2QC2A

Crystal structure of severe acute respiratory syndrome (sars) 3c-like protease asn214ala mutant
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
305
structure length
305
Chain Sequence
b'SSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVIAGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Crystal structure of Severe Acute Respiratory Syndrome (SARS) 3C-like protease Asn214Ala mutant with two non-native n-terminal residues (GLY AND SER)
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 78
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2qc2A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qc2A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2qc2A02
3A8AA 1XXDA 1UTOA 1C5LH 2IOTA 3A83A 1BTWA 4I7YH 2JETB 2WPIS 3ZVFA 1WYKA 3T62A 1Y3WA 8LPRA 4X0WU 2Z94A 1YPGH 1YP9A 5EXMA 2BVRH 2HPPH 2TGAA 1CT0E 4GHTA 5E0GA 2G00A 1PPGE 2XBXA 3UUZA 1SC8U 3SJIA 3TGKE 1Q3XA 4DGJA 3A7TA 1ZR0A 2C8XB 5FBEA 1MAXA 1O2KA 2TGDA 2BDIA 5ESBA 1O32A 3RU4E 1PQ7A 5E2PA 2ZCLP 3PMHB 1JIRA 2Y7ZA 2FLRH 5LPFA 4XSKU 4AORA 1SI5H 1OP8A 1C5TA 2VH6A 1O3NA 4WXIA 5EXNA 7LPRA 2A4GA 1VGCB 2YNAA 2OTVA 2BY5X 1VCWA 4Y8XA 1S0RA 1C2HA 3TH2H 1MU6B 1EZUC 2PKAA 1C1OA 3ZZ7A 3A82A 3O8DA 4GSOA 3SU4A 3P8NA 2A7JA 1GVZA 3ZZ8A 3ENSB 3BIUH 4A5TS 4CRFA 1OKXA 2ZEBA 2NWNA 3KL6A 4CRAA 1PQAA 4ZHLU 1ZTKA 4ZHAA 4D76A 1BQYA 4LZ1H 5A2MH 2CXVA 3N7OA 2EA3A 1ETRH 2BTCE 1O2IA 3B23B 5EG4A 1ZPCA 2WV5A 2Q6GA 3TJNA 3GCHC 3A87A 1BTZA 1HAXB 2ZWLH 2RDLA 1QBVH 2GKVE 1IHTH 1QRXA 2R0LA 4BANB 1B7XB 2FOEA 4GHQA 5E0HA 1J16A 2EI8A 4YTAA 4CRDA 6LPRA 1EASA 1P12E 1C5ZB 2PSYA 1O35A 1PPEE 1BTHH 5AFZH 1GHAG 1C1QA 1W10U 3ZZBA 1RFNA 1TQ7B 2OD3B 5FX6A 3CS0A 3CP7A 4ZAEA 1O3LA 1G9IE 2F9PA 1C1TA 2G5VA 4K60A 1P02A 5EW1H 1ELBA 3GY4A 5GXPA 2QCYA 1SFIA 2F9OA 2OUAA 4D9QA 2BYAX 2C90B 3SUDA 1TMBH 3SU1A 1LVMA 4IC6A 4AG2A 4CHAC 2GDEH 1WOFA 1UTKA 3Q00A 1G3DA 1OX1A 2HPQH 1NRSH 2NU2E 4H6SB 3KCGH 4BTUB 4BTTB 4OS1A 3UQVA 4B73A 1A0JA 4Y71A 3D49H 2BD7A 2PUQH 5F8XA 1JMOH 3UPEA 4NFEA 3TLOA 2PWXA 2Z9IA 3MH6A 1JRSA 1U6QA 4J2YB 1JWTA 3RP2A 1P2KA 2OC8A 1HAHH 1RTFB 2FO9A 6GCHF 1ZJKA 5G4BA 1CVWH 1AUTC 5HYOA 2W26A 4MNXA 4I8LA 1KDQA 1YPHC 3A89A 5EQRA 4D7FA 1SGFG 1A46H 1CBWC 3RM0H 2ZIQH 1AI8H 3MU5A 5EODA 2XTTB 2TIOA 1WQSA 1GG6B 1QBNA 2A32A 1YYY1 1ETSH 4UE7H 1FPCH 1TPOA 1O37A 1O3HA 5T6DA 1MCTA 3SN8A 3TH4H 2ANWA 3L33A 2ALVA 2XW9A 2VGCB 1O2PA 3VB3A 4IW4E 1AVXA 3LDXH 1WU1A 3TIUA 2G4UA 4Y79A 3TGIE 2B0FA 2O8LA 2WINI 4X6NA 1HAVB 1RIWB 3ZZ3A 2VIPA 1YM0A 2CN0H 1F5LA 4BXWA 4YO9A 1XUIA 3PO1C 3RXLA 4JYVH 4UFEH 1O2LA 3IITA 1FUJA 1GI0A 3L6PA 1F0SA 2O8MA 1Q31A 2ZZUH 1Z1JA 3E90B 3BG4B 1BMMH 2H9TH 4I32A 3F1SB 1LTOA 4TWWA 2A7HA 4WXVA 1W2KH 1IAUA 1GCTB 2GV7A 4FVBA 1TA2A 1EP6A 1YCPK 3T2NA 5LGOA 1HBTH 1NROH 3ATMA 2ZDMA 1E0FD 3EYDA 1NRNH 1OS8A 2BVXH 3NPSA 3KEEA 1P2QA 4WH8A 3Q77A 2LPRA 1VITH 3C1KA 1LKAA 4I8GA 3EA7A 1CU1A 1TX7A 1FIWA 4X6PA 1C5QA 1EZXC 3ITIA 1GL1A 4BAKB 1H9IE 3EAJA 1LVBA 3UNSA 4X2VA 2VIDA 1V2JT 1T4VH 2ZHEH 4AN7A 3P92A 4X1RU 4X1NU 3STJA 1HJAB 3ZVCA 1JIMA 2UWLA 4X6OA 2V6NA 1FJSA 2GD4B 2BB4A 1QA0A 1SQTA 1XKBC 5FBIA 3V13A 3LGIA 2AGGX 2VVVA 4Q80A 1C2LA 1ANBA 1L4DA 1VR1H 5SGAE 1KXDA 4H42U 4E06H 1N6YA 4K5ZA 1UTPA 1QGFA 1Z8GA 3KGPA 2BZ6H 1CGIE 1N8OC 1UCYK 2A0QB 1TOCB 4KKDA 3BTKE 2ZDLA 1KIGH 2BD9A 3DD2H 1O3PB 1MH0A 2OCVB 3T25A 1YF4A 1G32B 1TMUH 4K3JA 1UVOA 2ULLA 3Q3YA 3VB6A 1HFDA 1NC6A 2SFAA 1P10A 4XDEA 4Y8ZA 1N1LA 2CMYA 4Y10E 5J4SA 1A5HA 1GHBF 3UQOA 1P01A 1FAKH 1GWAA 2ZECA 8GCHG 2HALA 3RXBA 2FM2A 1T8NA 1G36A 2F3CE 4JZ1A 3Q3KA 2AMQA 1P09A 1MD7A 2D26C 4NSVA 3E6PH 1KSNA 3TU7H 1A4WH 3FANA 5DG6A 3U98H 2BOKA 5DO4H 3SV2H 3HK3B 1KXAA 3LC3A 1DT2A 2C93B 1GJ4H 2FZZA 2H2ZA 3SU5A 3Q76A 5L30H 1O2ZA 5F03A 2ASUB 5H4IB 2HNTF 3A7XA 1O5CB 2J4IA 2FX4A 4GAWA 1GHXH 2C3SA 2GX4A 1SHHB 1W12U 4Q7XA 4A1XA 1O2WA 3PM3A 2JH5D 4IGDA 3SV7A 2FP7B 3UREA 3KNXA 4ZXYH 3RXQA 1OP2A 1VITG 1GI7B 2FOGA 1PPBH 3VXEH 3SQEE 5HM9A 4WJG2 1KXFA 1EX3A 3BTEE 1VZQH 1SLXB 1PYTD 1HXFH 3B9FH 5DP6A 1J9CH 1GJ6A 2PV9B 1SGQE 3E3TA 4SGAE 4Q7YA 3FP8E 5JBAS 1GJDB 4JZFH 4OS5A 3MOCA 5T3HA 1TRMA 4HGCA 1LDTT 3GCHB 1UHBA 2VWOA 1C5MD 1H9LB 3TITA 4ESTE 2P3FH 2QGRA 1P2OA 3V12A 1AFEH 3ZZ4A 2VWMA 1IQJA 1OOKB 2FODA 1QR3E 2ZQ1A 1EPTC 1E38B 1MKWH 3TH3H 3M5OA 2GV6A 1W11U 2BVSH 4ISOA 4TPIZ 3VB5A 2GVFA 2VJ1A 1SGIB 1ELFA 4LZ4B 1ABIH 3HKIB 1GBLA 1O33A 2BMGB 2XXLA 3NUMA 3BTQE 1RRKA 3D23A 1P06A 3LGWA 1SGYE 3MU1A 4KP0A 2BZAA 3SJKA 4BXSA 1K1LA 3GCOA 1EJAA 1XUJA 2PGBB 3MWIU 1BRCE 4CHAB 4ABHA 2AMDA 1BITA 1FMGA 3T5FH 1O2QA 1SSXA 3PWBA 1MKXK 4INHA 1DANH 1A2CH 1CHOF 2A7CA 4ZHMU 4ABJA 2V35A 4BOHA 1WSSH 3AASA 1K1IA 1H1BA 3BEFB 1LKBA 4YESB 1CHOG 1THRH 3SUEA 1L2EA 1LHDH 8ESTE 2JH6D 3B8JA 3P8GA 4VGCC 2G8TA 1DLEA 3SGAE 5CMXH 1SG8B 3TK6A 3VGCC 3P6ZB 1V6DA 5DP5A 1SR5C 2W3KA 2FOHA 4CH8B 3RXOA 1GBBA 4OGYA 2A2XH 1GI8B 1S81A 3M3TA 1FY1A 2FIRH 2VB0A 1HYLA 2IPHA 5JBCS 1CBWB 1FY3A 3TJVA 2FEQH 3QO6A 4JYTA 1F0RA 1WQVH 1WCZA 3KHVA 4Y8YA 1S85A 1D4PB 2ZA5A 2A4QA 4U30A 3MH5A 4B74A 2GDDA 2D2DA 5EW2H 3U8OH 1GMHG 5JB9S 5K0HA 1ZHPA 3OYPA 1AQ7A 4MQAA 3ZZCA 1WTHD 3SU0A 3RXUA 