2QC2A

Crystal structure of severe acute respiratory syndrome (sars) 3c-like protease asn214ala mutant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
305
structure length
305
Chain Sequence
SSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title Crystal structure of Severe Acute Respiratory Syndrome (SARS) 3C-like protease Asn214Ala mutant with two non-native n-terminal residues (GLY AND SER)
rcsb
source organism Sars coronavirus
total genus 78
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2qc2A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qc2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qc2A02
1P10A 3LJJA 1NT1A 3UWJH 4ABDA 1P0SH 6GCHF 3E8LA 2Y7ZA 3M35A 5FBIA 1MBMA 4CRAA 4O9VA 3SJ8A 2P93A 1HXFH 3RXTA 2JETC 5DKMA 3M7QA 3LPRA 2BZAA 2ZI2H 3D49H 1DXWA 1O5EH 2F9VA 2XW9A 2R2WU 1UTJA 1BDAA 1SOZA 1O37A 1S5SA 5JBAS 1TWXB 2TGPZ 5L30H 3RXGA 1O2LA 3RXFA 1GVZA 1D9IA 1YPEH 1F5KU 1P2KA 1GJBB 3DA9B 3MNSA 4JYTA 3RU4D 3E3TA 4Y7AA 1IQNA 4A5TS 1GI3A 1PPBH 5EPYA 2BY6X 3KHVA 2JH6D 1BCUH 1Y59T 4H42U 4DW2U 1C1TA 1BITA 1WTHD 1EB2A 1P2MA 3AASA 4BAOB 4CRBA 3ZV9A 2QXHA 5L2ZH 5DG6A 3TJUA 2ZDAH 5FCKA 4PROA 1XUJA 1QBNA 2B7DH 1OWIA 1C1NA 4B76A 1V2VT 3KGPA 4Y8ZA 2A1DB 4Q80A 5GCHG 1BBRE 4JYUH 2ZHDA 2TGAA 1VCWA 4MLFB 1OKXA 4D8NA 3MYWA 4ZKRU 1HAYB 1NFUA 2ULLA 3SV8A 2YNAA 1VITH 1UCYE 2EI7A 2BDIA 2F9BH 1P2OA 3PLPA 2OLGA 2HNTC 1OXGA 1TYNA 3QTVH 1JRTA 4UONA 4BTUB 2FDAA 2ZTZA 1L4ZA 4KELA 2BYAX 2UUJB 1AZZA 2BY8X 3M3VA 3UOPA 1RGQA 6CHAC 3MMGA 1G2LA 1B5GH 3MU5A 1C1QA 1TX6A 2OCVB 2VIPA 4K60A 1F0SA 2ZGHA 2VH6A 1T32A 4LK4A 4BXWA 3NUMA 5E2OA 2Y5FA 4WJG2 3SV2H 3RXSA 1DOJA 2P3TB 2H9TH 2KAIB 3SU1A 3T29A 4GAWA 1ZMLA 3VGCB 3HPTB 3LT3A 1CA0C 3HK6B 1SBWA 4ZKSU 1QURH 3BIUH 1DXPA 2VIQA 1DX5M 2ESTE 1NTPA 2C8XB 1P2IA 1ELTA 2QXGA 1Y5AT 3T25A 1FIWA 1TONA 3SI3H 3VFEA 1KTSB 1SSXA 1VJ9U 2RDLA 1K28D 1BRUP 4Y8YA 3L6PA 3MOCA 1C1MA 2XCFA 1RTFB 3RLWH 3UUZA 2J92A 1K1PA 3C1KA 3RXCA 1GHVH 1KLTA 3ZVDA 4O3UA 8GCHG 1YF4A 5DP4A 1VITG 1GBKA 1UHBB 1YM0A 3ZYEA 1AFQB 8ESTE 3ELAH 1A7SA 1SGCA 1VCPA 6ESTA 2VWNA 3SHAH 1P06A 4NSYA 1YPJH 3SV7A 1GI5A 1MKXH 3B8JA 4DIIH 2W5EA 1GHWH 4FUCA 3ZZBA 4X8SH 1P2QA 1KXDA 1J9CH 1AQ7A 1V2KT 1ZJDA 2ANYA 4B2AA 2Q6DA 3SNBA 2BHGA 4FU9A 3A8CA 3QZRA 2C8WB 1G3CA 4X6PA 2XRCA 1K1JA 5EXLA 3RMOH 4AG2A 4CR5A 1CSOE 2RA0A 3RP2A 1V2UT 4RSPA 2P3FH 1AUJA 1MMJN 2G55A 1AFEH 1HAZB 1T7CA 1SGNE 3VB4A 2GMTC 3IG6B 1SVPA 1W0ZU 1GWAA 1BT7A 3QZQA 1ZJKA 1VJAU 2FOBA 2PWXA 1HAXB 1P02A 2FWWA 4CBNA 4DIHH 2XWBI 2Z6BD 3A82A 1EZUC 5GWZA 1D3PB 1UTQA 3LGWA 1ELDE 4JK5A 4XDEA 4OS1A 3F68H 1F0UA 2P94A 4IBLH 1VGCB 3A84A 1HRTH 3OY6U 3VB7A 1HJ9A 2LIZA 1ELEE 2O8WA 1BBRK 1RFNA 2SNWA 4YT7H 1KDQA 1DDJA 1MTNB 1RTLA 4UFDH 1EOJA 1O30A 4I31A 1UCYK 1UVOA 3UNQA 3KQBA 5EPNA 3RXVA 2Z9KA 1T4UH 2IN2A 3KQDA 1TA6A 1S84A 4H6SB 2GZ7A 5E0JA 4A1XA 1AVXA 4MPWA 2BMGB 1K1OA 2Y5HA 4KKDA 5I25A 3SV6A 1LHEH 2NU4E 1AHTH 1UTKA 3SQEE 1TA2A 2VGCB 2GVFA 1P03A 1JMOH 1MZAA 2NU3E 1ZSKA 1LHGH 3LGIA 3P6ZB 1XKAC 5DGJA 5FPYA 2W3IA 3PWCA 1O3LA 2GV7A 1A1RA 1MU6B 2BXUH 4K3JA 1EKBB 3UR6A 2Z7FE 1QL7A 3A7TA 1P2JA 1OWDA 1GJDB 2Z9IA 2FS8A 3D62A 1TALA 2FEQH 1K1NA 1QGFA 3Q3XA 3GCNA 4MTBA 3EA8A 3E91A 5K0HA 1CHOG 4B1TA 3TNSA 3LOXA 2BY7X 1INCA 5SGAE 1PYTD 5EGMA 4F49A 5DP6A 4Z6AH 5AVDA 2Z9JA 5J4SA 2SGAA 4Y8XA 4WH8A 1AE5A 1ELAA 1LHCH 1NRQH 2UWOA 2FLBH 2QC2A 1GGDB 2P59A 2YOLA 3PMHB 3KEEA 1PJPA 4JZIA 5EW2H 1KYNA 7LPRA 4MVNA 5BPEA 2IOTA 2XYAA 4XBBA 4Y71A 3RXRA 1EAXA 4MNVA 1DVAH 2DE9A 3RXUA 1ANEA 3OY5U 5CHAC 2Z3CA 2AYWA 5LPRA 6GCHG 1O36A 5GXPA 2QYIA 1G30B 3PTBA 1A0JA 1O2YA 4NIYA 1YLCA 1C5SA 3BTTE 2FP7B 2PUQH 4LOYH 1O3GA 1O32A 1E0FD 1U6QA 1GJ5H 1FN8A 1GMHF 2ZDVH 3EAJA 1MTVA 1NFYA 3P17H 4X0WU 2HALA 1RS0A 2TPIZ 1AUTC 1C1RA 4YESB 3RM0H 5T6FA 3QGJA 3M5MA 4AORA 3M5OA 1MH0A 1OOKB 1NRRH 4XOJA 2CF9H 3RXBA 4GCHG 1MKWH 1NESE 1ZPZA 2H9HA 2XC0A 3FAOA 1RJXB 3I77A 1S81A 2OBQA 3MH4A 5CMXH 1BBRH 2CMYA 3H7OA 4RKJB 1Z1IA 4I7YH 3FP8E 1LDTT 1FXYA 1LMWB 3RXMA 1UCYH 2OC8A 2ZFQH 4FU8A 1C5ZB 4MPVA 2H2ZA 1C2GA 1Q2WA 2R2MB 2ZFTA 3VXEH 3SU0A 2BXTH 1BTYA 2VNTA 4MNWA 2J95A 3AAUA 2O9QA 4U32A 1YYY1 2W26A 2FESH 3ENSB 5CE1A 3P70B 1O3NA 3ZZDA 1BQYA 1TBZH 4NIWA 1MCTA 4NWKA 1BTUA 3TJVA 4AX9H 1LKAA 1J16A 4D9RA 4DG4A 1BTHH 4MQAA 1NRSH 1QB9A 2R3UA 1TOCB 3MU8A 2H1UA 4KTCA 1HJAC 2C4FH 2V35A 2Z9LA 1QJ6B 2A7JA 3GCHC 2ZC9H 3SU2A 2PR3A 4ISHH 2PKAA 1XUGA 1C1OA 3U8RH 2ZCKP 1FLEE 1C1PA 2HNTE 2UWLA 3F9EA 3A7XA 3PROA 1MQ6A 1TMTH 4DVAU 2FTMA 5EG4A 3DFJA 3E0NB 1GGDC 1O3IA 3E1XB 3GISB 1O33A 4Y6DA 4THNH 1C5XB 1V3XA 1GJCB 4K1TA 1H9LB 3PMJA 4JCNA 5AHGH 2Y80A 4D76A 1C5RA 1EZQA 2FOAA 3HKIB 2A5IA 1QY6A 1VZQH 1GBAA 1HJ8A 5GIBA 1Z6JH 1ZTLA 2JH0D 4NZQA 1V2LT 3PLBA 3LDXH 1ELGA 5HM2A 3JZ1B 2A5KA 1EXFA 3W95A 4A6LA 1FIZA 1SGRE 1TFXA 4ZKNU 2VJ1A 3U1JB 1PPFE 2HGTH 4CBOA 2ZU5A 5C67A 1OX1A 3T5FH 5AF9H 1ZHRA 2PSXA 2WPHS 2RCEA 5JB8S 4BAMB 1WYKA 1ARCA 1QHRB 2OQ5A 1MTSA 4ZXXH 2C3SA 1GHZA 2HNTF 1ETRH 3UNSA 5F8ZA 5EW1H 2AEIH 2ANWA 1SG8B 1P8VC 1AB9B 3IWMA 1WUNH 2ZCLP 1O3BA 4K1EA 1GBHA 2GZ9A 1BOQA 3QN7A 1W14U 1TAWA 4B2CA 3FZZA 3TK9A 4YO9A 