1C2DA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2dA02
1SR5C 1PPHE 1C2LA 1Y3YA 3MU5A 5GJ4B 5K7RA 2ANWA 3OX7U 1ELVA 2QXIA 1KY9A 1FZZA 2B8OH 1O2VA 2Y5GA 3L3TA 1F5LA 1GMCF 1A5HA 1DXPA 1GMCG 4YOGA 4ZHMU 1NRNH 1ZTJA 4FUIA 1V2UT 3O8BA 2Y5HA 4AG1A 1UHBA 1EAWA 3M5OA 4X8VH 1DT2A 1QCPA 2FEQH 1F0RA 1GBMA 3RXLA 1RRKA 2I6QA 1D6RA 5JBBS 4BTUB 1GBFA 2Y80A 1O2OA 2R3UA 4ZXXH 3TITA 3S0NA 1A5GH 1GHZA 1GMHF 5FBEA 1GMHG 1F5RA 3UQVA 5JBTA 1Z71A 3TK5A 2K1QA 3PMAB 1V3XA 5GCHF 2CXVA 2ZPQA 1MH0A 3AAUA 5GCHG 1UTJA 1SFIA 3K2UA 3O8CA 2BMGB 5GXPA 1EPTC 4XE4A 5JBCS 2PV9B 1RJXB 2ZO3H 1EP6A 3VB7A 1IQHA 2IN2A 2BDAA 1RTFB 2D8WA 2O8TA 1LDTT 1P2JA 4UFEH 4B76A 5LH8A 1GBIA 5DP5A 1UJ1A 1XMNB 2ESTE 2VIOA 4OS4A 1DSUA 1GI7B 3AW0A 1NT1A 1SGFG 4Y11E 3V7TA 1AE8H 2Z9IA 1W0YH 1BZXE 2C4FH 2PW8H 4WH8A 4X6OA 1Y5AT 2Z9LA 3ATWA 1BHXF 1ZTKA 1UTMA 5EG4A 2QGRA 2AIQA 1ZHPA 4B73A 1AHTH 4IC5A 3UR9A 3TGKE 1NFXA 3SV2H 3M5MA 2BZ6H 2EC9H 1KSNA 5DK1A 4DW2U 4K5ZA 1C5RA 3SNDA 4Q7XA 1MKXH 1K2I1 4CRDA 1DUEA 4BXSA 4OS5A 1IAUA 2R9PA 3URCA 1HAPH 3I29A 2ULLA 2J94A 1HJAB 4ZKRU 1C5QA 4MTBA 2GTBA 1S0QA 1MKWK 3ATLA 2BD2A 1PPBH 3QN7A 2VH6A 2Z3EA 2FM2A 5J4QA 3LKWA 1O3PB 2D1JA 1MTNB 2BD5A 2D26C 5LPFA 4NG9H 1UVTH 1DS2E 2A2XH 4DJZB 1D3PB 1THSH 1W2KH 2H9HA 3BTQE 1P11E 3CP7A 1O2IA 1C4V2 1C2JA 1EATA 4Q2KA 4DVAU 3NPSA 2KAIA 2GDDA 3LPRA 1ZSJA 1UTOA 3GCTF 3U8TH 3GCTG 1MBMA 2W26A 3RC5A 3LGUA 1QR3E 3P8FA 2QV1A 4PROA 3DFJA 1ESTA 3U9AH 3NK8A 3M7QA 4TPYA 2RCEA 3V0XA 1TPSA 5DKMA 3SHCH 4WXIA 2Y7ZA 4XBBA 1DX5M 1DOJA 2BY5X 1GG6C 1XX9A 1C5OH 1PPEE 1ANDA 3RXRA 2H9EH 1GVZA 1C2EA 1C4Y2 3AVZA 4CRBA 1GDNA 2QA9E 3PTBA 3GY2A 2FPZA 2UWOA 5FCKA 1JIMA 1TQ0B 1L1NA 3RMNH 3LU9B 1BHXB 5EW1H 4A1TA 1A0JA 2V3HH 1V2WT 1Y3UA 5DP4A 3DUXH 4AGKA 1P2NA 1V2MT 1WCZA 3ATKA 2STAE 3PLKA 3STJA 2A7JA 1IQLA 1TWXB 5C20A 3LGIA 2PGBB 2WPIS 4GVUA 2JH5D 2WPHS 4AFZA 1UVSH 1SLXB 3L6PA 2HPQH 4Y10E 3U98H 3RU4T 1UVUH 4ZUHA 8GCHG 2ZEBA 5FPYA 2VVUA 1TOMH 1GI8B 1IQJA 4JZFH 3VB5A 1SGQE 3PWCA 2XTTB 1CGIE 1YBWA 3RXJA 2TIOA 3FFGA 4JZIA 3PO1B 2BDCA 2JETC 3IWMA 1C5PA 1NROH 3MU0A 3M35A 5ESTE 2BYAX 1QGFA 1GBBA 2A31A 2FYRA 2PKAA 1RTLA 1NY22 1ACBE 1AB9C 3S69A 1SQTA 5BPEA 3UOPA 4I8GA 3C27B 1LQDB 1JOUB 1AN1E 2A5AA 3TH4H 3VXEH 5E2PA 1RIWC 3RXCA 1VCWA 1OXGA 5E0HA 2XYAA 1JIRA 2GCHF 4JZEH 2GCHG 2EEKA 1P04A 3KCGH 3SNEA 5GIBA 3A8CA 5HM2A 1KIGH 1O2JA 4X1RU 3QX5H 3GISB 1KLJH 1L4ZA 1EZSC 1FIZA 1L0ZA 1C1VH 4A6LA 3A7WA 1SBWA 2BHGA 3RXGA 3RXOA 3FZZA 2ZQ2A 1LKBA 4SGAE 2ZTXA 2A2QH 1P8VC 1K21H 1QA7A 1VGCB 2VNTA 1PPFE 5EODA 3PWBA 1FDPA 2H6MA 3LONA 1N1LA 1GBDA 1TGBA 2WPMS 2PGQB 1ZSKA 2UUFB 3BEFB 4E7NA 1J14A 1O3FA 3EE0B 4XOJA 1ELAA 1YGCH 4NSVA 4FUHA 1OWHA 3ELAH 3BEUA 2XNIA 3SV7A 1QB6A 1TQ7B 4I7YH 1GBCA 3GY3A 1O3CA 1YPMH 4NIYA 5J4SA 1LTOA 3S9BA 2R2MB 1O2QA 3MU1A 1AFQC 2XBYA 1DVAH 2SGDE 3SNBA 3A7VA 2FLRH 1CE5A 1TALA 1RFNA 1DLKB 3LGWA 1ORFA 4OS6A 2TBSA 3UNQA 1D6WA 3RXEA 4IW4E 3SU2A 5A8YA 3E91A 1P05A 3SQEE 3E1XB 2UWLA 4A1VA 1FN6A 1C1UH 3LC5A 5BRRE 3AW1A 3A87A 1C1QA 1DICA 4TY7A 1FY1A 1C2FA 1D4PB 1EPTB 4X8SH 2W3KA 4ABDA 2OLGA 4RKJB 1U6QA 3E16B 1WAYB 3RXAA 1MCTA 2GV6A 5F6MA 4MPXA 2F9NA 5F8TA 1BRCE 3B9FH 3MH6A 4CHAC 3PROA 4ZH8A 2Q6GA 3FP6E 2G5NA 5SGAE 1C5VA 4AX9H 1O2SA 2FOEA 4AGJA 4X8UH 4K8BA 1Z8IB 1A0HB 1HGTH 1TX6A 2PFEA 1GJ9B 1HAIH 3SI4H 1MAYA 2PWXA 1SGPE 4BNRA 4O3UA 3SU4A 6ESTA 1ZGIA 1YCPM 1FAXA 3TIUA 1TX7A 1T7CA 1BBRH 1O37A 1V2VT 1NFYA 5C2ZA 3UTUH 3T62A 1GDQA 2TGAA 1WOFA 3KF2A 1C5YB 1O2YA 3V3MA 2AH4X 3BG8A 5FPTA 1UMAH 3MU8A 1P2MA 3A85A 3ZVEA 1Z1IA 3A84A 3PMBB 1BCUH 1G32B 1NRQH 2H1UA 3NUMA 3M36A 3ZZ3A 3M3SA 1IQGA 3U1IB 1KLTA 2OC1A 3A7XA 1DWBH 1SQOA 1HPGA 1LHEH 2B5TB 3EDXB 3M5LA 2VJ1A 3ZZ6A 2P94A 3K65B 2J92A 2GT8A 1SMFE 3GYMA 1DY8A 1Z8GA 4GHQA 1MTNC 2ZGJA 3RXVA 2J34A 2Q1JA 2ZHFH 1QA0A 2WUBA 1W0ZU 1HJ8A 3RXTA 4NFFA 1YPJH 2R2WU 3EA9A 4Y8ZA 3TNTA 1GBJA 3F68H 3QLPH 3SN8A 5F8XA 5EQRA 3PLBA 2AERH 2ZQ1A 1J9CH 3OYPA 4U01A 4KELA 2GZ8A 1ANEA 4K1EA 3TU7H 3A88A 2BDYA 4X2VA 4CR5A 1PQ5A 1GHYH 4E06H 4FUBA 4NIXA 1ZGVA 1LVYA 3GDUA 1UK3A 1ZMJA 4K69A 1P9SA 1HAHH 1Q31A 3SJ9A 4YESB 2W3IA 4D76A 1TBRH 5C3NA 1ELDE 3SHAH 3SV6A 3LGVA 1THPB 2AMDA 2HALA 3KIDU 1O3KA 1H9LB 3O8RA 1O0DH 1FPHH 4I8LA 1UCYH 4D9QA 1E36B 1AKSA 2AGEX 3QO6A 1BMMH 2WYGA 1IQFA 3AAVA 3ZZBA 1EUFA 4AFQA 1GCDA 1TGTA 1EB1H 2XW9A 2Z9GA 4JK5A 1FI8A 3GDVA 4BAKB 4AYYB 1V2ST 2C8YB 3CS0A 4K3JA 1DWDH 4TWWA 1K1MA 1K1NA 1OSSA 1SVPA 5EGMA 1BTHH 1JXPA 1K1OA 2Z9KA 3BV9B 4INKA 1MQ6A 1W8BH 3QTOH 3OSYA 1GBHA 1ZJDA 1A4WH 4KTSA 2ZU3A 4YT7H 3P92A 1PPCE 3PO1C 3RC4A 3E8LA 1F5KU 3LH1A 2ZPSA 2VIDA 4NA8A 4R0IA 5DPAA 1GHXH 2CF9H 4OGYA 1PPZA 2FOGA 1H9HE 1HXEH 3OY6U 1HB0B 4DCDA 1CQQA 2PTCE 2FZZA 4FVDA 1C1NA 3NCLA 1HRTH 3U8OH 4LZ4B 2SFAA 1BTYA 2EI7A 3ZVCA 3MH4A 1RGQA 4NWKA 1Y5UT 2A4QA 3C1KA 3ENSB 1S85A 1HAGE 2BTCE 1DDJA 1SB1H 2DE8A 3MO3A 3HK3B 1QRZA 2ZDLA 1TNHA 1AI8H 4AG2A 1ABIH 1W12U 2OC8A 8ESTE 2OINA 3JZ2B 1LVBA 1NO9H 1DXWA 1XUKA 2ILNA 1F92A 1PPGE 4H42U 4AB9A 5JDUB 3MO9A 3KNXA 4X2WA 5FPSA 2PUXB 1C1OA 1VR1H 1EOJA 2NU2E 3RXIA 