3PO1B 2HOBA 5LH8A 1QL7A 3K6YA 3O8RA 2O8TA 1BT7A 1GI9B 2EC9H 1GBIA 3VPKA 2H9EH 1IQIA 2ZFQH 1O2YA 3RUOA 2QIQA 1YPMH 1HNEE 1TX6A 1ANCA 2HVXA 1DWBH 4MVNA 1DSTA 1AVGH 4FXGH 3W94A 1XX9A 3SJ9A 3PB1E 3ZV9A 3ZZ6A 2FI5E 2QXGA 2LNCA 3KF2A 1FI8A 4X2WA 1ZPBA 2HNTE 2OC7A 4IBLH 2K1QA 3A86A 1NM6A 1THSH 1V2NT 3E91A 2BOHB 1QBOA 3OY6U 1K22H 5ABWA 4ZXXH 3VB7A 1PFXC 1C2DA 1FN6A 5C1UA 4O3UA 2BDGA 3E0PB 1ZMLA 2F9UA 1HIAB 1P0SH 1AFQB 1DITH 1O3KA 1N8OB 2Z6BD 2K7XA 2FXRA 4F49A 1BHXB 1EKBB 1NS3A 2A2QH 4Q7ZA 1MCVA 2W3IA 2FYRA 1GJAB 1PQ5A 2A31A 2V0BA 1SGRE 3AAVA 4AFQA 1QHRB 3RU4T 2ANYA 2ZPSA 1G37A 4E05H 1TNGA 3LJJA 2P16A 1TOMH 1RTLA 1UTJA 3HPTB 5TCCA 2ZGCA 2AMPA 1QQUA 1TX8A 3BF6H 1XKAC 5PTPA 1MQ5A 1QQ4A 1VCPA 4FUHA 2GZ8A 2P8OC 3QGNB 1SOTA 2Y82A 4JK5A 2AS9A 1P9UA 2Y5FA 1KLTA 4NIXA 4DVAU 1W0YH 1AY6H 1GBDA 3SNAA 4ABDA 1SB1H 2AERH 1NFWA 1W14U 1SGNE 2BD2A 1Z8JB 2I6SA 4HI3A 2THFB 1QJ6B 2PTCE 1MD8A 3T26A 3S7KB 1O3IA 3KN2A 4MNVA 1D3TB 3ZYEA 2FX6A 1O34A 1NRQH 3GY7A 3F9HA 2BXUH 4AYYB 3ZYDA 2QC2A 2ODYB 4DIIH 3U69H 1O3MA 4CBOA 1KXEA 1DWCH 1B0EA 3MNSA 2ALPA 4R0IA 1HB0B 4XBDA 1YPJH 3BEUA 2FOMB 1IQFA 1C1MA 4F4OC 1C5VA 1K1JA 1O3DA 2AGIX 3EGKH 3H5CB 4E7NA 4B75A 1YC0A 1UTLM 1F5RA 2IJOB 1LHFH 2R2MB 3A7WA 1TNIA 3D62A 4B1TA 3F9GA 2SNVA 2ZGBH 2JKHA 1EJMA 4X8VH 2BDCA 1WTGH 1HXEH 2ZGXH 1T8MA 4UD9H 1GHZA 1MTVA 3O8BA 1C2FA 5AHGH 5L6NH 3RMMH 5EQSA 3FP6E 1GPZA 5F6MA 1QNJA 1SVPA 1C1PA 4A6LA 1EB1H 1EPTB 3MI4A 3A84A 1O5EH 3LC5A 3F9FA 1E34B 2OC1A 2UUKB 3STIA 1K28D 1SLUB 2CHAC 3QZQA 3PWCA 2WUBA 1F0TA 1P05A 1F5KU 1SQAA 1QY6A 2ZHWH 2A5IA 5JYIA 5FCRA 3MO9A 3LJOA 1UTNA 4IN1A 1ELTA 4CH2B 1A61H 2F9BH 1GJBB 4NZLA 1GJ5H 1DE7H 4CRCA 1YPKH 4K8BA 4MPWA 2FDAA 3GY6A 1GBHA 2OP9A 3GY5A 4TPYA 1BIOA 1Y3VA 1PPFE 3F6UH 2ZU1A 1TPAE 4NWKA 1C1SA 5FPSA 4AZ2B 1MTUA 7KMEH 1AIXH 2Y5GA 5TJXA 4IMQA 2H5CA 3OSYA 1QJ7B 4Y7AA 1CQQA 1YCPM 4IS5A 1S6HA 4Y0YE 4VGCB 1BTYA 3NK8A 1TRNA 3VGCB 1V2KT 3QTOH 1ACBE 1GGDC 2Z3EA 4X2XA 1D3QB 1DDJA 4DG4A 1K1MA 4YT7H 3K2UA 1KXCA 2VVUA 3ATWA 1HAYB 3I77A 1FPHH 6GCHG 1V2ST 1ZYOA 1HAPH 2Q6FA 3ZZAA 4DY7B 3CENA 1SL3A 1P2NA 5LPRA 1O39A 2ZFRH 1O38A 5C1XA 2XBVA 3M7UA 1BBRH 2BLVA 3P95A 3SGQE 3RMNH 2A45B 4AFZA 1V2QT 1VJAU 2R9PA 4I8HA 5FAHA 4HZHA 1V2UT 1N6XA 5T6GA 1TGBA 3RXHA 4ISLA 2G5NA 2B9LA 4ZKSU 1O3OA 1ARCA 1WAYB 2Z7FE 1XVMA 1YPEH 4BAOB 1GMDF 2H5DA 1HAZB 4AG1A 4K69A 3R0FA 1BDAA 3DHKH 3VFEA 3RLYH 3SHCH 2RA0A 2LIZA 2HGTH 5I46H 4O9VA 3AW1A 3TK5A 4NA9H 1TABE 5AFYH 1C5YB 3ZZDA 2FMJA 4H4FA 4O97A 4BAQB 3EDXB 1UK2A 5DJ7A 1AB9C 1BUIA 5J4QA 1AZ8A 3T28A 2PSXA 3MNBA 1CGJE 2BD5A 1AUJA 5A09A 1Y3YA 2O8UA 2SGPE 3PROA 1TRYA 1ID5H 1O2RA 4AFUA 4M7GA 1UK3A 1O3CA 1SLWB 5A8YA 1P03A 2G4TA 1PQ8A 2FOFA 2EI6A 1B5GH 2OINA 2ILNA 3URDA 2FWWA 2FS9A 1O2GH 1ZRKA 3S7HB 3DFJA 3UFAA 6CHAC 2ZTYA 3TGJE 3P17H 4AGKA 5DP8A 4FU9A 1NRPH 4U32A 5C20A 2D8WA 1DY9A 3RXIA 1ELCA 1LPGB 2ZDKA 1GL0E 5C3NA 2QF3A 5GPIB 1EUFA 1E36B 1AKSB 1LPZB 1WUNH 3AVZA 3LH1A 2YNBA 4AFSA 1MQ6A 4ZKOU 4X8SH 3QZRA 1BRBE 2ZGHA 3LGTA 1C4V2 2Z9JA 1W7GH 2VH0A 1O3FA 1GMCF 2Y5HA 2AEIH 1EJNA 1GJ8B 4ABAA 3BTTE 1GMCG 1WV7H 2ZHFH 2AGEX 4O03A 3ZVBA 2A1DB 2G52A 1C4Y2 1RS0A 2WPHS 2WV4A 1TYNA 4ISIH 1IOEA 4FUBA 1W8BH 3P8OA 4X6MA 2RG3A 3RXAA 3CS7A 2AIQA 4MPUA 1UVTH 2XC4A 1OSSA 1AD8H 1GHBG 3V3MA 1EOJA 2P8OB 4NFFA 3WY8A 1TNHA 2KAIB 3PYHA 1MU8B 1ZHRA 2J92A 3BG8A 1ZGVA 3RXPA 3KQBA 5IYTA 2BQ6B 2ZI2H 4AGJA 2GZ9A 2R2WU 4Y6DA 5BRRE 1HAVA 1QURH 2GGVB 4IC5A 2BD8A 3KQDA 1HAIH 1GBMA 4KTSA 1S5SA 3UOPA 3DFLA 2BY7X 1YLDA 1O30A 1GJ7B 1LHGH 1C1UH 2ZF0H 3VB4A 3HK6B 1Z6JH 2ZFSA 1YGCH 2BM2A 2BHGA 2DUCA 1ZMNA 1ZSKA 4D7GA 1TONA 3RXEA 3LGVA 1G30B 1ZSLA 2GCTC 1T32A 5C2ZA 1HV7A 1MMJN 1P8VC 4K1EA 4GVUA 2BQWB 1FN8A 1GBKA 1C1RA 2BDBA 1NU9A 5FPYA 1FY4A 1GBTA 3O8CA 1GDNA 1OWKA 1ZSJA 1SFQB 3EE0B 3RC5A 1NY22 2GTBA 5DP9A 1C1NA 1UTMA 5EU8A 1XMNB 1V2LT 3NKKA 4DW2U 1OWEA 1O2SA 3MYWA 2Y7XA 1BRAA 3HGNA 2C4FH 1TGCA 1H8IH 2P59A 1LVYA 2O9QA 3LKWA 1T7CA 4YOGA 2V3OH 2VIQA 2B5TB 4YT6H 2QY0B 1ORFA 2BY9X 3S9BA 3SV8A 2Z9LA 4I8JA 1TGSZ 2CHAB 3BV9B 5DKMA 1A0HB 1GI5A 3EQ0H 2ZHDA 3MNCA 3NXPA 1MZDA 1GDQA 3PV4A 4MDSA 1KYNA 1UCYE 3PLKA 2H9HA 2H1UA 2Q6DA 4O3TA 2BDHA 4TYDA 3GDVA 1FONA 1FV9A 1TB6H 1ANDA 4MNYA 1C2IA 2UWOA 1Z6EA 3Q3XA 1IQNA 1ZTLA 2XC5A 3TPIZ 1O5DH 1P04A 3RXMA 1G3CA 1FZZA 5EPNA 5LPEA 2C8YB 1OWIA 3M7QA 1C2MA 3OU0A 1BB0B 3SOSA 3PMJA 2HWLB 1QRWA 5DP7A 2WPJS 4NSYA 3ELAH 1GGDB 1BTUA 3OY5U 1O0DH 4Y76A 1D3DB 3VEQB 4FUDA 4K2YA 1EXFA 5A0BA 1UVPA 4X1PU 2O8WA 1A0LA 3RC4A 2R3UA 3KIDU 3SI4H 1PJPA 1QB6A 4DOQA 4CRBA 1A3BH 3RMLH 1BHXF 1C2EA 3MU4A 4D9RA 3SBKA 4INLA 1ZGIA 2QXJA 5FX5A 5A8XA 1T4UH 2XYAA 3A8BA 3E1XB 3PTBA 1S6FA 1BJVA 1FDPA 3MO6A 4CR9A 1J17T 1BBRE 2A4OA 4TWYA 3MU0A 2ZTZA 4X1SU 4FUEA 4ISNA 1MBMA 4KGAA 3SU3A 2P3UB 1TGTA 4SGBE 1YKTA 2F9VA 2ANMH 1O3GA 1YBWA 1IQLA 4GUXA 1Y3XA 7ESTE 1SGEE 3URCA 2XNIA 3SU6A 2TRMA 3RU4D 1GI3A 2VINA 3ESTA 2PW8H 1F2SE 5GJ4B 2VGCC 1HAOH 1TIOA 1Y8TA 3FAOA 3QK1A 4BNRA 2W5EA 3SI3H 2NU1E 1HUTH 1AB9B 3SUFA 2ZCHP 1V2WT 1SGCA 1K1OA 5DGJA 1AE5A 1CE5A 1K1NA 4Z6AH 1A7SA 1GI6A 1J14A 3FZZA 1P11E 2VU8E 1HLTH 3TK9A 1O2MA 1JRTA 1A3EH 1QL9A 3UIRA 