4AORA

Cationic trypsin in complex with the spinacia oleracea trypsin inhibitor iii (soti-iii)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Structural Characterization of Spinacia Oleracea Trypsin Inhibitor III (Soti-III)
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 58
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aorA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aorA02
1O3PB 1FPHH 2G4UA 2OLGA 4THNH 1O31A 4WY3A 1DWEH 2QF3A 4AG1A 1SGRE 2FP7B 3ZZBA 1BRUP 1C5PA 1KYNA 1V2MT 1GI0A 2ZO3H 4KP0A 1MZAA 4K3JA 4CHAC 1AVXA 1V2TT 1T32A 3DUXH 1BBRK 3EAJA 3F9HA 2Y5FA 4NWKA 2HNTC 2GX4A 5FX5A 3OU0A 1JIRA 1VR1H 1J9CH 5A8XA 3RXPA 1LPZB 2F9NA 1SSXA 4OS2A 1LKAA 1QB9A 4MDSA 3MNBA 3MO6A 8KME2 2W3IA 1GI2A 3ATLA 4CRAA 2D1JA 4K8BA 3ZVBA 4AFSA 4CRGA 3DFLA 2FS9A 5C67A 1OWEA 2STAE 4AG2A 2BD9A 1FXYA 3RMMH 1P2QA 3GISB 1TBZH 5I25A 2FOAA 3Q00A 1CT2E 1GHYH 2AMDA 4TPIZ 4A1VA 1C1UH 1KLTA 3UOPA 1ESAA 1VITG 1QCPA 3TH4H 4E7RG 3E16B 1HYLA 2IJOB 1C2HA 3BSQA 1TAWA 1FPCH 4GHQA 1C5YB 3KL6A 3SOSA 4ABFA 3TH2H 3ZZAA 1HRTH 1VZQH 2FM2A 2F83A 1DANH 2FEQH 4FUDA 1FAXA 2BDCA 5ESTE 5JB9S 4DIHH 3FP6E 1H1BA 3FP7E 4WXIA 3Q3KA 4Y71A 3UWIA 1E36B 1MBMA 2ANYA 2Z9LA 1TIOA 3RXVA 4BANB 1GBJA 2PKSC 1UTNA 3RC4A 1SGCA 3ZZ7A 4KKDA 4CRFA 2A4QA 2NU0E 1P2KA 3PV4A 3ODFA 5EXNA 3FANA 4TWWA 1C2GA 2G4TA 5C3NA 1NRSH 1PPHE 3VGCC 1FQ3A 1F92A 2WYGA 1SGDE 2AIQA 3RDZA 2B7DH 3MH6A 3A7TA 3RU4E 2AIPA 5DP6A 2BZ6H 5FX6A 3ZYEA 1H9IE 1O3DA 3NXPA 2W5EA 2Z94A 3DHKH 4A1TA 4CR5A 2F9PA 1DWDH 2AH4X 1CO7E 3IG6B 1FAKH 3A81A 4AGKA 2UWPA 4YLQH 1N1LA 2FLRH 1ZHRA 1BTYA 1T4UH 1O5GH 2BXUH 4I32A 4BTIB 1ZMLA 1MKXK 1GBMA 1EQ9A 6GCHG 2O8MA 2CXVA 1MTNC 2B0FA 5I46H 4DW2U 1A3EH 4IGDA 1ELBA 1C1MA 1ELGA 3IITA 2ZGXH 1BA8B 1S5SA 1WTGH 1JOUB 2ODPA 1JMOH 3AVZA 3S7KB 1EAUA 2LPRA 3SI3H 4BAOB 1AB9C 1QJ1B 5A2MH 1GBAA 2GV7A 1LCYA 4A6LA 1OP2A 2G00A 4H42U 1DWCH 2OC1A 5T3HA 2AGIX 3LGVA 3L3TA 1MU6B 1MD8A 2UUJB 3LT3A 1IQIA 1BJUA 1O35A 1NRQH 3MU4A 1O2UA 2C93B 5AHGH 3RXDA 1DX5M 2ZFPH 3MWIU 4HZHA 2CN0H 3PO1B 1GL0E 1SQTA 3OY5U 1WV7H 3UIRA 4KELA 4INKA 2H1UA 1SGEE 4NG9H 1XMNB 3O8RA 3Q76A 4BXWA 2ZGBH 2PGQB 1C2MA 1JXPA 1GHBF 3PMBB 1Z6JH 1E34B 2GT8A 3ZZ3A 2V0BA 1AGJA 4WXVA 1O3JA 3ATIA 1V2WT 4ZUHA 1O33A 2QXGA 3KQBA 3MHWU 1DPOA 2JH6D 3U8TH 1K1JA 3D62A 1QRZA 3SNEA 4Y0ZE 2CGAA 1V2UT 3T26A 1GI5A 3A89A 2Z3DA 2H5CA 3LONA 2H6MA 1ETTH 3GY2A 2A2XH 1FY1A 3FAOA 2ZKSA 5FPYA 5FHTA 4RKOB 3VFEA 3KQDA 4ZKSU 2F3CE 3UR9A 1P2IA 2A1DB 4E05H 1BTHH 3VB3A 6CHAC 2ZA5A 1GI3A 4MPUA 1SLUB 3SI4H 2ZPRA 3SHAH 1L4DA 2BY8X 2FODA 2JH0D 1KXEA 2IN2A 2ZFQH 1TBQH 1SHYA 1GBTA 1JBUH 1O3HA 1YPLH 1SGYE 2J34A 4YO9A 3LJOA 3ZYDA 8GCHF 1FN8A 1THPB 3HK6B 3SBKA 1MQ5A 1NO9H 3SGAE 2FTLE 1ZYOA 1D3QB 1ETRH 2FOHA 5DP8A 3U98H 3D65E 2NU4E 4MTBA 2BOKA 3U1JB 1TWXB 5GIBA 3UR6A 1UVOA 1S85A 3GY4A 5F8TA 4UFEH 4Y8YA 2TGDA 5A0BA 3LJJA 5C1YA 1SGQE 2OD3B 1UTMA 3BTWE 1SL3A 5FBIA 2FX4A 3A84A 2XBWA 1BCUH 1ANDA 1UHBA 1LVOA 2Z9KA 1ZTLA 1P12E 2FESH 3BTME 4MNXA 2FOCA 1C2KA 3A8DA 1GDUA 1SR5C 4K1EA 4B73A 5B6OA 4HTCH 1IHTH 1A1RA 3KEEA 2O8LA 2PR3A 4KTUA 4BTTB 2RCEA 2HRVA 2OP9A 1TOCB 4Z0KA 1HUTH 1NRRH 2BHGA 1THRH 2YOLA 1FY8E 1DWBH 1H8IH 1K21H 1O3LA 1UVUH 5FCKA 5A0CA 2WPKS 3PYHA 1XUFA 1CA8B 1AUTC 3W95A 2G8TA 1NN6A 3PB1E 1HGTH 1LHCH 2SFAA 2WV5A 2BX4A 4A1XA 2A4OA 1A7SA 1UTQA 4D76A 4X6NA 1DUAA 1EJAA 1O2MA 1SG8B 3STIA 2AGEX 2P8OC 3VEQB 3M35A 3TJNA 1K1LA 2FMJA 1XUGA 1S83A 1XUJA 4JK5A 4INHA 2CF9H 3O8BA 2FOBA 2ZDMA 1HJAB 3MNCA 4NFEA 1TYNA 3SJKA 2QCYA 5HMAA 2EEKA 2VIOA 1UJ1A 4AB9A 3GCHC 3TNSA 3E0NB 4OGYA 1CA0C 2VVVA 1C1QA 1HJ8A 1TRYA 1UCYK 1G3EA 1SQOA 1YC0A 3N7OA 3VXEH 4BAKB 5FAHA 1T31A 1NESE 2XBYA 1C4V2 4BTUB 4Z6AH 1ZSLA 1LPGB 1TGBA 1HIAB 4Y7AA 1QR3E 1W12U 1W3CA 4XBDA 1ANCA 1HAXB 4NIWA 2QXIA 2BD7A 5T6FA 5DO4H 3O8CA 4JZIA 4CREA 1UCYH 5EXLA 5EPYA 3M7UA 1H8DH 3SU2A 4OS4A 3URDA 4YESB 4B1TA 1KXFA 2Y7ZA 2B8OH 3BTTE 2Y5HA 4ISIH 1DLKB 1HDTH 1LO6A 4FUCA 1G32B 2CV3A 1XVOA 2P59A 3RXQA 1AIXH 2VIWA 3SV6A 5G4BA 2BY5X 3SJ9A 2ZPSA 1D4PB 2VNTA 3KCGH 3M37A 2ZDNA 1O5BB 1S82A 2ZU2A 3P92A 2ZDLA 1TQ7B 1AFQC 1IQEA 1GI4A 1ABJH 1S0RA 4DG4A 4B75A 1VGCB 5JBCS 1PFXC 1Z8IB 1EPTB 2I6SA 2O9QA 5FPTA 2ZQ1A 4ESTE 4CBOA 3SU6A 3SUDA 1SC8U 1W7XH 3T2NA 3S7HB 1P05A 1GGDB 1T8OA 3PMAB 4Y11E 1RRKA 3QUMP 2Q1JA 1CQQA 5CHAB 1C4U2 1D9IA 2BDIA 3PWCA 4HFPB 1K28D 4UDWH 5EQRA 4TY6A 1RGQA 4MPWA 3T5FH 2TPIZ 2DE9A 1MD7A 3FVFB 1P8VC 3BG4B 1T8LA 2PTNA 4U01A 7ESTE 1ZJKA 1TGNA 3FZZA 5CHAC 5JDUB 5LPFA 1PPFE 2CMYA 3MU1A 1QQ4A 2R2MB 2F9BH 4U30A 3S9BA 3QZRA 1SGIB 3RXAA 4WF8A 1ESTA 1HAZB 2GP9B 1F0SA 4I8JA 2J94A 3A80A 1TALA 1BQYA 1E0FD 1EX3A 4IMQA 1GDQA 3RM0H 3MO3A 1O5DH 2ANMH 3HATH 5F6MA 3SHCH 3A83A 4GAWA 4B74A 1C9PA 2ZI2H 3PMJA 1GHBG 1QB6A 1ZSKA 3SQEE 2Q6FA 1MCTA 3RXSA 1GJ5H 1ZZZA 2ZU3A 5CE1A 1PPCE 4AYVB 2Z9GA 1C5VA 3JZ2B 1NC6A 3RP2A 4ABJA 1WSSH 1K1PA 4MPVA 3GOVB 4DVAU 1CSOE 2WINI 3UUZA 1K1IA 1AZZA 2XWBI 4YOIA 1CE5A 4U32A 1EB1H 3QX5H 4K1TA 4B76A 2BOHB 2F9OA 1A61H 1XUKA 2D26C 1AZ8A 4NFFA 1GHAF 4NWLA 3S9AA 2VIQA 2J2UA 2QXJA 3MOCA 2FOMB 1D6WA 1SFIA 1IQKA 3SUEA 