1C2DA

Recruiting zinc to mediate potent, specific inhibition of serine proteases
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c2dA02
3SJ9A 1SC8U 1WQVH 2ZHEH 9LPRA 1TGNA 1A3BH 3S9CA 3O8DA 4YZUA 2A5KA 5JB8S 3HK3B 1BRUP 4R0IA 2JH0D 4O9VA 3HKIB 4NA8A 4B76A 3UQOA 2QIQA 4YTAA 1A61H 3TK5A 3I77A 5PTPA 2FOEA 1TRMA 3UOUA 1MZDA 1TNHA 2J38A 2ZU1A 3BTHE 1GL1A 2ZDKA 1BRAA 1SGEE 2YNAA 1CU1A 4AB9A 4I7YH 3SHCH 1O2OA 1TIOA 1KXDA 3RXCA 2QC2A 3OY6U 4Y8YA 3M3TA 4KGAA 3PLKA 3ESTA 1QRZA 1V2PT 1C5VA 1O5EH 4X1SU 1G2LA 1SB1H 1HAYB 5JBBS 4AFUA 1XVOA 2UWOA 3RC4A 1O5DH 1WCZA 1JRSA 3ITIA 4E05H 1FUJA 2V0BA 5LGOA 1TONA 1G36A 2IJOB 1QJ6B 1VCWA 1EAIA 1QA7A 2EI6A 2OBOA 1PPCE 3CS0A 4F49A 1W10U 3T28A 1VZQH 4UFEH 1VITF 1HLTH 1C2GA 2ZHFH 3GICB 1O3DA 2G5VA 1HUTH 1ESBA 1ZTJA 1Y5BT 1TGSZ 6CHAB 1BTXA 1EZQA 2A4GA 3KQDA 5EQSA 3SUDA 3RXLA 2BY7X 4XBCA 1EPTB 5CHAB 1G32B 2ZHDA 1UK2A 3LGWA 2I6QA 1WTHD 3A8AA 2OQUA 3A88A 4NA9H 3KQEA 1AIXH 3M36A 1W0ZU 4U2WA 1THPB 4ABDA 1JMOH 4BAHB 1TWXB 2VIOA 4I8LA 1P3EA 2ZCLP 4X6PA 4YESB 1O3NA 1LVYA 1QY6A 3EQ0H 4A6LA 1TPPA 1QB9A 3GISB 3PWCA 1V2UT 3RXUA 1AFQB 1MCVA 2GGVB 3QTVH 3BTEE 4ISNA 2D8WA 7GCHF 5A0BA 1PPEE 2J92A 1EJMA 1DWCH 2BDYA 2VWLA 4B73A 1AQ7A 1AZZA 1GG6B 2OC1A 5LPFA 1AB9C 2IOTA 1GMCG 1XMNB 4GHQA 3DT0H 1C4Y2 1ORFA 5E2PA 3SOSA 2SGFE 2GCTC 4CHAB 2LNCA 3LU9B 1EKBB 4UEHH 1KXEA 1EP5A 3M61U 3RM0H 1O3EA 1GWAA 2A2QH 4MPWA 1G3BA 5TJXA 4DCDA 1GHYH 3AW0A 1EATA 1O2YA 1O3GA 2ZGXH 3GDSA 1E34B 1AGJA 2J4IA 1Z8RA 3RXBA 2ZDLA 4OS6A 2GTBA 1GDUA 1AHTH 1ANCA 2BDHA 3BTGE 2FLBH 7ESTE 1F92A 1SQOA 4GHTA 2QV1A 1KLIH 3M3VA 1ETTH 4ISHH 4NA7A 2Q6DA 1GI7B 2FXRA 2XYAA 1FN8A 4FUDA 5ESBA 3M5LA 3UTUH 4AG1A 5L6NH 4ABBA 2P95A 4U32A 3RP2A 4BAMB 1LVBA 1FY4A 1C1QA 4X6MA 1O3LA 1J17T 1NU9A 1OYQA 3TJUA 3MH6A 1W3CA 1ELTA 3F9HA 1QA0A 4YOGA 2PHBA 4GAWA 4XSKU 2ZTXA 3ATKA 2FI4E 3BEFB 1O3HA 2PUQH 2OC7A 2BOKA 2RCEA 3BG8A 1YPEH 2Z9GA 2D26C 3SV7A 3P8NA 5E0JA 2V3HH 4WXVA 4FUEA 1FY8E 3LC3A 1GJ8B 3LGIA 3URDA 1SQAA 2SGDE 3ZYDA 5DPAA 1H8IH 2AH4X 3EE0B 3NCLA 5F8TA 2ODQA 4Y8ZA 4E7NA 2ANYA 1C5LH 3SI4H 1YM0A 3S7KB 2JH6D 7GCHG 4BTIB 1X7AC 4GVUA 1HAVA 1QBOA 2HLCA 1ELAA 1MAYA 3PTBA 4D9RA 2PTCE 3A83A 3SV9A 2PKAB 3BTME 4IW4E 2R0LA 2O9QA 2RG3A 5EU8A 4RKJB 2P94A 3E1XB 2BDIA 2ZIQH 1NRPH 2VIWA 2ANWA 2J94A 1HAVB 3VB5A 5F6MA 4IS5A 4K3JA 3M35A 1ARCA 4X1QU 3NWUA 1GMDG 1P8VC 1C5XB 2HNTE 2UUKB 1UCYK 2CF9H 4K8BA 5HM9A 8KME2 2STAE 4AORA 2D2DA 1GVZA 1LO6A 1YPMH 1K1MA 1ZGVA 1GDQA 2QA9E 4RSPA 1OPHB 8LPRA 3QGJA 2FWWA 2Z9KA 2A4RA 1NROH 1LCYA 1O39A 1O2TA 3SJOA 4GUXA 1CHOG 3TJNA 5IDKA 2QCYA 1C9PA 2G55A 5AHGH 1BDAA 2A7HA 3PO1C 2WPHS 5BPEA 2A1DB 4NZQA 4XOJA 1NFUA 1D6WA 5IYTA 2Z9LA 5K0HA 3EYDA 3I78A 2ZFQH 5FHTA 1PPHE 2FOFA 1GMHF 1QTFA 2PR3A 4AYYB 1WSSH 3SU6A 1ELDE 2QF0A 4CR9A 2YOLA 4X2VA 2GMTB 1C2KA 3GY6A 3UNRA 1IQJA 1Z8IB 4INKA 1C1PA 2ZHWH 3ZZCA 1GI9B 1KDQA 1LMWB 3T5FH 4WJG2 3BSQA 1SGFA 3RXRA 3KL6A 3LH3A 4CH8B 4D76A 4YO9A 1C1SA 2BY8X 2AGGX 1FY3A 4NCYA 3RXMA 5A8XA 3HPTB 2F83A 1KDQB 1N6YA 1L1JA 2GZ8A 1INCA 2FOAA 3ZVCA 1OKXA 3K65B 3LC5A 5E8EH 5A0AE 2TBSA 2ZGHA 1A0HB 5GWZA 4D7GA 3U9AH 4CR5A 1UJ1A 2AIPA 1AWHB 3ENSB 3U1IB 2ZO3H 4ABJA 1OXGA 1QL7A 5I46H 1EJAA 1O3CA 1NTPA 1S0QA 1GHZA 1ANEA 1GBFA 1O30A 4WMFA 2Q6FA 1FAKH 1MKWK 3MNXA 3UNSA 1JIMA 1HXEH 1GPZA 2WUCA 1HB0B 1GBKA 3KQBA 1W0YH 3A7ZA 1MU6B 5T6GA 1HFDA 1HAZB 4TPIZ 2FO9A 4INHA 2F9OA 1OWHA 1S82A 1ZSKA 1TMUH 2Y5FA 1HBTH 4IGDA 1LDTT 2P59A 2W3KA 3FAOA 4Y8XA 2OP9A 5HXFA 4O03A 2FEQH 1AU8A 2G51A 3FP7E 1KTTB 4B2CA 4CRGA 3P8FA 1D3PB 1ZZZA 1FQ3A 1TBZH 2GCTB 1NM6A 4Q2KA 1C1UH 1AZ8A 3P92A 1C4V2 2YNBA 1GBLA 2OQ5A 1HPGA 2P3UB 4YM9A 2ZZUH 4DURA 1YPHC 3ODFA 5GXPA 1Y3UA 2BLVA 1PPFE 3M7QA 3A87A 4TY7A 1ANBA 3SW2B 1K1NA 4JYTA 4Y76A 4ZKRU 1XKBC 3A7VA 1O31A 1GMHG 2Y81A 1O3FA 1MTVA 2ZFPH 1GBMA 2W26A 1K22H 3F9GA 1F0SA 3SU4A 1P2NA 3SN8A 2DE9A 2XWBI 1K1PA 1BTUA 1KIGH 3KEEA 1SMFE 4TPYA 1FJSA 3B8JA 1SSXA 3ZZ7A 4JZ1A 1O2VA 1DXPA 1ZJKA 4WXIA 2I6SA 3SI3H 5E2OA 1MD7A 5C1XA 1TA2A 2PSXA 3QUMP 2B8OH 2HPQH 3P8OA 3PLBA 4OS4A 2H5CA 1Y59T 4YLUA 2BQ6B 1O2NA 1H9HE 3QX5H 3F6UH 1F5LA 4DOQA 1XUHA 3MO6A 2BM2A 2Z9IA 3OYPA 1HAGE 3SU5A 1P3CA 1ZPZA 4J2YB 4ISOA 3ODDA 1VGCC 1LKBA 4WMEA 1A5GH 2WPKS 3PMJA 1D3QB 1YPHE 4J1YA 1S6FA 3V12A 3P95A 3UQVA 1HJAB 4ZXYH 3E0PB 2G52A 1DE7H 1O33A 2BLWA 5DKMA 3RXFA 3O8CA 3L3TA 1C2LA 4ZKSU 2FM2A 1W11U 2WUBA 3MHWU 4B74A 4CBOA 2R9PA 2A2XH 3KF2A 1LQEA 1SGDE 1HIAA 1QQ4A 3F68H 1MD8A 1YBWA 2FYRA 3VEQB 2FESH 1FV9A 4NIWA 1LKAA 1NRRH 3LT3A 4NSYA 4XBBA 3U8RH 2BD7A 1EJNA 1GBEA 2G8TA 1GI2A 2AEIH 1EXFA 5L30H 1NESE 2QAAA 2W3IA 1MBQA 1O3OA 1OSSA 4XDEA 1TALA 1P10A 2GDDA 1FIZA 3E8LA 1OOKB 2OD3B 4I8HA 1D3DB 1BT7A 1GI0A 2GCHG 1TNIA 3TK6A 2DE8A 4I33A 2H6MA 3T26A 1OP8A 1UMAH 3SV8A 1ABJH 1NY22 3STJA 3UREA 1A46H 2BHGA 1MQ5A 1CQQA 2FOBA 4TWYA 1D9IA 4K8YA 1TE0A 2PW8H 5FCKA 1DITH 2AGIX 1ZRBA 1TLDA 1C1TA 4SGBE 2C8XB 1F2SE 5DP3A 2AMQA 2BZ6H 4X0WU 4Y7BA 1K21H 2ZWLH 4BTUB 1BOQA 1C2EA 3GCHB 1EOLA 1QRWA 4ZMAH 1T8MA 1KXAA 1YLDA 1J8AA 1V2RT 1ZPCA 2ZP0H 3MU0A 8GCHG 2JKHA 4AFQA 