1O2TA 2NU4E 4WH6A 2M5TA 3M3SA 1RJXB 3A7ZA 1SLVB 1S84A 2BX4A 4NIVA 2CGAA 2P95A 6CHAB 3MH7A 1VJ9U 1O5GH 1C5UA 1TMTH 2PKSC 1TNLA 1Z1IA 1YPHE 3HKJB 3ZZ9A 4UONA 1DWDH 2PKAB 2ZDAH 2OQ5A 2FI4E 1A5GH 4YLUA 1EATA 1ARBA 1AGJA 1MTWA 2VIWA 4NWLA 1HCGA 2CF9H 4AYVB 3LH3A 1L1JA 3RXJA 3TVJB 1LQDB 1LO6A 9ESTA 1GJCB 1O31A 1XUHA 3ODFA 1BTXA 2BDAA 4HFPB 1C9TA 1ZJDA 3SUGA 3ATLA 4JMYA 3FFGA 2ZU5A 1KXBA 3S69A 1AU8A 5JPMH 2VNTA 1SOZA 2I6QA 1CA0C 2OBQA 4NA7A 1BMAA 1D6WA 1C5XB 3ATKA 1QA7A 5HXFA 3BSQA 4WMEA 2Z3DA 2DE9A 1OYTH 4X8TH 3RXFA 3U1JB 1K21H 1ESBA 1PPHE 3MMGA 1IHSH 1Z8IB 1K2I1 2BD4A 2Y81A 4A1TA 3OTJE 1MKWK 2ZGJA 1ELEE 5EQQA 3SHAH 2ZDNA 2DE8A 5HMAA 4UFDH 1NN6A 1HPGA 1S82A 2ZFPH 5FHTA 1FAXA 3RMOH 5CHAC 5JBBS 2EI7A 2ZO3H 2J2UA 1MUEB 1XUKA 2PR3A 4ZH8A 1WBGB 1BRUP 5C5OA 1YCPH 1BOQA 3VXFH 3V0XA 3SNBA 2WPKS 2FTLE 1O2NA 3GY2A 3GY8A 4DIHH 2GCTB 2FYQA 5F8TA 1VCQA 5FXLA 1SQOA 1TBQH 2ZG0H 2Z9KA 3ZVDA 2R3YA 5DPAA 4U2WA 4XBBA 3K9XB 1ZZZA 3NZIA 1GJ9B 3GISB 4NA8A 5L2YH 2OC0A 3K65B 3QGJA 4NCYA 4ABGA 5GIBA 2PLXA 4A7IB 4ZKNU 2GZ7A 3BN9A 2BY6X 1EAXA 3MH4A 1BJUA 2GCHF 1KDQB 4FUIA 1MAYA 3EBNA 1TA6A 1LHEH 1UVSH 2GT7A 2GCHG 1SHYA 4JCNA 1C4U2 3H7TA 3RLWH 3SO3A 1CGHA 2BD3A 1F92A 1BTPA 2OQUA 5AVDA 1C5NH 1GVKB 1EZSC 1TBRH 3A8CA 3QX5H 1P3CA 5C67A 2SGEE 3GDUA 1ZRBA 4GPGA 4ABFA 4OS6A 4U01A 1RGQA 1UCYH 3AW0A 1BMLA 1X7AC 3UNRA 3L3TA 1HIAA 3MO3A 3LU9B 1O2UA 1ELGA 1QB9A 3LPRA 1V2TT 3P70B 4DURA 1AWFH 1AE8H 3SORA 2VIVA 1INCA 3GY3A 1CT2E 5GCHF 2SNWA 1ZTJA 1TALA 2ZHQH 3AAUA 1F7ZA 1NT1A 5GCHG 1JXPA 4INKA 4CR5A 2STBE 5GDSH 3M3VA 2WPLS 2ZU2A 3FP7E 1GHAF 2F83A 3UWIA 3SNDA 1O2JA 2W7UA 1EB2A 2FOAA 2AH4X 2RCEA 1A5IA 1TQ0B 2CJIA 1XXFA 2JH0D 4RSPA 2TGPZ 2Z9GA 4NIWA 1UMAH 2B8OH 4Y7BA 1GBEA 2CV3A 2VVCA 3V7TA 1QTFA 5TCAA 5E2OA 2FI3E 1H9HE 1PYTC 1D6RA 2ZU4A 1FY5A 3U1IB 4AB8A 1DS2E 5ESTE 3UNQA 4ASHA 3QTVH 1ELAA 4FUJA 4Q2KA 3F9EA 2BQ7B 4ZMAH 1EP5A 2VIOA 1ZLRA 1C5SA 4KELA 4MPVA 2VWNA 2QXHA 3RXDA 1KY9A 2J9NA 3KQCA 1AZZA 1Z7KA 4LK4A 4TY7A 4NGAH 3TJOA 1HJ9A 2FOBA 1V2RT 2FOCA 1L0ZA 4BTIB 1C5PA 1ELVA 1SBWA 1TFXA 3RXVA 3UOUA 4J1YA 4D8NA 3ZVAA 3TJUA 1Z8RA 3A85A 4GLYA 2AYWA 2C8ZB 3LT3A 4FUCA 2WPMS 1W7XH 4A1VA 1GI2A 3LONA 1MBQA 2HNTC 4RKJB 1G2LA 3C27B 1ESAA 2QV1A 5EXLA 2BLQA 2FLBH 1OWHA 1T8LA 3BTDE 1Q2WA 3LGUA 2XCNA 2Q1JA 1P3EA 1G3EA 4OS7A 2QAAA 1Y59T 4PROA 1GI1A 3GYLB 2ZPRA 1QIXB 1P2MA 2FS8A 5BPEA 3MNXA 1O5BB 2QA9E 1GMDG 1H8DH 3SGBE 1DX5M 1MTNC 3SV9A 2J94A 3D65E 3ZVEA 4DCDA 3H7OA 3SJOA 1EPTA 5E0JA 1K1PA 2C8WB 4FU8A 4R8TB 4B2BA 1C2KA 2SGQE 1CHGA 1KTSB 3IWMA 3A81A 2WYJA 4B2AA 3RXRA 4K1TA 1Y5AT 1C5WB 2RA3A 3MHWU 1C1VH 4NZQA 2GT8A 1NRRH 5HM2A 1DLKB 3PLBA 4ABEA 3I78A 1FLEE 1NFUA 4FU7A 1QJ1B 1V3XA 2P3TB 4K8YA 1F0UA 1G3BA 1RTKA 1KLJH 1W0ZU 3S0NA 1QCPA 1O3JA 1DFPA 5FPTA 1MKXH 2PKSB 1NTPA 4H6TA 2ANKH 4WMFA 3A8DA 3P8FA 5JBTA 1GBFA 1XUGA 3JZ1B 1EAWA 5I25A 4FUFA 2XRCA 1ABJH 1GI4A 4B76A 1BMNH 4IMZA 1TBZH 4Z0KA 2SGDE 4YLQH 1O5FH 5ETXA 3SJ8A 4YOIA 2V3HH 1O5AB 1IQHA 2NU3E 3NWUA 3RXGA 1Z71A 4I33A 1AVWA 2TBSA 3ZVGA 4B71A 1THPB 2Z3CA 1UHBB 1OWJA 1C9PA 1CA0B 3RC6A 4CBNA 1GDUA 2H6MA 4JYUH 3GICB 1RD3B 2BLWA 4ZROA 4KTCA 7GCHF 2J38A 2OXSA 4K1SA 1SPJA 3HATH 1FNIA 5EGMA 2UUYA 2GMTC 7GCHG 1SGTA 4ZKRU 2WYGA 5A0CA 1OPHB 1BZXE 3LIWA 1FIZA 1AFQC 1Y3UA 4X2YA 5C1YA 4BAMB 3BTGE 4A92A 4B2CA 2UUJB 4E7RG 3M36A 1HGTH 5A8ZA 3RDZA 2XBYA 5CHAB 2P93A 1NFYA 3S9AA 1IQMA 1EAIA 4XBCA 4AX9H 4NIYA 8GCHF 2PFEA 3KQEA 3SZNA 1GHYH 2JETC 1NESE 1S83A 4RN6A 4AOQA 1GBJA 1MZAA 1GHWH 4XOJA 1LCYA 2BY8X 4THNH 1ZPZA 3GOVB 5L2ZH 1C2GA 2TPIZ 1DUAA 4OGXA 4HTCH 1PPZA 1QRZA 2UUFB 1O3AA 1S0QA 2J34A 1DXWA 1D3PB 3FVFB 1BCUH 3QLPH 3BTHE 3GYMA 1P2IA 3G01A 1J15A 3ODDA 2WUCA 1SGDE 1JOUB 1G2MA 2Y80A 4XFQA 3U8RH 4BAHB 3LGYA 2XC0A 5JDUB 5DP3A 2XWBI 1CA8B 1C5RA 3IG6B 1OXGA 3UR6A 1O2XA 2ZFFH 2G81E 4MLFB 1VGCC 3E8LA 4UFGH 5EPYA 1OYQA 1VITF 2PUXB 1ELDE 1UJ1A 3BEIB 1L1GA 2ODQA 1DM4B 2VWLA 1NO9H 2J95A 1A1RA 1O3EA 1HRTH 1NU7B 4UEHH 1YPLH 1SMFE 1DSUA 3PTNA 1MTSA 1Y5BT 1AKSA 1BBRK 1DY8A 1M9UA 3SU2A 3GDSA 3I29A 1T31A 3RXSA 2SGFE 3T29A 4CRGA 1AWHB 4ISHH 1DXPA 4WY3A 1J8AA 1PPCE 2ZFTA 1P9SA 3GCNA 4JZDH 1TLDA 3PLPA 1TNJA 5K7RA 1TE0A 2HRVA 4Y11E 1E37B 2ZPQA 1O36A 5FCKA 3A88A 3ZZ5A 3QDZB 4RKOB 2W7SA 2CF8H 1O2VA 3OX7U 5DK1A 1NFXA 3RXCA 2PGQB 3S9CA 3BTFE 3QWCH 3F68H 4MNWA 2AIPA 1AO5A 3UY9A 6ESTA 4LOYH 1EZQA 1SGFA 1QB1A 1XVOA 1GHVH 3RXTA 1LMWB 1FY8E 1NPMA 2KAIA 4ZUHA 1DUEA 2ZU3A 2Y6TA 3T27A 2BX3A 2ZC9H 4YOJA 3DT0H 3EA8A 3EA9A 3SV6A 1CO7E 3GCTF 1UTQA 3DA9B 2SGAA 2P94A 2FTMA 2STAE 3GCTG 4JZEH 3MFJA 1ZMJA 2XBWA 2A4RA 4WVPE 1V2PT 1V2VT 3A7VA 3JZ2B 4LXBH 2ZKSA 3TNSA 4MPXA 2G55A 4GCHF 4WF8A 1O2OA 1OP0A 2BLOA 1DICA 4WWYA 1ZOMA 5A0AE 3MTYA 1FQ3A 4GCHG 4UDWH 2ESTE 1P57B 1H4WA 1K9OE 4IN2A 3A80A 3BTWE 1P2JA 3PMAB 3U9AH 1SGPE 2TGTA 2FPZA 1TPSA 1E35B 2GP9B 3M5NA 2IN2A 5CE1A 5C5NA 3R3GB 3BIVH 1DWEH 1GBCA 1HJ8A 1IQEA 3SW2B 1TAWA 4I8KA 4ABBA 2AFQB 1LPKB 3MU8A 5GWZA 4KTUA 2ZQ2A 3UTUH 2ODPA 1TNKA 1T8OA 4NG9H 1IQKA 3BTME 2R0KA 3NCLA 1V2OT 2A5KA 3TNTA 3SNCA 4DT7B 3UR9A 2PTNA 5HGGA 1W13U 2G51A 3M37A 1GMHF 1GG6C 1MTNB 3M7TA 1FXYA 3A7YA 4X8UH 