2VH6A 8GCHG 4DIIH 1BDAA 4FUIA 2XW9A 3EGKH 4I8KA 5LPEA 3V7TA 1O2KA 1UK3A 3FFGA 2A7JA 3ZZ5A 2BQ7B 2GT7A 1O2JA 3AW1A 4ZKOU 2FIRH 4FXGH 5ABWA 4HI3A 3E91A 2AFQB 2CF8H 4IN2A 2I6QA 1NROH 4X1RU 1W7GH 2M5TA 2Y7XA 3BIVH 4X2XA 2Y81A 4XSKU 1QQUA 1WCZA 3MNXA 1RFNA 4KTCA 1C5TA 1AKSA 2O8UA 1TNLA 1L4ZA 2FX6A 2G52A 4WVPE 5C2ZA 1TA2A 2SGPE 1NFWA 1ELFA 1ZHMA 1CVWH 1P2JA 1F0RA 3LH3A 3SORA 3ZV8A 2RA3A 1X7AC 2ZGCA 1MU8B 2SGDE 1S84A 4AYYB 1DOJA 1BRAA 1L2EA 3TGKE 1F5RA 4J2YB 3GY5A 2K1QA 1U6QA 1FNIA 2VGCB 1O30A 2WPIS 5JBBS 4A7IB 2ESTE 1P03A 1TGTA 4Y76A 5EODA 3A82A 1EZXC 2VB0A 1BMMH 2Y6TA 1S6HA 4M7GA 2SGAA 3OYPA 2GZ9A 1GVLA 2SGQE 1OWJA 3RXTA 3MI4A 5FBEA 2SNVA 1HLTH 3A7XA 1VCQA 1SLVB 1PYTD 1WBGB 5EU8A 4TPYA 1SOTA 4ABEA 5C5OA 2W7SA 2HWLB 2GTBA 3MH5A 1BBRH 1TNGA 1OOKB 1S81A 3URCA 1TMBH 2OUAA 1P2MA 4AZ2B 3GCNA 1CU1A 4NA7A 2FI5E 3ZZDA 4K5ZA 1QTFA 1FIZA 1DT2A 1QIXB 1P10A 4QT8C 2A5IA 2FPZA 2QF0A 1TB6H 3I77A 1CGHA 4FVDA 1TPPA 1GCTB 4HGCA 1GG6B 3GY3A 4I8LA 4O9VA 3AAVA 1IAUA 2BQWB 1O2ZA 2ALVA 2QA9E 4AOQA 3PTNA 1O2HA 2CHAB 3AAUA 3ZVEA 1AMHA 1RIWB 3P8FA 2Z7FE 1HXEH 1GCTC 2NU1E 4B2AA 1OS8A 2Y5GA 3LKWA 1C1NA 3M7QA 1EASA 1GBBA 2ZTZA 3DT0H 4JK6A 3SU3A 2V3HH 1O2PA 2ZGHA 1Z71A 2R3UA 2UUKB 1C5XB 3SGQE 1EZUC 3ZVGA 1A5IA 5GCHF 1C2DA 1NFYA 3HPTB 1MQ6A 3LGIA 5DGJA 3TJOA 4BNRA 1FI8A 1GJ4H 1GI9B 1ZPZA 2Z6BD 4GSOA 3EA8A 2BLVA 3CS7A 1TLDA 4ABDA 1Y3XA 4BXSA 3V0XA 4FUBA 1FV9A 2QC2A 1TGCA 3V12A 2A4RA 1PPEE 3K9XB 1KXBA 2QGRA 1F5LA 1IHSH 1M9UA 8LPRA 4Y10E 1DY8A 3O8DA 2FI3E 2FYQA 4X1PU 1YKTA 2OBOA 2FS8A 1BTXA 2Q6GA 2P3FH 3RLWH 1ABIH 1TMTH 4IS5A 4IC5A 1QA7A 3UQVA 2OBQA 2ANWA 2ZCKP 1P9UA 1K22H 1YM0A 3M61U 4ZROA 3ELAH 4ISOA 1TNKA 4YOGA 4JZ1A 2ZHDA 3LDXH 3RC5A 7LPRA 4ZKRU 1O2LA 2BLWA 1TX8A 4WMEA 3P8NA 4X6OA 1O3CA 5K7RA 1UCYE 4X8VH 2ZFSA 3EQ0H 1VJ9U 3SV7A 4I7YH 1GI1A 1MAXA 1NT1A 1L0ZA 5AF9H 1DXWA 3QO6A 1VCPA 2R9PA 3U9AH 2BY7X 1SGFG 3LOXA 4MNWA 3U1IB 2BDAA 1WQSA 1WTHD 2A45B 1O34A 3K6YA 1CHGA 5JPMH 1SVPA 1LKBA 1MKXH 4X8SH 1GVZA 1O37A 3RXJA 2P3UB 1O36A 4FUJA 4TWYA 3BN9A 2C90B 4X8UH 3RXGA 3UNSA 4B71A 4NCYA 2TGTA 1ELVA 1YLCA 1KIGH 2A32A 2BTCE 1ID5H 1YPJH 2BDYA 4ZH8A 2VINA 1MAYA 3T28A 1BHXB 3QZQA 4YT7H 3VB5A 4TYDA 2IPHA 1ACBE 3SU1A 1K1NA 1HAGE 2GDEH 2SGFE 3WY8A 3F9EA 3ZZ8A 3PO1C 3P17H 1DDJA 1NY22 5EPNA 3SU0A 2PFEA 1GHAG 1SLXB 1NFXA 1V6DA 2XRCA 1TQ0B 1VITH 2BD5A 3MH4A 1C5ZB 3A8CA 1OXGA 3PROA 2J9NA 4A5TS 1FDPA 4NZLA 2ZWLH 1JRSA 3T25A 4UEHH 4O97A 1GHVH 2BY9X 1HNEE 3KGPA 4Y8XA 4WWYA 3TVJB 2A5AA 5J4QA 2NU3E 1YLDA 1LVBA 1FZZA 4DY7B 5T6GA 5HM9A 2FZZA 4D9QA 1O5CB 3SQHE 4CR9A 2STBE 1PQAA 4INLA 2VIDA 1B0EA 5PTPA 3P6ZB 1DUEA 1PPBH 1DVAH 1TPOA 1Y59T 3RXLA 9LPRA 3F6UH 2FI4E 2J38A 3RMOH 1O2QA 1HV7A 2FYRA 1GDNA 3M3VA 3KNXA 1P3CA 1TNHA 1Y5UT 5GWZA 4WJG2 1O5AB 4GLYA 1T7CA 3UREA 2ALPA 1SGFA 2WUCA 2ZQ2A 4FU7A 3LC5A 1CT4E 1TBRH 2ZHQH 3FP8E 5FPSA 2PWXA 4OS7A 1AUJA 4K1SA 2UWOA 3F1SB 1KSNA 2BDBA 1C2FA 1O2SA 2BD8A 4FUEA 2V35A 1C5LH 1GBCA 1TX6A 1XKBC 3QDZB 3RMLH 5GDSH 1HAHH 1KDQA 4ASHA 1NFUA 1V2RT 3GCOA 1O32A 3PMHB 1NPMA 1P02A 4MPXA 2GDDA 3RMNH 2Z9IA 3TPIZ 2ZU5A 3ZVCA 3S69A 1EZSC 1GMCF 4D7GA 3RXIA 2C3SA 4RKJB 3UOUA 1VJAU 1DSTA 4X0WU 2VJ1A 5E2OA 1F5KU 1OYQA 2OC0A 2HALA 1O2VA 1A5GH 1INCA 4UFFH 3TK6A 5L6NH 3M5OA 1G9IE 2ZG0H 1YPEH 4GUXA 4MNVA 2F91A 1CBWB 3A7VA 1SGPE 3KHVA 3F9GA 3MU5A 5EQSA 1AHTH 1KXDA 3K65B 3KF2A 1K1OA 3P8GA 1QA0A 4CRCA 1C1OA 2TGPZ 4XE4A 1UK2A 1N8OB 4ABHA 4AFQA 1MTWA 1Z7KA 1O2RA 4XFQA 2P95A 4GHTA 4X6MA 1OWIA 2OTVA 3LGTA 1FONA 2UUYA 1GL1A 1P3EA 1W13U 1HJAC 1O3MA 1A3BH 1N8OC 1ELAA 4X2VA 4ZXXH 1BUIA 3RUOA 5DP4A 3M5LA 1J8AA 3T29A 1TOMH 3BTHE 5GCHG 2NWNA 1DLEA 3SV2H 2P3TB 3PM3A 1O2TA 3ZVAA 2PTCE 1GJCB 2AERH 5A8ZA 4LZ4B 3ENSB 1C5QA 1C1RA 1PPZA 4FVBA 4NZQA 3RXBA 1Z8JB 1H9HE 1WOFA 4AFZA 1BJVA 2AGGX 1LHEH 2BXTH 1RD3B 5LH8A 1WQVH 4LZ1H 5J4SA 1BBRE 1HAVA 3EA9A 1FY3A 1ETSH 5TCAA 1GI8B 1EAWA 1TRMA 1KTTB 5F8XA 3TJVA 1P0SH 1GJ8B 3S0NA 2A5KA 2BVXH 1C5WB 1T8NA 5EGMA 2TIOA 3PLBA 1KY9A 3EYDA 1G2MA 1YYY1 4X1NU 3W94A 1RTLA 1QRXA 3GCTF 4AB8A 1TGSZ 2F9VA 4NIVA 5E0GA 2BDHA 4WMDA 3RXRA 1FY5A 4VGCB 3STJA 1G3DA 1QB1A 3GDUA 3RXKA 4GCHF 3RLYH 1DSUA 4LXBH 2ZCHP 1ZPBA 4AGJA 4ZKNU 1HB0B 1SBWA 3NKKA 3A86A 1VGCC 1QY6A 1D3TB 2PSYA 1W2KH 2ZFFH 2J95A 4MG3A 1A2CH 4AFUA 1P06A 4ISNA 1EPTC 3RXFA 2R2WU 1D3PB 1UTPA 1O3AA 4D9RA 5A8YA 3RXHA 1AO5A 4X8TH 1Z1JA 1L1JA 1EUFA 1GGDC 3TGJE 1Y3WA 1C2EA 3K6ZA 2XTTB 2QYIA 3P8OA 1AE5A 1UTOA 6ESTA 5E2PA 3BG8A 1Z6EA 4LOYH 4OGXA 5LGOA 1TPAE 1BOQA 5EOKA 3QWCH 1Z1IA 1EZQA 1RTKA 2OXSA 1FUJA 3A88A 3BG4C 2PUQH 2ZECA 2HOBA 4RSPA 3R3GB 2GVFA 3SO3A 3H7OA 4NIXA 1O3NA 1OPHB 2PW8H 1HAOH 3TIUA 2AEIH 1YPGH 2C8ZB 4F49A 1UVPA 4A92A 2D8WA 1S6FA 1SGNE 4UONA 1C2LA 5LPRA 1J17T 5TCCA 1YP9A 1UTLM 3L6PA 3P70B 1QHRB 4Y79A 3H5CB 1LHGH 4BOHA 3QTVH 3UFAA 1K1MA 1UMAH 2UWLA 1C9TA 1E37B 5C20A 2W3KA 4I8HA 2ZHEH 5DJ7A 2QN5T 3C27B 2WUBA 3LGYA 1C1TA 1DS2E 2VVUA 1GMDF 2ZHWH 1C1WH 2B9LA 5EXMA 4MVNA 3SZNA 4AN7A 2ZU1A 1V2QT 1ZSJA 1V2JT 1C5MD 1PYTC 1VCWA 1WYKA 3M7TA 4X6PA 3SV9A 1Q31A 3LPRA 2YNBA 1GHZA 2KAIA 1AWFH 2FDAA 4K8YA 1HFDA 5HXFA 3M5NA 