2AYWA 1BTPA 1VGCC 1TGCA 2XCNA 3TGIE 2FYQA 1OKXA 1OWEA 5EXMA 2WINI 4ABFA 1O3EA 1SGIB 1O5DH 2ZG0H 2C90B 2VIWA 2ZP0H 2HNTC 5PTPA 1ZHRA 1G9IE 4ISOA 4ZAEA 1XUGA 4X1PU 1BTZA 1QRXA 1TA2A 4X8TH 4H6TA 1OWKA 1EJAA 3F9FA 1F0UA 1XUHA 1A1RA 1W14U 1A46H 3A8BA 2XBXA 1SGCA 1FLEE 1LMWB 2SGPE 1TB6H 1ELBA 2GZ7A 4J2YB 1OPHB 1NN6A 2ZHQH 1NESE 3T26A 2ZU2A 2XC4A 4GSOA 1Y3WA 1AGJA 2FOCA 5FHTA 4X6NA 2FX4A 4NIWA 2P3UB 3BN9A 4CHAB 4AFUA 9ESTA 3GCHB 1DPOA 1THRH 2AEIH 3SNAA 1UTNA 4E05H 1Y3XA 4K2YA 1V2PT 3MNXA 1YYY1 5C67A 4Y79A 4BAMB 1HAOH 1QY6A 5C5OA 1ESBA 1WQVH 1S6HA 3W95A 1O31A 1F2SE 1YM0A 1EZUC 1GI9B 1NTPA 4DOQA 4UEHH 1SPJA 1W10U 3BTKE 2BLQA 1K9OE 3QTVH 2OP9A 3SGQE 1CGHA 5A0CA 3MWIU 1QBOA 1C5NH 2FIRH 2A5KA 4JYTA 1KLIH 2Y7XA 3SU3A 4ESTE 2BLOA 1O2LA 2OCVB 1XXFA 4NWLA 1GPZA 4NA9H 2WPKS 1AQ7A 3D65E 2OUAA 5AHGH 3ZZDA 2BY6X 1O3BA 3F9HA 1GHBG 1ZRBA 2RA0A 1XVMA 2BVXH 1BITA 2AIPA 3TJNA 1GJ7B 5FAHA 1QQUA 1H8IH 2M5TA 3HKJB 5L2ZH 3U1JB 4LOYH 2G55A 5T6DA 4UFFH 1TYNA 5EXNA 1IQEA 1MTVA 3R3GB 2FS9A 1TNJA 3QZQA 4Y76A 1C5XB 1WU1A 2ZWLH 4ZMAH 4ZROA 4MDSA 4RSPA 3SU6A 5C1YA 1GJCB 1V2RT 5DP3A 1DFPA 1Y59T 1K22H 4IN2A 3VB6A 4ABBA 1SLVB 3RXPA 2BQ7B 3U69H 1ANCA 4A1XA 2Y6TA 4A7IB 6GCHG 2VGCB 3L33A 2G4TA 2ANYA 4JMYA 2WPJS 2PUQH 3NWUA 3SQHE 4I8KA 1Z1JA 3UQOA 4D7GA 2P3FH 1LO6A 4NCYA 1HUTH 2VVCA 4Z0KA 4TYDA 1ETTH 3M5NA 1O5FH 1PYTC 3NZIA 3EAJA 3U8RH 3GY6A 4NZLA 4WY3A 4A5TS 2XBWA 1AZZA 4UFGH 2G51A 2Y82A 4D8NA 1F0SA 1V2LT 3M7TA 1DY9A 2VWOA 1E0FD 2FOFA 1LQEA 1V2JT 2FOAA 5FX6A 2LPRA 5AVDA 3K6ZA 2NWNA 1RD3B 1ELTA 3VGCC 1BBRK 4BAQB 2EI6A 1LHDH 1BT7A 4OS7A 1WTGH 2P59A 2HNTF 3P8OA 4CRAA 1TRNA 1JRSA 2QIQA 1SLUB 2ODQA 3MNCA 4GPGA 3V13A 1GJ5H 2GT7A 2ZGXH 1C1WH 2C8XB 4YO9A 1TMUH 3TJOA 4INLA 2ZGBH 4ISIH 8GCHF 2BY7X 1LPGB 1QNJA 3KEEA 2VB0A 4UE7H 2Z9JA 1O2ZA 3ZZ5A 1TGSZ 1QRWA 2Z3CA 5F8ZA 2Q6FA 3M61U 3PM3A 2Y5FA 3HGPA 3T25A 2H9TH 1HDTH 4FU8A 3HPTB 1XVOA 2FWWA 5EU8A 4DT7B 1S6FA 4GLYA 5B6OA 4AFSA 1O3LA 2F83A 1VZQH 5AFZH 3VPKA 1ID5H 4ABAA 3A83A 1TBQH 1CT2E 2PHBA 2ASUB 1KXDA 1QHRB 4HFPB 1C1RA 3ODFA 3TNSA 1KDQB 2FOHA 2Z94A 2QXHA 3TH2H 1FV9A 1HCGA 3SV9A 1DUAA 1YF4A 1QJ7B 1EPTA 3SI3H 4JZ1A 2BLVA 3A8AA 5G4BA 1HIAB 4X6PA 2XWAA 2HGTH 3LT3A 1BTUA 4ABIA 1OOKB 2CJIA 3SOSA 1MTSA 4YZUA 3ZZCA 4CBOA 2QY0B 3GY7A 1EZXC 4B2AA 3VXFH 1V2QT 4WF8A 2ZHWH 5FBIA 1KXFA 1QL8A 1HNEE 3ZVAA 2ANMH 3B23B 2AMQA 4MNYA 5A8ZA 1G2LA 1ZMLA 5DG6A 3VFEA 4JYUH 1HXFH 4E7RG 1TE0A 3EQ0H 2Q6DA 4KTCA 1P3CA 2JH0D 3ZYDA 3UFAA 4YTAA 4U30A 3BIVH 2OXSA 1NRRH 1UVPA 1Y8TA 1NS3A 1E37B 1TBZH 4LK4A 2SGAA 2AGGX 2A4RA 4JK6A 2VU8E 1HAVB 2XCFA 4ABHA 1W7GH 1OYQA 2PR3A 1H8DH 1UTLM 5EQQA 1O39A 3Q3YA 4HZHA 2XC5A 4JYVH 2GVFA 1GJBB 1W13U 2F9OA 1E38B 1YCPK 1KTSB 1O2RA 4XBDA 1FN8A 2ZC9H 1GJAB 2BOHB 1A3BH 5HGGA 4DIHH 2VVVA 2F9VA 3EA7A 3TLOA 2BX3A 3WY8A 1P02A 1Z8RA 4M7GA 4TWYA 5L2YH 1GI4A 1VCPA 3Q00A 4MPWA 1SOTA 5JBAS 1MKWH 3ITIA 4X1SU 4WMFA 1OP0A 4K60A 1IHTH 1EB2A 1WQSA 4GUXA 3TVJB 2P8OC 3F9EA 4ABGA 1ZHMA 3LC3A 2SGFE 1S0RA 3BG4B 4TPIZ 4MNVA 1G3DA 1TOCB 1EKBB 1O3JA 2ZGHA 3P8GA 3MNSA 1G3BA 5FX5A 1Y3VA 2B7DH 3P17H 3TGJE 2RA3A 1C1SA 5IDKA 4Q7YA 1NZQH 4FU9A 2ZTYA 3GCHC 3KGPA 3UWIA 1BBRE 1C5SA 2GDEH 1IQIA 3D62A 2ZDNA 1TX8A 1KYNA 3UR6A 3GCNA 2JKHA 1XKAC 3SO3A 1CGJE 3GYLB 3S9CA 5E2OA 3PV4A 5A2MH 3ZVDA 3GICB 2C3SA 4UFDH 1BIOA 1D3QB 5I46H 2AMPA 6CHAB 5A0AE 3BIUH 4ABJA 1OYTH 1ARBA 2V3OH 2VIPA 3D49H 1ETRH 3ZVGA 2ZPRA 4D7FA 4Y7BA 2IJOB 1X7AC 2UWPA 2ZA5A 2ZDVH 1GBAA 1K1IA 1RXPA 1Z6JH 3UNSA 1GBKA 1Z7KA 1CO7E 3BSQA 3M3VA 1O5EH 1ZYOA 4SGBE 1GHWH 4B75A 4XDEA 1UO6A 4DIIH 2GV7A 1CU1A 4MPUA 3GY4A 3GY8A 3TK9A 1YC0A 5JB9S 3N7OA 2P95A 4O9VA 2A0QB 2ZKSA 1TPOA 1GMDG 3FZDA 3LH3A 3RM0H 2G8TA 1VJAU 1GJ4H 5GWZA 3TJVA 5EPYA 1QQ4A 2PSYA 3BTEE 3S7HB 1GJ6A 3RP2A 1O2WA 2H5DA 2H5CA 1IHSH 1O3IA 5CMXH 4DG4A 1JMOH 1JBUH 2G4UA 5EW2H 3RM2H 2XBVA 4RKOB 1SLWB 2O9QA 2RG3A 2ZNKH 4OS1A 1C5LH 4Y6DA 2ZFTA 1AIXH 4X2XA 5EOKA 1EASA 4AYVB 1NRSH 2A5IA 2BM2A 1O2GH 2J2UA 2GD4B 1CA0B 3RU4E 5E8EH 2VGCC 4ABEA 1FIWA 1P0SH 3NXPA 1GI0A 3A7YA 3NKKA 4Q7ZA 1N6YA 4B71A 1O3HA 3BTHE 3T28A 2Z6BD 8LPRA 1AO5A 1O34A 1ZPCA 2ZFRH 3B8JA 2O8MA 1SGDE 2BZAA 3UWJH 2WV5A 1DSTA 1UCYE 1V6DA 3GCOA 1C4U2 3DHKH 2NU1E 2HVXA 2FI4E 3URDA 3VGCB 4MPVA 1CHGA 3MO6A 2C8ZB 1N6XA 3JZ1B 1O30A 3SU5A 3RXDA 2FDAA 2A1DB 4ISHH 3E0NB 1C2KA 1TAWA 3LJJA 3RXSA 7KMEH 2BDIA 4FUDA 1B0EA 1SFQB 1YLCA 4BTIB 4WH6A 4Y71A 2RDLA 1SL3A 4I8HA 1WYKA 1ESAA 1G36A 1MKXK 2FXRA 3CS7A 5GDSH 1L4DA 1A2CH 4UDWH 1QJ1B 2QAAA 1A7SA 2ODPA 3H7TA 1V2KT 1V2OT 1O2TA 5DP6A 1T8OA 1KXBA 2LNCA 3A7ZA 1FQ3A 1GI3A 3SBKA 4NZQA 4LXBH 2PKSC 4U2WA 3SU1A 3HGNA 3Q3XA 3SORA 1AWHB 1AD8H 1O2PA 4FUFA 3ZZ8A 2BB4A 1UK2A 1C9TA 2TGDA 1GHVH 1EQ9A 3ZV8A 2ZDMA 1MTUA 1GBTA 4K1TA 3KHVA 1ZR0A 4MVNA 1AWFH 3EGKH 4GCHF 1IQNA 4GCHG 3ATIA 1BJVA 1ZTLA 2ZFFH 3E6PH 3PYHA 3QWCH 1KTTB 3DFLA 1YP9A 4HI3A 1ZMNA 1FXYA 4Y0ZE 4FVBA 1O36A 1EZQA 1VITG 1MUEB 4X1NU 1KXEA 1UTKA 4HGCA 1FY3A 5E0JA 2J4IA 1H1BA 1C2MA 1K1LA 3T2NA 2UUKB 4OS2A 3QGNB 3E3TA 1MD7A 1SGTA 3VB3A 2G5VA 1MQ5A 4H6SB 1GL1A 2VWNA 