4AORA

Cationic trypsin in complex with the spinacia oleracea trypsin inhibitor iii (soti-iii)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CATIONIC TRYPSIN
publication title Structural Characterization of Spinacia Oleracea Trypsin Inhibitor III (Soti-III)
pubmed doi rcsb
molecule tags Hydrolase/inhibitor
total genus 58
structure length 223
sequence length 223
chains with identical sequence B, C
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aorA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4aorA02
5GXPA 1HFDA 2PV9B 3A8BA 4AYVB 3NWUA 1VJAU 1KDQA 3LC5A 2FOCA 2OBOA 3SU2A 1PYTD 4CHAC 1P01A 1W0ZU 2BZAA 1P12E 2Z9IA 3QZQA 1CT0E 3EA8A 3QWCH 4X8TH 3B9FH 2OP9A 1C5QA 5C3NA 2G52A 3UR6A 5DG6A 1GHXH 3T2NA 1H9IE 2ZFRH 4K60A 1BBRH 1ELDE 3RXGA 2ZGBH 4ZH8A 1XUJA 4ZAEA 1MTWA 5DGJA 1F5LA 2HALA 4FU9A 1Y3XA 4X1SU 2UUJB 1O2WA 3U8TH 5LPEA 1TA6A 1C5MD 2ZQ2A 2A5IA 1SQTA 1QGFA 1T8OA 1P2NA 5JPMH 2F9PA 1ZLRA 4UEHH 3UNQA 2F3CE 4Y8ZA 3A83A 2ZP0H 2SFAA 4GVUA 5AHGH 1V2JT 2ZHWH 1GJ8B 2AIQA 4X6MA 3RM2H 4CRGA 2KAIA 4UDWH 1C2HA 1IAUA 5ESTE 1GI3A 2ZGCA 4INKA 2QIQA 6GCHF 1LQEA 3TPIZ 1SHHB 4OS2A 2ALVA 2J38A 1O2LA 3UNSA 2GT8A 1G3CA 3PO1C 1J16A 1KLIH 1KXDA 1O3MA 4IC6A 1WTHD 4ZHAA 2BY6X 2A31A 1HIAA 1K21H 1O3IA 3RXBA 2CHAB 1SGFA 1UCYH 1O3CA 3MTYA 2BDAA 3BEIB 2ZI2H 1BBRE 1XX9A 3MHWU 3MU8A 1UVSH 2STAE 2ZU5A 2BY5X 1TALA 5DK1A 3PWBA 2BVSH 3M5NA 3GCNA 3URDA 1F5RA 1K28D 2G00A 2BLVA 3OU0A 2FODA 2XBWA 3VB6A 2XC4A 1DICA 1AB9C 2NU4E 1F5KU 1DANH 1KXBA 2Z9KA 1BRAA 1AI8H 1P9SA 1ZRBA 1ZJKA 1V2LT 1WOFA 2H9EH 5FPTA 3NCLA 1WV7H 2HNTF 1LHFH 1W0YH 3SORA 2C3SA 3B23B 4MVNA 1LVOA 2ZHDA 2A4RA 2BYAX 2PW8H 3PMBB 5C20A 2BDGA 1IQIA 2BQ7B 3FVFB 2Y82A 3U8RH 2AERH 4GAWA 3M3VA 1FN8A 1O2IA 1C5UA 1EZUC 1O5GH 1RJXB 2ALPA 1BRUP 2ZO3H 3GYMA 2AH4X 2CF9H 4ESTE 1S6FA 2A5KA 1IQMA 2J95A 2ZPQA 3ODFA 3RC5A 2ZNKH 3ZVGA 1SFIA 1CE5A 2BY9X 3I78A 1BBRK 2IOTA 5GDSH 4X2WA 1UO6A 1ESTA 1C9TA 1ARCA 3W95A 1O31A 1VR1H 4NZQA 3LJOA 1BTHH 4PROA 1Z6EA 3GY7A 5HGGA 2GCTB 6CHAC 1EPTA 1XKBC 5IDKA 1H8DH 2Z3DA 3K65B 3ODDA 4K8YA 1MZAA 4FUGA 1P2OA 1OX1A 1TNHA 2BM2A 6GCHG 1SGNE 5F8TA 4Y71A 1EKBB 3GCOA 2Y5FA 4FUBA 2XWAA 3PTBA 2A7HA 1J17T 5T3HA 3SNDA 1EZQA 5JBBS 4NG9H 1OWHA 3CS7A 1C4Y2 4I32A 4A6LA 1A5GH 1C2DA 1LHCH 5C2ZA 3D65E 4MLFB 5EGMA 2A2XH 2NU2E 1ZTJA 1C5WB 2NU3E 1AGJA 1VZQH 1V6DA 3ATMA 5F6MA 1WU1A 1E38B 4GCHF 1AFQC 4CHAB 2PTNA 3V0XA 3QO6A 3HK3B 2OBQA 3NXPA 1JXPA 1L1NA 1RXPA 1PFXC 3GY5A 1T8NA 2PKSC 5HMAA 1A4WH 1PQ5A 1UCYK 2FLRH 1IQFA 1C2IA 2FDAA 1GI6A 1SC8U 2Q6FA 1O39A 5T6FA 3PLBA 4MPXA 5JDUB 2BD3A 4NA8A 1CBWC 1EJMA 1C5YB 2ZDVH 3Q76A 4MNVA 3TLOA 1C2LA 4YO9A 1DWBH 2V35A 2BD8A 4IN1A 2QCYA 1GMDG 4RSPA 1O3JA 4GLYA 1W2KH 4I8HA 1TNKA 2J92A 4UFDH 2R9PA 2P3TB 1J15A 4MTBA 4X8UH 5CHAC 1UK2A 1KIGH 1AWHB 1TPAE 2ZTZA 3MOCA 4Y0ZE 1CGHA 4D7FA 2I6SA 2WV5A 4NFEA 5TJXA 3UUZA 1D4PB 2QGRA 2PUQH 3KQEA 2J2UA 6LPRA 3HGPA 3SU0A 1C1SA 1ELTA 3GDVA 3AVZA 5EW2H 4BAQB 4B73A 4D9RA 2WUBA 1C1RA 4X0WU 3PO1B 3DA9B 2FX4A 1C9PA 2O9QA 4ZKOU 7KMEH 1V2ST 2CXVA 1GJBB 5K0HA 1TLDA 2ZDKA 2PUXB 2FYQA 3MNCA 4KP0A 1Q31A 2F9NA 1TA2A 4CRCA 1SGTA 1ZPBA 3UWIA 4AX9H 3BTKE 2BHGA 3ZZ6A 1GMHF 1ELGA 1AB9B 2WINI 1PQ8A 1YPJH 4GCHG 1QQ4A 1A0LA 9LPRA 4JK6A 2CGAA 1BHXF 4A1TA 1MZDA 1BITA 3P17H 3BSQA 5EQQA 3NUMA 1O2KA 5GCHF 1QJ6B 2H2ZA 4NSVA 4DOQA 5FXLA 1KSNA 3KQDA 1GI2A 3Q00A 2RG3A 4WWYA 3PLPA 2GKVE 1YF4A 1BDAA 2EI8A 1TOMH 4BTTB 4ABEA 1HJAC 2O8LA 1UMAH 5FPSA 3QK1A 3A87A 3CS0A 1IQKA 4R8TB 4X6OA 4U32A 4JZ1A 1BJVA 1Z8IB 3RXMA 1INCA 1AVGH 3Q3XA 2A5AA 1MU8B 1H4WA 1S6HA 6CHAB 1BUIA 1W11U 3SZNA 5CMXH 1D3TB 2RCEA 2FOFA 1TGCA 5HM2A 3SJOA 3AW1A 5C5NA 4LOYH 3TNTA 5BRRE 2K1QA 1OWKA 1ZMNA 2QF0A 4YZUA 1AKSB 4IW4E 1G36A 1P04A 1H8IH 2ZU1A 5C67A 2Z94A 3A7XA 1SI5H 3HK6B 1O2GH 3VXFH 4LK4A 4XFQA 3HKIB 5GPIB 2FI5E 4BAMB 3RMMH 1FNIA 5A0BA 1NPMA 4E7RG 1H9LB 1TBQH 3SHCH 1TWXB 4D8NA 2FS9A 4X6NA 3M7TA 1MMJN 2ZDAH 1ELCA 1LPGB 1BIOA 1GJAB 1TGBA 2AGEX 4H42U 1NRRH 4GUXA 5FX6A 1T8MA 1AFQB 1YPLH 3ZZ3A 5EW1H 3V3MA 4CBOA 8GCHF 3SU6A 1BTZA 1TBZH 2OD3B 4U01A 3SUGA 1GMHG 1S81A 3RXOA 2ULLA 2PKSB 1DLKB 4NIVA 3RXCA 1Z8RA 3ZV8A 1P3CA 2ASUB 3U1JB 1CBWB 1QR3E 3PMJA 3ZZ7A 4BXWA 3RC6A 4X2VA 1G3DA 5GCHG 1ZSKA 2R0LA 2WPHS 3UQOA 1L2EA 4Y6DA 1SR5C 3U9AH 1GHAF 1BTWA 1P05A 5CHAB 1MUEB 1A2CH 1O0DH 1L4ZA 1AN1E 2BX4A 2XYAA 2Z9LA 2ZDLA 1DX5M 1Q3XA 2AGGX 4XBBA 1BQYA 2ZKSA 1DFPA 3ZZAA 1GVLA 1O3DA 1N1LA 1UVPA 3L3TA 2AMDA 2VWLA 1TX6A 3RXIA 5A8YA 4A1XA 2FIRH 2SNVA 1WSSH 1YCPM 3QTVH 2O8WA 3UFAA 1O2XA 2W3KA 2W7SA 3M37A 3PTNA 2R3YA 1W8BH 1C2EA 1FY4A 1GG6B 1YBWA 3TH2H 2DE8A 4NWLA 3SV9A 2A4OA 1UTNA 1HAOH 4Y7BA 5HM9A 3UQVA 1NROH 3RXTA 5EPYA 1V2VT 1AVWA 1PPCE 1RS0A 3SV7A 4FU8A 3RXEA 2ODPA 3ENSB 1NRNH 2J9NA 1K22H 2FOGA 1UTMA 4Y8YA 1QCPA 1V2QT 2Q6DA 2TPIZ 4JYUH 1YLDA 5LPRA 1AE8H 8GCHG 2F83A 2PGBB 3RMNH 3T5FH 1AO5A 1V2OT 1UTKA 1CT4E 5LH8A 3TIUA 3FFGA 1QA0A 4AZ2B 1XVMA 1BRBE 1GBMA 2XBYA 2VGCC 2G8TA 4FUJA 1FDPA 3GY2A 2H5CA 4I33A 1SFQB 3LC3A 1SLXB 3UOPA 2Q1JA 4GPGA 3OX7U 4IGDA 1O2TA 3QGNB 1HJAB 4NIYA 4B2AA 1O5FH 2FOBA 1MBQA 2H6MA 1TX8A 2EC9H 2ZGXH 