2BQWB 1O2NA 3BEIB 3BG4C 2PTCE 2QCYA 4XBCA 1A0HB 1GCTB 1EZXC 5ABWA 1ETSH 4DOQA 1EOLA 2BDAA 4ABJA 3TPIZ 4K8YA 2VIVA 4WMEA 7GCHF 4KTUA 1Y3UA 3RXJA 1CT0E 4WF8A 1Z71A 2A4OA 1DY8A 3ZZ9A 3SN8A 3ODDA 1KY9A 5E2PA 1T8OA 1MZDA 1B0FA 3CENA 1GG6B 4AFSA 1Y5UT 1O0DH 2BX3A 3MO9A 4O03A 1W10U 1TB6H 2AGEX 1HV7A 2OBOA 1F0RA 1MD8A 2NU2E 2ZDNA 5DK1A 3HGPA 4CRFA 2H9EH 1IQJA 5AFZH 4BTIB 2ZGBH 3BV9B 1MTUA 2Y7XA 1FY4A 3GY2A 4MNXA 1FPCH 2FI4E 1EQ9A 1DSTA 3U9AH 3ZVFA 2FOCA 1YP9A 3U98H 1HAGE 5DP5A 4OS5A 3SHCH 1N1LA 2UUFB 1C2LA 1O3JA 1C1WH 1O38A 5F8TA 2ZNKH 1ORFA 4IS5A 1MAXA 2ILNA 2ZFFH 3V13A 1LTOA 1RD3B 5HXFA 3BN9A 3O8CA 8KME2 2XTTB 3KN2A 1XUFA 3B23B 2BB4A 1O2QA 4B75A 1NY22 2F83A 5E8EH 3STJA 2O8UA 3MTYA 1PPCE 3CS7A 2ZF0H 3PO1C 1C4Y2 2PKSC 2Z94A 3AW0A 1SGIB 3A8BA 1P9SA 5HYOA 4INHA 1UK3A 2H6MA 4AN7A 3LONA 3AAVA 3MH5A 4WH6A 4X2VA 2ODQA 1DY9A 1YPGH 3ZVCA 1LHFH 3BTFE 3TH2H 1C4V2 1NM6A 1W8BH 3RXQA 1C2FA 5A0CA 2D8WA 2F91A 2GCTB 1W7GH 2A31A 2I6QA 3BF6H 4GSOA 2BLVA 3L3TA 5LGOA 2DUCA 1GDUA 4I33A 3LC5A 1C5YB 3ATLA 3GYLB 1OP2A 5I46H 1MKXK 2ZPRA 1C5NH 2VIOA 3MO6A 5DPAA 4WY3A 1ZZZA 5T6GA 1AMHA 2J38A 4F4OC 2SGEE 4ISNA 4ISLA 2F9UA 1C5MD 4X2YA 3SUGA 2Q6FA 5JYIA 4NWLA 2Q6GA 2W7UA 1FNIA 1YKTA 3FP6E 5JBTA 1K22H 3GICB 3GYMA 5DJ7A 4FU7A 1GI6A 1SR5C 4INKA 1PFXC 4NCYA 3V0XA 4ZHLU 1HFDA 1EUFA 2H5CA 1EP6A 2FOGA 5LPFA 1O3KA 3NXPA 3SGAE 4K2YA 2A7CA 1ZOMA 2ZFPH 3ZZ5A 1BZXE 2GT7A 1EATA 2EI6A 3ZVBA 3ZZ6A 2PV9B 1YPHC 3MU4A 1GG6C 1O35A 4OS2A 4NA7A 1E37B 1GHAG 5EOKA 3SORA 2ZPQA 5C3NA 1F92A 1UMAH 4JZFH 4I8JA 4WXVA 2CN0H 1BA8B 2FTLE 1BJUA 5DP7A 5E0GA 1O3MA 2O8TA 4IMZA 1OP8A 3SU5A 1S83A 1TX8A 1Y5BT 5TCCA 3UNRA 3DFLA 3SJ9A 2BVSH 3KIDU 4LXBH 1GJ6A 1GL1A 3NPSA 3PB1E 1GCDA 3UOUA 1EPTA 3RC4A 2WUBA 3TVJB 2SGPE 1QTFA 1SMFE 1QQUA 2ZP0H 2NWNA 1V2ST 3STIA 1WSSH 3TGIE 4GLYA 2HVXA 3LC3A 3FFGA 1O2XA 1IQGA 1W3CA 3MFJA 3RXOA 4UE7H 2PSYA 5A09A 1FY3A 3RMLH 4OS6A 3M3TA 5ESBA 5GDSH 2ODPA 1KXEA 4X6MA 1YLDA 2ZU1A 1XVOA 4KGAA 4OGYA 3A7VA 3A7ZA 4UDWH 3KL6A 1O2GH 1TPAE 1G3BA 1GMCF 2XCNA 3GDSA 5LPEA 1HBTH 2BVRH 1HLTH 3TK6A 1GI0A 1UVUH 1TRMA 1AY6H 2D26C 2ODYB 3ATIA 1RIWB 1MUEB 1OS8A 1O3PB 2ZFRH 1SI5H 2PKAB 1UVSH 1AU8A 1CBWB 1OYQA 1CO7E 2QY0B 2ZGXH 5FBEA 1O3OA 1Y3YA 2FLRH 2J94A 2WV4A 2D2DA 4OS4A 4YM9A 3ATKA 3LIWA 4ZXYH 1P2NA 1GBFA 1GHBF 2P3UB 1EAIA 3P8NA 1A5IA 2ZGJA 1O2PA 4IC6A 3LGUA 1Y8TA 1C1VH 2WINI 1GJ4H 1S82A 3GDUA 1TNIA 4NIVA 3RUOA 1V2QT 4X8VH 2WPIS 3HKJB 4GVUA 1BUIA 2ZA5A 3RXPA 3M36A 2FOFA 2HRVA 3OTJE 1BIOA 1DFPA 1GJAB 1Z8GA 2FYRA 1O2JA 1K1IA 2FX4A 1MKWK 1S0QA 1BMNH 1SQTA 1V2JT 3BEUA 2G4TA 3GCTF 5IYTA 2FOHA 1K2I1 1JXPA 2FOMB 2TIOA 2HLCA 4A1TA 5FHTA 2V0BA 3BTME 1P9UA 1ESBA 3VGCC 1TPOA 1HNEE 3MI4A 1BMLA 3VB5A 1W7XH 3NZIA 1SFIA 1WBGB 2BQ7B 5C5OA 1C9TA 4BAQB 2OTVA 3NK8A 4ZKOU 4GHQA 1K1LA 3T26A 4Q2KA 1TMBH 4YLUA 1OPHB 3ZV8A 1Z8RA 4BTTB 4Y10E 1FN6A 1O3AA 5T6DA 4CH8B 4D9QA 2BD7A 3TITA 2YNBA 1A0LA 1C5OH 1ZLRA 4RKOB 3GY7A 1C1UH 1F2SE 2BD3A 1GL0E 1KSNA 4AFQA 1IHSH 1MQ5A 1TGBA 3ATMA 1DWCH 2K7XA 3C27B 1ETTH 1A4WH 3VEQB 2ZDMA 1O2IA 2B9LA 1GI8B 1AFQC 4ABHA 1SOTA 3SO3A 3MNCA 1G32B 1GI2A 1TPPA 4M7GA 3BTEE 4ABFA 4AYVB 1QB6A 1P05A 3VXFH 4YT6H 1TMUH 1LPKB 1OYTH 2GGVB 4D7GA 4HZHA 5JPMH 4XSKU 3BTWE 3MU1A 1O3EA 2AS9A 1CBWC 2WYGA 7ESTE 2W3KA 1XM1A 1IQFA 1ZGIA 3ODFA 2A4QA 4ABIA 2SGFE 3AW1A 2BDBA 2ZHEH 3SQHE 4CREA 2P8OB 3M5NA 2EA3A 3UREA 1KXBA 3A87A 1T8LA 1GVKB 2XBYA 4IW4E 1W2KH 4MNYA 4NA9H 1O3DA 2FZZA 5GCHF 1KXAA 1EZSC 2VINA 4YOGA 3ZZCA 3EBNA 3GY8A 1QRXA 3U69H 1Z1JA 3VB6A 1AKSA 4JK6A 4ZAEA 3UTUH 2OINA 1V2OT 2BDCA 3B9FH 1ID5H 2QV1A 4MPXA 3SW2B 1ZSLA 1E35B 1O31A 3MU0A 1GBCA 1KIGH 1VGCC 1NS3A 1YCPK 2EI8A 3P92A 1O5GH 2ZG0H 2R9PA 1GBMA 1K9OE 4U01A 1GI4A 1GHXH 1FAXA 1O39A 1MTNC 1QBOA 4WMDA 4TPIZ 2ZTYA 1DM4B 1LPGB 2BD9A 1V6DA 5G4BA 1H1BA 2RA3A 2GX4A 1X7AC 1WV7H 1V2MT 1ZSJA 3K6ZA 1GBBA 2VGCC 4X1RU 5GJ4B 3K2UA 1DWEH 2W7SA 3M37A 4CHAB 3H5CB 1IQHA 2C8YB 3P8OA 4FUIA 4FUHA 4FUJA 1Y3XA 2R0LA 3A81A 5FAHA 1QFKH 1O2KA 1QL8A 4E7NA 3LGVA 2RG3A 3ZVEA 3HGNA 1O2MA 1C2DA 1YCPM 3SUDA 3VPKA 2AGGX 2PFEA 1WQVH 2VH0A 3FP7E 1SHYA 3SGBE 1EX3A 3O8BA 4FVBA 3H7TA 3ZYDA 2D1JA 2NU1E 1O2TA 1C5UA 2UUYA 3QK1A 1PQ8A 3PMBB 1VITF 2FYQA 1TOMH 5B6OA 3LH3A 2G51A 1LVYA 1GI1A 4CR9A 1K21H 2XC5A 2AMQA 1RRKA 5JB9S 4X8UH 1OWJA 2XXLA 3RM2H 1QIXB 1YC0A 1GBIA 1TBQH 3RU4T 5EQRA 1PPGE 5EXMA 1M9UA 1YPHE 2BLQA 3P8GA 1IAUA 2XBXA 4D7FA 4K5ZA 1PQAA 1GVLA 1BTPA 4SGBE 3Q00A 1S6HA 2ALPA 1TNLA 4MDSA 3E90B 2ZDLA 1SGFA 5C1XA 1ELVA 3V12A 1EPTB 1DT2A 1TGCA 5F03A 1G3DA 2ZWLH 3BTHE 5J4QA 3EGKH 4OS7A 1LHDH 1KLJH 3ZZAA 3PM3A 3TLOA 2AMPA 4XFQA 1THPB 1UTOA 3S69A 4X1PU 2JETB 3DT0H 1IQKA 1SGFG 2QF3A 1SHHB 1MD7A 2GD4B 1C5WB 1NO9H 1CU1A 2PW8H 3BTGE 4WVPE 1ANBA 2XWAA 5FX6A 3ZZ7A 1ACBE 4AZ2B 4HTCH 1F7ZA 2Z3EA 5F8XA 1XMNB 1W12U 1T8NA 1O5BB 2BM2A 1YCPH 1GPZA 2ZZUH 4ESTE 1CVWH 1AZ8A 1J17T 1GMCG 4CRDA 4GPGA 3GDVA 3FVFB 1TGNA 3PV4A 1L4DA 1SC8U 1ZMNA 1O5DH 1OSSA 1A61H 1ELBA 2PTNA 4I8LA 4Y11E 1O2WA 1GBLA 1KXFA 2ZHQH 4IMQA 1H8DH 2H5DA 2IPHA 1SLXB 6LPRA 2AIPA 4JZDH 1FJSA 4NG9H 2FPZA 3SNEA 1BB0B 1IQEA 4JZ1A 4KP0A 1ZYOA 1FZZA 1KLIH 1IQMA 