FCKA 1ZJKA 1OYQA 1KLTA 4FUDA 3P17H 2SFAA 4TT3D 3DFLA 2BD4A 5A0BA 4Q2KA 3GY5A 3P8NA 4MNVA 5GCHG 5A09A 1L0ZA 2PTCE 4CRDA 1CT2E 3BIVH 3M37A 1JRTA 3WW7A 5T6DA 2VIDA 1SI5H 5EQRA 3OU0A 1LO6A 2QV1A 1QR3E 2NU4E 1ZLRA 2Z9KA 1V2UT 1CA8B 1NC6A 2WUCA 1L1JA 1AI8H 1TB6H 1FLEE 1GL1A 4ISNA 2QA9E 2JKHA 2ZTXA 2QYIA 1O36A 4X1QU 1J16A 1O2GH 2WPHS 4JZDH 3TGJE 5EW2H 2FOHA 2UUJB 2UWPA 3VB7A 3EA8A 1ETTH 4UFDH 1DX5M 1MU8B 1P57B 3GY2A 1GJ6A 1GHZA 2VIWA 1K0HA 2HPQH 1C5NH 2VWOA 1NFWA 3TH4H 1FIWA 4OGXA 2PTNA 2ASUB 4YT7H 2IOTA 4JK5A 1KIGH 4GLYA 1FY3A 3R3GB 4THNH 1D3QB 1MCVA 3ZVBA 4JZIA 1TONA 4X8SH 1OWEA 2FI5E 4D7FA 3CENA 1ELDE 4AFQA 3GS9A 2C90B 1V2WT 2GV6A 6CHAB 1P9UA 2Z9IA 1O3OA 1ZHMA 4IMQA 1GBTA 2WYGA 2QXHA 4OGYA 2J94A 4B1TA 2B8OH 1UMAH 1ZSJA 4A6LA 2J38A 2P94A 3V13A 4WXIA 1EATA 2OC0A 1BDAA 1HLTH 2BZAA 2F83A 1C1VH 2Y81A 1AVGH 1J15A 3MHWU 1EAXA 2A4QA 1GVLA 5EIYA 1ETSH 1SGCA 3UR9A 4ZKSU 2BXTH 2XRCA 1HIAA 3SORA 2XXLA 1N1LA 1QJ7B 1OPHB 3RXOA 2BM2A 1Z71A 1AKSB 3OY5U 4O03A 3H5CB 4X8UH 4FUBA 1K1JA 2W6JD 2FS9A 3SNCA 6CHAC 1TNKA 3KNXA 2A0QB 1M9UA 1IOEA 2ZGJA 3M5LA 4CRFA 4AZ2B 1L4DA 4PROA 1ZJDA 2TPIZ 1GCTB 3UOPA 2OINA 1P2MA 4CHAB 1VR1H 2Z6BD 1C1TA 3MYWA 1TMBH 1UTLM 2W26A 1TPOA 4CRBA 1P02A 1YPMH 3Q76A 3SV9A 1AFEH 3VXFH 1TABE 3Q3XA 3F2FA 4NSYA 5DP5A 3HPTB 3F0PA 1CGJE 4E06H 1K21H 3BTFE 5FL7D 3UR6A 2Y5FA 3FVFB 6ESTA 5DGJA 1HAZB 4B6EA 1PQAA 4BTUB 2BD2A 2OQUA 2JH0D 1BJUA 1LPKB 1Y5AT 4K2YA 5DP8A 2QXIA 2BQ7B 1O39A 1BA8B 1RTFB 1MTUA 3MNCA 1C5TA 4H6TA 3BN9A 1DUEA 3F3BA 1P2NA 2HNTC 2FOEA 3S9BA 2BDCA 2FI4E 4OS7A 1GGDB 4CHAC 3D62A 2G8TA 3GISB 2HVYB 2FXRA 1WXRA 1SGFG 2BY9X 3KQEA 3A7YA 2SGQE 2ZF0H 1JIRA 3PB1E 4ZMAH 1ZPZA 2GCTC 4JYTA 4WF8A 3GY6A 4DVAU 1C4Y2 2QF3A 4Y0ZE 1ANEA 1FAXA 3RXCA 2LELA 2J98A 1EOJA 3FKSD 4I32A 2ZDKA 1P06A 1WSSH 