1LVOA

Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain.
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
molecule tags Hydrolase
molecule keywords Replicase, hydrolase domain
total genus 82
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1lvoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA01
3BF6H 3P8GA 2G81E 4BAKB 2PTNA 5IDKA 3LH3A 2EA3A 4YM9A 1P2QA 1HIAB 2QN5T 3SNAA 3W95A 5LPFA 2WPJS 1BMNH 1CO7E 2BTCE 4AYYB 5C2ZA 1U6QA 2VH6A 8KME2 3JZ2B 3LGWA 3P95A 3DA9B 3M36A 4YOJA 1JIRA 4Y8ZA 2W26A 2WYJA 5TJXA 3SU0A 4QT8C 5H4IB 3M5LA 1TOMH 1XUKA 3EA7A 1V2KT 4OGXA 1AHTH 1VITH 2GCHF 1TX7A 4JYUH 3BTTE 1HBTH 3RM0H 3RXVA 2XRCA 3RMNH 1SC8U 1XM1A 3C27B 3LGTA 3P8OA 3M5NA 1OKXA 4CH8B 2BD3A 1C5ZB 2ZDNA 4OGYA 1ZLRA 4D8NA 4OS5A 2V6NA 1SGDE 1GHYH 2V35A 3M3SA 1TA2A 2TGDA 4X2YA 1W11U 2ZFTA 3PLBA 1D3DB 3LGUA 4GLYA 1O3LA 3PTNA 3TLOA 1EOJA 4E7NA 4Y10E 1C9PA 5JBTA 1WQVH 1ZMNA 3UNQA 2UUKB 2Y5HA 5A8YA 2FOGA 3RXIA 5GXPA 1DICA 1TBQH 1S82A 1TNLA 1MTUA 3QZRA 1GDNA 1H9HE 2ZEBA 1ZJKA 2R2MB 1AKSA 1CT0E 4OS6A 2A45B 1WCZA 3UWJH 2AYWA 5E0JA 3SU1A 1YF4A 5LPEA 1L1GA 3PM3A 1ZSJA 1H8DH 5E0GA 4XDEA 3SI4H 2FIRH 2OLGA 2OINA 1ELCA 1NC6A 2GV7A 1BJVA 1B0EA 3A83A 3F68H 2BZAA 1E38B 1BIOA 3A87A 3SQHE 4X2XA 3HK6B 1AI8H 1EZQA 1AFEH 1DS2E 5EQQA 1DVAH 1E36B 1P04A 5GJ4B 3AAUA 3TH2H 2PSXA 2I6QA 2FS8A 2P3FH 1O2UA 3QZQA 3ZZ9A 3UOUA 1V3XA 1DE7H 2ZDVH 4A6LA 1LVYA 2PGQB 1O2IA 1EJAA 1PQ5A 2ZU1A 4ZMAH 2Y7XA 4UEHH 2FI5E 1GMDG 5LH8A 1W3CA 1ZPCA 2IOTA 1V2WT 3KEEA 1PQAA 4DGJA 2A4QA 2DUCA 2OBQA 3GCTF 2ULLA 1GI5A 2P59A 4THNH 4AG2A 4E7RG 2O9QA 3D62A 1C4V2 3BSQA 4UFFH 8GCHG 5J4QA 2H5CA 4BXSA 4BNRA 1IOEA 1AFQB 1NFUA 3RXHA 1WU1A 3A7WA 1C1QA 1BTYA 1HAVB 3PMJA 1NO9H 1ZTKA 2ILNA 1THSH 3T2NA 4RKJB 3NCLA 4A92A 3O8RA 4DIHH 4AFUA 4B73A 1GG6B 1K1OA 1C2KA 2BDBA 2Z9LA 2VH0A 1TMBH 1W7GH 2VWOA 1DM4B 1DLEA 1HXEH 