3SNBA 4A1XA 2OTVA 1CGJE 1AVGH 2GDEH 2WYJA 1K28D 4Y79A 2P8OB 1QCPA 4AG2A 4YLQH 3CENA 4K2YA 2EEKA 1EP6A 5G4BA 1DM4B 4B2BA 3V3MA 3Q77A 4NFEA 1GI8B 2WPJS 1V2NT 2XXLA 1Y3VA 1D4PB 3LONA 1C2FA 3QZRA 1TGBA 3BTWE 1BMAA 3TH2H 1U6QA 4YT6H 5C5NA 2AYWA 2CHAC 1NO9H 8ESTE 1K1JA 4ABAA 1PQ5A 5GPIB 3SGAE 2W5EA 4O3UA 1GJ9B 1WOFA 3VFEA 1VCPA 1O2JA 1BTHH 3HATH 5HGGA 1EZXC 1MH0A 1O2KA 1F5RA 2VB0A 2VVCA 5LPEA 5DG6A 1V6DA 1FY5A 3VGCB 5C2ZA 2NU4E 4GCHF 3UIRA 1T4VH 5B6OA 4UFGH 2SNVA 1Z6EA 4UDWH 2GKVE 3MTYA 1O2ZA 1FI8A 1YCPM 3IITA 3PMAB 2JETC 1KXCA 1S81A 1O2IA 4ZUHA 1GVLA 1GHXH 4X8VH 4OS2A 1ZOMA 1CBWC 3TJOA 4K5ZA 5F03A 3RC6A 1OWDA 4H42U 4BAKB 1S84A 3ATIA 1GMCF 3AVZA 5T6FA 3M5OA 2XTTB 3LH1A 2CGAA 3RMNH 1NPMA 1SOTA 1Y5UT 1LVOA 1AUTC 1F0RA 1EAWA 3RDZA 4CRAA 3RXTA 4QT8C 2A31A 4A1TA 3E0NB 3GYLB 3D65E 3O8BA 3GDVA 1P03A 1EAUA 1PQ8A 2WYGA 1SFIA 4K1EA 1O2LA 2ZFFH 5K7RA 2Y80A 4D8NA 1C2MA 2C93B 3FP8E 3RM2H 1SGCA 1ACBE 1QFKH 4DIHH 2BLOA 1P09A 1Q2WA 2GX4A 2WPIS 2WPMS 3PMHB 2PKSB 1ZSLA 3BG4C 1ZMNA 5JB9S 3KCGH 2BD9A 4VGCC 1BMMH 4Y0ZE 1OS8A 3TGIE 4OGYA 1CT2E 4GPGA 3ZZ9A 5FPSA 1EPTA 3UFAA 3TPIZ 4IN1A 3I29A 2BDAA 1YP9A 3TNTA 1NN6A 2FOCA 3SO3A 4D7FA 7LPRA 3ZVAA 5DO4H 1ZTLA 5ABWA 6LPRA 4UE7H 1GHBG 4WF8A 3MOCA 2ALPA 4BTTB 4FUHA 1YPLH 1CO7E 1DSUA 2J34A 2GZ9A 1E35B 3RXIA 4GCHG 1ARBA 4YOIA 3RXEA 1P2JA 4M7GA 3QZQA 3RU4E 1YPKH 3BTFE 5EW1H 1LPKB 3HGPA 3QK1A 2ILNA 2ZDVH 3T27A 4LXBH 4BXSA 1MTNC 6ESTA 3MMGA 1O32A 5EPYA 1GL0E 1FMGA 1TYNA 3OY5U 1O34A 1E36B 1ZHRA 5JPMH 2R0KA 1PPGE 1XUKA 4CREA 3CS7A 2SGPE 1H4WA 3STIA 2HNTF 2GT7A 1O5FH 1MZAA 3ZV9A 4JYUH 2BDGA 1P2OA 1UHBA 1Y5AT 2O8WA 1DLEA 2THFB 1V2LT 2Y5HA 3IWMA 3A86A 1EB1H 1GDNA 1TA6A 4MPXA 4ZH8A 2VIPA 1GMDF 1NC6A 4NFFA 2CMYA 4NIYA 3A85A 7KMEH 2RA3A 4JZIA 1UHBB 4K1SA 4ZKOU 1YGCH 2QGRA 3D49H 1BBRH 2PFEA 4MNXA 5A8YA 3VB3A 1KXBA 4TWWA 1CHOF 1O3AA 2UWLA 4UFFH 3ZVEA 4IN2A 3RLWH 1KLJH 2RA0A 1MKXH 3W95A 2HNTC 5JBAS 2RDLA 3SUFA 1O5AB 4I8GA 4XFQA 3ATLA 1SGPE 1GGDC 1DVAH 5LH8A 5AF9H 4DVAU 2NU2E 2ZFRH 1EB2A 1BBRE 1FXYA 5EQQA 2Q6GA 1TNKA 3Q76A 2OUAA 2ZHQH 4H6TA 5L2YH 2EI8A 1TBRH 5F8ZA 2TGDA 1O2RA 2BMGB 1M9UA 1P9SA 2BD8A 3LGYA 2F91A 2V35A 2ZGBH 4AFSA 1BCUH 5C3NA 5DK1A 1YCPH 1FAXA 1CT4E 2PKAA 2QYIA 3SUEA 2ZDNA 4IMQA 4U01A 3RXAA 3H5CB 3W94A 1LTOA 1QHRB 1ZLRA 2HWLB 2FS8A 4YOJA 4NWLA 5AVDA 5C5OA 1FN6A 1YKTA 2ZDMA 5FAHA 1S85A 1DWBH 4I8KA 3SU2A 1ESTA 1NFWA 3GYMA 2VJ1A 1VJ9U 1GCDA 3ELAH 1KSNA 1Z8GA 2FOGA 2QY0B 1RGQA 1GJCB 1T32A 1WYKA 1S6HA 3FP6E 1KTSB 2O8UA 3PROA 4R8TB 2PLXA 2WPLS 3V13A 4I8JA 2HPPH 1ETRH 4AGKA 1GJDB 1AE5A 1A5IA 2VGCC 3EA8A 3UWJH 2G4UA 2TGPZ 5AFZH 3GCNA 3PMBB 3VB4A 4NIVA 4IC6A 2PV9B 1P2KA 4FU7A 2D1JA 3AAUA 2KAIB 1A0JA 3FZDA 3OTJE 4HFPB 1PQAA 3ZZDA 1DT2A 1YPJH 3HK6B 3P6ZB 4UD9H 4Z0KA 1V2WT 3U69H 1H1BA 2VH0A 2ZU5A 3NXPA 1S83A 5EODA 1MBMA 1V2VT 1NU7B 5DGJA 2BY6X 2A0QB 3TJVA 1FPCH 2FYQA 1O35A 1SQTA 3SU1A 2XBXA 2ZGJA 1GBJA 4KP0A 3H7TA 4ZAEA 1C5OH 2H9EH 1TAWA 2ZPRA 1G3CA 1UVSH 4THNH 1BB0B 2VVUA 1SLXB 1BHXF 4ABHA 4YT7H 3MNSA 1LHDH 3DFLA 1GJ5H 2FOMB 2QXGA 1DUAA 1EX3A 2BD2A 3E90B 5ESTE 4AFZA 2PWXA 1ETSH 1DLKB 3HKJB 1LQDB 2ULLA 1P05A 5EQRA 1RFNA 3OSYA 1HAOH 1CGHA 1GCTC 1SBWA 2J9NA 3GCOA 1AE8H 1TPOA 2LPRA 1QNJA 1C1MA 1C5WB 3RXJA 1AY6H 1V3XA 2WV4A 2JH5D 1OWIA 3TK9A 5AFYH 2EA3A 5C20A 1UTQA 4B2AA 1MCTA 1CSOE 2FOHA 1O2SA 1SL3A 3BN9A 1IQHA 4FUCA 4FU8A 2FIRH 3PTNA 1XX9A 3ZVBA 1AB9B 3KHVA 2XBVA 1CA0C 1ZMJA 1JOUB 1JRTA 3BEUA 4CRBA 1BMNH 4Y7AA 3RXDA 1HAIH 1GBCA 3GY8A 1LHCH 1VR1H 1DICA 1N8OC 2R3UA 1GHAG 3TU7H 5A09A 1OP2A 3EDXB 3RXPA 3P17H 2BD4A 1ELVA 3D62A 3VB6A 1XXDA 2FTLE 5GDSH 3KN2A 4NZLA 3F9EA 4CBNA 1FLEE 1BA8B 3SNAA 2TIOA 2Y7ZA 1SR5C 1P2QA 1PPZA 4FUJA 4X2WA 5TCCA 1HJ9A 1XUIA 1TPAE 1RTFB 1OWKA 2GCHF 4Q80A 3RXQA 4B1TA 2ANMH 3LGTA 3QN7A 1DWEH 5I25A 1NS3A 2BVRH 4FXGH 1TB6H 1QURH 1QJ1B 3V0XA 2STBE 1P9UA 1SHHB 4RN6A 2FMJA 2Z3EA 4UFDH 1HCGA 2AS9A 1BTZA 2AIQA 3TNSA 1ELBA 2ZQ2A 1HGTH 1WAYB 2CF8H 4FVDA 1N6XA 3TH4H 3U98H 1D6RA 2FX6A 3LOXA 3K6ZA 1H9LB 3S9BA 1AWFH 5H4IB 2PSYA 1XUGA 4JYVH 3VXEH 1IQGA 3M37A 1UCYH 1HAPH 3MU1A 1PFXC 2TRMA 3NK8A 4X8TH 1O3KA 4ABGA 1LHFH 4WWYA 4ESTE 8GCHF 1L1GA 3D23A 1RIWC 1ID5H 1V2JT 3KNXA 4OS7A 5DP4A 2A7JA 5JDUB 3EA9A 2Y82A 2ZC9H 3B23B 1IQNA 1XM1A 3RLYH 1QBNA 1O38A 3M3SA 1PYTC 1A5HA 2B7DH 1QB6A 5L2ZH 1UCYE 4O97A 1EPTC 1K9OE 5CHAC 2Q1JA 3WY8A 4B75A 3SNCA 4CH2B 3RUOA 1A3EH 4HZHA 4E06H 3RXHA 2G81E 1BUIA 4B71A 1C2DA 1GI3A 4K1TA 1ZHPA 2ZFTA 5CE1A 3JZ2B 1YLCA 1HDTH 2R2WU 2VWNA 1G37A 2QF3A 5EXNA 1NFYA 4OS5A 1K1LA 1GBTA 1TQ0B 1D3TB 1QIXB 4UONA 1P02A 1O3JA 2CJIA 2FZZA 1Z6JH 5A8ZA 1AFEH 2Z6BD 3SUGA 1GG6C 2FODA 1C9TA 1S0RA 4JZDH 3PO1B 3AW1A 1ZJDA 3E6PH 1GI6A 1LVMA 2ZTYA 5LPRA 1AD8H 1TX7A 2PUXB 2R3YA 1IQFA 4A7IB 1ELFA 4CHAC 1PJPA 2G5NA 4AX9H 1TX8A 3GY5A 3Q3KA 1BJUA 4TYDA 4ABEA 1C2JA 1GJBB 1CT0E 1SGTA 1MKWH 2A5AA 1TOMH 2TGAA 4LOYH 2PGBB 3ATMA 4MPUA 1O2HA 4KELA 4LZ4B 1ESAA 2ZDAH 3PLPA 1MMJN 3FZZA 4ASHA 4ABFA 1A1RA 1H9IE 2XBYA 4MDSA 1AI8H 2Z94A 1MTWA 3U8TH 1SPJA 3LIWA 1Q31A 3ZZ6A 4Y11E 3TH3H 4DIIH 1E38B 3K6YA 