2R3UA

Crystal structure of the pdz deletion mutant of degs
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
210
structure length
202
Chain Sequence
MTPASYNLAVRRAAPAVVNVYNRGLNNQLEIRTLGSGVIMDQRGYIITNKHVINDADQIIVALQDGRVFEALLVGSDSLTDLAVLKINATGGLPTIPINARRVPHIGDVVLAIGNPYNLGQTITQGIISATGRIGLNPTGRQNFLQTDASINHGNSGGALVNSLGELMGINTLSFDKETPEGIGFAIPFQLATKIMDKLIRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protease degS
publication title Regulation of the sigmaE stress response by DegS: how the PDZ domain keeps the protease inactive in the resting state and allows integration of different OMP-derived stress signals upon folding stress.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 40
structure length 202
sequence length 210
chains with identical sequence B, C
ec nomenclature ec 3.4.21.107: Peptidase Do.
pdb deposition date 2007-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r3uA02
2XC5A 4KKDA 3CS0A 5T6FA 2OXSA 4NSVA 3FP8E 2I6SA 3F6UH 1GDNA 1LO6A 1LHGH 3S9BA 3UQOA 1GHAG 1AZZA 2AGIX 2GCTB 3TK5A 3VB3A 3FVFB 1GJAB 5LH8A 3SW2B 4DIIH 1J14A 1GBBA 1QRZA 1WQVH 2ZCHP 3M5MA 1DE7H 1SGFA 4DJZB 1O3BA 1OPHB 2AEIH 3A7XA 4LXBH 1GMHG 3U8RH 2A4GA 4WWYA 1YGCH 1AE8H 1IQNA 2O8UA 1HAGE 4IW4E 3E1XB 2STBE 1AVWA 1PPHE 1VGCB 2ZDLA 1Z7KA 2ZFRH 4ISOA 3UY9A 1LDTT 2BDAA 1O2GH 4FXGH 3AASA 2R2WU 4ABHA 4KELA 1OWEA 1XUFA 1UCYH 3SNDA 1ZOMA 2ZWLH 1OXGA 1PPEE 5LGOA 2J34A 1HDTH 2P59A 3PB1E 1OP0A 1WAYB 1DWDH 1IAUA 1FN8A 5HM9A 2C8XB 1C4Y2 3PLKA 2ANMH 2P8OB 3NZIA 3SU6A 2FX4A 4E05H 2C8YB 2PR3A 2WPLS 5IYTA 1A3BH 2DUCA 5DP7A 2VIWA 2CXVA 1ELCA 1GMDG 3SJOA 5HMAA 2FXRA 2HWLB 3OX7U 2WINI 2IOTA 1P2MA 3GCTF 5GJ4B 3PV4A 1HJ8A 1YPHE 1EB2A 1SGNE 2BQ6B 1C5OH 2F3CE 4ZAEA 2GMTC 2HNTE 3VB7A 2TRMA 2C93B 2QCYA 1BQYA 1UHBB 2BQWB 2ZHWH 4Y7BA 1QQ4A 1GBMA 1VGCC 3UTUH 6CHAB 1IQFA 4NIWA 3RXEA 1OX1A 1ZZZA 4WH8A 1FIZA 1T4VH 3BTME 4NIVA 1KIGH 5F8XA 1AZ8A 2HALA 4ISIH 4JZDH 5F03A 4GHQA 3K6ZA 1C1OA 3LONA 1AE5A 1J9CH 3ZVDA 2XBVA 3QGNB 2ZHQH 2FM2A 1EAXA 1Q31A 4D8NA 1AKSA 2G52A 1TBQH 2KAIB 4NFEA 4CBOA 1P57B 5HGGA 2ZFPH 1OP2A 3CENA 1JIRA 1QIXB 2PSXA 2OP9A 4YOIA 2ZGHA 4AYVB 3B9FH 3KQDA 1BUIA 2ZECA 1O3LA 1YCPM 3S9CA 1BBRE 2PKAA 1THRH 1O2HA 1DOJA 1O3PB 2B5TB 2BLVA 1MUEB 4TPIZ 3HATH 2SNWA 3P8OA 3MI4A 1TE0A 1ELVA 3MH7A 1RFNA 2ZU4A 4H6SB 2XWAA 3BTKE 3UOUA 3D65E 1U6QA 3URCA 3PMAB 3ENSB 2J95A 3QZQA 1NU7B 4NFFA 1AB9C 1P2NA 1G36A 1O3HA 1YM0A 3V7TA 3B8JA 3A82A 4JYVH 2QV1A 3LGWA 4IS5A 1OP8A 4NG9H 1DXPA 5A2MH 5T6GA 1YPKH 2NWNA 1TABE 3Q77A 1KXFA 1GHBF 5FBEA 1LHFH 2AH4X 1Y3YA 3MU1A 1Z6EA 6GCHG 2XTTB 2VWNA 1SHHB 3T29A 1ZPBA 1BJVA 1GG6B 1TX7A 1O2NA 2P3UB 1O5EH 5L30H 4I8KA 4LOYH 4INHA 2H5DA 1J17T 1KLIH 4GLYA 5A0AE 4HFPB 4I8JA 1TONA 1C5NH 2UUJB 1Z6JH 2G81E 1L4DA 1BHXB 1XMNB 4BAQB 2VVCA 2H9TH 3E91A 1CHOF 1HAIH 1W10U 4AGJA 4CRAA 2WV5A 2C8ZB 4KP0A 1TGBA 3SHCH 2ZCKP 3ATWA 3MH6A 2XW9A 1C2IA 7GCHG 4Q7YA 3UWJH 3DT0H 1W0ZU 1GHWH 4YOJA 1FUJA 1DSTA 2TGAA 1V2KT 1SLXB 1K2I1 1ANEA 3LGVA 3P8GA 4I8LA 1TGTA 1TPSA 3SU3A 2Z9LA 4NA7A 4O3UA 1OWHA 2V6NA 3U8OH 1S83A 4X1SU 2RCEA 1AD8H 9ESTA 4XE4A 3T28A 1F2SE 1C9TA 2FI3E 1N8OB 1L0ZA 3GY4A 3SO3A 4K1TA 4JYUH 2A5IA 2JH6D 1JBUH 2FWWA 1T31A 2A4QA 2BDGA 5L2ZH 3N7OA 1AN1E 1IOEA 1QB1A 3KGPA 3T5FH 1D3QB 3UUZA 2ALPA 3UR9A 2ODQA 1T4UH 1N6XA 2BY5X 4AG2A 5FPSA 3CS7A 1O2PA 3GYLB 3M3SA 1QCPA 3ATMA 2WPKS 1GHVH 1QQUA 1E36B 2A5AA 4X8UH 4ABAA 5BPEA 3Q00A 2ASUB 3A8AA 1GVZA 1KTTB 3A81A 3M5NA 1OWIA 2Z9KA 1C9PA 4YLUA 2Y6TA 3QLPH 4CRDA 1HAYB 3A80A 3TNSA 2ZP0H 3ZV9A 2VIPA 1O3KA 2ZKSA 3NCLA 1UVSH 3M7UA 4K1SA 5CE1A 4OS1A 3GISB 1S82A 2C8WB 2VWMA 1CGHA 1QURH 3SUFA 1C5MD 1P11E 1V2WT 2FOMB 2GV6A 2SGAA 3RP2A 4K3JA 3U9AH 1HAHH 2ZPQA 1TB6H 2XC0A 2C4FH 2NU0E 1ZHMA 3S7KB 2A2QH 4Q80A 4RN6A 1BT7A 2G5NA 1DY9A 4NSYA 3SZNA 3H5CB 2FP7B 3T25A 2Z7FE 1LCYA 4HTCH 2V3HH 3BG8A 3MNCA 1C5PA 2NU2E 1P9SA 4DY7B 1Z1JA 1SQTA 1TA6A 1C1RA 3A7YA 2BYAX 3VFEA 2BD7A 3F1SB 3SGQE 4QT8C 3KNXA 5J4QA 1YP9A 3P8NA 1IQMA 1C1VH 1H8IH 1VITG 2A45B 4R8TB 1TMUH 1CVWH 3S9AA 3PTNA 1ANCA 1O3EA 1ZMNA 1IQHA 3PWCA 1A7SA 1LTOA 1P06A 1Y8TA 5TCAA 3MU0A 3ZZ8A 1FJSA 2CMYA 2FYRA 1CT2E 1YYY1 5EPNA 2WV4A 4MQAA 3SJ9A 1GI3A 1UVTH 1YC0A 3UWIA 1C1PA 1D3PB 1GBCA 4UFGH 1JIMA 5L2YH 2YNAA 3ODFA 2OQUA 1EASA 2W7UA 1P02A 4CH8B 1P2KA 3VEQB 1G3DA 2SGDE 1K28D 3SBKA 4DOQA 4X0WU 3O8BA 4BAKB 4BTIB 3EA7A 4VGCC 4FUBA 1LHCH 1P2QA 1C5UA 1K1OA 1MKXH 2PKSC 4I32A 1OWKA 2XCNA 2TGDA 3A86A 1LVBA 1JWTA 4CHAB 2HRVA 3AW1A 1KXAA 1QY6A 1BOQA 1CSOE 2J94A 4MDSA 1XUGA 4MG3A 1BTYA 5J4SA 4YOGA 2Z94A 3BTGE 1EATA 4GSOA 2Z3EA 4TY7A 2BD3A 1AUTC 1KYNA 3OYPA 4BAOB 1MU6B 1C1TA 1QA7A 1ZLRA 2BTCE 1ZTKA 1C5TA 4O03A 1NRRH 2AYWA 1TPPA 2ZGJA 1SGCA 3LIWA 4INLA 4X6MA 1ZPZA 1GI8B 2G51A 5C3NA 5A09A 3I78A 2ANYA 2WYJA 1TAWA 2XRCA 1NROH 1V2QT 3E0NB 3SV6A 2H6MA 4CR5A 1ELDE 3KQCA 4X8SH 2VH6A 5E8EH 3RM2H 3GCOA 3Q76A 3E90B 3KF2A 5FCKA 1HJ9A 1QL7A 4IN1A 1O3OA 4I31A 2GGVB 1DICA 2ZDVH 4AFQA 2Z9GA 1AU8A 1DWEH 3QUMP 5FPTA 3UPEA 1INCA 1DLKB 2UUKB 1GL1A 1L1NA 3GY6A 1J15A 1F0RA 2BY8X 1UHBA 2SGEE 1CT4E 1XM1A 2FS9A 1EXFA 1YLCA 3E16B 1ZHRA 2BDYA 1GVKB 1O5GH 2B9LA 3GCNA 5C67A 4Y8XA 3PO1B 