4E06H 2Z94A 1O3FA 3KIDU 2C8XB 3SW2B 2STBE 3LDXH 1XKAC 2ZHQH 1DFPA 3BTEE 3SHCH 4UDWH 3HKJB 3O8BA 3PTBA 1SGEE 1FN6A 1QGFA 5FPTA 2GDEH 1A3BH 3R0FA 1Z71A 3GY4A 4H4FA 2BXUH 1EB1H 1TAWA 2F9OA 1C5VA 2GCTB 3GDVA 1ZJDA 3TIUA 4ZUHA 1G37A 1N6XA 2Z3CA 1SFIA 1IHTH 1A0LA 3UUZA 2GDDA 4ZHAA 4R0IA 1O2QA 3Q3KA 1HAHH 1SG8B 1TNGA 3M7TA 1QBNA 2BXTH 2BYAX 2BDIA 2FXRA 2ZTXA 1W0ZU 3URDA 2GT8A 2VB0A 2VINA 2AS9A 5JDUB 4TYDA 4K60A 2ZQ2A 2CHAC 1NN6A 1EPTC 1QBVH 3H7OA 2M5TA 5C5OA 1HAXB 2ASUB 2QY0B 2D2DA 4ESTE 3K9XB 3ZYEA 4ISHH 3EYDA 4MG3A 4CRDA 1NU9A 2SGDE 2BLVA 2GT7A 1ABIH 1NRNH 1ELVA 1O2MA 1C9TA 5F6MA 3SV2H 4Q7ZA 3MNBA 1VCWA 3HGPA 4IC6A 2FOEA 4BAMB 4AGKA 4H6SB 1L1JA 1GBDA 2BQ7B 5BRRE 3SORA 1Z7KA 3H7TA 3BG4C 1FQ3A 1CE5A 1BHXF 1QRXA 4YOGA 1ARBA 2TBSA 4BAQB 1MUEB 5EU8A 1MU8B 4K5ZA 3KQCA 1AIXH 1C2HA 3M5OA 3BIUH 2BD9A 4YOIA 1CA0B 1TA6A 2SFAA 2FOHA 1PYTC 3KHVA 1PPHE 1HDTH 1LHFH 3GY6A 3HKIB 3QDZB 2ZECA 5DGJA 2G51A 1Y59T 5CHAC 1QJ6B 3U9AH 1GJ8B 1TGBA 4KTCA 1HAYB 1DWCH 1A2CH 1FY8E 1UCYH 4D7FA 4OS1A 2VIWA 1LQEA 4BTIB 4FU8A 4GHTA 5I25A 4NCYA 1C5SA 5GCHG 1HUTH 5AHGH 1D9IA 1BMAA 2OQUA 1IQHA 2Q6FA 1MD7A 1OWKA 1RJXB 1SOZA 5A09A 1AD8H 2A4RA 5C67A 2WYGA 4TPYA 1RD3B 2HOBA 3NKKA 1GL1A 1UTMA 1GJDB 1TOCB 2F91A 1SLUB 3NWUA 1GHWH 1QR3E 1YPGH 1A61H 4WMEA 2WV5A 2JH6D 2OBOA 2Q6DA 7LPRA 1S6FA 3U8TH 5DJ7A 4CRGA 3BEUA 5F8XA 4MPUA 2PGBB 1O2RA 5GWZA 1O3JA 2ZO3H 1DX5M 3AVZA 5JPMH 1SGQE 4BXWA 1ID5H 1GHVH 2FLRH 1XUHA 1GI2A 1QBOA 4A7IB 3RXTA 1FXYA 1Y3YA 3FFGA 3MH4A 2RG3A 2EEKA 1IQNA 4WXVA 1C1NA 4AFSA 4X2VA 1AO5A 1O2GH 3EQ0H 2FOAA 1GI1A 1GMDF 1QB1A 2VIDA 5GCHF 1NRPH 3RMMH 2GCHG 2ZFQH 1EAWA 2FODA 3A84A 3MFJA 4NIVA 1J8AA 1DY8A 1ETRH 1O3MA 3URCA 1ORFA 3ZVAA 4LOYH 1P8VC 3SZNA 1O39A 2ZU3A 1S6HA 4Y6DA 4DOQA 1O2JA 5A0AE 2XW9A 4JMYA 1KXAA 1T8LA 3Q3XA 4Y0ZE 2BD7A 3GY8A 2C93B 1K28D 2ESTE 4ABJA 3DD2H 1S85A 1P9SA 