1HDTH 1GHAG 3S7KB 2UWPA 3LT3A 1EJAA 4IS5A 1MD7A 1C1TA 1HNEE 2ZU4A 3T27A 4BAHB 3LH3A 5B6OA 1QJ1B 2ANWA 3UOUA 1MKWH 2Q6GA 1UJ1A 3ZVEA 1GBDA 2QF3A 2XBXA 3AW0A 2VWNA 1AMHA 4ABBA 2GGVB 3BTHE 1HJ8A 3QGJA 4NSYA 3RXDA 5A0CA 3V12A 4HFPB 4AG1A 3RP2A 1LPKB 2ZU2A 4Q80A 4TPIZ 4Z0KA 3ZZDA 1EASA 3P70B 2Z3CA 3S9AA 3OYPA 1E0FD 2OUAA 4JZFH 5DO4H 3E1XB 1RIWC 1WTGH 3ZVAA 3EGKH 2UUYA 3E0NB 2BVXH 2BQWB 2Z3EA 1WAYB 4AOQA 1TYNA 9ESTA 1S84A 4Y76A 3RXRA 4THNH 1M9UA 1Q2WA 3QN7A 3KCGH 1P2IA 2P3UB 4MPVA 1P57B 4MQAA 5GIBA 3OY6U 2JKHA 1CHOF 4JK5A 1XUKA 1FIWA 1EAWA 1W13U 2WV4A 1GBAA 1CVWH 4KTSA 1F0TA 1TPPA 2BDIA 3AAVA 1AE5A 1XM1A 1WBGB 1IQLA 5LPFA 4Y79A 1O2OA 1TABE 3P92A 1FXYA 5HXFA 2FOEA 4GSOA 4WY3A 1JRTA 1GBIA 1ZMJA 3SU3A 1EOLA 1C5OH 3EDXB 2GMTC 3A88A 2PSYA 1DY9A 2ZGJA 1KTTB 2OC8A 3BTDE 3U98H 7ESTE 4X1NU 2ZCHP 1W12U 3TNSA 1P2JA 1THSH 1ZGIA 1HRTH 1CGJE 3A7TA 2C4FH 2TBSA 3TITA 2BD5A 1BMAA 3RXFA 3EQ0H 1C2JA 1LO6A 1ZPCA 2SGEE 3A86A 4LXBH 1HAVA 3NKKA 1MTNC 3T62A 2FLBH 2A4QA 1OS8A 1XUGA 3LH1A 2HNTE 4NGAH 3T28A 5JB9S 2BOKA 3ATKA 1P2KA 3ITIA 5I46H 1S5SA 1ZMLA 3TJNA 1L0ZA 1GL1A 4YLQH 1GBTA 1O3KA 1MKWK 2M5TA 1S0RA 4K5ZA 1BT7A 3TJOA 4UFEH 3LKWA 4K3JA 4YOGA 2GVFA 3JZ1B 2CF8H 1ZRKA 1GDQA 1LKBA 1K1MA 1KY9A 1SGDE 3EA7A 3SJKA 3TGJE 4UD9H 1JWTA 3OY5U 2JETC 1CHOG 3RM0H 5L2ZH 4ZKNU 3BG8A 1OSSA 4FU7A 2Z6BD 3AAUA 1YYY1 2CN0H 3M36A 1GPZA 3TK5A 1N6YA 2P59A 1O3GA 2VGCB 3JZ2B 3IWMA 1QIXB 1DT2A 2FPZA 1YKTA 1LVYA 1OWDA 4CR5A 1B5GH 1C1QA 1BZXE 4X1QU 4XDEA 4H4FA 3ZZ8A 1GL0E 2TGAA 1TONA 3H7OA 1CGIE 3MU1A 1SQAA 1ELEE 3SJ9A 1P03A 1OP0A 1AHTH 4MNXA 4UFGH 1FAXA 1Y5UT 3GYLB 1TRNA 4DJZB 1CA0C 2OC1A 2FO9A 1C1OA 1HLTH 2H9TH 3ZZ4A 3MU0A 4FUDA 4DIIH 4TYDA 1NO9H 1ETRH 5JBAS 1F2SE 5K7RA 1G2LA 1O2NA 3GY4A 1MAXA 1TOCB 1EB1H 2G51A 1TMTH 2QA9E 3RLYH 2VU8E 4MNWA 2V0BA 1BHXB 2AMQA 3VXEH 1GVKB 1SGQE 1DWDH 1THRH 2AFQB 1KDQB 2BY7X 2FM2A 1SB1H 3HKJB 3S0NA 3TVJB 4A7IB 4ABDA 1XUHA 3GY3A 3SQEE 1RIWB 4XBCA 5EQRA 1O3BA 2TRMA 4K1SA 4SGAE 2W26A 7LPRA 2G5VA 2Y81A 3K6ZA 4B2BA 1NRPH 3RXVA 1P2MA 3U1IB 3KIDU 1BMLA 3S9CA 1O5BB 2GT7A 2SGDE 4DIHH 4DT7B 3I29A 1IHSH 3BIVH 3MNBA 3P8NA 1FUJA 1F0RA 4ISNA 1JIMA 1UK3A 1JIRA 2AGIX 1B7XB 3RXQA 3QUMP 4ZKSU 1X7AC 1DPOA 1NFWA 1GCTC 1ETTH 3KHVA 3UR9A 3C1KA 3LGUA 1VITF 4ZMAH 5L2YH 4IMZA 1YPHE 3QDZB 2ZU3A 1VJ9U 1ABIH 1C5TA 2KAIB 1UHBA 2ZPRA 2GDDA 1QRXA 2ZECA 3LPRA 3M61U 4OGXA 4WJG2 1TX7A 2YOLA 2THFB 4WXVA 5EXNA 5C1XA 5L6NH 1E36B 1RTFB 2GMTB 3SHAH 3PB1E 3VB4A 1LHDH 1BCUH 3IITA 1LCYA 1GHZA 3BTGE 2GZ7A 4WH6A 3TGKE 2G4UA 3R3GB 1QRWA 3SGBE 2QV1A 4NCYA 2ZHFH 1GJ4H 1B0FA 3LGTA 1HIAB 2ZFTA 3A8DA 4XOJA 4YOJA 2VVVA 4E05H 4BXSA 2BZ6H 5FAHA 1ELFA 1KLTA 4NA7A 3TJUA 1GBLA 2A2QH 2VJ1A 1D3PB 1MTNB 2Y6TA 2OTVA 1SGEE 4I7YH 1KYNA 1PQ7A 2BLQA 3QLPH 3ZVBA 3L6PA 3GISB 1L1GA 1EAIA 3V7TA 1ANDA 1LVBA 2FEQH 1EX3A 4BTUB 3A8CA 3LJJA 1BRCE 1GHYH 4ISHH 1WQSA 2PLXA 2ZF0H 1OP2A 3DHKH 2SGPE 4FXGH 1SSXA 3RU4E 1LTOA 3ZVCA 4DG4A 5E0HA 3KQCA 3UY9A 1ELBA 2PWXA 2W3IA 4I8JA 1O37A 3FP7E 2VIDA 2HPQH 2OC0A 1RGQA 1Z1JA 1AD8H 1D9IA 2IJOB 4E06H 5ETXA 2BDYA 1HJ9A 1ZTKA 1P11E 2J94A 3DUXH 1O2VA 4OS7A 2JETB 1GBJA 4ISIH 1HBTH 1EOJA 3A85A 4WVPE 1C2GA 1D3QB 2P94A 3P8GA 5G4BA 1EP6A 1A5HA 3ESTA 1SVPA 3BTME 4HI3A 1C5VA 2A45B 1VITG 5E2OA 1EQ9A 1MCVA 1HUTH 3A84A 3A81A 3RXUA 1F92A 5I25A 4K1TA 5DJ7A 3VB7A 5EQSA 2ANKH 2OCVB 1AZ8A 1RD3B 2ZC9H 3BTTE 1JRSA 4UE7H 1H9HE 1O3AA 2SNWA 2VIVA 2VVCA 1CA0B 1Y3YA 2WUCA 2B0FA 3LDXH 3ZV9A 3ATWA 3BG4C 1YC0A 1YCPK 2XXLA 1QFKH 1FIZA 1S0QA 3QZRA 4MPUA 4ZHLU 1T7CA 1ZTLA 3A7VA 3E90B 5SGAE 1BOQA 1FONA 2ZFPH 1V2KT 1E34B 5A09A 1NFXA 1MKXH 2C8WB 2AMPA 4I31A 4H6TA 3STIA 4F4OC 1C4V2 5JB8S 4I8LA 3GOVB 3H7TA 1LHEH 1NS3A 1OOKB 2VIQA 1AWFH 1P8VC 3PV4A 5A2MH 1C1WH 2C90B 1YPGH 1MTUA 1SGPE 4TWWA 5F8ZA 2HGTH 2OXSA 1LPZB 3LGIA 4GHTA 5F03A 3SUDA 1OWEA 3PROA 3P8OA 1VGCC 3ELAH 1C5ZB 4CRFA 1HAHH 3PWCA 3AASA 2HNTC 2XWBI 1GCTB 4MPWA 3SGQE 1TE0A 4ABIA 2UWOA 1GBEA 3HPTB 2EA3A 3P8FA 1NM6A 1P0SH 2P95A 4ZROA 2JH6D 2BD4A 4AFUA 1ZSJA 1FV9A 3RXAA 3SU5A 2OC7A 3KGPA 3NK8A 3SI3H 1SGCA 2FOHA 3S9BA 2C8YB 2FTMA 3W94A 2FI3E 1V2NT 3SNCA 2WYJA 1U6QA 1ZHRA 4KELA 1FAKH 4FVBA 1MTVA 3MO3A 3RMOH 1CO7E 2RDLA 1XUIA 2BDBA 2AS9A 5DP7A 5GWZA 5DKMA 1GJ9B 4Z6AH 3LIWA 1O5EH 1NRSH 1S82A 3GDSA 3UIRA 1C1VH 1CU1A 3FZZA 1GJCB 4YM9A 1GBFA 2B9LA 3OTJE 2Z9JA 4NIXA 4AB8A 1WQVH 3UNRA 3A82A 3M7QA 2BD2A 1EUFA 2BLOA 1MKXK 2PKAA 1CHGA 4OS1A 4ABHA 3TH3H 1NRQH 1C5PA 1NY22 4A5TS 1V2PT 3PLKA 2YNBA 3BIUH 2G55A 2BD7A 4O3TA 1QTFA 4X2YA 2ESTE 1OXGA 1THPB 2BXTH 1DXWA 1DWCH 1A3EH 1ESBA 3F9EA 5T6GA 3TH4H 1ZJDA 1RRKA 3NPSA 1YM0A 3D23A 4ABAA 3UTUH 2BD9A 1HGTH 2ANMH 2PFEA 2WPKS 4Q7YA 3STJA 1TMUH 3L33A 1O36A 4FVDA 1HB0B 3VGCC 1SOZA 1OYQA 2BB4A 4B1TA 1C5LH 4D7GA 1BMMH 2ZWLH 1N8OC 5DP5A 2FOMB 2LPRA 5E0JA 1V2UT 2H5DA 2XBVA 5LGOA 1W14U 4M7GA 1K2I1 5EU8A 1ELVA 3BG4B 4R0IA 2XC0A 2FI4E 3SV8A 4AORA 2J34A 3T29A 2FX6A 3TGIE 1FN6A 4JYVH 3SNAA 1BA8B 3VEQB 3RMLH 4JZDH 1TNGA 2B5TB 4Y10E 3UWJH 1HV7A 1O3PB 1GHBF 3D62A 1ZGVA 1C1UH 1YPHC 2G5NA 1O3FA 4CR9A 4NZLA 1FMGA 2QXIA 2RA3A 3SNBA 3DFLA 2V6NA 3BF6H 1AUTC 2BMGB 