3KHVA 1XVMA 4ZKNU 1O5CB 1ABJH 2VNTA 1XUIA 1MD7A 2ZU1A 4WXVA 1M9UA 2W7SA 3M5OA 4HZHA 2AIPA 1HJAC 3TJNA 3AAVA 4YT7H 1O39A 1LPZB 3R0FA 1HAPH 1V2RT 2KAIA 1CA8B 1T8NA 4E7NA 2HPQH 2R2MB 2OINA 5L6NH 1EZUC 1QJ7B 1LVOA 1CA0B 1Y3UA 4X6NA 3QWCH 1MBMA 2A5KA 1PJPA 3UNSA 3RXMA 5JBAS 1RTLA 3A7WA 1GBKA 4IC6A 1X7AC 2ANKH 5EODA 1UVUH 4LK4A 1BRBE 2A4OA 1Z71A 3QN7A 2PUQH 1RIWB 3LU9B 1GGDB 5I46H 1MAYA 1TGCA 1P12E 4ZHAA 2ZPSA 4MPUA 3PO1C 1O33A 2QXGA 4YESB 1PYTD 3GCHB 3C1KA 2A4RA 2XNIA 4PROA 5FAHA 1W11U 2HNTF 1BRAA 3RMNH 1AHTH 1O30A 3PMBB 2GDDA 1OWDA 1VCQA 1QFKH 1CQQA 2HVXA 2IPHA 1C5XB 1CU1A 1O2YA 4Q2KA 3GCTG 3GDSA 3D49H 3M37A 1SG8B 1CA0C 4X2XA 4YT6H 3SUEA 1P04A 2BQ7B 4RKJB 1O31A 2Y7ZA 3SQHE 1Y3WA 3K9XB 4Y8YA 1BTWA 2O8LA 4XBBA 2VGCB 4SGBE 1AVGH 1MCVA 5EQSA 1YPGH 2QA9E 1SL3A 4THNH 1RIWC 1RXPA 3RXTA 1P3EA 2ZGCA 1QL9A 1P9UA 1AO5A 4E06H 4NWKA 3BTFE 3ZVBA 1GI2A 3M61U 4FUCA 1EX3A 1O5BB 2OBQA 2ZGBH 3V12A 2GV7A 3RXFA 3PLPA 4D76A 3QTVH 3PYHA 1NM6A 4MVNA 5JDUB 3P95A 2F9VA 1DWCH 3HK3B 2VB0A 4DURA 2BM2A 1ZR0A 1ESAA 1TBRH 2PV9B 3ZZ5A 3SHAH 5EW1H 4WH6A 1NPMA 2XBWA 1MD8A 4IMQA 3UNRA 2OLGA 4JZIA 1O2LA 5C20A 1BZXE 4X6OA 4NWLA 1RTKA 3RU4D 3BTHE 2BY7X 1EAWA 2GZ7A 1XKAC 1YPJH 1GJ9B 2D2DA 3MNBA 1K1IA 2FOGA 1HAZB 1Z8IB 1KY9A 1HAOH 4RKOB 1ZMJA 1O2JA 3OSYA 4MLFB 1ZRKA 1UVPA 3T62A 1SGYE 1ORFA 2CF8H 3BEUA 4HI3A 3V0XA 1K9OE 1ANDA 3GOVB 3BTWE 2H9EH 2G55A 2VH0A 3UNQA 4E7RG 3T27A 3GY8A 1GHBG 1L1GA 4X2WA 4BTUB 1BB0B 2BDIA 2B8OH 2Q6DA 4TY6A 4GHTA 1ELFA 4FU7A 1EUFA 3SV7A 1K1LA 1EZXC 1Z8GA 5T3HA 3FANA 1ELGA 1UCYE 2GCTC 3LGUA 1G32B 1QRXA 2UWOA 4MNVA 3SI4H 2ALVA 3SI3H 3A87A 2P16A 1ZSKA 2PGQB 2TIOA 4K69A 3RXVA 2F9NA 4SGAE 1ETSH 1WU1A 3TH2H 2FTLE 4XBCA 2XCFA 3BG4B 2JH0D 1SPJA 1A5HA 4F4OC 3NKKA 1HNEE 2Q1JA 4CRCA 2YOLA 1CHOG 2BLWA 4BOHA 5E2OA 1LVYA 5I25A 4NA9H 3SN8A 2GT8A 1YBWA 4U01A 2QXHA 2UWPA 2HPPH 5BRRE 1SR5C 2O8MA 3LGYA 4DG4A 1FQ3A 2V0BA 1O3CA 2IJOB 5T6DA 3I29A 4IN2A 3ZVCA 3E6PH 2R0LA 1A0JA 1GI7B 4U32A 1MBQA 4ABIA 1ZSLA 4OS5A 3TPIZ 2PTNA 3GY2A 2GD4B 2P8OC 1L1JA 1O37A 1SGIB 4F49A 3VGCB 1G9IE 5ESBA 3ESTA 4FUHA 3QK1A 4K1EA 2ESTE 4B73A 1A46H 1E37B 3RMLH 1KXBA 2XBYA 4Q7ZA 1YF4A 2P93A 3F68H 1GI1A 3W94A 1L2EA 1A0HB 2K1QA 1GWAA 4FVDA 3RC5A 3KEEA 3RXAA 1C2DA 2ZU3A 3BG4C 3F9EA 1GJBB 1G30B 2WYGA 1P8VC 5EQRA 3ZZBA 1LMWB 6CHAC 3UR6A 4NZLA 3ZV8A 2ZI2H 3RC6A 3QGJA 2F9UA 1S0QA 4A1TA 1F0UA 1MQ5A 2FI4E 1UVOA 1GBIA 3SU0A 1GJ5H 3P92A 3RLWH 2GCHF 1V2PT 1GBHA 5DK1A 1TNHA 1GHXH 3C27B 4B1TA 2Y82A 3SJIA 1UTQA 3A85A 4WMFA 1O3DA 3A8CA 3V13A 4GCHF 1IQKA 5GPIB 4WVPE 5DP9A 2Z3CA 4I8GA 4UFFH 2ZC9H 1O2WA 1UTNA 2FIRH 3TVJB 1GHYH 2XXLA 1KLJH 2ZZUH 5EGMA 2PSYA 3A7VA 4K60A 3SU4A 1KDQA 2O8WA 1MTNB 1G3BA 1C5VA 3W95A 2G8TA 1FPHH 3EA9A 1CE5A 2D1JA 4DGJA 2Z3DA 4ZKSU 1HUTH 1ELAA 1GDQA 3ZZAA 2J2UA 1GBDA 2BDHA 1BRUP 3DHKH 2FPZA 4KTCA 2TGTA 1MAXA 6LPRA 1NT1A 2BD2A 5ESTE 3IWMA 1MKWK 4YLQH 2GZ8A 5JPMH 1XUKA 3RC4A 1P05A 3FZZA 1TLDA 4IMZA 1IHSH 1OSSA 5EOKA 2A0QB 1DWBH 1ZSJA 2EEKA 3MYWA 1QB6A 2GT7A 1RGQA 1YPLH 4NA8A 1ID5H 4CRFA 1Y5UT 4OS7A 4U2WA 1EP6A 2QYIA 1GG6C 4WXIA 4UFDH 1MKXK 1O2QA 4GUXA 1KXEA 1UTPA 1QL8A 3O8RA 3WY8A 2SGPE 3E0PB 1MTNC 4YTAA 1NFWA 1F92A 1FI8A 1SGRE 5A8YA 1LPGB 4AX9H 3NUMA 4BANB 2BVSH 4LZ4B 4X1NU 5F8TA 3TH4H 2ZG0H 1CBWB 1V3XA 4OGYA 2OTVA 4X1PU 2FODA 5EXMA 4BAMB 4Y79A 1H9LB 1G37A 3LGTA 1O3JA 2ZCLP 1Y3VA 5G4BA 3UREA 3DA9B 2EA3A 5AFZH 3LGIA 1PQ5A 4ZROA 1TX6A 3A88A 2ODPA 2ZHEH 1QJ1B 1UTLM 3IG6B 3SV9A 4FU9A 1DFPA 1JXPA 1H9HE 1O5DH 3SORA 2A32A 5DP5A 3KCGH 4YZUA 1GJCB 2DE9A 5IDKA 1SLUB 2FOFA 1C1WH 2VVUA 3MNXA 1DM4B 3LOXA 1N8OC 5GXPA 1TNIA 2GDEH 5DGJA 1SOTA 1MTWA 4AORA 3VB6A 4ISLA 1TGSZ 2Y81A 5GWZA 1NRSH 2PGBB 3ATLA 1BMMH 1TPOA 1ZGIA 3TLOA 3SJKA 3RM0H 1O2SA 2ZF0H 4BNRA 5F6MA 1SOZA 1C2KA 1CBWC 1J8AA 5FPYA 2BD9A 1SGFG 1SB1H 1FY4A 4GAWA 1GVLA 1QHRB 2G4TA 3TU7H 3EYDA 3ZZDA 1T8LA 3VXEH 5FXLA 1YCPH 3TJUA 2OC0A 4X2YA 3RXCA 1TMTH 1TRYA 1IQIA 1PQ7A 1ARCA 3VB4A 5E2PA 2OD3B 1QBVH 1W0YH 2J9NA 3F9FA 1OWJA 3AW0A 2V35A 2F9BH 2J38A 1ZTLA 1BIOA 2SNVA 3BEFB 1QA0A 5GDSH 1NN6A 1O5AB 5F8ZA 3TNTA 4CBNA 4Y76A 4ABDA 5TCCA 2W26A 1F5KU 1A3EH 1MKWH 4JZ1A 3TITA 1AKSB 2VIVA 1S85A 1UMAH 5AVDA 1P10A 3QDZB 3P17H 4AYYB 3LC3A 1Q2WA 1VR1H 3HGNA 5C1XA 1TGNA 1H9IE 3D62A 5JB9S 3OY5U 3MWIU 4B75A 3Q3KA 2OQ5A 2PKAB 3TIUA 4I33A 2WPJS 2BDCA 1SC8U 2HGTH 2ZNKH 5AF9H 2FOEA 3M7QA 3B23B 2AMPA 3QTOH 8GCHF 4DIHH 3SU5A 4INKA 4LZ1H 2R3UA 3RXUA 1V2NT 2FOBA 1WBGB 1RRKA 2GVFA 4Y6DA 4IBLH 3DFJA 4JYTA 1FIWA 1IQLA 2UUFB 1TNGA 1BTPA 3RU4E 4Y10E 1OKXA 1W12U 1AFEH 1EPTB 3LT3A 1C5YB 1BMNH 1TMBH 4K8YA 4M7GA 1K1PA 2ZFFH 1GBEA 3GDVA 4WY3A 2FEQH 5C1YA 4CR9A 1TFXA 1S84A 2CN0H 3D23A 3U1JB 1DXWA 1A2CH 7ESTE 3P8FA 2Y80A 4ZHLU 1BTHH 1MMJN 3GDUA 1GBLA 1C2GA 1GHZA 1E35B 1H8DH 3RXGA 2ZO3H 3MH4A 1IQGA 4A92A 3BSQA 2TPIZ 3S69A 1DY8A 2BVRH 2XC4A 4UEHH 3ZZ6A 3PWBA 2ZTXA 2BX4A 5DP3A 4Z0KA 2VU8E 4AZ2B 1HAVB 4BTTB 1G3CA 3MMGA 1AGJA 5LPFA 1HXFH 3TJVA 3RUOA 1Z1IA 4UE7H 3AAUA 1S5SA 1SLWB 2UUYA 3RXRA 1LKAA 4CHAC 1EOJA 1FZZA 3K65B 4DT7B 3NWUA 2JH5D 2AMQA 1WSSH 2EI8A 1GJ8B 1ARBA 4X8TH 4ABGA 1RS0A 1ETTH 1EPTC 4KGAA 1GCDA 3MH5A 4A6LA 3STIA 1F0TA 3ITIA 4Z6AH 