3A8BA 4Q7YA 2TBSA 1MTSA 1ZRKA 2XNIA 3PWBA 5L2YH 1GJDB 2D2DA 2XC4A 2H2ZA 1L1NA 1C5UA 3ZZ6A 1C1PA 4ZAEA 1EOLA 3SJ8A 2ZFTA 2PKAA 2ZDKA 1T4VH 5C1UA 4DT7B 1O2IA 2R3YA 3UPEA 3NWUA 2QV1A 2RG3A 1QRWA 3BF6H 2QXHA 2SGEE 3EDXB 1GBFA 3RXCA 2JETB 1O2NA 4MQAA 3MTYA 1LHDH 1TE0A 1FMGA 1OWHA 1Q2WA 2CJIA 1BHXF 5BRRE 3GY6A 1CGJE 3A87A 1G2LA 1GI7B 1XVMA 1DY9A 5GPIB 1V3XA 3I78A 1BTPA 1ORFA 2GGVB 5AFZH 2A0QB 1O5EH 3QN7A 3ESTA 1A0HB 1T8MA 4ABIA 1GMCG 1SLWB 1ARBA 1TONA 4X2WA 3DD2H 1TNIA 1LDTT 5E8EH 2BD2A 1HAYB 4DJZB 4YOJA 2DUCA 1FLEE 2TRMA 3AW0A 1NU9A 3TJUA 2BD3A 1N6YA 1P04A 1XUHA 2A7HA 3SU4A 3SV8A 5SGAE 2JH5D 4CHAB 1SFQB 1Y5BT 1FIWA 4DCDA 1LTOA 2ZC9H 2BX3A 1B0FA 1EJNA 2A2QH 2VGCC 1QJ7B 1CT0E 3OX7U 3U8OH 4O3UA 2AYWA 2V3OH 1EB2A 1QBVH 1GJ7B 2Z9JA 1GPZA 3BIUH 2G51A 4LK4A 2GCHF 2H9TH 1DICA 5FXLA 4TY7A 3DFJA 2F9UA 1UO6A 1D3DB 4ZHLU 4IBLH 2R0LA 1PPGE 5DP5A 4ABBA 3PLKA 1C2JA 4AORA 1G37A 2ASUB 1UTJA 1O3OA 4WH8A 5F8ZA 4ZMAH 1CHOF 5L30H 1O2WA 4BAMB 1Y3YA 2OINA 1NRPH 2ULLA 2YNAA 1SHHB 1ZMNA 2OQUA 2ZGJA 4NA9H 4NA8A 1XKAC 1LPKB 3UNQA 1ESBA 1YCPM 2C8WB 1GBKA 4YTAA 5ETXA 4JZDH 1EOJA 3KN2A 3NPSA 1ZGVA 3UQOA 1GG6C 3T62A 1IOEA 2XXLA 1KXAA 3ODDA 1UK4A 1MCVA 3HGNA 3CP7A 2BM2A 2CHAC 5H4IB 3R0FA 7KMEH 1RIWC 1OWDA 5GJ4B 3M36A 1AD8H 1BIOA 1OYTH 1J14A 3KQEA 1ZOMA 2PKSB 3BTFE 2BMGB 3KIDU 3ZV9A 4OS1A 1OKXA 3GCTG 4ABGA 1KTSB 3MNSA 4JCNA 1C4Y2 1GJAB 1AU8A 1LQDB 4DOQA 4DGJA 1SOZA 4JMYA 4GCHG 1ANEA 2BDGA 2GZ7A 3UTUH 2AMQA 4XDEA 2BY6X 3VGCB 5FCRA 1P01A 3E1XB 5IDKA 1WUNH 1GMHF 5A09A 1DFPA 3V13A 3SJOA 4B2BA 2VVCA 1BTUA 3ZVFA 2FOGA 1EP6A 2A4GA 1V2NT 2ZDAH 2ZPQA 1V2ST 2ILNA 4JYTA 4ZXYH 7GCHF 3MO9A 3Q3XA 4Q80A 3UNRA 2PV9B 3KQCA 1IQGA 3AASA 1Z8GA 2C4FH 4H6SB 1RS0A 1ZJDA 3EE0B 4Y6DA 1DE7H 1N6XA 1O2YA 1GJ6A 3TK9A 1XX9A 4IMZA 1EP5A 2HPPH 2A31A 1HAIH 1JIMA 1KDQB 4JZFH 5CMXH 1H9LB 1W14U 1O39A 1SQAA 2HPQH 3HK3B 3TK5A 1UHBB 1MTNB 4K2YA 2EA3A 1HPGA 1ZHPA 1GBDA 4UD9H 2XBVA 1BT7A 3MU0A 4FUHA 1C5RA 4CRBA 3VB7A 3F9FA 4KTSA 5DK1A 4GVUA 1G3BA 2Y82A 1RXPA 1AB9B 1F7ZA 3LGWA 3ITIA 1O3IA 1XXFA 2FWWA 1BMNH 1OWKA 3QTOH 1W0YH 1GWAA 1MUEB 1J16A 1PQ7A 2C8YB 3M5MA 1C1SA 1O5FH 1O3EA 3JZ1B 4BAQB 3HGPA 5GXPA 1O3FA 2XC0A 3SNCA 1HCGA 2OC8A 3Q77A 1P11E 2DE8A 1GMDG 1E38B 2PUXB 1O3GA 1V2LT 2EI8A 3G01A 4SGBE 4YM9A 2VIVA 2XCFA 4JYUH 5HGGA 4CH8B 1EKBB 2BZAA 2VH0A 1EAXA 2ZZUH 1QL8A 1AWHB 2ZDVH 1E35B 1Y3UA 1NM6A 1WAYB 2J92A 1HAPH 2EI6A 3B8JA 2FTMA 2PGBB 4FU9A 1O2OA 5AVDA 4E7NA 1TMUH 4Q7XA 3OTJE 1MTVA 2R0KA 4JYVH 4R8TB 3BEIB 1RJXB 4YLUA 1OSSA 1QGFA 5C1XA 2SNWA 3RC6A 2B5TB 3I29A 5EW1H 4XOJA 3CENA 4ISLA 3UY9A 3GYLB 4CRDA 4GPGA 5HYOA 1Z8RA 1TX7A 4K60A 4O3TA 3BTGE 4I33A 2P94A 5K0HA 5DPAA 3CS0A 2G55A 1H4WA 1HAVB 4AX9H 1KXCA 3TNTA 2H9HA 1EJMA 2FOFA 1ZMJA 2VU8E 6CHAB 1GCDA 1ZR0A 2QIQA 5JBAS 3LH1A 4Y8ZA 3PTBA 3SN8A 2C8XB 1GJ9B 1FJSA 3SNDA 2W7UA 2ZCLP 1B7XB 5EG4A 5F03A 3S9CA 1BRCE 1MBQA 5DG6A 1ZTKA 1QBOA 2Z3EA 3SNAA 1UVSH 3D23A 3RU4T 1A46H 1PQ8A 1TPSA 2ZU4A 4Y7BA 2OQ5A 4FUGA 4IW4E 1BRBE 2ZEBA 1AI8H 1LMWB 2BLOA 2PLXA 4DURA 5JYIA 2OCVB 1LQEA 3RU4D 5DP3A 1XXDA 1BMLA 3BTEE 3SUFA 2P16A 3HKIB 4Q2KA 1O2XA 4UFGH 3UWJH 3E8LA 1ARCA 1Y8TA 2ZIQH 3DA9B 3MH7A 2NU2E 1TABE 3OY6U 3SUGA 3LC3A 4FU8A 2GCHG 4X1SU 1O3KA 3E90B 2G5NA 1P09A 2WPHS 1IQNA 2Y80A 4J1YA 2BVRH 1AVWA 5TJXA 4YZUA 1K9OE 3GY8A 3VB4A 3ATWA 1LVMA 4H4FA 3VXFH 1NU7B 4O03A 2EC9H 1JWTA 1CHOG 3MU8A 3MFJA 2FO9A 4YT6H 1UTKA 1K2I1 1OX1A 2FLBH 1EXFA 2AS9A 9ESTA 1W10U 1ELTA 1L1GA 3LU9B 2A7CA 3GICB 4R0IA 1A5HA 4NGAH 1HBTH 4SGAE 1F0UA 2ZP0H 2P8OB 1Y3VA 1RTFB 1YBWA 2OC7A 1F0TA 2VWLA 4I8GA 2RDLA 2ODQA 1NTPA 1AFEH 3EA7A 1IQHA 5A0AE 1CBWC 4UFDH 4OS5A 1XM1A 1SPJA 1BTZA 3MYWA 2WYJA 3GCHB 1YCPK 2O8WA 1YPHE 1CA0B 1ZPCA 3A85A 1NS3A 1QJ6B 2GV6A 2H9EH 3K2UA 3QGNB 3QGJA 2Z3CA 3RXUA 2BD4A 2GCTB 2XWAA 5ESBA 2W26A 2XYAA 5E0HA 4ABAA 2VWMA 2FXRA 2GKVE 4ZHMU 1UVTH 5BPEA 2PHBA 1A0LA 1SB1H 4Y0YE 4D7FA 2KAIB 4E06H 1W11U 1JRTA 3IWMA 2GCTC 1TRNA 3Q3YA 4D8NA 1VITF 1YCPH 2THFB 1AVGH 2J4IA 2ZTYA 3SW2B 1GMHG 1BTWA 4U2WA 1ELEE 1MTUA 2V6NA 1V2VT 1ELCA 2HNTF 1FN6A 7GCHG 1B5GH 2ODYB 2HVXA 3RXEA 1P57B 3NZIA 2PKAB 1GBLA 1SI5H 2BYAX 2RA0A 1OP8A 3QLPH 1ANBA 1IQJA 1P2OA 4OS6A 4XBCA 4KGAA 2H5DA 4K69A 1DXPA 1YF4A 3B23B 2LNCA 1YPHC 5L2ZH 3GDSA 1PQ5A 2ZTXA 1ZGIA 4WH6A 2GZ8A 3TH3H 3ZZCA 3ZVDA 1AFQB 1C2IA 1O2GH 3A7WA 4X1QU 1G30B 1BZXE 3ATKA 2GD4B 5DP7A 1AKSB 2BQ6B 1F2SE 4PROA 3A8AA 1AE8H 3ZZ4A 4H6TA 2Q6DA 2P93A 3BV9B 4VGCC 5AFYH 1W0ZU 3BTKE 1SMFE 2IOTA 2ZF0H 1TA6A 4RN6A 5IYTA 2VWOA 4BAHB 4WMFA 1V2KT 1LHFH 2WPMS 1THSH 1P2NA 1EAIA 1ELDE 4F4OC 1LVYA 1Q3XA 1YPMH 3U69H 1WU1A 3A7YA 3NCLA 5JB8S 1KLIH 3BTQE 1XUIA 1GHXH 3OSYA 3LIWA 1G3CA 3NK8A 2G81E 1MZDA 4FUFA 4NIYA 1ZTJA 1KLJH 2FOEA 3V3MA 3TLOA 1O38A 1NRNH 4MNYA 1S0QA 4ISHH 4CBNA 2ZHFH 4IN1A 3RM2H 5EW2H 1HJ9A 6GCHF 1D6RA 1DM4B 1GHWH 5JBTA 1GVKB 2WPLS 1GI6A 1MH0A 2AMPA 3SNBA 2BLQA 1GBIA 1GJBB 4MLFB 3BEUA 3BEFB 2G5VA 5DP9A 1YGCH 4Q7ZA 2UUFB 3SGBE 1DITH 3PLPA 1A0JA 3ATMA 1AN1E 5DKMA 1SGTA 1C5NH 1IQMA 1C5OH 2XCNA 3E6PH 3GDVA 3TITA 1QNJA 1AQ7A 3U8RH 1AY6H 2ZNKH 4NSYA 2O8TA 1CGIE 2WPJS 2BVSH 2QY0B 1TNJA 1A4WH 3VB6A 3M3TA 5HM2A 1IQLA 1MKWK 1ZLRA 3GY7A 1G36A 1HXFH 1YPKH 1QFKH 3ZZ9A 1TFXA 3H7TA 2WV4A 3C1KA 1OP0A 1C1VH 2VIPA 1HIAA 1MMJN 1W8BH 4IC6A 1BB0B 1QL9A 3BTDE 2TGAA 1FY4A 1C5SA 3LGUA 5C5NA 2VWNA 1QURH 3B9FH 3SJIA 1BITA 4X2YA 4JZEH 2XC5A 3VPKA 4UE7H 1O3BA 1IQFA 2BB4A 1MKWH 2XBXA 2QAAA 3MMGA 1GBHA 3FZDA 5T6DA 2GMTB 4I31A 5E0JA 1EATA 3RXMA 1P9SA 1NZQH 3TU7H 3RXOA 3E3TA 1V2PT 3HKJB 4CH2B 1Y5AT 2GMTC 2JETC 4B2CA 2HNTE 4NSVA 2PSXA 3D49H 1QL7A 3SU5A 3TGIE 6LPRA 1O0DH 1GBEA 2HLCA 3P95A 3GYMA 2EI7A 3M3SA 1V2OT 1ZRBA 3A7ZA 5EQQA 1BMAA 2ZFRH 2ANKH 8ESTE 3F68H 2HGTH 3E0PB 4ZHAA 3T27A 3QK1A 1PJPA 2JKHA 1J15A 4XBBA 3L33A 3NUMA 1EPTA 1QBNA