1XUFA 3BTME 4VGCB 2J95A 5T6FA 4F4OC 4FUEA 2HPPH 1C5UA 5HMAA 4NFEA 2WYJA 3TH3H 2VWMA 2GKVE 2B9LA 3LIWA 3UPEA 7LPRA 2THFB 3P70B 1O2UA 1TPAE 3ATMA 2R0LA 4FXGH 1TFXA 5AF9H 1TONA 1B5GH 1HBTH 3GOVB 1O2HA 3G01A 5F03A 3A86A 1EXFA 2F91A 3RXUA 1D3TB 1TNKA 1LVMA 5TCAA 2NU3E 5T6GA 2ALVA 2P8OB 2BY8X 1BMAA 4AORA 2QCYA 3CENA 3RXFA 1W7XH 3A89A 1DWCH 5AFYH 3TJUA 1C5WB 1BB0B 1GI1A 1SOZA 3RXKA 1IOEA 1V2NT 4X6MA 4OGXA 1SSXA 1SGEE 3RDZA 5K0HA 3SUEA 3SJOA 2ZU5A 2CN0H 1PFXC 2CF8H 2P16A 1P12E 2OTVA 1ELFA 1P9UA 1BA8B 1TNIA 3SGBE 4YLUA 1S81A 2CHAC 2FTLE 1SG8B 1G3CA 2W5EA 2ZDKA 4FUGA 3PMJA 2Z7FE 3BG4C 3K6YA 1Z6EA 1UVOA 6LPRA 2HLCA 1DM4B 2TGPZ 1CT0E 2SGEE 2OBQA 1QBNA 3MH5A 1CT4E 3QGJA 1TGNA 1NU9A 1CHOF 1GCTB 4Y0YE 1CHOG 1YPHC 3ZZ9A 1SGFA 3RMMH 1O3MA 1UTPA 3P95A 1OP2A 2OBOA 3S7KB 4ASHA 3T27A 3QUMP 3I77A 1E34B 4U32A 5TJXA 2R0KA 3O8DA 4WMEA 3LOXA 2WPLS 7ESTE 1GHBF 5TCCA 1LHCH 4B74A 1A5IA 1OX1A 4QT8C 4ZHAA 3E90B 4IGDA 2GMTB 3F9GA 3UNRA 1V2TT 6CHAC 1HJ9A 3M7UA 1ETSH 2YNAA 4B2CA 5CHAB 3RLYH 3TK6A 2ZHEH 4F49A 3F6UH 1UK4A 1NFWA 3ZZAA 3VEQB 4R8TB 1FPCH 1A0LA 3MH7A 2BD7A 2A32A 1Q3XA 1KXCA 3PB1E 1O35A 1AFEH 1C2HA 1A3EH 2O8LA 2BDGA 1LKAA 1LCYA 4IMQA 1K1JA 2A7CA 1E35B 1T4UH 2AFQB 1HFDA 1ZRKA 3ZVBA 1VITH 4CRFA 2YOLA 2GCTB 4JZDH 4HTCH 4TY6A 2R3YA 2BXTH 2ALPA 4MLFB 1ZPZA 2P3TB 5EPNA 4K1SA 1O33A 6GCHF 5JYIA 2XWBI 1MCVA 1GGDB 1UHBB 5ETXA 1KDQA 1P09A 4K8YA 1O3AA 3M37A 1BOQA 1W3CA 1OWIA 1DITH 2FOMB 3MOCA 1GL0E 1O2MA 3BTTE 1HIAA 2B0FA 4XFQA 1BRUP 5L30H 1QTFA 2NU4E 2BD8A 2V0BA 1CA0C 2ZIQH 5DO4H 1G2MA 2AGIX 4Z6AH 1SGNE 4CBNA 4O3TA 3SJKA 3RXHA 3H7OA 2ZFSA 3P6ZB 4X1QU 1TRMA 1KXAA 4O97A 1TRYA 3KN2A 1NRPH 4FUJA 4XBCA 4XSKU 4BAOB 2EI8A 4GAWA 1AVXA 1O2KA 1DANH 1LVOA 5DGJA 1QBVH 1AZ8A 4YT6H 2XRCA 1L2EA 3KQEA 2BQWB 3TPIZ 3SNCA 1P2IA 1A61H 5LPRA 1IQKA 3SJIA 1ZJKA 8KME2 1Z8JB 1YPGH 4Q80A 1EJMA 2A45B 4THNH 5DJ7A 5FXLA 2PKSB 1P2OA 2QC2A 1HAVA 3SUFA 1GBLA 2A4GA 2ZCLP 3Q3KA 3FANA 2ZHDA 2OQUA 2V6NA 1SC8U 1PQAA 1EAXA 2BDHA 1GBEA 3ZYEA 4I8JA 1T4VH 3AASA 4FU7A 4ZKOU 2ZI2H 1L1JA 1L1GA 3OU0A 1MU6B 3LGYA 3OY5U 1BJUA 2UUJB 2TGTA 4UONA 2A7HA 3DD2H 1O3NA 1T32A 1VCQA 1NU7B 5CE1A 2OC7A 4NIVA 4JCNA 3MI4A 1BTXA 1GWAA 4DGJA 4DURA 2GGVB 1C1PA 1F7ZA 1MAXA 1FAKH 2FO9A 2P93A 3GDSA 3Q76A 4B1TA 2KAIB 1FY5A 2J38A 3QDZB 1XUJA 1AE5A 1BQYA 3KQDA 1P01A 5C1UA 2G52A 2F9UA 1TMBH 1NM6A 5IYTA 3BTDE 1YKTA 2BD4A 2QYIA 1OWJA 1ELEE 1GVKB 1O3DA 5GPIB 2XXLA 1C9PA 5L6NH 2I6SA 1CBWC 1MBQA 4I33A 5JB8S 2C8WB 3A80A 4ZKSU 1BTWA 2Y81A 1N8OB 4I32A 1EJNA 3A82A 3F1SB 3BTFE 2BVRH 2HRVA 2ZDAH 1S82A 1B0FA 2EA3A 4IS5A 3RU4D 3BTWE 4CR9A 4WXVA 2BD9A 4AOQA 1C2GA 1DE7H 1EP5A 1OP8A 3EA8A 1FONA 2BVSH 4FUCA 1OS8A 1UCYK 1P06A 2OQ5A 4VGCC 1O5CB 2VIQA 2YNBA 3UOUA 3H5CB 4LZ1H 2CGAA 2BQ6B 1J17T 1EOLA 1O32A 1UTQA 1CSOE 2QXJA 1GI6A 1Y5BT 1J8AA 2XC0A 1MTWA 3UREA 1RS0A 2QF3A 1ARCA 5HXFA 2ZECA 5LPEA 5H4IB 2QN5T 3V12A 1PJPA 1PYTD 5E0GA 2CV3A 1VJ9U 2FP7B 4DY7B 1F0TA 2HNTE 2TRMA 3IITA 3BTGE 2CHAB 9LPRA 2FX6A 2FS8A 1INCA 1O3GA 4MNXA 4MNWA 2PKAB 1TLDA 2FTMA 3RXMA 3HATH 1AUTC 3SV8A 4AZ2B 2A4OA 4ISLA 1AVGH 3MFJA 7GCHF 7GCHG 1WSSH 1AU8A 3ZV9A 1FJSA 4X0WU 4WJG2 1K1PA 1B7XB 5C5NA 1J15A 1XXDA 1O2XA 3ZZ7A 4KGAA 1ZPBA 4IMZA 3ESTA 3LDXH 4YM9A 3MMGA 3A7TA 3PMHB 3HKIB 2FESH 2F9BH 2ZZUH 4A92A 1GCTC 4KP0A 3UUZA 2W7SA 1BRBE 2WUCA 2ZFQH 4Y7AA 3T5FH 1O38A 2F9PA 1C5TA 3FVFB 1C5MD 1MMJN 1RTKA 2VH0A 5ABWA 1YPHE 1DWEH 1C2IA 1QL9A 3M3TA 3SJ8A 1G30B 3LGTA 1HAXB 4GHTA 1YPLH 3S9AA 2G81E 1FY4A 2GMTC 1PQ7A 1ELGA 1BMLA 1JRTA 1GI5A 2BDBA 1TNGA 2SGQE 1D9IA 1GVLA 5CHAC 5A09A 2VIVA 4CRGA 4IBLH 1T31A 1PQ8A 3MTYA 3MHWU 2STBE 1ANBA 3FP8E 1GMDF 1H4WA 4IC6A 3W94A 2IOTA 2ODYB 1EAUA 1SGRE 3Q77A 2CMYA 1BDAA 3OTJE 4CRCA 2C93B 4BAHB 3KL6A 3SW2B 1ZSLA 1YLDA 3RUOA 3RMOH 3I78A 4I31A 5C1XA 1QIXB 1BUIA 4ZHLU 4AB8A 1MU8B 5ESBA 1HJAC 2GCTC 1SHHB 3DT0H 3UY9A 3RLWH 1MZDA 1O3OA 1MD8A 2QXGA 3D23A 1GJDB 2ZFPH 3PTNA 1GGDC 1C2DA 3ZVFA 2H2ZA 3QK1A 1XUIA 3RXQA 4ZKNU 5JPMH 5DP9A 1GG6B 3MNBA 3T29A 1C1MA 1C1TA 5DP7A 1FMGA 2V35A 1ZOMA 1CVWH 1AMHA 1ABJH 3RC6A 1CA8B 5A0BA 1K28D 2BY9X 4YOIA 4Y8XA 2WV4A 2Z3DA 1FNIA 1FUJA 1OWDA 2FOBA 3QZRA 4NGAH 1HLTH 1QB9A 1T8LA 2FMJA 1P03A 2ZF0H 3K9XB 1GI2A 2ZCKP 2ZU1A 3STIA 1HAZB 1TPPA 2OD3B 1O5BB 1BMNH 4B2BA 3SU0A 2SNVA 2FI5E 3RMLH 4MQAA 1P57B 1QL7A 3SUDA 4INHA 1YPEH 1TMTH 3PLPA 3MU4A 2FODA 3DA9B 1QJ6B 2ZCHP 1W11U 2TPIZ 3SGAE 1G3EA 3BEIB 3EYDA 3FAOA 2BX4A 1GHAF 1WUNH 1GHAG 1NC6A 1P2QA 2BOKA 1YCPH 1TIOA 2JETB 2OC0A 1AVWA 1ZLRA 1LHGH 3ODDA 3A81A 4NSYA 2DE9A 2ZU4A 1O2NA 3RXBA 1TNLA 2GZ9A 1MZAA 4IN1A 4J1YA 4X2YA 1AB9B 1AUJA 2J9NA 3SZNA 1LPZB 1M9UA 1JWTA 1QB1A 2VWLA 1S5SA 2UUYA 2BXUH 3UIRA 5LGOA 3LJOA 4ZXYH 2O8UA 4CH8B 5I25A 1RIWB 3SUGA 3ZZ4A 1T8NA 3MYWA 1BRAA 1ZZZA 1TA6A 1FY8E 2ZTZA 3GY5A 2O8WA 1NFUA 4UD9H 4YOJA 1CBWB 1AY6H 2PLXA 2DUCA 1S83A 1HYLA 1WBGB 1XM1A 5DP8A 2BLWA 4KTUA 4Y8YA 1VITF 3R0FA 1SHYA 1GJ8B 1QFKH 3P8NA 1WV7H 1WTHD 5HM9A 1HAYB 2ZGCA 5EQSA 1H9IE 2NU0E 1EAIA 4BTTB 2GX4A 4BANB 2GP9B 2QF0A 1P10A 1YPKH 3HK6B 1TABE 3VB4A 1P3EA 2AS9A 3KQBA 1N8OC 2HOBA 1J16A 2FLBH 1GDUA 1P2KA 1O5GH 4MG3A 4AN7A 1SGYE 1D3DB 4WWYA 3FP7E 4D9RA 3E0PB 5T3HA 4CH2B 4H4FA 2SNWA 1S84A 2G00A 2VINA 4NA7A 1SQAA 4BOHA 4WVPE 2BD3A 1ELCA 2D2DA 2W7UA 5HYOA 5A8XA 2PSXA 3KQCA 1XKBC 2IPHA 1SI5H 4YLQH 1G37A 1C5ZB 4KKDA 5EXLA 1NPMA 1IQMA 1LPKB 1QURH 1LHFH 2PTNA 4CREA 1O5AB 4ISNA 1AKSB 2JH6D 2HWLB 4WMDA 1HV7A 1Q2WA 2F3CE 1AFQB 4BXWA 1DLEA 1EX3A 1T8MA 2FI3E 3A8DA 2ANKH 4O03A 5FCRA 3BF6H 4RN6A 3IG6B