3NWUA 5FX5A 4KTSA 4BANB 2PHBA 2FO9A 5E0HA 4E7RG 2HOBA 2ALVA 4ISIH 4Q7YA 1FY5A 2V6NA 5A0BA 2O8LA 1A3BH 1HAOH 4O97A 1TIOA 3UWIA 1E36B 1SGQE 4Y7BA 2STAE 2GP9B 1E38B 3D65E 1C2KA 1T4VH 1QA7A 1TQ7B 2F9OA 1AWHB 1W0YH 3SJIA 3GCOA 2I6SA 1UTNA 3KNXA 1JIMA 3RDZA 3DUXH 3A80A 3RXHA 1D3TB 3SOSA 4MPUA 1A5HA 2BD5A 3ITIA 2FMJA 1HGTH 2WUCA 1RTKA 2PGQB 2A4GA 5T3HA 1CE5A 3GCTG 6CHAB 3EDXB 4K8BA 5IDKA 1G9IE 1VR1H 2A32A 1QRZA 1UVPA 1UTMA 2A5AA 1OP0A 3RMNH 4AG1A 1EAUA 2GCHF 2BVXH 4ZMAH 1MTWA 4A7IB 1ZRBA 3K6YA 4NGAH 2STBE 1WCZA 4YZUA 4HFPB 1ZPBA 1CA0B 1O2UA 1OWEA 4IN1A 1J8AA 4ZUHA 2AIQA 2J34A 1TRNA 3EA7A 2WPLS 5A0AE 1SLVB 3ZZ3A 4ZHAA 1XVMA 4BAKB 1XKBC 3I29A 3TGKE 1ABIH 3SZNA 1DITH 3TGJE 1UO6A 1SLWB 1TPSA 4TY6A 1E34B 3RMMH 1BRBE 1Y3WA 1O3HA 2R3YA 3SNAA 1EB1H 1ZR0A 2B5TB 1C2IA 1NZQH 1YBWA 1AVGH 3E0PB 2A45B 2PUXB 4ASHA 1QA0A 2G81E 1FQ3A 2Q1JA 4TYDA 3RXIA 1NC6A 3MH6A 4IN2A 2ZIQH 2GTBA 1NU9A 1XUIA 3SUFA 3TK5A 2FOEA 1AB9C 1PPEE 1L1GA 4GCHF 1V2RT 1GHYH 1O2HA 1S6FA 2OQUA 3BEFB 1HAPH 2TGTA 1A3EH 1GMDF 1UK4A 2BTCE 1ELCA 4ABGA 4AB8A 3LU9B 1JWTA 1SGYE 4X6OA 4A1VA 3HATH 4NSVA 3LGYA 1TNKA 5JBCS 4BOHA 1GCTC 2FIRH 4DY7B 2FXRA 1ZTJA 2ZO3H 2C8ZB 1GJ8B 4BXSA 1QNJA 2ZQ1A 8LPRA 4Y0YE 3RC5A 3BTKE 2WPKS 2C93B 1HAHH 1HDTH 2SNVA 3ATWA 2FI3E 1NRNH 2G8TA 3KQEA 2HPQH 3UIRA 2BQ6B 1AKSB 1C4U2 3T2NA 4U30A 1SLUB 3SU3A 1CQQA 2V3HH 1GMHG 1V2TT 4NA8A 1YPMH 1TGTA 4ISOA 3MO3A 2GMTB 3EYDA 1P12E 1GBDA 1ESAA 1GBJA 1AD8H 5FPSA 1C2HA 4J2YB 1H9HE 2BOHB 4R0IA 1QJ1B 3G01A 1FAKH 4FUEA 1N6XA 2VWMA 1EJNA 4X6NA 2UUKB 1QRWA 4FUDA 1C2EA 2GDEH 2AFQB 4I32A 1ZGVA 4IGDA 3T62A 1FDPA 1O5AB 2ANKH 1OWKA 3HK3B 5EXNA 4OGXA 2ZHFH 1HYLA 2AH4X 1C2MA 1LVBA 1XXFA 3Q3KA 1SPJA 3M61U 3VB3A 3KCGH 3URDA 2UWPA 1QQ4A 1P04A 1ZHPA 3N7OA 4FUBA 2LNCA 5A8XA 1GBTA 3QUMP 1THSH 1F5RA 4WWYA 1NPMA 1EJMA 2QGRA 2LPRA 3WY8A 5BRRE 1EJAA 4FVDA 5TCAA 1C1SA 1GDNA 1FMGA 4Q7ZA 1DS2E 2J4IA 1J15A 1HXEH 1UTPA 4DCDA 1FUJA 1LO6A 4YOIA 1AGJA 1ELFA 3PMAB 1HAVA 1Z6EA 2ZEBA 3Q76A 2OC0A 4XE4A 1D6WA 3TJOA 3O8RA 2TBSA 2B8OH 3A8DA 2GCTC 3GY4A 1DPOA 4FXGH 1W13U 1L2EA 1FY8E 1O2ZA 2VWLA 4U2WA 1J14A 3OX7U 2A7HA 3MH7A 2OP9A 3GOVB 4X1QU 5FXLA 5C2ZA 1A46H 5GPIB 1O3CA 3S0NA 1DWBH 1AIXH 5EODA 1TQ0B 1YPLH 4YTAA 5A8YA 3TNTA 1JRSA 1DSUA 3QTOH 3A83A 4K1SA 3QGNB 1WU1A 3RLYH 4SGAE 3SNDA 3L33A 4Y79A 4J1YA 1T8MA 4NIXA 1BRAA 2FM2A 2F3CE 1V2PT 4QT8C 5L6NH 3U8OH 1K1MA 1YGCH 3Q77A 4IC5A 3A88A 2BY9X 1TBRH 1MAYA 1P11E 1HIAA 2HPPH 4AGKA 1ABJH 1V2NT 1CA8B 4TWYA 1PQ5A 4GHTA 1TLDA 2OC1A 3OSYA 3K9XB 2G5VA 4ABBA 2CJIA 4FUFA 1SQOA 1LVOA 4TPYA 2OD3B 1AO5A 3A7YA 3V3MA 2Y5GA 5K7RA 1MBQA 4UD9H 3M3SA 1PPHE 4LZ1H 3PTNA 3A8AA 1O2RA 4Z0KA 5CHAB 4TWWA 2P16A 1D3DB 1WAYB 3IITA 2BLOA 3T27A 3TJNA 3O8DA 1CT2E 2BOKA 4K69A 2AMDA 1G36A 1TE0A 1BJVA 4UEHH 1SL3A 2QF0A 5FPTA 3URCA 1LQEA 3ZVAA 3RXKA 1Z8IB 1QCPA 4TY7A 5C20A 2C90B 2XBVA 4H6TA 3ESTA 2HWLB 1C5TA 3SJKA 1LVMA 1CGHA 2ZECA 4I8HA 1IHTH 1NFXA 1DUEA 1QL9A 3S9AA 2BD4A 2BX4A 2VB0A 4I8GA 1GDQA 1EAWA 4BNRA 1NFWA 4GUXA 3FZDA 1LQDB 2M5TA 1F0TA 2A2XH 1AN1E 1G37A 3P8FA 5A8ZA 4X2WA 3TU7H 2P95A 2ZGCA 1C9PA 3LGTA 2XNIA 3MNBA 3CP7A 5C1YA 1ZTKA 2F9PA 3UQVA 3ZVGA 5F6MA 1RXPA 3LH1A 5ETXA 5DP3A 1A2CH 3SV9A 3A89A 1A5GH 1TNJA 3E6PH 3Q3YA 1JOUB 7GCHG 2Y6TA 1SFQB 2G4UA 1PQ7A 2Z3DA 1V2WT 1C2JA 1NN6A 2OC7A 3FANA 5A2MH 1DLKB 2G00A 1HAIH 1GJ9B 1BMAA 1GI7B 4AFUA 2ZFSA 2A2QH 1QBVH 3EA9A 1UK2A 1L1JA 4DGJA 3A7WA 5H4IB 3UFAA 1EASA 1TNGA 2QXJA 4X1SU 2BDHA 2PLXA 1TGSZ 3RXAA 3LKWA 1Q3XA 1RIWC 1O2SA 3BTQE 5TJXA 2G52A 1O2OA 4HI3A 5HM9A 2THFB 1AE8H 1ZHMA 2CF8H 1N6YA 2AERH 4B73A 3RXEA 1N8OB 1HJAB 1F5LA 4JYVH 1DWDH 3KF2A 1TRYA 3LJOA 3GCHB 1QJ7B 2Y82A 3SU4A 2NU0E 1JIRA 1UJ1A 2ASUB 4ZH8A 1UTLM 1P3CA 1DE7H 1JBUH 3S7KB 3V7TA 4ZHMU 5HGGA 1SB1H 4A92A 1OWHA 2GCHG 1C5VA 3NCLA 4MG3A 1SGTA 4UFGH 1SGDE 2WV5A 1Y3VA 3AVZA 3SI4H 3UR9A 3F9HA 1T31A 4YLQH 4DT7B 4DURA 1UVTH 1Z8JB 3S9BA 3SU6A 1ARBA 2TRMA 4INLA 3P95A 1IQLA 1THRH 2ZCHP 3W94A 4CRGA 5DP8A 1ESTA 2GKVE 4Y76A 1D6RA 4CH2B 1H4WA 5C5NA 2O8MA 1BRCE 2A4RA 2AGIX 1GHAF 4JMYA 1C5PA 3QX5H 3TH4H 4B2BA 2QIQA 1FI8A 3DD2H 3SUEA 1FY1A 5EU8A 1DLEA 1XUKA 3KQCA 3M7TA 3R0FA 2EEKA 2J2UA 1C5QA 3I78A 4I8KA 1NRPH 2KAIA 3UY9A 2BZ6H 2A0QB 1LCYA 1GMDG 3F9GA 3UQOA 5AFYH 5DP9A 4AOQA 1ANDA 1AI8H 2IJOB 3F1SB 1L0ZA 2VVCA 1WOFA 4ZROA 1P57B 1L1NA 1S0RA 1ZRKA 1GBEA 3MHWU 4HGCA 1SQAA 4UFEH 1O2VA 4VGCB 2GDDA 4E06H 3TIUA 2ZHWH 3BG4B 3CS0A 1BTWA 5C1UA 3QLPH 7KMEH 2DE8A 2Z9GA 2SGDE 2SFAA 4BAHB 1MCVA 5LH8A 1H9IE 2ZTXA 3PWBA 3UPEA 3EE0B 2WPJS 5EQSA 1DICA 4DJZB 8GCHF 3QWCH 1G3EA 3PYHA 2VU8E 1D4PB 1UHBA 1CT4E 1BTZA 1GI9B 4AFZA 1ZMJA 2OUAA 1MU8B 1AWFH 1O5FH 3BTDE 5FCRA 2QXIA 2CHAB 1N8OC 2VVVA 1QR3E 5JBBS 4R8TB 1KTTB 1NU7B 1WQSA 4UFFH 5HMAA 2V3OH 2CGAA 4E05H 4X8TH 2P8OC 3MNXA 2ZU3A 1PYTC 4H4FA 1FPHH 1O5CB 3E16B 1HB0B 2WPMS 1B0EA 3A85A 3EQ0H 1TABE 3SBKA 1GJ7B 1SGPE 9LPRA 1P3EA 1W11U 3QDZB 2OXSA 3PLKA 2B0FA 2GT8A 1LKBA 1TX7A 4RN6A 1VCQA 4WMFA 3F6UH 4FUGA 5DO4H 1HAVB 2BDGA 3PO1B 2PKSB 1SGEE 2EC9H 3OYPA 1IOEA 1EP5A 4B74A 3GY6A 3U8TH 3ZZ8A 1HUTH 2ANMH 2JH5D 2JKHA 1O3FA 1QB1A 4ABEA 2ZPSA 2K1QA 3SNCA 4X2XA 1CGIE 