1UVUH 4FVDA 1EOLA 2ZNKH 1TWXB 2ZP0H 2B7DH 1AMHA 4AB9A 1TPPA 2OLGA 3HGPA 1W3CA 4JZIA 1O2HA 2A5AA 1KLIH 5E8EH 1HAGE 3M61U 3RM2H 4UFFH 3M5LA 1RIWC 4TY6A 1DVAH 1B0FA 1NZQH 1JBUH 3E16B 4QT8C 2QF0A 2F91A 3ZV8A 2F9NA 3SNEA 1DPOA 5IDKA 3BG4C 2OBOA 1EAUA 1UO6A 1D9IA 5AF9H 3QUMP 1QL8A 1ESTA 3UWJH 5JB8S 1ETTH 2PHBA 3FZDA 1AN1E 5F8ZA 1GCTC 5EOKA 1XUFA 4YM9A 1HDTH 4WMDA 2QXIA 4YZUA 4X1QU 4CREA 3U8TH 1Y5UT 3DUXH 4FUGA 2QYIA 1CSOE 4OS2A 1L1NA 1O3BA 4ABIA 4MG3A 1IQGA 3M35A 1CT4E 3M5MA 1GVLA 2QN5T 3RXKA 4JK6A 1YLCA 3PMBB 2UWPA 5T6FA 1C1WH 3LOXA 5B6OA 4DJZB 1LHCH 1AHTH 2BXTH 8KME2 1DOJA 1EQ9A 1KTTB 9LPRA 2XCFA 1HJAC 1QFKH 1RXPA 1V2MT 1BA8B 2GMTB 1OWDA 2YOLA 1TGNA 5DP4A 3SQHE 2BDYA 1LVOA 2FESH 1L4ZA 1LQEA 4XE4A 1GCDA 1C5OH 3QN7A 4OS4A 2D1JA 1ZHMA 3E0NB 1C2JA 4I31A 3K6ZA 2XWAA 4MTBA 2ZCKP 1ANEA 3ATIA 2ZTXA 2ZDVH 3W95A 1GBAA 2HLCA 2EEKA 2NU0E 4Y0ZE 1XM1A 1UK4A
chains in the Genus database with same CATH superfamily
3A8AA 1XXDA 1UTOA 5FL7D 1C5LH 2IOTA 3A83A 1BTWA 4I7YH 2JETB 2WPIS 3ZVFA 1WYKA 3T62A 1Y3WA 8LPRA 4X0WU 2Z94A 1YPGH 1YP9A 5EXMA 2BVRH 2HPPH 2TGAA 1CT0E 2EY4C 4GHTA 5E0GA 2G00A 1PPGE 2XBXA 3UUZA 1SC8U 3SJIA 3TGKE 1Q3XA 4DGJA 3A7TA 1ZR0A 2C8XB 5FBEA 1MAXA 1O2KA 2TGDA 2BDIA 5ESBA 1O32A 3RU4E 1PQ7A 5E2PA 2ZCLP 3PMHB 1JIRA 2Y7ZA 2FLRH 5LPFA 4XSKU 5CHBA 4AORA 1SI5H 2LELA 1OP8A 1C5TA 2VH6A 1O3NA 4WXIA 5EXNA 7LPRA 2A4GA 1VGCB 2YNAA 2OTVA 2BY5X 1VCWA 3FKSD 4Y8XA 1S0RA 1C2HA 3FOAA 3TH2H 1MU6B 1EZUC 2PKAA 1C1OA 3ZZ7A 3A82A 3O8DA 4GSOA 3SU4A 3P8NA 2A7JA 1GVZA 3ZZ8A 3ENSB 3BIUH 4A5TS 4CRFA 1OKXA 2ZEBA 2NWNA 3KL6A 4CRAA 1PQAA 4ZHLU 1ZTKA 4ZHAA 4D76A 1BQYA 4LZ1H 5A2MH 2CXVA 3N7OA 2EA3A 1ETRH 2BTCE 1O2IA 3B23B 5EG4A 1ZPCA 2WV5A 2Q6GA 3TJNA 3GCHC 3A87A 1BTZA 1HAXB 2ZWLH 2RDLA 1QBVH 2GKVE 1IHTH 1QRXA 2R0LA 4BANB 1B7XB 2FOEA 4GHQA 5E0HA 1J16A 2EI8A 4YTAA 4CRDA 6LPRA 1EASA 1P12E 1C5ZB 2PSYA 1O35A 1PPEE 1BTHH 5AFZH 3WWBA 1GHAG 1C1QA 1W10U 3ZZBA 1RFNA 1TQ7B 2OD3B 5FX6A 3CS0A 3CP7A 4ZAEA 1O3LA 1G9IE 2F9PA 1C1TA 2G5VA 4K60A 1P02A 5EW1H 1ELBA 3GY4A 5GXPA 2QCYA 1SFIA 2F9OA 2OUAA 4D9QA 2BYAX 2C90B 3SUDA 1TMBH 3SU1A 1LVMA 4IC6A 4AG2A 4CHAC 2IJD1 2GDEH 1WOFA 1UTKA 3Q00A 1G3DA 1OX1A 2HPQH 1NRSH 2NU2E 4H6SB 3KCGH 4BTUB 4BTTB 4OS1A 3UQVA 4B73A 1A0JA 4Y71A 3D49H 2BD7A 2PUQH 5F8XA 1JMOH 3UPEA 4NFEA 3TLOA 2PWXA 2Z9IA 3MH6A 1JRSA 1U6QA 4J2YB 1JWTA 3RP2A 1P2KA 2OC8A 1HAHH 1RTFB 1W0JD 2FO9A 6GCHF 1ZJKA 5G4BA 3F0PA 1CVWH 1AUTC 5HYOA 5C0TA 5CDFE 2W26A 4MNXA 4I8LA 1KDQA 1YPHC 3A89A 5EQRA 4D7FA 1SGFG 1A46H 1CBWC 3RM0H 2ZIQH 3F0OA 1AI8H 3MU5A 5EODA 2XTTB 2TIOA 1WQSA 1GG6B 1QBNA 2A32A 1YYY1 1ETSH 4UE7H 1FPCH 1TPOA 1O37A 1O3HA 5T6DA 1MCTA 3SN8A 3TH4H 1H8ED 2ANWA 3L33A 2ALVA 2XW9A 2VGCB 1O2PA 3VB3A 4IW4E 1AVXA 3LDXH 1WU1A 3TIUA 2G4UA 4Y79A 3TGIE 2B0FA 2O8LA 2WINI 4X6NA 1HAVB 1RIWB 3ZZ3A 2VIPA 1YM0A 2CN0H 1F5LA 4BXWA 5HIZA 2HVYB 4YO9A 1XUIA 3PO1C 3RXLA 4JYVH 4UFEH 1O2LA 3IITA 1FUJA 1GI0A 3L6PA 1F0SA 2O8MA 1Q31A 2ZZUH 1Z1JA 3E90B 3BG4B 1BMMH 2H9TH 4I32A 3F1SB 1LTOA 4TWWA 2A7HA 4WXVA 1W2KH 1IAUA 1GCTB 2GV7A 3DSGA 1TA2A 4FVBA 4XRNA 1EP6A 1YCPK 3T2NA 5LGOA 1HBTH 4B6FA 1NROH 3ATMA 2ZDMA 1E0FD 3EYDA 1NRNH 1OS8A 2BVXH 3NPSA 3KEEA 1P2QA 4WH8A 3Q77A 2LPRA 2W6ID 1VITH 3C1KA 1LKAA 4I8GA 3EA7A 1CU1A 1TX7A 1FIWA 4X6PA 1C5QA 1EZXC 3ITIA 1GL1A 4BAKB 1H9IE 3EAJA 1LVBA 3UNSA 4X2VA 2VIDA 1V2JT 1T4VH 2ZHEH 4AN7A 3P92A 4X1RU 4X1NU 3STJA 1HJAB 3ZVCA 1JIMA 2UWLA 4X6OA 2V6NA 1FJSA 2GD4B 2BB4A 1QA0A 1SQTA 1XKBC 5FBIA 3DSPA 3V13A 3LGIA 2AGGX 2VVVA 1H8HD 4Q80A 1C2LA 1ANBA 1L4DA 2YMSC 1VR1H 5SGAE 1KXDA 4H42U 4E06H 1N6YA 4K5ZA 1UTPA 1QGFA 1Z8GA 3KGPA 2BZ6H 1CGIE 1N8OC 1UCYK 2A0QB 1TOCB 4KKDA 3BTKE 2ZDLA 1KIGH 2BD9A 3DD2H 1O3PB 1MH0A 2OCVB 4TT3D 3T25A 1YF4A 1G32B 1TMUH 4K3JA 1UVOA 2ULLA 3Q3YA 3VB6A 1HFDA 1NC6A 2SFAA 1P10A 4XDEA 4Y8ZA 1N1LA 2CMYA 4Y10E 5J4SA 1A5HA 1GHBF 3SZEA 3UQOA 1P01A 1FAKH 1GWAA 2ZECA 1OHHD 8GCHG 2HALA 3RXBA 3SYJA 2FM2A 1T8NA 1G36A 2F3CE 4OM9A 4JZ1A 3Q3KA 2AMQA 1P09A 1MD7A 2D26C 4NSVA 3E6PH 1KSNA 3TU7H 1A4WH 3FANA 5DG6A 3U98H 2BOKA 5DO4H 3SV2H 3HK3B 2QE7D 1KXAA 3LC3A 1DT2A 2V7QD 2C93B 1GJ4H 3FN8A 2FZZA 2H2ZA 3SU5A 3Q76A 5L30H 1O2ZA 5F03A 2ASUB 5H4IB 2HNTF 3A7XA 1O5CB 2J4IA 2FX4A 4GAWA 1GHXH 2C3SA 2PP6A 2GX4A 1SHHB 1W12U 4Q7XA 4A1XA 1O2WA 3PM3A 2JH5D 4IGDA 3SV7A 2FP7B 3UREA 3KNXA 4ZXYH 3RXQA 1OP2A 1VITG 1GI7B 2FOGA 1PPBH 3VXEH 4TSFD 3SQEE 5HM9A 4WJG2 1KXFA 1EX3A 3BTEE 1VZQH 1SLXB 1PYTD 1VKYA 1HXFH 3B9FH 5DP6A 1QZ8A 1J9CH 1GJ6A 2PV9B 1SGQE 3E3TA 4SGAE 4Q7YA 3FP8E 5JBAS 3F2HA 1GJDB 4JZFH 4OS5A 3MOCA 5T3HA 1TRMA 4HGCA 1LDTT 3GCHB 1UHBA 2VWOA 1C5MD 1H9LB 3TITA 4ESTE 2P3FH 2QGRA 1P2OA 3V12A 1AFEH 3ZZ4A 2VWMA 1IQJA 1OOKB 2FODA 1QR3E 2ZQ1A 1EPTC 1E38B 1MKWH 3TH3H 3M5OA 2GV6A 1W11U 2BVSH 4ISOA 4TPIZ 3VB5A 2GVFA 2VJ1A 1SGIB 1ELFA 4LZ4B 1ABIH 3HKIB 1GBLA 2BMGB 1O33A 2XXLA 1SQRA 3NUMA 5KECA 3BTQE 5B6LA 1RRKA 3D23A 1P06A 3LGWA 1SGYE 3MU1A 4KP0A 2BZAA 3SJKA 4BXSA 1K1LA 3GCOA 3PRBA 1EJAA 1XUJA 5T1VA 2PGBB 3MWIU 1BRCE 4CHAB 4ABHA 2AMDA 1BITA 1FMGA 3T5FH 1O2QA 1SSXA 3PWBA 1MKXK 4INHA 1DANH 1A2CH 1CHOF 2A7CA 4ZHMU 4ABJA 2V35A 4BOHA 1WSSH 