4NA7A 4FUJA 5IYTA 3UREA 3MU0A 3SNBA 3RC6A 1UK4A 1AB9C 2F9UA 1TALA 3TJOA 2UUFB 1O5EH 4IS5A 4A5TS 3FZZA 3GISB 3SI3H 1TMTH 3VB5A 1EPTB 2FEQH 4KKDA 1BTPA 5FCKA 1UK2A 1LHGH 3PO1C 1BT7A 2BDAA 1THRH 1WOFA 3B8JA 1SBWA 3GICB 3NUMA 4R8TB 3ZV8A 3F9HA 3UTUH 4XOJA 3TGIE 2XC0A 3GCTG 3KNXA 5E2PA 1KXDA 3MH6A 1O37A 1O2HA 2PLXA 4FVBA 2BD8A 1ELAA 4WY3A 2PWXA 4HGCA 4K3JA 1SGRE 1G2LA 4M7GA 1ZTJA 3A8CA 3PB1E 2BDYA 2FTLE 7ESTE 2ZGHA 4PROA 3RU4E 4GUXA 3M7QA 4K69A 1O31A 3SU6A 2A1DB 2YNBA 1S81A 4I8HA 4CRBA 1V2UT 2Z9IA 2SGQE 1QHRB 1MTSA 1F5RA 2P16A 1S0QA 3D49H 2Y81A 1PPBH 1V2RT 3A7TA 1ACBE 4TY7A 3VXFH 4Q80A 8ESTE 1OP8A 2UWOA 9ESTA 2F9VA 1XUGA 1XX9A 3SV6A 3E6PH 3RXGA 1AZ8A 4FUCA 1MD8A 1EJNA 3GY7A 5GDSH 2AMPA 2ZF0H 3QUMP 4FUDA 2A5IA 2BX3A 2BDGA 3ATWA 1CBWB 5FCRA 5JBBS 3OTJE 1WTGH 2BZ6H 4JZEH 1IQEA 3VGCB 1QRZA 1FJSA 2K7XA 1FDPA 1NU7B 3LC5A 1YPJH 3MU1A 1K1NA 2ZFFH 4ISLA 1SGCA 2XYAA 1WV7H 2BVSH 3L33A 1AUTC 1T8OA 1F0SA 1Z8GA 3FVFB 3RC4A 3BTHE 5JYIA 2ZU2A 4BTUB 4AFQA 5GIBA 2ZIQH 1UMAH 4AOQA 1TQ0B 4ZROA 1NFYA 4U01A 1PPEE 1E35B 1V2VT 3BV9B 2WPHS 5HGGA 1AWFH 1DWDH 2SGEE 2QXJA 4YZUA 2J2UA 4D9RA 1SFQB 1GBCA 1L0ZA 4U32A 7KMEH 1XVOA 1O2SA 4MNWA 5LGOA 1LKAA 1V2PT 2O8MA 2ZPRA 1J14A 1HNEE 1GJCB 1WQSA 2AMQA 4A1TA 1C5RA 3UFAA 3DHKH 1K1JA 3P17H 1D3QB 5E0HA 1UTPA 2OC1A 4UFDH 3BTME 3C1KA 1OP2A 1MAXA 3SJOA 4TPIZ 1XXDA 1W0YH 1LQDB 1C1PA 3GDSA 3CENA 1TFXA 4JK5A 1GPZA 4Y71A 3AW1A 4AFZA 1TPSA 2XC5A 4MPWA 1P11E 1QQUA 3CS0A 1QQ4A 1CGHA 2J94A 3ZVCA 3GDUA 4LXBH 5HXFA 3I29A 1NROH 2VIQA 1EZUC 2WPMS 3A7ZA 3UNRA 3M3VA 4MLFB 1BRBE 2VIVA 3A7YA 3RDZA 4IBLH 1O5CB 3FP6E 3T26A 1M9UA 2PTCE 1TRNA 1MTNB 1T32A 4Z0KA 1ETSH 8LPRA 1SGTA 2QXIA 5E8EH 1MKXK 2BQ6B 3A8AA 3D65E 2R3YA 1UTJA 3QO6A 1XUIA 1TGCA 3RP2A 3LH1A 1W12U 2HRVA 5A0CA 2J9NA 1GHAG 2XTTB 1P12E 3RXRA 4ABBA 3TK6A 2J38A 2G5VA 4FUFA 3PMBB 1GBLA 2VWMA 1YPLH 2A31A 