4WH6A 3BTDE 4Y0YE 4ZHMU 1MTUA 1O2PA 1Q3XA 2FI5E 1IQLA 1DPOA 3QLPH 1P57B 3Q3YA 2ZGCA 3V7TA 1O2GH 3ZVFA 1W7XH 2ZA5A 2ZU2A 5EXLA 2BQWB 2K1QA 3MNCA 5HM2A 3SU0A 1MUEB 2A7CA 1GHBF 1O3PB 4XE4A 3EAJA 2A5IA 3SNEA 2SFAA 1AKSA 1DANH 2BZAA 2AMPA 1BIOA 3BTTE 3ZZ8A 1XVMA 3B9FH 1BHXB 1UTMA 2VINA 5FX5A 5FPYA 3NPSA 1VJAU 3U8OH 2Z9JA 1GJ7B 2HOBA 2DUCA 4ZHLU 1YYY1 4DG4A 4PROA 1AKSB 3QTOH 2ASUB 2BY5X 3RXGA 3GY7A 1SGRE 2ZU3A 1NRSH 4JZFH 1RTLA 5ETXA 5T3HA 2C3SA 1SGYE 1ZTKA 1TNLA 4AYVB 5DP8A 1C1NA 3UPEA 2Y5GA 2Z7FE 1SHYA 2F9BH 4KTUA 4AGJA 1J15A 2NU0E 2XW9A 1C1VH 2FX4A 3QDZB 2VWMA 5A0CA 3BIUH 1GI1A 4CRFA 1OWJA 4CRDA 3S69A 1P11E 1HAXB 5DP5A 1NT1A 1XUJA 3SGQE 5J4SA 4FUFA 4I31A 4IMZA 1QB1A 4XBDA 3ZVGA 4SGAE 1YCPK 1C1WH 1GJ4H 3UY9A 3MFJA 4MQAA 1PQ7A 1RRKA 1UK3A 3MI4A 1V2OT 3Q3XA 1C5YB 2IN2A 1DS2E 2PGQB 2C8WB 5JBTA 1A7SA 3A80A 1MAXA 1KY9A 3ZZBA 4AB8A 1SLUB 1UVPA 5J4QA 3R0FA 1SLVB 3SGBE 2FLRH 1UTLM 1WU1A 1DOJA 1UO6A 3FVFB 3RMMH 2P93A 1EAXA 1QGFA 2AERH 3AAVA 4WH8A 5HMAA 1J16A 4X6NA 1DDJA 4D9QA 2VVVA 1PYTD 2XNIA 3SU3A 2GMTC 1ZHMA 1EZSC 5FBIA 4Q7ZA 1RIWB 4FU9A 1VGCB 1IQMA 5F8XA 1F0TA 3UR6A 3KIDU 1W7GH 2ZPSA 3SJIA 2ESTE 3TGJE 1O5CB 1HRTH 2SGEE 2W7UA 1J14A 3M5MA 3RMLH 1NRNH 3FANA 1UVTH 1GVKB 3E16B 3UWIA 1P2IA 1L4DA 4JZEH 4Y6DA 5A2MH 3G01A 2NWNA 1Z1IA 3GDUA 9ESTA 4MG3A 2WINI 4BXWA 1CVWH 1HJ8A 2ZCKP 3ZZ3A 1GBIA 1IAUA 1Y3YA 2ODYB 4JK6A 1EZUC 1V2TT 3C27B 2GVFA 1Y8TA 1F5KU 1ZSJA 4X6OA 1DY8A 4X1PU 1OX1A 4O3TA 4ISLA 2ZEBA 4NGAH 3ZZAA 3S7HB 3DFJA 3VPKA 1RS0A 4HI3A 4MPVA 1P01A 3T62A 1BTYA 1C5UA 3BF6H 3P8GA 2Z3DA 4WVPE 2NU3E 3TITA 1IOEA 1AUJA 2SGQE 5JBCS 2ZU4A 1A2CH 3A8BA 3MH7A 1O5BB 1TMBH 2HGTH 2P16A 3T2NA 2OC0A 2BVXH 1O36A 5EPNA 1CE5A 3U1JB 1SGFG 1B7XB 1DX5M 1THRH 1ZYOA 5EXMA 2OBQA 4Y71A 1BQYA 3A8CA 2ZECA 2TGTA 2H5DA 2F9NA 2XRCA 1BZXE 1HV7A 5EOKA 3A82A 3ZYEA 1LPZB 3OX7U 3LJJA 3LGVA 1NFXA 1O5GH 1VITH 3MYWA 3GY3A 1GHVH 1NZQH 4FUBA 1VITG 3CP7A 4H6SB 4DW2U 2ZQ1A 3A7XA 3LPRA 3BTQE 1BRCE 4Y10E 3A8DA 1FZZA 1TPSA 3SNDA 4MTBA 2FPZA 1L4ZA 3SHAH 1C2IA 3DUXH 1W13U 1XXFA 1JIRA 1FIWA 4AN7A 1GBAA 2OINA 5EW2H 1YC0A 3SQHE 2CHAB 3UOPA 3DA9B 2HVXA 1ELGA 1T8LA 1V2MT 5DP7A 1EOJA 3S0NA 1C5QA 1KLTA 2CV3A 1O2UA 3M5NA 4U30A 1SG8B 2ZFSA 4OS1A 1Z8JB 2BYAX 2H2ZA 1ZMLA 1L1NA 2SGAA 4A92A 2ODPA 3SZNA 1G9IE 3ATWA 3N7OA 2Y6TA 1TQ7B 3QO6A 1SGQE 1Y3XA 2JETB 3RU4D 1CGIE 1GHWH 1AN1E 4ZKNU 3QWCH 1HJAC 2G00A 1WBGB 1CBWB 2F9VA 2KAIA 1T7CA 3H7OA 2XCFA 3QGNB 3RMOH 2FS9A 3A7WA 1PPBH 2A4QA 1O2QA 1TRNA 4RKOB 5FBEA 1UTJA 1WQSA 2UUYA 1O2WA 1K1OA 1UTPA 2VU8E 3RXVA 1HAHH 3GY2A 3MU5A 1GHAF 3BTKE 3ZVDA 1FPHH 1Z71A 2QXIA 1T31A 1B0EA 3MU8A 6GCHF 3A84A 2F3CE 4Q7YA 2UUJB 2XC5A 1G3EA 1P12E 2C4FH 2O8MA 1L0ZA 2FDAA 4INLA 3ZV8A 3MH5A 3DHKH 1TGCA 1BTWA 1J9CH 1O3IA 3SORA 3BG4B 4MNVA 1QQUA 1RD3B 2VIDA 3SBKA 1UTOA 4VGCB 3GCTF 4KKDA 1DFPA 3Q00A 2EC9H 2C8YB 1LHEH 4FUIA 4DJZB 1JWTA 1KYNA 2GV6A 4DT7B 1FONA 1BTPA 1QJ7B 2WV5A 1MTSA 3URCA 1UK4A 4IC5A 3RC5A 3C1KA 2FTMA 1HNEE 2J95A 4E7RG 3L6PA 2ZG0H 2VWOA 1SLWB 4MLFB 2BOHB 3PV4A 3TIUA 3GCHC 3NKKA 1K2I1 2W7SA 4X1NU 1IHTH 1SGIB 2H9TH 3MWIU 5DP9A 4A1VA 1OWEA 1EQ9A 1N1LA 4X8UH 1IQEA 3F1SB 1T8NA 1GI4A 2Y7XA 1O0DH 2BX4A 2ZF0H 2P8OC 3E91A 1WTGH 1T4UH 4LZ1H 1MTNB 4MVNA 5GIBA 1GBHA 4ABIA 5C1YA 1YPGH 4A5TS 1ZR0A 2H1UA 4TY6A 1UTKA 2QN5T 3K9XB 1Y3WA 1SI5H 2V6NA 2P3TB 2ZI2H 1GI5A 3O8RA 1QBVH 4CRCA 4FVBA 1MQ6A 2SNWA 5GJ4B 1IQIA 4H4FA 1WUNH 3BIVH 1HXFH 1FDPA 4LK4A 1C1RA 2BDBA 1C2HA 1LHGH 3L33A 2B5TB 1C1OA 2A32A 3VGCC 2FP7B 1C5PA 4NWKA 1OYTH 1RJXB 1UTNA 3E3TA 3T29A 6GCHG 4F4OC 3MNBA 1Z1JA 4KTSA 1AMHA 1B5GH 1KXFA 4DGJA 2XCNA 5FPTA 2A4OA 3RXOA 1C5MD 2BQ7B 2V3OH 2VH6A 2B0FA 3LGUA 3TVJB 5JYIA 1JXPA 1ELCA 3UNQA 1O2MA 4FUGA 3AASA 2OXSA 4ZXXH 3GCTG 2NU1E 1P04A 4OGXA 2VIVA 1AO5A 1IQKA 5FXLA 3PYHA 1Z7KA 2ZNKH 4BAOB 1G2MA 2R2MB 3NZIA 5EG4A 3ZZ5A 2QXHA 1DUEA 1LPGB 1GGDB 3DD2H 3R3GB 1W2KH 1OP0A 2BY9X 1H8DH 1P2MA 2VNTA 3PB1E 2GD4B 2C8ZB 5GCHF 1XKAC 1THSH 4DY7B 4NSVA 1DWDH 1QL9A 1RXPA 1BITA 4MNWA 4MNYA 2C90B 4ISIH 2BD5A 2XC0A 2GZ7A 4NG9H 3LJOA 2OCVB 1MU8B 1W14U 1ZGIA 2HALA 4AOQA 3VB7A 2PKSC 3TGKE 4K69A 1SFQB 1P06A 1SGNE 5EGMA 4KTCA 1G30B 1O3BA 1B0FA 2QXJA 2F9PA 5DP6A 3GY4A 2XBWA 2G4TA 5SGAE 1E37B 1SOZA 3MU4A 5FCRA 3RXKA 2OLGA 2ZPQA 3LKWA 1V2QT 2AMDA 2BB4A 1P0SH 4NIXA 4BOHA 3P70B 1C4U2 2AGEX 2M5TA 6CHAC 1BRBE 1GBBA 3A81A 1DSTA 1W12U 1C5NH 2GT8A 1GJ6A 4Q7XA 1HYLA 1YF4A 1TNJA 3NUMA 2BXTH 2AFQB 2J2UA 4X1RU 4BANB 3UUZA 2UUFB 3M7TA 1ELEE 2H9HA 1IHSH 2O8LA 1VCQA 3SJKA 2ZTZA 4HGCA 2TPIZ 1A0LA 2VGCB 1BMLA 1ANDA 1NRQH 3MO9A 3PM3A 4BAQB 3BV9B 3A7TA 1O2XA 4WMDA 4ZHAA 1ZRKA 1XUFA 1AFQC 1QR3E 1UVOA 1V2KT 2XWAA 3A89A 3MO3A 2OC8A 1O3MA 3K2UA 1DY9A 1EUFA 1F7ZA 2EI7A 1G3DA 3GOVB 3F9FA 2BXUH 4I32A 1A4WH 2A45B 1WV7H 1C5SA 2BLQA 5HYOA 3TLOA 3KQCA 1ZPBA 4BNRA 3M7UA 2PTNA 1UVUH 1FNIA 1O37A 3IG6B 1FY1A 1HIAB 1TNGA 2CN0H 2O8TA 2Z3CA 4K60A 5E0HA 5C1UA 4AZ2B 1TMTH 1RTKA 5CMXH 1TRYA 2ZKSA 3OU0A 1CA8B 5GCHG 2GV7A 2IPHA 3FFGA 5BRRE 3PWBA 2P3FH 2BVSH 1GJAB 2UWPA 3SV6A 1C5RA 2VIQA 5TCAA 1TFXA 2BTCE 3KGPA 4ZROA 1TABE 5C67A 4X2YA 4WY3A 1QL8A 1TOCB 5T6DA 2BX3A 1C5ZB 1T8OA 3BEIB 1L2EA 3UR9A 1E0FD 1GBDA 1QRXA 2HRVA 1CHGA 3RXSA 3T25A 3VXFH 3MH4A 1C5TA 5E0GA 3A7YA 1TGTA 1ABIH 4X8SH 3S9AA 1GCTB 4GSOA 4HTCH 2FI3E 2CXVA 3ZZ4A 2BD3A 1F0UA 2ALVA 1W8BH 3JZ1B 3LDXH 1DXWA 1BJVA 4JCNA 1K1IA 1TX6A 4X2XA 1AVWA 1BBRK 1EASA 1V2ST 1TBQH 1S5SA 2ZCHP 5FX6A 2B9LA 3SQEE 3HGNA 2ANKH 4Z6AH 3SV2H 3EA7A 4JMYA 1CA0B 2BDCA 2XC4A 1AVXA 1JBUH 1MKXK 5DJ7A 4IBLH 3RU4T 3SJ8A 3EGKH 2GP9B 2F9UA 1N8OB 4JK5A 1SVPA 4GLYA