5JBTA 1BA8B 1Y5BT 1NFYA 1LVMA 5GCHF 1JMOH 3FFGA 2FLBH 3SNAA 3SNEA 4A1VA 2PTCE 1UO6A 1GBJA 1TA2A 4FUFA 4R0IA 1P2JA 5FX6A 2J92A 1EJAA 3SNCA 1SGPE 1O2OA 1W7GH 3PM3A 1A1RA 2OC8A 1TWXB 4CH2B 2RG3A 1O36A 1E0FD 4D7FA 5EQQA 5K7RA 2BB4A 1EZQA 4NIXA 2P3FH 1FMGA 1SGEE 1G3EA 1HYLA 3M3TA 1GCTB 1B7XB 1C5RA 3RDZA 4KTUA 1HCGA 5E0HA 2NU1E 1O2UA 4XFQA 3U8TH 2AGGX 2D8WA 2BD4A 3UQVA 1W2KH 1EAIA 2BZ6H 2QAAA 1F5RA 5A8ZA 1EJMA 2THFB 1FONA 1FNIA 1FPCH 2F9OA 4ZH8A 1ESBA 1YLDA 1C1MA 1AFQB 2GP9B 1LQEA 4J2YB 4TWWA 1HLTH 2P95A 3FAOA 1ELEE 4ABJA 1PFXC 4AOQA 3O8CA 1FN6A 3SV2H 1FY8E 1GMCF 2Q6FA 4FUDA 4X1RU 1SGQE 1QNJA 2YNBA 2A7JA 1D3TB 4XOJA 1ACBE 1OYTH 5E0JA 2ILNA 1DUAA 2ZDAH 3VXFH 4D9RA 1NS3A 3U98H 1GI0A 2RA0A 1TPAE 1TRNA 1F7ZA 1GCTC 3ZYDA 1TALA 3BTEE 2R0KA 3E8LA 1HRTH 1DLEA 2R3YA 2XWBI 4ASHA 3PLBA 1BCUH 1N6YA 3PMHB 4Y71A 5C2ZA 2ZU5A 2C3SA 3A8BA 1H4WA 3I77A 4O97A 1NESE 2F9PA 2G00A 3DUXH 1GGDC 3OTJE 1C5WB 3BTQE 1A4WH 1T7CA 2FZZA 5LPEA 1NRQH 1SI5H 4FUEA 2VJ1A 1VCWA 1BBRK 1GI5A 4Y7AA 2VVVA 1V2VT 3GCHC 1ZGVA 4ABEA 3RXBA 3MOCA 1VITH 3UFAA 2ZHDA 2ZA5A 5JB8S 3V3MA 2FTMA 1D3DB 3EE0B 3EGKH 3EDXB 4WMEA 1LHDH 2OUAA 3ATIA 3TJOA 1FV9A 3TGIE 4IC5A 1J16A 2P3TB 3MO3A 4AFUA 1ZTJA 2ZIQH 2FX6A 1S0RA 1EOLA 4JCNA 4I7YH 1PPFE 4YO9A 3EAJA 1AI8H 1GBFA 4IGDA 1P01A 4AN7A 1GPZA 1C2HA 7LPRA 2VGCC 1PYTC 5EPYA 1FXYA 1A5IA 3SQEE 2WPIS 1JRTA 1B0EA 1O3AA 2ZDMA 2GCHG 3RXIA 5EXNA 1CGIE 3TGKE 3GICB 2PFEA 1QR3E 4D9QA 4BAHB 5AFYH 1E38B 4A5TS 5H4IB 2GMTB 2BY6X 1QJ6B 1EB1H 4GCHG 4UONA 1T8OA 4TWYA 4D7GA 2EI6A 3U1IB 1HIAB 2QGRA 1SQAA 3GY3A 1T8MA 2AMDA 2R9PA 4ZKRU 3BEIB 1WTGH 1P2IA 4TPYA 3RMOH 1P03A 2F83A 2GKVE 4H42U 3ZYEA 1O0DH 3F9HA 2VIQA 1MCTA 3FP6E 2FI5E 2CF9H 3PMJA 1GI6A 4JZEH 1W14U 1TQ7B 2H9HA 3A84A 2SGQE 5HM2A 3H7TA 1PQ8A 1GJ7B 1NZQH 1TBZH 1XX9A 2Y5HA 1OOKB 1KLTA 1XXDA 1DVAH 4FUGA 1EQ9A 3HPTB 3GY7A 1IQJA 2LNCA 3T2NA 4O9VA 1C5QA 2BLOA 4AB8A 2ANWA 1XVOA 2FOAA 1PQAA 1SSXA 1SMFE 3FP7E 4H6TA 3QZRA 4RSPA 3KQBA 4FU8A 1BJUA 4BXWA 8LPRA 1WQSA 1NFUA 2EI7A 1O3NA 1QBNA 3RU4T 1AB9B 3LH1A 2TBSA 4NZQA 3LH3A 2OBOA 1O2MA 4ZUHA 2AS9A 1C2JA 1MZDA 4OS4A 1E34B 1O2VA 3M36A 1D4PB 3L3TA 5EXLA 2Z9JA 1MTUA 2BD8A 3NPSA 1BBRH 1SBWA 6ESTA 2VINA 4Y11E 2BY9X 4MPWA 1W13U 1QB9A 2O9QA 2OC7A 3K2UA 2CGAA 4UD9H 1GJDB 1GHAF 1T32A 1THPB 3S0NA 1TQ0B 4JMYA 4DW2U 1V2OT 4MNWA 1DDJA 1BRCE 1Y59T 1THSH 3ZVAA 2WPMS 3RLYH 1HV7A 2VWOA 3OU0A 1O2RA 2ZU2A 1GMHF 1ABIH 1A5GH 1TRMA 3KIDU 5DJ7A 1AMHA 1MTVA 3TK6A 1ZRBA 1GJ6A 2PHBA 3BV9B 2Y5FA 1O3GA 5GIBA 1C5LH 4ZHMU 1PPZA 1PPCE 3VGCC 1QRWA 1V2UT 4AB9A 2AIQA 1YCPK 4AFZA 4MNYA 1UK2A 5K0HA 1EPTA 3A7ZA 5HYOA 2J4IA 4DVAU 2WUCA 5EU8A 3UIRA 1K1JA 1B5GH 1ELTA 1G2LA 1GI4A 1PPGE 1KXCA 4AGKA 1K1MA 2GX4A 1ZJDA 4NGAH 1HGTH 3Q3XA 2QIQA 1NO9H 5C1UA 4ISHH 4AG1A 1GMDF 4WMDA 5CHAB 1UTKA 3HKIB 5FX5A 3MFJA 1UK4A 1VCPA 3ZZ7A 5TJXA 3MO6A 5PTPA 3R3GB 1MQ6A 1HAVA 4X6PA 5FCRA 4NIYA 3A83A 3ZVGA 3NXPA 1BTUA 3JZ1B 1C2LA 1OYQA 2FLRH 5DP6A 1VZQH 1UTMA 1TOCB 2CHAB 1DS2E 2BZAA 2O8TA 5LPRA 2I6QA 1C5ZB 1D6WA 2XYAA 4Y0ZE 2SGFE 4DCDA 3MNSA 1LQDB 1KTSB 5JBBS 2B7DH 4BXSA 2H2ZA 2HLCA 3LJJA 1V2LT 1UTOA 4K8BA 5EW2H 5DPAA 2PUXB 1GJ4H 1CHGA 2FO9A 1V2MT 3LDXH 2UWLA 1C1UH 8GCHG 8ESTE 3CP7A 5CHAC 1S6FA 2Y5GA 2ZDNA 2FOCA 3EQ0H 1O5FH 4GPGA 5SGAE 2FS8A 3K6YA 2A7HA 2STAE 1C2FA 1FDPA 2GTBA 2WPHS 1XXFA 3PROA 1OS8A 4FUIA 3FZDA 4Y0YE 1SGDE 3AVZA 1AWHB 2JKHA 1RD3B 4A1XA 2LPRA 3ZZ3A 1HAXB 2FDAA 3SJ8A 2CHAC 1WOFA 4MPVA 5E0GA 2HOBA 1O38A 3BF6H 3L6PA 5AHGH 1P2OA 2FESH 3RXHA 2IN2A 4OS2A 1TYNA 3RXLA 2XBXA 1O2XA 3BTTE 1C2MA 3M35A 3P6ZB 1P09A 1XKBC 3MU4A 6GCHF 2V3OH 1C1SA 1C1NA 4JZFH 3O8DA 4ZXYH 1DX5M 3Q3YA 4HGCA 1A61H 3ELAH 1ETRH 1DITH 1S6HA 1O34A 4TYDA 1O3FA 4ABBA 1RJXB 2ZQ2A 1ZPCA 5DKMA 3SV8A 3A8DA 1V2TT 1YKTA 3QO6A 1EKBB 3RMMH 3BIUH 2NU4E 1GL0E 1QTFA 5CMXH 4B71A 3A7TA 1W7XH 3ZVEA 2FMJA 3LPRA 4VGCB 2C90B 1O2IA 2JETB 1D6RA 1ZMLA 1NTPA 1SFQB 2PKSB 1V2JT 9LPRA 1BDAA 3HK6B 5A0CA 1F0SA 7GCHF 2QXJA 4CRBA 1C1QA 1DSUA 2RDLA 1LPKB 2ZHFH 5GCHG 1ELBA 3HGPA 4OGXA 3DD2H 1MU8B 1NRNH 3BIVH 1AUJA 3TGJE 2A7CA 1KSNA 2DE8A 1HB0B 1LHEH 1CO7E 1WUNH 2A1DB 1MTSA 1AQ7A 2F91A 2AERH 2A2XH 2NU3E 3EA8A 4XDEA 3SGAE 1WV7H 3SUDA 1O32A 1P3CA 1FY3A 7KMEH 4AFSA 2PWXA 3LKWA 2VIDA 3SU1A 2QF3A 1EJNA 1DT2A 2BHGA 2BOKA 3VB5A 1SVPA 1MH0A 1QBOA 2ZTYA 1TNJA 2OC1A 2BMGB 4K2YA 2BX3A 1L4ZA 1BHXF 1GBAA 4X2VA 1V6DA 3ZZCA 3JZ2B 3NK8A 2BVXH 1FY5A 2JETC 1DANH 3F9GA 4Q7XA 1V2ST 3RXJA 2QXIA 1DUEA 4J1YA 1Z8JB 5DP4A 2QN5T 4UDWH 2H5CA 1SFIA 1UJ1A 1IHTH 3G01A 5C5NA 4UFEH 4ZKOU 2D26C 8KME2 2SFAA 3RXSA 2ZGXH 1WCZA 1YPHC 1WTHD 2FYQA 2HNTC 1GMCG 1UTJA 3SU2A 1NRPH 4ESTE 1SHYA 1C4V2 1TNKA 3BN9A 1C5SA 4B2CA 1KDQB 4X1QU 3STJA 2OCVB 4WJG2 1K1NA 1N1LA 1HIAA 1SGTA 5A0BA 3TK9A 2BLQA 2A31A 4ISNA 5DP8A 1BTZA 5DG6A 2AGEX 4FUJA 1P0SH 1NC6A 3LC5A 4I8HA 3U69H 1D9IA 2WUBA 2BXTH 1SQOA 4XSKU 1XUJA 2G5VA 2ZPRA 1AIXH 1K21H 4YM9A 5JBCS 1HJAB 1Z8RA 1AWFH 2PW8H 1YPEH 2QF0A 4A7IB 1NU9A 1UK3A 1ZHPA 1F5LA 3QX5H 2ZEBA 1O3IA 3RXDA 4CRGA 4Y8ZA 3SUGA 3MTYA 3RXPA 1BTXA 1FY1A 1H1BA 1O35A 4MPXA 3IITA 1FAXA 2P94A 1JRSA 5FBIA 1O2ZA 1ANBA 1VITF 1CT0E 2ZFTA 2W5EA 1O2KA 4O3TA 4X8VH 3P70B 2W3IA 