3MWIU 2SGQE 3DHKH 2PGBB 2ZU2A 1CGJE 4X1NU 4AB9A 1BHXF 1XX9A 1Q31A 4XBDA 2R0KA 1BTXA 2ZDKA 3T28A 1H8IH 1YPKH 1NROH 3RXDA 4NFFA 2VIDA 1PPZA 2XC4A 1AVWA 3QO6A 3U1IB 4CHAC 2BY5X 3A86A 2QAAA 3GY3A 2BD8A 1HIAB 4Y0ZE 3TH3H 1XUHA 1P09A 3ZZ4A 2VVUA 2ZKSA 4CRCA 3OU0A 4Q7XA 4VGCC 1GHBG 1TNHA 2VWOA 3BIVH 2Y81A 3D23A 1D3QB 2QA9E 1S85A 1IQIA 1O34A 2BDYA 1CHGA 5JDUB 2VIWA 4JZEH 4WXIA 1DANH 3RC6A 4NFEA 3S9CA 4O3TA 2GZ8A 5EQQA 3RU4E 3SGQE 1WTGH 4B71A 3R3GB 3M5LA 4AGJA 4YOJA 5ESTE 2QN5T 1C5LH 1Z7KA 3JZ2B 3GY5A 2FX6A 2F9NA 1XXDA 1G2MA 2J9NA 1FONA 2BD2A 9ESTA 1CHOF 1P01A 2BLWA 3S7HB 1BHXB 2FS9A 4AYYB 2ZU4A 3F9FA 5PTPA 1HPGA 3RXLA 3M7UA 2GV6A 1HCGA 2CHAC 1B7XB 4LZ4B 2TGDA 2CXVA 2G5NA 3BG8A 1KXCA 2FI5E 3SJOA 1BMMH 1ZPCA 2WYJA 2CV3A 1DUAA 4NZLA 4ABAA 1LPZB 1EPTC 2FODA 1KDQB 1FV9A 2ZQ2A 3BSQA 5L2YH 1ANCA 3K65B 2XBWA 3NKKA
chains in the Genus database with same CATH superfamily
1P10A 3LJJA 1NT1A 3UWJH 4ABDA 1P0SH 6GCHF 3E8LA 2Y7ZA 3M35A 5FBIA 1MBMA 4CRAA 4O9VA 3SJ8A 2P93A 1HXFH 3RXTA 2JETC 5DKMA 3GS9A 3M7QA 3LPRA 2BZAA 2ZI2H 3D49H 1DXWA 1O5EH 2F9VA 2XW9A 2R2WU 1UTJA 1BDAA 1NBMD 1SOZA 1O37A 1S5SA 5JBAS 1TWXB 2TGPZ 5L30H 3RXGA 1O2LA 3RXFA 1GVZA 1D9IA 1YPEH 1F5KU 1P2KA 1GJBB 3DA9B 3MNSA 4JYTA 3RU4D 3E3TA 4Y7AA 1IQNA 4A5TS 1GI3A 1PPBH 5EPYA 2BY6X 3KHVA 2JH6D 1BCUH 1Y59T 4H42U 4DW2U 1C1TA 1BITA 1WTHD 1EB2A 1P2MA 3AASA 4BAOB 4CRBA 3ZV9A 2QXHA 5L2ZH 5DG6A 3TJUA 2ZDAH 5FCKA 4PROA 3N7DA 1XUJA 1QBNA 2B7DH 3AK5A 1OWIA 1C1NA 4B76A 1V2VT 3KGPA 4Y8ZA 2A1DB 4Q80A 5GCHG 1BBRE 4JYUH 2ZHDA 2TGAA 1VCWA 4MLFB 1OKXA 4D8NA 3MYWA 4ZKRU 1HAYB 1NFUA 2ULLA 3SV8A 2YNAA 1VITH 1UCYE 2EI7A 2BDIA 2F9BH 1P2OA 3PLPA 2OLGA 2HNTC 1OXGA 1TYNA 3QTVH 1JRTA 4UONA 4BTUB 2FDAA 2ZTZA 1L4ZA 4KELA 2BYAX 2UUJB 1WXRA 1AZZA 2BY8X 3M3VA 3UOPA 1RGQA 6CHAC 3MMGA 5C17A 1G2LA 1B5GH 3WWBA 3MU5A 1C1QA 1TX6A 2OCVB 2VIPA 4K60A 1F0SA 2ZGHA 2VH6A 1T32A 4LK4A 4BXWA 3NUMA 5E2OA 2Y5FA 4WJG2 3SV2H 3RXSA 1DOJA 2P3TB 2H9TH 2KAIB 3SU1A 3T29A 4GAWA 1ZMLA 3VGCB 3HPTB 3LT3A 1CA0C 1H8ED 1SBWA 3HK6B 1QURH 4ZKSU 3BIUH 1DXPA 2VIQA 1DX5M 2ESTE 1NTPA 2C8XB 1P2IA 1ELTA 2QXGA 1Y5AT 3T25A 1FIWA 1TONA 3SI3H 3VFEA 1KTSB 1SSXA 1VJ9U 2RDLA 1K28D 1BMFD 1BRUP 4Y8YA 3L6PA 3MOCA 1C1MA 2XCFA 1RTFB 3RLWH 3UUZA 2J92A 5KGOA 1K1PA 3C1KA 3RXCA 1GHVH 1KLTA 3FKSD 3ZVDA 4O3UA 8GCHG 4RI0A 1YF4A 5DP4A 1VITG 3FO8D 1GBKA 1UHBB 1YM0A 3ZYEA 1AFQB 8ESTE 3ELAH 1A7SA 1SGCA 1VCPA 6ESTA 2VWNA 3SHAH 1P06A 4NSYA 1YPJH 3SV7A 1GI5A 1MKXH 3B8JA 4DIIH 2W5EA 1GHWH 4FUCA 3ZZBA 4X8SH 5FL7D 1P2QA 1KXDA 1J9CH 2QF4A 1AQ7A 1V2KT 1ZJDA 2J97A 2ANYA 4B2AA 2Q6DA 3SNBA 2BHGA 2KCPA 4FU9A 3A8CA 3QZRA 2C8WB 1G3CA 4X6PA 2XRCA 1K1JA 5EXLA 3RMOH 4AG2A 4CR5A 1CSOE 2RA0A 3RP2A 1V2UT 2KM0A 4RSPA 2P3FH 1AUJA 1MMJN 2G55A 2K0QA 1AFEH 1HAZB 1T7CA 1SGNE 3VB4A 2GMTC 2LELA 1SVPA 3IG6B 1W0ZU 1GWAA 1BT7A 3QZQA 1ZJKA 1VJAU 2FOBA 2PWXA 1HAXB 1P02A 2FWWA 4CBNA 4DIHH 2XWBI 2Z6BD 3A82A 3U28C 1EZUC 5GWZA 1D3PB 1UTQA 3LGWA 1ELDE 4JK5A 4XDEA 4OS1A 3F68H 1F0UA 2P94A 3MQKC 4IBLH 1VGCB 3A84A 1HRTH 3OY6U 3VB7A 1HJ9A 2LIZA 1ELEE 2O8WA 1BBRK 1RFNA 2SNWA 4YT7H 1KDQA 1DDJA 1MTNB 1RTLA 4UFDH 1EOJA 1O30A 3WW7A 4I31A 1UCYK 1UVOA 3UNQA 3KQBA 5EPNA 3RXVA 2Z9KA 1T4UH 2IN2A 3KQDA 1TA6A 1S84A 4H6SB 2GZ7A 5E0JA 4A1XA 1AVXA 4MPWA 1VKYA 2BMGB 1K1OA 2Y5HA 4KKDA 5I25A 3SV6A 1LHEH 2NU4E 1AHTH 1UTKA 3SQEE 1TA2A 2VGCB 3N7EA 2GVFA 4TT3D 1P03A 1JMOH 1MZAA 2NU3E 2CK3D 1ZSKA 1LHGH 3LGIA 3P6ZB 1XKAC 5KECA 5DGJA 5FPYA 2W3IA 3PWCA 1O3LA 2GV7A 1A1RA 1MU6B 2BXUH 4K3JA 1EKBB 3UR6A 2Z7FE 1QL7A 4ASUD 3A7TA 1P2JA 1OWDA 1GJDB 2Z9IA 2FS8A 3OFND 3D62A 1TALA 4FETA 2FEQH 1K1NA 1QGFA 3Q3XA 3GCNA 4MTBA 3EA8A 3E91A 5K0HA 1CHOG 4B1TA 3TNSA 3LOXA 2BY7X 1INCA 5CHBA 5SGAE 1PYTD 5EGMA 4F49A 2HVYB 5DP6A 4Z6AH 5AVDA 2Z9JA 5J4SA 2SGAA 4Y8XA 4WH8A 1AE5A 1ELAA 1LHCH 1NRQH 2UWOA 2FLBH 2QC2A 1GGDB 2P59A 2YOLA 3PMHB 3KEEA 1PJPA 4JZIA 5EW2H 4XD7D 1KYNA 7LPRA 4MVNA 5BPEA 2IOTA 2XYAA 4XBBA 4Y71A 3RXRA 1EAXA 4MNVA 1DVAH 2DE9A 3RXUA 1ANEA 3OY5U 5CHAC 2Z3CA 2AYWA 5LPRA 6GCHG 1O36A 5GXPA 2QYIA 1G30B 3PTBA 1A0JA 1O2YA 4NIYA 1YLCA 1C5SA 3BTTE 2FP7B 2PUQH 4LOYH 1O3GA 1O32A 1E0FD 1U6QA 1GJ5H 1FN8A 1GMHF 2ZDVH 3EAJA 1MTVA 1NFYA 3P17H 4X0WU 2HALA 1RS0A 2TPIZ 1AUTC 1C1RA 4YESB 3RM0H 1E1RD 5T6FA 3QGJA 3M5MA 4AORA 3M5OA 1MH0A 1OOKB 1NRRH 4XOJA 2CF9H 3RXBA 2JJ1D 4GCHG 1MKWH 1NESE 1ZPZA 2H9HA 2XC0A 3FAOA 1RJXB 3I77A 1S81A 2OBQA 3MH4A 5CMXH 1BBRH 2CMYA 3H7OA 5C0UA 4RKJB 1Z1IA 4I7YH 3FP8E 1LDTT 1FXYA 1LMWB 3RXMA 1UCYH 2OC8A 2ZFQH 4FU8A 1C5ZB 4MPVA 2H2ZA 1C2GA 1Q2WA 2R2MB 2ZFTA 3VXEH 3SU0A 2BXTH 1BTYA 2VNTA 4MNWA 2J95A 3AAUA 1WDIA 2O9QA 4U32A 1YYY1 2W26A 2FESH 3ENSB 5CE1A 3P70B 1O3NA 3ZZDA 2RDEA 1BQYA 1TBZH 4NIWA 1MCTA 4NWKA 1BTUA 3TJVA 4AX9H 1LKAA 1J16A 4D9RA 4DG4A 1BTHH 4MQAA 4I86A 1NRSH 1QB9A 2R3UA 1TOCB 3MU8A 2H1UA 4KTCA 1HJAC 2C4FH 2V35A 2Z9LA 1QJ6B 2A7JA 3GCHC 2ZC9H 3SU2A 2PR3A 4ISHH 2PKAA 1XUGA 1C1OA 3U8RH 2ZCKP 1FLEE 1C1PA 2HNTE 2UWLA 3F9EA 3A7XA 3PROA 1MQ6A 1TMTH 4DVAU 2FTMA 5EG4A 3DFJA 3E0NB 1GGDC 1O3IA 3E1XB 3GISB 1O33A 4Y6DA 4THNH 1C5XB 1V3XA 1GJCB 4K1TA 1H9LB 3PMJA 4JCNA 5AHGH 