3AASA 1K1IA 4FETA 1H1BA 3BEFB 1LKBA 4YESB 1CHOG 1THRH 3SUEA 1L2EA 1LHDH 8ESTE 2JH6D 3B8JA 3P8GA 4VGCC 2G8TA 1DLEA 2RDEA 3SGAE 5CMXH 1SG8B 3TK6A 3VGCC 3P6ZB 1V6DA 5DP5A 1SR5C 2W3KA 2FOHA 4CH8B 3RXOA 1GBBA 4OGYA 2A2XH 1GI8B 1S81A 3M3TA 3N99A 1FY1A 2QF4A 2FIRH 2VB0A 5DN6D 1EFRD 3OFND 1HYLA 2IPHA 5JBCS 1CBWB 1FY3A 3TJVA 2FEQH 3QO6A 4JYTA 1F0RA 1WQVH 1WCZA 3KHVA 4Y8YA 1S85A 1D4PB 2ZA5A 2A4QA 4U30A 1K0HA 3MH5A 4B74A 2GDDA 1MABB 2D2DA 5EW2H 3U8OH 1GMHG 5JB9S 5K0HA 1ZHPA 3OYPA 1AQ7A 4MQAA 3ZZCA 1WTHD 3SU0A 3RXUA 3PO1B 2HOBA 3N7EA 3EE7A 5LH8A 1QL7A 3K6YA 3O8RA 2O8TA 1BT7A 1GI9B 2EC9H 1GBIA 3VPKA 2H9EH 1IQIA 2ZFQH 3DSOA 1O2YA 3RUOA 2QIQA 1YPMH 2KCPA 5EIYA 3MQKC 1HNEE 1TX6A 1ANCA 2HVXA 1DWBH 1FX0B 4MVNA 1DSTA 1AVGH 4FXGH 3W94A 1XX9A 3SJ9A 3PB1E 3ZV9A 3ZZ6A 2FI5E 2QXGA 2LNCA 3VG8A 5KGOA 3KF2A 1FI8A 4X2WA 2KCYA 1ZPBA 2HNTE 3U28C 2OC7A 4IBLH 2K1QA 2JIZD 3A86A 1NM6A 1THSH 1V2NT 3E91A 2BOHB 1QBOA 3OY6U 1K22H 5ABWA 4ZXXH 3VB7A 1PFXC 2YMSB 2WHXA 1C2DA 1FN6A 5C1UA 4O3UA 2BDGA 3E0PB 1ZMLA 2F9UA 1HIAB 1P0SH 1AFQB 1DITH 1O3KA 1N8OB 2Z6BD 2K7XA 2FXRA 4F49A 1BHXB 1EKBB 1NS3A 2A2QH 4Q7ZA 1MCVA 2W3IA 1YWUA 2FYRA 1GJAB 1PQ5A 2A31A 2V0BA 1SGRE 3AAVA 4AFQA 1QHRB 4DT4A 3RU4T 2ANYA 2ZPSA 1G37A 4E05H 1TNGA 3LJJA 2P16A 1TOMH 1RTLA 1UTJA 3HPTB 5TCCA 2ZGCA 2AMPA 1QQUA 1TX8A 3BF6H 1XKAC 5PTPA 1MQ5A 1QQ4A 1VCPA 4FUHA 2GZ8A 4Z1MD 2P8OC 2LP6A 3QGNB 1SOTA 2Y82A 4JK5A 2AS9A 1P9UA 2Y5FA 1KLTA 4NIXA 4DVAU 1W0YH 1AY6H 1GBDA 3SNAA 4ABDA 1SB1H 2AERH 1NFWA 1W14U 1SGNE 2BD2A 1Z8JB 2I6SA 4HI3A 2THFB 4P00A 1QJ6B 2PTCE 1S6LA 1MD8A 3T26A 3S7KB 1O3IA 3KN2A 4MNVA 1D3TB 3ZYEA 2FX6A 1O34A 1NRQH 3GY7A 4RT0A 3F9HA 2BXUH 4AYYB 3ZYDA 2QC2A 2ODYB 4DIIH 3U69H 1O3MA 4CBOA 1KXEA 1DWCH 1B0EA 3MNSA 2ALPA 2L74A 4R0IA 1HB0B 4XBDA 1YPJH 3BEUA 2FOMB 1IQFA 1C1MA 4F4OC 4RT1A 1C5VA 1K1JA 1O3DA 2AGIX 3EGKH 3H5CB 4E7NA 4B75A 1YC0A 1UTLM 1F5RA 2IJOB 1LHFH 2R2MB 3A7WA 1TNIA 3D62A 4B1TA 3F9GA 2SNVA 2ZGBH 2JKHA 1EJMA 4X8VH 2BDCA 5EJ1A 1WTGH 1HXEH 2ZGXH 1T8MA 4UD9H 1GHZA 1MTVA 3O8BA 1C2FA 5AHGH 5L6NH 3RMMH 5EQSA 3FP6E 1GPZA 5F6MA 1QNJA 1SVPA 1C1PA 4A6LA 1EB1H 1EPTB 3MI4A 3A84A 1O5EH 3LC5A 3F9FA 1E34B 2OC1A 2UUKB 3STIA 1K28D 1SLUB 2IPQX 2CHAC 3QZQA 3PWCA 2WUBA 1F0TA 1P05A 1F5KU 1SQAA 1QY6A 2ZHWH 2A5IA 5JYIA 5FCRA 3MO9A 3LJOA 1UTNA 4IN1A 1ELTA 4CH2B 1A61H 2F9BH 1GJBB 4NZLA 1GJ5H 2WSSD 1DE7H 4CRCA 1YPKH 4K8BA 4MPWA 2FDAA 3GY6A 1GBHA 2OP9A 3GY5A 4TPYA 1BIOA 1Y3VA 1PPFE 3F6UH 2ZU1A 1TPAE 4NWKA 1C1SA 5FPSA 4AZ2B 1MTUA 7KMEH 2F4LA 1AIXH 2Y5GA 5TJXA 4IMQA 2H5CA 3OSYA 1QJ7B 4Y7AA 1CQQA 1YCPM 4IS5A 1S6HA 4Y0YE 4VGCB 1BTYA 3NK8A 1TRNA 3VGCB 1V2KT 3QTOH 1ACBE 1GGDC 2W6JD 2Z3EA 4X2XA 1D3QB 1DDJA 4DG4A 1K1MA 4YT7H 3K2UA 1KXCA 2VVUA 3ATWA 1HAYB 3I77A 1FPHH 6GCHG 1V2ST 1ZYOA 1HAPH 2Q6FA 3ZZAA 4DY7B 3CENA 1SL3A 1P2NA 5LPRA 1O39A 2ZFRH 1O38A 2JDID 5C1XA 2XBVA 3M7UA 1BBRH 2BLVA 3P95A 3SGQE 3RMNH 2A45B 4AFZA 1V2QT 1VJAU 5GNDA 2R9PA 4I8HA 5FAHA 4HZHA 1V2UT 3AK5A 1N6XA 5T6GA 1TGBA 3RXHA 4ISLA 2G5NA 2B9LA 4ZKSU 1O3OA 1ARCA 1WAYB 2Z7FE 1XVMA 1YPEH 4BAOB 1GMDF 2H5DA 1HAZB 4AG1A 4K69A 3R0FA 1BDAA 3DHKH 3VFEA 3RLYH 3SHCH 2RA0A 2LIZA 2HGTH 5I46H 4O9VA 3AW1A 3TK5A 4NA9H 1TABE 5AFYH 1C5YB 3ZZDA 2FMJA 4H4FA 4O97A 4BAQB 3EDXB 1UK2A 3KYGA 5DJ7A 1AB9C 1BUIA 5J4QA 1AZ8A 3T28A 2PSXA 3MNBA 1CGJE 2BD5A 1AUJA 5A09A 1Y3YA 2O8UA 2SGPE 3PROA 1TRYA 1ID5H 1O2RA 4AFUA 4M7GA 1UK3A 1O3CA 1SLWB 5A8YA 1P03A 2G4TA 1PQ8A 2FOFA 2EI6A 3W1EA 1B5GH 2OINA 2ILNA 3URDA 2FWWA 2FS9A 1O2GH 3N7DA 1ZRKA 3S7HB 2V3MA 3DFJA 3UFAA 1WXRA 6CHAC 2ZTYA 3TGJE 3P17H 4AGKA 5DP8A 4FU9A 1NRPH 4U32A 5C20A 2JJ2D 2D8WA 1DY9A 3RXIA 1ELCA 1LPGB 5F53A 2ZDKA 1GL0E 5C3NA 2QF3A 5GPIB 1EUFA 1E36B 1AKSB 1LPZB 1WUNH 3AVZA 3LH1A 2YNBA 4AFSA 1MQ6A 4ZKOU 4X8SH 3QZRA 1BRBE 2ZGHA 3LGTA 1C4V2 2Z9JA 1W7GH 2VH0A 1O3FA 1GMCF 2Y5HA 2AEIH 1EJNA 1GJ8B 4ABAA 3BTTE 1GMCG 1WV7H 2ZHFH 2AGEX 4O03A 3ZVBA 2A1DB 2G52A 1C4Y2 3FO8D 1RS0A 2WPHS 2WV4A 1TYNA 4ISIH 1IOEA 4FUBA 1W8BH 3P8OA 2KX4A 4X6MA 2RG3A 3RXAA 3CS7A 2AIQA 4MPUA 3OEED 1UVTH 2XC4A 1OSSA 1AD8H 3ZIAD 1GHBG 3V3MA 1EOJA 2P8OB 4NFFA 3WY8A 1TNHA 2KAIB 3PYHA 1MU8B 1ZHRA 2J92A 3BG8A 1ZGVA 3RXPA 3KQBA 5IYTA 2BQ6B 2ZI2H 4AGJA 2GZ9A 2R2WU 4Y6DA 5BRRE 1HAVA 1QURH 2GGVB 4IC5A 2BD8A 3KQDA 3CNRA 1HAIH 1GBMA 4KTSA 1S5SA 3UOPA 3DFLA 2BY7X 1YLDA 1O30A 3NRLA 1GJ7B 1LHGH 1C1UH 2ZF0H 2CK3D 3WW7A 3VB4A 4F48B 1UW7A 3HK6B 1Z6JH 2ZFSA 1YGCH 2BM2A 2BHGA 2DUCA 1ZMNA 1ZSKA 4D7GA 1TONA 3RXEA 3LGVA 1G30B 1ZSLA 1SKYE 2GCTC 1T32A 5C2ZA 1HV7A 1MMJN 1P8VC 4K1EA 4GVUA 2BQWB 3KYFA 1FN8A 1GBKA 1C1RA 2BDBA 1NU9A 5FPYA 1FY4A 1GBTA 3O8CA 1GDNA 1OWKA 1ZSJA 1SFQB 3EE0B 3RC5A 1NY22 2GTBA 5DP9A 1C1NA 2KM0A 1UTMA 5EU8A 2VBCA 4P02A 1XMNB 1V2LT 3NKKA 4DW2U 1OWEA 1O2SA 3MYWA 2Y7XA 1BRAA 3HGNA 2C4FH 1TGCA 1H8IH 2P59A 1LVYA 2O9QA 3LKWA 1T7CA 4YOGA 2V3OH 2VIQA 2B5TB 4YT6H 2QY0B 1ORFA 2BY9X 3UB0A 3S9BA 2KR7A 3SV8A 2Z9LA 4I8JA 1TGSZ 2CHAB 3BV9B 5DKMA 1A0HB 1GI5A 3EQ0H 2J98B 2ZHDA 3MNCA 3NXPA 1MZDA 1GDQA 3PV4A 4MDSA 1KYNA 1UCYE 3PLKA 2H9HA 2H1UA 2Q6DA 4O3TA 2BDHA 4TYDA 3GDVA 5IK2D 1FONA 1FV9A 3OTPA 1TB6H 1ANDA 4MNYA 1C2IA 2UWOA 