5FBEA 1PPZA 3E0PB 3BTWE 2F9VA 5AF9H 4X1PU 4CREA 2A0QB 1TQ7B 2HLCA 3Q77A 4OS6A 1K1IA 4ZXXH 3P6ZB 3U8OH 2AEIH 5HYOA 4FUHA 3FZDA 2QXJA 3ATIA 3KN2A 2NWNA 4Y11E 2TGPZ 5JYIA 1T8LA 3CENA 3TK9A 2ZEBA 1VGCB 1BB0B 1UTQA 1GBCA 2W5EA 1SGYE 1UVUH 5ESBA 1DUEA 1O3NA 4BAOB 4JZEH 1PPEE 2ANYA 2ZTXA 4J1YA 2SGAA 1SQOA 3MH4A 1TNIA 3ZVFA 3MH5A 2H1UA 1NU7B 2JH0D 2GV6A 3MU4A 4BNRA 1UTOA 5EODA 3S69A 2TGDA 3M3SA 4YESB 4Q7ZA 5FCKA 2QXHA 1S83A 3RU4T 1T31A 1G9IE 1DY8A 3S7HB 4ABGA 2CJIA 1FY8E 4K1EA 1IQHA 2VIOA 4Y7AA 3H5CB 2FP7B 2WPJS 1N6XA 2GV7A 1O33A 4K69A 4TWYA 4YT6H 1L4DA 1EB2A 1FI8A 1KXFA 2F9OA 1XUFA 1EAXA 1GI0A 2VB0A 3ZZCA 1BTUA 3K2UA 2D2DA 1SGIB 3SNEA 3UREA 1QNJA 1P02A 4DCDA 3F1SB 3LONA 1GHBG 2F9UA 1FJSA 3SJIA 4NA9H 2A4GA 4AG2A 1FY3A 1GWAA 3T25A 1PQAA 2ZA5A 1YPEH 3HATH 1J14A 2HWLB 3SQHE 2ZGHA 4WMEA 1MQ6A 3MH7A 1XXDA 2ODYB 5EOKA 2HPPH 2ZHEH 2FMJA 3LU9B 1T4UH 2QYIA 3Q3KA 1O32A 5L30H 1P3EA 3BEFB 4Y8XA 1QA7A 1FLEE 2GTBA 2P93A 2FESH 5AFZH 4DURA 1FPCH 3LGYA 4B74A 1XMNB 5C5OA 1O2UA 1VITH 5TCCA 1F7ZA 1O5DH 1DM4B 3ZVDA 3LOXA 2Y5HA 1EATA 1MAYA 1CSOE 1QQUA 1QBNA 3RXLA 1QB1A 3U69H 2GZ9A 4WMDA 1SOTA 4F49A 1P10A 1Z8JB 1TFXA 2FOAA 1AU8A 4Y0YE 1GI7B 1IQJA 1Z1IA 1LVMA 3VGCB 3EAJA 4AFZA 1N8OB 1ANEA 1AVXA 1PJPA 5E0GA 4AFQA 1PPHE 4X6PA 1GMCF 3Q3YA 3RXSA 4INHA 2ZQ1A 1VCQA 2B7DH 1AIXH 3V13A 1QJ7B 3GICB 1FZZA 2XW9A 1GJ7B 3FANA 2CV3A 3KL6A 1V2TT 1EP5A 4IN2A 5T6DA 2JH5D 1SMFE 4FUFA 1K1LA 2C93B 1MBMA 2WPMS 5EPNA 4K2YA 4X1RU 1SBWA 3A7WA 1EPTC 2C8ZB 1Z71A 2GZ8A 5FBIA 3SUFA 3O8RA 2BLWA 3MU5A 1C2KA 4AYYB 1YPMH 1QB6A 1SLWB 1EZXC 5C1UA 1GI9B 2OINA 1KTSB 4D9QA 3PYHA 1W7XH 1B0EA 4ABJA 1NFUA 2GCHF 3A7YA 1J9CH 3CP7A 4AGJA 1ACBE 1AUJA 3M5OA 4WXIA 1SLVB 2P8OC 1NC6A 1QURH 2P3FH 4AFSA 4CH8B 3GY8A 1G37A 2R2MB 1P2QA 1C2MA 3SV6A 2VH6A 1AY6H 3VFEA 1BMNH 1JBUH 1NU9A 1GHWH 6ESTA 4KGAA 3ZZBA 4YOIA 2GD4B 1V2WT 2VWMA 3F6UH 5EXLA 4ZUHA 2ZIQH 1DWEH 3F9FA 4WMFA 1GMDF 1RTKA 1ABJH 1FY1A 4QT8C 4BOHA 1Y5AT 2ILNA 2A7CA 2QY0B 4E7NA 4OS5A 2OQ5A 2ZFSA 3C27B 1G30B 3DFJA 1QRZA 1PPBH 1HAVB 3M5MA 5DP3A 1KXAA 1ZR0A 4NFFA 1W10U 1GMCG 1UCYE 1OKXA 7GCHF 4CRBA 4ZXYH 3KF2A 4BAKB 3WY8A 1YCPH 3F68H 2ZCKP 4MG3A 1DVAH 1O5CB 1QB9A 4D76A 2XTTB 5ABWA 1O35A 4J2YB 2OLGA 3FP6E 3KEEA 1TAWA 1A61H 1IQNA 1PYTC 3ZZ9A 1GCDA 4Q7XA 3TU7H 5IYTA 1GDUA 3LGVA 5J4SA 2R0KA 4TY6A 3GCTF 1A7SA 2UUKB 2TGTA 3MWIU 2FTLE 1XVOA 2D1JA 1O30A 5JBTA 1A3BH 2XNIA 1C1PA 4KTUA 1W7GH 2ZCLP 3NZIA 4CH2B 5A0AE 2IN2A 3A89A 1J8AA 1O2RA 2GCHG 3O8CA 3SW2B 1KXEA 1JOUB 1OP8A 1TGNA 2VNTA 2XC5A 1TRMA 2C8XB 1QHRB 4JMYA 2BDHA 2ZFQH 1TPOA 2Z9GA 2R2WU 4RKJB 2A32A 2PR3A 4X8SH 3SBKA 2ODQA 2G4TA 3PMHB 5H4IB 3RXJA 1S85A 4BTIB 5GJ4B 4Q2KA 2EI6A 1AQ7A 2UWLA 1QL9A 5DP4A 5E8EH 3SOSA 4AN7A 1OPHB 2ZPSA 1BTPA 1ELAA 1MQ5A 2XRCA 3MO9A 3DT0H 1EXFA 1BJUA 2O8UA 4MNYA 1V3XA 2HOBA 3IG6B 4JYTA 5DP9A 3GY6A 4FUIA 4CRDA 1WYKA 3RXPA 2QC2A 2PHBA 3R0FA 2D26C 1AKSA 1K1JA 2SGFE 2FWWA 3SI4H 4ISOA 4HTCH 1W3CA 1V2RT 2B8OH 1EJNA 2D8WA 4B71A 1GBHA 4B2CA 1CQQA 2ZG0H 2V3HH 1O2SA 1YPKH 2DE9A 3LGWA 1P09A 1EZSC 1JMOH 2WYGA 2BDCA 1WCZA 1K1PA 1KLJH 3RDZA 4H6SB 4TPYA 7GCHG 4B75A 1A0HB 1ZOMA 4OGYA 3E91A 1NESE 1ZSLA 1IHTH 4GHQA 1QBOA 4XSKU 3P95A 3SU1A 1Y3VA 2NU1E 2XCFA 3I77A 2BOHB 1EPTB 1DXPA 2H9HA 3PMAB 3A80A 1SL3A 3MNSA 1C5NH 4WH8A 5PTPA 4DVAU 2F91A 3MYWA 1QL7A 4BANB 1TMBH 2BQ6B 1HAIH 1HXEH 4CBNA 4AGKA 1Y5BT 4UFFH 2VVUA 1ZPZA 3GCTG 1NT1A 1GG6C 1NN6A 1Y8TA 2HVXA 2P8OB 4DY7B 2Y80A 3MFJA 3SN8A 3M7UA 1A46H 5EXMA 1UHBB 1E37B 1NTPA 3M35A 1RFNA 1C2FA 2O8MA 3GCHC 1D6RA 1LKAA 1TNJA 1TGTA 5DP8A 1LDTT 1QBVH 1G3BA 1D6WA 1O38A 3FP8E 3SUEA 1TNLA 5DP6A 5E2PA 1G32B 3BV9B 1Y3WA 1GI8B 1ANBA 1BTYA 2G81E 1T32A 2VWOA 3SU4A 1GVZA 1O2PA 8ESTE 1A1RA 1AZZA 1UTJA 3RC4A 3D49H 1HAGE 1F0SA 1Z8GA 4U30A 1SGRE 2BXUH 1MU6B 1C5RA 4YT7H 1ETSH 3BTEE 2AYWA 3RXKA 1O3LA 1TGSZ 4I8KA 1DITH 4TY7A 2A1DB 3MI4A 4KTCA 3FAOA 1YP9A 1O3OA 1GI1A 1HXFH 2GX4A 1DE7H 3OSYA 1C5XB 1EAUA 1CA8B 1LQDB 1BTXA 1HCGA 3E16B 4NIWA 2PTCE 1K1OA 1HAZB 2BX3A 2R3UA 3UPEA 1DUAA 1A5IA 3B8JA 3RLWH 1HAPH 1G3EA 1O2HA 1QY6A 1FY5A 3ZYDA 3BEUA 2EEKA 1SG8B 1KXCA 2FYRA 1ESAA 1TB6H 2SGQE 1Y59T 5A8ZA 3HGNA 3EYDA 4MDSA 4UONA 3VB3A 1YLCA 3K9XB 4ASHA 1A0JA 4HZHA 1UVTH 3QX5H 1C1NA 4O3UA 2ZHQH 5F8XA 1IQEA 3MO6A 1ORFA 2EI7A 4OS4A 1DS2E 3SV2H 1Z7KA 1O3EA 3KQBA 3VPKA 1K1NA 3TJVA 1C5SA 4VGCC 3T26A 2DUCA 5BPEA 3RU4D 1PPGE 1G2MA 1MTSA 1Z6JH 4YTAA 1T4VH 2ZZUH 3EA9A 1DSTA 1CT2E 3VB5A 1O34A 1O5AB 1UTPA 1ID5H 2ZFFH 3URCA 5AFYH 1VCWA 3O8BA 3ATLA 4FUEA 1NFYA 1O2QA 4IMQA 1IOEA 4K8BA 2XCNA 2LNCA 1GGDC 3E8LA 1LHGH 2CMYA 1VCPA 4XBDA 1O2ZA 1HYLA 5DPAA 3M3TA 2I6QA 2FXRA 3A8AA 2Z7FE 8KME2 1XXFA 2VIPA 2Y5GA 5AVDA 2FZZA 2W7UA 1SLUB 3A7ZA 1TIOA 4DGJA 2AIPA 2ZTYA 1F0UA 3RXHA 2F9BH 1ZHMA 4SGBE 1SHYA 2FS8A 4RKOB 2WPLS 2VH0A 5C1YA 1FPHH 5CE1A 4CRAA 1K9OE 2J4IA 2ZDNA 2NU0E 2OQUA 4KKDA 1O2YA 3E6PH 4NWKA 1ZHPA 2STBE 4X2XA 3MMGA 8LPRA 2BTCE 3O8DA 1UK4A 4ISLA 2Y7ZA 3RUOA 3GDUA 3E3TA 1Y3UA 3SJ8A 2P16A 4XE4A 2GDEH 4IC5A 4A1VA 1P06A 4ZKRU 1L1JA 4ABFA 2BY8X 1H1BA 3QTOH 1HAYB 3KNXA 1HAXB 2TIOA 2UUFB 3GCHB 3F9GA 5FCRA 3K6YA 3F9HA 1GJ6A 