2Y80A 4D76A 1C5RA 1EZQA 2FOAA 3ZIAD 3HKIB 2A5IA 1QY6A 4P00A 1VZQH 1GBAA 1HJ8A 5GIBA 1Z6JH 1ZTLA 2JH0D 4NZQA 1V2LT 3PLBA 3LDXH 1ELGA 5HM2A 3JZ1B 2A5KA 1EXFA 3W95A 4A6LA 1FIZA 1SGRE 1TFXA 4ZKNU 2VJ1A 3U1JB 1PPFE 2HGTH 4CBOA 2ZU5A 5C67A 1OX1A 3T5FH 5AF9H 1ZHRA 2PSXA 2WPHS 2RCEA 2QE7D 5JB8S 4BAMB 5GNDA 1WYKA 1ARCA 1QHRB 2W6JD 2OQ5A 1MTSA 4ZXXH 2C3SA 1GHZA 2HNTF 1ETRH 3F2HA 5F8ZA 3UNSA 5EW1H 2AEIH 3SYJA 2ANWA 1SG8B 1P8VC 1AB9B 3IWMA 1WUNH 2ZCLP 1O3BA 4K1EA 1GBHA 2GZ9A 1BOQA 3QN7A 1W14U 1TAWA 4B2CA 3FZZA 3TK9A 4YO9A 2BQWB 1O2NA 3BEIB 2JJ2D 2VBCA 3BG4C 2PTCE 1E1QD 2QCYA 2L6OA 4XBCA 1A0HB 1GCTB 1EZXC 5ABWA 1ETSH 4DOQA 1EOLA 2BDAA 4ABJA 3TPIZ 4K8YA 2VIVA 4WMEA 7GCHF 4KTUA 1Y3UA 3RXJA 1CT0E 4WF8A 1Z71A 2A4OA 3PV5A 1DY8A 3ZZ9A 3SN8A 3UAIC 3ODDA 1KY9A 5E2PA 5C0TA 1T8OA 1MZDA 1B0FA 3CENA 1GG6B 4AFSA 2KX4A 1Y5UT 1O0DH 2BX3A 3MO9A 4O03A 1W10U 4YXWD 1TB6H 2AGEX 1HV7A 2OBOA 1F0RA 1MD8A 2NU2E 2ZDNA 5DK1A 3HGPA 4CRFA 2H9EH 1IQJA 5AFZH 4BTIB 2ZGBH 3BV9B 1MTUA 2Y7XA 1FY4A 3GY2A 4MNXA 1FPCH 2FI4E 1EQ9A 1DSTA 3U9AH 3F2GA 3ZVFA 2FOCA 1YP9A 3U98H 1HAGE 5DP5A 4OS5A 3SHCH 1N1LA 2UUFB 1C2LA 1O3JA 1C1WH 1O38A 5F8TA 2ZNKH 1ORFA 4IS5A 1MAXA 2ILNA 2ZFFH 3V13A 1LTOA 1RD3B 5HXFA 3BN9A 3O8CA 8KME2 2XTTB 3KN2A 1XUFA 3B23B 2BB4A 4AC9A 1O2QA 4B75A 1NY22 2F83A 5E8EH 3STJA 2O8UA 3CNRA 3MTYA 1PPCE 3CS7A 2ZF0H 3PO1C 1C4Y2 2PKSC 2Z94A 3AW0A 1SGIB 3A8BA 1P9SA 5HYOA 4INHA 1UK3A 2H6MA 4AN7A 3LONA 3AAVA 3MH5A 4WH6A 4X2VA 2ODQA 3KYGA 1DY9A 1YPGH 3ZVCA 1LHFH 3BTFE 3TH2H 1C4V2 1NM6A 1W8BH 3RXQA 1C2FA 5A0CA 2D8WA 2F91A 2GCTB 1W7GH 2A31A 2I6QA 3BF6H 4GSOA 2BLVA 3L3TA 5LGOA 2DUCA 1GDUA 4I33A 3LC5A 1C5YB 3ATLA 3GYLB 1OP2A 5I46H 1MKXK 2ZPRA 1C5NH 2VIOA 3MO6A 5DPAA 4WY3A 1ZZZA 5T6GA 1AMHA 2J38A 4ZCNA 4F4OC 2SGEE 4ISNA 4ISLA 2F9UA 1C5MD 4X2YA 3SUGA 2Q6FA 5JYIA 4NWLA 4ACBA 2Q6GA 2W7UA 1FNIA 1YKTA 3FP6E 5EIYA 5JBTA 1K22H 3GICB 3GYMA 5DJ7A 4FU7A 1GI6A 1SR5C 4INKA 1PFXC 4NCYA 3V0XA 4ZHLU 1HFDA 1EUFA 2EQNA 2H5CA 1EP6A 2FOGA 5LPFA 1O3KA 3NXPA 3SGAE 4K2YA 2A7CA 2YMSD 1ZOMA 2ZFPH 3ZZ5A 1BZXE 2GT7A 1EATA 2EI6A 3ZVBA 3ZZ6A 2PV9B 1YPHC 2WZQA 3MU4A 1GG6C 1O35A 4OS2A 4NA7A 1E37B 1GHAG 5EOKA 3SORA 2ZPQA 5C3NA 1F92A 1UMAH 4JZFH 4I8JA 4WXVA 5HIYA 5HKKD 1SKYE 2CN0H 1BA8B 2FTLE 1BJUA 5DP7A 5E0GA 2YMSB 2XOKD 1O3MA 2O8TA 4IMZA 1OP8A 3SU5A 1MABB 1S83A 1TX8A 1Y5BT 5TCCA 3UNRA 3DFLA 3SJ9A 2BVSH 3KIDU 4LXBH 1GJ6A 1GL1A 2KCYA 2QF5A 3NPSA 3PB1E 1GCDA 1W0JD 3UOUA 1EPTA 3RC4A 2WUBA 3TVJB 2SGPE 1QTFA 1SMFE 1QQUA 2ZP0H 2NWNA 1V2ST 3STIA 1WSSH 3TGIE 4GLYA 2HVXA 3LC3A 3FFGA 1O2XA 1IQGA 1W3CA 3MFJA 3RXOA 4UE7H 2PSYA 5A09A 1FY3A 3RMLH 4OS6A 3M3TA 5ESBA 5GDSH 2ODPA 1KXEA 4X6MA 1YLDA 2ZU1A 1XVOA 4KGAA 4OGYA 3A7VA 3A7ZA 4UDWH 3KL6A 1O2GH 1TPAE 1G3BA 1GMCF 2XCNA 3GDSA 5LPEA 1HBTH 2BVRH 1HLTH 3TK6A 1GI0A 1UVUH 1TRMA 1AY6H 2D26C 5EJZA 2ODYB 1YWUA 3ATIA 1RIWB 3F3BA 1MUEB 1OS8A 2OK5A 1O3PB 2ZFRH 1SI5H 2PKAB 1UVSH 1AU8A 1CBWB 1OYQA 1CO7E 2QY0B 2ZGXH 5FBEA 1O3OA 1Y3YA 2FLRH 2J94A 2WV4A 2D2DA 4OS4A 4YM9A 3ATKA 3LIWA 4ZXYH 1P2NA 4DT4A 1GBFA 1GHBF 2P3UB 1EAIA 3P8NA 1A5IA 2ZGJA 1O2PA 4IC6A 3LGUA 1Y8TA 1C1VH 2F43B 2WINI 1GJ4H 1S82A 3GDUA 1TNIA 4NIVA 3RUOA 1V2QT 4X8VH 2WPIS 3HKJB 4GVUA 1BUIA 2ZA5A 3RXPA 3M36A 2FOFA 2HRVA 3OTJE 2IJD1 2J5UA 3DCLA 1BIOA 1DFPA 1GJAB 1Z8GA 2FYRA 1O2JA 1K1IA 2FX4A 1MKWK 1S0QA 1BMNH 1SQTA 1V2JT 3BEUA 2G4TA 3GCTF 5IYTA 2FOHA 1K2I1 5EJ1A 2GJGA 1JXPA 2FOMB 2TIOA 1W0KD 2HLCA 4A1TA 5FHTA 2V0BA 3BTME 1P9UA 1ESBA 3VGCC 1TPOA 1HNEE 3MI4A 1BMLA 3VB5A 1W7XH 3NZIA 1SFIA 1WBGB 2BQ7B 5C5OA 5CDFE 1C9TA 4BAQB 2OTVA 3NK8A 4ZKOU 1OHHD 4GHQA 1K1LA 3T26A 4Q2KA 1TMBH 4YLUA 1OPHB 3ZV8A 1Z8RA 4BTTB 4Y10E 1FN6A 1O3AA 5T6DA 4CH8B 4D9QA 2BD7A 5F53A 3TITA 2YNBA 1A0LA 1C5OH 1K0HA 1ZLRA 4RKOB 2LP6A 3GY7A 1C1UH 1F2SE 2BD3A 1GL0E 1KSNA 4AFQA 1IHSH 1MQ5A 1TGBA 3DSPA 3ATMA 1DWCH 2K7XA 3C27B 3OEHD 1ETTH 2XNDD 1A4WH 3VEQB 2ZDMA 1O2IA 2B9LA 1GI8B 1AFQC 4ABHA 1SOTA 3SO3A 3MNCA 1G32B 1GI2A 1TPPA 4M7GA 3BTEE 4ABFA 4AYVB 1QB6A 1P05A 3VXFH 4YT6H 1TMUH 1LPKB 1OYTH 2GGVB 4D7GA 4HZHA 5JPMH 4XSKU 5KEDA 3BTWE 3MU1A 1O3EA 2AS9A 1CBWC 2WYGA 7ESTE 2W3KA 1XM1A 1IQFA 1ZGIA 3ODFA 2A4QA 4ABIA 2SGFE 3AW1A 2BDBA 2ZHEH 2RFKC 3SQHE 4CREA 2P8OB 3M5NA 2EA3A 3UREA 1KXBA 3A87A 1T8LA 1GVKB 2XBYA 4IW4E 1W2KH 4MNYA 4NA9H 1O3DA 2FZZA 5GCHF 1KXAA 1EZSC 2VINA 4YOGA 3ZZCA 3EBNA 3GY8A 3VG8A 1QRXA 3U69H 1Z1JA 3VB6A 1AKSA 4JK6A 4ZAEA 3UTUH 2OINA 1V2OT 2BDCA 3B9FH 1ID5H 2IPQX 2QV1A 4MPXA 3SW2B 1ZSLA 1E35B 1O31A 3MU0A 1GBCA 2F4LA 1KIGH 1VGCC 1NS3A 1YCPK 2EI8A 3P92A 1O5GH 2ZG0H 2R9PA 1GBMA 1K9OE 4U01A 1GI4A 1GHXH 1FAXA 1O39A 1MTNC 1QBOA 4WMDA 4TPIZ 2ZTYA 1DM4B 1LPGB 2BD9A 1V6DA 5G4BA 1H1BA 2RA3A 2GX4A 1X7AC 1WV7H 1V2MT 1ZSJA 3DSGA 3EE7A 3K6ZA 1GBBA 2VGCC 4X1RU 5GJ4B 3K2UA 1DWEH 2W7SA 3M37A 4CHAB 3H5CB 1IQHA 2C8YB 3P8OA 4FUIA 4FUHA 4FUJA 1Y3XA 2R0LA 3A81A 5FAHA 1QFKH 1O2KA 1QL8A 4E7NA 3LGVA 2RG3A 2AHME 3ZVEA 3HGNA 1O2MA 1C2DA 1YCPM 3SUDA 3VPKA 2AGGX 2PFEA 1WQVH 2VH0A 3FP7E 4ACAA 1SHYA 3SGBE 1EX3A 3O8BA 4FVBA 3H7TA 3ZYDA 2D1JA 2NU1E 1O2TA 1C5UA 2PP6A 2UUYA 3QK1A 1PQ8A 3PMBB 1VITF 2FYQA 1TOMH 