3KN2A 1B0FA 1HFDA 5FHTA 1HXEH 1TOMH 3ZZ9A 3KQEA 3UOPA 3ZZ4A 1JOUB 2B0FA 2AFQB 3ODDA 2BDBA 4NCYA 4B2BA 1Q3XA 2G4UA 1FAKH 4K5ZA 1QGFA 1O2TA 2ZTZA 3ATKA 1PPBH 4ZMAH 2TGPZ 2ZDKA 1EZSC 5A8XA 4CREA 2BXUH 1NFXA 2GZ9A 1AY6H 1A0LA 1GBTA 2H1UA 2Q6GA 1G2MA 1UCYK 1EP5A 2M5TA 2VIOA 4JK5A 1KXDA 4GVUA 1EAUA 5DO4H 4U30A 1HPGA 2CV3A 2EC9H 4B74A 2QC2A 2RA3A 1ZJKA 1RTFB 1Y3XA 1SLVB 5C5OA 1VJ9U 2W3KA 4ZXXH 3TH3H 3M3VA 1TNLA 4WF8A 1O3MA 3URDA 2Z6BD 5EG4A 4ABFA 2BD5A 3VPKA 5HXFA 2VWLA 5B6OA 3SOSA 1XUHA 1ZYOA 3ZVFA 4MNXA 3SNBA 4JK6A 3T26A 3PTBA 4B76A 1LKBA 3GY5A 1FLEE 1K22H 5JYIA 4H4FA 1DPOA 4B2AA 2ULLA 2ZFSA 1CGJE 4MTBA 4OS6A 2ZQ1A 1HBTH 3BTDE 2QY0B 3E3TA 4FVBA 1BITA 3M7TA 3L33A 3A89A 1YPMH 1VJAU 1WYKA 3MHWU 1AFQC 3SGBE 3MU5A 3MU8A 3H7OA 1ESTA 1TX8A 2CJIA 3LJOA 4XBDA 1BMAA 1C2EA 2ZFQH 1GI9B 1AVXA 1GDUA 1NY22 1TIOA 1W8BH 5ETXA 3OY6U 3MO9A 1MZAA 3S7HB 1W3CA 3GYMA 1Y5AT 5ABWA 1S81A 2BOHB 1IQEA 4KTSA 3RXOA 3RXKA 2ODYB 2Y7XA 3KL6A 2PLXA 3HKJB 3RXQA 2FOHA 3DFLA 3M5LA 2Z9IA 1BMLA 1C4U2
chains in the Genus database with same CATH superfamily
2XC5A 4KKDA 3CS0A 5T6FA 2OXSA 4NSVA 3FP8E 2I6SA 3F6UH 4P02A 1GDNA 1LO6A 1LHGH 3S9BA 3UQOA 1GHAG 1AZZA 2AGIX 2GCTB 3TK5A 3VB3A 3FVFB 1GJAB 5LH8A 3SW2B 4DIIH 1J14A 1GBBA 1QRZA 1WQVH 2ZCHP 3M5MA 1DE7H 1SGFA 4B6FA 1O3BA 4DJZB 1OPHB 2AEIH 3A7XA 4LXBH 1GMHG 3U8RH 2A4GA 4WWYA 1YGCH 1AE8H 1IQNA 2O8UA 1HAGE 4IW4E 3E1XB 2STBE 1AVWA 1PPHE 1VGCB 2ZDLA 1Z7KA 2ZFRH 4ISOA 3UY9A 1LDTT 2BDAA 1O2GH 4FXGH 3AASA 2R2WU 4ABHA 4KELA 1OWEA 1XUFA 1UCYH 3SNDA 1ZOMA 2ZWLH 1OXGA 1PPEE 5LGOA 2J34A 1HDTH 2P59A 3PB1E 1OP0A 1WAYB 1DWDH 1IAUA 1FN8A 5HM9A 2C8XB 1C4Y2 3PLKA 2ANMH 2P8OB 3NZIA 3SU6A 2FX4A 2JDID 4E05H 2C8YB 2PR3A 2WPLS 5IYTA 1A3BH 2DUCA 5DP7A 2VIWA 2CXVA 1ELCA 1GMDG 3SJOA 5HMAA 2FXRA 2HWLB 3OX7U 2WINI 2IOTA 1P2MA 2VBCA 3GCTF 5GJ4B 5EJ1A 3PV4A 1HJ8A 1YPHE 1EB2A 1SGNE 2BQ6B 1C5OH 2F3CE 4ZAEA 2GMTC 2HNTE 3VB7A 2TRMA 2C93B 2QCYA 1BQYA 1UHBB 2BQWB 2ZHWH 4Y7BA 1QQ4A 1GBMA 1VGCC 3UTUH 6CHAB 1IQFA 4NIWA 3RXEA 1OX1A 1ZZZA 4WH8A 4YXWD 1FIZA 1T4VH 3BTME 4NIVA 2KX4A 1KIGH 5F8XA 1AZ8A 2HALA 4ISIH 4JZDH 5F03A 4GHQA 3K6ZA 1C1OA 3LONA 1AE5A 1J9CH 3ZVDA 2XBVA 3WWFA 3QGNB 2ZHQH 2FM2A 3F2FA 1EAXA 1Q31A 4D8NA 1AKSA 2G52A 1TBQH 2KAIB 4NFEA 4CBOA 1P57B 4FOUC 5CHBA 5HGGA 2ZFPH 1OP2A 3CENA 1JIRA 1QIXB 2PSXA 2OP9A 4YOIA 2ZGHA 4AYVB 1WXRA 3B9FH 3KQDA 1BUIA 2ZECA 1O3LA 1YCPM 3S9CA 1BBRE 2K8IA 2PKAA 1THRH 1O2HA 1DOJA 1O3PB 2B5TB 2BLVA 3N99A 1MUEB 4TPIZ 3HATH 4AC9A 2SNWA 2KR7A 3P8OA 3MI4A 1TE0A 1ELVA 3MH7A 1RFNA 2ZU4A 4H6SB 2XWAA 3BTKE 3UOUA 3D65E 1U6QA 3URCA 3PMAB 3ENSB 2J95A 3QZQA 1NU7B 4NFFA 3DSPA 1AB9C 1P2NA 1G36A 1O3HA 1W0JD 1YM0A 3V7TA 3B8JA 3A82A 4JYVH 2QV1A 3LGWA 5KEDA 4IS5A 3OEHD 1OP8A 4NG9H 1DXPA 5A2MH 5T6GA 1YPKH 2NWNA 1TABE 3Q77A 1KXFA 1GHBF 5FBEA 1LHFH 2AH4X 1Y3YA 3MU1A 1Z6EA 1YWUA 3F2HA 2XTTB 6GCHG 2VWNA 1SHHB 4Q63A 3T29A 1MABB 1ZPBA 1BJVA 1GG6B 1TX7A 1O2NA 2P3UB 1O5EH 5L30H 4I8KA 4LOYH 4INHA 2H5DA 1COWD 1J17T 1KLIH 4GLYA 5A0AE 4HFPB 4I8JA 1TONA 1C5NH 2UUJB 1Z6JH 2G81E 1L4DA 1BHXB 1XMNB 4BAQB 5IK2D 2VVCA 2H9TH 3E91A 1CHOF 1HAIH 1W10U 4AGJA 4CRAA 2WV5A 2C8ZB 4KP0A 1TGBA 3SHCH 2ZCKP 3ATWA 3MH6A 2XW9A 1C2IA 7GCHG 4Q7YA 5CDFE 3UWJH 3DT0H 1W0ZU 1GHWH 4YOJA 4Z1MD 1FUJA 2EQNA 1DSTA 2TGAA 1V2KT 1SLXB 1K2I1 1ANEA 3LGVA 3DSGA 3P8GA 4I8LA 1TGTA 1TPSA 3SU3A 2Z9LA 4NA7A 4O3UA 1OWHA 2V6NA 1EFRD 1S83A 4X1SU 3U8OH 2RCEA 1AD8H 9ESTA 4XE4A 3T28A 1F2SE 1C9TA 2FI3E 1N8OB 1L0ZA 3GY4A 3SO3A 4K1TA 4JYUH 2A5IA 2JH6D 1JBUH 2FWWA 1T31A 2A4QA 2BDGA 5L2ZH 3N7OA 1AN1E 1IOEA 1QB1A 3KGPA 3T5FH 1D3QB 3UUZA 1VKYA 2ALPA 3UR9A 2ODQA 1T4UH 1N6XA 2BY5X 4AG2A 5FPSA 3CS7A 1O2PA 3GYLB 3M3SA 1QCPA 3ATMA 2WPKS 1GHVH 1QQUA 1E36B 2A5AA 4X8UH 4ABAA 5BPEA 3Q00A 2ASUB 3A8AA 1GVZA 1KTTB 3A81A 3M5NA 1OWIA 2Z9KA 1C9PA 4YLUA 2Y6TA 3QLPH 4CRDA 1HAYB 3A80A 3TNSA 2ZP0H 3ZV9A 2VIPA 1O3KA 2ZKSA 3NCLA 1UVSH 3M7UA 4K1SA 5CE1A 1NBME 4OS1A 3GISB 1S82A 2C8WB 2VWMA 1CGHA 3FOAA 1QURH 3SUFA 1C5MD 1P11E 1V2WT 2FOMB 2GV6A 2SGAA 3RP2A 4K3JA 3U9AH 4TT3D 1HAHH 2ZPQA 1TB6H 2XC0A 2C4FH 2NU0E 1ZHMA 3S7KB 2A2QH 4Q80A 4RN6A 1BT7A 2G5NA 1DY9A 4NSYA 3SZNA 3H5CB 2FP7B 2LELA 3T25A 2Z7FE 1LCYA 3FKSD 2V3HH 3BG8A 4HTCH 3MNCA 1C5PA 2NU2E 1P9SA 4DY7B 1Z1JA 1SQTA 1TA6A 1C1RA 3A7YA 2BYAX 3OE7D 3VFEA 2BD7A 3F1SB 3SGQE 2IPQX 4QT8C 3KNXA 5J4QA 1YP9A 3P8NA 4TSFD 1IQMA 1C1VH 1H8IH 1VITG 2A45B 4R8TB 1TMUH 1CVWH 3S9AA 3PTNA 1ANCA 1O3EA 1ZMNA 1IQHA 3PWCA 1A7SA 1LTOA 1P06A 1Y8TA 5TCAA 3MU0A 3ZZ8A 1K0HA 1FJSA 2CMYA 2FYRA 1CT2E 1YYY1 5EPNA 2WV4A 4MQAA 3SJ9A 1GI3A 1UVTH 1YC0A 3UWIA 1C1PA 1D3PB 1GBCA 4UFGH 1JIMA 5L2YH 2YNAA 3ODFA 2OQUA 1EASA 2W7UA 1P02A 4CH8B 1P2KA 3VEQB 1G3DA 2SGDE 1K28D 3DCLA 3SBKA 4RT1A 4DOQA 4X0WU 3O8BA 4BAKB 5DN6D 4BTIB 3EA7A 2J98B 4VGCC 4FUBA 1LHCH 1P2QA 1C5UA 1K1OA 1MKXH 2PKSC 4I32A 1OWKA 2XCNA 2TGDA 3A86A 1LVBA 1JWTA 3KYGA 1YY3A 2HRVA 4CHAB 3AW1A 1KXAA 1QY6A 1BOQA 1WDIA 1CSOE 2J94A 4MDSA 1XUGA 4MG3A 1BTYA 5J4SA 4YOGA 2Z94A 3BTGE 1EATA 4GSOA 2Z3EA 4TY7A 2BD3A 5C0TA 1AUTC 1KYNA 2K0QA 3OYPA 4BAOB 1MU6B 1C1TA 1QA7A 1ZLRA 2BTCE 1ZTKA 1C5TA 4O03A 5KECA 1NRRH 2AYWA 1TPPA 2ZGJA 1SGCA 