chains in the Genus database with same CATH superfamily
1SR5C 1PPHE 1C2LA 1Y3YA 3MU5A 5GJ4B 5K7RA 2ANWA 3OX7U 1ELVA 2QXIA 1KY9A 1FZZA 2B8OH 1O2VA 2Y5GA 3L3TA 1F5LA 1GMCF 1A5HA 1DXPA 1GMCG 4YOGA 4ZHMU 3OE7D 1NRNH 1ZTJA 4FUIA 1V2UT 3O8BA 2Y5HA 3F3BA 4AG1A 1UHBA 1EAWA 5KGOA 3M5OA 4X8VH 1DT2A 1QCPA 3KYGA 2FEQH 1F0RA 1GBMA 3RXLA 1RRKA 2I6QA 1D6RA 5JBBS 4BTUB 1GBFA 2Y80A 1O2OA 2R3UA 4ZXXH 3TITA 3N99A 3S0NA 1A5GH 1GHZA 1GMHF 5FBEA 1GMHG 1F5RA 3UQVA 5JBTA 1Z71A 3TK5A 2K1QA 3PMAB 1V3XA 5GCHF 2CXVA 2ZPQA 1MH0A 3AAUA 5GCHG 1UTJA 1SFIA 3K2UA 3O8CA 2BMGB 5GXPA 1EPTC 4XE4A 5JBCS 2PV9B 1RJXB 2ZO3H 1EP6A 3VB7A 1IQHA 4RI0A 2IN2A 2BDAA 1RTFB 2D8WA 2O8TA 3DSPA 1LDTT 1P2JA 4M9FA 4UFEH 4B76A 5LH8A 1GBIA 5DP5A 1UJ1A 1XMNB 2ESTE 2VIOA 4OS4A 1DSUA 1GI7B 3AW0A 1NT1A 1SGFG 4Y11E 3V7TA 1AE8H 2Z9IA 1W0YH 1BZXE 2C4FH 2PW8H 4WH8A 4X6OA 1Y5AT 2Z9LA 3ATWA 1BHXF 1ZTKA 1UTMA 5EG4A 2QGRA 2AIQA 1ZHPA 4B73A 1AHTH 4IC5A 3UR9A 3TGKE 1NFXA 3SV2H 3M5MA 2BZ6H 2EC9H 1KSNA 2W6ID 5DK1A 4DW2U 4K5ZA 1C5RA 3SNDA 4Q7XA 1MKXH 1K2I1 4CRDA 1DUEA 4BXSA 4OS5A 1IAUA 2R9PA 3URCA 1HAPH 3I29A 2ULLA 2J94A 1HJAB 4ZKRU 1C5QA 4MTBA 2GTBA 1S0QA 1MKWK 3ATLA 2BD2A 1PPBH 3QN7A 2VH6A 2Z3EA 2FM2A 5J4QA 3LKWA 1O3PB 2D1JA 1MTNB 2BD5A 2D26C 2XNDD 5LPFA 4NG9H 1UVTH 1DS2E 2A2XH 4DJZB 1D3PB 1THSH 1W2KH 2H9HA 3BTQE 1P11E 3CP7A 1O2IA 1C4V2 1C2JA 1EATA 4Q2KA 4DVAU 3NPSA 2KAIA 2GDDA 3LPRA 1ZSJA 1UTOA 3GCTF 3U8TH 3GCTG 1MBMA 2W26A 3RC5A 3LGUA 1QR3E 3P8FA 2QV1A 4PROA 3DFJA 1ESTA 4FETA 3U9AH 3NK8A 3M7QA 4TPYA 2RCEA 3V0XA 1TPSA 5DKMA 3SHCH 4WXIA 2Y7ZA 2JIZD 4XBBA 1DX5M 1DOJA 2BY5X 1GG6C 1XX9A 1C5OH 1PPEE 1ANDA 3RXRA 2H9EH 1GVZA 1C2EA 1C4Y2 3AVZA 4CRBA 1GDNA 2QA9E 3PTBA 3GY2A 2FPZA 2UWOA 5FCKA 1JIMA 1TQ0B 1L1NA 3RMNH 3LU9B 1BHXB 5EW1H 4A1TA 3MQKC 1A0JA 2V3HH 1V2WT 1Y3UA 5DP4A 3DUXH 4AGKA 1P2NA 1V2MT 1WCZA 3ATKA 2STAE 3PLKA 3STJA 2A7JA 1IQLA 1TWXB 5C20A 1YWUA 3LGIA 2PGBB 2WPIS 4GVUA 2JH5D 2WPHS 4AFZA 1UVSH 1SLXB 3L6PA 2HPQH 4Y10E 3U98H 3RU4T 1UVUH 4ZUHA 8GCHG 2ZEBA 5FPYA 2VVUA 1TOMH 1GI8B 1IQJA 4JZFH 3VB5A 1SGQE 3PWCA 2XTTB 1CGIE 3VG8A 1YBWA 3RXJA 2QE7D 2TIOA 3FFGA 4JZIA 3PO1B 2BDCA 2JETC 3IWMA 1C5PA 1NROH 3MU0A 3M35A 5ESTE 2BYAX 1QGFA 1GBBA 2A31A 2FYRA 2PKAA 1RTLA 1NY22 1ACBE 1AB9C 3S69A 1SQTA 5BPEA 3UOPA 4I8GA 3C27B 1LQDB 1JOUB 1AN1E 2A5AA 3TH4H 1SQRA 3VXEH 5E2PA 1RIWC 3RXCA 1VCWA 1OXGA 5E0HA 2XYAA 1JIRA 2GCHF 4JZEH 2GCHG 2EEKA 1P04A 3KCGH 3DCLA 3SNEA 5GIBA 3A8CA 5HM2A 1KIGH 1O2JA 4X1RU 3QX5H 3GISB 1KLJH 1L4ZA 1EZSC 1FIZA 1L0ZA 1C1VH 4A6LA 3A7WA 1SBWA 2BHGA 3RXGA 3WWBA 3RXOA 3FZZA 2ZQ2A 1LKBA 4SGAE 2ZTXA 2A2QH 1P8VC 1K21H 1QA7A 1VGCB 2VNTA 1PPFE 5EODA 2V3MA 3PWBA 1FDPA 2H6MA 3LONA 1N1LA 1GBDA 1TGBA 2WPMS 2PGQB 1ZSKA 2UUFB 3BEFB 4E7NA 1J14A 1O3FA 3EE0B 4XOJA 1ELAA 1YGCH 4NSVA 4FUHA 1OWHA 3ELAH 3BEUA 2XNIA 3SV7A 1QB6A 1TQ7B 4I7YH 1GBCA 5GNDA 3GY3A 1O3CA 1YPMH 4NIYA 5J4SA 1LTOA 3S9BA 2R2MB 1O2QA 3MU1A 1AFQC 2XBYA 1DVAH 2SGDE 3SNBA 2J97A 4Z1MD 3A7VA 2FLRH 1CE5A 1TALA 2KX4A 1RFNA 1DLKB 3OFND 3LGWA 1ORFA 4OS6A 2TBSA 3UNQA 1D6WA 3RXEA 4IW4E 3SU2A 3WW7A 5A8YA 3E91A 1P05A 3SQEE 3E1XB 2UWLA 4ACBA 4A1VA 1FN6A 1C1UH 3LC5A 5BRRE 3AW1A 3A87A 1C1QA 1DICA 4TY7A 1FY1A 1C2FA 1D4PB 1EPTB 4X8SH 2IPQX 2W3KA 4ABDA 2OLGA 4RKJB 1U6QA 3E16B 1WAYB 3RXAA 1MCTA 2GV6A 5F6MA 4MPXA 2F9NA 5F8TA 1BRCE 3B9FH 3MH6A 3W1EA 4CHAC 3PROA 4ZH8A 2Q6GA 3FP6E 2G5NA 5SGAE 1C5VA 4AX9H 1O2SA 2FOEA 4AGJA 4X8UH 4K8BA 1Z8IB 1A0HB 1HGTH 1NBMD 1TX6A 2PFEA 1GJ9B 1HAIH 3SI4H 1MAYA 4XRNA 2PWXA 1SGPE 4BNRA 4O3UA 3SU4A 6ESTA 1ZGIA 1YCPM 1FAXA 3TIUA 1TX7A 1T7CA 1BBRH 1O37A 1V2VT 1NFYA 5C2ZA 3UTUH 3T62A 2WSSD 1GDQA 2TGAA 1WOFA 3KF2A 1C5YB 1O2YA 3V3MA 2AH4X 3BG8A 5FPTA 1UMAH 3MU8A 1P2MA 3A85A 3ZVEA 1Z1IA 3A84A 3PMBB 1BCUH 1G32B 1NRQH 2H1UA 2WHXA 3NUMA 3M36A 3ZZ3A 3M3SA 1IQGA 3U1IB 1KLTA 2OC1A 3A7XA 1DWBH 1SQOA 5B6LA 1HPGA 1LHEH 2B5TB 3EDXB 3M5LA 5CDFE 2VJ1A 3ZZ6A 2P94A 3K65B 2YMSD 2J92A 2GT8A 1SMFE 1BMFD 3GYMA 1DY8A 1Z8GA 4GHQA 1MTNC 2ZGJA 3RXVA 2J34A 2Q1JA 2ZHFH 1QA0A 2WUBA 1W0ZU 1HJ8A 3RXTA 4NFFA 1YPJH 2R2WU 3EA9A 4Y8ZA 3TNTA 1GBJA 3F68H 3QLPH 3SN8A 5F8XA 5EQRA 3PLBA 2AERH 2ZQ1A 1J9CH 3OYPA 4U01A 1W0JD 2GZ8A 4KELA 1ANEA 4K1EA 3TU7H 3A88A 2BDYA 4X2VA 4CR5A 1PQ5A 1GHYH 4E06H 4FUBA 4NIXA 1ZGVA 1LVYA 3GDUA 1UK3A 1ZMJA 4K69A 1P9SA 1HAHH 1Q31A 1E1RD 3SJ9A 4YESB 2W3IA 4D76A 1TBRH 5C3NA 1ELDE 3SHAH 3SV6A 4HG6A 3LGVA 1THPB 2AMDA 2HALA 3KIDU 1O3KA 1H9LB 3O8RA 1YY3A 1O0DH 1FPHH 4I8LA 1UCYH 4D9QA 1E36B 1AKSA 2AGEX 3QO6A 1BMMH 2WYGA 1IQFA 3AAVA 3ZZBA 1EUFA 4AFQA 1GCDA 1TGTA 1EB1H 2XW9A 2Z9GA 4JK5A 1FI8A 