4AX9H 3BEFB 1TGNA 4BOHA 4JYTA 2FX4A 2JETB 7GCHF 1NFXA 2G8TA 4WF8A 2PFEA 3RXOA 3LPRA 1GMHG 1V2LT 2NWNA 1UK3A 1Z8IB 3V7TA 2HLCA 1GI8B 3L6PA 1O3GA 1Q2WA 4ISOA 3V12A 2Y6TA 1C1RA 3LJJA 4WMDA 1YLCA 3NZIA 2WV4A 2BOKA 1EB2A 4ZXYH 1XXFA 5K0HA 1O5FH 1BTXA 3LGVA 2BHGA 2FYQA 1KDQB 2YOLA 1T7CA 1O2WA 1DOJA 1P2JA 1SGNE 4HFPB 3GYLB 2AERH 5EXMA 2ZGXH 1GDUA 4DVAU 3VXEH 4GHQA 1GCTC 2VIOA 1ABJH 1P2NA 1P2OA 2FI4E 1V2NT 4X6MA 3M5MA 1KTSB 3MNSA 1N6YA 1MU6B 1O2ZA 4GAWA 5EPNA 2BLOA 3TJNA 3LKWA 4ISIH 2PR3A 1BB0B 1LTOA 3PWBA 1EZSC 2OTVA 3MH5A 1SLXB 1BUIA 1G36A 3MO3A 3VB4A 1WAYB 2CF9H 3U1IB 1MQ6A 1V2MT 2BY5X 2NU2E 3LIWA 4J2YB 1KXEA 4X6PA 1KY9A 4YO9A 1NRRH 2ZCKP 4MPXA 4FUIA 1QL8A 1V2JT 4A1XA 1T8NA 4O3UA 3RXJA 5JBCS 1UTOA 4XBDA 4AYVB 1F92A 3MWIU 2LPRA 3ZZ8A 1K21H 1P03A 1BITA 1CT4E 1TYNA 3U69H 2GCTC 3A86A 4J1YA 3RLWH 1ZHPA 4SGAE 4LK4A 4CBOA 1A7SA 1ANCA 1SQOA 1TRMA 2P95A 2UUJB 1BTUA 1O2TA 1DXPA 3A81A 1C2EA 1DSUA 2KAIA 1QFKH 2PHBA 2JH5D 3MI4A 2A7JA 3M3TA 1FMGA 3LJOA 1OYTH 2ZHFH 3H5CB 3ATMA 2WPIS 2VNTA 4E05H 3F9GA 4ISNA 4X8TH 4Z6AH 3I78A 1C1SA 1ZR0A 1N8OC 1MQ5A 1T4UH 2EC9H 3WY8A 1ZHMA 4NZLA 1Q31A 2OC7A 2IPHA 1H9IE 2XBXA 1RRKA 2OXSA 2QV1A 1WUNH 3AASA 3ZZAA 3K6YA 1Y3VA 3TJVA 2Z9GA 2Z9KA 4TWYA 1P05A 1GHBF 1C5QA 2BDCA 1O5DH 4BAOB 2CGAA 3P70B 3SNCA 3MU5A 2D1JA 1UCYE 1VGCC 1XUFA 2ZWLH 1KXFA 1EX3A 4UFGH 2GZ7A 3UY9A 3SOSA 3BG4B 1O2NA 1O3DA 1Y5BT 2HALA 3P92A 4B71A 1IQMA 1UTNA 4B76A 3BG8A 5TCAA 3OY6U 4ASHA 3TU7H 4JZFH 4DW2U 1SGFA 1GCDA 5C20A 1KTTB 1LCYA 5EOKA 2GD4B 1DSTA 1FY5A 3VPKA 1JIMA 1GBTA 3BTKE 2ODYB 1F5KU 3U8RH 3SJKA 2O8TA 1KLIH 1P06A 2Z3DA 1A3EH 4GSOA 1EZXC 4YLQH 3ELAH 1PJPA 4ABFA 3Q76A 1ELTA 2O8LA 5DP4A 3TH3H 4NIYA 4HTCH 1VJAU 2YNAA 2CF8H 2A2QH 1TBRH 2DE8A 3A82A 2Y5FA 1W10U 2PUXB 2OC0A 1O2PA 3SGAE 2UUYA 5LPRA 4I8LA 1IQLA 2FWWA 3TNTA 3DFJA 1TPOA 2Y7ZA 1SGIB 2BQWB 1PQ8A 1QB9A 2ZPQA 