3LIWA 4INLA 4X6MA 1ZPZA 1GI8B 2G51A 5C3NA 5A09A 3I78A 2ANYA 3OFND 2WYJA 1TAWA 2XRCA 1NROH 1V2QT 3E0NB 3SV6A 2H6MA 4CR5A 1ELDE 3KQCA 4X8SH 2VH6A 5E8EH 3RM2H 3GCOA 3Q76A 3E90B 3KF2A 5FCKA 1HJ9A 1QL7A 4IN1A 1O3OA 4I31A 2GGVB 1DICA 2ZDVH 4AFQA 2Z9GA 1AU8A 1DWEH 3QUMP 5FPTA 3UPEA 1INCA 2QE7D 1DLKB 2UUKB 1GL1A 1L1NA 3GY6A 1J15A 4ZCNA 1F0RA 2BY8X 2KFWA 1UHBA 2SGEE 1CT4E 1XM1A 2FS9A 1EXFA 5HIYA 1YLCA 3E16B 1ZHRA 2BDYA 4F48B 1GVKB 1O5GH 2B9LA 3GCNA 5C67A 4Y8XA 3PO1B 3KHVA 1XVMA 4ZKNU 1O5CB 1ABJH 2VNTA 1XUIA 1MD7A 2ZU1A 4WXVA 1M9UA 2W7SA 3M5OA 4HZHA 2AIPA 1HJAC 3TJNA 3AAVA 4YT7H 1O39A 1LPZB 3R0FA 1HAPH 1V2RT 2KAIA 1CA8B 1T8NA 4E7NA 2HPQH 2R2MB 2JJ2D 2OINA 5L6NH 1EZUC 1QJ7B 1LVOA 1CA0B 1Y3UA 4X6NA 3QWCH 1MBMA 2A5KA 1PJPA 3UNSA 3RXMA 5JBAS 1RTLA 3A7WA 1GBKA 4IC6A 1X7AC 2ANKH 5EJZA 2YMSC 1SQRA 1UVUH 4LK4A 1BRBE 5EODA 2A4OA 1Z71A 3QN7A 2PUQH 1RIWB 3LU9B 1GGDB 5I46H 1MAYA 1TGCA 2AHME 1P12E 4ZHAA 2ZPSA 4MPUA 3PO1C 1O33A 2QXGA 4YESB 1PYTD 3GCHB 3C1KA 2A4RA 2XNIA 4PROA 5FAHA 1W11U 2HNTF 1BRAA 3RMNH 1AHTH 1O30A 3PMBB 2GDDA 1OWDA 1VCQA 1QFKH 1CQQA 2HVXA 3U28C 2IPHA 1C5XB 1CU1A 1O2YA 4Q2KA 1QZ8A 3GCTG 3GDSA 3D49H 3M37A 1SG8B 1CA0C 4X2XA 4YT6H 3SUEA 1P04A 2BQ7B 4RKJB 1O31A 2Y7ZA 3SQHE 1Y3WA 3K9XB 4Y8YA 1BTWA 2O8LA 4XBBA 2VGCB 4SGBE 1AVGH 1MCVA 5EQSA 5HIZA 1YPGH 2QA9E 1SL3A 4THNH 1RIWC 1RXPA 3RXTA 1P3EA 2ZGCA 1QL9A 1P9UA 1AO5A 4E06H 4NWKA 3BTFE 3ZVBA 1GI2A 3M61U 4FUCA 1EX3A 1O5BB 2OBQA 2ZGBH 3V12A 2GV7A 3RXFA 3PLPA 4D76A 3QTVH 3PYHA 1NM6A 4MVNA 5JDUB 3P95A 2F9VA 1DWCH 3HK3B 2VB0A 4DURA 2BM2A 1ZR0A 1ESAA 1TBRH 2PV9B 3ZZ5A 3SHAH 5EW1H 4WH6A 1NPMA 1BMFD 3OEED 2XBWA 1MD8A 4IMQA 3UNRA 2OLGA 2F4LA 4JZIA 1O2LA 5C20A 1BZXE 4X6OA 4NWLA 1RTKA 3RU4D 3BTHE 2BY7X 1EAWA 2GZ7A 1XKAC 1YPJH 1GJ9B 2D2DA 3MNBA 1K1IA 3ZIAD 2FOGA 1HAZB 1Z8IB 1KY9A 1HAOH 4RKOB 1ZMJA 2J5UA 1O2JA 3OSYA 4MLFB 1ZRKA 1UVPA 3T62A 1SGYE 1ORFA 2CF8H 2PP6A 3BEUA 4HI3A 3V0XA 1K9OE 1ANDA 3GOVB 3BTWE 2H9EH 2G55A 2VH0A 3UNQA 4E7RG 3T27A 3GY8A 3F0OA 1GHBG 1L1GA 4X2WA 4BTUB 1BB0B 2BDIA 2B8OH 2Q6DA 4TY6A 2M2AA 4GHTA 5KGOA 1ELFA 4FU7A 1EUFA 3SV7A 1K1LA 1EZXC 1Z8GA 5T3HA 3FANA 1ELGA 1UCYE 2GCTC 3LGUA 1G32B 1QRXA 2UWOA 4MNVA 3SI4H 2ALVA 5EJLA 3SI3H 3A87A 2P16A 1ZSKA 2PGQB 2TIOA 5DSFA 4K69A 3RXVA 2F9NA 4SGAE 1ETSH 1WU1A 3TH2H 2FTLE 4XBCA 2XCFA 3BG4B 2JH0D 1SPJA 1A5HA 4F4OC 3NKKA 1HNEE 2Q1JA 4CRCA 2YOLA 2HVYB 1CHOG 2BLWA 4BOHA 5E2OA 1LVYA 4DT4A 5I25A 4NA9H 3SN8A 5F53A 2GT8A 1YBWA 4U01A 2QXHA 2UWPA 2HPPH 5BRRE 1SR5C 2O8MA 3LGYA 4DG4A 1FQ3A 2V0BA 1O3CA 2IJOB 5T6DA 3I29A 4IN2A 3ZVCA 3E6PH 2R0LA 1A0JA 1GI7B 4U32A 1MBQA 4ABIA 1ZSLA 4OS5A 3TPIZ 2PTNA 3GY2A 2GD4B 2P8OC 1L1JA 1O37A 1SGIB 4F49A 3VGCB 1G9IE 5ESBA 5HKKD 3ESTA 4FUHA 3QK1A 4K1EA 2ESTE 4B73A 1A46H 5B6LA 1E37B 3RMLH 1KXBA 2XBYA 4Q7ZA 3N7EA 1YF4A 2P93A 3F68H 1GI1A 2W6ID 3W94A 1L2EA 1A0HB 2K1QA 1GWAA 4FVDA 3RC5A 3KEEA 3RXAA 1C2DA 2ZU3A 3BG4C 3F9EA 1GJBB 3DSOA 1G30B 2WYGA 1P8VC 3FO8D 5EQRA 3ZZBA 1LMWB 3KQ5A 3UR6A 6CHAC 4NZLA 2KCPA 3ZV8A 2ZI2H 3RC6A 3QGJA 2F9UA 1S0QA 4A1TA 1F0UA 1MQ5A 2FI4E 1UVOA 1GBIA 3SU0A 1GJ5H 3P92A 3RLWH 2GCHF 1V2PT 2J98A 1GBHA 5DK1A 1TNHA 1GHXH 3C27B 4B1TA 2Y82A 3SJIA 1UTQA 3A85A 4WMFA 1SKYE 1O3DA 3A8CA 3V13A 3EE7A 4GCHF 1IQKA 5GPIB 4WVPE 5DP9A 2Z3CA 4I8GA 4UFFH 2ZC9H 1O2WA 1UTNA 2FIRH 3TVJB 3OAAD 1GHYH 2XXLA 1KLJH 2ZZUH 5EGMA 2PSYA 2WHXA 2WV9A 3A7VA 4K60A 3SU4A 1KDQA 2O8WA 1MTNB 1G3BA 1W0KD 1C5VA 3W95A 2G8TA 1FPHH 3EA9A 1CE5A 2D1JA 4DGJA 2Z3DA 4ZKSU 1HUTH 1ELAA 1GDQA 3ZZAA 2J2UA 1GBDA 2BDHA 1BRUP 3DHKH 2FPZA 4KTCA 2TGTA 1MAXA 6LPRA 1NT1A 2BD2A 2HLDD 5ESTE 3IWMA 1MKWK 4YLQH 2GZ8A 5JPMH 1XUKA 3RC4A 1P05A 3FZZA 1TLDA 4IMZA 1IHSH 1OSSA 5EOKA 2A0QB 1DWBH 1ZSJA 2EEKA 3MYWA 1QB6A 2GT7A 1RGQA 1YPLH 4NA8A 1ID5H 4CRFA 1Y5UT 4OS7A 4U2WA 1EP6A 1S6LA 2QYIA 3W1EA 1GG6C 4WXIA 4UFDH 2L6OA 1MKXK 1O2QA 4GUXA 1KXEA 1UTPA 1QL8A 2L74A 3O8RA 3WY8A 2SGPE 3E0PB 1MTNC 4YTAA 1NFWA 1F92A 1FI8A 3F2GA 1SGRE 5A8YA 1LPGB 4AX9H 3NUMA 4BANB 2BVSH 4LZ4B 4X1NU 5F8TA 3TH4H 2ZG0H 1CBWB 1V3XA 4OGYA 2OTVA 4Q4LA 4X1PU 2FODA 5EXMA 4BAMB 1E79D 4Y79A 1H9LB 1G37A 3LGTA 2OK5A 1O3JA 2ZCLP 1UW7A 1Y3VA 5G4BA 3UREA 3DA9B 2EA3A 5AFZH 3LGIA 1PQ5A 4ZROA 1TX6A 3A88A 2ODPA 2ZHEH 1QJ1B 1UTLM 3IG6B 3SV9A 4FU9A 1DFPA 1JXPA 1H9HE 1O5DH 3SORA 2A32A 5DP5A 3KCGH 4YZUA 1GJCB 2DE9A 5IDKA 1SLUB 2FOFA 1C1WH 2VVUA 3MNXA 1DM4B 3LOXA 1N8OC 5GXPA 1TNIA 2GDEH 5DGJA 1SOTA 1MTWA 4AORA 2JIZD 3SZEA 3VB6A 4ISLA 1TGSZ 2LP6A 2Y81A 5GWZA 1NRSH 2PGBB 3ATLA 1BMMH 1TPOA 1ZGIA 3TLOA 3SJKA 3RM0H 1O2SA 2ZF0H 4BNRA 5F6MA 2KCYA 1SOZA 1C2KA 1CBWC 1J8AA 5FPYA 2BD9A 1SGFG 1SB1H 1FY4A 4GAWA 1GVLA 1QHRB 2G4TA 3TU7H 3EYDA 3ZZDA 1T8LA 3VXEH 5FXLA 1YCPH 3H09A 3TJUA 2OC0A 4X2YA 3RXCA 1TMTH 1TRYA 1IQIA 1PQ7A 1ARCA 3VB4A 5E2PA 2OD3B 1QBVH 1W0YH 2J9NA 3F9FA 1OWJA 3AW0A 3NRLA 2V35A 2F9BH 2J38A 1ZTLA 1BIOA 2SNVA 3BEFB 1QA0A 5GDSH 1NN6A 1O5AB 5F8ZA 3TNTA 4CBNA 4Y76A 4ABDA 5TCCA 2W26A 1F5KU 1A3EH 1MKWH 4JZ1A 3TITA 1AKSB 2VIVA 1S85A 1UMAH 5AVDA 1P10A 3QDZB 3P17H 4AYYB 3LC3A 1Q2WA 1VR1H 3HGNA 5C1XA 1TGNA 1H9IE 3OTPA 3D62A 5JB9S 3OY5U 3MWIU 4B75A 3Q3KA 2OQ5A 2PKAB 3TIUA 4I33A 2WPJS 