3EE0B 1SGFG 1C1MA 2ZDMA 1ANCA 3BN9A 2V3OH 4WF8A 4DW2U 4O9VA 4U2WA 4ZHMU 3ZZ5A 1DLEA 3ZYEA 5FX5A 1LMWB 5JBCS 2CHAC 1O3HA 1NZQH 1TBRH 1RTLA 1GJ5H 5EG4A 1O2MA 2QN5T 1ZZZA 2RA0A 1D3DB 2QXGA 3BTQE 1OYTH 1GHVH 3N7OA 4JCNA 4JZIA 4AB9A 3PM3A 5J4QA 1FQ3A 1PPFE 1QL8A 1GJDB 3TK6A 2O8TA 2A7JA 1SPJA 1P9UA 1DOJA 4IBLH 3MNXA 4HGCA 4INLA 2IPHA 2YNAA 1GDNA 1YGCH 1TQ0B 2BVRH 2QAAA 4B76A 2HRVA 2PKAB 3DD2H 1V2MT 4LZ4B 4I8GA 5TCAA 3BTFE 1OWJA 1DDJA 1GI4A 1MH0A 4LZ1H 1IQGA 4O97A 5FPYA 1ARBA 3SO3A 3G01A 1C4U2 1UTLM 1AFEH 2Y7XA 1WUNH 1ZYOA 1GBBA 5A8XA 2VIWA 1OWIA 2PSXA 1HPGA 4VGCB 4X8VH 1DSUA 2GCTC 1MCTA 1E35B 4O03A 2PGQB 2GP9B 5FHTA 1MD8A 3MH6A 4YLUA 1O2JA 4RN6A 2WPIS 1GI5A 1XKAC 3M5LA 4A92A 1TRYA 1GGDB 1TPSA 1UVOA 4FUCA 3SGAE 2VINA 1GBKA
chains in the Genus database with same CATH superfamily
5GXPA 1HFDA 2PV9B 3A8BA 4AYVB 3NWUA 1VJAU 1KDQA 3LC5A 2FOCA 2OBOA 3SU2A 1PYTD 4CHAC 1P01A 1W0ZU 2BZAA 1P12E 3FO8D 2Z9IA 3QZQA 1CT0E 1SKYE 3EA8A 3QWCH 3B9FH 2OP9A 4X8TH 1C5QA 5C3NA 2G52A 3UR6A 5DG6A 1GHXH 2W6ID 3T2NA 1H9IE 2ZFRH 4K60A 1BBRH 1ELDE 3RXGA 2ZGBH 4ZH8A 1XUJA 4ZAEA 1MTWA 5DGJA 1F5LA 2HALA 4FU9A 1Y3XA 4X1SU 2UUJB 1O2WA 3U8TH 5LPEA 1TA6A 1C5MD 2ZQ2A 2A5IA 1SQTA 1QGFA 1T8OA 1P2NA 5JPMH 2F9PA 1ZLRA 4UEHH 3UNQA 2F3CE 4Y8ZA 3A83A 2ZP0H 2SFAA 4GVUA 5AHGH 1V2JT 2ZHWH 1GJ8B 2AIQA 4X6MA 3RM2H 1KMHB 4CRGA 2KAIA 4UDWH 1C2HA 1IAUA 5ESTE 1GI3A 2ZGCA 4INKA 2QIQA 6GCHF 1LQEA 3F0PA 3TPIZ 1SHHB 4OS2A 2ALVA 1YY3A 2J38A 1O2LA 3UNSA 2GT8A 1G3CA 3PO1C 1J16A 1KLIH 1KXDA 1O3MA 4IC6A 1WTHD 4ZHAA 2BY6X 2A31A 1HIAA 1K21H 1O3IA 3RXBA 2CHAB 1SGFA 1UCYH 1O3CA 3MTYA 2BDAA 3BEIB 3OAAD 2ZI2H 1BBRE 1XX9A 3MHWU 3MU8A 1UVSH 2STAE 2ZU5A 2BY5X 1TALA 5DK1A 3PWBA 2BVSH 3M5NA 3GCNA 3URDA 1F5RA 1K28D 2K8IA 2G00A 4TT3D 2BLVA 3OU0A 2FODA 2XBWA 3VB6A 2XC4A 1DICA 1AB9C 2QF4A 2NU4E 1F5KU 1DANH 2QF5A 1KXBA 2Z9KA 1BRAA 1AI8H 1P9SA 1ZRBA 1ZJKA 1V2LT 1WOFA 2H9EH 5FPTA 3NCLA 1WV7H 2HNTF 1LHFH 1W0YH 3SORA 2C3SA 3B23B 4MVNA 1LVOA 2ZHDA 2A4RA 2BYAX 2PW8H 3PMBB 5C20A 2BDGA 4OM9A 1IQIA 2BQ7B 3FVFB 2Y82A 3U8RH 2AERH 4GAWA 3M3VA 1W0JD 1FN8A 1O2IA 1C5UA 1EZUC 1O5GH 1RJXB 2ALPA 1BRUP 2ZO3H 3GYMA 4ASUD 2AH4X 2CF9H 4ESTE 1S6FA 2A5KA 1IQMA 2J95A 2ZPQA 3ODFA 3RC5A 2ZNKH 3ZVGA 1SFIA 1CE5A 2BY9X 3I78A 1BBRK 2IOTA 5GDSH 4X2WA 1UO6A 1ESTA 1C9TA 1ARCA 3W95A 1O31A 1VR1H 4NZQA 3LJOA 1BTHH 2VBCA 1Z6EA 4PROA 3GY7A 5HGGA 2GCTB 6CHAC 1EPTA 1XKBC 5IDKA 1H8DH 2Z3DA 3K65B 3ODDA 4K8YA 2KCPA 1MZAA 4FUGA 1P2OA 1OX1A 3F2GA 1TNHA 2BM2A 6GCHG 5IK2D 1SGNE 5F8TA 4Y71A 1EKBB 3GCOA 2Y5FA 4FUBA 2XWAA 2WHXA 3PTBA 2A7HA 1J17T 5T3HA 3SNDA 1EZQA 5JBBS 4NG9H 1OWHA 3CS7A 2KZ4A 1C4Y2 4I32A 4A6LA 1A5GH 1C2DA 1LHCH 5C2ZA 3D65E 4MLFB 5EGMA 2A2XH 2NU2E 1ZTJA 1C5WB 2NU3E 1AGJA 1VZQH 1V6DA 3ATMA 5F6MA 1WU1A 1E38B 4GCHF 1AFQC 4CHAB 2PTNA 3V0XA 3QO6A 5C17A 3HK3B 2OBQA 3NXPA 1JXPA 1L1NA 1RXPA 1PFXC 3GY5A 1T8NA 2PKSC 5HMAA 1A4WH 1PQ5A 1UCYK 2FLRH 1IQFA 1C2IA 2FDAA 1GI6A 1SC8U 2Q6FA 1O39A 5T6FA 3PLBA 4MPXA 5JDUB 2BD3A 4NA8A 1CBWC 1EJMA 1C5YB 2ZDVH 3Q76A 4MNVA 3TLOA 1C2LA 4YO9A 1DWBH 2EQNA 2V35A 2BD8A 4IN1A 2QCYA 1GMDG 4RSPA 3SZEA 2EY4C 1O3JA 4GLYA 1W2KH 3WW7A 4I8HA 1TNKA 2J92A 4UFDH 2R9PA 2P3TB 1J15A 4MTBA 4X8UH 5CHAC 1UK2A 1KIGH 1AWHB 1TPAE 2ZTZA 3MOCA 4Y0ZE 5HKKD 1CGHA 4D7FA 2I6SA 2WV5A 4NFEA 5TJXA 3UUZA 1D4PB 2QGRA 2PUQH 3KQEA 2J2UA 6LPRA 3HGPA 2WZQA 3SU0A 1C1SA 1ELTA 3GDVA 3AVZA 3WWBA 5EW2H 4BAQB 1YLNA 4B73A 4D9RA 2WUBA 1C1RA 4X0WU 3PO1B 3DA9B 2FX4A 1C9PA 2O9QA 4ZKOU 7KMEH 1V2ST 2CXVA 1GJBB 5K0HA 1TLDA 2ZDKA 2PUXB 2FYQA 3MNCA 4KP0A 1Q31A 2F9NA 1TA2A 4CRCA 1SGTA 3F2FA 1ZPBA 3UWIA 4AX9H 3BTKE 2BHGA 3ZZ6A 1GMHF 4Q4LA 1ELGA 1AB9B 2WINI 1PQ8A 1YPJH 4GCHG 1QQ4A 1A0LA 9LPRA 4JK6A 2CGAA 1BHXF 4A1TA 1MZDA 1BITA 1SQRA 3P17H 3BSQA 5EQQA 3NUMA 1O2KA 5GCHF 1QJ6B 2H2ZA 4NSVA 4DOQA 5FXLA 1KSNA 3KQDA 1GI2A 3Q00A 2RG3A 4WWYA 3PLPA 2GKVE 1YF4A 1BDAA 2EI8A 1TOMH 4BTTB 3FKSD 4ABEA 1HJAC 2O8LA 1UMAH 5FPSA 3QK1A 3A87A 3CS0A 1IQKA 4R8TB 4X6OA 4U32A 4JZ1A 1BJVA 5CDFE 1Z8IB 3RXMA 1INCA 2J98A 1AVGH 3Q3XA 2A5AA 1MU8B 1H4WA 1S6HA 6CHAB 1BUIA 1W11U 3SZNA 5CMXH 1D3TB 2RCEA 2FOFA 1TGCA 5HM2A 3SJOA 3W1EA 3AW1A 5C5NA 4LOYH 3TNTA 5BRRE 2K1QA 2YMSD 1OWKA 3F3BA 1ZMNA 2QF0A 4YZUA 1AKSB 4IW4E 1G36A 1P04A 1H8IH 1YWUA 2ZU1A 5C67A 2Z94A 3A7XA 1SI5H 3HK6B 1O2GH 3VXFH 4LK4A 4XFQA 2V3MA 3HKIB 5GPIB 2FI5E 4BAMB 3RMMH 1FNIA 5A0BA 1NPMA 4E7RG 5KECA 1H9LB 1TBQH 3SHCH 1TWXB 4D8NA 2FS9A 4X6NA 3M7TA 1MMJN 2ZDAH 1ELCA 1LPGB 1BIOA 1GJAB 1TGBA 2AGEX 4H42U 1NRRH 4GUXA 5FX6A 1T8MA 1AFQB 1YPLH 5CHBA 3ZZ3A 5EW1H 3SYJA 3V3MA 4CBOA 8GCHF 3SU6A 1BTZA 1TBZH 2OD3B 4U01A 3SUGA 1GMHG 1S81A 3RXOA 2ULLA 2PKSB 5T1VA 1DLKB 4NIVA 3RXCA 1Z8RA 3ZV8A 1P3CA 2ASUB 3U1JB 1CBWB 1QR3E 3PMJA 3ZZ7A 4BXWA 3RC6A 4X2VA 1G3DA 5GCHG 1ZSKA 2R0LA 2WPHS 3UQOA 1L2EA 4Y6DA 1SR5C 3U9AH 1GHAF 1BTWA 1P05A 5CHAB 3FOAA 1MUEB 2V7QD 1A2CH 1O0DH 1L4ZA 1AN1E 2BX4A 2XYAA 2Z9LA 2ZDLA 1DX5M 1Q3XA 2AGGX 4XBBA 1BQYA 2ZKSA 3PV2A 1DFPA 3ZZAA 1GVLA 1O3DA 1N1LA 1UVPA 3L3TA 2AMDA 2VWLA 1TX6A 3RXIA 5A8YA 2LP6A 4A1XA 2FIRH 2SNVA 1WSSH 1YCPM 3QTVH 2O8WA 3UFAA 1O2XA 