chains in the Genus database with same CATH superfamily
1O3PB 1FPHH 2G4UA 2OLGA 4THNH 1O31A 4WY3A 1DWEH 2QF3A 2KCOA 4AG1A 1SGRE 2FP7B 3ZZBA 1BRUP 1C5PA 1KYNA 1V2MT 1GI0A 2ZO3H 4KP0A 1MZAA 4K3JA 4CHAC 1AVXA 1V2TT 3OEHD 1T32A 3DUXH 1BBRK 3EAJA 3F9HA 2Y5FA 4NWKA 2WZQA 2HNTC 2GX4A 5FX5A 3OU0A 1JIRA 1VR1H 1J9CH 5A8XA 3RXPA 1LPZB 2F9NA 1SSXA 4OS2A 1LKAA 1QB9A 4MDSA 3MNBA 3MO6A 8KME2 2W3IA 1GI2A 3ATLA 4CRAA 2D1JA 4K8BA 3ZVBA 4AFSA 4CRGA 3DFLA 2FS9A 5C67A 1OWEA 2STAE 4AG2A 2BD9A 1FXYA 3RMMH 1P2QA 3GISB 1TBZH 5I25A 2FOAA 3Q00A 1CT2E 1GHYH 2AMDA 4TPIZ 4A1VA 1C1UH 1KLTA 3UOPA 1ESAA 1VITG 1QCPA 3TH4H 4E7RG 3E16B 1HYLA 2IJOB 1C2HA 3BSQA 1TAWA 1FPCH 4GHQA 1C5YB 3KL6A 3SOSA 4ABFA 3TH2H 3ZZAA 1HRTH 1VZQH 2FM2A 2F83A 1DANH 2FEQH 4FUDA 1FAXA 2BDCA 5ESTE 5JB9S 4DIHH 3FP6E 1H1BA 3FP7E 4WXIA 3Q3KA 1K0HA 4Y71A 3UWIA 1E36B 1MBMA 2ANYA 2Z9LA 1TIOA 3RXVA 4BANB 1GBJA 2PKSC 1SQRA 1UTNA 3RC4A 1SGCA 3ZZ7A 4KKDA 4CRFA 2A4QA 2NU0E 1P2KA 3PV4A 3ODFA 5EXNA 2XNDD 3FANA 4TWWA 1C2GA 2G4TA 1H8ED 5C3NA 1NRSH 1PPHE 1YLNA 3VGCC 1FQ3A 4B6FA 1F92A 2WYGA 1SGDE 3F0OA 2AIQA 3RDZA 2B7DH 3MH6A 3A7TA 1SKYE 3RU4E 4OM9A 2AIPA 5DP6A 2BZ6H 5FX6A 3ZYEA 1H9IE 1O3DA 3NXPA 2W5EA 2Z94A 3DHKH 4A1TA 4CR5A 2F9PA 1DWDH 2AH4X 1CO7E 3IG6B 1FAKH 3A81A 4AGKA 2UWPA 4YLQH 1E1QD 1N1LA 2FLRH 1ZHRA 1BTYA 1T4UH 1O5GH 2BXUH 4I32A 4BTIB 1ZMLA 1MKXK 1GBMA 1EQ9A 6GCHG 2O8MA 2CXVA 1MTNC 2B0FA 5I46H 4DW2U 1A3EH 4IGDA 3UB0A 1ELBA 1C1MA 2L6OA 1ELGA 3IITA 2ZGXH 1BA8B 1S5SA 1WTGH 1JOUB 2ODPA 1JMOH 3AVZA 3S7KB 1EAUA 2LPRA 3SI3H 4BAOB 2J98B 1AB9C 1QJ1B 5A2MH 1GBAA 2GV7A 1LCYA 4A6LA 1OP2A 2G00A 4H42U 5EJ1A 1DWCH 2OC1A 5T3HA 2AGIX 3LGVA 3L3TA 1MU6B 1MD8A 2UUJB 3LT3A 1IQIA 4F55A 1BJUA 1O35A 3F2FA 1NRQH 3MU4A 1O2UA 2C93B 5AHGH 3RXDA 1DX5M 2ZFPH 3MWIU 4HZHA 2CN0H 3PO1B 1GL0E 1SQTA 5DN6D 3OY5U 1WV7H 3UIRA 4KELA 4INKA 2H1UA 1SGEE 4NG9H 1XMNB 3O8RA 3Q76A 4BXWA 2ZGBH 2PGQB 1C2MA 1JXPA 1GHBF 3PMBB 1Z6JH 1E34B 2GT8A 3ZZ3A 2V0BA 1AGJA 4WXVA 1O3JA 3ATIA 1V2WT 4ZUHA 1O33A 2QXGA 3KQBA 3MHWU 1DPOA 2JH6D 3U8TH 1K1JA 3D62A 1QRZA 3SNEA 4Y0ZE 3FO8D 2CGAA 1V2UT 3T26A 1GI5A 3A89A 2Z3DA 2H5CA 3LONA 2H6MA 1ETTH 3GY2A 2A2XH 1FY1A 3FAOA 2ZKSA 5FPYA 5FHTA 4RKOB 3VFEA 3KQDA 4ZKSU 2F3CE 3UR9A 1P2IA 2A1DB 4E05H 1BTHH 3VB3A 6CHAC 3F2GA 2ZA5A 1GI3A 4MPUA 1SLUB 3SI4H 3SYJA 2ZPRA 3SHAH 1L4DA 2BY8X 2FODA 2JH0D 1KXEA 2IN2A 2ZFQH 1TBQH 1SHYA 1GBTA 1JBUH 1O3HA 1YPLH 1SGYE 2J34A 4YO9A 2KZ4A 1E79D 3LJOA 3ZYDA 8GCHF 1FN8A 1THPB 3HK6B 3SBKA 1MQ5A 1NO9H 3SGAE 2FTLE 1ZYOA 1D3QB 1ETRH 2FOHA 5DP8A 3U98H 3F3BA 3D65E 2NU4E 4MTBA 2BOKA 5DSFA 3U1JB 1TWXB 5GIBA 3UR6A 1UVOA 1S85A 3GY4A 5F8TA 4UFEH 4Y8YA 2TGDA 5A0BA 3LJJA 5FL7D 5C1YA 1SGQE 2OD3B 1UTMA 3BTWE 1SL3A 5FBIA 2FX4A 2JDID 3A84A 2XBWA 1BCUH 1ANDA 1UHBA 1LVOA 2Z9KA 1ZTLA 1P12E 2FESH 3BTME 4MNXA 2FOCA 1C2KA 3A8DA 1GDUA 1SR5C 4K1EA 4B73A 5B6OA 4HTCH 1IHTH 1A1RA 3KEEA 3OAAD 2O8LA 2PR3A 4KTUA 4BTTB 2RCEA 2HRVA 2OP9A 1TOCB 4Z0KA 2KCYA 1HUTH 1NRRH 2BHGA 3AK5A 1THRH 2YOLA 1FY8E 1DWBH 1H8IH 1K21H 1O3LA 1UVUH 5FCKA 5A0CA 2WPKS 3PYHA 1XUFA 1CA8B 1AUTC 3N7EA 3W95A 2G8TA 1NN6A 3PB1E 1HGTH 1LHCH 2SFAA 2WV5A 2BX4A 4A1XA 2A4OA 1A7SA 1UTQA 4D76A 1YY3A 1DUAA 3N99A 4X6NA 1EJAA 1O2MA 1SG8B 3STIA 2AGEX 2P8OC 3VEQB 3M35A 3TJNA 1K1LA 2FMJA 1XUGA 1S83A 1XUJA 4ASUD 2W6ID 4JK5A 4Q63A 4INHA 2CF9H 3O8BA 2FOBA 2ZDMA 1HJAB 3MNCA 4NFEA 1TYNA 3SJKA 2QCYA 5HMAA 2EEKA 2VIOA 1UJ1A 4AB9A 3GCHC 3TNSA 3E0NB 4OGYA 1CA0C 2VVVA 1C1QA 1HJ8A 1TRYA 1UCYK 1G3EA 1SQOA 2KCPA 1YC0A 3N7OA 3VXEH 4BAKB 5FAHA 1T31A 1NESE 2XBYA 1C4V2 4BTUB 1MABB 4Z6AH 1ZSLA 1LPGB 1TGBA 1HIAB 4Y7AA 2VBCA 1QR3E 1W12U 1W3CA 4XBDA 1ANCA 1HAXB 4NIWA 2LP6A 2QXIA 2BD7A 5T6FA 5DO4H 3O8CA 4JZIA 4CREA 1UCYH 5EXLA 5EPYA 3M7UA 1H8DH 2J97A 3SU2A 2PP6A 4OS4A 3URDA 4YESB 4B1TA 1KXFA 2Y7ZA 2B8OH 3BTTE 2Y5HA 4ISIH 1DLKB 1HDTH 1LO6A 4FUCA 1G32B 2CV3A 1XVOA 2P59A 3RXQA 1AIXH 2VIWA 3SV6A 5G4BA 2BY5X 3SJ9A 2ZPSA 1D4PB 2VNTA 3KCGH 3M37A 2ZDNA 1O5BB 1S82A 2ZU2A 3P92A 2ZDLA 1TQ7B 1AFQC 1IQEA 1GI4A 1ABJH 1S0RA 4DG4A 4B75A 1VGCB 5JBCS 1PFXC 1Z8IB 1EPTB 2I6SA 2O9QA 5FPTA 2ZQ1A 4ESTE 2L74A 4CBOA 3SU6A 3SUDA 1SC8U 1W7XH 3T2NA 3S7HB 1P05A 1GGDB 1T8OA 3PMAB 4Y11E 1RRKA 3QUMP 2Q1JA 1CQQA 5CHAB 1C4U2 1D9IA 2BDIA 3PWCA 4HFPB 1K28D 4UDWH 5EQRA 4TY6A 1RGQA 4MPWA 3T5FH 2TPIZ 2DE9A 1MD7A 3FVFB 1P8VC 3BG4B 1T8LA 2PTNA 4U01A 7ESTE 1ZJKA 1TGNA 3FZZA 5CHAC 5JDUB 