3GDVA 4BAKB 4AYYB 1V2ST 4F55A 3OEHD 2C8YB 4RT1A 3CS0A 4K3JA 1DWDH 4TWWA 1K1MA 1K1NA 1OSSA 1SVPA 5EGMA 1BTHH 1JXPA 1K1OA 2Z9KA 3BV9B 4INKA 1MQ6A 1W8BH 3QTOH 3OSYA 1GBHA 1ZJDA 1A4WH 4KTSA 2ZU3A 4YT7H 3P92A 1PPCE 3PO1C 3RC4A 3E8LA 1F5KU 3LH1A 2ZPSA 2VIDA 1NBME 4NA8A 4R0IA 5DPAA 1GHXH 2CF9H 4OGYA 1PPZA 2FOGA 1H9HE 1HXEH 3OY6U 1HB0B 4DCDA 1CQQA 2PTCE 2FZZA 2JJ2D 4FVDA 1C1NA 3NCLA 1HRTH 3U8OH 4LZ4B 2SFAA 1BTYA 2EI7A 3ZVCA 3MH4A 1RGQA 4NWKA 1Y5UT 2A4QA 3C1KA 3ENSB 4AC9A 2LP6A 1S85A 1HAGE 2BTCE 1DDJA 1SB1H 2DE8A 3MO3A 3HK3B 2L74A 1QRZA 2QF4A 2ZDLA 1TNHA 1AI8H 4AG2A 1ABIH 1W12U 4P02A 2OC8A 8ESTE 2OINA 3JZ2B 1LVBA 1NO9H 1DXWA 1XUKA 2ILNA 1F92A 1PPGE 4H42U 4AB9A 5JDUB 3MO9A 3KNXA 4X2WA 5FPSA 2PUXB 1C1OA 1VR1H 1EOJA 2NU2E 3RXIA 2AYWA 1BTPA 1VGCC 1TGCA 2XCNA 3TGIE 2FYQA 1OKXA 1OWEA 5EXMA 2WINI 4ABFA 1O3EA 1SGIB 3N7DA 1O5DH 2ZG0H 3NRLA 2C90B 2VIWA 2ZP0H 2HNTC 5PTPA 1ZHRA 1G9IE 4YXWD 4ISOA 4ZAEA 1XUGA 3ZIAD 4X1PU 1BTZA 1QRXA 1TA2A 4X8TH 4H6TA 2KCPA 1OWKA 1EJAA 3F9FA 1F0UA 1XUHA 1A1RA 1W14U 1A46H 3A8BA 2XBXA 1SGCA 1FLEE 1LMWB 2SGPE 1TB6H 1ELBA 2GZ7A 4J2YB 1OPHB 1NN6A 2ZHQH 1NESE 3T26A 2ZU2A 2XC4A 4GSOA 1Y3WA 1AGJA 2FOCA 5FHTA 5EJ1A 4X6NA 2FX4A 4NIWA 2P3UB 3BN9A 4CHAB 1W0KD 4AFUA 9ESTA 3GCHB 2L6OA 2KCOA 1DPOA 1THRH 2AHME 2HVYB 2AEIH 3SNAA 1UTNA 4E05H 1Y3XA 4K2YA 1V2PT 3MNXA 1YYY1 5C67A 2KCYA 4Y79A 4BAMB 1HAOH 1QY6A 5C5OA 1ESBA 1WQVH 1S6HA 3W95A 1O31A 1F2SE 1YM0A 1EZUC 1GI9B 1NTPA 4DOQA 4UEHH 1SPJA 1WDIA 1W10U 3BTKE 2BLQA 1K9OE 3QTVH 2OP9A 3SGQE 1CGHA 5DSFA 2K8IA 3MWIU 1QBOA 5A0CA 1C5NH 2FIRH 2A5KA 4JYTA 1KLIH 2Y7XA 3SU3A 4ESTE 2BLOA 1O2LA 2OCVB 1XXFA 5C17A 4NWLA 1GPZA 4NA9H 2WPKS 1AQ7A 3D65E 4I86A 2OUAA 5AHGH 3ZZDA 2BY6X 1O3BA 3F9HA 1GHBG 1VKYA 1ZRBA 2RA0A 1XVMA 2BVXH 1BITA 2AIPA 3TJNA 1GJ7B 1WXRA 5FAHA 1QQUA 1H8IH 2M5TA 3HKJB 5L2ZH 3U1JB 4LOYH 2G55A 5T6DA 4UFFH 1TYNA 3U28C 5EXNA 1IQEA 1MTVA 3R3GB 2FS9A 1TNJA 3QZQA 3KQ5A 4Y76A 1C5XB 1WU1A 2ZWLH 4ZMAH 4ZROA 4MDSA 4RSPA 3SU6A 5C1YA 1GJCB 1V2RT 5DP3A 2WPDD 1DFPA 3N7EA 5T1VA 1Y59T 1K22H 4IN2A 3VB6A 4ABBA 1SLVB 3RXPA 2BQ7B 3U69H 1K0HA 1ANCA 4A1XA 2Y6TA 3AK5A 4A7IB 6GCHG 2VGCB 3L33A 2G4TA 2ANYA 4JMYA 2WPJS 2PUQH 3NWUA 3SQHE 2WV9A 3GS9A 4I8KA 1Z1JA 3UQOA 4D7GA 2P3FH 1LO6A 4NCYA 1HUTH 2VVCA 4Z0KA 4TYDA 2W6JD 1ETTH 3M5NA 1O5FH 1PYTC 3NZIA 3SYJA 3EAJA 3FO8D 3U8RH 3GY6A 4NZLA 4WY3A 4A5TS 2XBWA 1AZZA 4UFGH 2G51A 2Y82A 4D8NA 1F0SA 1V2LT 3M7TA 1DY9A 2VWOA 1E0FD 2FOFA 2VBCA 1LQEA 1V2JT 2FOAA 5FX6A 2LPRA 5AVDA 3K6ZA 2NWNA 1RD3B 1ELTA 3VGCC 1BBRK 4BAQB 2EI6A 2JDID 1LHDH 1BT7A 4OS7A 1WTGH 2P59A 2HNTF 3P8OA 4CRAA 1TRNA 1JRSA 2QIQA 1SLUB 2ODQA 3MNCA 4GPGA 3V13A 1GJ5H 2GT7A 4ASUD 2ZGXH 1C1WH 5EJLA 2C8XB 3PRBA 1TMUH 4YO9A 3TJOA 4INLA 2ZGBH 4ISIH 8GCHF 2BY7X 1LPGB 1QNJA 3KEEA 1COWD 2J98B 2VB0A 4UE7H 2Z9JA 1O2ZA 3ZZ5A 1TGSZ 1QRWA 2Z3CA 5F8ZA 2Q6FA 3M61U 3PM3A 2Y5FA 3HGPA 3T25A 2H9TH 1HDTH 4FU8A 3HPTB 1XVOA 2FWWA 4Q4LA 5EU8A 4DT7B 1S6FA 4GLYA 5B6OA 4AFSA 1O3LA 2F83A 1VZQH 5AFZH 3VPKA 1KMHB 1ID5H 4ABAA 3A83A 1TBQH 1CT2E 2PHBA 2ASUB 1KXDA 1QHRB 4HFPB 1C1RA 3ODFA 3TNSA 1KDQB 2FOHA 2Z94A 2QXHA 3TH2H 1FV9A 1HCGA 3SV9A 1DUAA 1YF4A 1QJ7B 1EPTA 3SI3H 4JZ1A 2BLVA 3A8AA 5G4BA 1HIAB 4X6PA 2XWAA 2HGTH 4XD7D 3LT3A 1BTUA 4ABIA 1OOKB 2CJIA 3SOSA 3OTPA 1MTSA 4YZUA 3ZZCA 4F48B 2QY0B 3GY7A 4CBOA 1EZXC 4B2AA 3VXFH 1V2QT 4WF8A 2ZHWH 5FBIA 1KXFA 4OM9A 1QL8A 1HNEE 3ZVAA 2ANMH 3B23B 2AMQA 4MNYA 1H8ED 5A8ZA 1G2LA 1ZMLA 5DG6A 3VFEA 4JYUH 1HXFH 4E7RG 1TE0A 3EQ0H 2Q6DA 4KTCA 1P3CA 2JH0D 3ZYDA 3UFAA 4YTAA 4U30A 3BIVH 2OXSA 1NRRH 1UVPA 1Y8TA 1NS3A 1E37B 1TBZH 4LK4A 2SGAA 2AGGX 2A4RA 4JK6A 2VU8E 1HAVB 2XCFA 4ABHA 1W7GH 1OYQA 2PR3A 1H8DH 1UTLM 5EQQA 1O39A 3Q3YA 4HZHA 2XC5A 4JYVH 2GVFA 1GJBB 1W13U 2F9OA 1E38B 1YCPK 1KTSB 1O2RA 4XBDA 1FN8A 2ZC9H 1GJAB 2BOHB 1A3BH 5HGGA 3KYFA 4DIHH 2VVVA 2F9VA 3EA7A 3TLOA 2BX3A 3WY8A 1P02A 1Z8RA 4M7GA 4TWYA 5L2YH 1GI4A 1VCPA 3Q00A 4MPWA 1SOTA 5JBAS 1MKWH 3ITIA 4X1SU 4WMFA 1OP0A 4K60A 1IHTH 1EB2A 1WQSA 4GUXA 3TVJB 2P8OC 3F9EA 4ABGA 1ZHMA 3LC3A 2SGFE 1S0RA 3BG4B 4TPIZ 4MNVA 1G3DA 1TOCB 1EKBB 1O3JA 2ZGHA 3P8GA 3MNSA 1G3BA 5FX5A 1Y3VA 2B7DH 3P17H 3TGJE 2RA3A 1C1SA 5IDKA 4Q7YA 1NZQH 4FU9A 2ZTYA 3GCHC 3KGPA 3UWIA 1BBRE 3CNRA 1C5SA 2GDEH 1IQIA 3D62A 2ZDNA 1TX8A 1KYNA 3UR6A 3GCNA 2JKHA 1XKAC 3SO3A 1CGJE 3GYLB 3S9CA 5E2OA 3PV4A 5A2MH 5KEDA 2KZ4A 3ZVDA 3GICB 3PV2A 2C3SA 4UFDH 1BIOA 1D3QB 5I46H 2AMPA 6CHAB 5A0AE 3BIUH 4ABJA 1OYTH 1ARBA 2V3OH 2VIPA 3D49H 1ETRH 3ZVGA 2ZPRA 4D7FA 4Y7BA 2IJOB 1X7AC 2UWPA 1SKYE 2ZA5A 2ZDVH 1GBAA 1K1IA 1RXPA 1Z6JH 3F2GA 3UNSA 1GBKA 1Z7KA 1CO7E 3BSQA 3M3VA 1O5EH 1ZYOA 4SGBE 1GHWH 4B75A 4XDEA 1UO6A 4DIIH 2GV7A 1CU1A 4MPUA 3GY4A 3GY8A 3TK9A 1YC0A 5JB9S 3N7OA 2P95A 4O9VA 2A0QB 2ZKSA 1TPOA 1GMDG 3FZDA 3LH3A 3RM0H 2G8TA 1VJAU 1GJ4H 5GWZA 3TJVA 5EPYA 1QQ4A 2PSYA 3BTEE 3S7HB 1GJ6A 3RP2A 1O2WA 2H5DA 2H5CA 1IHSH 1O3IA 5CMXH 4DG4A 1JMOH 1JBUH 2G4UA 5EW2H 3RM2H 2XBVA 4RKOB 1SLWB 2O9QA 2RG3A 2ZNKH 2QF5A 4OS1A 1C5LH 4Y6DA 2ZFTA 1AIXH 4X2XA 5EOKA 1EASA 4AYVB 1NRSH 