2W3KA 2W7SA 3M37A 3PTNA 2R3YA 1W8BH 1C2EA 1FY4A 1GG6B 1YBWA 2LELA 2DE8A 4NWLA 3TH2H 2A4OA 1UTNA 3SV9A 1HAOH 4Y7BA 5HM9A 3UQVA 5FL7D 1NROH 3RXTA 5EPYA 1V2VT 1AVWA 1PPCE 1RS0A 3SV7A 4FU8A 3RXEA 2ODPA 3ENSB 1NRNH 2J9NA 1COWD 1K22H 2FOGA 1UTMA 4Y8YA 1QCPA 1V2QT 2Q6DA 2TPIZ 4JYUH 1YLDA 5LPRA 1AE8H 8GCHG 2F83A 2PGBB 3RMNH 3T5FH 1AO5A 1V2OT 1UTKA 1CT4E 5LH8A 3TIUA 3FFGA 1QA0A 4AZ2B 1XVMA 1BRBE 1GBMA 2XBYA 2VGCC 2G8TA 4FUJA 1FDPA 3GY2A 2H5CA 4B6FA 4I33A 1SFQB 3LC3A 1SLXB 3UOPA 2Q1JA 4GPGA 3OX7U 3OFND 4IGDA 1O2TA 3QGNB 1HJAB 4NIYA 4B2AA 1O5FH 2FOBA 1MBQA 2H6MA 1TX8A 2EC9H 2ZGXH 1HDTH 1GHAG 3S7KB 2UWPA 3LT3A 1EJAA 4IS5A 2PP6A 1MD7A 2CK3D 1C1TA 1HNEE 2ZU4A 3T27A 4BAHB 3LH3A 5B6OA 1QJ1B 2ANWA 3UOUA 1MKWH 2Q6GA 1UJ1A 3ZVEA 1GBDA 2QF3A 2XBXA 3AW0A 2VWNA 1AMHA 3KYFA 4ABBA 2GGVB 3BTHE 1HJ8A 3QGJA 4NSYA 3RXDA 5A0CA 3V12A 4HFPB 4AG1A 3RP2A 1LPKB 2ZU2A 4Q80A 4TPIZ 4Z0KA 3ZZDA 1EASA 3P70B 2Z3CA 3S9AA 3OYPA 1E0FD 2OUAA 4JZFH 5DO4H 3E1XB 1RIWC 1WTGH 3ZVAA 3EGKH 1BMFD 2UUYA 3E0NB 2BVXH 2BQWB 2Z3EA 1WAYB 4F48B 4AOQA 1TYNA 9ESTA 1S84A 4Y76A 3RXRA 4THNH 1M9UA 1Q2WA 3QN7A 3KCGH 1P2IA 2P3UB 4MPVA 1P57B 4MQAA 2IPQX 5GIBA 3OY6U 2JKHA 1CHOF 4JK5A 1XUKA 1FIWA 1EAWA 1W13U 2WV4A 1GBAA 1CVWH 4KTSA 1F0TA 1TPPA 2BDIA 3AAVA 1AE5A 1XM1A 3OTPA 1WBGB 1IQLA 5LPFA 4Y79A 1O2OA 1TABE 3P92A 1FXYA 5HXFA 2FOEA 4GSOA 4WY3A 1JRTA 1GBIA 1ZMJA 3SU3A 1EOLA 1C5OH 3EDXB 2GMTC 3A88A 2PSYA 1DY9A 2ZGJA 1KTTB 2OC8A 3BTDE 3U98H 3KYGA 7ESTE 4X1NU 2ZCHP 1W12U 3TNSA 1P2JA 1THSH 1ZGIA 1HRTH 1CGJE 3A7TA 2C4FH 2TBSA 3TITA 2BD5A 1BMAA 2WV9A 3RXFA 3EQ0H 1C2JA 1LO6A 1ZPCA 2SGEE 2J97A 3A86A 4LXBH 1HAVA 3NKKA 1MTNC 3T62A 2FLBH 2A4QA 2J5UA 1OS8A 1XUGA 3LH1A 2HNTE 4NGAH 3T28A 5JB9S 2BOKA 3ATKA 1P2KA 3ITIA 5I46H 1S5SA 1ZMLA 3TJNA 1L0ZA 3EE7A 1GL1A 4YLQH 4AC9A 1GBTA 1O3KA 4HG6A 1MKWK 2L6OA 2M5TA 1S0RA 4K5ZA 3KQ5A 1BT7A 3TJOA 4UFEH 2QE7D 2HLDD 3LKWA 4K3JA 4YOGA 2GVFA 3JZ1B 2CF8H 1ZRKA 1GDQA 1LKBA 1K1MA 1KY9A 1SGDE 5B6LA 3EA7A 3SJKA 3TGJE 4UD9H 1JWTA 3OY5U 2JETC 1CHOG 3RM0H 5L2ZH 4ZKNU 3BG8A 1OSSA 4FU7A 2Z6BD 3AAUA 1YYY1 2CN0H 3M36A 1GPZA 3TK5A 1N6YA 3UB0A 2P59A 1O3GA 2VGCB 5C0UA 3JZ2B 3IWMA 1QIXB 1DT2A 2FPZA 1YKTA 1LVYA 1OWDA 4CR5A 1B5GH 1C1QA 2YMSB 1BZXE 4X1QU 4XDEA 4H4FA 3ZZ8A 1GL0E 2TGAA 1TONA 4RT0A 3H7OA 1CGIE 3MU1A 1SQAA 1ELEE 3SJ9A 1P03A 1OP0A 3FN8A 1AHTH 4MNXA 4UFGH 1FAXA 1Y5UT 3GYLB 1TRNA 4DJZB 1CA0C 2OC1A 2FO9A 1C1OA 1HLTH 2H9TH 3ZZ4A 3MU0A 1NBME 3N7EA 4FUDA 4DIIH 4TYDA 1NO9H 1ETRH 5JBAS 1F2SE 5K7RA 1G2LA 1O2NA 3GY4A 1MAXA 1TOCB 1EB1H 4F55A 2G51A 1TMTH 2QA9E 4YXWD 3RLYH 2VU8E 4MNWA 2V0BA 1BHXB 2AMQA 3VXEH 1GVKB 1SGQE 3N7DA 1DWDH 1THRH 2AFQB 1KDQB 2BY7X 2FM2A 1SB1H 3HKJB 3S0NA 3TVJB 2JIZD 4A7IB 4ABDA 1XUHA 3GY3A 3SQEE 1RIWB 4XBCA 5EQRA 1O3BA 2TRMA 4Z1MD 4K1SA 4SGAE 2W26A 7LPRA 2G5VA 2Y81A 3K6ZA 4B2BA 3MQKC 1NRPH 3RXVA 1P2MA 3U1IB 3KIDU 1BMLA 3S9CA 1O5BB 2GT7A 2SGDE 4DIHH 4DT7B 3I29A 1IHSH 3BIVH 3MNBA 3P8NA 1FUJA 5EJ1A 1F0RA 4ISNA 1JIMA 1UK3A 1JIRA 2AGIX 1B7XB 3RXQA 3QUMP 4ZKSU 2KCOA 2F43B 1X7AC 1DPOA 1NFWA 1GCTC 1ETTH 3KHVA 4DT4A 3UR9A 3C1KA 3LGUA 1VITF 4ZMAH 5L2YH 4IMZA 1YPHE 3QDZB 2ZU3A 1VJ9U 3OEED 1ABIH 1C5TA 2KAIB 1UHBA 2ZPRA 2GDDA 1QRXA 2ZECA 3LPRA 3M61U 4OGXA 4WJG2 1TX7A 2YOLA 2THFB 4WXVA 5EXNA 5C1XA 5L6NH 1E36B 1RTFB 2GMTB 3SHAH 3PB1E 3VB4A 1LHDH 1BCUH 3IITA 1LCYA 1GHZA 3BTGE 2GZ7A 4WH6A 3TGKE 2G4UA 3R3GB 1QRWA 3SGBE 2QV1A 4NCYA 2ZHFH 1GJ4H 1B0FA 3LGTA 1HIAB 2ZFTA 3A8DA 1QZ8A 1E1QD 4XOJA 4YOJA 2VVVA 4E05H 4BXSA 2BZ6H 5FAHA 1ELFA 1KLTA 4NA7A 3TJUA 1GBLA 2A2QH 2IJD1 2K0QA 2VJ1A 1D3PB 1MTNB 2Y6TA 2OTVA 1SGEE 4I7YH 1KYNA 1PQ7A 2BLQA 3QLPH 3ZVBA 3L6PA 3GISB 1L1GA 1EAIA 3V7TA 1ANDA 1LVBA 2FEQH 1EX3A 4BTUB 3A8CA 3LJJA 1BRCE 4XD7D 1GHYH 4ISHH 2RFKC 1WQSA 2PLXA 2ZF0H 1OP2A 3DHKH 2SGPE 4FXGH 1SSXA 3RU4E 1LTOA 3ZVCA 4DG4A 5E0HA 3KQCA 3UY9A 1ELBA 2PWXA 2W3IA 4I8JA 1O37A 1W0KD 3FP7E 2VIDA 2HPQH 2OC0A 1RGQA 1Z1JA 1AD8H 1D9IA 2IJOB 4E06H 5ETXA 2BDYA 1HJ9A 1ZTKA 1P11E 2J94A 3DUXH 1O2VA 4M9FA 4OS7A 2JETB 1GBJA 4ISIH 1HBTH 1EOJA 3A85A 4WVPE 1C2GA 1D3QB 2P94A 3P8GA 5G4BA 1EP6A 1A5HA 3ESTA 1SVPA 3BTME 4HI3A 1C5VA 2A45B 1VITG 5E2OA 1EQ9A 2KR7A 1MCVA 4P00A 1HUTH 3A84A 3A81A 3RXUA 1F92A 5I25A 4K1TA 5DJ7A 3VB7A 5EQSA 2ANKH 2OCVB 1AZ8A 1RD3B 2ZC9H 3BTTE 1JRSA 4UE7H 1H9HE 1O3AA 2SNWA 2VIVA 2VVCA 1CA0B 1Y3YA 2WUCA 4P02A 2B0FA 3LDXH 4RT1A 3ZV9A 3ATWA 3BG4C 1YC0A 1YCPK 2XXLA 1QFKH 1FIZA 1S0QA 3QZRA 4MPUA 4ZHLU 3H09A 1T7CA 1ZTLA 3A7VA 3E90B 5SGAE 1BOQA 1FONA 2ZFPH 1V2KT 1E34B 5A09A 1NFXA 1MKXH 2C8WB 2AMPA 4I31A 4H6TA 3STIA 4F4OC 1C4V2 5JB8S 4I8LA 3GOVB 3H7TA 1LHEH 1NS3A 1OOKB 2VIQA 1AWFH 1P8VC 3PV4A 5A2MH 1C1WH 2C90B 1YPGH 1MTUA 1SGPE 4TWWA 5F8ZA 2HGTH 2OXSA 1LPZB 3LGIA 4GHTA 5F03A 3SUDA 1OWEA 2GJGA 3PROA 3P8OA 1VGCC 3ELAH 1C5ZB 4CRFA 1HAHH 3PWCA 3DSOA 3AASA 2HNTC 2XWBI 1GCTB 4MPWA 3SGQE 1TE0A 3F0OA 4ABIA 2UWOA 1GBEA 3HPTB 2EA3A 3P8FA 1NM6A 1P0SH 2P95A 4ZROA 2JH6D 2BD4A 4AFUA 1ZSJA 1FV9A 3RXAA 3SU5A 2OC7A 3KGPA 3NK8A 3SI3H 1SGCA 2FOHA 5HIZA 3U28C 2C8YB 3S9BA 2FTMA 3NRLA 3W94A 2FI3E 1V2NT 3SNCA 2WYJA 1U6QA 1ZHRA 4KELA 