5KEDA 5LPFA 1PPFE 2CMYA 3MU1A 1QQ4A 2R2MB 2F9BH 4U30A 3S9BA 3QZRA 1SGIB 3RXAA 4WF8A 1ESTA 1HAZB 2GP9B 1F0SA 4I8JA 2J94A 3A80A 1TALA 1BQYA 1E0FD 1EX3A 4IMQA 1GDQA 4RI0A 3MO3A 3RM0H 1O5DH 5IK2D 2ANMH 3HATH 5F6MA 3SHCH 3A83A 4GAWA 4B74A 1C9PA 2ZI2H 3PMJA 1GHBG 1QB6A 1ZSKA 3ZIAD 3SQEE 2Q6FA 1MCTA 3RXSA 1GJ5H 1ZZZA 2ZU3A 5CE1A 1PPCE 4AYVB 2Z9GA 1C5VA 3JZ2B 1NC6A 3PV5A 3RP2A 4ABJA 1WSSH 1K1PA 4MPVA 3GOVB 4DVAU 1CSOE 2WINI 3UUZA 1K1IA 5T1VA 1AZZA 2XWBI 4YOIA 1CE5A 4U32A 1EB1H 3QX5H 4K1TA 4B76A 2BOHB 2F9OA 1A61H 4TT3D 1XUKA 2D26C 1AZ8A 4NFFA 1GHAF 4NWLA 3S9AA 2VIQA 2WPDD 2J2UA 5EIYA 2QXJA 3MOCA 2FOMB 1D6WA 3MQKC 1SFIA 1IQKA 3SUEA 2VH6A 8GCHG 4DIIH 1BDAA 4FUIA 2XW9A 3EGKH 4I8KA 5LPEA 3V7TA 1O2KA 1UK3A 3FFGA 2A7JA 2IPQX 3ZZ5A 2K0QA 2BQ7B 2GT7A 5HIYA 1O2JA 3AW1A 4ZKOU 2FIRH 4FXGH 5ABWA 4HI3A 3E91A 2AFQB 2CF8H 4IN2A 2I6QA 1NROH 4X1RU 1W7GH 2M5TA 2Y7XA 3BIVH 4X2XA 2Y81A 4XSKU 1QQUA 1WCZA 3MNXA 1RFNA 4KTCA 1C5TA 1AKSA 2O8UA 1TNLA 2J5UA 1L4ZA 2FX6A 2G52A 4WVPE 5C2ZA 1TA2A 2SGPE 2EY4C 1NFWA 1ELFA 1ZHMA 1CVWH 1P2JA 1F0RA 3LH3A 3SORA 3ZV8A 2RA3A 1X7AC 2ZGCA 1MU8B 2SGDE 1S84A 4AYYB 1DOJA 1BRAA 1L2EA 3TGKE 1F5RA 4J2YB 3GY5A 2K1QA 1U6QA 1FNIA 2VGCB 1O30A 2WPIS 5JBBS 4A7IB 2ESTE 1P03A 1TGTA 4Y76A 5EODA 3A82A 3WWFA 1EZXC 2VB0A 1BMMH 2Y6TA 1S6HA 4M7GA 2SGAA 3OYPA 2GZ9A 1GVLA 2EQNA 2SGQE 1OWJA 3RXTA 3MI4A 5FBEA 2SNVA 1HLTH 3A7XA 1VCQA 1SLVB 3DCLA 1PYTD 1WBGB 5EU8A 4TPYA 4B6EA 1SOTA 4ABEA 5C5OA 2W7SA 2HWLB 2GTBA 2WV9A 3MH5A 1BBRH 1W0KD 1TNGA 1OOKB 1S81A 3URCA 1TMBH 2OUAA 1P2MA 4AZ2B 3GCNA 1CU1A 4NA7A 2FI5E 3ZZDA 4K5ZA 1QTFA 1FIZA 1DT2A 1QIXB 1P10A 4QT8C 2A5IA 2FPZA 2QF0A 1TB6H 3I77A 1CGHA 4FVDA 1TPPA 3KYFA 1GCTB 4HGCA 1GG6B 3GY3A 4I8LA 4O9VA 3AAVA 1IAUA 2BQWB 1O2ZA 2ALVA 2QA9E 4AOQA 3PTNA 1O2HA 2CHAB 3AAUA 3ZVEA 1AMHA 1RIWB 3P8FA 2Z7FE 1HXEH 1GCTC 2NU1E 4B2AA 1OS8A 5C94A 2Y5GA 3LKWA 1C1NA 3M7QA 1EASA 1GBBA 2ZTZA 3DT0H 4JK6A 3SU3A 2V3HH 1O2PA 2ZGHA 1Z71A 2R3UA 2UUKB 1C5XB 3SGQE 1EZUC 3ZVGA 1A5IA 5GCHF 1C2DA 1NFYA 3HPTB 4YXWD 1MQ6A 3LGIA 5DGJA 3TJOA 4BNRA 1FI8A 4F48B 1GJ4H 1GI9B 1ZPZA 2Z6BD 1BMFD 3EA8A 4GSOA 2BLVA 3CS7A 1TLDA 4ABDA 1Y3XA 4BXSA 3V0XA 4FUBA 1FV9A 2QC2A 1TGCA 3V12A 2A4RA 1PPEE 3K9XB 1KXBA 2QGRA 1F5LA 1IHSH 1M9UA 8LPRA 4Y10E 1DY8A 3O8DA 2FI3E 2FYQA 4X1PU 1YKTA 5C0TA 2OBOA 2FS8A 1BTXA 2Q6GA 2P3FH 3RLWH 1ABIH 1TMTH 4IS5A 4IC5A 1QA7A 3UQVA 2OBQA 2ANWA 2ZCKP 1P9UA 1K22H 1YM0A 3M61U 4ZROA 3ELAH 4ISOA 1TNKA 4YOGA 2RFKC 4JZ1A 2ZHDA 3LDXH 3RC5A 7LPRA 4ZKRU 4XD7D 1O2LA 2BLWA 1TX8A 4WMEA 3P8NA 4ACAA 4X6OA 1O3CA 5K7RA 1UCYE 4X8VH 2ZFSA 3EQ0H 1VJ9U 3SV7A 2KFWA 1GI1A 1MAXA 1NT1A 4I7YH 1L0ZA 5AF9H 1DXWA 3QO6A 1VCPA 2R9PA 3U9AH 2BY7X 1SGFG 3LOXA 4MNWA 3U1IB 2BDAA 1WQSA 1WTHD 2A45B 3DSPA 1O34A 3K6YA 1CHGA 5JPMH 1SVPA 1LKBA 1MKXH 4X8SH 1GVZA 1O37A 3RXJA 2P3UB 1O36A 4FUJA 4TWYA 3BN9A 2C90B 4X8UH 1KMHB 3RXGA 3UNSA 4B71A 4NCYA 4XRNA 2TGTA 1ELVA 1YLCA 1KIGH 2A32A 2BTCE 1ID5H 1YPJH 2BDYA 4ZH8A 3F2HA 2VINA 1MAYA 4FOUC 3T28A 1BHXB 3QZQA 4YT7H 3VB5A 4TYDA 2IPHA 1ACBE 3SU1A 1K1NA 1HAGE 2AHME 2GDEH 2SGFE 3WY8A 3F9EA 3ZZ8A 3PO1C 3P17H 1DDJA 1NY22 5EPNA 3SU0A 1GHAG 1SLXB 2PFEA 1NFXA 1V6DA 2XRCA 1TQ0B 1VITH 2BD5A 3MH4A 1C5ZB 3A8CA 1OXGA 3PROA 2J9NA 4A5TS 1FDPA 4NZLA 2ZWLH 1JRSA 3T25A 4UEHH 4O97A 1GHVH 2BY9X 2QF5A 1HNEE 3DSGA 3KGPA 4Y8XA 4WWYA 3TVJB 2A5AA 5J4QA 2NU3E 1YLDA 1LVBA 1FZZA 4DY7B 5T6GA 5HM9A 2FZZA 4D9QA 1O5CB 3SQHE 4CR9A 2STBE 1PQAA 4INLA 2VIDA 1B0EA 5PTPA 3P6ZB 1DUEA 1PPBH 1DVAH 1TPOA 1Y59T 3RXLA 9LPRA 3F6UH 2FI4E 2J38A 3RMOH 1O2QA 1HV7A 2FYRA 1GDNA 3M3VA 3WWBA 3KNXA 1P3CA 1TNHA 1Y5UT 5GWZA 4WJG2 1O5AB 4GLYA 1T7CA 3UREA 2ALPA 1SGFA 2WUCA 2ZQ2A 4FU7A 3LC5A 1CT4E 1TBRH 2ZHQH 3FP8E 5FPSA 2PWXA 4OS7A 1AUJA 4K1SA 2UWOA 2KM0A 3F1SB 1WXRA 1KSNA 2BDBA 1C2FA 1O2SA 2BD8A 4FUEA 4RT1A 2V35A 1C5LH 1GBCA 1TX6A 1XKBC 3EE7A 3QDZB 3RMLH 5GDSH 1HAHH 1KDQA 4ASHA 1NFUA 1V2RT 3GCOA 1O32A 3PMHB 1NPMA 1P02A 4MPXA 2GDDA 3RMNH 2Z9IA 3TPIZ 2ZU5A 3ZVCA 3S69A 1EZSC 1GMCF 4D7GA 5EJZA 3RXIA 2C3SA 4RKJB 3UOUA 1VJAU 1DSTA 4X0WU 2VJ1A 5E2OA 1F5KU 1OYQA 2OC0A 4HG6A 2HALA 1O2VA 1A5GH 1INCA 4UFFH 3TK6A 5L6NH 3M5OA 1G9IE 2ZG0H 1YPEH 4GUXA 4MNVA 2F91A 1CBWB 3A7VA 1SGPE 3KHVA 3F9GA 3MU5A 5EQSA 1AHTH 1KXDA 3K65B 3KF2A 1K1OA 3P8GA 1QA0A 4CRCA 1C1OA 2TGPZ 4XE4A 1UK2A 1N8OB 2KX4A 4ABHA 4AFQA 1MTWA 1Z7KA 1O2RA 4XFQA 2P95A 4GHTA 4X6MA 1OWIA 2OTVA 3LGTA 1FONA 2UUYA 1GL1A 1P3EA 1W13U 1HJAC 1O3MA 1A3BH 1N8OC 1ELAA 4X2VA 4ZXXH 1BUIA 3RUOA 5DP4A 3M5LA 1J8AA 3T29A 1TOMH 3BTHE 5GCHG 2NWNA 1DLEA 3SV2H 2P3TB 3PM3A 1O2TA 3ZVAA 2PTCE 1GJCB 1YWUA 2AERH 5A8ZA 4LZ4B 3ENSB 1C5QA 1C1RA 1PPZA 4FVBA 4NZQA 3RXBA 1Z8JB 1H9HE 1WOFA 4AFZA 1BJVA 2AGGX 1LHEH 2BXTH 1RD3B 5LH8A 4Q4LA 1WQVH 2F43B 5J4SA 4LZ1H 1BBRE 1HAVA 3EA9A 1FY3A 1ETSH 5TCAA 1GI8B 1EAWA 1TRMA 1KTTB 5F8XA 5KECA 3TJVA 1P0SH 1GJ8B 3S0NA 2A5KA 2BVXH 1C5WB 1T8NA 5EGMA 2TIOA 3PLBA 1KY9A 3EYDA 1G2MA 1YYY1 4X1NU 3W94A 1RTLA 1QRXA 3GCTF 4AB8A 1TGSZ 2F9VA 2F4LA 4NIVA 5E0GA 2BDHA 4WMDA 3RXRA 1FY5A 4VGCB 3STJA 1G3DA 1QB1A 3GDUA 3RXKA 4GCHF 3RLYH 1DSUA 4LXBH 2ZCHP 