2A7CA 5DP7A 1BA8B 1JBUH 3FZDA 4LZ1H 1D6WA 1KLJH 4ZXXH 5DP8A 5FX6A 1NT1A 3E8LA 1LMWB 1BJUA 2HVXA 1VITF 3ZVEA 2O8UA 1GBKA 4KELA 1V6DA 1LHEH 2CN0H 2BY6X 3ZZ7A 2NU1E 1A4WH 2O8WA 3OYPA 1Y5UT 5DP3A 2BVRH 1PPFE 3OY5U 1IQIA 3HK3B 3EBNA 2ZC9H 4U2WA 1KIGH 3QLPH 3BTGE 1C2DA 1Y3XA 1S84A 2QXGA 1L4DA 2SNWA 5AVDA 2FTMA 2ZGJA 5J4SA 6ESTA 2STAE 1KYNA 2I6SA 2GKVE 2ZCHP 4ZKRU 6GCHF 3ESTA 1UVPA 2ZP0H 1D3PB 1ZHRA 2EI7A 1OX1A 1TGSZ 3GY5A 2Y80A 1EP6A 3LGYA 2P3TB 4IC5A 4F49A 4D9QA 3DUXH 1GVZA 2G52A 4FUGA 1HAPH 1EQ9A 1DT2A 4IGDA 4YT7H 4BAHB 3KQDA 1UVUH 4ZH8A 3QGJA 1P10A 1PQ7A 1N8OB 3T27A 1GHBG 1NY22 1C5MD 4YTAA 1AB9B 3RXEA 4CBNA 5C1XA 1CHOG 2RA0A 5C3NA 1F0TA 2R0KA 4ZKOU 4JYVH 2C8YB 1HRTH 1O35A 3T28A 1AE5A 1C5LH 2ZFRH 1K1MA 1AGJA 3L3TA 3FAOA 1TX8A 3I77A 1A0HB 4O9VA 1NM6A 2G5NA 3PO1B 1O5GH 1ZGVA 4Y79A 1QRWA 3MO6A 1ELBA 1P01A 5CE1A 2J34A 4KTUA 4X1RU 5A0BA 4I8JA 1SLWB 3RXKA 1B7XB 1S5SA 5FPYA 3HGNA 1K22H 1T8MA 1TWXB 1Y8TA 4MVNA 1HLTH 1K1LA 2AGIX 1UO6A 1GMHF 1RS0A 3QN7A 2W3KA 5K7RA 1E34B 4IN1A 1HAOH 1QTFA 5DO4H 4X1SU 4AZ2B 1GHAF 1KXCA 3JZ1B 4B75A 4AN7A 1TNJA 2HNTE 2KAIB 3SV9A 2ZQ1A 1GJAB 8GCHF 3EA9A 1C2IA 1SVPA 1FNIA 3KQBA 3T62A 1FIZA 3CS7A 4JZDH 1MKWK 3RMLH 1ANEA 3IWMA 4ABDA 1XUJA 1QJ7B 1TMUH 3GY2A 4MDSA 1FY1A 2NU0E 4DURA 1AN1E 5AFYH 3KF2A 3GCHB 1BBRE 1S0RA 2V3OH 4AB8A 3K2UA 4WH8A 4K8BA 2OC8A 3SUDA 3NK8A 1TE0A 1RTKA 4AB9A 2WUBA 1ESAA 3BEIB 1OSSA 1Z8JB 6CHAC 1YCPM 2XBVA 4Q2KA 3A7VA 2ZI2H 4MTBA 3S69A 4B2BA 3E0NB 1BDAA 1EJMA 3G01A 3ZV9A 2ZHDA 2ZFSA 1H4WA 2QF0A 1JRSA 1PPGE 3PROA 4ABAA 5FX5A 3A89A 2VWNA 2Y82A 2P8OC 1WTHD 2F3CE 1AE8H 4Y0YE 2AMDA 3ZZ3A 2FYRA 3SHAH 1UTLM 4INLA 2BLWA 1BOQA 3OX7U 2ZCLP 1C5XB 4U30A 1DUAA 1GGDB 1P57B 1SGFG 3BN9A 6LPRA 4WJG2 5TCCA 3SU5A 1SGYE 4HZHA 2PKAB 2RDLA 3M7UA 1TRYA 4KGAA 2BDHA 2QCYA 3RU4T 3SJ9A 2DE9A 1FAXA 3LU9B 3QGNB 1OWJA 1IQGA 1DLKB 1OWIA 4UFEH 