3A7TA 1PPZA 3PMAB 3OEED 1GMHG 1O2PA 1ETRH 4MPVA 2G5VA 3BTKE 4NZLA 1FY1A 2XOKD 3FP8E 4Q63A 2BDHA 2WYJA 3SZEA 2HVXA 2XW9A 2UWLA 1V2QT 3W1EA 1Y3XA 4B2BA 1TPPA 2W3KA 4ACBA 4BAMB 1AIXH 2A5AA 1FV9A 1XKAC 2VH6A 5K0HA 3RXAA 1JWTA 4ABBA 4X0WU 4X6NA 5HM9A 1J17T 1G3BA 3STIA 1WOFA 3GYLB 5JYIA 2DE8A 4WMEA 1UHBA 4IGDA 1HV7A 1ABJH 3A86A 1A2CH 3RU4E 1BUIA 3ODDA 4K1TA 1IQFA 1QGFA 3A7VA 1ZOMA 3A89A 4YLQH 1QBVH 5IK2D 3S0NA 2G5NA 5BRRE 4UFGH 1BTZA 5IYTA 2VINA 2ZDNA 1EOLA 1K28D 2FESH 5F8ZA 4GHQA 1NY22 3SYJA 1NFXA 2Z94A 1YCPM 3LGTA 4AG2A 3ZZDA 4AX9H 3K9XB 1MU6B 4LXBH 4A1TA 1QA7A 3T5FH 5JBBS 1IHTH 1EZUC 1UCYE 2ZU4A 1T8MA 2PGBB 1P3CA 1KSNA 1RRKA 4FUCA 2HALA 1GI5A 1SVPA 1UTQA 1P11E 3ZZBA 2OD3B 4KELA 4JZFH 2BLOA 3M7TA 5A0CA 1H8IH 3SV7A 1KTTB 3OAAD 1ZR0A 1MQ6A 1C5WB 2UUKB 3DD2H 1QQ4A 3AAVA 1TX7A 3VB5A 3P8FA 5FX6A 1KLIH 2ZECA 5C67A 4FETA 1UCYH 4WWYA 3S9AA 3U98H 1KXBA 2QC2A 2BZ6H 4FUHA 4JZ1A 3URCA 1S85A 4H6SB 3E8LA 4J1YA 1C2HA 1NPMA 2AGEX 5SGAE 4GUXA 3GDVA 1GI0A 1GBFA 3PLBA 1UVTH 1RD3B 1ZTLA 3OX7U 1O3IA 3TNTA 3DFJA 3BSQA 2ZDLA 1SQTA 1VJ9U 3VG8A 2F9NA 5DP3A 5C1XA 1KY9A 1Y3WA 2RCEA 1AWFH 1TRNA 1C5XB 1EJNA 1JXPA 1W13U 2FO9A 1QTFA 1H4WA 2ZTZA 1ZMJA 4FUFA 1V2KT 1XXDA 2WPIS 2BLQA 5GWZA 1YM0A 1A0LA 1AZZA 2AHME 4B71A 2BOHB 1O3CA 4Y11E 1KXFA 1HDTH 3ITIA 5T1VA 2BDIA 1D9IA 4ABFA 1CT4E 1K1OA 1MH0A 1ELBA 2UUYA 1HYLA 3E6PH 5EXNA 1IQKA 1EFRD 1O2SA 1GBCA 1GL0E 3P95A 4ZXYH 1FY5A 1SGYE 2F9UA 1MUEB 3ATWA 3GY4A 1SSXA 4GSOA 1LPGB 1SPJA 1ZGVA 1GWAA 4XOJA 1CT0E 5F8XA 2K1QA 2WPJS 1LQDB 5H4IB 1D3TB 4NIYA 3MNBA 1XUJA 1O5EH 5C94A 4ABIA 2H5CA 1GHXH 2ALPA 3S7KB 1LCYA 1YC0A 4CBOA 3LH3A 1V2NT 1O2LA 2GV7A 4NA7A 1LHFH 3LGIA 1FY4A 1ZMNA 3RXHA 2LPRA 1LHCH 1S0QA 2HLDD 1GHAF 1VKYA 2FP7B 5E0HA 5FBIA 2AFQB 2Z9JA 1LVOA 1HJ9A 1ARBA 1O3AA 2J5UA 