5B6OA 3LH3A 3F0PA 2G51A 1LVYA 1GI1A 4CR9A 1K21H 2XC5A 2AMQA 1RRKA 5JB9S 4X8UH 1OWJA 2XXLA 1S6LA 3RM2H 3OE7D 1QIXB 1YC0A 1GBIA 1TBQH 3RU4T 5EQRA 1PPGE 5EXMA 4B6FA 1M9UA 1YPHE 2BLQA 3P8GA 1IAUA 2XBXA 4D7FA 4K5ZA 1PQAA 1GVLA 1BTPA 4SGBE 3Q00A 1S6HA 2ALPA 1TNLA 4MDSA 3E90B 2ZDLA 1SGFA 5C1XA 1ELVA 3V12A 1EPTB 1DT2A 1TGCA 5F03A 1G3DA 2ZWLH 3BTHE 5J4QA 3EGKH 1H8HD 4OS7A 1LHDH 1KLJH 3ZZAA 1KMHB 3PM3A 3TLOA 2AMPA 4XFQA 1THPB 1UTOA 3S69A 4X1PU 2JETB 3DT0H 1IQKA 1SGFG 2QF3A 1SHHB 1MD7A 2GD4B 1C5WB 1NO9H 1CU1A 2PW8H 3BTGE 4WVPE 1ANBA 2XWAA 5FX6A 3ZZ7A 1ACBE 4AZ2B 4HTCH 1F7ZA 2Z3EA 5F8XA 2KR7A 1XMNB 3NRLA 1W12U 1T8NA 1O5BB 2BM2A 1YCPH 1GPZA 2ZZUH 4ESTE 1CVWH 1AZ8A 1J17T 1GMCG 4CRDA 4GPGA 3GDVA 3FVFB 4Q63A 1TGNA 3PV4A 1L4DA 1SC8U 1ZMNA 1O5DH 1OSSA 1A61H 1ELBA 2PTNA 2HLDD 4I8LA 4Y11E 1O2WA 1GBLA 1KXFA 2ZHQH 4IMQA 1H8DH 2H5DA 2IPHA 1SLXB 6LPRA 2AIPA 4JZDH 1FJSA 4NG9H 2FPZA 3SNEA 1BB0B 1IQEA 4JZ1A 4KP0A 1ZYOA 1FZZA 1KLIH 1IQMA 3NWUA 5FX5A 5T1VA 4KTSA 4BANB 2PHBA 2FO9A 5E0HA 4E7RG 2HOBA 2ALVA 4ISIH 4Q7YA 1FY5A 2V6NA 5A0BA 2O8LA 1A3BH 1HAOH 3SZEA 4O97A 1TIOA 3UWIA 1E36B 1SGQE 4Y7BA 2STAE 2GP9B 1E38B 3D65E 1C2KA 1T4VH 1QA7A 1TQ7B 2F9OA 1AWHB 1W0YH 2KFWA 3SJIA 3GCOA 2I6SA 1UTNA 3KNXA 1JIMA 3RDZA 3DUXH 3A80A 3RXHA 1D3TB 3SOSA 4MPUA 1A5HA 2BD5A 3ITIA 2FMJA 1HGTH 2WUCA 1E79D 1RTKA 2PGQB 2A4GA 5T3HA 1CE5A 3GCTG 6CHAB 3EDXB 4K8BA 5IDKA 1G9IE 1VR1H 2A32A 1QRZA 1UVPA 1UTMA 2A5AA 1OP0A 3RMNH 4AG1A 1EAUA 2GCHF 2BVXH 4ZMAH 1MTWA 4A7IB 1ZRBA 5B6LA 3K6YA 4NGAH 2STBE 1WCZA 4YZUA 4HFPB 1ZPBA 1CA0B 1O2UA 1OWEA 4IN1A 1J8AA 2J98A 4ZUHA 2AIQA 2J34A 1TRNA 3EA7A 2WPLS 3PV2A 5A0AE 1SLVB 3ZZ3A 4ZHAA 1XVMA 4BAKB 1XKBC 3I29A 3TGKE 1ABIH 3SZNA 1DITH 3TGJE 1UO6A 1SLWB 1TPSA 4TY6A 3F2FA 1E34B 3RMMH 1BRBE 1Y3WA 1O3HA 2R3YA 3OAAD 3SNAA 1EB1H 1ZR0A 2B5TB 1C2IA 1NZQH 1YBWA 1AVGH 3E0PB 2A45B 2PUXB 4ASHA 1QA0A 2G81E 1FQ3A 2Q1JA 4TYDA 3RXIA 1NC6A 3MH6A 4IN2A 4XRNA 2ZIQH 2GTBA 1NU9A 1XUIA 3SUFA 3TK5A 2FOEA 1AB9C 1PPEE 1L1GA 4GCHF 1V2RT 1GHYH 1O2HA 1S6FA 2OQUA 3BEFB 1HAPH 3PRBA 2TGTA 1A3EH 1GMDF 1UK4A 2BTCE 1ELCA 4ABGA 4AB8A 3LU9B 1JWTA 1SGYE 4X6OA 4A1VA 4Z1MD 3HATH 4NSVA 3LGYA 1TNKA 3UB0A 2EY4C 5JBCS 4BOHA 1GCTC 2FIRH 4DY7B 2FXRA 2K8IA 1ZTJA 2ZO3H 2C8ZB 1GJ8B 4BXSA 1QNJA 2ZQ1A 8LPRA 4Y0YE 3RC5A 3BTKE 2WPKS 2C93B 1HAHH 1HDTH 2SNVA 2KZ4A 3ATWA 1YY3A 2FI3E 1NRNH 2G8TA 3KQEA 2HPQH 3UIRA 2BQ6B 1AKSB 1C4U2 3T2NA 4U30A 1SLUB 3SU3A 1CQQA 2V3HH 1GMHG 1V2TT 4NA8A 1YPMH 1TGTA 4ISOA 3MO3A 2GMTB 3EYDA 1P12E 1GBDA 1ESAA 1GBJA 1AD8H 5FPSA 1C2HA 4J2YB 1H9HE 2BOHB 4R0IA 1QJ1B 3G01A 1FAKH 4FUEA 1N6XA 2VWMA 1EJNA 4X6NA 2UUKB 1QRWA 4FUDA 1C2EA 2GDEH 2AFQB 4I32A 1ZGVA 4IGDA 3T62A 1FDPA 1O5AB 2ANKH 1OWKA 3HK3B 5EXNA 4OGXA 2ZHFH 1HYLA 2AH4X 1C2MA 1LVBA 1XXFA 3Q3KA 1SPJA 3M61U 3VB3A 3KCGH 3URDA 2UWPA 1QQ4A 1P04A 1ZHPA 3N7OA 4FUBA 2LNCA 5A8XA 1GBTA 3QUMP 1THSH 5DN6D 1F5RA 4WWYA 1NPMA 1EJMA 2QGRA 2LPRA 3WY8A 5BRRE 1EJAA 4FVDA 5TCAA 1C1SA 1GDNA 1FMGA 4Q7ZA 1DS2E 2J4IA 1J15A 1HXEH 1UTPA 4DCDA 1FUJA 1LO6A 4YOIA 1AGJA 1ELFA 3PMAB 2WPDD 1HAVA 1Z6EA 2ZEBA 3Q76A 2OC0A 4XE4A 1D6WA 3TJOA 3O8RA 2TBSA 2B8OH 3A8DA 2GCTC 3GY4A 1DPOA 2M2AA 1W13U 1L2EA 4FXGH 1FY8E 1O2ZA 2VWLA 4U2WA 1J14A 3OX7U 2A7HA 3MH7A 2OP9A 3GOVB 4X1QU 5FXLA 4F48B 5C2ZA 1A46H 5GPIB 1O3CA 3S0NA 1DWBH 1AIXH 5EODA 1TQ0B 1YPLH 4YTAA 5A8YA 3TNTA 1JRSA 1DSUA 3QTOH 3A83A 4K1SA 3QGNB 1WU1A 3RLYH 4SGAE 3SNDA 3L33A 4Y79A 4J1YA 1T8MA 4NIXA 1BRAA 3WWFA 2FM2A 2F3CE 1V2PT 4QT8C 5L6NH 3U8OH 1K1MA 1YGCH 3Q77A 4IC5A 3A88A 4FOUC 2BY9X 1TBRH 1MAYA 1P11E 1HIAA 2HPPH 4AGKA 1ABJH 2JDID 1V2NT 1CA8B 4TWYA 1PQ5A 4GHTA 1TLDA 2OC1A 3OSYA 3K9XB 2G5VA 4ABBA 2CJIA 4FUFA 1SQOA 1LVOA 4TPYA 2OD3B 1AO5A 3A7YA 3V3MA 2Y5GA 5K7RA 1MBQA 4UD9H 3M3SA 1PPHE 4LZ1H 3PTNA 3A8AA 1O2RA 2WHXA 4Z0KA 5CHAB 4TWWA 2P16A 1D3DB 1WAYB 3IITA 2BLOA 3T27A 3TJNA 3O8DA 1CT2E 2BOKA 4K69A 2AMDA 1G36A 3DSOA 1TE0A 1BJVA 4UEHH 1SL3A 2QF0A 5FPTA 3URCA 1LQEA 3ZVAA 3RXKA 1Z8IB 1FX0B 1QCPA 4TY7A 2YMSC 4P02A 5C20A 2C90B 2XBVA 4H6TA 3ESTA 2HWLB 1C5TA 3SJKA 1LVMA 1CGHA 2ZECA 4I8HA 1IHTH 1NFXA 1DUEA 1QL9A 3S9AA 2BD4A 2BX4A 2VB0A 4I8GA 1GDQA 2JIZD 1EAWA 4BNRA 1NFWA 4GUXA 3FZDA 1LQDB 2M5TA 1F0TA 2A2XH 1AN1E 1G37A 3P8FA 5A8ZA 4X2WA 3TU7H 2P95A 2ZGCA 1C9PA 3LGTA 2XNIA 3MNBA 3CP7A 5C1YA 1ZTKA 4TSFD 2F9PA 3UQVA 3ZVGA 5F6MA 1RXPA 3LH1A 5ETXA 5DP3A 1A2CH 3SV9A 3A89A 1A5GH 1TNJA 2V3MA 3E6PH 3Q3YA 1JOUB 7GCHG 2Y6TA 1SFQB 2G4UA 1PQ7A 2Z3DA 1V2WT 1C2JA 1NN6A 2OC7A 3FANA 5A2MH 1DLKB 2G00A 1HAIH 1GJ9B 1BMAA 1GI7B 4RT1A 4AFUA 2ZFSA 2A2QH 1QBVH 3EA9A 1UK2A 1L1JA 4DGJA 3A7WA 5H4IB 3UFAA 1EASA 1TNGA 2QXJA 4X1SU 2BDHA 2PLXA 1TGSZ 5DSFA 3RXAA 3LKWA 5C94A 1Q3XA 1RIWC 1O2SA 3BTQE 5TJXA 2G52A 1O2OA 4HI3A 5HM9A 2THFB 1AE8H 1ZHMA 2CF8H 1N6YA 1YLNA 2AERH 4B73A 3RXEA 1N8OB 1HJAB 1F5LA 4JYVH 1DWDH 3KF2A 1TRYA 3LJOA 3GCHB 1QJ7B 2Y82A 3N99A 3SU4A 2NU0E 1JIRA 1UJ1A 2ASUB 4ZH8A 1UTLM 1P3CA 1DE7H 1JBUH 3S7KB 3V7TA 4ZHMU 5HGGA 1SB1H 4A92A 4OM9A 1OWHA 2GCHG 4F55A 1C5VA 3NCLA 4MG3A 1SGTA 4UFGH 1SGDE 2WV5A 1Y3VA 3AVZA 3SI4H 3UR9A 3F9HA 2J98B 1T31A 4YLQH 4DT7B 4DURA 1UVTH 1Z8JB 