1ZPBA 4AGJA 4ZKNU 1HB0B 1SBWA 3NKKA 3A86A 1VGCC 1QY6A 1D3TB 2PSYA 1W2KH 2ZFFH 2J95A 4MG3A 1A2CH 4AFUA 1P06A 4ISNA 1EPTC 3RXFA 2R2WU 1D3PB 1UTPA 1O3AA 4D9RA 5A8YA 3RXHA 1AO5A 4X8TH 3U28C 1Z1JA 1L1JA 1EUFA 1GGDC 3TGJE 1Y3WA 1C2EA 3K6ZA 2XTTB 2QYIA 3P8OA 1AE5A 1UTOA 6ESTA 5E2PA 3BG8A 1Z6EA 4LOYH 4OGXA 5LGOA 1TPAE 1BOQA 5EOKA 3QWCH 1Z1IA 3KQ5A 1EZQA 1RTKA 2OXSA 1FUJA 3A88A 3BG4C 2PUQH 2ZECA 2HOBA 4RSPA 3R3GB 2GVFA 3SO3A 3H7OA 4NIXA 1O3NA 1OPHB 2PW8H 1HAOH 3TIUA 2AEIH 1YPGH 2C8ZB 4F49A 1UVPA 4A92A 2D8WA 1S6FA 1SGNE 4UONA 4P00A 1C2LA 2V7QD 5LPRA 1J17T 5TCCA 1YP9A 1UTLM 3L6PA 3P70B 1QHRB 4Y79A 3H5CB 1LHGH 4M9FA 4BOHA 3QTVH 3UFAA 1K1MA 1UMAH 2UWLA 1C9TA 1E37B 1COWD 2W6JD 5C20A 2W3KA 4I8HA 2ZHEH 5DJ7A 2QN5T 3C27B 2LELA 2WUBA 3LGYA 1C1TA 1DS2E 3H09A 5KGOA 2VVUA 1GMDF 2ZHWH 1C1WH 2B9LA 5EXMA 4MVNA 3SZNA 4AN7A 2ZU1A 2M2AA 1V2QT 1ZSJA 1V2JT 1C5MD 1PYTC 1VCWA 1WYKA 3M7TA 4X6PA 3SV9A 1Q31A 3LPRA 2YNBA 1GHZA 2KAIA 1AWFH 2FDAA 4K8YA 1HFDA 5HXFA 3M5NA 3A8BA 4Q7YA 2TBSA 1MTSA 1ZRKA 2XNIA 3PWBA 5L2YH 1GJDB 2D2DA 2XC4A 2H2ZA 1L1NA 1C5UA 3ZZ6A 1C1PA 4ZAEA 3WW7A 1EOLA 3SJ8A 2ZFTA 2PKAA 2ZDKA 1T4VH 2KCAA 5C1UA 4DT7B 1O2IA 2R3YA 3UPEA 3NWUA 2QV1A 2RG3A 1QRWA 3BF6H 2QXHA 2SGEE 3EDXB 1GBFA 3RXCA 2JETB 1O2NA 4MQAA 3MTYA 1LHDH 1TE0A 1FMGA 1OWHA 1Q2WA 2CJIA 4Z1MD 1BHXF 1W0JD 2IJD1 3GY6A 5BRRE 1CGJE 3A87A 1G2LA 1GI7B 1XVMA 1DY9A 5GPIB 1V3XA 4ACBA 3I78A 1BTPA 1ORFA 2GGVB 3PRBA 5AFZH 2A0QB 1O5EH 3QN7A 3ESTA 1A0HB 1T8MA 4ABIA 1GMCG 1SLWB 1ARBA 1TONA 4X2WA 3DD2H 1TNIA 1LDTT 5E8EH 2BD2A 1HAYB 4DJZB 4YOJA 2DUCA 1FLEE 2TRMA 3AW0A 1NU9A 3TJUA 2BD3A 4ZCNA 1N6YA 2HLDD 1P04A 1XUHA 2A7HA 3SU4A 3SV8A 5SGAE 2JH5D 4CHAB 1SFQB 1Y5BT 1FIWA 4DCDA 1LTOA 2ZC9H 2BX3A 1B0FA 1EJNA 2A2QH 2VGCC 1QJ7B 1CT0E 3OX7U 3U8OH 4O3UA 2AYWA 2V3OH 1EB2A 1QBVH 1GJ7B 2Z9JA 1GPZA 3BIUH 2G51A 4LK4A 2GCHF 2H9TH 1DICA 5FXLA 4TY7A 3DFJA 5C0UA 2F9UA 1UO6A 1D3DB 4ZHLU 4IBLH 2R0LA 1PPGE 5DP5A 4ABBA 3PLKA 1C2JA 4AORA 1G37A 2ASUB 1UTJA 1O3OA 4WH8A 5F8ZA 4ZMAH 1CHOF 5L30H 1O2WA 4BAMB 1Y3YA 2OINA 1NRPH 2ULLA 2YNAA 1SHHB 1ZMNA 2OQUA 2ZGJA 4NA9H 4NA8A 3W1EA 1XKAC 1LPKB 3UNQA 1ESBA 1YCPM 2C8WB 1GBKA 4YTAA 5ETXA 4JZDH 1EOJA 3OTPA 3KN2A 3NPSA 1H8HD 1ZGVA 3UQOA 1GG6C 3T62A 1IOEA 5B6LA 2XXLA 1KXAA 3ODDA 1UK4A 2JJ2D 1MCVA 3HGNA 3CP7A 2BM2A 2CHAC 5H4IB 3R0FA 7KMEH 1RIWC 1OWDA 5GJ4B 3M36A 1AD8H 1BIOA 1OYTH 1J14A 3KQEA 1ZOMA 5F53A 2PKSB 3BTFE 2BMGB 3KIDU 3ZV9A 4OS1A 1OKXA 3GCTG 4ABGA 1KTSB 3MNSA 4JCNA 1C4Y2 1GJAB 1AU8A 1LQDB 4DOQA 3PV2A 4DGJA 1SOZA 4JMYA 4GCHG 1ANEA 2BDGA 2GZ7A 3UTUH 2AMQA 4XDEA 2BY6X 3VGCB 5FCRA 1P01A 3E1XB 5IDKA 1WUNH 1GMHF 5A09A 1DFPA 3V13A 3SJOA 4B2BA 2VVCA 1BTUA 3GS9A 2FOGA 3ZVFA 1EP6A 2A4GA 1V2NT 2ZDAH 2ZPQA 1V2ST 2ILNA 3NRLA 4JYTA 4ZXYH 3MO9A 3Q3XA 4Q80A 7GCHF 3UNRA 2PV9B 3KQCA 1IQGA 3AASA 1Z8GA 2C4FH 4H6SB 1RS0A 1ZJDA 3EE0B 4Y6DA 1DE7H 1N6XA 1O2YA 1GJ6A 3TK9A 1XX9A 4IMZA 1EP5A 2HPPH 2A31A 1HAIH 1JIMA 3SZEA 1KDQB 4JZFH 5CMXH 1H9LB 1W14U 1O39A 1SQAA 2HPQH 3HK3B 3TK5A 1UHBB 1MTNB 4K2YA 2EA3A 1HPGA 1ZHPA 1GBDA 4UD9H 2XBVA 1BT7A 3MU0A 4FUHA 1C5RA 2K8IA 4CRBA 3VB7A 3F9FA 4KTSA 5DK1A 4GVUA 1G3BA 2Y82A 1RXPA 1AB9B 1F7ZA 3LGWA 3ITIA 1NBME 1O3IA 1XXFA 2FWWA 1BMNH 1OWKA 3QTOH 1W0YH 1GWAA 1MUEB 1J16A 1PQ7A 2C8YB 2QE7D 3M5MA 1C1SA 1O5FH 1O3EA 3JZ1B 4BAQB 3HGPA 5GXPA 1O3FA 2XC0A 3SNCA 1HCGA 2OC8A 3Q77A 1P11E 2DE8A 1GMDG 1QZ8A 1E38B 2PUXB 3FKSD 1O3GA 1V2LT 2EI8A 2XOKD 3G01A 4SGBE 4YM9A 2VIVA 2XCFA 4JYUH 3CNRA 5HGGA 4CH8B 1EKBB 2BZAA 2VH0A 1EAXA 2ZZUH 1UW7A 1QL8A 1AWHB 2ZDVH 1E35B 1Y3UA 1NM6A 1WAYB 2J92A 1HAPH 2EI6A 3B8JA 2FTMA 2PGBB 4FU9A 2JIZD 1O2OA 5AVDA 4E7NA 1TMUH 4Q7XA 3OTJE 1MTVA 2QF4A 2GJGA 2R0KA 4JYVH 4R8TB 3BEIB 1RJXB 4YLUA 1OSSA 1QGFA 5C1XA 2SNWA 3RC6A 2OK5A 2B5TB 3F0PA 3I29A 5EW1H 4XOJA 3CENA 4ISLA 3UY9A 3GYLB 4CRDA 2YMSB 4GPGA 5HYOA 1Z8RA 1TX7A 5HIZA 4K60A 1WDIA 4O3TA 5GNDA 3BTGE 4I33A 2P94A 5K0HA 2WSSD 5DPAA 3CS0A 2G55A 1H4WA 1HAVB 4AX9H 2YMSC 1KXCA 3TNTA 2H9HA 1EJMA 2FOFA 1ZMJA 2VU8E 6CHAB 1GCDA 1ZR0A 2QIQA 4I86A 5JBAS 3LH1A 4Y8ZA 3PTBA 3SN8A 2C8XB 1GJ9B 1FJSA 3SNDA 2W7UA 2ZCLP 1B7XB 5EG4A 5F03A 3S9CA 2HVYB 1BRCE 1MBQA 5DG6A 1ZTKA 2RDEA 1QBOA 2Z3EA 3SNAA 1UVSH 3D23A 3RU4T 1A46H 1PQ8A 1TPSA 2JJ1D 2ZU4A 4Y7BA 2OQ5A 4FUGA 4IW4E 1BRBE 2ZEBA 1AI8H 1LMWB 2BLOA 2PLXA 4AC9A 4DURA 5JYIA 2OCVB 1LQEA 2KR7A 3RU4D 5DP3A 1XXDA 1BMLA 3BTEE 3SUFA 2P16A 3HKIB 4Q2KA 1O2XA 4UFGH 3UWJH 3OFND 4TSFD 3E8LA 1ARCA 1Y8TA 2ZIQH 3DA9B 3MH7A 2NU2E 1TABE 3OY6U 3SUGA 3LC3A 4FU8A 2GCHG 4RT0A 4X1SU 1O3KA 5HKKD 3E90B 2G5NA 1P09A 2WPHS 1IQNA 2Y80A 4J1YA 3KYGA 2BVRH 1AVWA 5TJXA 4FETA 4YZUA 1K9OE 3GY8A 3VB4A 3ATWA 1LVMA 3DSOA 4H4FA 3VXFH 1NU7B 4O03A 2EC9H 1JWTA 1CHOG 3MU8A 3MFJA 2FO9A 4YT6H 1UTKA 1K2I1 1NBMD 1OX1A 2FLBH 1EXFA 2AS9A 9ESTA 1W10U 3UAIC 2J98A 1ELTA 1L1GA 3LU9B 2A7CA 2WHXA 3GICB 3OE7D 4R0IA 1A5HA 4NGAH 1HBTH 4SGAE 1F0UA 2ZP0H 2P8OB 1Y3VA 1RTFB 1YBWA 4DT4A 2OC7A 1F0TA 2VWLA 4I8GA 2RDLA 2ODQA 1NTPA 1AFEH 2YMSD 3EA7A 1IQHA 5A0AE 1CBWC 4UFDH 4OS5A 1XM1A 1SPJA 1BTZA 3MYWA 2WYJA 3GCHB 1YCPK 2O8WA 1YPHE 1CA0B 