3TNSA 2RA3A 3MO3A 3T2NA 1RTKA 2Z3DA 1TNHA 2XBXA 1QCPA 3EGKH 3RMMH 4D76A 2V3MA 1TNGA 3A87A 3U9AH 2WV5A 5C1UA 1ZPCA 2ANWA 2J4IA 2YNAA 3N99A 4LZ1H 1TQ7B 1NRPH 4A1VA 4SGAE 4UE7H 4ACAA 1W0ZU 1P2QA 3L6PA 2ZEBA 4I7YH 1Y8TA 3LJOA 2G55A 1EAWA 5HMAA 4HFPB 1UVUH 4MLFB 3M3TA 1SGQE 1AUJA 1FQ3A 5C2ZA 1UVSH 2QF0A 4K8YA 2KR7A 1NT1A 1SGEE 1SB1H 2OBOA 2QE7D 1ZRKA 4GVUA 2JH6D 2ZDMA 2OXSA 1SC8U 3F2GA 1E36B 2O9QA 4KKDA 3LONA 1GI1A 1HRTH 8LPRA 1P8VC 2V3OH 2PKAB 3QWCH 1QBOA 1H8ED 2ZU3A 1F0SA 2NU2E 2AH4X 4HZHA 2QXJA 1QA0A 2A32A 2FYRA 5EPYA 4M9FA 2OC7A 1A3EH 1SHYA 4Y8ZA 4YESB 1O5AB 3DSGA 1SLUB 3E16B 2O8UA 1SGTA 1GBBA 2JDID 3SQHE 3TU7H 1P9SA 2BY8X 1K22H 1UW7A 1YLCA 3NWUA 3SU1A 1YKTA 1K1IA 3K6ZA 3MWIU 3VEQB 1QL9A 2J2UA 2BHGA 1H8DH 2A4RA 2ZU5A 4MPXA 1H9LB 1W0YH 1YGCH 1P3EA 3C27B 3LGWA 1C2JA 1PQ7A 3ZYEA 3SQEE 2FM2A 1COWD 1RIWB 2EA3A 4UFEH 3UPEA 1YPHC 2XBYA 5DP9A 1QNJA 2A45B 3V12A 1DXWA 1C2MA 4K60A 1XM1A 3Q77A 5B6LA 4AYVB 2JETB 2BY7X 1CGIE 3UWIA 4ZROA 1KXCA 3NZIA 4GPGA 1GHYH 1V2VT 5L6NH 4YTAA 2KAIB 3RLYH 2GZ9A 2IN2A 3ZVCA 1Y59T 2CF8H 3BEUA 1D3PB 3ZZ5A 3T28A 3UOUA 3BIUH 2F4LA 5EW1H 1O5CB 1O3FA 4Z6AH 1QZ8A 8ESTE 5ABWA 1IHSH 1ARCA 2ZQ1A 1BTPA 3OE7D 1DXPA 3VB6A 4ABHA 5C0TA 1IQGA 1MBMA 1RIWC 4NA9H 3RXKA 2A5IA 2BMGB 1O3BA 1UTKA 1SLWB 1TMTH 1CBWC 5FPSA 1VITH 4INLA 2H9TH 2FOFA 3ZV9A 1S6HA 1MZAA 2ODPA 4J2YB 1F92A 1C1UH 1QJ1B 2SNVA 2JETC 2WPDD 4JYUH 1CO7E 3KGPA 3QTOH 1HAHH 1J9CH 1O2WA 2ULLA 1V3XA 2FX6A 2H9EH 3M5NA 5L2YH 1A3BH 3HK6B 3MU0A 5JDUB 1O2UA 1T8OA 3BG8A 5FPYA 1GCDA 5E8EH 2FOAA 4DGJA 5EXMA 6GCHF 4TY6A 2FPZA 4DW2U 1KDQA 3PLKA 4ZKNU 3LIWA 2A7JA 2VIQA 5T6GA 3PWBA 1W8BH 3SV8A 4WMDA 4JK6A 1XUIA 1GI7B 1EB2A 3EYDA 2F9VA 5EG4A 1MKWH 3UTUH 4Y79A 2AGIX 2ZHEH 3A84A 2BLVA 4NFFA 5EJ1A 3LH1A 1E0FD 3NXPA 1OOKB 2G51A 2ANMH 