1Z6EA 3Q3XA 1IQNA 1ZTLA 2XC5A 3TPIZ 1O5DH 1P04A 3RXMA 1G3CA 1FZZA 4Q63A 5EPNA 5LPEA 2C8YB 1OWIA 3M7QA 1C2MA 3OU0A 1BB0B 4XD7D 3SOSA 3PMJA 2HWLB 1QRWA 5DP7A 2WPJS 4NSYA 3ELAH 1GGDB 4RI0A 1BTUA 3OY5U 1O0DH 4Y76A 1D3DB 3VEQB 4FUDA 4K2YA 1EXFA 5A0BA 1UVPA 4X1PU 2O8WA 1A0LA 3RC4A 2R3UA 3KIDU 3SI4H 1PJPA 1QB6A 4DOQA 3WWFA 4CRBA 1A3BH 3RMLH 1BHXF 1C2EA 3MU4A 4D9RA 5DSFA 4INLA 3SBKA 1ZGIA 2QXJA 5FX5A 5A8XA 1T4UH 2XYAA 3A8BA 3E1XB 3PTBA 1S6FA 1BJVA 1FDPA 3MO6A 4CR9A 1J17T 1BBRE 2A4OA 4TWYA 3MU0A 2ZTZA 4X1SU 4FUEA 4ISNA 1MBMA 4KGAA 3SU3A 2P3UB 1TGTA 4SGBE 1YKTA 2F9VA 2ANMH 4F55A 1O3GA 1E1QD 1YBWA 1IQLA 4GUXA 1Y3XA 1YLNA 7ESTE 1SGEE 3URCA 2XNIA 4FOUC 3SU6A 2TRMA 3RU4D 1GI3A 2VINA 3ESTA 2PW8H 1F2SE 5GJ4B 2VGCC 1HAOH 1TIOA 1Y8TA 3FAOA 3QK1A 4BNRA 2W5EA 4Q4LA 2YMSD 3SI3H 2NU1E 1HUTH 1AB9B 2K0QA 3SUFA 2ZCHP 1V2WT 1SGCA 1K1OA 5DGJA 1AE5A 1CE5A 1K1NA 4Z6AH 1A7SA 1GI6A 1J14A 3FZZA 1P11E 2VU8E 1HLTH 3TK9A 3H09A 1O2MA 1JRTA 1A3EH 1QL9A 3UIRA 2F43B 1O2TA 2NU4E 4WH6A 2M5TA 3M3SA 1RJXB 3A7ZA 1SLVB 1S84A 2BX4A 4NIVA 2CGAA 2P95A 6CHAB 3MH7A 1VJ9U 1O5GH 1C5UA 1TMTH 2PKSC 1TNLA 1Z1IA 1E79D 1YPHE 3HKJB 3ZZ9A 4UONA 1DWDH 3F3BA 2PKAB 2ZDAH 2OQ5A 2FI4E 1A5GH 4YLUA 1EATA 1ARBA 1AGJA 1MTWA 2VIWA 4NWLA 1HCGA 2CF9H 4AYVB 3LH3A 1BMFD 1L1JA 3RXJA 3TVJB 1LQDB 1LO6A 9ESTA 1GJCB 1O31A 1XUHA 3ODFA 1BTXA 2BDAA 4HFPB 1C9TA 1ZJDA 3SUGA 3ATLA 4JMYA 3FFGA 2ZU5A 2HLDD 1KXBA 3S69A 1AU8A 5KEDA 5JPMH 2VNTA 1SOZA 2I6QA 1CA0C 2OBQA 4NA7A 1BMAA 1D6WA 1C5XB 3ATKA 1QA7A 5HXFA 3BSQA 4WMEA 2Z3DA 2DE9A 3OEHD 1OYTH 4X8TH 3RXFA 3U1JB 1K21H 3GS9A 1ESBA 1PPHE 3MMGA 1IHSH 1Z8IB 1K2I1 2BD4A 2Y81A 1NBMD 4A1TA 5HKKD 3OTJE 1MKWK 2ZGJA 1ELEE 2KCAA 5EQQA 2GJGA 3SHAH 2ZDNA 2DE8A 5HMAA 5EJLA 4UFDH 1NN6A 1HPGA 1S82A 2ZFPH 5FHTA 1FAXA 3RMOH 5CHAC 5JBBS 2EI7A 4ASUD 2ZO3H 2J2UA 1MUEB 1XUKA 2PR3A 4ZH8A 1WBGB 1BRUP 5C5OA 1YCPH 1BOQA 4YXWD 3VXFH 3V0XA 3SNBA 2WPKS 2FTLE 1O2NA 3GY2A 3GY8A 4DIHH 2GCTB 2FYQA 5F8TA 1VCQA 5FXLA 4B6EA 1SQOA 1TBQH 2ZG0H 2Z9KA 3ZVDA 2R3YA 5DPAA 4U2WA 4XBBA 3K9XB 1ZZZA 3NZIA 1GJ9B 3GISB 4NA8A 5L2YH 2OC0A 3K65B 3QGJA 4NCYA 4ABGA 5GIBA 2PLXA 4A7IB 4ZKNU 2GZ7A 3BN9A 2BY6X 1EAXA 3MH4A 1BJUA 2GCHF 1KDQB 4FUIA 1MAYA 3EBNA 1TA6A 1LHEH 1UVSH 1WDIA 2GT7A 2GCHG 1SHYA 4JCNA 1C4U2 3H7TA 3RLWH 3SO3A 1YY3A 1CGHA 5C17A 2BD3A 1F92A 1BTPA 2OQUA 5AVDA 1C5NH 1GVKB 1EZSC 1TBRH 3A8CA 3QX5H 1P3CA 5C67A 2SGEE 3GDUA 1ZRBA 4GPGA 4ABFA 4OS6A 4U01A 1RGQA 1UCYH 2KZ4A 3AW0A 1BMLA 1X7AC 3UNRA 3L3TA 1HIAA 3MO3A 3LU9B 1O2UA 1ELGA 1QB9A 3LPRA 1V2TT 3P70B 4DURA 1AWFH 1AE8H 3SORA 2VIVA 1INCA 3GY3A 1CT2E 5GCHF 5C94A 2SNWA 1ZTJA 1TALA 2ZHQH 3AAUA 1F7ZA 1NT1A 5GCHG 1JXPA 3PV5A 4INKA 4CR5A 2STBE 5GDSH 3M3VA 2WPLS 2ZU2A 3FP7E 1GHAF 2F83A 3UWIA 3SNDA 1O2JA 2W7UA 1EB2A 2FOAA 2AH4X 5HIYA 2RCEA 1A5IA 1TQ0B 2CJIA 1XXFA 2JH0D 4RSPA 2TGPZ 2Z9GA 4NIWA 1UMAH 2B8OH 4Y7BA 1GBEA 2CV3A 2VVCA 3V7TA 1QTFA 5TCAA 5E2OA 2FI3E 1H9HE 1PYTC 1D6RA 2ZU4A 1FY5A 1NBME 3U1IB 4AB8A 2WV9A 1DS2E 5ESTE 3UNQA 4ASHA 3QTVH 1ELAA 4FUJA 4Q2KA 3F9EA 2BQ7B 4ZMAH 1EP5A 2VIOA 1ZLRA 1C5SA 4KELA 4MPVA 2VWNA 2QXHA 3RXDA 1KY9A 2J9NA 3KQCA 1AZZA 1Z7KA 4LK4A 4TY7A 4NGAH 3TJOA 1HJ9A 2FOBA 1V2RT 2FOCA 1L0ZA 4BTIB 1C5PA 1ELVA 1SBWA 1TFXA 3RXVA 3UOUA 4I86A 4J1YA 4D8NA 3ZVAA 3TJUA 1Z8RA 3A85A 4GLYA 2AYWA 2C8ZB 3UAIC 3LT3A 4FUCA 2WPMS 1W7XH 4A1VA 1GI2A 3LONA 1MBQA 2HNTC 4RKJB 1G2LA 3C27B 1ESAA 2QV1A 5EXLA 2OK5A 2BLQA 2FLBH 1OWHA 1T8LA 3BTDE 1Q2WA 3LGUA 2XCNA 2Q1JA 1P3EA 2L6OA 1G3EA 4OS7A 2QAAA 1Y59T 4PROA 1GI1A 3GYLB 2ZPRA 1QIXB 1P2MA 2FS8A 5BPEA 3MNXA 1O5BB 2QA9E 1GMDG 1H8DH 3SGBE 1DX5M 1MTNC 3SV9A 2J94A 3D65E 3ZVEA 4DCDA 3H7OA 3SJOA 1EPTA 5E0JA 1K1PA 2C8WB 4FU8A 4R8TB 4B2BA 1C2KA 2SGQE 1CHGA 1KTSB 3IWMA 2J97A 3A81A 2WYJA 4B2AA 3RXRA 4K1TA 1Y5AT 1C5WB 2RA3A 3MHWU 1C1VH 4NZQA 2GT8A 1NRRH 5HM2A 1DLKB 3PLBA 4ABEA 3I78A 1FLEE 1NFUA 4FU7A 1QJ1B 1V3XA 2P3TB 4K8YA 1F0UA 1G3BA 1RTKA 1KLJH 1W0ZU 3S0NA 1QCPA 1O3JA 1DFPA 5FPTA 1MKXH 2PKSB 1NTPA 4H6TA 2ANKH 4WMFA 3A8DA 3P8FA 5JBTA 1GBFA 1XUGA 3JZ1B 1EAWA 5I25A 3PV2A 4FUFA 2XRCA 1ABJH 1GI4A 4B76A 1BMNH 4IMZA 1TBZH 4Z0KA 2SGDE 4YLQH 1O5FH 5ETXA 3SJ8A 4ACAA 4YOIA 2V3HH 1O5AB 1IQHA 2NU3E 3NWUA 3RXGA 1Z71A 4I33A 1AVWA 2TBSA 3ZVGA 4B71A 1THPB 2Z3CA 2XNDD 1UHBB 1OWJA 1C9PA 1CA0B 3RC6A 4CBNA 1GDUA 2H6MA 4JYUH 3GICB 1RD3B 2BLWA 4ZROA 4KTCA 7GCHF 2J38A 2OXSA 4K1SA 1SPJA 2JJ1D 3HATH 1FNIA 5EGMA 2UUYA 2GMTC 7GCHG 1SGTA 4ZKRU 2WYGA 5A0CA 1OPHB 1BZXE 3LIWA 1FIZA 1AFQC 1Y3UA 4X2YA 5C1YA 4BAMB 3BTGE 4A92A 4B2CA 2UUJB 4E7RG 3M36A 1HGTH 5A8ZA 5EJZA 3RDZA 2XBYA 5CHAB 2P93A 1NFYA 3S9AA 1IQMA 1EAIA 4XBCA 4AX9H 4NIYA 8GCHF 2PFEA 3KQEA 3SZNA 1GHYH 2JETC 1NESE 1S83A 4RN6A 4AOQA 1GBJA 1MZAA 1GHWH 4XOJA 1LCYA 5C0UA 2BY8X 4THNH 1ZPZA 3GOVB 5L2ZH 1C2GA 2TPIZ 1DUAA 4OGXA 4HTCH 3OE7D 1PPZA 1QRZA 2RFKC 2UUFB 1O3AA 1S0QA 2J34A 1W0KD 1DXWA 1D3PB 3FVFB 1BCUH 3QLPH 3BTHE 3GYMA 1P2IA 3G01A 1J15A 3ODDA 2WUCA 1SGDE 1JOUB 1G2MA 2Y80A 4XFQA 3U8RH 4BAHB 3LGYA 2XC0A 5JDUB 5DP3A 2XWBI 1CA8B 3PRDA 1C5RA 3IG6B 1OXGA 3UR6A 1O2XA 2ZFFH 2J5UA 2G81E 4MLFB 1VGCC 3E8LA 4UFGH 5EPYA 1OYQA 1VITF 2PUXB 