1LHCH 4B2CA 4KTSA 4GPGA 4RKOB 2WPKS 1C4U2 1O0DH 1XMNB 3SJIA 1P02A 1FUJA 1L4ZA 3A8BA 3QWCH 3U98H 3E90B 1LKBA 1LPGB 4NSVA 2ZHEH 2OP9A 2ZFPH 4NIXA 1EAXA 3SNDA 1YYY1 1Z6EA 2H9TH 1YP9A 2XWBI 1ELDE 1MH0A 3BTQE 3VGCC 1AVGH 5FHTA 1RTFB 5A8XA 1HPGA 5T6FA 1BCUH 3AAVA 1HV7A 1NRQH 4KP0A 3U8OH 1AUJA 2VVUA 1TNHA 2ANWA 3T29A 1ZMLA 4INKA 2Y5GA 1BRUP 2P93A 1NPMA 3KGPA 5F8ZA 2XCFA 1OPHB 5EW1H 1X7AC 1GI4A 5F03A 1A5GH 1TPAE 1C2JA 1ESBA 2A4OA 3D23A 1AVXA 3SUEA 4AG1A 4K1SA 4AGJA 1GBMA 1CVWH 4Q7XA 1C1TA 3TITA 1L2EA 1GBIA 1FY4A 3SU2A 1O5BB 1C5YB 2GGVB 1C1VH 1UHBB 2PW8H 2FDAA 2FESH 1KLTA 1CGIE 2BVXH 4X0WU 3PLKA 2EI8A 1INCA 1YC0A 2G00A 3F9FA 5EQSA 2ODQA 3P8NA 1V2TT 4O97A 2Q1JA 1IQKA 1SR5C 5A8ZA 3ZVDA 4X8VH 5FBEA 1W7XH 3GY3A 2TGPZ 3PV4A 5FXLA 4MPVA 2SGPE 3UR9A 1BRCE 1VJ9U 1RIWC 3ZVGA 3TGJE 4NG9H 3S9AA 3E0PB 3PMAB 3MH7A 2ZDMA 3F6UH 1QNJA 3RXPA 2NU3E 4WXIA 4OS2A 3SV8A 4FVDA 1PPZA 1ZPZA 4VGCC 3ZVFA 2AIQA 1FI8A 1D4PB 2QC2A 1GCTB 1LPZB 1WYKA 5EXLA 1ZPBA 1O3EA 1MCTA 1MTNC 2QYIA 4IMQA 1CA8B 1F0UA 1BZXE 4X8UH 1C5WB 1GHXH 2GMTB 3A85A 2FI3E 2SNVA 4K8YA 3SV7A 4TY6A 1K1PA 1TIOA 2FPZA 1NRSH 2W3IA 1ETTH 1UTQA 5ESTE 2ZG0H 1UVSH 5AFZH 1E37B 1NFWA 2P8OB 4NA9H 2SGAA 1JMOH 1A5IA 1HJAB 2GX4A 1P3CA 3U1JB 2HPQH 3S7HB 3DFLA 1E0FD 1OS8A 5EXNA 4UONA 1DITH 2QGRA 1O3AA 2JETC 3E91A 4X1PU 3HATH 5T6GA 2FOBA 4BANB 1O3HA 2QA9E 4XBBA 1YPHC 1GJBB 1GI0A 3ENSB 1GBAA 1QA0A 1ZTLA 3SGQE 1AWHB 4IMZA 1A1RA 1CT2E 3EDXB 4Y11E 3RUOA 1IQFA 3RM2H 1QL7A 2ZGCA 1S83A 2BD5A 3TK9A 1MKXH 2FLBH 2G4TA 2F9NA 2ZU4A 1J9CH 4FU7A 1CQQA 5FAHA 4DCDA 3AW0A 2PKAA 1O5AB 1O2YA 2VVVA 3RXDA 2A0QB 1CGJE 2Z7FE 3SU3A 4JZIA 4MQAA 3EGKH 1EP5A 1MKWH 3QTVH 1FV9A 1BMLA 3SJ8A 3HPTB 1O34A 5SGAE 1EASA 3O8DA 5DP5A 1UJ1A 1HYLA 3RXFA 1C5UA 2H1UA 1QB6A 1DUEA 3PMHB 1ARCA 3OSYA 1Y5AT 4O3TA 3BTDE 1GJ4H 4XSKU 1UCYK 5T3HA 1C2MA 2FM2A 2R2WU 2XCNA 3TGKE 