2KFWA 1FAKH 4FVBA 4FOUC 1MTVA 3MO3A 3RMOH 1CO7E 2RDLA 1XUIA 2BDBA 2AS9A 5DP7A 5GWZA 5DKMA 1GJ9B 4Z6AH 3LIWA 1O5EH 1NRSH 1S82A 3GDSA 3UIRA 1C1VH 1CU1A 3FZZA 1GJCB 4YM9A 1GBFA 2B9LA 3OTJE 2Z9JA 4NIXA 4AB8A 1WQVH 3UNRA 3A82A 3M7QA 2BD2A 1EUFA 2BLOA 1MKXK 2PKAA 1CHGA 4OS1A 4XRNA 4ABHA 3TH3H 1NRQH 1C5PA 1NY22 4A5TS 1V2PT 3PLKA 2YNBA 3BIUH 2G55A 2BD7A 4O3TA 1QTFA 4Q63A 4X2YA 2ESTE 1OXGA 1THPB 2BXTH 1DXWA 1DWCH 1A3EH 1ESBA 3F9EA 5T6GA 3TH4H 1ZJDA 1RRKA 3NPSA 1YM0A 3DCLA 3D23A 4ABAA 3UTUH 2BD9A 1HGTH 2ANMH 2PFEA 2WPKS 4Q7YA 5DSFA 3STJA 1TMUH 3L33A 1O36A 4FVDA 1HB0B 3VGCC 1SOZA 1OYQA 2BB4A 4B1TA 1C5LH 4D7GA 1BMMH 2ZWLH 1N8OC 5DP5A 2FOMB 2LPRA 5E0JA 1V2UT 2H5DA 2XBVA 5LGOA 1W14U 4M7GA 1K2I1 5EU8A 1ELVA 3BG4B 4R0IA 2XC0A 2FI4E 3SV8A 4AORA 2J34A 3T29A 2JJ1D 2FX6A 3TGIE 1FN6A 4JYVH 3SNAA 1BA8B 3VEQB 3RMLH 4JZDH 1TNGA 2B5TB 4Y10E 3UWJH 1HV7A 1O3PB 1GHBF 3D62A 1ZGVA 1C1UH 1YPHC 2G5NA 1O3FA 4CR9A 2KM0A 1FMGA 4NZLA 2QXIA 2RA3A 3SNBA 3DFLA 4ACBA 2V6NA 3BF6H 1AUTC 2XNDD 2BMGB 5FBEA 1PPZA 3E0PB 3BTWE 2F9VA 5GNDA 5AF9H 4X1PU 4CREA 2A0QB 1TQ7B 2HLCA 3Q77A 4OS6A 1K1IA 4ZXXH 3P6ZB 3U8OH 2AEIH 5HYOA 4FUHA 3FZDA 2QXJA 3ATIA 3KN2A 2NWNA 4Y11E 2TGPZ 5JYIA 1T8LA 3CENA 3TK9A 2ZEBA 1VGCB 1BB0B 5EIYA 1UTQA 1GBCA 2W5EA 1SGYE 1UVUH 5ESBA 1DUEA 1O3NA 4BAOB 2M2AA 4JZEH 1PPEE 2ANYA 2ZTXA 4J1YA 2SGAA 1SQOA 3MH4A 1TNIA 3ZVFA 3MH5A 2H1UA 1NU7B 2JH0D 2GV6A 3MU4A 4BNRA 1UTOA 3PRDA 5EODA 3S69A 2TGDA 3M3SA 4YESB 4Q7ZA 5FCKA 2QXHA 1S83A 3N99A 3RU4T 1T31A 1G9IE 1DY8A 3S7HB 4ABGA 2CJIA 1FY8E 4K1EA 1IQHA 2VIOA 4Y7AA 1K0HA 3H5CB 2FP7B 2WPJS 1N6XA 1UW7A 2GV7A 1O33A 4K69A 4TWYA 4YT6H 1L4DA 1EB2A 1FI8A 1KXFA 2F9OA 1XUFA 1EAXA 1GI0A 2VB0A 3ZZCA 1BTUA 3UAIC 3K2UA 2D2DA 1SGIB 3SNEA 3UREA 1QNJA 1P02A 4DCDA 3F1SB 3LONA 1GHBG 2F9UA 1FJSA 3SJIA 4NA9H 2A4GA 4AG2A 1FY3A 1GWAA 2W6JD 3T25A 1PQAA 2ZA5A 1YPEH 3HATH 1J14A 2HWLB 3SQHE 2ZGHA 4WMEA 1MQ6A 3MH7A 1XXDA 2ODYB 5EOKA 2HPPH 2ZHEH 2FMJA 3LU9B 1T4UH 2QYIA 3Q3KA 1O32A 5L30H 1P3EA 3BEFB 4Y8XA 1QA7A 1FLEE 2GTBA 2P93A 2FESH 5AFZH 4DURA 1FPCH 3LGYA 4B74A 1XMNB 5C5OA 1O2UA 1VITH 5TCCA 1F7ZA 1O5DH 1DM4B 3ZVDA 3LOXA 2Y5HA 1EATA 1MAYA 1CSOE 1QQUA 1QBNA 3RXLA 1QB1A 3U69H 2GZ9A 4WMDA 1SOTA 4F49A 1P10A 2OK5A 1Z8JB 1TFXA 2FOAA 1AU8A 4Y0YE 1GI7B 1IQJA 1Z1IA 1LVMA 3VGCB 3EAJA 2RDEA 4AFZA 1N8OB 1ANEA 1AVXA 1PJPA 5E0GA 4AFQA 1PPHE 4X6PA 1GMCF 3Q3YA 3RXSA 4INHA 2ZQ1A 1VCQA 2B7DH 1AIXH 3V13A 1QJ7B 1E79D 1MABB 3GICB 1FZZA 5F53A 2XW9A 1GJ7B 3FANA 2CV3A 3KL6A 4TSFD 1V2TT 1EP5A 4IN2A 5T6DA 2JH5D 1SMFE 4FUFA 1K1LA 2C93B 1MBMA 2WPMS 5EPNA 4K2YA 4X1RU 1SBWA 3A7WA 1EPTC 2C8ZB 1Z71A 2GZ8A 5FBIA 3SUFA 3O8RA 2BLWA 3MU5A 1C2KA 4AYYB 1YPMH 1QB6A 1SLWB 1EZXC 5C1UA 1GI9B 2OINA 1KTSB 4D9QA 3PYHA 1W7XH 1B0EA 4ABJA 1NFUA 2GCHF 3A7YA 1J9CH 3CP7A 4AGJA 1ACBE 1AUJA 3M5OA 4WXIA 1SLVB 2P8OC 1NC6A 1QURH 2P3FH 3PRBA 1H8HD 4AFSA 4CH8B 3GY8A 1G37A 2R2MB 1P2QA 1C2MA 3SV6A 2VH6A 1H8ED 5KGOA 1AY6H 1VKYA 3VFEA 1BMNH 1JBUH 1NU9A 5C94A 1GHWH 6ESTA 4KGAA 3ZZBA 4YOIA 2GD4B 1V2WT 2VWMA 3F6UH 2KCAA 5EXLA 4ZUHA 2ZIQH 1DWEH 3F9FA 4WMFA 1GMDF 1RTKA 1ABJH 1FY1A 4QT8C 4BOHA 1Y5AT 2ILNA 1E1RD 2A7CA 2QY0B 4E7NA 4OS5A 2OQ5A 2ZFSA 3C27B 1G30B 3DFJA 1QRZA 1PPBH 1HAVB 3M5MA 5DP3A 1KXAA 1ZR0A 4NFFA 1W10U 1GMCG 2KCYA 1UCYE 1OKXA 7GCHF 4CRBA 4ZXYH 3KF2A 4BAKB 3WY8A 1YCPH 3F68H 2ZCKP 2JJ2D 4MG3A 1DVAH 1O5CB 1QB9A 4D76A 2XTTB 5ABWA 1O35A 5KEDA 4J2YB 2OLGA 3FP6E 3KEEA 1TAWA 1A61H 1IQNA 1PYTC 3ZZ9A 1GCDA 4Q7XA 3TU7H 5IYTA 1GDUA 3LGVA 5J4SA 2R0KA 4TY6A 3GCTF 1A7SA 2UUKB 2TGTA 3MWIU 2FTLE 1XVOA 2D1JA 5EJLA 1O30A 5JBTA 1A3BH 2XNIA 1C1PA 4KTUA 1W7GH 2ZCLP 3NZIA 4CH2B 5A0AE 2IN2A 3A89A 1J8AA 1O2RA 2GCHG 3O8CA 3SW2B 1KXEA 1JOUB 1OP8A 1TGNA 2VNTA 2XC5A 1TRMA 2C8XB 1QHRB 4JMYA 2BDHA 2ZFQH 2XOKD 1TPOA 2Z9GA 2R2WU 4RKJB 2A32A 2PR3A 4X8SH 3SBKA 2ODQA 2G4TA 3PMHB 5H4IB 3RXJA 1S85A 4BTIB 5GJ4B 4Q2KA 1S6LA 1AQ7A 2EI6A 2UWLA 1QL9A 5DP4A 5E8EH 3SOSA 4AN7A 1OPHB 2ZPSA 1BTPA 1ELAA 1MQ5A 2XRCA 3MO9A 2JDID 3DT0H 1EXFA 1BJUA 2O8UA 4MNYA 1V3XA 2HOBA 3IG6B 4JYTA 5DP9A 3GY6A 4FUIA 4CRDA 1WYKA 3RXPA 2QC2A 2PHBA 3R0FA 2D26C 1AKSA 1K1JA 2SGFE 2FWWA 3SI4H 4ISOA 4HTCH 1W3CA 1V2RT 2B8OH 1EJNA 2D8WA 4B71A 1GBHA 4B2CA 1CQQA 2ZG0H 2V3HH 1O2SA 1YPKH 2DE9A 3LGWA 1P09A 1EZSC 1JMOH 2WYGA 2BDCA 1WCZA 1K1PA 1KLJH 3RDZA 4H6SB 4TPYA 7GCHG 2KX4A 4B75A 1A0HB 1ZOMA 4OGYA 3E91A 1NESE 1NBMD 1ZSLA 1IHTH 4GHQA 1QBOA 4XSKU 3P95A 3SU1A 1Y3VA 2NU1E 2XCFA 3I77A 2BOHB 1EPTB 1DXPA 2H9HA 3PMAB 3A80A 1SL3A 3MNSA 1C5NH 4WH8A 5PTPA 4DVAU 2F91A 3MYWA 1QL7A 4BANB 1TMBH 2BQ6B 1HAIH 1HXEH 4CBNA 4AGKA 1Y5BT 3AK5A 4UFFH 2VVUA 1ZPZA 3GCTG 1NT1A 1GG6C 1NN6A 1Y8TA 2HVXA 2P8OB 4DY7B 2Y80A 3MFJA 3SN8A 3M7UA 1A46H 5EXMA 1UHBB 1E37B 5DN6D 1NTPA 3M35A 3PV5A 1RFNA 1C2FA 2O8MA 3GCHC 1D6RA 4I86A 1LKAA 3VG8A 1TNJA 1TGTA 5DP8A 2WPDD 1LDTT 1QBVH 1G3BA 1D6WA 1O38A 3FP8E 3SUEA 1TNLA 5DP6A 5E2PA 1G32B 3BV9B 1Y3WA 1GI8B 1ANBA 1BTYA 2G81E 1T32A 2VWOA 3SU4A 1GVZA 1O2PA 8ESTE 1A1RA 1AZZA 1UTJA 3RC4A 3D49H 1HAGE 1F0SA 1Z8GA 4U30A 1SGRE 2BXUH 1MU6B 1C5RA 4YT7H 1ETSH 3BTEE 2AYWA 3RXKA 1O3LA 1TGSZ 