chains in the Genus database with same CATH superfamily
3SJ9A 1SC8U 1WQVH 2ZHEH 9LPRA 3DSPA 1TGNA 1A3BH 1FX0B 3S9CA 3O8DA 4YZUA 2A5KA 5JB8S 3HK3B 1BRUP 4R0IA 2JH0D 4O9VA 3HKIB 4NA8A 4B76A 4YXWD 3UQOA 2QIQA 4YTAA 1A61H 3TK5A 3I77A 5PTPA 2FOEA 1TRMA 3UOUA 1MZDA 1TNHA 2J38A 2ZU1A 3BTHE 1GL1A 1W0JD 2ZDKA 1BRAA 1SGEE 2YNAA 1CU1A 4AB9A 2V3MA 4I7YH 3SHCH 2L74A 1O2OA 1TIOA 1KXDA 3RXCA 2QC2A 3F0PA 3OY6U 4Y8YA 2J98B 3M3TA 4KGAA 3PLKA 3ESTA 1QRZA 1V2PT 1C5VA 1O5EH 4X1SU 1G2LA 1SB1H 1HAYB 5JBBS 4AFUA 3EE7A 1XVOA 2UWOA 3WWBA 3RC4A 1O5DH 1WCZA 1JRSA 3ITIA 4E05H 1FUJA 4ZCNA 2V0BA 5LGOA 1TONA 1G36A 2IJOB 1QJ6B 1VCWA 1EAIA 1QA7A 2EI6A 2OBOA 1PPCE 3CS0A 4F49A 1W10U 3T28A 4B6FA 2KR7A 1VZQH 4UFEH 1VITF 1HLTH 1C2GA 2ZHFH 3GICB 1EFRD 1O3DA 2G5VA 1HUTH 1ESBA 1ZTJA 1Y5BT 1TGSZ 6CHAB 1BTXA 1EZQA 2A4GA 3KQDA 4TT3D 5EQSA 3RXLA 2BY7X 3SUDA 4XBCA 1EPTB 5CHAB 1G32B 2ZHDA 1KMHB 1UK2A 3LGWA 2I6QA 1WTHD 3A8AA 3WW7A 2OQUA 3A88A 4NA9H 3KQEA 1AIXH 3M36A 1W0ZU 4U2WA 1THPB 4ABDA 1JMOH 4BAHB 1TWXB 2VIOA 4I8LA 1P3EA 2ZCLP 4X6PA 4YESB 1O3NA 1LVYA 1QY6A 3EQ0H 1WXRA 4A6LA 1TPPA 1QB9A 3GISB 3PWCA 1V2UT 2J5UA 3RXUA 1AFQB 1MCVA 2GGVB 3QTVH 3BTEE 4ISNA 2D8WA 7GCHF 5A0BA 1PPEE 2J92A 1EJMA 1DWCH 2BDYA 2VWLA 4B73A 1AQ7A 1AZZA 2WPDD 1GG6B 2OC1A 5LPFA 1AB9C 2IOTA 1GMCG 1XMNB 3F2GA 4GHQA 3DT0H 1C4Y2 1ORFA 5E2PA 3SOSA 2SGFE 2GCTC 4CHAB 2LNCA 3LU9B 1EKBB 4UEHH 1KXEA 1EP5A 3M61U 3RM0H 5KEDA 1O3EA 1GWAA 2A2QH 4MPWA 1G3BA 5TJXA 4DCDA 1GHYH 3AW0A 1K0HA 1EATA 1O2YA 3DSOA 1O3GA 2ZGXH 3GDSA 1E34B 3N99A 1AGJA 2J4IA 1Z8RA 3RXBA 2ZDLA 4OS6A 2GTBA 1GDUA 1AHTH 1ANCA 2BDHA 3BTGE 2FLBH 7ESTE 1F92A 1SQOA 4GHTA 2QV1A 1KLIH 3M3VA 1ETTH 4ISHH 4NA7A 2Q6DA 1GI7B 2FXRA 2XYAA 1FN8A 4FUDA 5ESBA 3M5LA 3UTUH 4AG1A 5L6NH 4ABBA 2P95A 4U32A 2AHME 3RP2A 4BAMB 1LVBA 1FY4A 1C1QA 4X6MA 1O3LA 1J17T 1NU9A 1OYQA 3TJUA 3MH6A 1W3CA 1ELTA 3F9HA 1QA0A 4YOGA 2PHBA 4GAWA 4XSKU 2ZTXA 3ATKA 2FI4E 3BEFB 1O3HA 2PUQH 2OC7A 2BOKA 2RCEA 3BG8A 1YPEH 2Z9GA 2D26C 3SV7A 3P8NA 5E0JA 2V3HH 4WXVA 4FUEA 1FY8E 3LC3A 1GJ8B 3LGIA 3URDA 1SQAA 2SGDE 3ZYDA 5DPAA 1H8IH 2AH4X 3EE0B 3NCLA 5F8TA 2ODQA 4Y8ZA 4E7NA 2ANYA 3OE7D 1C5LH 3SI4H 1YM0A 2JIZD 3S7KB 2JH6D 7GCHG 4BTIB 1X7AC 4GVUA 1HAVA 1VKYA 1QBOA 2HLCA 1ELAA 4ACAA 1MAYA 3PTBA 4D9RA 2PTCE 3A83A 3SV9A 2PKAB 3BTME 4IW4E 2R0LA 2O9QA 2RG3A 5EU8A 4RKJB 2P94A 3E1XB 2BDIA 2ZIQH 1NRPH 2KCOA 2VIWA 2ANWA 2J94A 1HAVB 2JJ2D 3VB5A 5F6MA 4IS5A 4K3JA 4Q63A 3M35A 1ARCA 4X1QU 3NWUA 1GMDG 1P8VC 1C5XB 2HNTE 2UUKB 1UCYK 2CF9H 4K8BA 5HM9A 8KME2 2STAE 4AORA 2D2DA 1GVZA 1LO6A 1YPMH 1K1MA 1ZGVA 1GDQA 2QA9E 4RSPA 1OPHB 8LPRA 3QGJA 2FWWA 2Z9KA 2A4RA 1NBME 1LCYA 1NROH 1O39A 1O2TA 3SJOA 4GUXA 1CHOG 3TJNA 5IDKA 2QCYA 4TSFD 1C9PA 2G55A 5AHGH 1BDAA 3ZIAD 2A7HA 3PO1C 2WPHS 5BPEA 2A1DB 4NZQA 4XOJA 1NFUA 1D6WA 5IYTA 2Z9LA 5K0HA 3EYDA 3I78A 2ZFQH 5FHTA 1PPHE 2FOFA 1GMHF 1QTFA 2PR3A 4AYYB 1WSSH 3SU6A 3W1EA 1ELDE 2QF0A 3GS9A 4CR9A 2YOLA 4X2VA 2GMTB 1C2KA 3GY6A 3UNRA 1IQJA 1Z8IB 2WSSD 4INKA 1C1PA 2ZHWH 3ZZCA 1GI9B 1KDQA 1LMWB 3T5FH 4WJG2 3BSQA 1SGFA 3RXRA 3KL6A 3LH3A 4CH8B 4D76A 4YO9A 1C1SA 2BY8X 2AGGX 1FY3A 4NCYA 3RXMA 5A8XA 3HPTB 2F83A 1KDQB 1N6YA 1L1JA 2GZ8A 1INCA 2FOAA 3ZVCA 1OKXA 3K65B 3LC5A 5E8EH 5A0AE 2TBSA 2ZGHA 1A0HB 5GWZA 4D7GA 3U9AH 4CR5A 1UJ1A 5HKKD 2AIPA 1AWHB 3ENSB 3U1IB 2ZO3H 3SZEA 4F55A 4ABJA 1OXGA 1QL7A 5I46H 1EJAA 1O3CA 1NTPA 1S0QA 1GHZA 1ANEA 1GBFA 1O30A 4WMFA 2W6ID 2Q6FA 1FAKH 1MKWK 2OK5A 3MNXA 5HIZA 3UNSA 1JIMA 1HXEH 1GPZA 2WUCA 1HB0B 1GBKA 3KQBA 1W0YH 3A7ZA 1MU6B 5T6GA 1HFDA 1HAZB 4TPIZ 2FO9A 4INHA 2F9OA 1OWHA 1S82A 1ZSKA 1TMUH 2Y5FA 1HBTH 4IGDA 1LDTT 2P59A 2W3KA 3FAOA 4Y8XA 2OP9A 5HXFA 4O03A 2FEQH 1AU8A 2G51A 3FP7E 1KTTB 4B2CA 4CRGA 3P8FA 1D3PB 1ZZZA 3UAIC 1FQ3A 1TBZH 2GCTB 1NM6A 4Q2KA 1C1UH 1AZ8A 3P92A 1C4V2 2YNBA 1GBLA 2OQ5A 1HPGA 2P3UB 4YM9A 2ZZUH 4DURA 1YPHC 3ODFA 5GXPA 1Y3UA 2BLVA 1PPFE 3M7QA 3A87A 4TY7A 1ANBA 3SW2B 1K1NA 4JYTA 4Y76A 4ZKRU 1XKBC 3A7VA 1O31A 1GMHG 2Y81A 1O3FA 1MTVA 2ZFPH 1GBMA 2W26A 1K22H 3F9GA 1F0SA 3SU4A 1P2NA 3SN8A 2DE9A 2XWBI 1K1PA 1BTUA 1KIGH 3KEEA 1SMFE 4TPYA 1FJSA 3B8JA 1SSXA 3ZZ7A 4JZ1A 1O2VA 1DXPA 1ZJKA 4WXIA 2I6SA 3SI3H 5E2OA 1MD7A 5C1XA 1TA2A 2PSXA 3QUMP 2B8OH 2HPQH 3P8OA 3PLBA 4OS4A 2H5CA 1Y59T 4YLUA 1E1RD 2BQ6B 1O2NA 1H9HE 3QX5H 3F6UH 1F5LA 4DOQA 4Z1MD 1XUHA 3MO6A 2BM2A 2RFKC 2Z9IA 3OYPA 2K8IA 1HAGE 3SU5A 1P3CA 1ZPZA 3FN8A 4J2YB 4ISOA 3ODDA 1VGCC 1LKBA 4WMEA 1A5GH 2WPKS 5EJLA 2VBCA 4AC9A 3PMJA 1D3QB 1YPHE 4J1YA 3CNRA 1S6FA 3V12A 3P95A 3UQVA 1HJAB 3OEED 3E0PB 