1FPCH 4ZHLU 2HGTH 4MNYA 1GJ7B 1ANDA 2Z9JA 1SGPE 1IQJA 1BRAA 2B7DH 1F0RA 1TNKA 1YLDA 1VGCB 1G2MA 1LHDH 2VVCA 2W7UA 3UWIA 2BD4A 4FUEA 4INHA 2EI6A 1HFDA 1XKBC 4Y76A 1UHBA 2FZZA 1ZZZA 5DG6A 1CSOE 2ZDLA 1SL3A 1C5TA 3UQOA 1O3KA 3QK1A 2AFQB 4ABEA 2C3SA 3IITA 1UVTH 3ATKA 2XXLA 3UIRA 1SOTA 1F2SE 2H9HA 4I32A 3N7OA 3ZZ6A 1GMCG 5F8TA 2BOHB 4XBCA 2VGCC 4CHAB 2UWLA 3NPSA 1RIWB 1HXFH 1O2KA 1MTWA 3B9FH 5DP6A 3LC3A 3RXBA 2C8ZB 2NU4E 3S0NA 2B9LA 4VGCB 1MCVA 1YPMH 1BQYA 3QTOH 3K6ZA 1FIWA 1VZQH 2FX6A 1HAZB 1AMHA 3S9BA 1GJ5H 2WINI 3M35A 3LOXA 3MHWU 2VJ1A 4ABHA 5L30H 2IN2A 4K2YA 3GCOA 3W94A 4CH2B 3BTWE 3GYMA 4Y7BA 2GMTC 2B0FA 3VFEA 2UWPA 2ZPSA 1QIXB 4NGAH 3RXUA 3V3MA 4DIIH 1QY6A 5T6DA 4YLUA 3B23B 4CR5A 1L1NA 4GVUA 1Z1JA 1Z6JH 1LPKB 2GP9B 1PFXC 4Y7AA 3P6ZB 1BBRK 1GWAA 1O30A 3UR6A 1GG6C 4CREA 3OU0A 4Y8YA 2FOFA 4RSPA 2XBYA 1YPHE 3ZZ4A 1SB1H 1GMCF 1FZZA 1C2GA 1OP0A 1P0SH 2BLQA 1P9UA 4Q7YA 3LT3A 3LONA 2A32A 2D8WA 1MBMA 1VCQA 2BX4A 1J17T 3TPIZ 4B2AA 4WMFA 1ELGA 2R3UA 5EQRA 1H9LB 1P2KA 4I31A 1G32B 1EAUA 1LO6A 1Q3XA 1THPB 1AU8A 3F9EA 4Y8XA 1K1IA 3P8FA 1JRTA 1ZYOA 1K2I1 1G3EA 1O3BA 2ANYA 4RN6A 4CR9A 3KCGH 5EG4A 3T5FH 2C8WB 2PKSC 1GBFA 3VB3A 4JK6A 4WVPE 5E2OA 3TH4H 1ZGIA 3ZZDA 4I7YH 3PLPA 1W14U 5DP9A 2R9PA 1MBQA 4LZ4B 4H42U 4ABIA 1OWHA 2G55A 3RXAA 3FP8E 1GDQA 2FOCA 2XBWA 2XWAA 3SNEA 3EE0B 4FU9A 3K65B 2BD2A 1RGQA 1YCPH 1N1LA 1YPEH 3SUGA 1O3CA 4ZAEA 4NWLA 4FUHA 5L2YH 3M61U 1DDJA 3S9CA 1AFQC 2CXVA 4AORA 4D7GA 1EATA 5B6OA 2JKHA 1DPOA 3RU4D 1FN8A 1VR1H 1JWTA 1NS3A 1NZQH 1JXPA 1J16A 3VB6A 2ZU5A 1ZMJA 1ESTA 1ZRBA 2TGTA 3SO3A 3MU8A 2A2XH 6GCHG 1TABE 4I8KA 1TQ7B 3SUFA 1LDTT 1NTPA 1CA0C 4ZKSU 3E1XB 1P09A 1G3DA 1O3NA 4GCHF 4TWWA 1SPJA 1C5OH 3TNSA 3RLYH 2AGGX 2QAAA 3S7KB 1UVOA 2CJIA 2PUQH 5A2MH 1MZDA 3FP7E 1B0FA 3MYWA 1NESE 2VGCB 1IHSH 4CHAC 1DWBH 4B74A 1FLEE 4NSYA 2CMYA 4XE4A 5EPYA 2OUAA 