4I8KA 1DITH 4TY7A 2A1DB 3MI4A 4KTCA 3FAOA 1YP9A 1O3OA 1GI1A 1HXFH 2GX4A 1DE7H 3OSYA 1C5XB 1EAUA 1CA8B 1LQDB 1BTXA 1HCGA 3E16B 4NIWA 2PTCE 4RI0A 1K1OA 1HAZB 2BX3A 2R3UA 3UPEA 1DUAA 1A5IA 3B8JA 3RLWH 1HAPH 1G3EA 1O2HA 1QY6A 1FY5A 3ZYDA 3BEUA 2EEKA 1SG8B 1KXCA 2FYRA 1ESAA 1TB6H 1WDIA 2SGQE 1Y59T 5A8ZA 3HGNA 3EYDA 4MDSA 4UONA 3VB3A 1YLCA 3K9XB 4ASHA 1A0JA 4HZHA 1UVTH 3QX5H 1C1NA 4O3UA 2ZHQH 5F8XA 1IQEA 3MO6A 1ORFA 2EI7A 4OS4A 1DS2E 3SV2H 1Z7KA 1O3EA 3KQBA 3VPKA 1K1NA 3TJVA 1C5SA 4VGCC 3T26A 2DUCA 5BPEA 3RU4D 1PPGE 1G2MA 1MTSA 1Z6JH 4YTAA 1T4VH 2ZZUH 3EA9A 1DSTA 1CT2E 3VB5A 1O34A 2WSSD 1WXRA 1O5AB 1UTPA 1ID5H 2ZFFH 3URCA 5AFYH 1VCWA 3O8BA 3ATLA 4FUEA 1NFYA 1O2QA 4IMQA 1IOEA 4K8BA 2XCNA 2LNCA 1GGDC 3E8LA 3OE7D 1LHGH 2CMYA 1VCPA 4XBDA 1O2ZA 1HYLA 5DPAA 3M3TA 2I6QA 3WWFA 2FXRA 3A8AA 2Z7FE 8KME2 1XXFA 2VIPA 2Y5GA 5AVDA 2FZZA 2W7UA 4FETA 1SLUB 3A7ZA 1TIOA 4DGJA 2AIPA 2ZTYA 1F0UA 3CNRA 3RXHA 2F9BH 1ZHMA 4SGBE 1SHYA 2FS8A 4RKOB 2WPLS 2VH0A 5C1YA 1FPHH 5CE1A 2J98B 4CRAA 1K9OE 2J4IA 2ZDNA 5HIYA 2NU0E 2OQUA 4KKDA 2HVYB 1O2YA 3E6PH 4NWKA 1ZHPA 2STBE 4X2XA 3DSPA 3MMGA 8LPRA 2BTCE 3O8DA 1UK4A 4ISLA 2Y7ZA 3RUOA 3GDUA 3E3TA 1Y3UA 3SJ8A 2P16A 4XE4A 2GDEH 4IC5A 4A1VA 1P06A 1OHHD 4ZKRU 1L1JA 4ABFA 2BY8X 1H1BA 3QTOH 1HAYB 3KNXA 1HAXB 2TIOA 2UUFB 3GCHB 3F9GA 5FCRA 3K6YA 3F9HA 1GJ6A 2F4LA 3EE0B 1SGFG 1C1MA 2ZDMA 1ANCA 3BN9A 2V3OH 4WF8A 4DW2U 4O9VA 4U2WA 4ZHMU 5C0TA 3ZZ5A 1DLEA 3ZYEA 5FX5A 1LMWB 5JBCS 2CHAC 1O3HA 1NZQH 1TBRH 1RTLA 1GJ5H 5EG4A 1O2MA 2QN5T 2YMSC 1ZZZA 2RA0A 1D3DB 2QXGA 3BTQE 4ACAA 1OYTH 1GHVH 3N7OA 4JCNA 4JZIA 4AB9A 3PM3A 5J4QA 1FQ3A 1PPFE 1QL8A 1GJDB 3TK6A 2O8TA 2A7JA 1SPJA 1P9UA 1DOJA 4IBLH 3MNXA 1FX0B 4HGCA 4INLA 2IPHA 2YNAA 4B6EA 1GDNA 1YGCH 1TQ0B 5EJZA 2BVRH 2QAAA 3DSGA 4B76A 2HRVA 2PKAB 3DD2H 1V2MT 2L74A 4LZ4B 4I8GA 5TCAA 3BTFE 1OWJA 1DDJA 1GI4A 1MH0A 3GS9A 4LZ1H 1IQGA 4O97A 5FPYA 1ARBA 3SO3A 3G01A 1C4U2 1UTLM 1AFEH 3OEHD 2Y7XA 1WUNH 1ZYOA 1GBBA 5A8XA 2VIWA 1OWIA 2PSXA 1HPGA 4VGCB 4X8VH 1DSUA 2GCTC 1MCTA 3ZIAD 1E35B 4O03A 2PGQB 2GP9B 5FHTA 1MD8A 3MH6A 3F2HA 4YLUA 1O2JA 4RN6A 2WPIS 1EFRD 1GI5A 1XKAC 3M5LA 4A92A 1TRYA 4ZCNA 1GGDB 1TPSA 1UVOA 2AHME 4FUCA 3SGAE 2VINA 1GBKA
chains in the Genus database with same CATH topology
5GXPA 1HFDA 2PV9B 3A8BA 4AYVB 3NWUA 1VJAU 1KDQA 3LC5A 2FOCA 2OBOA 3SU2A 1PYTD 4CHAC 1P01A 1W0ZU 2BZAA 1P12E 2Z9IA 3QZQA 1CT0E 3EA8A 3QWCH 4X8TH 3B9FH 2OP9A 1C5QA 5C3NA 2G52A 3UR6A 5DG6A 1GHXH 3T2NA 1H9IE 2ZFRH 4K60A 1BBRH 1ELDE 3RXGA 2ZGBH 4ZH8A 1XUJA 4ZAEA 1MTWA 5DGJA 1F5LA 2HALA 4FU9A 1Y3XA 4X1SU 2UUJB 1O2WA 3U8TH 5LPEA 1TA6A 1C5MD 2ZQ2A 2A5IA 1SQTA 1QGFA 1T8OA 1P2NA 5JPMH 2F9PA 1ZLRA 4UEHH 3UNQA 2F3CE 4Y8ZA 3A83A 2ZP0H 2SFAA 4GVUA 5AHGH 1V2JT 2ZHWH 1GJ8B 2AIQA 4X6MA 3RM2H 4CRGA 2KAIA 4UDWH 1C2HA 1IAUA 5ESTE 1GI3A 2ZGCA 4INKA 2QIQA 6GCHF 1LQEA 3TPIZ 1SHHB 4OS2A 2ALVA 2J38A 1O2LA 3UNSA 2GT8A 1G3CA 3PO1C 1J16A 1KLIH 1KXDA 1O3MA 4IC6A 1WTHD 4ZHAA 2BY6X 2A31A 1HIAA 1K21H 1O3IA 3RXBA 2CHAB 1SGFA 1UCYH 1O3CA 3MTYA 2BDAA 3BEIB 2ZI2H 1BBRE 1XX9A 3MHWU 3MU8A 1UVSH 2STAE 2ZU5A 2BY5X 1TALA 5DK1A 3PWBA 2BVSH 3M5NA 3GCNA 3URDA 1F5RA 1K28D 2G00A 2BLVA 3OU0A 2FODA 2XBWA 3VB6A 2XC4A 1DICA 1AB9C 2NU4E 1F5KU 1DANH 1KXBA 2Z9KA 1BRAA 1AI8H 1P9SA 1ZRBA 1ZJKA 1V2LT 1WOFA 2H9EH 5FPTA 3NCLA 1WV7H 2HNTF 1LHFH 1W0YH 3SORA 2C3SA 3B23B 4MVNA 1LVOA 2ZHDA 2A4RA 2BYAX 2PW8H 3PMBB 5C20A 2BDGA 1IQIA 2BQ7B 3FVFB 2Y82A 3U8RH 2AERH 4GAWA 3M3VA 1FN8A 1O2IA 1C5UA 1EZUC 1O5GH 1RJXB 2ALPA 1BRUP 2ZO3H 3GYMA 2AH4X 2CF9H 4ESTE 1S6FA 2A5KA 1IQMA 2J95A 2ZPQA 3ODFA 3RC5A 2ZNKH 3ZVGA 1SFIA 1CE5A 2BY9X 3I78A 1BBRK 2IOTA 5GDSH 4X2WA 1UO6A 1ESTA 1C9TA 1ARCA 3W95A 1O31A 1VR1H 4NZQA 3LJOA 1BTHH 4PROA 1Z6EA 3GY7A 5HGGA 2GCTB 6CHAC 1EPTA 1XKBC 5IDKA 1H8DH 2Z3DA 3K65B 3ODDA 4K8YA 1MZAA 4FUGA 1P2OA 1OX1A 1TNHA 2BM2A 6GCHG 1SGNE 5F8TA 4Y71A 1EKBB 3GCOA 2Y5FA 4FUBA 2XWAA 3PTBA 2A7HA 1J17T 5T3HA 3SNDA 1EZQA 5JBBS 4NG9H 1OWHA 3CS7A 1C4Y2 4I32A 4A6LA 1A5GH 1C2DA 1LHCH 5C2ZA 3D65E 4MLFB 5EGMA 2A2XH 2NU2E 1ZTJA 1C5WB 2NU3E 1AGJA 1VZQH 1V6DA 3ATMA 5F6MA 1WU1A 1E38B 4GCHF 1AFQC 4CHAB 2PTNA 3V0XA 3QO6A 3HK3B 2OBQA 3NXPA 1JXPA 1L1NA 1RXPA 1PFXC 3GY5A 1T8NA 2PKSC 5HMAA 1A4WH 1PQ5A 1UCYK 2FLRH 1IQFA 1C2IA 2FDAA 1GI6A 1SC8U 2Q6FA 1O39A 5T6FA 3PLBA 4MPXA 5JDUB 2BD3A 4NA8A 1CBWC 1EJMA 1C5YB 2ZDVH 3Q76A 4MNVA 3TLOA 1C2LA 4YO9A 1DWBH 2V35A 2BD8A 4IN1A 2QCYA 1GMDG 4RSPA 1O3JA 4GLYA 1W2KH 4I8HA 1TNKA 2J92A 4UFDH 2R9PA 2P3TB 1J15A 4MTBA 4X8UH 5CHAC 1UK2A 1KIGH 1AWHB 1TPAE 2ZTZA 3MOCA 4Y0ZE 1CGHA 4D7FA 2I6SA 2WV5A 4NFEA 5TJXA 3UUZA 1D4PB 2QGRA 2PUQH 3KQEA 2J2UA 6LPRA 3HGPA 3SU0A 1C1SA 1ELTA 3GDVA 3AVZA 5EW2H 4BAQB 4B73A 4D9RA 2WUBA 1C1RA 4X0WU 3PO1B 3DA9B 2FX4A 1C9PA 2O9QA 4ZKOU 7KMEH 1V2ST 2CXVA 1GJBB 5K0HA 1TLDA 2ZDKA 2PUXB 2FYQA 3MNCA 4KP0A 1Q31A 2F9NA 1TA2A 4CRCA 1SGTA 1ZPBA 3UWIA 4AX9H 3BTKE 2BHGA 3ZZ6A 1GMHF 1ELGA 1AB9B 2WINI 1PQ8A 1YPJH 4GCHG 1QQ4A 1A0LA 9LPRA 4JK6A 2CGAA 1BHXF 4A1TA 1MZDA 1BITA 3P17H 3BSQA 5EQQA 3NUMA 1O2KA 5GCHF 1QJ6B 2H2ZA 4NSVA 4DOQA 5FXLA 1KSNA 3KQDA 1GI2A 3Q00A 2RG3A 