4ZXYH 2G52A 1DE7H 1O33A 2BLWA 5DKMA 3RXFA 3O8CA 3L3TA 1C2LA 4ZKSU 2FM2A 1W11U 2WUBA 3MHWU 4B74A 4CBOA 2R9PA 2A2XH 3KF2A 2KM0A 1LQEA 1SGDE 1HIAA 1QQ4A 3F68H 1MD8A 1YBWA 2FYRA 2KZ4A 3VEQB 2FESH 1FV9A 4NIWA 5C94A 1LKAA 1NRRH 4FETA 3LT3A 4NSYA 4XBBA 3U8RH 2BD7A 1EJNA 1GBEA 2G8TA 1GI2A 2AEIH 1EXFA 5L30H 1NESE 2QAAA 2W3IA 1MBQA 1O3OA 1OSSA 4XDEA 1TALA 1P10A 2GDDA 1FIZA 3E8LA 1OOKB 2OD3B 4I8HA 1D3DB 1BT7A 1GI0A 2GCHG 1TNIA 3TK6A 2DE8A 4I33A 2H6MA 3T26A 1OP8A 1UMAH 3SV8A 1ABJH 1NY22 3STJA 3UREA 1A46H 2BHGA 3F0OA 1MQ5A 1CQQA 2FOBA 4TWYA 1D9IA 3FO8D 4K8YA 1TE0A 2PW8H 1BMFD 5FCKA 1DITH 2AGIX 1ZRBA 2M2AA 1TLDA 1C1TA 4SGBE 2C8XB 1F2SE 5DP3A 2AMQA 2BZ6H 4X0WU 4Y7BA 1K21H 2ZWLH 4BTUB 1BOQA 1C2EA 3GCHB 1EOLA 1QRWA 4ZMAH 1T8MA 1KXAA 1YLDA 1J8AA 1V2RT 1ZPCA 2ZP0H 3MU0A 8GCHG 2JKHA 4AFQA 2HLDD 3SNBA 4A1XA 2OTVA 1CGJE 1E1QD 1AVGH 2GDEH 2WYJA 1K28D 4Y79A 2P8OB 1QCPA 4AG2A 4YLQH 3CENA 4K2YA 2EEKA 1EP6A 5G4BA 1DM4B 4B2BA 3V3MA 3Q77A 4NFEA 1GI8B 2WPJS 1V2NT 2XXLA 1Y3VA 1D4PB 3LONA 1C2FA 3QZRA 1TGBA 3BTWE 1BMAA 3TH2H 1U6QA 4YT6H 5C5NA 2AYWA 2CHAC 1NO9H 8ESTE 1K1JA 4ABAA 1PQ5A 5GPIB 3SGAE 2W5EA 4O3UA 1GJ9B 1WOFA 3VFEA 1VCPA 3MQKC 1O2JA 1BTHH 3HATH 5HGGA 1EZXC 1MH0A 4DT4A 1O2KA 1F5RA 2VB0A 2VVCA 5LPEA 5DG6A 1V6DA 1FY5A 3VGCB 5C2ZA 2NU4E 3OFND 4GCHF 3UIRA 1T4VH 5B6OA 4UFGH 2SNVA 1Z6EA 4UDWH 2GKVE 3MTYA 1O2ZA 1FI8A 2WV9A 1YCPM 3IITA 3PMAB 2JETC 1KXCA 1S81A 1O2IA 2J98A 4ZUHA 1GVLA 1GHXH 4X8VH 4OS2A 1ZOMA 1CBWC 3TJOA 4K5ZA 5F03A 3RC6A 1OWDA 4H42U 4BAKB 1S84A 3ATIA 1GMCF 3AVZA 5T6FA 3M5OA 2XTTB 3LH1A 2CGAA 3RMNH 1NPMA 1SOTA 1Y5UT 2QF5A 1LVOA 1AUTC 1F0RA 1EAWA 3RDZA 4CRAA 3RXTA 4QT8C 2A31A 1E79D 3E0NB 3GYLB 4A1TA 3D65E 3OTPA 3O8BA 3GDVA 1P03A 1EAUA 1PQ8A 2WYGA 1SFIA 4K1EA 1O2LA 2ZFFH 5K7RA 2Y80A 4D8NA 1C2MA 2C93B 3FKSD 3FP8E 3RM2H 1SGCA 1ACBE 1QFKH 4DIHH 2BLOA 1P09A 1Q2WA 2GX4A 2WPIS 2WPMS 3PMHB 5IK2D 2PKSB 1ZSLA 3BG4C 1ZMNA 5JB9S 3KCGH 2BD9A 4VGCC 3FOAA 1BMMH 4Y0ZE 1OS8A 3TGIE 4OGYA 1CT2E 4GPGA 3ZZ9A 5FPSA 1EPTA 3UFAA 3TPIZ 5F53A 4IN1A 3I29A 2BDAA 1YP9A 3TNTA 1NN6A 4ACBA 2FOCA 3SO3A 4D7FA 7LPRA 5EIYA 3ZVAA 5DO4H 1ZTLA 5ABWA 6LPRA 4UE7H 1GHBG 4WF8A 3MOCA 2ALPA 4BTTB 4FUHA 1YPLH 1CO7E 1DSUA 2J34A 2GZ9A 1E35B 3RXIA 4GCHG 1ARBA 4YOIA 3RXEA 1P2JA 4M7GA 3QZQA 3RU4E 1YPKH 3BTFE 5EW1H 1LPKB 3HGPA 3QK1A 2ILNA 2ZDVH 3T27A 4LXBH 4BXSA 1MTNC 6ESTA 3MMGA 1O32A 5EPYA 1GL0E 1FMGA 1TYNA 3OY5U 1O34A 1E36B 1ZHRA 5JPMH 2R0KA 1PPGE 1XUKA 4CREA 3CS7A 2SGPE 1H4WA 3STIA 2HNTF 4OM9A 2GT7A 1O5FH 1MZAA 3ZV9A 4JYUH 2BDGA 1P2OA 1UHBA 1Y5AT 2O8WA 1DLEA 2THFB 3OAAD 1V2LT 2Y5HA 3IWMA 3A86A 1EB1H 1GDNA 1TA6A 4MPXA 4ZH8A 2VIPA 1GMDF 1NC6A 4NFFA 2CMYA 4NIYA 3A85A 7KMEH 2RA3A 4JZIA 1UHBB 4K1SA 4ZKOU 1YGCH 2QGRA 3D49H 1BBRH 2PFEA 4MNXA 4P02A 5A8YA 3VB3A 1KXBA 4TWWA 1CHOF 1O3AA 2UWLA 4UFFH 5KGOA 3ZVEA 4IN2A 3RLWH 1KLJH 2RA0A 1MKXH 3W95A 2HNTC 5JBAS 2RDLA 3SUFA 1O5AB 4I8GA 4XFQA 3ATLA 1SGPE 1GGDC 1DVAH 5LH8A 5AF9H 4DVAU 2NU2E 2ZFRH 1EB2A 1BBRE 1FXYA 5EQQA 2Q6GA 1TNKA 3Q76A 2OUAA 2ZHQH 4H6TA 5L2YH 2EI8A 1TBRH 2KFWA 5F8ZA 2TGDA 1O2RA 2BMGB 1M9UA 1P9SA 2BD8A 3LGYA 2F91A 2V35A 2ZGBH 4AFSA 1BCUH 5C3NA 5DK1A 1YCPH 1FAXA 1CT4E 2PKAA 2QYIA 3SUEA 2ZDNA 4IMQA 4U01A 3RXAA 3H5CB 3W94A 1LTOA 1QHRB 1ZLRA 2HWLB 2FS8A 4RT0A 4YOJA 4NWLA 5AVDA 5C5OA 1FN6A 1YKTA 2ZDMA 5FAHA 1H8ED 2JJ1D 1S85A 3H09A 1DWBH 4I8KA 3SU2A 1ESTA 1NFWA 3GYMA 2VJ1A 1OHHD 1VJ9U 1GCDA 3ELAH 1KSNA 1Z8GA 2FOGA 2QY0B 1RGQA 1GJCB 1T32A 1WYKA 1S6HA 2F43B 1KTSB 3FP6E 2O8UA 3PROA 4R8TB 2PLXA 2WPLS 3V13A 4I8JA 2HPPH 1ETRH 4AGKA 1GJDB 1AE5A 1A5IA 2VGCC 3EA8A 3PV2A 3UWJH 2G4UA 2TGPZ 5AFZH 3GCNA 3PMBB 3VB4A 4NIVA 4IC6A 2PV9B 1P2KA 5HIYA 4FU7A 2D1JA 2HVYB 3AAUA 2KAIB 1A0JA 3FZDA 3OTJE 4HFPB 1PQAA 3ZZDA 1DT2A 1YPJH 3HK6B 3P6ZB 4UD9H 3DSGA 4Z0KA 1V2WT 3U69H 3PRDA 2KCYA 1H1BA 2VH0A 2ZU5A 3NXPA 1S83A 5EODA 1MBMA 1V2VT 1NU7B 5DGJA 2BY6X 2A0QB 3TJVA 1FPCH 2FYQA 1O35A 1SQTA 3SU1A 2XBXA 2ZGJA 1GBJA 4KP0A 3H7TA 4ZAEA 1C5OH 2H9EH 1TAWA 2ZPRA 1G3CA 1UVSH 4THNH 4RT1A 1BB0B 2VVUA 1SLXB 1BHXF 4ABHA 4YT7H 3MNSA 1LHDH 3DFLA 1GJ5H 1H8HD 2FOMB 2QXGA 1DUAA 1EX3A 2BD2A 3E90B 5ESTE 4AFZA 2PWXA 1ETSH 1DLKB 3HKJB 1LQDB 2ULLA 1P05A 5EQRA 1RFNA 2YMSC 3OSYA 1HAOH 1CGHA 1GCTC 1SBWA 2J9NA 3GCOA 1AE8H 1W0KD 1TPOA 2LPRA 1QNJA 1C1MA 1C5WB 4ASUD 3RXJA 1AY6H 1V3XA 2WV4A 2JH5D 1OWIA 3TK9A 5AFYH 2EA3A 1SKYE 5C20A 1UTQA 4B2AA 1MCTA 1CSOE 2FOHA 1O2SA 1SL3A 3BN9A 1IQHA 4FUCA 4FU8A 2FIRH 3DCLA 1XX9A 3PTNA 1AB9B 3ZVBA 3KHVA 2XBVA 1CA0C 1ZMJA 1JOUB 1JRTA 3BEUA 4CRBA 1BMNH 4Y7AA 4M9FA 3RXDA 1HAIH 1GBCA 3OEHD 3GY8A 1LHCH 1VR1H 1DICA 1N8OC 2R3UA 1GHAG 3TU7H 5A09A 1OP2A 3EDXB 3RXPA 3P17H 2BD4A 1ELVA 3D62A 3VB6A 1XXDA 2FTLE 5GDSH 3KN2A 4NZLA 3F9EA 4CBNA 1FLEE 1BA8B 3SNAA 2CK3D 2TIOA 2Y7ZA 1SR5C 1P2QA 1PPZA 4FUJA 4X2WA 5TCCA 1HJ9A 1NBMD 1XUIA 1TPAE 1RTFB 1OWKA 2GCHF 4Q80A 3RXQA 4B1TA 2ANMH 3LGTA 3QN7A 4B6EA 1DWEH 5I25A 1NS3A 2BVRH 4FXGH 1TB6H 1QURH 1QJ1B 3V0XA 5CHBA 2STBE 1P9UA 1SHHB 4RN6A 2FMJA 2Z3EA 4UFDH 1HCGA 2AS9A 1BTZA 2AIQA 3TNSA 1ELBA 2ZQ2A 1HGTH 1WAYB 