2A5IA 2BM2A 1O2GH 2J2UA 2GD4B 1CA0B 3RU4E 5E8EH 2VGCC 4ABEA 1FIWA 1P0SH 3NXPA 1GI0A 2OK5A 3A7YA 3NKKA 4Q7ZA 1N6YA 4B71A 1O3HA 3BTHE 3T28A 2Z6BD 8LPRA 3OEED 1AO5A 1O34A 1ZPCA 2ZFRH 3B8JA 2O8MA 1SGDE 2BZAA 3UWJH 2WV5A 1DSTA 1UCYE 1V6DA 3GCOA 1C4U2 3DHKH 2NU1E 1E1QD 2HVXA 2FI4E 3URDA 3VGCB 4Q63A 4MPVA 1CHGA 3MO6A 2C8ZB 1N6XA 1YLNA 3JZ1B 1O30A 3SU5A 3RXDA 2FDAA 2A1DB 4ISHH 3E0NB 1C2KA 1TAWA 3LJJA 3RXSA 7KMEH 2BDIA 4FUDA 1B0EA 1SFQB 1YLCA 4BTIB 4WH6A 4Y71A 2RDLA 1SL3A 4I8HA 1WYKA 1ESAA 1G36A 1MKXK 2FXRA 3CS7A 5GDSH 3F0OA 1L4DA 1A2CH 4UDWH 3SZEA 1QJ1B 2QAAA 1A7SA 2ODPA 3H7TA 1V2KT 2XOKD 1V2OT 1O2TA 5DP6A 1T8OA 2RDEA 1KXBA 2LNCA 3A7ZA 4ACAA 1FQ3A 1GI3A 3SBKA 4NZQA 4LXBH 2PKSC 4U2WA 3SU1A 3HGNA 3Q3XA 3SORA 1AWHB 2KFWA 1AD8H 1O2PA 4FUFA 3ZZ8A 2BB4A 1UK2A 1C9TA 2TGDA 5C0UA 1GHVH 1EQ9A 3ZV8A 2ZDMA 1MTUA 1GBTA 4K1TA 3KHVA 1ZR0A 4MVNA 1AWFH 3EGKH 4GCHF 1IQNA 4GCHG 3ATIA 4B6EA 1BJVA 1ZTLA 2ZFFH 3E6PH 3PYHA 3QWCH 1KTTB 3DFLA 1YP9A 4HI3A 1ZMNA 1FXYA 3F0PA 1E79D 4Y0ZE 4FVBA 1O36A 1EZQA 1VITG 1MUEB 4X1NU 1KXEA 1UTKA 4HGCA 1FY3A 5E0JA 2J4IA 1H1BA 1C2MA 1K1LA 2F43B 3T2NA 2UUKB 5F53A 4OS2A 3QGNB 3E3TA 1MD7A 1SGTA 3VB3A 2G5VA 5DN6D 2KR7A 1MQ5A 4H6SB 1GL1A 2VWNA 1XUFA 3BTME 4VGCB 2J95A 5T6FA 4F4OC 4FUEA 2HPPH 1C5UA 5HMAA 4NFEA 2WYJA 3TH3H 2VWMA 2GKVE 2B9LA 3LIWA 1MABB 3UPEA 7LPRA 2THFB 3P70B 2J5UA 1O2UA 1TPAE 3ATMA 2R0LA 4FXGH 1TFXA 5AF9H 1TONA 1B5GH 1HBTH 3GOVB 1O2HA 3G01A 5F03A 3A86A 1EXFA 2F91A 3RXUA 1D3TB 1TNKA 1LVMA 5TCAA 2NU3E 5T6GA 2ALVA 2P8OB 1H8HD 2BY8X 1BMAA 4AORA 2QCYA 3FOAA 3CENA 3RXFA 1W7XH 3A89A 1DWCH 5AFYH 3TJUA 1C5WB 1BB0B 1GI1A 1SOZA 3RXKA 1IOEA 1V2NT 4X6MA 4OGXA 1SSXA 1SGEE 3RDZA 5K0HA 3SUEA 3SJOA 2ZU5A 2CN0H 1PFXC 2CF8H 2P16A 1P12E 1P9UA 1ELFA 2OTVA 1BA8B 1TNIA 3SGBE 4YLUA 1S81A 2CHAC 2FTLE 1SG8B 1G3CA 2W5EA 2ZDKA 4FUGA 3PMJA 2Z7FE 3BG4C 3K6YA 5EIYA 1Z6EA 1UVOA 6LPRA 2HLCA 1DM4B 2TGPZ 1CT0E 2SGEE 2OBQA 1QBNA 3MH5A 1CT4E 3QGJA 1TGNA 1NU9A 1CHOF 1GCTB 4Y0YE 1CHOG 1YPHC 3ZZ9A 1SGFA 3RMMH 1O3MA 1UTPA 3P95A 1OP2A 2OBOA 3S7KB 4ASHA 3T27A 1UW7A 3QUMP 3I77A 1E34B 4U32A 5TJXA 2R0KA 3O8DA 4WMEA 3LOXA 2WPLS 7ESTE 1GHBF 2F4LA 1LHCH 5TCCA 4B74A 1A5IA 1OX1A 2EY4C 3F2FA 3EE7A 4QT8C 4ZHAA 2KCAA 3E90B 4IGDA 2GMTB 3F9GA 3UNRA 1V2TT 6CHAC 1HJ9A 3M7UA 1ETSH 2YNAA 4B2CA 5CHAB 3RLYH 3TK6A 2ZHEH 4F49A 3F6UH 1UK4A 1NFWA 3ZZAA 2J98A 3VEQB 4R8TB 1FPCH 1A0LA 2CK3D 3MH7A 2BD7A 2A32A 1Q3XA 1KXCA 3PB1E 1O35A 1AFEH 1C2HA 1A3EH 2O8LA 2BDGA 1LKAA 1LCYA 4IMQA 1K1JA 2A7CA 1E35B 1T4UH 5HIZA 2AFQB 1HFDA 1ZRKA 3ZVBA 1VITH 4CRFA 2YOLA 2GCTB 4JZDH 4HTCH 4TY6A 2R3YA 2BXTH 2ALPA 4MLFB 1ZPZA 2P3TB 5EPNA 4K1SA 5HIYA 1O33A 6GCHF 2GJGA 5JYIA 2XWBI 3H09A 1MCVA 1GGDB 1UHBB 5ETXA 1KDQA 5C94A 1P09A 4K8YA 1O3AA 3M37A 1BOQA 1W3CA 1OWIA 1DITH 2FOMB 3MOCA 1GL0E 1O2MA 3BTTE 1HIAA 2B0FA 4XFQA 2HLDD 1BRUP 5L30H 1QTFA 2NU4E 2BD8A 2V0BA 1CA0C 2ZIQH 5DO4H 1G2MA 2LELA 2K0QA 2AGIX 4Z6AH 4TT3D 1SGNE 4CBNA 4O3TA 3SJKA 3RXHA 3H7OA 2ZFSA 3P6ZB 4X1QU 1TRMA 1KXAA 4O97A 1TRYA 3KN2A 1NRPH 4FUJA 4XBCA 3F2HA 4XSKU 4BAOB 2EI8A 4GAWA 1AVXA 1O2KA 1DANH 1LVOA 5DGJA 1QBVH 1AZ8A 4YT6H 2XRCA 1L2EA 3KQEA 2BQWB 3TPIZ 3SNCA 1P2IA 1A61H 5LPRA 1IQKA 3SJIA 3WWFA 1ZJKA 8KME2 1Z8JB 1YPGH 2V7QD 4Q80A 1EJMA 2A45B 4THNH 5DJ7A 5FXLA 2PKSB 1P2OA 2QC2A 1HAVA 3SUFA 1GBLA 2A4GA 4DT4A 2ZCLP 3Q3KA 3FANA 2ZHDA 2OQUA 2V6NA 1SC8U 1PQAA 2IJD1 2RFKC 1EAXA 2BDHA 1GBEA 3ZYEA 4I8JA 1T4VH 3AASA 2EQNA 4FU7A 4ZKOU 3FN8A 2ZI2H 1L1JA 1L1GA 3OU0A 1MU6B 3LGYA 3OY5U 1BJUA 2UUJB 2TGTA 4UONA 2A7HA 4ZCNA 3DD2H 1O3NA 1T32A 1VCQA 1NU7B 5CE1A 2OC7A 4NIVA 4JCNA 3MI4A 1S6LA 1BTXA 1GWAA 4DGJA 4DURA 2GGVB 1C1PA 1F7ZA 1MAXA 1FAKH 2FO9A 2P93A 3GDSA 3Q76A 4B1TA 2KAIB 1FY5A 2J38A 3QDZB 1XUJA 1AE5A 1BQYA 3KQDA 1P01A 5C1UA 2G52A 2F9UA 1TMBH 1NM6A 5IYTA 3BTDE 1YKTA 2BD4A 2QYIA 1OWJA 1ELEE 1GVKB 1O3DA 5GPIB 2XXLA 3DSOA 1C9PA 5L6NH 2I6SA 1CBWC 1MBQA 4I33A 5JB8S 2C8WB 3A80A 4ZKSU 1BTWA 2Y81A 1N8OB 4I32A 1EJNA 3A82A 3F1SB 3BTFE 4FOUC 2BVRH 2HRVA 2ZDAH 1S82A 1B0FA 2EA3A 4IS5A 3RU4D 3BTWE 4CR9A 2YMSC 4WXVA 2BD9A 4AOQA 1C2GA 1DE7H 1EP5A 1OP8A 3EA8A 1FONA 2BVSH 4FUCA 1OS8A 1UCYK 1P06A 2OQ5A 4VGCC 1O5CB 4TSFD 2VIQA 2YNBA 5EJZA 3H5CB 3UOUA 4LZ1H 2CGAA 2BQ6B 1J17T 1EOLA 1O32A 1UTQA 1CSOE 2QXJA 1GI6A 1Y5BT 1J8AA 2XC0A 1MTWA 3UREA 1EFRD 1RS0A 2QF3A 1ARCA 5HXFA 2ZECA 5LPEA 5H4IB 2QN5T 3V12A 1PJPA 1PYTD 5E0GA 2CV3A 1VJ9U 2M2AA 2FP7B 3PV5A 4DY7B 1F0TA 2HNTE 2TRMA 3IITA 3BTGE 2CHAB 9LPRA 2FX6A 2FS8A 1INCA 1O3GA 4MNXA 4MNWA 2PKAB 1TLDA 2FTMA 3RXMA 3HATH 1AUTC 3SV8A 4AZ2B 2A4OA 4ISLA 1AVGH 3MFJA 7GCHF 7GCHG 1WSSH 1AU8A 3ZV9A 1FJSA 4X0WU 4WJG2 1K1PA 3PRDA 1B7XB 5KECA 5C5NA 1J15A 1XXDA 1O2XA 3ZZ7A 4KGAA 1ZPBA 4IMZA 3ESTA 3LDXH 4YM9A 3MMGA 3A7TA 3PMHB 5CHBA 3HKIB 2FESH 2F9BH 2ZZUH 4A92A 1GCTC 4KP0A 3UUZA 2W7SA 1BRBE 3DSGA 2WUCA 2ZFQH 4Y7AA 3T5FH 1O38A 2F9PA 1C5TA 3FVFB 1C5MD 1MMJN 1RTKA 2VH0A 5ABWA 1YPHE 1DWEH 1C2IA 1QL9A 3M3TA 3SJ8A 1G30B 3LGTA 1HAXB 4GHTA 1YPLH 3S9AA 2G81E 1FY4A 2GMTC 1PQ7A 1ELGA 1BMLA 1JRTA 1GI5A 2BDBA 1TNGA 