3S9BA 3SU6A 1ARBA 2TRMA 4INLA 3P95A 1IQLA 1THRH 2ZCHP 3KYFA 3W94A 4CRGA 5DP8A 1ESTA 2GKVE 4Y76A 1D6RA 4CH2B 1H4WA 5C5NA 2O8MA 1BRCE 2A4RA 2AGIX 1GHAF 4JMYA 1C5PA 3QX5H 3TH4H 4B2BA 2QIQA 1FI8A 3DD2H 3SUEA 1FY1A 5EU8A 1DLEA 1XUKA 3KQCA 3M7TA 3R0FA 2EEKA 2J2UA 1C5QA 2L74A 3I78A 4I8KA 1NRPH 2KAIA 3H09A 3UY9A 2BZ6H 2A0QB 1LCYA 1GMDG 3F9GA 3UQOA 5AFYH 5DP9A 4AOQA 1ANDA 4M9FA 1AI8H 2IJOB 3F1SB 1L0ZA 2VVCA 1WOFA 4ZROA 1P57B 1L1NA 1S0RA 1ZRKA 1GBEA 3MHWU 4HGCA 1SQAA 4UFEH 1O2VA 4VGCB 2GDDA 4E06H 3TIUA 2ZHWH 3BG4B 4B6EA 3CS0A 1BTWA 5C1UA 3QLPH 7KMEH 2DE8A 2Z9GA 2SGDE 2SFAA 1SQRA 4BAHB 1MCVA 5LH8A 1H9IE 2ZTXA 3PWBA 3UPEA 3EE0B 2WPJS 3F0OA 5EQSA 1DICA 4DJZB 8GCHF 3QWCH 1G3EA 2WV9A 3PYHA 2VU8E 1D4PB 1UHBA 1CT4E 1BTZA 1GI9B 4AFZA 1ZMJA 2OUAA 1MU8B 1AWFH 1O5FH 3BTDE 1UW7A 5FCRA 2QXIA 2CHAB 5IK2D 1N8OC 2VVVA 1QR3E 5JBBS 4R8TB 1KTTB 1NU7B 1WQSA 2V7QD 4UFFH 5HMAA 2V3OH 2CGAA 4E05H 4X8TH 2P8OC 3MNXA 2ZU3A 1PYTC 4H4FA 1FPHH 1O5CB 3E16B 1HB0B 1COWD 2WPMS 1B0EA 3A85A 3EQ0H 1TABE 3SBKA 1GJ7B 1SGPE 9LPRA 3W1EA 1P3EA 4HG6A 1W11U 3QDZB 2OXSA 3PLKA 2B0FA 2GT8A 1LKBA 1TX7A 4RN6A 1VCQA 4WMFA 3F6UH 4FUGA 5DO4H 1HAVB 2BDGA 3PRDA 3PO1B 2PKSB 3OTPA 1SGEE 2EC9H 3OYPA 1IOEA 1EP5A 4B74A 3GY6A 3U8TH 3ZZ8A 1HUTH 2ANMH 2JH5D 2JKHA 1O3FA 1QB1A 4ABEA 2ZPSA 2K1QA 3SNCA 4X2XA 3KQ5A 1CGIE 3MWIU 2SGQE 3DHKH 2PGBB 2ZU2A 1CGJE 4X1NU 4AB9A 1BHXF 1XX9A 1Q31A 4XBDA 2R0KA 1BTXA 2ZDKA 3T28A 1H8IH 2KCOA 1YPKH 1NROH 2WSSD 3RXDA 4NFFA 2VIDA 3FOAA 4RT0A 1PPZA 2XC4A 5EJLA 1AVWA 3QO6A 3U1IB 4CHAC 2BY5X 3A86A 2QAAA 3GY3A 2BD8A 1HIAB 4Y0ZE 3TH3H 1XUHA 1P09A 3ZZ4A 2VVUA 2ZKSA 4CRCA 3OU0A 4Q7XA 4VGCC 1NBME 1GHBG 1TNHA 2VWOA 3BIVH 2Y81A 3D23A 1D3QB 2QA9E 1S85A 1IQIA 1O34A 2BDYA 1CHGA 5JDUB 2W6ID 5HIZA 2VIWA 4JZEH 4WXIA 1DANH 3RC6A 4NFEA 3S9CA 1QZ8A 2GZ8A 4O3TA 5EQQA 3RU4E 3SGQE 1WTGH 4B71A 3R3GB 3M5LA 4AGJA 1EFRD 2KCAA 4YOJA 5ESTE 2QN5T 1C5LH 1Z7KA 3JZ2B 3GY5A 2FX6A 3OEED 2F9NA 1XXDA 1G2MA 2J9NA 1FONA 2BD2A 9ESTA 1CHOF 1P01A 2BLWA 3S7HB 1BHXB 2FS9A 4AYYB 2ZU4A 3F9FA 5PTPA 1HPGA 3RXLA 3M7UA 2GV6A 1HCGA 3FN8A 2CHAC 1B7XB 4LZ4B 2TGDA 2CXVA 2G5NA 3BG8A 1KXCA 2FI5E 3SJOA 1BMMH 1ZPCA 2WYJA 2CV3A 1DUAA 4NZLA 4ABAA 1LPZB 4Q4LA 1EPTC 2FODA 1KDQB 1FV9A 2ZQ2A 3BSQA 5L2YH 1ANCA 3K65B 2XBWA 3NKKA
chains in the Genus database with same CATH topology
1P10A 3LJJA 1NT1A 3UWJH 4ABDA 1P0SH 6GCHF 3E8LA 2Y7ZA 3M35A 5FBIA 1MBMA 4CRAA 4O9VA 3SJ8A 2P93A 1HXFH 3RXTA 2JETC 5DKMA 3M7QA 3LPRA 2BZAA 2ZI2H 3D49H 1DXWA 1O5EH 2F9VA 2XW9A 2R2WU 1UTJA 1BDAA 1SOZA 1O37A 1S5SA 5JBAS 1TWXB 2TGPZ 5L30H 3RXGA 1O2LA 3RXFA 1GVZA 1D9IA 1YPEH 1F5KU 1P2KA 1GJBB 3DA9B 3MNSA 4JYTA 3RU4D 3E3TA 4Y7AA 1IQNA 4A5TS 1GI3A 1PPBH 5EPYA 2BY6X 3KHVA 2JH6D 1BCUH 1Y59T 4H42U 4DW2U 1C1TA 1BITA 1WTHD 1EB2A 1P2MA 3AASA 4BAOB 4CRBA 3ZV9A 2QXHA 5L2ZH 5DG6A 3TJUA 2ZDAH 5FCKA 4PROA 1XUJA 1QBNA 2B7DH 1OWIA 1C1NA 4B76A 1V2VT 3KGPA 4Y8ZA 2A1DB 4Q80A 5GCHG 1BBRE 4JYUH 2ZHDA 2TGAA 1VCWA 4MLFB 1OKXA 4D8NA 3MYWA 4ZKRU 1HAYB 1NFUA 2ULLA 3SV8A 2YNAA 1VITH 1UCYE 2EI7A 2BDIA 2F9BH 1P2OA 3PLPA 2OLGA 2HNTC 1OXGA 1TYNA 3QTVH 1JRTA 4UONA 4BTUB 2FDAA 2ZTZA 1L4ZA 4KELA 2BYAX 2UUJB 1AZZA 2BY8X 3M3VA 3UOPA 1RGQA 6CHAC 3MMGA 1G2LA 1B5GH 3MU5A 1C1QA 1TX6A 2OCVB 2VIPA 4K60A 1F0SA 2ZGHA 2VH6A 1T32A 4LK4A 4BXWA 3NUMA 5E2OA 2Y5FA 4WJG2 3SV2H 3RXSA 1DOJA 2P3TB 2H9TH 2KAIB 3SU1A 3T29A 4GAWA 1ZMLA 3VGCB 3HPTB 3LT3A 1CA0C 3HK6B 1SBWA 4ZKSU 1QURH 3BIUH 1DXPA 2VIQA 1DX5M 2ESTE 1NTPA 2C8XB 1P2IA 1ELTA 2QXGA 1Y5AT 3T25A 1FIWA 1TONA 3SI3H 3VFEA 1KTSB 1SSXA 1VJ9U 2RDLA 1K28D 1BRUP 4Y8YA 3L6PA 3MOCA 1C1MA 2XCFA 1RTFB 3RLWH 3UUZA 2J92A 1K1PA 3C1KA 3RXCA 1GHVH 1KLTA 3ZVDA 4O3UA 8GCHG 1YF4A 5DP4A 1VITG 1GBKA 1UHBB 1YM0A 3ZYEA 1AFQB 8ESTE 3ELAH 1A7SA 1SGCA 1VCPA 6ESTA 2VWNA 3SHAH 1P06A 4NSYA 1YPJH 3SV7A 1GI5A 1MKXH 3B8JA 4DIIH 2W5EA 1GHWH 4FUCA 3ZZBA 4X8SH 1P2QA 1KXDA 1J9CH 1AQ7A 1V2KT 1ZJDA 2ANYA 4B2AA 2Q6DA 3SNBA 2BHGA 4FU9A 3A8CA 3QZRA 2C8WB 1G3CA 4X6PA 2XRCA 1K1JA 5EXLA 3RMOH 4AG2A 4CR5A 1CSOE 2RA0A 3RP2A 1V2UT 4RSPA 2P3FH 1AUJA 1MMJN 2G55A 1AFEH 1HAZB 1T7CA 1SGNE 3VB4A 2GMTC 3IG6B 1SVPA 1W0ZU 1GWAA 1BT7A 3QZQA 1ZJKA 1VJAU 2FOBA 2PWXA 1HAXB 1P02A 2FWWA 4CBNA 4DIHH 2XWBI 2Z6BD 3A82A 1EZUC 5GWZA 1D3PB 1UTQA 3LGWA 1ELDE 4JK5A 4XDEA 4OS1A 3F68H 1F0UA 2P94A 4IBLH 1VGCB 3A84A 1HRTH 3OY6U 3VB7A 1HJ9A 2LIZA 1ELEE 2O8WA 1BBRK 1RFNA 2SNWA 4YT7H 1KDQA 1DDJA 1MTNB 1RTLA 4UFDH 1EOJA 1O30A 4I31A 1UCYK 1UVOA 3UNQA 3KQBA 5EPNA 3RXVA 2Z9KA 1T4UH 2IN2A 3KQDA 1TA6A 1S84A 4H6SB 2GZ7A 5E0JA 4A1XA 1AVXA 4MPWA 2BMGB 1K1OA 2Y5HA 4KKDA 5I25A 3SV6A 1LHEH 2NU4E 1AHTH 1UTKA 3SQEE 1TA2A 2VGCB 2GVFA 1P03A 1JMOH 1MZAA 2NU3E 1ZSKA 1LHGH 3LGIA 3P6ZB 1XKAC 5DGJA 5FPYA 2W3IA 3PWCA 1O3LA 2GV7A 1A1RA 1MU6B 2BXUH 4K3JA 1EKBB 3UR6A 2Z7FE 1QL7A 3A7TA 1P2JA 1OWDA 1GJDB 2Z9IA 2FS8A 3D62A 1TALA 2FEQH 1K1NA 1QGFA 3Q3XA 3GCNA 4MTBA 3EA8A 3E91A 5K0HA 1CHOG 4B1TA 3TNSA 3LOXA 2BY7X 1INCA 5SGAE 1PYTD 5EGMA 4F49A 5DP6A 4Z6AH 5AVDA 2Z9JA 5J4SA 2SGAA 4Y8XA 4WH8A 1AE5A 1ELAA 1LHCH 1NRQH 2UWOA 2FLBH 2QC2A 1GGDB 2P59A 2YOLA 3PMHB 3KEEA 1PJPA 4JZIA 5EW2H 