2CF8H 4FVDA 1N6XA 3TH4H 3U98H 1D6RA 2FX6A 3LOXA 3K6ZA 1H9LB 3S9BA 1AWFH 5H4IB 2PSYA 1XUGA 4JYVH 3VXEH 1IQGA 3M37A 1UCYH 1HAPH 3MU1A 1PFXC 2TRMA 3NK8A 4X8TH 1O3KA 4ABGA 1LHFH 4WWYA 4ESTE 8GCHF 1L1GA 3D23A 1RIWC 1ID5H 1S6LA 1V2JT 3KNXA 4OS7A 5DP4A 1UW7A 2A7JA 5JDUB 3EA9A 2Y82A 2ZC9H 3B23B 1IQNA 1XM1A 5EJ1A 3RLYH 1QBNA 1O38A 3M3SA 1PYTC 2JDID 1A5HA 3PRBA 2B7DH 4FOUC 1QB6A 5L2ZH 1UCYE 4O97A 1EPTC 1K9OE 5CHAC 1MABB 2Q1JA 3WY8A 4B75A 3SNCA 4CH2B 3RUOA 1A3EH 4HZHA 4E06H 3RXHA 2G81E 1BUIA 4B71A 1C2DA 1GI3A 4K1TA 1ZHPA 2ZFTA 5CE1A 4Q4LA 3JZ2B 1YLCA 1HDTH 2R2WU 2VWNA 1G37A 2QF3A 4HG6A 5EXNA 1NFYA 4OS5A 1K1LA 1GBTA 1TQ0B 1D3TB 1QIXB 4UONA 1P02A 1O3JA 2CJIA 2FZZA 1Z6JH 5A8ZA 1AFEH 2Z6BD 3SUGA 1GG6C 2FODA 1C9TA 1S0RA 4JZDH 3PO1B 3AW1A 1ZJDA 3E6PH 1GI6A 1LVMA 2ZTYA 3KYGA 5LPRA 1AD8H 1TX7A 2PUXB 2R3YA 1IQFA 4A7IB 1ELFA 4CHAC 1PJPA 2G5NA 4AX9H 1TX8A 3GY5A 3Q3KA 1BJUA 4TYDA 4ABEA 1C2JA 1GJBB 1CT0E 1SGTA 1MKWH 2A5AA 1TOMH 2TGAA 3AK5A 4LOYH 2PGBB 3ATMA 4MPUA 3KQ5A 2KCPA 5DN6D 1O2HA 4KELA 4LZ4B 2J97A 2LELA 1ESAA 2ZDAH 3PLPA 1MMJN 3FZZA 4ASHA 2YMSD 4ABFA 1A1RA 1H9IE 2XBYA 4MDSA 1AI8H 2Z94A 1MTWA 3U8TH 1SPJA 3LIWA 1Q31A 3ZZ6A 4Y11E 3TH3H 4DIIH 1E38B 3K6YA 4WH6A 3BTDE 3SYJA 4Y0YE 4ZHMU 1MTUA 1O2PA 1Q3XA 2FI5E 1IQLA 1DPOA 2KCAA 3QLPH 1P57B 3Q3YA 2ZGCA 3V7TA 1O2GH 3ZVFA 1W7XH 2ZA5A 2ZU2A 5EXLA 2BQWB 2K1QA 3MNCA 5HM2A 3SU0A 1MUEB 2A7CA 1GHBF 1O3PB 4XE4A 3EAJA 2A5IA 3SNEA 2SFAA 1AKSA 1DANH 2BZAA 2AMPA 1BIOA 3U28C 3BTTE 3ZZ8A 1XVMA 3B9FH 1BHXB 1UTMA 2VINA 3N7EA 5FX5A 5FPYA 3NPSA 1VJAU 3U8OH 2Z9JA 1GJ7B 2HOBA 2DUCA 2GJGA 1YYY1 4DG4A 4ZHLU 4PROA 1AKSB 3UB0A 3QTOH 2ASUB 2BY5X 3RXGA 3GY7A 1SGRE 2ZU3A 1NRSH 4JZFH 1RTLA 5ETXA 5T3HA 2C3SA 1SGYE 1ZTKA 1TNLA 4AYVB 5DP8A 1C1NA 3UPEA 2Y5GA 2Z7FE 1SHYA 2F9BH 4KTUA 4AGJA 1J15A 2NU0E 2XW9A 1C1VH 2FX4A 3QDZB 2VWMA 5A0CA 3BIUH 1GI1A 4CRFA 1OWJA 4CRDA 3S69A 1P11E 1HAXB 5DP5A 1NT1A 1XUJA 2F4LA 3SGQE 5J4SA 3VG8A 4FUFA 4I31A 5CDFE 4IMZA 1QB1A 4XBDA 3ZVGA 4SGAE 1YCPK 1C1WH 1GJ4H 3UY9A 4I86A 3MFJA 4MQAA 1PQ7A 1RRKA 1UK3A 3MI4A 3F2FA 1V2OT 3Q3XA 1C5YB 2IN2A 1DS2E 2PGQB 2C8WB 5JBTA 1A7SA 3A80A 1MAXA 1KY9A 3ZZBA 4AB8A 1SLUB 1UVPA 5J4QA 3R0FA 1SLVB 3SGBE 2FLRH 1UTLM 1WU1A 1DOJA 1UO6A 3FVFB 3RMMH 4F48B 2P93A 1EAXA 1QGFA 2AERH 3AAVA 4WH8A 5HMAA 1J16A 4X6NA 1DDJA 4D9QA 2VVVA 1PYTD 2XNIA 3SU3A 2GMTC 1YY3A 1ZHMA 1EZSC 2KX4A 5FBIA 4Q7ZA 1RIWB 4FU9A 1VGCB 1IQMA 5F8XA 1YWUA 1F0TA 3UR6A 3KIDU 1W7GH 2ZPSA 3SJIA 2ESTE 3WWFA 3TGJE 1O5CB 1HRTH 2SGEE 2W7UA 1J14A 3M5MA 3RMLH 1NRNH 3FANA 2XNDD 1UVTH 1GVKB 3E16B 3UWIA 1P2IA 1L4DA 4JZEH 4Y6DA 5A2MH 3G01A 2NWNA 1Z1IA 3GDUA 9ESTA 4MG3A 2WINI 4BXWA 1YLNA 1CVWH 1HJ8A 2ZCKP 3ZZ3A 1GBIA 1IAUA 1Y3YA 2ODYB 4JK6A 1EZUC 1V2TT 3C27B 2GVFA 1Y8TA 2L6OA 1F5KU 1ZSJA 4X6OA 1DY8A 4X1PU 1OX1A 4O3TA 4ISLA 2ZEBA 4NGAH 3ZZAA 3S7HB 3DFJA 3VPKA 1RS0A 4HI3A 4MPVA 1P01A 3T62A 1BTYA 1C5UA 3BF6H 3P8GA 2Z3DA 4WVPE 2NU3E 3TITA 1IOEA 1AUJA 2SGQE 5JBCS 2ZU4A 1A2CH 3A8BA 3MH7A 1O5BB 1WDIA 1TMBH 2HGTH 3PV5A 2P16A 3T2NA 2OC0A 2BVXH 1O36A 5EPNA 1CE5A 3U1JB 1SGFG 1B7XB 1DX5M 1THRH 1ZYOA 2IPQX 5EXMA 2OBQA 4Y71A 1BQYA 3A8CA 2ZECA 2TGTA 2H5DA 2F9NA 2XRCA 1BZXE 1HV7A 5EOKA 3A82A 3ZYEA 1LPZB 2PP6A 3OX7U 3LJJA 2WHXA 3LGVA 1NFXA 1O5GH 1VITH 3MYWA 2LP6A 3GY3A 2QF4A 1GHVH 1NZQH 4FUBA 1VITG 3CP7A 4H6SB 4DW2U 2ZQ1A 3A7XA 3LPRA 3BTQE 1BRCE 4Y10E 3A8DA 1FZZA 1TPSA 3SNDA 4MTBA 2FPZA 1L4ZA 5C0UA 4P00A 3SHAH 1C2IA 3DUXH 1W13U 1XXFA 1JIRA 1FIWA 4AN7A 1GBAA 2OINA 5EW2H 1YC0A 3SQHE 2CHAB 3UOPA 2RDEA 3DA9B 2HVXA 1ELGA 1T8LA 1V2MT 5DP7A 1EOJA 3S0NA 1C5QA 1KLTA 2CV3A 1O2UA 3M5NA 4U30A 1SG8B 2ZFSA 2IJD1 4OS1A 2EQNA 1Z8JB 2BYAX 2H2ZA 1ZMLA 1L1NA 2SGAA 4A92A 2ODPA 3SZNA 1G9IE 3ATWA 3N7OA 2Y6TA 1TQ7B 3QO6A 1SGQE 1Y3XA 2JETB 3RU4D 4RI0A 1CGIE 1GHWH 1AN1E 4ZKNU 3QWCH 1HJAC 2G00A 2V7QD 1WBGB 1CBWB 2F9VA 2KAIA 1T7CA 3H7OA 2XCFA 3QGNB 3RMOH 2FS9A 3A7WA 1PPBH 2A4QA 1O2QA 1TRNA 4RKOB 5FBEA 1UTJA 1WQSA 2UUYA 1O2WA 1K1OA 1UTPA 3F3BA 2VU8E 3RXVA 1HAHH 3GY2A 3MU5A 1GHAF 3BTKE 3ZVDA 1FPHH 1Z71A 2QXIA 1T31A 1B0EA 3MU8A 6GCHF 3A84A 2F3CE 4Q7YA 2UUJB 2XC5A 1G3EA 1P12E 5DSFA 2C4FH 2O8MA 1L0ZA 2FDAA 4INLA 3KYFA 1SQRA 3ZV8A 3MH5A 3DHKH 1TGCA 1BTWA 1J9CH 1O3IA 2WZQA 3SORA 2EY4C 3BG4B 4MNVA 1QQUA 1RD3B 2VIDA 3SBKA 1UTOA 4VGCB 3GCTF 4KKDA 1DFPA 3Q00A 5KECA 2EC9H 2C8YB 1LHEH 4FUIA 4DJZB 1JWTA 1KYNA 2GV6A 4DT7B 1FONA 1BTPA 1QJ7B 2WV5A 1MTSA 3URCA 1UK4A 4IC5A 3RC5A 3C1KA 2FTMA 1HNEE 2J95A 4E7RG 3L6PA 2ZG0H 2VWOA 1SLWB 4MLFB 2BOHB 3PV4A 3TIUA 3GCHC 3NKKA 1K2I1 2W7SA 4X1NU 2QE7D 1IHTH 1SGIB 2H9TH 3MWIU 5DP9A 4A1VA 5C0TA 1OWEA 1EQ9A 1N1LA 4X8UH 1IQEA 3F1SB 1T8NA 1GI4A 2Y7XA 1O0DH 2BX4A 2ZF0H 2P8OC 3E91A 1WTGH 1T4UH 4LZ1H 3N7DA 1MTNB 4MVNA 5GIBA 1GBHA 4ABIA 5C1YA 1YPGH 4A5TS 1ZR0A 2H1UA 4TY6A 1UTKA 2QN5T 3K9XB 1Y3WA 1SI5H 2V6NA 2P3TB 2ZI2H 1GI5A 3O8RA 1QBVH 4CRCA 4FVBA 1MQ6A 2SNWA 5GJ4B 1IQIA 4H4FA 1WUNH 3BIVH 1HXFH 1FDPA 2XOKD 4LK4A 1C1RA 2BDBA 1C2HA 1LHGH 3L33A 5FL7D 2B5TB 1C1OA 2A32A 3VGCC 2FP7B 1C5PA 4NWKA 1OYTH 1RJXB 1UTNA 3E3TA 3T29A 