5FAHA 1ZHPA 3MU1A 2A4OA 1UTJA 3RU4T 1ZGIA 3KF2A 4UFFH 3TGIE 2XTTB 1BTYA 4U32A 2J95A 3LJJA 1BBRK 3SJKA 1YLNA 4FUIA 1MMJN 8GCHF 3CS7A 2AEIH 1NN6A 6LPRA 3RMOH 1IQJA 1O3DA 3E91A 2NU3E 3PYHA 4GCHG 1BHXF 2R3YA 1OWIA 1SFQB 2HPPH 5T6FA 4Z0KA 2AMQA 3H7TA 2O8WA 5E0GA 1ESTA 2HOBA 1B0FA 2A2XH 2AS9A 3SOSA 1MBQA 2BB4A 1C5VA 4UONA 2EEKA 3F9HA 5C1YA 3U8OH 1HAVA 1W2KH 1BRCE 1F5RA 4X8TH 1ID5H 1TBQH 4O3UA 5I46H 2YOLA 3SN8A 4B76A 4TY7A 3B8JA 2C8YB 4MTBA 1C1MA 3BTTE 3Q3YA 1G3EA 2AIQA 1EPTA 4FVBA 1XVMA 2ZO3H 3DT0H 4DCDA 2K0QA 2SGDE 2GP9B 3F68H 3RC4A 3SNEA 1GPZA 4ZXXH 2B5TB 1F0UA 1HXEH 1S84A 4B2AA 2P8OB 4Y7AA 1J14A 2P3FH 1GI4A 1SGPE 2KCAA 3UQVA 1GJ9B 1DE7H 5HIYA 3MMGA 3V0XA 1KTSB 1CGHA 2M2AA 4BXSA 1MTWA 1QIXB 1A0JA 1TALA 4AFZA 4KTUA 1UTOA 1A46H 5HKKD 2ZDAH 1GJ4H 1QRZA 1WV7H 1GI2A 3F9EA 1P10A 2C8WB 5ETXA 3PV2A 4F49A 2A1DB 5KECA 5AHGH 2QGRA 1T32A 4U01A 2IJOB 1AE5A 3EA7A 1Z8IB 3RXQA 4K5ZA 3SHCH 3OEHD 1TLDA 1AQ7A 1HNEE 2W7UA 1EZQA 4CBNA 5E2PA 3RXEA 4MPUA 4ABEA 5J4SA 2BVRH 2GDEH 7LPRA 3V7TA 2P8OC 3TPIZ 1S0RA 1VITF 1FX0B 2G00A
chains in the Genus database with same CATH topology
3NCLA 4XE4A 1BTHH 1O2YA 2I6SA 3LDXH 2HRVA 1DVAH 1TBZH 3P8OA 1PJPA 1UJ1A 4GHTA 1K1PA 2ALVA 4KP0A 3EAJA 3MH4A 2FEQH 5LPFA 4SGBE 1FZZA 1C5MD 3LC3A 1GI8B 5C20A 1AHTH 4NGAH 2FWWA 3TGKE 4I31A 1H9IE 1RS0A 2BY6X 1MKXH 2TGDA 2ZWLH 4TWWA 1GHAG 3QTVH 1SR5C 2UUFB 2OP9A 2QXGA 1O3KA 3ZZ8A 1UVPA 2FLRH 3D49H 5DK1A 2WPLS 1AZ8A 3MH6A 1C5LH 1C2FA 1AN1E 2FX4A 2NWNA 2GX4A 3A8DA 1Q2WA 3I77A 3TK5A 4R0IA 1OP8A 1YPKH 1GCTC 2GDDA 2ZPRA 1ELVA 4A7IB 5JBAS 1LMWB 4FUJA 1L4ZA 3SJ9A 1E35B 1K1LA 3T27A 3UY9A 4ZAEA 1UK3A 2XCNA 4IS5A 4CH2B 4ISHH 2ZHQH 3BG4B 2SGFE 1ELAA 2J34A 2AMDA 1A1RA 3ZZ3A 2TBSA 2FYQA 1THRH 1UTMA 1XX9A 3QUMP 3B23B 2ZCHP 1QBNA 4IMZA 2C8ZB 5C5NA 3KL6A 