2KCOA 1ELDE 1UJ1A 3BEIB 1L1GA 2ODQA 3KQ5A 1DM4B 2VWLA 1NO9H 2J95A 1A1RA 1O3EA 1HRTH 1NU7B 4UEHH 1YPLH 1SMFE 1DSUA 2AHME 3PTNA 1MTSA 1Y5BT 1AKSA 1BBRK 1DY8A 1M9UA 3SU2A 3GDSA 1COWD 3I29A 1T31A 3RXSA 2SGFE 3T29A 4CRGA 1AWHB 4ISHH 1DXPA 4WY3A 1J8AA 1PPCE 2ZFTA 1P9SA 3GCNA 4JZDH 1TLDA 3PLPA 1TNJA 5K7RA 1TE0A 2HRVA 4Y11E 1E37B 2ZPQA 1O36A 5FCKA 3A88A 3ZZ5A 3QDZB 4RKOB 2W7SA 2CF8H 1O2VA 3OX7U 5DK1A 1NFXA 2WPDD 3RXCA 2PGQB 3S9CA 3BTFE 3QWCH 3F68H 4MNWA 2AIPA 1AO5A 3UY9A 6ESTA 4LOYH 1EZQA 1SGFA 1QB1A 1XVOA 1GHVH 1KMHB 3RXTA 1LMWB 1FY8E 1NPMA 2KAIA 4ZUHA 1DUEA 2ZU3A 2Y6TA 3T27A 2BX3A 2ZC9H 4YOJA 3DT0H 3EA8A 3EA9A 3SV6A 1CO7E 3GCTF 2KFWA 1UTQA 3DA9B 2SGAA 2P94A 2FTMA 2STAE 3GCTG 4JZEH 3MFJA 1ZMJA 2XBWA 2A4RA 4WVPE 1V2PT 1V2VT 3A7VA 3JZ2B 4LXBH 2QF5A 2ZKSA 3TNSA 4MPXA 2G55A 4GCHF 4WF8A 1O2OA 1OP0A 2BLOA 4HG6A 1DICA 4WWYA 1ZOMA 5A0AE 3MTYA 1FQ3A 4GCHG 4UDWH 2ESTE 1P57B 1H4WA 1K9OE 4IN2A 3A80A 3BTWE 1P2JA 3PMAB 3U9AH 1SGPE 2TGTA 2FPZA 1TPSA 1E35B 2GP9B 3M5NA 2IN2A 5CE1A 5C5NA 4M9FA 3R3GB 3BIVH 1DWEH 1GBCA 1HJ8A 1IQEA 3SW2B 1TAWA 4I8KA 4ABBA 2AFQB 1LPKB 3MU8A 4AC9A 3DCLA 5GWZA 4KTUA 2ZQ2A 3UTUH 2ODPA 1TNKA 1T8OA 4NG9H 1IQKA 3BTME 2R0KA 2XOKD 3NCLA 1V2OT 2A5KA 3TNTA 3SNCA 4DT7B 3UR9A 2PTNA 5HGGA 1W13U 2G51A 3M37A 1GMHF 1GG6C 1MTNB 3M7TA 1FXYA 3A7YA 3F2GA 4X8UH 1UVUH 4FVDA 1EOLA 2ZNKH 1TWXB 2ZP0H 2B7DH 1AMHA 4AB9A 1TPPA 2OLGA 3HGPA 1W3CA 4JZIA 2EQNA 1O2HA 2A5AA 1KLIH 5E8EH 1HAGE 3M61U 3RM2H 4UFFH 3M5LA 1RIWC 4TY6A 1DVAH 2J98A 1B0FA 1NZQH 1JBUH 2M2AA 3E16B 4QT8C 2QF0A 2F91A 3ZV8A 2F9NA 2WZQA 3SNEA 1DPOA 5IDKA 3BG4C 2OBOA 1EAUA 1UO6A 1D9IA 5AF9H 3QUMP 1QL8A 1ESTA 3UWJH 5JB8S 1ETTH 2PHBA 3FZDA 1AN1E 5F8ZA 1GCTC 5EOKA 1XUFA 4YM9A 1HDTH 4WMDA 2QXIA 4YZUA 4X1QU 4CREA 3U8TH 1Y5UT 3DUXH 4FUGA 2QYIA 1CSOE 4OS2A 1L1NA 1O3BA 4ABIA 4MG3A 1IQGA 3M35A 1CT4E 3M5MA 1GVLA 2QN5T 3RXKA 4JK6A 1YLCA 3PMBB 2UWPA 4ACBA 5T6FA 3F2FA 1C1WH 3LOXA 5B6OA 4DJZB 1LHCH 1AHTH 2BXTH 8KME2 1DOJA 3OAAD 4ZCNA 1EQ9A 1KTTB 9LPRA 2XCFA 1HJAC 1QFKH 1RXPA 1V2MT 1BA8B 2GMTB 1OWDA 2YOLA 1TGNA 5DP4A 3SQHE 2BDYA 2K8IA 1LVOA 2FESH 1L4ZA 1LQEA 4XE4A 1GCDA 1C5OH 3QN7A 4OS4A 2D1JA 1ZHMA 3E0NB 1C2JA 4I31A 3K6ZA 2XWAA 4MTBA 2ZCKP 1ANEA 3ATIA 1E1RD 2ZDVH 2ZTXA 3W95A 1GBAA 2HLCA 2EEKA 2NU0E 4Y0ZE 1XM1A 1UK4A
chains in the Genus database with same CATH topology
3A8AA 1XXDA 1UTOA 1C5LH 2IOTA 3A83A 1BTWA 4I7YH 2JETB 2WPIS 3ZVFA 1WYKA 3T62A 1Y3WA 8LPRA 4X0WU 2Z94A 1YPGH 1YP9A 5EXMA 2BVRH 2HPPH 2TGAA 1CT0E 4GHTA 5E0GA 2G00A 1PPGE 2XBXA 3UUZA 1SC8U 3SJIA 3TGKE 1Q3XA 4DGJA 3A7TA 1ZR0A 2C8XB 5FBEA 1MAXA 1O2KA 2TGDA 2BDIA 5ESBA 1O32A 3RU4E 1PQ7A 5E2PA 2ZCLP 3PMHB 1JIRA 2Y7ZA 2FLRH 5LPFA 4XSKU 4AORA 1SI5H 1OP8A 1C5TA 2VH6A 1O3NA 4WXIA 5EXNA 7LPRA 2A4GA 1VGCB 2YNAA 2OTVA 2BY5X 1VCWA 4Y8XA 1S0RA 1C2HA 3TH2H 1MU6B 1EZUC 2PKAA 1C1OA 3ZZ7A 3A82A 3O8DA 4GSOA 3SU4A 3P8NA 2A7JA 1GVZA 3ZZ8A 3ENSB 3BIUH 4A5TS 4CRFA 1OKXA 2ZEBA 2NWNA 3KL6A 4CRAA 1PQAA 4ZHLU 1ZTKA 4ZHAA 4D76A 1BQYA 4LZ1H 5A2MH 2CXVA 3N7OA 2EA3A 1ETRH 2BTCE 1O2IA 3B23B 5EG4A 1ZPCA 2WV5A 2Q6GA 3TJNA 3GCHC 3A87A 1BTZA 1HAXB 2ZWLH 2RDLA 1QBVH 2GKVE 1IHTH 1QRXA 2R0LA 4BANB 1B7XB 2FOEA 4GHQA 5E0HA 1J16A 2EI8A 4YTAA 4CRDA 6LPRA 1EASA 1P12E 1C5ZB 2PSYA 1O35A 1PPEE 1BTHH 5AFZH 1GHAG 1C1QA 1W10U 3ZZBA 1RFNA 1TQ7B 2OD3B 5FX6A 3CS0A 3CP7A 4ZAEA 1O3LA 1G9IE 2F9PA 1C1TA 2G5VA 4K60A 1P02A 5EW1H 1ELBA 3GY4A 5GXPA 2QCYA 1SFIA 2F9OA 2OUAA 4D9QA 2BYAX 2C90B 3SUDA 1TMBH 3SU1A 1LVMA 4IC6A 4AG2A 4CHAC 2GDEH 1WOFA 1UTKA 3Q00A 1G3DA 1OX1A 2HPQH 1NRSH 2NU2E 4H6SB 3KCGH 4BTUB 4BTTB 4OS1A 3UQVA 4B73A 1A0JA 4Y71A 3D49H 2BD7A 2PUQH 5F8XA 1JMOH 3UPEA 4NFEA 3TLOA 2PWXA 2Z9IA 3MH6A 1JRSA 1U6QA 4J2YB 1JWTA 3RP2A 1P2KA 2OC8A 1HAHH 1RTFB 2FO9A 6GCHF 1ZJKA 5G4BA 1CVWH 1AUTC 5HYOA 2W26A 4MNXA 4I8LA 1KDQA 1YPHC 3A89A 5EQRA 4D7FA 1SGFG 1A46H 1CBWC 3RM0H 2ZIQH 1AI8H 3MU5A 5EODA 2XTTB 2TIOA 1WQSA 1GG6B 1QBNA 2A32A 1YYY1 1ETSH 4UE7H 1FPCH 1TPOA 1O37A 1O3HA 5T6DA 1MCTA 3SN8A 3TH4H 2ANWA 3L33A 2ALVA 2XW9A 2VGCB 1O2PA 3VB3A 4IW4E 1AVXA 3LDXH 1WU1A 3TIUA 2G4UA 4Y79A 3TGIE 2B0FA 2O8LA 2WINI 4X6NA 1HAVB 1RIWB 3ZZ3A 2VIPA 1YM0A 2CN0H 1F5LA 4BXWA 4YO9A 1XUIA 3PO1C 3RXLA 4JYVH 4UFEH 1O2LA 3IITA 1FUJA 1GI0A 3L6PA 1F0SA 2O8MA 1Q31A 2ZZUH 1Z1JA 3E90B 3BG4B 1BMMH 2H9TH 4I32A 3F1SB 1LTOA 4TWWA 2A7HA 4WXVA 1W2KH 1IAUA 1GCTB 2GV7A 4FVBA 1TA2A 1EP6A 1YCPK 3T2NA 5LGOA 1HBTH 1NROH 3ATMA 2ZDMA 1E0FD 3EYDA 1NRNH 1OS8A 2BVXH 3NPSA 3KEEA 1P2QA 4WH8A 3Q77A 2LPRA 1VITH 3C1KA 1LKAA 4I8GA 3EA7A 1CU1A 1TX7A 1FIWA 4X6PA 1C5QA 1EZXC 3ITIA 1GL1A 4BAKB 1H9IE 3EAJA 1LVBA 3UNSA 4X2VA 2VIDA 1V2JT 1T4VH 2ZHEH 4AN7A 3P92A 4X1RU 4X1NU 3STJA 1HJAB 3ZVCA 1JIMA 2UWLA 4X6OA 2V6NA 1FJSA 2GD4B 2BB4A 1QA0A 1SQTA 1XKBC 5FBIA 3V13A 3LGIA 2AGGX 2VVVA 4Q80A 1C2LA 1ANBA 1L4DA 1VR1H 5SGAE 1KXDA 4H42U 4E06H 1N6YA 4K5ZA 1UTPA 1QGFA 1Z8GA 3KGPA 2BZ6H 1CGIE 1N8OC 1UCYK 2A0QB 1TOCB 4KKDA 3BTKE 2ZDLA 1KIGH 2BD9A 3DD2H 1O3PB 1MH0A 2OCVB 3T25A 1YF4A 1G32B 1TMUH 4K3JA 1UVOA 2ULLA 3Q3YA 3VB6A 1HFDA 1NC6A 2SFAA 1P10A 4XDEA 4Y8ZA 1N1LA 2CMYA 4Y10E 5J4SA 1A5HA 1GHBF 3UQOA 1P01A 