2BDCA 1SC8U 2HGTH 2ZNKH 5C0UA 5AF9H 2FOEA 3M7QA 3B23B 2AMPA 3QTOH 8GCHF 4DIHH 3SU5A 4INKA 4LZ1H 2R3UA 1H8ED 3RXUA 1V2NT 2FOBA 1WBGB 1RRKA 2GVFA 4Y6DA 4IBLH 3DFJA 4JYTA 1FIWA 1IQLA 2UUFB 1TNGA 1BTPA 3RU4E 4Y10E 1OKXA 1W12U 1AFEH 1EPTB 3LT3A 4B6EA 1C5YB 1BMNH 1TMBH 4K8YA 4M7GA 1K1PA 2ZFFH 1GBEA 3GDVA 4WY3A 2FEQH 5C1YA 4CR9A 1TFXA 1S84A 2CN0H 3D23A 3U1JB 1DXWA 1A2CH 7ESTE 3P8FA 2Y80A 4ZHLU 1BTHH 1MMJN 3GDUA 1GBLA 1C2GA 1GHZA 1E35B 1H8DH 3RXGA 2ZO3H 3MH4A 1IQGA 4A92A 3BSQA 2TPIZ 2JJ1D 3S69A 1DY8A 2BVRH 4XD7D 2XC4A 4UEHH 3ZZ6A 3PWBA 2ZTXA 2BX4A 5DP3A 4Z0KA 2VU8E 4AZ2B 1HAVB 4BTTB 1G3CA 3MMGA 1AGJA 5LPFA 1HXFH 4I86A 3TJVA 3RUOA 1Z1IA 4UE7H 3AAUA 1S5SA 1SLWB 2UUYA 3RXRA 1LKAA 4CHAC 1EOJA 1FZZA 3K65B 4DT7B 3NWUA 2JH5D 2AMQA 1WSSH 2EI8A 1GJ8B 1ARBA 4X8TH 4ABGA 1RS0A 1ETTH 1EPTC 4KGAA 1GCDA 3MH5A 4A6LA 3STIA 1F0TA 3ITIA 4Z6AH 5JBTA 1BA8B 1Y5BT 1NFYA 1LVMA 5GCHF 1JMOH 3FFGA 2FLBH 5GNDA 3SNAA 3SNEA 4A1VA 2PTCE 1UO6A 1GBJA 1TA2A 4FUFA 4R0IA 1P2JA 5FX6A 2J92A 1EJAA 3SNCA 1SGPE 1O2OA 1W7GH 3PM3A 3SYJA 1A1RA 2OC8A 1TWXB 4CH2B 2RG3A 1O36A 1E0FD 4D7FA 5EQQA 5K7RA 2BB4A 1EZQA 4NIXA 2P3FH 1FMGA 1SGEE 1G3EA 1HYLA 3M3TA 1GCTB 1B7XB 1C5RA 3CNRA 3RDZA 4KTUA 1HCGA 5E0HA 2NU1E 1O2UA 4XFQA 3U8TH 2AGGX 2D8WA 2BD4A 3UQVA 1W2KH 1EAIA 2BZ6H 2QAAA 1F5RA 5A8ZA 1EJMA 2THFB 1FONA 1FNIA 1FPCH 2F9OA 4ZH8A 1ESBA 1YLDA 1C1MA 1AFQB 2GP9B 1LQEA 4J2YB 4TWWA 1HLTH 2P95A 1NBMD 3FAOA 1ELEE 4ABJA 1PFXC 3KYFA 4AOQA 3O8CA 1FN6A 3SV2H 1FY8E 1GMCF 2Q6FA 4FUDA 4X1RU 1SGQE 1QNJA 2YNBA 2A7JA 1D3TB 4XOJA 1ACBE 3UB0A 1OYTH 5E0JA 2ILNA 1DUAA 2CK3D 2ZDAH 3VXFH 4D9RA 1NS3A 3U98H 1GI0A 3F3BA 3UAIC 2RA0A 1TPAE 1TRNA 1F7ZA 1GCTC 3ZYDA 1TALA 3BTEE 2R0KA 3E8LA 1HRTH 1DLEA 2R3YA 2XWBI 4ASHA 3PLBA 1BCUH 2XOKD 1N6YA 3PMHB 4Y71A 5C2ZA 2ZU5A 2C3SA 3A8BA 1H4WA 3I77A 4O97A 1NESE 2F9PA 2G00A 3DUXH 1GGDC 3OTJE 1C5WB 3BTQE 1A4WH 1T7CA 2FZZA 5LPEA 1NRQH 1SI5H 4FUEA 2VJ1A 1VCWA 1BBRK 1GI5A 4Y7AA 2VVVA 1V2VT 3GCHC 1ZGVA 4ABEA 3RXBA 3MOCA 1VITH 3UFAA 2ZHDA 2ZA5A 5JB8S 3V3MA 2FTMA 1D3DB 2QF4A 3EE0B 3EGKH 3EDXB 4WMEA 1LHDH 2OUAA 3ATIA 3TJOA 1FV9A 3TGIE 4IC5A 1J16A 2P3TB 3MO3A 4AFUA 1ZTJA 2ZIQH 2FX6A 1S0RA 1EOLA 4JCNA 4I7YH 1PPFE 4YO9A 3EAJA 1AI8H 1GBFA 4IGDA 1P01A 4AN7A 1GPZA 1C2HA 7LPRA 2VGCC 3PRBA 1PYTC 5EPYA 1FXYA 1A5IA 3SQEE 2WPIS 1JRTA 1B0EA 1O3AA 2ZDMA 2GCHG 2KCOA 3RXIA 5EXNA 1CGIE 3TGKE 3GICB 2PFEA 1QR3E 4D9QA 4BAHB 5AFYH 1E38B 4A5TS 5H4IB 2GMTB 2BY6X 1QJ6B 1EB1H 4GCHG 4UONA 1T8OA 4TWYA 4D7GA 2EI6A 3U1IB 1HIAB 2QGRA 1SQAA 3GY3A 1T8MA 2AMDA 2R9PA 4ZKRU 3BEIB 1WTGH 1P2IA 4TPYA 3RMOH 1P03A 2F83A 2GKVE 4H42U 3ZYEA 1O0DH 3F9HA 2VIQA 1MCTA 3FP6E 2FI5E 2CF9H 3PMJA 3N7DA 1GI6A 4JZEH 1W14U 1TQ7B 2H9HA 3A84A 2SGQE 5HM2A 3H7TA 3WW7A 1PQ8A 1E1QD 1GJ7B 1NZQH 1TBZH 1XX9A 2Y5HA 1OOKB 1KLTA 1XXDA 1DVAH 4FUGA 1EQ9A 5FL7D 3HPTB 3GY7A 1IQJA 2LNCA 3T2NA 4O9VA 1C5QA 2BLOA 4AB8A 2ANWA 1E1RD 1XVOA 2FOAA 5C94A 1PQAA 1SSXA 1SMFE 3FP7E 3PV5A 4H6TA 3QZRA 4RSPA 3KQBA 4FU8A 1BJUA 4BXWA 8LPRA 1WQSA 1NFUA 2EI7A 1O3NA 1QBNA 3RU4T 1AB9B 3LH1A 4ACAA 2TBSA 4NZQA 3LH3A 2OBOA 1O2MA 4ZUHA 2AS9A 1C2JA 1MZDA 4OS4A 1E34B 1O2VA 3M36A 1D4PB 3L3TA 5EXLA 2Z9JA 1MTUA 2BD8A 3NPSA 1BBRH 1SBWA 6ESTA 2VINA 4Y11E 2BY9X 4MPWA 1W13U 1QB9A 2O9QA 2OC7A 4ASUD 3K2UA 2CGAA 4UD9H 1GJDB 1GHAF 1T32A 1THPB 3S0NA 1TQ0B 4JMYA 4DW2U 1V2OT 4MNWA 1DDJA 1BRCE 1Y59T 1THSH 3ZVAA 2WPMS 3RLYH 4F55A 1HV7A 2VWOA 3OU0A 1O2RA 2ZU2A 1GMHF 1ABIH 1A5GH 1TRMA 3KIDU 4OM9A 1AMHA 5DJ7A 1MTVA 3TK6A 1ZRBA 1GJ6A 2PHBA 3BV9B 2Y5FA 1O3GA 5GIBA 1C5LH 4ZHMU 1PPZA 1PPCE 3VGCC 1QRWA 1V2UT 4AB9A 2AIQA 1YCPK 4AFZA 4MNYA 1UK2A 5K0HA 1EPTA 3A7ZA 5HYOA 1H8HD 2J4IA 2WZQA 4DVAU 2WUCA 5EU8A 3UIRA 1K1JA 1B5GH 1ELTA 1G2LA 1GI4A 1PPGE 1KXCA 4AGKA 1K1MA 2GX4A 1ZJDA 4NGAH 1HGTH 3Q3XA 2KZ4A 2QIQA 1NO9H 5C1UA 4ISHH 4AG1A 1GMDF 4WMDA 5CHAB 1UTKA 3HKIB 5FX5A 3MFJA 1UK4A 1VCPA 3ZZ7A 5TJXA 3MO6A 5PTPA 3R3GB 1MQ6A 1HAVA 4X6PA 5FCRA 4NIYA 3A83A 3ZVGA 3NXPA 1BTUA 3JZ1B 1C2LA 1OYQA 2FLRH 5DP6A 1VZQH 1UTMA 1TOCB 2CHAB 1DS2E 2BZAA 2O8TA 5LPRA 2I6QA 2QF5A 1C5ZB 1D6WA 2XYAA 4Y0ZE 2SGFE 4DCDA 3MNSA 1LQDB 1KTSB 5JBBS 4XRNA 2B7DH 4BXSA 1OHHD 2H2ZA 2HLCA 3LJJA 1V2LT 5C17A 1UTOA 4K8BA 2V3MA 5EW2H 5DPAA 2PUXB 1GJ4H 1CHGA 2FO9A 1V2MT 3LDXH 2KCAA 2UWLA 1C1UH 8GCHG 8ESTE 3CP7A 5CHAC 1S6FA 2Y5GA 2ZDNA 2FOCA 3EQ0H 1O5FH 4GPGA 5SGAE 2FS8A 3K6YA 2A7HA 2STAE 1C2FA 1FDPA 2GTBA 2WPHS 1XXFA 3PROA 1OS8A 4FUIA 3FZDA 4Y0YE 1SGDE 3AVZA 5EIYA 1AWHB 2JKHA 1RD3B 4A1XA 2LPRA 3ZZ3A 1HAXB 2FDAA 3SJ8A 2EY4C 2CHAC 1WOFA 4MPVA 2XNDD 5E0GA 2HOBA 1O38A 3BF6H 3L6PA 5AHGH 1P2OA 2FESH 3RXHA 2IN2A 4OS2A 1TYNA 3RXLA 3WWBA 2XBXA 1O2XA 3BTTE 4HG6A 1C2MA 3M35A 3P6ZB 1P09A 1XKBC 3MU4A 6GCHF 2V3OH 1C1SA 1C1NA 4JZFH 3O8DA 4ZXYH 1DX5M 3Q3YA 4HGCA 2V7QD 1A61H 3ELAH 1ETRH 1DITH 1S6HA 1O34A 4TYDA 1FX0B 1O3FA 4ABBA 1RJXB 2ZQ2A 3PRDA 1ZPCA 5DKMA 3SV8A 3A8DA 1V2TT 1YKTA 3QO6A 1EKBB 3RMMH 3BIUH 2NU4E 1YLNA 1GL0E 1QTFA 5CMXH 4B71A 3A7TA 1W7XH 3ZVEA 2FMJA 3LPRA 2F43B 2RDEA 2C90B 1O2IA 2GJGA 4VGCB 2JETB 1D6RA 1ZMLA 1NTPA 1SFQB 2PKSB 1V2JT 9LPRA 1BDAA 3HK6B 5A0CA 1F0SA 7GCHF 2QXJA 4CRBA 2WPDD 1C1QA 1DSUA 2RDLA 1LPKB 