2SGQE 1D9IA 1GVLA 5CHAC 5A09A 2VIVA 4B6FA 4CRGA 4IBLH 1T31A 1PQ8A 3MTYA 3MHWU 2STBE 1ANBA 3FP8E 1GMDF 1H4WA 4IC6A 3W94A 2IOTA 2ODYB 1EAUA 1SGRE 3Q77A 2CMYA 1BDAA 3OTJE 4CRCA 2C93B 4BAHB 3KL6A 3SW2B 1ZSLA 1YLDA 3RUOA 3RMOH 3I78A 4I31A 5C1XA 1QIXB 1BUIA 4ZHLU 4AB8A 1MU8B 5ESBA 1HJAC 2GCTC 1SHHB 3DT0H 3UY9A 3RLWH 1MZDA 1O3OA 1MD8A 2QXGA 3D23A 1GJDB 2ZFPH 3PTNA 1GGDC 1C2DA 3ZVFA 2H2ZA 3QK1A 1XUIA 3RXQA 4ZKNU 5JPMH 5DP9A 1GG6B 3MNBA 3T29A 4P00A 1C1MA 1C1TA 5DP7A 1FMGA 5HKKD 2V35A 1ZOMA 1CVWH 1AMHA 1ABJH 3RC6A 1CA8B 5A0BA 1K28D 2WZQA 2BY9X 4YOIA 4Y8XA 2WV4A 2Z3DA 1FNIA 3UB0A 1FUJA 1OWDA 2FOBA 3QZRA 4NGAH 1HLTH 1QB9A 1T8LA 2FMJA 1P03A 2ZF0H 3K9XB 1GI2A 2ZCKP 2ZU1A 5IK2D 3STIA 1HAZB 1TPPA 2OD3B 1O5BB 1BMNH 4B2BA 1QZ8A 3SU0A 2SNVA 2FI5E 3RMLH 4MQAA 1P57B 1QL7A 3SUDA 4INHA 1YPEH 1TMTH 3PLPA 3MU4A 2FODA 3DA9B 1QJ6B 2ZCHP 1W11U 2TPIZ 3SGAE 1G3EA 3BEIB 3EYDA 3FAOA 2BX4A 1GHAF 1WUNH 1GHAG 1NC6A 1P2QA 2BOKA 1YCPH 1TIOA 2JETB 2OC0A 1AVWA 1ZLRA 1LHGH 3ODDA 4RT0A 3A81A 4NSYA 2DE9A 2ZU4A 2KM0A 1O2NA 3RXBA 1TNLA 2GZ9A 1FX0B 1MZAA 4IN1A 4J1YA 5C0TA 4X2YA 1AB9B 1AUJA 2J9NA 3SZNA 1LPZB 1M9UA 1JWTA 1QB1A 2VWLA 1S5SA 2UUYA 1OHHD 2BXUH 3UIRA 5LGOA 3LJOA 4ZXYH 2O8UA 4CH8B 5I25A 1RIWB 3SUGA 3ZZ4A 1T8NA 3MYWA 1BRAA 1ZZZA 1TA6A 1FY8E 2ZTZA 3GY5A 2O8WA 3UAIC 1NFUA 4UD9H 2PP6A 4YOJA 1CBWB 1AY6H 2PLXA 3OAAD 2DUCA 1S83A 1HYLA 1WBGB 1XM1A 5DP8A 2BLWA 4KTUA 4Y8YA 1VITF 3R0FA 1SHYA 1GJ8B 1QFKH 3P8NA 1WV7H 1WTHD 5FL7D 5HM9A 1HAYB 2ZGCA 2YMSB 5EQSA 1H9IE 2NU0E 1EAIA 4BTTB 2GX4A 4BANB 2GP9B 2QF0A 1P10A 1YPKH 3HK6B 1TABE 3VB4A 1P3EA 2AS9A 3KQBA 1N8OC 2HOBA 1J16A 2FLBH 1GDUA 1P2KA 1O5GH 4MG3A 4AN7A 1SGYE 1D3DB 4WWYA 3FP7E 4D9RA 2JJ1D 3E0PB 5T3HA 4CH2B 4H4FA 2SNWA 1S84A 2G00A 2VINA 4NA7A 1SQAA 4BOHA 4WVPE 2BD3A 1ELCA 2D2DA 2W7UA 5HYOA 5A8XA 2PSXA 3KQCA 1XKBC 2IPHA 1SI5H 4YLQH 1G37A 1C5ZB 4KKDA 5EXLA 1NPMA 1IQMA 1LPKB 1QURH 1LHFH 2PTNA 4CREA 1O5AB 4ISNA 2HWLB 2JH6D 1AKSB 4WMDA 1HV7A 1Q2WA 2F3CE 1AFQB 4BXWA 3FKSD 1DLEA 1EX3A 1T8MA 2FI3E 3A8DA 2ANKH 4O03A 5FCRA 3BF6H 4RN6A 3IG6B
chains in the Genus database with same CATH topology
1SR5C 1PPHE 1C2LA 1Y3YA 3MU5A 5GJ4B 5K7RA 2ANWA 3OX7U 1ELVA 2QXIA 1KY9A 1FZZA 2B8OH 1O2VA 2Y5GA 3L3TA 1F5LA 1GMCF 1A5HA 1DXPA 1GMCG 4YOGA 4ZHMU 1NRNH 1ZTJA 4FUIA 1V2UT 3O8BA 2Y5HA 4AG1A 1UHBA 1EAWA 3M5OA 4X8VH 1DT2A 1QCPA 2FEQH 1F0RA 1GBMA 3RXLA 1RRKA 2I6QA 1D6RA 5JBBS 4BTUB 1GBFA 2Y80A 1O2OA 2R3UA 4ZXXH 3TITA 3S0NA 1A5GH 1GHZA 1GMHF 5FBEA 1GMHG 1F5RA 3UQVA 5JBTA 1Z71A 3TK5A 2K1QA 3PMAB 1V3XA 5GCHF 2CXVA 2ZPQA 1MH0A 3AAUA 5GCHG 1UTJA 1SFIA 3K2UA 3O8CA 2BMGB 5GXPA 1EPTC 4XE4A 5JBCS 2PV9B 1RJXB 2ZO3H 1EP6A 3VB7A 1IQHA 2IN2A 2BDAA 1RTFB 2D8WA 2O8TA 1LDTT 1P2JA 4UFEH 4B76A 5LH8A 1GBIA 5DP5A 1UJ1A 1XMNB 2ESTE 2VIOA 4OS4A 1DSUA 1GI7B 3AW0A 1NT1A 1SGFG 4Y11E 3V7TA 1AE8H 2Z9IA 1W0YH 1BZXE 2C4FH 2PW8H 4WH8A 4X6OA 1Y5AT 2Z9LA 3ATWA 1BHXF 1ZTKA 1UTMA 5EG4A 2QGRA 2AIQA 1ZHPA 4B73A 1AHTH 4IC5A 3UR9A 3TGKE 1NFXA 3SV2H 3M5MA 2BZ6H 2EC9H 1KSNA 5DK1A 4DW2U 4K5ZA 1C5RA 3SNDA 4Q7XA 1MKXH 1K2I1 4CRDA 1DUEA 4BXSA 4OS5A 1IAUA 2R9PA 3URCA 1HAPH 3I29A 2ULLA 2J94A 1HJAB 4ZKRU 1C5QA 4MTBA 2GTBA 1S0QA 1MKWK 3ATLA 2BD2A 1PPBH 3QN7A 2VH6A 2Z3EA 2FM2A 5J4QA 3LKWA 1O3PB 2D1JA 1MTNB 2BD5A 2D26C 5LPFA 4NG9H 1UVTH 1DS2E 2A2XH 4DJZB 1D3PB 1THSH 1W2KH 2H9HA 3BTQE 1P11E 3CP7A 1O2IA 1C4V2 1C2JA 1EATA 4Q2KA 4DVAU 3NPSA 2KAIA 2GDDA 3LPRA 1ZSJA 1UTOA 3GCTF 3U8TH 3GCTG 1MBMA 2W26A 3RC5A 3LGUA 1QR3E 3P8FA 2QV1A 4PROA 3DFJA 1ESTA 3U9AH 3NK8A 3M7QA 4TPYA 2RCEA 3V0XA 1TPSA 5DKMA 3SHCH 4WXIA 2Y7ZA 4XBBA 1DX5M 1DOJA 2BY5X 1GG6C 1XX9A 1C5OH 1PPEE 1ANDA 3RXRA 2H9EH 1GVZA 1C2EA 1C4Y2 3AVZA 4CRBA 1GDNA 2QA9E 3PTBA 3GY2A 2FPZA 2UWOA 5FCKA 1JIMA 1TQ0B 1L1NA 3RMNH 3LU9B 1BHXB 5EW1H 4A1TA 1A0JA 2V3HH 1V2WT 1Y3UA 5DP4A 3DUXH 4AGKA 1P2NA 1V2MT 1WCZA 3ATKA 2STAE 3PLKA 3STJA 2A7JA 1IQLA 1TWXB 5C20A 3LGIA 2PGBB 2WPIS 4GVUA 2JH5D 2WPHS 4AFZA 1UVSH 1SLXB 3L6PA 2HPQH 4Y10E 3U98H 3RU4T 1UVUH 4ZUHA 8GCHG 2ZEBA 5FPYA 2VVUA 1TOMH 1GI8B 1IQJA 4JZFH 3VB5A 1SGQE 3PWCA 2XTTB 1CGIE 1YBWA 3RXJA 2TIOA 3FFGA 4JZIA 3PO1B 2BDCA 2JETC 3IWMA 1C5PA 1NROH 3MU0A 3M35A 5ESTE 2BYAX 1QGFA 1GBBA 2A31A 2FYRA 2PKAA 1RTLA 1NY22 1ACBE 1AB9C 3S69A 1SQTA 5BPEA 3UOPA 4I8GA 3C27B 1LQDB 1JOUB 1AN1E 2A5AA 3TH4H 3VXEH 5E2PA 1RIWC 3RXCA 1VCWA 1OXGA 5E0HA 2XYAA 1JIRA 2GCHF 4JZEH 2GCHG 2EEKA 1P04A 3KCGH 3SNEA 5GIBA 3A8CA 5HM2A 1KIGH 1O2JA 4X1RU 3QX5H 3GISB 1KLJH 1L4ZA 1EZSC 1FIZA 1L0ZA 1C1VH 4A6LA 3A7WA 1SBWA 2BHGA 3RXGA 3RXOA 3FZZA 2ZQ2A 1LKBA 4SGAE 2ZTXA 2A2QH 1P8VC 1K21H 1QA7A 1VGCB 2VNTA 1PPFE 5EODA 3PWBA 1FDPA 2H6MA 3LONA 1N1LA 1GBDA 1TGBA 2WPMS 2PGQB 1ZSKA 2UUFB 3BEFB 4E7NA 1J14A 1O3FA 3EE0B 4XOJA 1ELAA 1YGCH 4NSVA 4FUHA 1OWHA 3ELAH 3BEUA 2XNIA 3SV7A 1QB6A 1TQ7B 4I7YH 1GBCA 3GY3A 1O3CA 1YPMH 4NIYA 5J4SA 1LTOA 3S9BA 2R2MB 1O2QA 3MU1A 1AFQC 2XBYA 1DVAH 2SGDE 3SNBA 3A7VA 2FLRH 1CE5A 1TALA 1RFNA 1DLKB 3LGWA 1ORFA 4OS6A 2TBSA 3UNQA 1D6WA 3RXEA 4IW4E 3SU2A 5A8YA 3E91A 1P05A 3SQEE 3E1XB 2UWLA 