3KIDU 3SGQE 4ASHA 3RC6A 1HGTH 4OS4A 1HB0B 1V2OT 1JRSA 4WMFA 1EZSC 2VWMA 1YPGH 1FAKH 1AWHB 1NFYA 1TA2A 4AB8A 3CP7A 1GJCB 1P12E 1AGJA 4BAQB 1YPLH 4ISIH 1MAYA 4CRGA 4Q7XA 4FUEA 3E90B 3TJOA 2Y5GA 1EZXC 1GGDC 4ISLA 1DLKB 4DG4A 1DT2A 4AFSA 4B2CA 1SHHB 4E7NA 2THFB 2XC4A 2ZI2H 3BG4C 2ZNKH 5DJ7A 1Z8RA 1NFUA 3PM3A 2AIPA 1GJBB 1BTWA 4NIWA 3ATLA 3AAUA 2ZHFH 1C5SA 4XDEA 1OS8A 2V35A 2FS8A 2VH0A 3NUMA 3PV4A 3MNSA 3OY6U 3RXUA 1P03A 1YP9A 3RLWH 1GJ5H 2HNTF 1AKSA 4NWLA 2VGCB 1NM6A 1HBTH 3CS0A 3M7UA 2BDYA 1VZQH 1DM4B 5ESBA 1O2QA 4DOQA 3M61U 1O32A 3ZZAA 1C5ZB 2DUCA 1PPCE 3DHKH 3PMJA 4MNWA 1CVWH 1EP5A 1LVMA 3RXIA 3LGYA 2JH5D 1NRRH 2YNBA 5LPRA 1TMUH 3SU5A 1O2KA 1C5PA 2ANYA 2OUAA 1QRXA 3TK9A 1DS2E 3UNQA 2RG3A 1Q3XA 1S83A 1CHOF 2R3UA 2TGPZ 4NZQA 4IC5A 4NA8A 4ABJA 1L2EA 2D1JA 3SU0A 4ZKRU 4ISOA 2VWLA 3ZZ9A 4JZEH 4XBDA 3ATIA 1O5GH 2R0LA 2VGCC 1TX8A 2GZ8A 1W14U 2PUXB 1GBIA 2VNTA 1U6QA 1ELGA 5FHTA 1FIZA 4ABGA 2F9BH 1A5GH 2C93B 2EI8A 3ZZCA 1EASA 4ABAA 1TA6A 5FX5A 3BV9B 2B0FA 1O3PB 4D9QA 4E7RG 1C1QA 4RKOB 1O3GA 1YYY1 6GCHG 2BD5A 1GJ7B 2RDLA 3QN7A 4Y0YE 1W7XH 1TOMH 3QDZB 1GVKB 1X7AC 2XC5A 1C2EA 1QRWA 3HKJB 1BITA 5AVDA 5JB9S 5EU8A 1YBWA 1CU1A 1SGRE 2D26C 2XCFA 2H2ZA 4OS1A 1TNIA 1IQIA 4I8GA 3SI3H 1J8AA 5K7RA 2VIOA 2ODQA 1G36A 1ZHRA 3SHAH 3VPKA 3ZZ7A 1JOUB 4I8HA 2ZFPH 3UNSA 2Z3CA 3A8CA 5A2MH 1A4WH 3QZRA 1Z6EA 1YCPK 2GCHG 7GCHF 1O5BB 4AGJA 1DSTA 1F0RA 1Z1JA 1LKBA 1FPCH 3A8AA 4TYDA 2A4GA 3JZ2B 1EKBB 3MNXA 8GCHG 1F7ZA 4YZUA 3E3TA 4Q7YA 1SBWA 1DITH 2ZU1A 3KN2A 4WH6A 3RXLA 1XUGA 1C1RA 1W11U 1NRQH 1BCUH 1C4U2 2PLXA 5DKMA 3PO1B 4Q80A 2D2DA 3W94A 1G9IE 2WUBA 2A2QH 4YOIA 3WY8A 1DWDH 3VB4A 4AOQA 1KYNA 1GBEA 1GI3A 3BEIB 3IG6B 4WH8A 4A92A 2F9PA 4LK4A 4K3JA 4ZHMU 5LH8A 3TK6A 1Y3VA 1Q31A 3LC5A 4OS5A 4UEHH 4KGAA 1QY6A 3QO6A 4NIXA 