2ZHFH 5GCHG 1ELBA 3HGPA 4OGXA 3DD2H 1MU8B 1NRNH 3BIVH 1AUJA 3TGJE 2A7CA 1KSNA 2DE8A 1HB0B 1LHEH 1CO7E 1WUNH 2A1DB 1MTSA 1AQ7A 2F91A 2AERH 2A2XH 2NU3E 3EA8A 4XDEA 3SGAE 1WV7H 3SUDA 1O32A 1P3CA 1FY3A 7KMEH 4AFSA 2PWXA 3LKWA 2VIDA 3SU1A 4FETA 2QF3A 1EJNA 1DT2A 2BHGA 2BOKA 3VB5A 1SVPA 1MH0A 1QBOA 2ZTYA 1TNJA 2OC1A 2BMGB 4K2YA 2BX3A 1L4ZA 1BHXF 1GBAA 4X2VA 1V6DA 3ZZCA 3JZ2B 3NK8A 4M9FA 2BVXH 1FY5A 2JETC 1DANH 3F9GA 4Q7XA 1V2ST 3RXJA 2QXIA 1DUEA 4J1YA 1Z8JB 5DP4A 2QN5T 4UDWH 2H5CA 1SFIA 1UJ1A 1IHTH 3G01A 5C5NA 4UFEH 5T1VA 2D26C 4ZKOU 2SFAA 3RXSA 8KME2 3GS9A 2ZGXH 1WCZA 1YPHC 1WTHD 2FYQA 2HNTC 1GMCG 1UTJA 3SU2A 1NRPH 4ESTE 1SHYA 1C4V2 1TNKA 3BN9A 1C5SA 4B2CA 1KDQB 2IJD1 4X1QU 3STJA 2OCVB 4WJG2 1K1NA 1N1LA 2WSSD 1HIAA 1SGTA 5A0BA 3TK9A 2BLQA 2A31A 4ISNA 5DP8A 1BTZA 5DG6A 2AGEX 4FUJA 1P0SH 1NC6A 3LC5A 4I8HA 3U69H 1D9IA 2YMSD 2WUBA 2BXTH 1SQOA 4XSKU 1XUJA 2G5VA 3AK5A 2ZPRA 1AIXH 1K21H 4YM9A 5JBCS 1HJAB 1Z8RA 1AWFH 2PW8H 1YPEH 2QF0A 4A7IB 1NU9A 1UK3A 1ZHPA 1F5LA 3QX5H 2ZEBA 1O3IA 3RXDA 4CRGA 4Y8ZA 3SUGA 3MTYA 4ACBA 3RXPA 4P00A 1BTXA 1FY1A 1H1BA 1O35A 4MPXA 3IITA 1FAXA 2P94A 1JRSA 5FBIA 1O2ZA 1ANBA 1VITF 1CT0E 2KM0A 2ZFTA 2W5EA 1O2KA 2W6JD 4O3TA 2YMSB 3P70B 4X8VH 2W3IA 3KN2A 1B0FA 1HFDA 5FHTA 1HXEH 1TOMH 3ZZ9A 3KQEA 3UOPA 3ZZ4A 1JOUB 2B0FA 2AFQB 3ODDA 2BDBA 4NCYA 4B2BA 1Q3XA 2G4UA 1FAKH 4K5ZA 1QGFA 1O2TA 2ZTZA 3ATKA 1PPBH 4ZMAH 2TGPZ 2ZDKA 1EZSC 5A8XA 4CREA 3FN8A 2BXUH 1NFXA 2GZ9A 1AY6H 1A0LA 1GBTA 2H1UA 2Q6GA 1G2MA 1KMHB 1UCYK 1EP5A 2M5TA 2VIOA 4JK5A 1KXDA 4GVUA 1EAUA 5DO4H 4U30A 1HPGA 2CV3A 2EC9H 4B74A 2QC2A 2RA3A 1ZJKA 1RTFB 1Y3XA 4RT0A 1SLVB 5C5OA 1VJ9U 2W3KA 4ZXXH 3TH3H 3M3VA 1TNLA 4WF8A 1O3MA 3URDA 2Z6BD 5EG4A 4ABFA 2BD5A 3VPKA 5HXFA 2VWLA 5B6OA 3SOSA 1XUHA 1ZYOA 3ZVFA 4MNXA 3SNBA 4JK6A 3T26A 3PTBA 4B76A 1LKBA 3GY5A 1FLEE 1K22H 5JYIA 4H4FA 3PV2A 3VG8A 1DPOA 4B2AA 2ULLA 2ZFSA 4RI0A 1CGJE 4MTBA 4OS6A 2J97A 2ZQ1A 1HBTH 3BTDE 2QY0B 3E3TA 4FVBA 1BITA 3M7TA 3F0PA 3L33A 3A89A 1YPMH 1VJAU 1WYKA 3MHWU 1AFQC 3MQKC 3SGBE 3MU5A 3MU8A 3H7OA 1ESTA 1TX8A 2CJIA 3LJOA 4XBDA 1BMAA 1C2EA 2ZFQH 1GI9B 1AVXA 1GDUA 1NY22 1TIOA 1W8BH 5ETXA 3OY6U 3MO9A 1MZAA 3S7HB 1W3CA 3GYMA 1Y5AT 5ABWA 1S81A 2BOHB 1IQEA 4KTSA 3RXOA 3RXKA 2ODYB 2Y7XA 3KL6A 2PLXA 3HKJB 3RXQA 2FOHA 3DFLA 2RFKC 3M5LA 2Z9IA 1BMLA 1C4U2
chains in the Genus database with same CATH topology
2XC5A 4KKDA 3CS0A 5T6FA 2OXSA 4NSVA 3FP8E 2I6SA 3F6UH 1GDNA 1LO6A 1LHGH 3S9BA 3UQOA 1GHAG 1AZZA 2AGIX 2GCTB 3TK5A 3VB3A 3FVFB 1GJAB 5LH8A 3SW2B 4DIIH 1J14A 1GBBA 1QRZA 1WQVH 2ZCHP 3M5MA 1DE7H 1SGFA 4DJZB 1O3BA 1OPHB 2AEIH 3A7XA 4LXBH 1GMHG 3U8RH 2A4GA 4WWYA 1YGCH 1AE8H 1IQNA 2O8UA 1HAGE 4IW4E 3E1XB 2STBE 1AVWA 1PPHE 1VGCB 2ZDLA 1Z7KA 2ZFRH 4ISOA 3UY9A 1LDTT 2BDAA 1O2GH 4FXGH 3AASA 2R2WU 4ABHA 4KELA 1OWEA 1XUFA 1UCYH 3SNDA 1ZOMA 2ZWLH 1OXGA 1PPEE 5LGOA 2J34A 1HDTH 2P59A 3PB1E 1OP0A 1WAYB 1DWDH 1IAUA 1FN8A 5HM9A 2C8XB 1C4Y2 3PLKA 2ANMH 2P8OB 3NZIA 3SU6A 2FX4A 4E05H 2C8YB 2PR3A 2WPLS 5IYTA 1A3BH 2DUCA 5DP7A 2VIWA 2CXVA 1ELCA 1GMDG 3SJOA 5HMAA 2FXRA 2HWLB 3OX7U 2WINI 2IOTA 1P2MA 3GCTF 5GJ4B 3PV4A 1HJ8A 1YPHE 1EB2A 1SGNE 2BQ6B 1C5OH 2F3CE 4ZAEA 2GMTC 2HNTE 3VB7A 2TRMA 2C93B 2QCYA 1BQYA 1UHBB 2BQWB 2ZHWH 4Y7BA 1QQ4A 1GBMA 1VGCC 3UTUH 6CHAB 1IQFA 4NIWA 3RXEA 1OX1A 1ZZZA 4WH8A 1FIZA 1T4VH 3BTME 4NIVA 1KIGH 5F8XA 1AZ8A 2HALA 4ISIH 4JZDH 5F03A 4GHQA 3K6ZA 1C1OA 3LONA 1AE5A 1J9CH 3ZVDA 2XBVA 3QGNB 2ZHQH 2FM2A 1EAXA 1Q31A 4D8NA 1AKSA 2G52A 1TBQH 2KAIB 4NFEA 4CBOA 1P57B 5HGGA 2ZFPH 1OP2A 3CENA 1JIRA 1QIXB 2PSXA 2OP9A 4YOIA 2ZGHA 4AYVB 3B9FH 3KQDA 1BUIA 2ZECA 1O3LA 1YCPM 3S9CA 1BBRE 2PKAA 1THRH 1O2HA 1DOJA 1O3PB 2B5TB 2BLVA 1MUEB 4TPIZ 3HATH 2SNWA 3P8OA 3MI4A 1TE0A 1ELVA 3MH7A 1RFNA 2ZU4A 4H6SB 2XWAA 3BTKE 3UOUA 3D65E 1U6QA 3URCA 3PMAB 3ENSB 2J95A 3QZQA 1NU7B 4NFFA 1AB9C 1P2NA 1G36A 1O3HA 1YM0A 3V7TA 3B8JA 3A82A 4JYVH 2QV1A 3LGWA 4IS5A 1OP8A 4NG9H 1DXPA 5A2MH 5T6GA 1YPKH 2NWNA 1TABE 3Q77A 1KXFA 1GHBF 5FBEA 1LHFH 2AH4X 1Y3YA 3MU1A 1Z6EA 6GCHG 2XTTB 2VWNA 1SHHB 3T29A 1ZPBA 1BJVA 1GG6B 1TX7A 1O2NA 2P3UB 1O5EH 5L30H 4I8KA 4LOYH 4INHA 2H5DA 1J17T 1KLIH 4GLYA 5A0AE 4HFPB 4I8JA 1TONA 1C5NH 2UUJB 1Z6JH 2G81E 1L4DA 1BHXB 1XMNB 4BAQB 2VVCA 2H9TH 3E91A 1CHOF 1HAIH 1W10U 4AGJA 4CRAA 2WV5A 2C8ZB 4KP0A 1TGBA 3SHCH 2ZCKP 3ATWA 3MH6A 2XW9A 1C2IA 7GCHG 4Q7YA 3UWJH 3DT0H 1W0ZU 1GHWH 4YOJA 1FUJA 1DSTA 2TGAA 1V2KT 1SLXB 1K2I1 1ANEA 3LGVA 3P8GA 4I8LA 1TGTA 1TPSA 3SU3A 2Z9LA 4NA7A 4O3UA 1OWHA 2V6NA 3U8OH 1S83A 4X1SU 2RCEA 1AD8H 9ESTA 4XE4A 3T28A 1F2SE 1C9TA 2FI3E 1N8OB 1L0ZA 3GY4A 3SO3A 4K1TA 4JYUH 2A5IA 2JH6D 1JBUH 2FWWA 1T31A 2A4QA 2BDGA 5L2ZH 3N7OA 1AN1E 1IOEA 1QB1A 3KGPA 3T5FH 1D3QB 3UUZA 2ALPA 3UR9A 2ODQA 1T4UH 1N6XA 2BY5X 4AG2A 5FPSA 3CS7A 1O2PA 3GYLB 3M3SA 1QCPA 3ATMA 2WPKS 1GHVH 1QQUA 1E36B 2A5AA 4X8UH 4ABAA 5BPEA 3Q00A 2ASUB 3A8AA 1GVZA 1KTTB 3A81A 3M5NA 1OWIA 2Z9KA 1C9PA 4YLUA 2Y6TA 3QLPH 4CRDA 1HAYB 3A80A 3TNSA 2ZP0H 3ZV9A 2VIPA 1O3KA 2ZKSA 3NCLA 1UVSH 3M7UA 4K1SA 5CE1A 4OS1A 3GISB 1S82A 2C8WB 2VWMA 1CGHA 1QURH 3SUFA 1C5MD 1P11E 1V2WT 2FOMB 2GV6A 2SGAA 3RP2A 4K3JA 3U9AH 1HAHH 2ZPQA 