4XRNA 6GCHG 4F4OC 3MNBA 1Z1JA 4KTSA 1AMHA 1B5GH 1KXFA 4DGJA 2XCNA 5FPTA 2A4OA 3RXOA 1C5MD 2BQ7B 2V3OH 2VH6A 2B0FA 3LGUA 3TVJB 5JYIA 1COWD 1JXPA 1ELCA 3UNQA 1O2MA 4FUGA 3AASA 2OXSA 4ZXXH 3GCTG 2NU1E 1P04A 4OGXA 2VIVA 1AO5A 2K0QA 1IQKA 5FXLA 3PYHA 1Z7KA 2ZNKH 4BAOB 1G2MA 2R2MB 4XD7D 3NZIA 5EG4A 3ZZ5A 2QXHA 1DUEA 1LPGB 1GGDB 3DD2H 3R3GB 1W2KH 1OP0A 2BY9X 1H8DH 1P2MA 2VNTA 3PB1E 2GD4B 2C8ZB 5GCHF 1XKAC 1THSH 4DY7B 4NSVA 1DWDH 1QL9A 1RXPA 1BITA 4MNWA 4MNYA 2C90B 4ISIH 2BD5A 2XC0A 2GZ7A 4NG9H 3LJOA 2OCVB 1MU8B 1W14U 1ZGIA 2HALA 4AOQA 3VB7A 2PKSC 3TGKE 4K69A 1SFQB 1P06A 1SGNE 5EGMA 4KTCA 1G30B 1O3BA 1B0FA 2QXJA 2F9PA 5DP6A 3GY4A 2XBWA 2G4TA 5SGAE 1E37B 1SOZA 3MU4A 5FCRA 3RXKA 2OLGA 2ZPQA 3LKWA 1V2QT 2AMDA 2BB4A 1P0SH 4NIXA 4BOHA 3P70B 1C4U2 2AGEX 2M5TA 6CHAC 1BRBE 1GBBA 3A81A 1DSTA 1W12U 1C5NH 2GT8A 1GJ6A 4Q7XA 1HYLA 1YF4A 1TNJA 3NUMA 2BXTH 2AFQB 2J2UA 4X1RU 4BANB 3UUZA 2UUFB 3M7TA 1ELEE 2H9HA 1IHSH 2O8LA 1VCQA 3SJKA 5B6LA 2ZTZA 4HGCA 2TPIZ 1A0LA 2VGCB 3F2HA 1BMLA 1ANDA 1NRQH 3MO9A 3PM3A 4BAQB 3BV9B 3A7TA 1O2XA 4WMDA 4ZHAA 1ZRKA 1XUFA 1AFQC 1QR3E 1UVOA 1V2KT 2XWAA 3A89A 3MO3A 2OC8A 1O3MA 3K2UA 1DY9A 1EUFA 1F7ZA 2EI7A 1G3DA 3GOVB 3F9FA 2BXUH 4I32A 1A4WH 5C17A 2A45B 1WV7H 1C5SA 2BLQA 5HYOA 3TLOA 3KQCA 1ZPBA 4BNRA 3M7UA 2PTNA 3NRLA 1UVUH 1FNIA 1O37A 3IG6B 1FY1A 1HIAB 1TNGA 2CN0H 2O8TA 2Z3CA 4K60A 5E0HA 5C1UA 4AZ2B 1TMTH 1RTKA 5CMXH 1TRYA 2ZKSA 3OU0A 1CA8B 5GCHG 2GV7A 2IPHA 3FFGA 5GNDA 5BRRE 3PWBA 2P3FH 2BVSH 1GJAB 2UWPA 3SV6A 1C5RA 2VIQA 5TCAA 1TFXA 2BTCE 3KGPA 4ZROA 1TABE 5C67A 5T1VA 4X2YA 4WY3A 1QL8A 1TOCB 5T6DA 2BX3A 1C5ZB 1T8OA 3BEIB 1L2EA 3UR9A 1E0FD 1GBDA 1QRXA 2HRVA 1CHGA 3RXSA 3T25A 3VXFH 2YMSB 3MH4A 1C5TA 5E0GA 3A7YA 1TGTA 1ABIH 4X8SH 3S9AA 1GCTB 4GSOA 4HTCH 2FI3E 2CXVA 3ZZ4A 2BD3A 1F0UA 2ALVA 1W8BH 2W6JD 3JZ1B 3LDXH 1DXWA 1BJVA 4JCNA 1K1IA 5EJZA 1TX6A 4X2XA 1AVWA 1BBRK 1EASA 1V2ST 1TBQH 1S5SA 2ZCHP 5FX6A 2B9LA 3SQEE 3HGNA 2ANKH 4Z6AH 3SV2H 1QZ8A 3EA7A 4JMYA 1CA0B 2BDCA 2XC4A 1AVXA 1JBUH 1MKXK 5DJ7A 4IBLH 3RU4T 3SJ8A 3EGKH 2GP9B 2F9UA 1N8OB 4JK5A 1SVPA 4GLYA
chains in the Genus database with same CATH topology
3SJ9A 1SC8U 1WQVH 2ZHEH 9LPRA 1TGNA 1A3BH 3S9CA 3O8DA 4YZUA 2A5KA 5JB8S 3HK3B 1BRUP 4R0IA 2JH0D 4O9VA 3HKIB 4NA8A 4B76A 3UQOA 2QIQA 4YTAA 1A61H 3TK5A 3I77A 5PTPA 2FOEA 1TRMA 3UOUA 1MZDA 1TNHA 2J38A 2ZU1A 3BTHE 1GL1A 2ZDKA 1BRAA 1SGEE 2YNAA 1CU1A 4AB9A 4I7YH 3SHCH 1O2OA 1TIOA 1KXDA 3RXCA 2QC2A 3OY6U 4Y8YA 3M3TA 4KGAA 3PLKA 3ESTA 1QRZA 1V2PT 1C5VA 1O5EH 4X1SU 1G2LA 1SB1H 1HAYB 5JBBS 4AFUA 1XVOA 2UWOA 3RC4A 1O5DH 1WCZA 1JRSA 3ITIA 4E05H 1FUJA 2V0BA 5LGOA 1TONA 1G36A 2IJOB 1QJ6B 1VCWA 1EAIA 1QA7A 2EI6A 2OBOA 1PPCE 3CS0A 4F49A 1W10U 3T28A 1VZQH 4UFEH 1VITF 1HLTH 1C2GA 2ZHFH 3GICB 1O3DA 2G5VA 1HUTH 1ESBA 1ZTJA 1Y5BT 1TGSZ 6CHAB 1BTXA 1EZQA 2A4GA 3KQDA 5EQSA 3SUDA 3RXLA 2BY7X 4XBCA 1EPTB 5CHAB 1G32B 2ZHDA 1UK2A 3LGWA 2I6QA 1WTHD 3A8AA 2OQUA 3A88A 4NA9H 3KQEA 1AIXH 3M36A 1W0ZU 4U2WA 1THPB 4ABDA 1JMOH 4BAHB 1TWXB 2VIOA 4I8LA 1P3EA 2ZCLP 4X6PA 4YESB 1O3NA 1LVYA 1QY6A 3EQ0H 4A6LA 1TPPA 1QB9A 3GISB 3PWCA 1V2UT 3RXUA 1AFQB 1MCVA 2GGVB 3QTVH 3BTEE 4ISNA 2D8WA 7GCHF 5A0BA 1PPEE 2J92A 1EJMA 1DWCH 2BDYA 2VWLA 4B73A 1AQ7A 1AZZA 1GG6B 2OC1A 5LPFA 1AB9C 2IOTA 1GMCG 1XMNB 4GHQA 3DT0H 1C4Y2 1ORFA 5E2PA 3SOSA 2SGFE 2GCTC 4CHAB 2LNCA 3LU9B 1EKBB 4UEHH 1KXEA 1EP5A 3M61U 3RM0H 1O3EA 1GWAA 2A2QH 4MPWA 1G3BA 5TJXA 4DCDA 1GHYH 3AW0A 1EATA 1O2YA 1O3GA 2ZGXH 3GDSA 1E34B 1AGJA 2J4IA 1Z8RA 3RXBA 2ZDLA 4OS6A 2GTBA 1GDUA 1AHTH 1ANCA 2BDHA 3BTGE 2FLBH 7ESTE 1F92A 1SQOA 4GHTA 2QV1A 1KLIH 3M3VA 1ETTH 4ISHH 4NA7A 2Q6DA 1GI7B 2FXRA 2XYAA 1FN8A 4FUDA 5ESBA 3M5LA 3UTUH 4AG1A 5L6NH 4ABBA 2P95A 4U32A 3RP2A 4BAMB 1LVBA 1FY4A 1C1QA 4X6MA 1O3LA 1J17T 1NU9A 1OYQA 3TJUA 3MH6A 1W3CA 1ELTA 3F9HA 1QA0A 4YOGA 2PHBA 4GAWA 4XSKU 2ZTXA 3ATKA 2FI4E 3BEFB 1O3HA 2PUQH 2OC7A 2BOKA 2RCEA 3BG8A 1YPEH 2Z9GA 2D26C 3SV7A 3P8NA 5E0JA 2V3HH 4WXVA 4FUEA 1FY8E 3LC3A 1GJ8B 3LGIA 3URDA 1SQAA 2SGDE 3ZYDA 5DPAA 1H8IH 2AH4X 3EE0B 3NCLA 5F8TA 2ODQA 4Y8ZA 4E7NA 2ANYA 1C5LH 3SI4H 1YM0A 3S7KB 2JH6D 7GCHG 4BTIB 1X7AC 4GVUA 1HAVA 1QBOA 2HLCA 1ELAA 1MAYA 3PTBA 4D9RA 2PTCE 3A83A 3SV9A 2PKAB 3BTME 4IW4E 2R0LA 2O9QA 2RG3A 5EU8A 4RKJB 2P94A 3E1XB 2BDIA 2ZIQH 1NRPH 2VIWA 2ANWA 2J94A 1HAVB 3VB5A 5F6MA 4IS5A 4K3JA 3M35A 1ARCA 4X1QU 3NWUA 1GMDG 1P8VC 1C5XB 2HNTE 2UUKB 1UCYK 2CF9H 4K8BA 5HM9A 8KME2 2STAE 4AORA 2D2DA 1GVZA 1LO6A 1YPMH 1K1MA 1ZGVA 1GDQA 2QA9E 4RSPA 1OPHB 8LPRA 3QGJA 2FWWA 2Z9KA 2A4RA 1NROH 1LCYA 1O39A 1O2TA 3SJOA 4GUXA 1CHOG 3TJNA 5IDKA 2QCYA 1C9PA 2G55A 5AHGH 1BDAA 2A7HA 3PO1C 2WPHS 5BPEA 2A1DB 4NZQA 4XOJA 1NFUA 1D6WA 5IYTA 2Z9LA 5K0HA 3EYDA 3I78A 2ZFQH 5FHTA 1PPHE 2FOFA 1GMHF 1QTFA 2PR3A 4AYYB 1WSSH 3SU6A 1ELDE 2QF0A 4CR9A 2YOLA 4X2VA 2GMTB 1C2KA 3GY6A 3UNRA 1IQJA 1Z8IB 4INKA 1C1PA 2ZHWH 3ZZCA 1GI9B 1KDQA 1LMWB 3T5FH 4WJG2 3BSQA 1SGFA 3RXRA 3KL6A 3LH3A 4CH8B 4D76A 4YO9A 1C1SA 2BY8X 2AGGX 1FY3A 4NCYA 3RXMA 5A8XA 3HPTB 2F83A 1KDQB 1N6YA 1L1JA 2GZ8A 1INCA 