2OLGA 5G4BA 3RXBA 2P95A 1QL8A 1LHDH 1WTHD 2R9PA 2ZU2A 1E38B 2GZ7A 4H4FA 1JBUH 3U1IB 1T8NA 1O30A 1FN8A 3LGVA 3RDZA 3TJUA 5GPIB 2EI6A 2Q1JA 1BRUP 2ZGXH 2BDGA 1O37A 2QCYA 1PYTD 1K2I1 2M5TA 3GYMA 2OCVB 1TRMA 1O5FH 4O97A 1H9HE 1EXFA 1NTPA 2F9OA 3BF6H 5IDKA 1C4V2 1BQYA 3PO1C 2RA0A 1OP2A 3F9GA 4ESTE 3STJA 3FFGA 2GT8A 1XUHA 5DP6A 2I6QA 3MH5A 1NROH 3SJIA 3SO3A 1AMHA 1HJAB 7KMEH 1WQVH 2ZKSA 4ZHAA 3M36A 2XYAA 4ZH8A 1OWKA 3BTEE 3U8RH 4BAHB 2VIPA 2BQWB 3ATKA 1WCZA 1THPB 3PROA 2R0KA 2BYAX 2WINI 3LT3A 1O2NA 2F3CE 3H7OA 3PTNA 4A5TS 3HGPA 1GHWH 3SI4H 1BMAA 1GI9B 5GIBA 3BTME 5J4QA 2VWNA 4B73A 2CF9H 1OP0A 1ESAA 1W12U 3LOXA 1G30B 1WQSA 1WTGH 3KHVA 5JB8S 1ANDA 1L1NA 3S69A 1VITG 5A8ZA 1V2PT 5EXLA 2Y6TA 4DURA 2ZCKP 4NSVA 5I25A 4RSPA 4F4OC 1VCQA 2W3IA 2ZC9H 2H5DA 3URDA 1LVBA 1O2MA 3P70B 1BRAA 1HJAC 1GDNA 5C3NA 1GMHF 1V2JT 1Z6JH 2ANKH 1DUAA 4Y8YA 3SUDA 3W95A 1C5RA 3D23A 1PPFE 3KEEA 3D65E 1B7XB 3A80A 1FUJA 1ZSKA 3KQCA 1V2ST 2Y82A 3GCHB 1MCTA 2BX3A 2ZIQH 1HCGA 1PPBH 4DT7B 3P8GA 2R2WU 1NU9A 1P0SH 2G81E 4K1EA 1O2IA 2ZA5A 5FBEA 1ZTJA 1XXFA 1HAXB 1UTPA 1WAYB 1HXFH 4X2VA 1GBDA 5FCRA 1AB9B 4BANB 3KQDA 3MTYA 3MU5A 1Z8GA 1V2RT 2ZQ2A 4AN7A 3S7HB 1AVXA 1E34B 3LU9B 1Z7KA 2G4TA 3I29A 5CHAB 2ZGBH 4IBLH 1UO6A 2AERH 3SNBA 4RN6A 5B6OA 2C4FH 3SJ8A 2PR3A 1A61H 3GCHC 4HTCH 1W3CA 3GCTF 3AASA 1VCPA 1OWHA 1NRNH 1BMLA 1H1BA 3RXJA 3GCNA 1N6YA 1HAGE 5FXLA 1AB9C 1TGNA 3QGJA 4IW4E 1TQ0B 1DLEA 1B5GH 1PQ5A 3A83A 1FDPA 3TVJB 2CGAA 2ZHDA 1TNLA 4D9RA 5LGOA 3RXVA 4XBCA 7ESTE 1AO5A 5A8XA 1HAIH 1MQ5A 1SFIA 5CHAC 3GOVB 5L2ZH 1KLJH 3A7ZA 2D8WA 1AVWA 1VCWA 2GMTB 1CQQA 4X6OA 3RU4D 2VVCA 3MU8A 1SQOA 4DY7B 2ZFQH 3A82A 4GAWA 2BDBA 2Z9GA 4R8TB 4AGKA 4X1RU 1GHBF 3TH3H 4CREA 3GDSA 1O3NA 4BAKB 5CMXH 1RFNA 2PKAA 2G4UA 2B7DH 2F91A 2GKVE 9ESTA 3FAOA 