1TB6H 2XC0A 2C4FH 2NU0E 1ZHMA 3S7KB 2A2QH 4Q80A 4RN6A 1BT7A 2G5NA 1DY9A 4NSYA 3SZNA 3H5CB 2FP7B 3T25A 2Z7FE 1LCYA 4HTCH 2V3HH 3BG8A 3MNCA 1C5PA 2NU2E 1P9SA 4DY7B 1Z1JA 1SQTA 1TA6A 1C1RA 3A7YA 2BYAX 3VFEA 2BD7A 3F1SB 3SGQE 4QT8C 3KNXA 5J4QA 1YP9A 3P8NA 1IQMA 1C1VH 1H8IH 1VITG 2A45B 4R8TB 1TMUH 1CVWH 3S9AA 3PTNA 1ANCA 1O3EA 1ZMNA 1IQHA 3PWCA 1A7SA 1LTOA 1P06A 1Y8TA 5TCAA 3MU0A 3ZZ8A 1FJSA 2CMYA 2FYRA 1CT2E 1YYY1 5EPNA 2WV4A 4MQAA 3SJ9A 1GI3A 1UVTH 1YC0A 3UWIA 1C1PA 1D3PB 1GBCA 4UFGH 1JIMA 5L2YH 2YNAA 3ODFA 2OQUA 1EASA 2W7UA 1P02A 4CH8B 1P2KA 3VEQB 1G3DA 2SGDE 1K28D 3SBKA 4DOQA 4X0WU 3O8BA 4BAKB 4BTIB 3EA7A 4VGCC 4FUBA 1LHCH 1P2QA 1C5UA 1K1OA 1MKXH 2PKSC 4I32A 1OWKA 2XCNA 2TGDA 3A86A 1LVBA 1JWTA 4CHAB 2HRVA 3AW1A 1KXAA 1QY6A 1BOQA 1CSOE 2J94A 4MDSA 1XUGA 4MG3A 1BTYA 5J4SA 4YOGA 2Z94A 3BTGE 1EATA 4GSOA 2Z3EA 4TY7A 2BD3A 1AUTC 1KYNA 3OYPA 4BAOB 1MU6B 1C1TA 1QA7A 1ZLRA 2BTCE 1ZTKA 1C5TA 4O03A 1NRRH 2AYWA 1TPPA 2ZGJA 1SGCA 3LIWA 4INLA 4X6MA 1ZPZA 1GI8B 2G51A 5C3NA 5A09A 3I78A 2ANYA 2WYJA 1TAWA 2XRCA 1NROH 1V2QT 3E0NB 3SV6A 2H6MA 4CR5A 1ELDE 3KQCA 4X8SH 2VH6A 5E8EH 3RM2H 3GCOA 3Q76A 3E90B 3KF2A 5FCKA 1HJ9A 1QL7A 4IN1A 1O3OA 4I31A 2GGVB 1DICA 2ZDVH 4AFQA 2Z9GA 1AU8A 1DWEH 3QUMP 5FPTA 3UPEA 1INCA 1DLKB 2UUKB 1GL1A 1L1NA 3GY6A 1J15A 1F0RA 2BY8X 1UHBA 2SGEE 1CT4E 1XM1A 2FS9A 1EXFA 1YLCA 3E16B 1ZHRA 2BDYA 1GVKB 1O5GH 2B9LA 3GCNA 5C67A 4Y8XA 3PO1B 3KHVA 1XVMA 4ZKNU 1O5CB 1ABJH 2VNTA 1XUIA 1MD7A 2ZU1A 4WXVA 1M9UA 2W7SA 3M5OA 4HZHA 2AIPA 1HJAC 3TJNA 3AAVA 4YT7H 1O39A 1LPZB 3R0FA 1HAPH 1V2RT 2KAIA 1CA8B 1T8NA 4E7NA 2HPQH 2R2MB 2OINA 5L6NH 1EZUC 1QJ7B 1LVOA 1CA0B 1Y3UA 4X6NA 3QWCH 1MBMA 2A5KA 1PJPA 3UNSA 3RXMA 5JBAS 1RTLA 3A7WA 1GBKA 4IC6A 1X7AC 2ANKH 5EODA 1UVUH 4LK4A 1BRBE 2A4OA 1Z71A 3QN7A 2PUQH 1RIWB 3LU9B 1GGDB 5I46H 1MAYA 1TGCA 1P12E 4ZHAA 2ZPSA 4MPUA 3PO1C 1O33A 2QXGA 4YESB 1PYTD 3GCHB 3C1KA 2A4RA 2XNIA 4PROA 5FAHA 1W11U 2HNTF 1BRAA 3RMNH 1AHTH 1O30A 3PMBB 2GDDA 1OWDA 1VCQA 1QFKH 1CQQA 2HVXA 2IPHA 1C5XB 1CU1A 1O2YA 4Q2KA 3GCTG 3GDSA 3D49H 3M37A 1SG8B 1CA0C 4X2XA 4YT6H 3SUEA 1P04A 2BQ7B 4RKJB 1O31A 2Y7ZA 3SQHE 1Y3WA 3K9XB 4Y8YA 1BTWA 2O8LA 4XBBA 2VGCB 4SGBE 1AVGH 1MCVA 5EQSA 1YPGH 2QA9E 1SL3A 4THNH 1RIWC 1RXPA 3RXTA 1P3EA 2ZGCA 1QL9A 1P9UA 1AO5A 4E06H 4NWKA 3BTFE 3ZVBA 1GI2A 3M61U 4FUCA 1EX3A 1O5BB 2OBQA 2ZGBH 3V12A 2GV7A 3RXFA 3PLPA 4D76A 3QTVH 3PYHA 1NM6A 4MVNA 5JDUB 3P95A 2F9VA 1DWCH 3HK3B 2VB0A 4DURA 2BM2A 1ZR0A 1ESAA 1TBRH 2PV9B 3ZZ5A 3SHAH 5EW1H 4WH6A 1NPMA 2XBWA 1MD8A 4IMQA 3UNRA 2OLGA 4JZIA 1O2LA 5C20A 1BZXE 4X6OA 4NWLA 1RTKA 3RU4D 3BTHE 2BY7X 1EAWA 2GZ7A 1XKAC 1YPJH 1GJ9B 2D2DA 3MNBA 1K1IA 2FOGA 1HAZB 1Z8IB 1KY9A 1HAOH 4RKOB 1ZMJA 1O2JA 3OSYA 4MLFB 1ZRKA 1UVPA 3T62A 1SGYE 1ORFA 2CF8H 3BEUA 4HI3A 3V0XA 1K9OE 1ANDA 3GOVB 3BTWE 2H9EH 2G55A 2VH0A 3UNQA 4E7RG 3T27A 3GY8A 1GHBG 1L1GA 4X2WA 4BTUB 1BB0B 2BDIA 2B8OH 2Q6DA 4TY6A 4GHTA 1ELFA 4FU7A 1EUFA 3SV7A 1K1LA 1EZXC 1Z8GA 5T3HA 3FANA 1ELGA 1UCYE 2GCTC 3LGUA 1G32B 1QRXA 2UWOA 4MNVA 3SI4H 2ALVA 3SI3H 3A87A 2P16A 1ZSKA 2PGQB 2TIOA 4K69A 3RXVA 2F9NA 4SGAE 1ETSH 1WU1A 3TH2H 2FTLE 4XBCA 2XCFA 3BG4B 2JH0D 1SPJA 1A5HA 4F4OC 3NKKA 1HNEE 2Q1JA 4CRCA 2YOLA 1CHOG 2BLWA 4BOHA 5E2OA 1LVYA 5I25A 4NA9H 3SN8A 2GT8A 1YBWA 4U01A 2QXHA 2UWPA 2HPPH 5BRRE 1SR5C 2O8MA 3LGYA 4DG4A 1FQ3A 2V0BA 1O3CA 2IJOB 5T6DA 3I29A 4IN2A 3ZVCA 3E6PH 2R0LA 1A0JA 1GI7B 4U32A 1MBQA 4ABIA 1ZSLA 4OS5A 3TPIZ 2PTNA 3GY2A 2GD4B 2P8OC 1L1JA 1O37A 1SGIB 4F49A 3VGCB 1G9IE 5ESBA 3ESTA 4FUHA 3QK1A 4K1EA 2ESTE 4B73A 1A46H 1E37B 3RMLH 1KXBA 2XBYA 4Q7ZA 1YF4A 2P93A 3F68H 1GI1A 3W94A 1L2EA 1A0HB 2K1QA 1GWAA 4FVDA 3RC5A 3KEEA 3RXAA 1C2DA 2ZU3A 3BG4C 3F9EA 1GJBB 1G30B 2WYGA 1P8VC 5EQRA 3ZZBA 1LMWB 6CHAC 3UR6A 4NZLA 3ZV8A 2ZI2H 3RC6A 3QGJA 2F9UA 1S0QA 4A1TA 1F0UA 1MQ5A 2FI4E 1UVOA 1GBIA 3SU0A 1GJ5H 3P92A 3RLWH 2GCHF 1V2PT 1GBHA 5DK1A 1TNHA 1GHXH 3C27B 4B1TA 2Y82A 3SJIA 1UTQA 3A85A 4WMFA 1O3DA 3A8CA 3V13A 4GCHF 1IQKA 5GPIB 4WVPE 5DP9A 2Z3CA 4I8GA 4UFFH 2ZC9H 1O2WA 1UTNA 2FIRH 3TVJB 1GHYH 2XXLA 1KLJH 2ZZUH 5EGMA 2PSYA 3A7VA 4K60A 3SU4A 1KDQA 2O8WA 1MTNB 1G3BA 1C5VA 3W95A 2G8TA 1FPHH 3EA9A 1CE5A 2D1JA 4DGJA 2Z3DA 4ZKSU 1HUTH 1ELAA 1GDQA 3ZZAA 2J2UA 1GBDA 2BDHA 1BRUP 3DHKH 2FPZA 4KTCA 2TGTA 1MAXA 6LPRA 1NT1A 2BD2A 5ESTE 3IWMA 1MKWK 4YLQH 2GZ8A 5JPMH 1XUKA 3RC4A 1P05A 3FZZA 1TLDA 4IMZA 1IHSH 1OSSA 5EOKA 2A0QB 1DWBH 1ZSJA 2EEKA 3MYWA 1QB6A 2GT7A 1RGQA 1YPLH 4NA8A 1ID5H 4CRFA 1Y5UT 4OS7A 4U2WA 1EP6A 2QYIA 1GG6C 4WXIA 4UFDH 1MKXK 1O2QA 4GUXA 1KXEA 1UTPA 1QL8A 3O8RA 3WY8A 2SGPE 3E0PB 1MTNC 4YTAA 1NFWA 1F92A 1FI8A 1SGRE 5A8YA 1LPGB 4AX9H 3NUMA 4BANB 2BVSH 4LZ4B 4X1NU 5F8TA 3TH4H 2ZG0H 1CBWB 1V3XA 4OGYA 2OTVA 4X1PU 2FODA 5EXMA 4BAMB 4Y79A 1H9LB 1G37A 3LGTA 1O3JA 2ZCLP 1Y3VA 5G4BA 3UREA 3DA9B 2EA3A 5AFZH 3LGIA 1PQ5A 4ZROA 1TX6A 3A88A 2ODPA 2ZHEH 1QJ1B 1UTLM 3IG6B 3SV9A 4FU9A 1DFPA 1JXPA 1H9HE 1O5DH 3SORA 2A32A 5DP5A 3KCGH 4YZUA 1GJCB 2DE9A 5IDKA 1SLUB 2FOFA 1C1WH 2VVUA 3MNXA 1DM4B 3LOXA 1N8OC 5GXPA 1TNIA 2GDEH 5DGJA 1SOTA 1MTWA 4AORA 3VB6A 4ISLA 1TGSZ 2Y81A 5GWZA 1NRSH 2PGBB 3ATLA 1BMMH 1TPOA 1ZGIA 3TLOA