1KYNA 7LPRA 4MVNA 5BPEA 2IOTA 2XYAA 4XBBA 4Y71A 3RXRA 1EAXA 4MNVA 1DVAH 2DE9A 3RXUA 1ANEA 3OY5U 5CHAC 2Z3CA 2AYWA 5LPRA 6GCHG 1O36A 5GXPA 2QYIA 1G30B 3PTBA 1A0JA 1O2YA 4NIYA 1YLCA 1C5SA 3BTTE 2FP7B 2PUQH 4LOYH 1O3GA 1O32A 1E0FD 1U6QA 1GJ5H 1FN8A 1GMHF 2ZDVH 3EAJA 1MTVA 1NFYA 3P17H 4X0WU 2HALA 1RS0A 2TPIZ 1AUTC 1C1RA 4YESB 3RM0H 5T6FA 3QGJA 3M5MA 4AORA 3M5OA 1MH0A 1OOKB 1NRRH 4XOJA 2CF9H 3RXBA 4GCHG 1MKWH 1NESE 1ZPZA 2H9HA 2XC0A 3FAOA 1RJXB 3I77A 1S81A 2OBQA 3MH4A 5CMXH 1BBRH 2CMYA 3H7OA 4RKJB 1Z1IA 4I7YH 3FP8E 1LDTT 1FXYA 1LMWB 3RXMA 1UCYH 2OC8A 2ZFQH 4FU8A 1C5ZB 4MPVA 2H2ZA 1C2GA 1Q2WA 2R2MB 2ZFTA 3VXEH 3SU0A 2BXTH 1BTYA 2VNTA 4MNWA 2J95A 3AAUA 2O9QA 4U32A 1YYY1 2W26A 2FESH 3ENSB 5CE1A 3P70B 1O3NA 3ZZDA 1BQYA 1TBZH 4NIWA 1MCTA 4NWKA 1BTUA 3TJVA 4AX9H 1LKAA 1J16A 4D9RA 4DG4A 1BTHH 4MQAA 1NRSH 1QB9A 2R3UA 1TOCB 3MU8A 2H1UA 4KTCA 1HJAC 2C4FH 2V35A 2Z9LA 1QJ6B 2A7JA 3GCHC 2ZC9H 3SU2A 2PR3A 4ISHH 2PKAA 1XUGA 1C1OA 3U8RH 2ZCKP 1FLEE 1C1PA 2HNTE 2UWLA 3F9EA 3A7XA 3PROA 1MQ6A 1TMTH 4DVAU 2FTMA 5EG4A 3DFJA 3E0NB 1GGDC 1O3IA 3E1XB 3GISB 1O33A 4Y6DA 4THNH 1C5XB 1V3XA 1GJCB 4K1TA 1H9LB 3PMJA 4JCNA 5AHGH 2Y80A 4D76A 1C5RA 1EZQA 2FOAA 3HKIB 2A5IA 1QY6A 1VZQH 1GBAA 1HJ8A 5GIBA 1Z6JH 1ZTLA 2JH0D 4NZQA 1V2LT 3PLBA 3LDXH 1ELGA 5HM2A 3JZ1B 2A5KA 1EXFA 3W95A 4A6LA 1FIZA 1SGRE 1TFXA 4ZKNU 2VJ1A 3U1JB 1PPFE 2HGTH 4CBOA 2ZU5A 5C67A 1OX1A 3T5FH 5AF9H 1ZHRA 2PSXA 2WPHS 2RCEA 5JB8S 4BAMB 1WYKA 1ARCA 1QHRB 2OQ5A 1MTSA 4ZXXH 2C3SA 1GHZA 2HNTF 1ETRH 3UNSA 5F8ZA 5EW1H 2AEIH 2ANWA 1SG8B 1P8VC 1AB9B 3IWMA 1WUNH 2ZCLP 1O3BA 4K1EA 1GBHA 2GZ9A 1BOQA 3QN7A 1W14U 1TAWA 4B2CA 3FZZA 3TK9A 4YO9A 2BQWB 1O2NA 3BEIB 3BG4C 2PTCE 2QCYA 4XBCA 1A0HB 1GCTB 1EZXC 5ABWA 1ETSH 4DOQA 1EOLA 2BDAA 4ABJA 3TPIZ 4K8YA 2VIVA 4WMEA 7GCHF 4KTUA 1Y3UA 3RXJA 1CT0E 4WF8A 1Z71A 2A4OA 1DY8A 3ZZ9A 3SN8A 3ODDA 1KY9A 5E2PA 1T8OA 1MZDA 1B0FA 3CENA 1GG6B 4AFSA 1Y5UT 1O0DH 2BX3A 3MO9A 4O03A 1W10U 1TB6H 2AGEX 1HV7A 2OBOA 1F0RA 1MD8A 2NU2E 2ZDNA 5DK1A 3HGPA 4CRFA 2H9EH 1IQJA 5AFZH 4BTIB 2ZGBH 3BV9B 1MTUA 2Y7XA 1FY4A 3GY2A 4MNXA 1FPCH 2FI4E 1EQ9A 1DSTA 3U9AH 3ZVFA 2FOCA 1YP9A 3U98H 1HAGE 5DP5A 4OS5A 3SHCH 1N1LA 2UUFB 1C2LA 1O3JA 1C1WH 1O38A 5F8TA 2ZNKH 1ORFA 4IS5A 1MAXA 2ILNA 2ZFFH 3V13A 1LTOA 1RD3B 5HXFA 3BN9A 3O8CA 8KME2 2XTTB 3KN2A 1XUFA 3B23B 2BB4A 1O2QA 4B75A 1NY22 2F83A 5E8EH 3STJA 2O8UA 3MTYA 1PPCE 3CS7A 2ZF0H 3PO1C 1C4Y2 2PKSC 2Z94A 3AW0A 1SGIB 3A8BA 1P9SA 5HYOA 4INHA 1UK3A 2H6MA 4AN7A 3LONA 3AAVA 3MH5A 4WH6A 4X2VA 2ODQA 1DY9A 1YPGH 3ZVCA 1LHFH 3BTFE 3TH2H 1C4V2 1NM6A 1W8BH 3RXQA 1C2FA 5A0CA 2D8WA 2F91A 2GCTB 1W7GH 2A31A 2I6QA 3BF6H 4GSOA 2BLVA 3L3TA 5LGOA 2DUCA 1GDUA 4I33A 3LC5A 1C5YB 3ATLA 3GYLB 1OP2A 5I46H 1MKXK 2ZPRA 1C5NH 2VIOA 3MO6A 5DPAA 4WY3A 1ZZZA 5T6GA 1AMHA 2J38A 4F4OC 2SGEE 4ISNA 4ISLA 2F9UA 1C5MD 4X2YA 3SUGA 2Q6FA 5JYIA 4NWLA 2Q6GA 2W7UA 1FNIA 1YKTA 3FP6E 5JBTA 1K22H 3GICB 3GYMA 5DJ7A 4FU7A 1GI6A 1SR5C 4INKA 1PFXC 4NCYA 3V0XA 4ZHLU 1HFDA 1EUFA 2H5CA 1EP6A 2FOGA 5LPFA 1O3KA 3NXPA 3SGAE 4K2YA 2A7CA 1ZOMA 2ZFPH 3ZZ5A 1BZXE 2GT7A 1EATA 2EI6A 3ZVBA 3ZZ6A 2PV9B 1YPHC 3MU4A 1GG6C 1O35A 4OS2A 4NA7A 1E37B 1GHAG 5EOKA 3SORA 2ZPQA 5C3NA 1F92A 1UMAH 4JZFH 4I8JA 4WXVA 2CN0H 1BA8B 2FTLE 1BJUA 5DP7A 5E0GA 1O3MA 2O8TA 4IMZA 1OP8A 3SU5A 1S83A 1TX8A 1Y5BT 5TCCA 3UNRA 3DFLA 3SJ9A 2BVSH 3KIDU 4LXBH 1GJ6A 1GL1A 3NPSA 3PB1E 1GCDA 3UOUA 1EPTA 3RC4A 2WUBA 3TVJB 2SGPE 1QTFA 1SMFE 1QQUA 2ZP0H 2NWNA 1V2ST 3STIA 1WSSH 3TGIE 4GLYA 2HVXA 3LC3A 3FFGA 1O2XA 1IQGA 1W3CA 3MFJA 3RXOA 4UE7H 2PSYA 5A09A 1FY3A 3RMLH 4OS6A 3M3TA 5ESBA 5GDSH 2ODPA 1KXEA 4X6MA 1YLDA 2ZU1A 1XVOA 4KGAA 4OGYA 3A7VA 3A7ZA 4UDWH 3KL6A 1O2GH 1TPAE 1G3BA 1GMCF 2XCNA 3GDSA 5LPEA 1HBTH 2BVRH 1HLTH 3TK6A 1GI0A 1UVUH 1TRMA 1AY6H 2D26C 2ODYB 3ATIA 1RIWB 1MUEB 1OS8A 1O3PB 2ZFRH 1SI5H 2PKAB 1UVSH 1AU8A 1CBWB 1OYQA 1CO7E 2QY0B 2ZGXH 5FBEA 1O3OA 1Y3YA 2FLRH 2J94A 2WV4A 2D2DA 4OS4A 4YM9A 3ATKA 3LIWA 4ZXYH 1P2NA 1GBFA 1GHBF 2P3UB 1EAIA 3P8NA 1A5IA 2ZGJA 1O2PA 4IC6A 3LGUA 1Y8TA 1C1VH 2WINI 1GJ4H 1S82A 3GDUA 1TNIA 4NIVA 3RUOA 1V2QT 4X8VH 2WPIS 3HKJB 4GVUA 1BUIA 2ZA5A 3RXPA 3M36A 2FOFA 2HRVA 3OTJE 1BIOA 1DFPA 1GJAB 1Z8GA 2FYRA 1O2JA 1K1IA 2FX4A 1MKWK 1S0QA 1BMNH 1SQTA 1V2JT 3BEUA 2G4TA 3GCTF 5IYTA 2FOHA 1K2I1 1JXPA 2FOMB 2TIOA 2HLCA 4A1TA 5FHTA 2V0BA 3BTME 1P9UA 1ESBA 3VGCC 1TPOA 1HNEE 3MI4A 1BMLA 3VB5A 1W7XH 3NZIA 1SFIA 1WBGB 2BQ7B 5C5OA 1C9TA 4BAQB 2OTVA 3NK8A 4ZKOU 4GHQA 1K1LA 3T26A 4Q2KA 1TMBH 4YLUA 1OPHB 3ZV8A 1Z8RA 4BTTB 4Y10E 1FN6A 1O3AA 5T6DA 4CH8B 4D9QA 2BD7A 3TITA 2YNBA 1A0LA 1C5OH 1ZLRA 4RKOB 3GY7A 1C1UH 1F2SE 2BD3A 1GL0E 1KSNA 4AFQA 1IHSH 1MQ5A 1TGBA 3ATMA 1DWCH 2K7XA 3C27B 1ETTH 1A4WH 3VEQB 2ZDMA 1O2IA 2B9LA 1GI8B 1AFQC 4ABHA 1SOTA 3SO3A 3MNCA 1G32B 1GI2A 1TPPA 4M7GA 3BTEE 4ABFA 4AYVB 1QB6A 1P05A 3VXFH 4YT6H 1TMUH 1LPKB 1OYTH 2GGVB 4D7GA 4HZHA 5JPMH 4XSKU 3BTWE 3MU1A 1O3EA 2AS9A 1CBWC 2WYGA 7ESTE 2W3KA 1XM1A 1IQFA 1ZGIA 3ODFA 2A4QA 4ABIA 2SGFE 3AW1A 2BDBA 2ZHEH 3SQHE 4CREA 2P8OB 3M5NA 2EA3A 3UREA 1KXBA 3A87A 1T8LA 1GVKB 2XBYA 4IW4E 1W2KH 4MNYA 4NA9H 1O3DA 2FZZA