1ELCA 3EQ0H 2GGVB 1HIAB 5DO4H 1TRYA 2ZP0H 1XUFA 3F6UH 3SU4A 5JBTA 2CV3A 5JPMH 1K9OE 3ESTA 4INHA 3AVZA 1SMFE 1HUTH 1N8OB 2STBE 2GMTC 1FJSA 3ZVGA 1ACBE 4TWYA 4YM9A 3SJOA 1ZPBA 2HLCA 3O8DA 3E1XB 1OXGA 1SLVB 1W10U 1PFXC 3SUEA 1C1WH 1HAPH 1HAOH 5AF9H 2P3TB 1YPJH 1C2GA 1HPGA 2Y7ZA 4MG3A 3A85A 2STAE 1GJAB 4X8VH 5F8TA 4U2WA 2A5KA 3K2UA 1ZMLA 3VXEH 2Q6FA 1P04A 1K1MA 1CHOG 3SV2H 3R0FA 4K1SA 1FXYA 1O33A 4CH8B 1GMDF 1BT7A 1DWCH 3BTDE 3U1JB 1LHGH 4NFEA 1QL7A 3MU4A 3PLPA 2KAIA 4YOJA 1BZXE 1N8OC 2R2MB 3SU2A 2OC8A 1RJXB 2HNTE 4B74A 1Z8JB 3VFEA 1GHVH 2EI7A 2V6NA 1V2MT 4MPWA 1JIMA 3LPRA 1C1SA 3TJVA 2BDAA 1OWJA 2Z7FE 1OYTH 4LOYH 1S6FA 2VVUA 2XWBI 4TPIZ 2ZZUH 2SGEE 4FUGA 4XSKU 2OBQA 2ZG0H 1A5HA 4ABDA 2BLWA 1ESBA 3MH7A 1C1PA 1UCYK 2OC1A 5EOKA 2HWLB 2J92A 4Y6DA 1RGQA 3ZZ4A 3VGCB 3LGUA 3O8RA 2TGTA 2ZCLP 9LPRA 5JBCS 5EGMA 4A1XA 4Y76A 1C9TA 1WYKA 2H6MA 3KQBA 2BX4A 1GBMA 2CHAB 1JMOH 1P2IA 1V6DA 7GCHG 3T25A 1P2JA 3OYPA 2G52A 1Y5UT 1DFPA 2AGGX 1EJAA 2Q6DA 3TIUA 4I8LA 1LTOA 4X2YA 2CN0H 3O8CA 1MD7A 4X2WA 1EX3A 4AG1A 4MNXA 1GJ8B 2BOKA 1AD8H 3ZVEA 1TOCB 1ZSLA 1UHBB 4CR9A 4WY3A 2VU8E 1DSUA 4IN1A 1T4VH 2GTBA 4IN2A 3ZYDA 4AB9A 3VGCC 1ZZZA 3RXTA 3RM2H 3M3SA 4HGCA 3T29A 2PGQB 2ZGCA 4MQAA 2Y80A 2CHAC 3DUXH 2FLBH 2A7CA 1GI6A 2FTLE 1C5UA 1O2HA 3M35A 3MFJA 3DA9B 4RKJB 1S5SA 3K6YA 4NWKA 1V2LT 2BY5X 2C3SA 1CE5A 2FMJA 1RTLA 3SBKA 1TGTA 1WU1A 3RXDA 1TIOA 4UDWH 3TLOA 1OWDA 2NU0E 1O34A 4JCNA 1O3EA 2PW8H 3GCOA 2ZTYA 3MOCA 2FOGA 1FY8E 2BTCE 1EJMA 2GCTB 1TPSA 1F5LA 2PSYA 3C1KA 1DANH 4D7GA 3RP2A 1N6XA 4B75A 4CR5A 1LPZB 1AU8A 2Y5HA 1PPGE 3EE0B 1O31A 1GBJA 3RXMA 3Q3KA 1LKAA 4JMYA 1SLXB 3T26A 1O38A 5DG6A 1P05A 3BTHE 1QB9A 1KXDA 1GDUA 3PWCA 2WPKS 4IC6A 4ZUHA 1ELFA 3ZVDA 3BTQE 4I8KA 3ODFA 5TCCA 1EUFA 3UUZA 4UD9H 1G37A 1NESE 1BIOA 