1ZPCA 3A85A 1NS3A 1QJ6B 2GV6A 2H9EH 3K2UA 3QGNB 3QGJA 2Z3CA 3RXUA 2BD4A 2GCTB 2XWAA 5ESBA 2W26A 2XYAA 5E0HA 4ABAA 2VWMA 2FXRA 2GKVE 4ZHMU 1UVTH 1VKYA 5BPEA 2PHBA 1A0LA 1SB1H 4Y0YE 4D7FA 2KAIB 4E06H 1W11U 1JRTA 3IWMA 2GCTC 1TRNA 3Q3YA 4D8NA 1VITF 1YCPH 2THFB 1AVGH 2J4IA 2ZTYA 3SW2B 1GMHG 1BTWA 5C17A 4U2WA 1ELEE 1MTUA 2V6NA 1V2VT 3PRDA 1ELCA 2HNTF 1FN6A 7GCHG 1B5GH 2ODYB 2HVXA 3RXEA 1P57B 3NZIA 2PKAB 1GBLA 1SI5H 2BYAX 2RA0A 3N7DA 1OP8A 3QLPH 1ANBA 1IQJA 1OHHD 1P2OA 4OS6A 4XBCA 4KGAA 2H5DA 4K69A 1DXPA 1YF4A 3B23B 2LNCA 1YPHC 5L2ZH 3GDSA 1PQ5A 2ZTXA 1ZGIA 4WH6A 2GZ8A 3TH3H 3ZZCA 3ZVDA 1AFQB 1C2IA 1O2GH 3A7WA 4X1QU 1G30B 1BZXE 3ATKA 2GD4B 5DP7A 1AKSB 2BQ6B 1F2SE 4PROA 3A8AA 5CHBA 1AE8H 3ZZ4A 4H6TA 2Q6DA 2P93A 3BV9B 4VGCC 5AFYH 1W0ZU 3BTKE 1SMFE 2IOTA 2ZF0H 1TA6A 4RN6A 5IYTA 2VWOA 4BAHB 4WMFA 1V2KT 1LHFH 2WPMS 1THSH 1P2NA 1EAIA 1ELDE 4F4OC 1LVYA 1Q3XA 1YPMH 3U69H 1WU1A 3A7YA 3NCLA 5JB8S 1KLIH 3BTQE 1E1RD 1XUIA 1GHXH 3OSYA 3LIWA 1G3CA 3NK8A 2G81E 1MZDA 4FUFA 4NIYA 1ZTJA 1KLJH 2FOEA 3V3MA 3TLOA 1O38A 1NRNH 4MNYA 1S0QA 4ISHH 4CBNA 2ZHFH 3FN8A 4IN1A 3RM2H 5EW2H 1HJ9A 6GCHF 1D6RA 4P02A 1DM4B 1GHWH 5JBTA 1GVKB 2WPLS 1GI6A 1MH0A 2AMPA 3SNBA 2BLQA 1GBIA 1GJBB 4MLFB 3BEUA 3BEFB 2G5VA 5DP9A 1YGCH 4Q7ZA 2UUFB 3SGBE 1DITH 3PLPA 3FOAA 1A0JA 3ATMA 1AN1E 5DKMA 1SGTA 1C5NH 1IQMA 1C5OH 2XCNA 3E6PH 3VG8A 3GDVA 3TITA 1QNJA 1AQ7A 3U8RH 1AY6H 2ZNKH 4NSYA 2O8TA 1CGIE 2WPJS 2BVSH 5EJLA 5CDFE 2QY0B 1TNJA 1EFRD 1A4WH 3VB6A 3M3TA 5HM2A 1IQLA 1MKWK 1ZLRA 3GY7A 1G36A 1HXFH 1YPKH 1QFKH 3ZZ9A 1TFXA 3H7TA 2WV4A 3C1KA 1OP0A 1C1VH 2VIPA 1HIAA 1MMJN 1W8BH 4IC6A 1BB0B 1QL9A 3BTDE 2TGAA 1FY4A 1C5SA 3LGUA 5C5NA 2CK3D 2VWNA 1QURH 3B9FH 3SJIA 1BITA 4X2YA 4JZEH 2XC5A 3VPKA 4UE7H 1O3BA 1IQFA 2BB4A 1MKWH 2XBXA 2QAAA 3MMGA 1GBHA 3FZDA 5T6DA 2GMTB 4I31A 5E0JA 1EATA 3RXMA 1P9SA 1NZQH 3TU7H 3RXOA 3E3TA 1V2PT 3HKJB 4CH2B 1Y5AT 2GMTC 2JETC 3OEED 2HNTE 4NSVA 2V3MA 4B2CA 2PSXA 3D49H 1QL7A 3SU5A 3TGIE 6LPRA 1O0DH 1GBEA 2HLCA 3P95A 3GYMA 2EI7A 3M3SA 1V2OT 1ZRBA 3A7ZA 5EQQA 1BMAA 2ZFRH 2ANKH 8ESTE 3F68H 2HGTH 3E0PB 4ZHAA 1S6LA 3T27A 1FX0B 3QK1A 1PJPA 2JKHA 1J15A 4XBBA 3L33A 3NUMA 1EPTA 1QBNA
chains in the Genus database with same CATH topology
1O3PB 1FPHH 2G4UA 2OLGA 4THNH 1O31A 4WY3A 1DWEH 2QF3A 4AG1A 1SGRE 2FP7B 3ZZBA 1BRUP 1C5PA 1KYNA 1V2MT 1GI0A 2ZO3H 4KP0A 1MZAA 4K3JA 4CHAC 1AVXA 1V2TT 1T32A 3DUXH 1BBRK 3EAJA 3F9HA 2Y5FA 4NWKA 2HNTC 2GX4A 5FX5A 3OU0A 1JIRA 1VR1H 1J9CH 5A8XA 3RXPA 1LPZB 2F9NA 1SSXA 4OS2A 1LKAA 1QB9A 4MDSA 3MNBA 3MO6A 8KME2 2W3IA 1GI2A 3ATLA 4CRAA 2D1JA 4K8BA 3ZVBA 4AFSA 4CRGA 3DFLA 2FS9A 5C67A 1OWEA 2STAE 4AG2A 2BD9A 1FXYA 3RMMH 1P2QA 3GISB 1TBZH 5I25A 2FOAA 3Q00A 1CT2E 1GHYH 2AMDA 4TPIZ 4A1VA 1C1UH 1KLTA 3UOPA 1ESAA 1VITG 1QCPA 3TH4H 4E7RG 3E16B 1HYLA 2IJOB 1C2HA 3BSQA 1TAWA 1FPCH 4GHQA 1C5YB 3KL6A 3SOSA 4ABFA 3TH2H 3ZZAA 1HRTH 1VZQH 2FM2A 2F83A 1DANH 2FEQH 4FUDA 1FAXA 2BDCA 5ESTE 5JB9S 4DIHH 3FP6E 1H1BA 3FP7E 4WXIA 3Q3KA 4Y71A 3UWIA 1E36B 1MBMA 2ANYA 2Z9LA 1TIOA 3RXVA 4BANB 1GBJA 2PKSC 1UTNA 3RC4A 1SGCA 3ZZ7A 4KKDA 4CRFA 2A4QA 2NU0E 1P2KA 3PV4A 3ODFA 5EXNA 3FANA 4TWWA 1C2GA 2G4TA 5C3NA 1NRSH 1PPHE 3VGCC 1FQ3A 1F92A 2WYGA 1SGDE 2AIQA 3RDZA 2B7DH 3MH6A 3A7TA 3RU4E 2AIPA 5DP6A 2BZ6H 5FX6A 3ZYEA 1H9IE 1O3DA 3NXPA 2W5EA 2Z94A 3DHKH 4A1TA 4CR5A 2F9PA 1DWDH 2AH4X 1CO7E 3IG6B 1FAKH 3A81A 4AGKA 2UWPA 4YLQH 1N1LA 2FLRH 1ZHRA 1BTYA 1T4UH 1O5GH 2BXUH 4I32A 4BTIB 1ZMLA 1MKXK 1GBMA 1EQ9A 6GCHG 2O8MA 2CXVA 1MTNC 2B0FA 5I46H 4DW2U 1A3EH 4IGDA 1ELBA 1C1MA 1ELGA 3IITA 2ZGXH 1BA8B 1S5SA 1WTGH 1JOUB 2ODPA 1JMOH 3AVZA 3S7KB 1EAUA 2LPRA 3SI3H 4BAOB 1AB9C 1QJ1B 5A2MH 1GBAA 2GV7A 1LCYA 4A6LA 1OP2A 2G00A 4H42U 1DWCH 2OC1A 5T3HA 2AGIX 3LGVA 3L3TA 1MU6B 1MD8A 2UUJB 3LT3A 1IQIA 1BJUA 1O35A 1NRQH 3MU4A 1O2UA 2C93B 5AHGH 3RXDA 1DX5M 2ZFPH 3MWIU 4HZHA 2CN0H 3PO1B 1GL0E 1SQTA 3OY5U 1WV7H 3UIRA 4KELA 4INKA 2H1UA 1SGEE 4NG9H 1XMNB 3O8RA 3Q76A 4BXWA 2ZGBH 2PGQB 1C2MA 1JXPA 1GHBF 3PMBB 1Z6JH 1E34B 2GT8A 3ZZ3A 2V0BA 1AGJA 4WXVA 1O3JA 3ATIA 1V2WT 4ZUHA 1O33A 2QXGA 3KQBA 3MHWU 1DPOA 2JH6D 3U8TH 1K1JA 3D62A 1QRZA 3SNEA 4Y0ZE 2CGAA 1V2UT 3T26A 1GI5A 3A89A 2Z3DA 2H5CA 3LONA 2H6MA 1ETTH 3GY2A 2A2XH 1FY1A 3FAOA 2ZKSA 5FPYA 5FHTA 4RKOB 3VFEA 3KQDA 4ZKSU 2F3CE 3UR9A 1P2IA 2A1DB 4E05H 1BTHH 3VB3A 6CHAC 2ZA5A 1GI3A 4MPUA 1SLUB 3SI4H 2ZPRA 3SHAH 1L4DA 2BY8X 2FODA 2JH0D 1KXEA 2IN2A 2ZFQH 1TBQH 1SHYA 1GBTA 1JBUH 1O3HA 1YPLH 1SGYE 2J34A 4YO9A 3LJOA 3ZYDA 8GCHF 1FN8A 1THPB 3HK6B 3SBKA 1MQ5A 1NO9H 3SGAE 2FTLE 1ZYOA 1D3QB 1ETRH 2FOHA 5DP8A 3U98H 3D65E 2NU4E 4MTBA 2BOKA 3U1JB 1TWXB 5GIBA 3UR6A 1UVOA 1S85A 3GY4A 5F8TA 4UFEH 4Y8YA 2TGDA 5A0BA 3LJJA 5C1YA 1SGQE 2OD3B 1UTMA 3BTWE 1SL3A 5FBIA 2FX4A 3A84A 2XBWA 1BCUH 1ANDA 1UHBA 1LVOA 2Z9KA 1ZTLA 1P12E 2FESH 3BTME 4MNXA 2FOCA 1C2KA 3A8DA 1GDUA 1SR5C 4K1EA 4B73A 5B6OA 4HTCH 1IHTH 1A1RA 3KEEA 2O8LA 2PR3A 4KTUA 4BTTB 2RCEA 2HRVA 2OP9A 1TOCB 4Z0KA 1HUTH 1NRRH 2BHGA 1THRH 2YOLA 1FY8E 1DWBH 1H8IH 1K21H 1O3LA 1UVUH 5FCKA 5A0CA 2WPKS 3PYHA 1XUFA 1CA8B 1AUTC 3W95A 2G8TA 