2FOAA 3ZVCA 1OKXA 3K65B 3LC5A 5E8EH 5A0AE 2TBSA 2ZGHA 1A0HB 5GWZA 4D7GA 3U9AH 4CR5A 1UJ1A 2AIPA 1AWHB 3ENSB 3U1IB 2ZO3H 4ABJA 1OXGA 1QL7A 5I46H 1EJAA 1O3CA 1NTPA 1S0QA 1GHZA 1ANEA 1GBFA 1O30A 4WMFA 2Q6FA 1FAKH 1MKWK 3MNXA 3UNSA 1JIMA 1HXEH 1GPZA 2WUCA 1HB0B 1GBKA 3KQBA 1W0YH 3A7ZA 1MU6B 5T6GA 1HFDA 1HAZB 4TPIZ 2FO9A 4INHA 2F9OA 1OWHA 1S82A 1ZSKA 1TMUH 2Y5FA 1HBTH 4IGDA 1LDTT 2P59A 2W3KA 3FAOA 4Y8XA 2OP9A 5HXFA 4O03A 2FEQH 1AU8A 2G51A 3FP7E 1KTTB 4B2CA 4CRGA 3P8FA 1D3PB 1ZZZA 1FQ3A 1TBZH 2GCTB 1NM6A 4Q2KA 1C1UH 1AZ8A 3P92A 1C4V2 2YNBA 1GBLA 2OQ5A 1HPGA 2P3UB 4YM9A 2ZZUH 4DURA 1YPHC 3ODFA 5GXPA 1Y3UA 2BLVA 1PPFE 3M7QA 3A87A 4TY7A 1ANBA 3SW2B 1K1NA 4JYTA 4Y76A 4ZKRU 1XKBC 3A7VA 1O31A 1GMHG 2Y81A 1O3FA 1MTVA 2ZFPH 1GBMA 2W26A 1K22H 3F9GA 1F0SA 3SU4A 1P2NA 3SN8A 2DE9A 2XWBI 1K1PA 1BTUA 1KIGH 3KEEA 1SMFE 4TPYA 1FJSA 3B8JA 1SSXA 3ZZ7A 4JZ1A 1O2VA 1DXPA 1ZJKA 4WXIA 2I6SA 3SI3H 5E2OA 1MD7A 5C1XA 1TA2A 2PSXA 3QUMP 2B8OH 2HPQH 3P8OA 3PLBA 4OS4A 2H5CA 1Y59T 4YLUA 2BQ6B 1O2NA 1H9HE 3QX5H 3F6UH 1F5LA 4DOQA 1XUHA 3MO6A 2BM2A 2Z9IA 3OYPA 1HAGE 3SU5A 1P3CA 1ZPZA 4J2YB 4ISOA 3ODDA 1VGCC 1LKBA 4WMEA 1A5GH 2WPKS 3PMJA 1D3QB 1YPHE 4J1YA 1S6FA 3V12A 3P95A 3UQVA 1HJAB 4ZXYH 3E0PB 2G52A 1DE7H 1O33A 2BLWA 5DKMA 3RXFA 3O8CA 3L3TA 1C2LA 4ZKSU 2FM2A 1W11U 2WUBA 3MHWU 4B74A 4CBOA 2R9PA 2A2XH 3KF2A 1LQEA 1SGDE 1HIAA 1QQ4A 3F68H 1MD8A 1YBWA 2FYRA 3VEQB 2FESH 1FV9A 4NIWA 1LKAA 1NRRH 3LT3A 4NSYA 4XBBA 3U8RH 2BD7A 1EJNA 1GBEA 2G8TA 1GI2A 2AEIH 1EXFA 5L30H 1NESE 2QAAA 2W3IA 1MBQA 1O3OA 1OSSA 4XDEA 1TALA 1P10A 2GDDA 1FIZA 3E8LA 1OOKB 2OD3B 4I8HA 1D3DB 1BT7A 1GI0A 2GCHG 1TNIA 3TK6A 2DE8A 4I33A 2H6MA 3T26A 1OP8A 1UMAH 3SV8A 1ABJH 1NY22 3STJA 3UREA 1A46H 2BHGA 1MQ5A 1CQQA 2FOBA 4TWYA 1D9IA 4K8YA 1TE0A 2PW8H 5FCKA 1DITH 2AGIX 1ZRBA 1TLDA 1C1TA 4SGBE 2C8XB 1F2SE 5DP3A 2AMQA 2BZ6H 4X0WU 4Y7BA 1K21H 2ZWLH 4BTUB 1BOQA 1C2EA 3GCHB 1EOLA 1QRWA 4ZMAH 1T8MA 1KXAA 1YLDA 1J8AA 1V2RT 1ZPCA 2ZP0H 3MU0A 8GCHG 2JKHA 4AFQA 3SNBA 4A1XA 2OTVA 1CGJE 1AVGH 2GDEH 2WYJA 1K28D 4Y79A 2P8OB 1QCPA 4AG2A 4YLQH 3CENA 4K2YA 2EEKA 1EP6A 5G4BA 1DM4B 4B2BA 3V3MA 3Q77A 4NFEA 1GI8B 2WPJS 1V2NT 2XXLA 1Y3VA 1D4PB 3LONA 1C2FA 3QZRA 1TGBA 3BTWE 1BMAA 3TH2H 1U6QA 4YT6H 5C5NA 2AYWA 2CHAC 1NO9H 8ESTE 1K1JA 4ABAA 1PQ5A 5GPIB 3SGAE 2W5EA 4O3UA 1GJ9B 1WOFA 3VFEA 1VCPA 1O2JA 1BTHH 3HATH 5HGGA 1EZXC 1MH0A 1O2KA 1F5RA 2VB0A 2VVCA 5LPEA 5DG6A 1V6DA 1FY5A 3VGCB 5C2ZA 2NU4E 4GCHF 3UIRA 1T4VH 5B6OA 4UFGH 2SNVA 1Z6EA 4UDWH 2GKVE 3MTYA 1O2ZA 1FI8A 1YCPM 3IITA 3PMAB 2JETC 1KXCA 1S81A 1O2IA 4ZUHA 1GVLA 1GHXH 4X8VH 4OS2A 1ZOMA 1CBWC 3TJOA 4K5ZA 5F03A 3RC6A 1OWDA 4H42U 4BAKB 1S84A 3ATIA 1GMCF 3AVZA 5T6FA 3M5OA 2XTTB 3LH1A 2CGAA 3RMNH 1NPMA 1SOTA 1Y5UT 1LVOA 1AUTC 1F0RA 1EAWA 3RDZA 4CRAA 3RXTA 4QT8C 2A31A 4A1TA 3E0NB 3GYLB 3D65E 3O8BA 3GDVA 1P03A 1EAUA 1PQ8A 2WYGA 1SFIA 4K1EA 1O2LA 2ZFFH 5K7RA 2Y80A 4D8NA 1C2MA 2C93B 3FP8E 3RM2H 1SGCA 1ACBE 1QFKH 4DIHH 2BLOA 1P09A 1Q2WA 2GX4A 2WPIS 2WPMS 3PMHB 2PKSB 1ZSLA 3BG4C 1ZMNA 5JB9S 3KCGH 2BD9A 4VGCC 1BMMH 4Y0ZE 1OS8A 3TGIE 4OGYA 1CT2E 4GPGA 3ZZ9A 5FPSA 1EPTA 3UFAA 3TPIZ 4IN1A 3I29A 2BDAA 1YP9A 3TNTA 1NN6A 2FOCA 3SO3A 4D7FA 7LPRA 3ZVAA 5DO4H 1ZTLA 5ABWA 6LPRA 4UE7H 1GHBG 4WF8A 3MOCA 2ALPA 4BTTB 4FUHA 1YPLH 1CO7E 1DSUA 2J34A 2GZ9A 1E35B 3RXIA 4GCHG 1ARBA 4YOIA 3RXEA 1P2JA 4M7GA 3QZQA 3RU4E 1YPKH 3BTFE 5EW1H 1LPKB 3HGPA 3QK1A 2ILNA 2ZDVH 3T27A 4LXBH 4BXSA 1MTNC 6ESTA 3MMGA 1O32A 5EPYA 1GL0E 1FMGA 1TYNA 3OY5U 1O34A 1E36B 1ZHRA 5JPMH 2R0KA 1PPGE 1XUKA 4CREA 3CS7A 2SGPE 1H4WA 3STIA 2HNTF 2GT7A 1O5FH 1MZAA 3ZV9A 4JYUH 2BDGA 1P2OA 1UHBA 1Y5AT 2O8WA 1DLEA 2THFB 1V2LT 2Y5HA 3IWMA 3A86A 1EB1H 1GDNA 1TA6A 4MPXA 4ZH8A 2VIPA 1GMDF 1NC6A 4NFFA 2CMYA 4NIYA 3A85A 7KMEH 2RA3A 4JZIA 1UHBB 4K1SA 4ZKOU 1YGCH 2QGRA 3D49H 1BBRH 2PFEA 4MNXA 5A8YA 3VB3A 1KXBA 4TWWA 1CHOF 1O3AA 2UWLA 4UFFH 3ZVEA 4IN2A 3RLWH 1KLJH 2RA0A 1MKXH 3W95A 2HNTC 5JBAS 2RDLA 3SUFA 1O5AB 4I8GA 4XFQA 3ATLA 1SGPE 1GGDC 1DVAH 5LH8A 5AF9H 4DVAU 2NU2E 2ZFRH 1EB2A 1BBRE 1FXYA 5EQQA 2Q6GA 1TNKA 3Q76A 2OUAA 2ZHQH 4H6TA 5L2YH 2EI8A 1TBRH 5F8ZA 2TGDA 1O2RA 2BMGB 1M9UA 1P9SA 2BD8A 3LGYA 2F91A 2V35A 2ZGBH 4AFSA 1BCUH 5C3NA 5DK1A 1YCPH 1FAXA 1CT4E 2PKAA 2QYIA 3SUEA 2ZDNA 4IMQA 4U01A 3RXAA 3H5CB 3W94A 1LTOA 1QHRB 1ZLRA 2HWLB 2FS8A 4YOJA 4NWLA 5AVDA 5C5OA 1FN6A 1YKTA 2ZDMA 5FAHA 1S85A 1DWBH 4I8KA 3SU2A 1ESTA 1NFWA 3GYMA 2VJ1A 1VJ9U 1GCDA 3ELAH 1KSNA 1Z8GA 2FOGA 2QY0B 1RGQA 1GJCB 1T32A 1WYKA 1S6HA 3FP6E 1KTSB 2O8UA 3PROA 4R8TB 2PLXA 2WPLS 3V13A 4I8JA 2HPPH 1ETRH 4AGKA 1GJDB 1AE5A 1A5IA 2VGCC 3EA8A 3UWJH 2G4UA 2TGPZ 5AFZH 3GCNA 3PMBB 3VB4A 4NIVA 4IC6A 2PV9B 1P2KA 4FU7A 2D1JA 3AAUA 2KAIB 1A0JA 3FZDA 3OTJE 4HFPB 1PQAA 3ZZDA 1DT2A 1YPJH 3HK6B 3P6ZB 4UD9H 4Z0KA 1V2WT 3U69H 1H1BA 2VH0A 2ZU5A 3NXPA 1S83A 5EODA 1MBMA 1V2VT 1NU7B 5DGJA 2BY6X 2A0QB 3TJVA 1FPCH 2FYQA 1O35A 1SQTA 3SU1A 2XBXA 2ZGJA 1GBJA 4KP0A 3H7TA 4ZAEA 1C5OH 2H9EH 1TAWA 2ZPRA 1G3CA 1UVSH 4THNH 1BB0B 2VVUA 1SLXB 1BHXF 4ABHA 4YT7H 3MNSA 1LHDH 3DFLA 1GJ5H