1F2SE 1DWEH 4YLUA 4YO9A 3RXFA 3SU6A 1ANBA 1DWBH 3K65B 2FIRH 3L3TA 1LHEH 1BBRE 2V0BA 4XFQA 3PTBA 4U30A 2Z3EA 1C5OH 3F1SB 4LZ4B 2ZHWH 1MTVA 3BEFB 1PYTC 5HM2A 2DE9A 2ZFFH 1GBAA 1C2KA 4FU8A 1SGDE 4AORA 4WVPE 5ESTE 1O2XA 1SGNE 1BBRH 1DOJA 3PMHB 1MD8A 3RMNH 1GBKA 2A7HA 3E0NB 4AFUA 2GD4B 4DIHH 2ZPQA 3S9CA 1TWXB 3RC5A 1T7CA 1IQMA 2ZDVH 5AFYH 3TJNA 1MZDA 3RXSA 2VB0A 1FPHH 1C9PA 3PMBB 1F5KU 1XUKA 1ELTA 1YPEH 2PWXA 1ZYOA 2WV4A 1PPEE 3SNAA 1AE8H 3GY8A 2ESTE 2FDAA 4FU7A 2BVXH 1D3DB 1GMCF 3QX5H 1CA0B 3ZVFA 5EQQA 1TNJA 4TPYA 4GCHF 3V3MA 3GICB 1GVZA 2ZFSA 3UNRA 5GCHF 4FVDA 1IQEA 5LPEA 3GCTG 1GBLA 1C5QA 1QURH 1GJDB 3NKKA 1T8LA 1IQHA 3AW0A 1HAYB 2Z9LA 4ZKOU 2QAAA 2SGAA 2IPHA 3HGNA 3TITA 1AY6H 1HJ8A 3SUGA 4BOHA 1TE0A 1O2ZA 4K69A 2ILNA 3RM0H 1ABIH 1O3MA 2XWAA 1V2TT 4X2XA 1DY8A 3FP6E 3HKIB 4Q7ZA 2SNWA 4KTCA 1KXEA 1XKBC 1CA0C 1TGSZ 2PFEA 1DDJA 1YF4A 1QHRB 1GBHA 3RXPA 3T62A 1TPAE 3I78A 1RXPA 3IITA 2W5EA 1GHBG 5DP7A 3M7QA 1EP6A 2P16A 1P2OA 2FOCA 1Z1IA 2VIVA 2FOMB 4INKA 5DPAA 4DJZB 3NK8A 1UK4A 2GT7A 4BXWA 4ZHLU 3A88A 1DY9A 1NZQH 4FXGH 3SNDA 2PUQH 1EQ9A 5T3HA 1EAIA 1NU7B 3SGAE 3RMLH 1NS3A 2B9LA 1MKWK 5HGGA 1O2OA 1YPHE 3N7OA 3TH2H 2TIOA 2BXUH 5DP4A 1TX6A 3GDUA 3MI4A 1E37B 2XNIA 5F6MA 1QB6A 1OKXA 2PV9B 4Y8XA 1BOQA 4O9VA 1AFQB 2TRMA 3OTJE 1C2LA 4E05H 4NIVA 5TJXA 2AMPA 4K8BA 2CMYA 1GMDG 1XVOA 1TAWA 4BNRA 3QK1A 4CRCA 2O8MA 2O8LA 5GJ4B 2PHBA 1IQLA 1VJAU 1FMGA 4O3TA 1BTXA 2P93A 1BRBE 4QT8C 2FI3E 1TBRH 1THSH 2CXVA 3VB3A 3ZV8A 4BAOB 4VGCB 1D6WA 3M5MA 2GVFA 3QLPH 1AFQC 1ZTKA 2QY0B 1ZRBA 2EC9H 5C5OA 2BD8A 1K1NA 3FANA 2FZZA 1EB1H 2ZGHA 3SGBE 2ZFRH 3UQOA 2QIQA 5GDSH 4MNYA 3SZNA 3P6ZB 3ATMA 2Y7XA 1Y3UA 1XMNB 1O0DH 2FTMA 3MO6A 4OS2A 4X1PU 2NU1E 3U69H 1BJVA 1O2RA 1C1OA 1SQAA 1IAUA 1G3CA 1O5DH 1PPHE 1KDQB 3RXGA 5GXPA 3HATH