1NN6A 3PB1E 1HGTH 1LHCH 2SFAA 2WV5A 2BX4A 4A1XA 2A4OA 1A7SA 1UTQA 4D76A 4X6NA 1DUAA 1EJAA 1O2MA 1SG8B 3STIA 2AGEX 2P8OC 3VEQB 3M35A 3TJNA 1K1LA 2FMJA 1XUGA 1S83A 1XUJA 4JK5A 4INHA 2CF9H 3O8BA 2FOBA 2ZDMA 1HJAB 3MNCA 4NFEA 1TYNA 3SJKA 2QCYA 5HMAA 2EEKA 2VIOA 1UJ1A 4AB9A 3GCHC 3TNSA 3E0NB 4OGYA 1CA0C 2VVVA 1C1QA 1HJ8A 1TRYA 1UCYK 1G3EA 1SQOA 1YC0A 3N7OA 3VXEH 4BAKB 5FAHA 1T31A 1NESE 2XBYA 1C4V2 4BTUB 4Z6AH 1ZSLA 1LPGB 1TGBA 1HIAB 4Y7AA 1QR3E 1W12U 1W3CA 4XBDA 1ANCA 1HAXB 4NIWA 2QXIA 2BD7A 5T6FA 5DO4H 3O8CA 4JZIA 4CREA 1UCYH 5EXLA 5EPYA 3M7UA 1H8DH 3SU2A 4OS4A 3URDA 4YESB 4B1TA 1KXFA 2Y7ZA 2B8OH 3BTTE 2Y5HA 4ISIH 1DLKB 1HDTH 1LO6A 4FUCA 1G32B 2CV3A 1XVOA 2P59A 3RXQA 1AIXH 2VIWA 3SV6A 5G4BA 2BY5X 3SJ9A 2ZPSA 1D4PB 2VNTA 3KCGH 3M37A 2ZDNA 1O5BB 1S82A 2ZU2A 3P92A 2ZDLA 1TQ7B 1AFQC 1IQEA 1GI4A 1ABJH 1S0RA 4DG4A 4B75A 1VGCB 5JBCS 1PFXC 1Z8IB 1EPTB 2I6SA 2O9QA 5FPTA 2ZQ1A 4ESTE 4CBOA 3SU6A 3SUDA 1SC8U 1W7XH 3T2NA 3S7HB 1P05A 1GGDB 1T8OA 3PMAB 4Y11E 1RRKA 3QUMP 2Q1JA 1CQQA 5CHAB 1C4U2 1D9IA 2BDIA 3PWCA 4HFPB 1K28D 4UDWH 5EQRA 4TY6A 1RGQA 4MPWA 3T5FH 2TPIZ 2DE9A 1MD7A 3FVFB 1P8VC 3BG4B 1T8LA 2PTNA 4U01A 7ESTE 1ZJKA 1TGNA 3FZZA 5CHAC 5JDUB 5LPFA 1PPFE 2CMYA 3MU1A 1QQ4A 2R2MB 2F9BH 4U30A 3S9BA 3QZRA 1SGIB 3RXAA 4WF8A 1ESTA 1HAZB 2GP9B 1F0SA 4I8JA 2J94A 3A80A 1TALA 1BQYA 1E0FD 1EX3A 4IMQA 1GDQA 3RM0H 3MO3A 1O5DH 2ANMH 3HATH 5F6MA 3SHCH 3A83A 4GAWA 4B74A 1C9PA 2ZI2H 3PMJA 1GHBG 1QB6A 1ZSKA 3SQEE 2Q6FA 1MCTA 3RXSA 1GJ5H 1ZZZA 2ZU3A 5CE1A 1PPCE 4AYVB 2Z9GA 1C5VA 3JZ2B 1NC6A 3RP2A 4ABJA 1WSSH 1K1PA 4MPVA 3GOVB 4DVAU 1CSOE 2WINI 3UUZA 1K1IA 1AZZA 2XWBI 4YOIA 1CE5A 4U32A 1EB1H 3QX5H 4K1TA 4B76A 2BOHB 2F9OA 1A61H 1XUKA 2D26C 1AZ8A 4NFFA 1GHAF 4NWLA 3S9AA 2VIQA 2J2UA 2QXJA 3MOCA 2FOMB 1D6WA 1SFIA 1IQKA 3SUEA 2VH6A 8GCHG 4DIIH 1BDAA 4FUIA 2XW9A 3EGKH 4I8KA 5LPEA 3V7TA 1O2KA 1UK3A 3FFGA 2A7JA 3ZZ5A 2BQ7B 2GT7A 1O2JA 3AW1A 4ZKOU 2FIRH 4FXGH 5ABWA 4HI3A 3E91A 2AFQB 2CF8H 4IN2A 2I6QA 1NROH 4X1RU 1W7GH 2M5TA 2Y7XA 3BIVH 4X2XA 2Y81A 4XSKU 1QQUA 1WCZA 3MNXA 1RFNA 4KTCA 1C5TA 1AKSA 2O8UA 1TNLA 1L4ZA 2FX6A 2G52A 4WVPE 5C2ZA 1TA2A 2SGPE 1NFWA 1ELFA 1ZHMA 1CVWH 1P2JA 1F0RA 3LH3A 3SORA 3ZV8A 2RA3A 1X7AC 2ZGCA 1MU8B 2SGDE 1S84A 4AYYB 1DOJA 1BRAA 1L2EA 3TGKE 1F5RA 4J2YB 3GY5A 2K1QA 1U6QA 1FNIA 2VGCB 1O30A 2WPIS 5JBBS 4A7IB 2ESTE 1P03A 1TGTA 4Y76A 5EODA 3A82A 1EZXC 2VB0A 1BMMH 2Y6TA 1S6HA 4M7GA 2SGAA 3OYPA 2GZ9A 1GVLA 2SGQE 1OWJA 3RXTA 3MI4A 5FBEA 2SNVA 1HLTH 3A7XA 1VCQA 1SLVB 1PYTD 1WBGB 5EU8A 4TPYA 1SOTA 4ABEA 5C5OA 2W7SA 2HWLB 2GTBA 3MH5A 1BBRH 1TNGA 1OOKB 1S81A 3URCA 1TMBH 2OUAA 1P2MA 4AZ2B 3GCNA 1CU1A 4NA7A 2FI5E 3ZZDA 4K5ZA 1QTFA 1FIZA 1DT2A 1QIXB 1P10A 4QT8C 2A5IA 2FPZA 2QF0A 1TB6H 3I77A 1CGHA 4FVDA 1TPPA 1GCTB 4HGCA 1GG6B 3GY3A 4I8LA 4O9VA 3AAVA 1IAUA 2BQWB 1O2ZA 2ALVA 2QA9E 4AOQA 3PTNA 1O2HA 2CHAB 3AAUA 3ZVEA 1AMHA 1RIWB 3P8FA 2Z7FE 1HXEH 1GCTC 2NU1E 4B2AA 1OS8A 2Y5GA 3LKWA 1C1NA 3M7QA 1EASA 1GBBA 2ZTZA 3DT0H 4JK6A 3SU3A 2V3HH 1O2PA 2ZGHA 1Z71A 2R3UA 2UUKB 1C5XB 3SGQE 1EZUC 3ZVGA 1A5IA 5GCHF 1C2DA 1NFYA 3HPTB 1MQ6A 3LGIA 5DGJA 3TJOA 4BNRA 1FI8A 1GJ4H 1GI9B 1ZPZA 2Z6BD 4GSOA 3EA8A 2BLVA 3CS7A 1TLDA 4ABDA 1Y3XA 4BXSA 3V0XA 4FUBA 1FV9A 2QC2A 1TGCA 3V12A 2A4RA 1PPEE 3K9XB 1KXBA 2QGRA 1F5LA 1IHSH 1M9UA 8LPRA 4Y10E 1DY8A 3O8DA 2FI3E 2FYQA 4X1PU 1YKTA 2OBOA 2FS8A 1BTXA 2Q6GA 2P3FH 3RLWH 1ABIH 1TMTH 4IS5A 4IC5A 1QA7A 3UQVA 2OBQA 2ANWA 2ZCKP 1P9UA 1K22H 1YM0A 3M61U 4ZROA 3ELAH 4ISOA 1TNKA 4YOGA 4JZ1A 2ZHDA 3LDXH 3RC5A 7LPRA 4ZKRU 1O2LA 2BLWA 1TX8A 4WMEA 3P8NA 4X6OA 1O3CA 5K7RA 1UCYE 4X8VH 2ZFSA 3EQ0H 1VJ9U 3SV7A 4I7YH 1GI1A 1MAXA 1NT1A 1L0ZA 5AF9H 1DXWA 3QO6A 1VCPA 2R9PA 3U9AH 2BY7X 1SGFG 3LOXA 4MNWA 3U1IB 2BDAA 1WQSA 1WTHD 2A45B 1O34A 3K6YA 1CHGA 5JPMH 1SVPA 1LKBA 1MKXH 4X8SH 1GVZA 1O37A 3RXJA 2P3UB 1O36A 4FUJA 4TWYA 3BN9A 2C90B 4X8UH 3RXGA 3UNSA 4B71A 4NCYA 2TGTA 1ELVA 1YLCA 1KIGH 2A32A 2BTCE 1ID5H 1YPJH 2BDYA 4ZH8A 2VINA 1MAYA 3T28A 1BHXB 3QZQA 4YT7H 3VB5A 4TYDA 2IPHA 1ACBE 3SU1A 1K1NA 1HAGE 2GDEH 2SGFE 3WY8A 3F9EA 3ZZ8A 3PO1C 3P17H 1DDJA 1NY22 5EPNA 3SU0A 2PFEA 1GHAG 1SLXB 1NFXA 1V6DA 2XRCA 1TQ0B 1VITH 2BD5A 3MH4A 1C5ZB 3A8CA 1OXGA 3PROA 2J9NA 4A5TS 1FDPA 4NZLA 2ZWLH 1JRSA 3T25A 4UEHH 4O97A 1GHVH 2BY9X 1HNEE 3KGPA 4Y8XA 4WWYA 3TVJB 2A5AA 5J4QA 2NU3E 1YLDA 1LVBA 1FZZA 4DY7B 5T6GA 5HM9A 2FZZA 4D9QA 1O5CB 3SQHE 4CR9A 2STBE 1PQAA 4INLA 2VIDA 1B0EA 5PTPA 3P6ZB 1DUEA 1PPBH 1DVAH 1TPOA 1Y59T 3RXLA 9LPRA 3F6UH 2FI4E 2J38A 3RMOH 1O2QA 1HV7A 2FYRA 1GDNA 3M3VA 3KNXA 1P3CA 1TNHA 1Y5UT 5GWZA 4WJG2 1O5AB 4GLYA 1T7CA 3UREA 2ALPA 1SGFA 2WUCA 2ZQ2A 4FU7A 3LC5A 1CT4E 1TBRH 2ZHQH 3FP8E 5FPSA 2PWXA 4OS7A 1AUJA 4K1SA 2UWOA 3F1SB 1KSNA 2BDBA 1C2FA 1O2SA 2BD8A 4FUEA 2V35A 1C5LH 1GBCA 1TX6A 1XKBC 3QDZB 3RMLH 5GDSH 1HAHH 1KDQA 4ASHA 1NFUA 1V2RT 3GCOA 1O32A 3PMHB 1NPMA 1P02A 4MPXA 2GDDA 3RMNH 2Z9IA 3TPIZ 2ZU5A 3ZVCA 3S69A 1EZSC 1GMCF 4D7GA 3RXIA 2C3SA 4RKJB 3UOUA 1VJAU 1DSTA 4X0WU 2VJ1A 5E2OA 1F5KU 1OYQA 2OC0A 2HALA 1O2VA 1A5GH 1INCA 4UFFH 3TK6A 5L6NH 3M5OA 1G9IE 2ZG0H 1YPEH