4A1VA 1FN6A 1C1UH 3LC5A 5BRRE 3AW1A 3A87A 1C1QA 1DICA 4TY7A 1FY1A 1C2FA 1D4PB 1EPTB 4X8SH 2W3KA 4ABDA 2OLGA 4RKJB 1U6QA 3E16B 1WAYB 3RXAA 1MCTA 2GV6A 5F6MA 4MPXA 2F9NA 5F8TA 1BRCE 3B9FH 3MH6A 4CHAC 3PROA 4ZH8A 2Q6GA 3FP6E 2G5NA 5SGAE 1C5VA 4AX9H 1O2SA 2FOEA 4AGJA 4X8UH 4K8BA 1Z8IB 1A0HB 1HGTH 1TX6A 2PFEA 1GJ9B 1HAIH 3SI4H 1MAYA 2PWXA 1SGPE 4BNRA 4O3UA 3SU4A 6ESTA 1ZGIA 1YCPM 1FAXA 3TIUA 1TX7A 1T7CA 1BBRH 1O37A 1V2VT 1NFYA 5C2ZA 3UTUH 3T62A 1GDQA 2TGAA 1WOFA 3KF2A 1C5YB 1O2YA 3V3MA 2AH4X 3BG8A 5FPTA 1UMAH 3MU8A 1P2MA 3A85A 3ZVEA 1Z1IA 3A84A 3PMBB 1BCUH 1G32B 1NRQH 2H1UA 3NUMA 3M36A 3ZZ3A 3M3SA 1IQGA 3U1IB 1KLTA 2OC1A 3A7XA 1DWBH 1SQOA 1HPGA 1LHEH 2B5TB 3EDXB 3M5LA 2VJ1A 3ZZ6A 2P94A 3K65B 2J92A 2GT8A 1SMFE 3GYMA 1DY8A 1Z8GA 4GHQA 1MTNC 2ZGJA 3RXVA 2J34A 2Q1JA 2ZHFH 1QA0A 2WUBA 1W0ZU 1HJ8A 3RXTA 4NFFA 1YPJH 2R2WU 3EA9A 4Y8ZA 3TNTA 1GBJA 3F68H 3QLPH 3SN8A 5F8XA 5EQRA 3PLBA 2AERH 2ZQ1A 1J9CH 3OYPA 4U01A 4KELA 2GZ8A 1ANEA 4K1EA 3TU7H 3A88A 2BDYA 4X2VA 4CR5A 1PQ5A 1GHYH 4E06H 4FUBA 4NIXA 1ZGVA 1LVYA 3GDUA 1UK3A 1ZMJA 4K69A 1P9SA 1HAHH 1Q31A 3SJ9A 4YESB 2W3IA 4D76A 1TBRH 5C3NA 1ELDE 3SHAH 3SV6A 3LGVA 1THPB 2AMDA 2HALA 3KIDU 1O3KA 1H9LB 3O8RA 1O0DH 1FPHH 4I8LA 1UCYH 4D9QA 1E36B 1AKSA 2AGEX 3QO6A 1BMMH 2WYGA 1IQFA 3AAVA 3ZZBA 1EUFA 4AFQA 1GCDA 1TGTA 1EB1H 2XW9A 2Z9GA 4JK5A 1FI8A 3GDVA 4BAKB 4AYYB 1V2ST 2C8YB 3CS0A 4K3JA 1DWDH 4TWWA 1K1MA 1K1NA 1OSSA 1SVPA 5EGMA 1BTHH 1JXPA 1K1OA 2Z9KA 3BV9B 4INKA 1MQ6A 1W8BH 3QTOH 3OSYA 1GBHA 1ZJDA 1A4WH 4KTSA 2ZU3A 4YT7H 3P92A 1PPCE 3PO1C 3RC4A 3E8LA 1F5KU 3LH1A 2ZPSA 2VIDA 4NA8A 4R0IA 5DPAA 1GHXH 2CF9H 4OGYA 1PPZA 2FOGA 1H9HE 1HXEH 3OY6U 1HB0B 4DCDA 1CQQA 2PTCE 2FZZA 4FVDA 1C1NA 3NCLA 1HRTH 3U8OH 4LZ4B 2SFAA 1BTYA 2EI7A 3ZVCA 3MH4A 1RGQA 4NWKA 1Y5UT 2A4QA 3C1KA 3ENSB 1S85A 1HAGE 2BTCE 1DDJA 1SB1H 2DE8A 3MO3A 3HK3B 1QRZA 2ZDLA 1TNHA 1AI8H 4AG2A 1ABIH 1W12U 2OC8A 8ESTE 2OINA 3JZ2B 1LVBA 1NO9H 1DXWA 1XUKA 2ILNA 1F92A 1PPGE 4H42U 4AB9A 5JDUB 3MO9A 3KNXA 4X2WA 5FPSA 2PUXB 1C1OA 1VR1H 1EOJA 2NU2E 3RXIA 2AYWA 1BTPA 1VGCC 1TGCA 2XCNA 3TGIE 2FYQA 1OKXA 1OWEA 5EXMA 2WINI 4ABFA 1O3EA 1SGIB 1O5DH 2ZG0H 2C90B 2VIWA 2ZP0H 2HNTC 5PTPA 1ZHRA 1G9IE 4ISOA 4ZAEA 1XUGA 4X1PU 1BTZA 1QRXA 1TA2A 4X8TH 4H6TA 1OWKA 1EJAA 3F9FA 1F0UA 1XUHA 1A1RA 1W14U 1A46H 3A8BA 2XBXA 1SGCA 1FLEE 1LMWB 2SGPE 1TB6H 1ELBA 2GZ7A 4J2YB 1OPHB 1NN6A 2ZHQH 1NESE 3T26A 2ZU2A 2XC4A 4GSOA 1Y3WA 1AGJA 2FOCA 5FHTA 4X6NA 2FX4A 4NIWA 2P3UB 3BN9A 4CHAB 4AFUA 9ESTA 3GCHB 1DPOA 1THRH 2AEIH 3SNAA 1UTNA 4E05H 1Y3XA 4K2YA 1V2PT 3MNXA 1YYY1 5C67A 4Y79A 4BAMB 1HAOH 1QY6A 5C5OA 1ESBA 1WQVH 1S6HA 3W95A 1O31A 1F2SE 1YM0A 1EZUC 1GI9B 1NTPA 4DOQA 4UEHH 1SPJA 1W10U 3BTKE 2BLQA 1K9OE 3QTVH 2OP9A 3SGQE 1CGHA 5A0CA 3MWIU 1QBOA 1C5NH 2FIRH 2A5KA 4JYTA 1KLIH 2Y7XA 3SU3A 4ESTE 2BLOA 1O2LA 2OCVB 1XXFA 4NWLA 1GPZA 4NA9H 2WPKS 1AQ7A 3D65E 2OUAA 5AHGH 3ZZDA 2BY6X 1O3BA 3F9HA 1GHBG 1ZRBA 2RA0A 1XVMA 2BVXH 1BITA 2AIPA 3TJNA 1GJ7B 5FAHA 1QQUA 1H8IH 2M5TA 3HKJB 5L2ZH 3U1JB 4LOYH 2G55A 5T6DA 4UFFH 1TYNA 5EXNA 1IQEA 1MTVA 3R3GB 2FS9A 1TNJA 3QZQA 4Y76A 1C5XB 1WU1A 2ZWLH 4ZMAH 4ZROA 4MDSA 4RSPA 3SU6A 5C1YA 1GJCB 1V2RT 5DP3A 1DFPA 1Y59T 1K22H 4IN2A 3VB6A 4ABBA 1SLVB 3RXPA 2BQ7B 3U69H 1ANCA 4A1XA 2Y6TA 4A7IB 6GCHG 2VGCB 3L33A 2G4TA 2ANYA 4JMYA 2WPJS 2PUQH 3NWUA 3SQHE 4I8KA 1Z1JA 3UQOA 4D7GA 2P3FH 1LO6A 4NCYA 1HUTH 2VVCA 4Z0KA 4TYDA 1ETTH 3M5NA 1O5FH 1PYTC 3NZIA 3EAJA 3U8RH 3GY6A 4NZLA 4WY3A 4A5TS 2XBWA 1AZZA 4UFGH 2G51A 2Y82A 4D8NA 1F0SA 1V2LT 3M7TA 1DY9A 2VWOA 1E0FD 2FOFA 1LQEA 1V2JT 2FOAA 5FX6A 2LPRA 5AVDA 3K6ZA 2NWNA 1RD3B 1ELTA 3VGCC 1BBRK 4BAQB 2EI6A 1LHDH 1BT7A 4OS7A 1WTGH 2P59A 2HNTF 3P8OA 4CRAA 1TRNA 1JRSA 2QIQA 1SLUB 2ODQA 3MNCA 4GPGA 3V13A 1GJ5H 2GT7A 2ZGXH 1C1WH 2C8XB 4YO9A 1TMUH 3TJOA 4INLA 2ZGBH 4ISIH 8GCHF 2BY7X 1LPGB 1QNJA 3KEEA 2VB0A 4UE7H 2Z9JA 1O2ZA 3ZZ5A 1TGSZ 1QRWA 2Z3CA 5F8ZA 2Q6FA 3M61U 3PM3A 2Y5FA 3HGPA 3T25A 2H9TH 1HDTH 4FU8A 3HPTB 1XVOA 2FWWA 5EU8A 4DT7B 1S6FA 4GLYA 5B6OA 4AFSA 1O3LA 2F83A 1VZQH 5AFZH 3VPKA 1ID5H 4ABAA 3A83A 1TBQH 1CT2E 2PHBA 2ASUB 1KXDA 1QHRB 4HFPB 1C1RA 3ODFA 3TNSA 1KDQB 2FOHA 2Z94A 2QXHA 3TH2H 1FV9A 1HCGA 3SV9A 1DUAA 1YF4A 1QJ7B 1EPTA 3SI3H 4JZ1A 2BLVA 3A8AA 5G4BA 1HIAB 4X6PA 2XWAA 2HGTH 3LT3A 1BTUA 4ABIA 1OOKB 2CJIA 3SOSA 1MTSA 4YZUA 3ZZCA 4CBOA 2QY0B 3GY7A 1EZXC 4B2AA 3VXFH 1V2QT 4WF8A 2ZHWH 5FBIA 1KXFA 1QL8A 1HNEE 3ZVAA 2ANMH 3B23B 2AMQA 4MNYA 5A8ZA 1G2LA 1ZMLA 5DG6A 3VFEA 4JYUH 1HXFH 4E7RG 1TE0A 3EQ0H 2Q6DA 4KTCA 1P3CA 2JH0D 3ZYDA 3UFAA 4YTAA 4U30A 3BIVH 2OXSA 1NRRH 1UVPA 1Y8TA 1NS3A 1E37B 1TBZH 4LK4A 2SGAA 2AGGX 2A4RA 4JK6A 2VU8E 1HAVB 2XCFA 4ABHA 1W7GH 1OYQA 2PR3A 1H8DH 1UTLM 5EQQA 1O39A 3Q3YA 4HZHA 2XC5A 4JYVH 2GVFA 1GJBB 1W13U 2F9OA 1E38B 1YCPK 1KTSB 1O2RA 4XBDA 1FN8A 2ZC9H 1GJAB 2BOHB 1A3BH 5HGGA 4DIHH 2VVVA 2F9VA 3EA7A 3TLOA 2BX3A 3WY8A 1P02A 1Z8RA 4M7GA 4TWYA 5L2YH 1GI4A 1VCPA 3Q00A 4MPWA 1SOTA 5JBAS 1MKWH 3ITIA 4X1SU 4WMFA 1OP0A 4K60A 1IHTH 1EB2A 1WQSA 4GUXA 3TVJB 2P8OC 3F9EA 4ABGA