4WWYA 3PLPA 2GKVE 1YF4A 1BDAA 2EI8A 1TOMH 4BTTB 4ABEA 1HJAC 2O8LA 1UMAH 5FPSA 3QK1A 3A87A 3CS0A 1IQKA 4R8TB 4X6OA 4U32A 4JZ1A 1BJVA 1Z8IB 3RXMA 1INCA 1AVGH 3Q3XA 2A5AA 1MU8B 1H4WA 1S6HA 6CHAB 1BUIA 1W11U 3SZNA 5CMXH 1D3TB 2RCEA 2FOFA 1TGCA 5HM2A 3SJOA 3AW1A 5C5NA 4LOYH 3TNTA 5BRRE 2K1QA 1OWKA 1ZMNA 2QF0A 4YZUA 1AKSB 4IW4E 1G36A 1P04A 1H8IH 2ZU1A 5C67A 2Z94A 3A7XA 1SI5H 3HK6B 1O2GH 3VXFH 4LK4A 4XFQA 3HKIB 5GPIB 2FI5E 4BAMB 3RMMH 1FNIA 5A0BA 1NPMA 4E7RG 1H9LB 1TBQH 3SHCH 1TWXB 4D8NA 2FS9A 4X6NA 3M7TA 1MMJN 2ZDAH 1ELCA 1LPGB 1BIOA 1GJAB 1TGBA 2AGEX 4H42U 1NRRH 4GUXA 5FX6A 1T8MA 1AFQB 1YPLH 3ZZ3A 5EW1H 3V3MA 4CBOA 8GCHF 3SU6A 1BTZA 1TBZH 2OD3B 4U01A 3SUGA 1GMHG 1S81A 3RXOA 2ULLA 2PKSB 1DLKB 4NIVA 3RXCA 1Z8RA 3ZV8A 1P3CA 2ASUB 3U1JB 1CBWB 1QR3E 3PMJA 3ZZ7A 4BXWA 3RC6A 4X2VA 1G3DA 5GCHG 1ZSKA 2R0LA 2WPHS 3UQOA 1L2EA 4Y6DA 1SR5C 3U9AH 1GHAF 1BTWA 1P05A 5CHAB 1MUEB 1A2CH 1O0DH 1L4ZA 1AN1E 2BX4A 2XYAA 2Z9LA 2ZDLA 1DX5M 1Q3XA 2AGGX 4XBBA 1BQYA 2ZKSA 1DFPA 3ZZAA 1GVLA 1O3DA 1N1LA 1UVPA 3L3TA 2AMDA 2VWLA 1TX6A 3RXIA 5A8YA 4A1XA 2FIRH 2SNVA 1WSSH 1YCPM 3QTVH 2O8WA 3UFAA 1O2XA 2W3KA 2W7SA 3M37A 3PTNA 2R3YA 1W8BH 1C2EA 1FY4A 1GG6B 1YBWA 3TH2H 2DE8A 4NWLA 3SV9A 2A4OA 1UTNA 1HAOH 4Y7BA 5HM9A 3UQVA 1NROH 3RXTA 5EPYA 1V2VT 1AVWA 1PPCE 1RS0A 3SV7A 4FU8A 3RXEA 2ODPA 3ENSB 1NRNH 2J9NA 1K22H 2FOGA 1UTMA 4Y8YA 1QCPA 1V2QT 2Q6DA 2TPIZ 4JYUH 1YLDA 5LPRA 1AE8H 8GCHG 2F83A 2PGBB 3RMNH 3T5FH 1AO5A 1V2OT 1UTKA 1CT4E 5LH8A 3TIUA 3FFGA 1QA0A 4AZ2B 1XVMA 1BRBE 1GBMA 2XBYA 2VGCC 2G8TA 4FUJA 1FDPA 3GY2A 2H5CA 4I33A 1SFQB 3LC3A 1SLXB 3UOPA 2Q1JA 4GPGA 3OX7U 4IGDA 1O2TA 3QGNB 1HJAB 4NIYA 4B2AA 1O5FH 2FOBA 1MBQA 2H6MA 1TX8A 2EC9H 2ZGXH 1HDTH 1GHAG 3S7KB 2UWPA 3LT3A 1EJAA 4IS5A 1MD7A 1C1TA 1HNEE 2ZU4A 3T27A 4BAHB 3LH3A 5B6OA 1QJ1B 2ANWA 3UOUA 1MKWH 2Q6GA 1UJ1A 3ZVEA 1GBDA 2QF3A 2XBXA 3AW0A 2VWNA 1AMHA 4ABBA 2GGVB 3BTHE 1HJ8A 3QGJA 4NSYA 3RXDA 5A0CA 3V12A 4HFPB 4AG1A 3RP2A 1LPKB 2ZU2A 4Q80A 4TPIZ 4Z0KA 3ZZDA 1EASA 3P70B 2Z3CA 3S9AA 3OYPA 1E0FD 2OUAA 4JZFH 5DO4H 3E1XB 1RIWC 1WTGH 3ZVAA 3EGKH 2UUYA 3E0NB 2BVXH 2BQWB 2Z3EA 1WAYB 4AOQA 1TYNA 9ESTA 1S84A 4Y76A 3RXRA 4THNH 1M9UA 1Q2WA 3QN7A 3KCGH 1P2IA 2P3UB 4MPVA 1P57B 4MQAA 5GIBA 3OY6U 2JKHA 1CHOF 4JK5A 1XUKA 1FIWA 1EAWA 1W13U 2WV4A 1GBAA 1CVWH 4KTSA 1F0TA 1TPPA 2BDIA 3AAVA 1AE5A 1XM1A 1WBGB 1IQLA 5LPFA 4Y79A 1O2OA 1TABE 3P92A 1FXYA 5HXFA 2FOEA 4GSOA 4WY3A 1JRTA 1GBIA 1ZMJA 3SU3A 1EOLA 1C5OH 3EDXB 2GMTC 3A88A 2PSYA 1DY9A 2ZGJA 1KTTB 2OC8A 3BTDE 3U98H 7ESTE 4X1NU 2ZCHP 1W12U 3TNSA 1P2JA 1THSH 1ZGIA 1HRTH 1CGJE 3A7TA 2C4FH 2TBSA 3TITA 2BD5A 1BMAA 3RXFA 3EQ0H 1C2JA 1LO6A 1ZPCA 2SGEE 3A86A 4LXBH 1HAVA 3NKKA 1MTNC 3T62A 2FLBH 2A4QA 1OS8A 1XUGA 3LH1A 2HNTE 4NGAH 3T28A 5JB9S 2BOKA 3ATKA 1P2KA 3ITIA 5I46H 1S5SA 1ZMLA 3TJNA 1L0ZA 1GL1A 4YLQH 1GBTA 1O3KA 1MKWK 2M5TA 1S0RA 4K5ZA 1BT7A 3TJOA 4UFEH 3LKWA 4K3JA 4YOGA 2GVFA 3JZ1B 2CF8H 1ZRKA 1GDQA 1LKBA 1K1MA 1KY9A 1SGDE 3EA7A 3SJKA 3TGJE 4UD9H 1JWTA 3OY5U 2JETC 1CHOG 3RM0H 5L2ZH 4ZKNU 3BG8A 1OSSA 4FU7A 2Z6BD 3AAUA 1YYY1 2CN0H 3M36A 1GPZA 3TK5A 1N6YA 2P59A 1O3GA 2VGCB 3JZ2B 3IWMA 1QIXB 1DT2A 2FPZA 1YKTA 1LVYA 1OWDA 4CR5A 1B5GH 1C1QA 1BZXE 4X1QU 4XDEA 4H4FA 3ZZ8A 1GL0E 2TGAA 1TONA 3H7OA 1CGIE 3MU1A 1SQAA 1ELEE 3SJ9A 1P03A 1OP0A 1AHTH 4MNXA 4UFGH 1FAXA 1Y5UT 3GYLB 1TRNA 4DJZB 1CA0C 2OC1A 2FO9A 1C1OA 1HLTH 2H9TH 3ZZ4A 3MU0A 4FUDA 4DIIH 4TYDA 1NO9H 1ETRH 5JBAS 1F2SE 5K7RA 1G2LA 1O2NA 3GY4A 1MAXA 1TOCB 1EB1H 2G51A 1TMTH 2QA9E 3RLYH 2VU8E 4MNWA 2V0BA 1BHXB 2AMQA 3VXEH 1GVKB 1SGQE 1DWDH 1THRH 2AFQB 1KDQB 2BY7X 2FM2A 1SB1H 3HKJB 3S0NA 3TVJB 4A7IB 4ABDA 1XUHA 3GY3A 3SQEE 1RIWB 4XBCA 5EQRA 1O3BA 2TRMA 4K1SA 4SGAE 2W26A 7LPRA 2G5VA 2Y81A 3K6ZA 4B2BA 1NRPH 3RXVA 1P2MA 3U1IB 3KIDU 1BMLA 3S9CA 1O5BB 2GT7A 2SGDE 4DIHH 4DT7B 3I29A 1IHSH 3BIVH 3MNBA 3P8NA 1FUJA 1F0RA 4ISNA 1JIMA 1UK3A 1JIRA 2AGIX 1B7XB 3RXQA 3QUMP 4ZKSU 1X7AC 1DPOA 1NFWA 1GCTC 1ETTH 3KHVA 3UR9A 3C1KA 3LGUA 1VITF 4ZMAH 5L2YH 4IMZA 1YPHE 3QDZB 2ZU3A 1VJ9U 1ABIH 1C5TA 2KAIB 1UHBA 2ZPRA 2GDDA 1QRXA 2ZECA 3LPRA 3M61U 4OGXA 4WJG2 1TX7A 2YOLA 2THFB 4WXVA 5EXNA 5C1XA 5L6NH 1E36B 1RTFB 2GMTB 3SHAH 3PB1E 3VB4A 1LHDH 1BCUH 3IITA 1LCYA 1GHZA 3BTGE 2GZ7A 4WH6A 3TGKE 2G4UA 3R3GB 1QRWA 3SGBE 2QV1A 4NCYA 2ZHFH 1GJ4H 1B0FA 3LGTA 1HIAB 2ZFTA 3A8DA 4XOJA 4YOJA 2VVVA 4E05H 4BXSA 2BZ6H 5FAHA 1ELFA 1KLTA 4NA7A 3TJUA 1GBLA 2A2QH 2VJ1A 1D3PB 1MTNB 2Y6TA 2OTVA 1SGEE 4I7YH 1KYNA 1PQ7A 2BLQA 3QLPH 3ZVBA 3L6PA 3GISB 1L1GA 1EAIA 3V7TA 1ANDA 1LVBA 2FEQH 1EX3A 4BTUB 3A8CA 3LJJA 1BRCE 1GHYH 4ISHH 1WQSA 2PLXA 2ZF0H 1OP2A 3DHKH 2SGPE 4FXGH 1SSXA 3RU4E 1LTOA 3ZVCA 4DG4A 5E0HA 3KQCA 3UY9A 1ELBA 2PWXA 2W3IA 4I8JA 1O37A 3FP7E 2VIDA 2HPQH 2OC0A 1RGQA 1Z1JA 1AD8H 1D9IA 2IJOB 4E06H 5ETXA 2BDYA 1HJ9A 1ZTKA 1P11E 2J94A 3DUXH 1O2VA 4OS7A 2JETB 1GBJA 4ISIH 1HBTH 1EOJA 3A85A 4WVPE 1C2GA 1D3QB 2P94A 3P8GA 5G4BA 1EP6A 1A5HA 3ESTA 1SVPA 3BTME 4HI3A 1C5VA 2A45B 1VITG 5E2OA 1EQ9A 1MCVA 1HUTH 3A84A 3A81A 3RXUA 1F92A 5I25A 4K1TA 5DJ7A 3VB7A 5EQSA 2ANKH 2OCVB 1AZ8A 1RD3B 2ZC9H 3BTTE 1JRSA