1FAKH 1GWAA 2ZECA 8GCHG 2HALA 3RXBA 2FM2A 1T8NA 1G36A 2F3CE 4JZ1A 3Q3KA 2AMQA 1P09A 1MD7A 2D26C 4NSVA 3E6PH 1KSNA 3TU7H 1A4WH 3FANA 5DG6A 3U98H 2BOKA 5DO4H 3SV2H 3HK3B 1KXAA 3LC3A 1DT2A 2C93B 1GJ4H 2FZZA 2H2ZA 3SU5A 3Q76A 5L30H 1O2ZA 5F03A 2ASUB 5H4IB 2HNTF 3A7XA 1O5CB 2J4IA 2FX4A 4GAWA 1GHXH 2C3SA 2GX4A 1SHHB 1W12U 4Q7XA 4A1XA 1O2WA 3PM3A 2JH5D 4IGDA 3SV7A 2FP7B 3UREA 3KNXA 4ZXYH 3RXQA 1OP2A 1VITG 1GI7B 2FOGA 1PPBH 3VXEH 3SQEE 5HM9A 4WJG2 1KXFA 1EX3A 3BTEE 1VZQH 1SLXB 1PYTD 1HXFH 3B9FH 5DP6A 1J9CH 1GJ6A 2PV9B 1SGQE 3E3TA 4SGAE 4Q7YA 3FP8E 5JBAS 1GJDB 4JZFH 4OS5A 3MOCA 5T3HA 1TRMA 4HGCA 1LDTT 3GCHB 1UHBA 2VWOA 1C5MD 1H9LB 3TITA 4ESTE 2P3FH 2QGRA 1P2OA 3V12A 1AFEH 3ZZ4A 2VWMA 1IQJA 1OOKB 2FODA 1QR3E 2ZQ1A 1EPTC 1E38B 1MKWH 3TH3H 3M5OA 2GV6A 1W11U 2BVSH 4ISOA 4TPIZ 3VB5A 2GVFA 2VJ1A 1SGIB 1ELFA 4LZ4B 1ABIH 3HKIB 1GBLA 1O33A 2BMGB 2XXLA 3NUMA 3BTQE 1RRKA 3D23A 1P06A 3LGWA 1SGYE 3MU1A 4KP0A 2BZAA 3SJKA 4BXSA 1K1LA 3GCOA 1EJAA 1XUJA 2PGBB 3MWIU 1BRCE 4CHAB 4ABHA 2AMDA 1BITA 1FMGA 3T5FH 1O2QA 1SSXA 3PWBA 1MKXK 4INHA 1DANH 1A2CH 1CHOF 2A7CA 4ZHMU 4ABJA 2V35A 4BOHA 1WSSH 3AASA 1K1IA 1H1BA 3BEFB 1LKBA 4YESB 1CHOG 1THRH 3SUEA 1L2EA 1LHDH 8ESTE 2JH6D 3B8JA 3P8GA 4VGCC 2G8TA 1DLEA 3SGAE 5CMXH 1SG8B 3TK6A 3VGCC 3P6ZB 1V6DA 5DP5A 1SR5C 2W3KA 2FOHA 4CH8B 3RXOA 1GBBA 4OGYA 2A2XH 1GI8B 1S81A 3M3TA 1FY1A 2FIRH 2VB0A 1HYLA 2IPHA 5JBCS 1CBWB 1FY3A 3TJVA 2FEQH 3QO6A 4JYTA 1F0RA 1WQVH 1WCZA 3KHVA 4Y8YA 1S85A 1D4PB 2ZA5A 2A4QA 4U30A 3MH5A 4B74A 2GDDA 2D2DA 5EW2H 3U8OH 1GMHG 5JB9S 5K0HA 1ZHPA 3OYPA 1AQ7A 4MQAA 3ZZCA 1WTHD 3SU0A 3RXUA 3PO1B 2HOBA 5LH8A 1QL7A 3K6YA 3O8RA 2O8TA 1BT7A 1GI9B 2EC9H 1GBIA 3VPKA 2H9EH 1IQIA 2ZFQH 1O2YA 3RUOA 2QIQA 1YPMH 1HNEE 1TX6A 1ANCA 2HVXA 1DWBH 4MVNA 1DSTA 1AVGH 4FXGH 3W94A 1XX9A 3SJ9A 3PB1E 3ZV9A 3ZZ6A 2FI5E 2QXGA 2LNCA 3KF2A 1FI8A 4X2WA 1ZPBA 2HNTE 2OC7A 4IBLH 2K1QA 3A86A 1NM6A 1THSH 1V2NT 3E91A 2BOHB 1QBOA 3OY6U 1K22H 5ABWA 4ZXXH 3VB7A 1PFXC 1C2DA 1FN6A 5C1UA 4O3UA 2BDGA 3E0PB 1ZMLA 2F9UA 1HIAB 1P0SH 1AFQB 1DITH 1O3KA 1N8OB 2Z6BD 2K7XA 2FXRA 4F49A 1BHXB 1EKBB 1NS3A 2A2QH 4Q7ZA 1MCVA 2W3IA 2FYRA 1GJAB 1PQ5A 2A31A 2V0BA 1SGRE 3AAVA 4AFQA 1QHRB 3RU4T 2ANYA 2ZPSA 1G37A 4E05H 1TNGA 3LJJA 2P16A 1TOMH 1RTLA 1UTJA 3HPTB 5TCCA 2ZGCA 2AMPA 1QQUA 1TX8A 3BF6H 1XKAC 5PTPA 1MQ5A 1QQ4A 1VCPA 4FUHA 2GZ8A 2P8OC 3QGNB 1SOTA 2Y82A 4JK5A 2AS9A 1P9UA 2Y5FA 1KLTA 4NIXA 4DVAU 1W0YH 1AY6H 1GBDA 3SNAA 4ABDA 1SB1H 2AERH 1NFWA 1W14U 1SGNE 2BD2A 1Z8JB 2I6SA 4HI3A 2THFB 1QJ6B 2PTCE 1MD8A 3T26A 3S7KB 1O3IA 3KN2A 4MNVA 1D3TB 3ZYEA 2FX6A 1O34A 1NRQH 3GY7A 3F9HA 2BXUH 4AYYB 3ZYDA 2QC2A 2ODYB 4DIIH 3U69H 1O3MA 4CBOA 1KXEA 1DWCH 1B0EA 3MNSA 2ALPA 4R0IA 1HB0B 4XBDA 1YPJH 3BEUA 2FOMB 1IQFA 1C1MA 4F4OC 1C5VA 1K1JA 1O3DA 2AGIX 3EGKH 3H5CB 4E7NA 4B75A 1YC0A 1UTLM 1F5RA 2IJOB 1LHFH 2R2MB 3A7WA 1TNIA 3D62A 4B1TA 3F9GA 2SNVA 2ZGBH 2JKHA 1EJMA 4X8VH 2BDCA 1WTGH 1HXEH 2ZGXH 1T8MA 4UD9H 1GHZA 1MTVA 3O8BA 1C2FA 5AHGH 5L6NH 3RMMH 5EQSA 3FP6E 1GPZA 5F6MA 1QNJA 1SVPA 1C1PA 4A6LA 1EB1H 1EPTB 3MI4A 3A84A 1O5EH 3LC5A 3F9FA 1E34B 2OC1A 2UUKB 3STIA 1K28D 1SLUB 2CHAC 3QZQA 3PWCA 2WUBA 1F0TA 1P05A 1F5KU 1SQAA 1QY6A 2ZHWH 2A5IA 5JYIA 5FCRA 3MO9A 3LJOA 1UTNA 4IN1A 1ELTA 4CH2B 1A61H 2F9BH 1GJBB 4NZLA 1GJ5H 1DE7H 4CRCA 1YPKH 4K8BA 4MPWA 2FDAA 3GY6A 1GBHA 2OP9A 3GY5A 4TPYA 1BIOA 1Y3VA 1PPFE 3F6UH 2ZU1A 1TPAE 4NWKA 1C1SA 5FPSA 4AZ2B 1MTUA 7KMEH 1AIXH 2Y5GA 5TJXA 4IMQA 2H5CA 3OSYA 1QJ7B 4Y7AA 1CQQA 1YCPM 4IS5A 1S6HA 4Y0YE 4VGCB 1BTYA 3NK8A 1TRNA 3VGCB 1V2KT 3QTOH 1ACBE 1GGDC 2Z3EA 4X2XA 1D3QB 1DDJA 4DG4A 1K1MA 4YT7H 3K2UA 1KXCA 2VVUA 3ATWA 1HAYB 3I77A 1FPHH 6GCHG 1V2ST 1ZYOA 1HAPH 2Q6FA 3ZZAA 4DY7B 3CENA 1SL3A 1P2NA 5LPRA 1O39A 2ZFRH 1O38A 5C1XA 2XBVA 3M7UA 1BBRH 2BLVA 3P95A 3SGQE 3RMNH 2A45B 4AFZA 1V2QT 1VJAU 2R9PA 4I8HA 5FAHA 4HZHA 1V2UT 1N6XA 5T6GA 1TGBA 3RXHA 4ISLA 2G5NA 2B9LA 4ZKSU 1O3OA 1ARCA 1WAYB 2Z7FE 1XVMA 1YPEH 4BAOB 1GMDF 2H5DA 1HAZB 4AG1A 4K69A 3R0FA 1BDAA 3DHKH 3VFEA 3RLYH 3SHCH 2RA0A 2LIZA 2HGTH 5I46H 4O9VA 3AW1A 3TK5A 4NA9H 1TABE 5AFYH 1C5YB 3ZZDA 2FMJA 4H4FA 4O97A 4BAQB 3EDXB 1UK2A 5DJ7A 1AB9C 1BUIA 5J4QA 1AZ8A 3T28A 2PSXA 3MNBA 1CGJE 2BD5A 1AUJA 5A09A 1Y3YA 2O8UA 2SGPE 3PROA 1TRYA 1ID5H 1O2RA 4AFUA 4M7GA 1UK3A 1O3CA 1SLWB 5A8YA 1P03A 2G4TA 1PQ8A 2FOFA 2EI6A 1B5GH 2OINA 2ILNA 3URDA 2FWWA 2FS9A 1O2GH 1ZRKA 3S7HB 3DFJA 3UFAA 6CHAC 2ZTYA 3TGJE 3P17H 4AGKA 5DP8A 4FU9A 1NRPH 4U32A 5C20A 2D8WA 1DY9A 3RXIA 1ELCA 1LPGB 2ZDKA 1GL0E 5C3NA 2QF3A 5GPIB 1EUFA 1E36B 1AKSB 1LPZB 1WUNH 3AVZA 3LH1A 2YNBA 4AFSA 1MQ6A 4ZKOU 4X8SH 3QZRA 1BRBE 2ZGHA 3LGTA 1C4V2 2Z9JA 1W7GH 2VH0A 1O3FA 1GMCF 2Y5HA 2AEIH 1EJNA 1GJ8B 4ABAA 3BTTE 1GMCG 1WV7H 2ZHFH 2AGEX 4O03A 3ZVBA 2A1DB 2G52A 1C4Y2 1RS0A 2WPHS 2WV4A 1TYNA 4ISIH 1IOEA 4FUBA 1W8BH 3P8OA 4X6MA 2RG3A 3RXAA 3CS7A 2AIQA 4MPUA 1UVTH 2XC4A 1OSSA 1AD8H 1GHBG 3V3MA 1EOJA 2P8OB 4NFFA 3WY8A 1TNHA 2KAIB 3PYHA 1MU8B 1ZHRA 2J92A 3BG8A 1ZGVA 3RXPA 3KQBA 5IYTA 2BQ6B 2ZI2H 4AGJA 2GZ9A 2R2WU 4Y6DA 5BRRE 1HAVA 1QURH 2GGVB 4IC5A 2BD8A 3KQDA 1HAIH 1GBMA 4KTSA 1S5SA 3UOPA 3DFLA 2BY7X