2XC4A 1C1WH 3QX5H 4DY7B 1A5HA 1P2IA 3CP7A 2LIZA 4WWYA 1TGTA 1O3PB 3EAJA 1HAGE 3MMGA 1G30B 2B5TB 1KXBA 4SGBE 2GTBA 1C1UH 1G3BA 1HCGA 2CHAB 1H8IH 1IAUA 2F83A 2ZTYA 2ZGBH 2J92A 1V2OT 4ZHMU 3RMOH 2LNCA 5EGMA 2ZZUH 1W13U 3MTYA 3M37A 1Z1IA 3IG6B 2AIPA 1GBJA 3GCHC 1TBZH 1YBWA 4NIWA 1FONA 1YCPK 1DANH 1CHGA 4NFEA 2A5KA 4CRCA 1QL9A 3A88A 4XFQA 3NXPA 2ZHWH 1TPPA 3MNXA 2AGEX 1AZZA 3ATLA 3MO9A 3RXQA 1RTLA 2Z3EA 4JZ1A 5CMXH 1G3CA 3A80A 1FPHH 1OYQA 3UQVA 4FUBA 1BHXB 1EPTA 5FBIA 3O8CA 2J95A 1BMMH 2THFB 1MMJN 6CHAB 1SQTA 1GBEA 1Y3WA 2ZDAH 1A0JA 2FOMB 4B1TA 2SGFE 7GCHG 2A4GA 1YKTA 2C4FH 2H6MA 1GL0E 1BBRH 2Z6BD 1O3OA 1GGDC 2GZ9A 1MTVA 4MNXA 1C2FA 1MZAA 2QXHA 1TB6H 1W8BH 2FMJA 4ABGA 5CHAB 2H2ZA 2ZNKH 1SI5H 2HPPH 4A1VA 1DY9A 3TK5A 2GZ8A 1YM0A 5HYOA 1ANBA 1HJ8A 3R3GB 2JH0D 1HB0B 3KQEA 3ZZBA 3EA8A 5DK1A 4X8SH 2PKSB 1AVWA 3ATIA 4I8GA 1K9OE 2BY7X 1V2QT 2H9EH 3ODDA 3RXMA 2FP7B 1YPKH 3E16B 2RCEA 1EKBB 5EODA 5ETXA 2BB4A 2QF3A 5C1YA 3MOCA 1SLVB 5L2ZH 5FPSA 4X2WA 3F1SB 4JCNA 1RFNA 2ALPA 1PYTD 1V2ST 1GVLA 3SN8A 1D3TB 1EOLA 3Q3YA 1WSSH 3RXSA 3VB7A 1TNIA 1GBBA 1Z8RA 2QIQA 2A5AA 1QA7A 1SSXA 4IN2A 1OOKB 3BIVH 4X1QU 1LVBA 1A46H 1DXWA 5DKMA 1AKSB 1J15A 1O36A 2HWLB 2J4IA 2AEIH 1GJ9B 1Y3UA 2XNIA 3SBKA 1XVMA 1TONA 4NA8A 1HAIH 2VIPA 4X1NU 4UE7H 3KN2A 1O2VA 4NZQA 1PPCE 2P94A 2HNTC 1ZSKA 2B8OH 3KL6A 4IW4E 3GCNA 3UNSA 5DPAA 4OS4A 3RC5A 1P3EA 1HJ9A 2W7SA 3E3TA 1GI7B 1ZSLA 5C1UA 4OS7A 1KDQA 4CRFA 5HM2A 2BY8X 1F5LA 3STIA 2TGAA 1FAKH 1C1MA 1C2LA 3Q00A 4NFFA 2AH4X 2V3HH 1GJ6A 1O2XA 4H6TA 4YESB 2RA3A 2H5DA 2K1QA 1O32A 2IJOB 1GBHA 1BTHH 1P2MA 5BPEA 2TRMA 1D6RA 1O3IA 5I46H 1RXPA 3GOVB 1O2LA 3UPEA 5HMAA 1YGCH 5HM9A 2V0BA 1T31A 2BMGB 2R0LA 2ODPA 3Q77A 4MNVA 5PTPA 1H1BA 1SHHB 1DWEH 3SGBE 2ANMH 4X6OA 1O33A 2VU8E 2ZKSA 3VEQB 2F9PA 3RXLA 1EAIA 1SQAA 1FY3A 5EW2H 2D26C 3ZZ5A 3TJUA 3MNCA 3FANA 3RXCA 3BTFE 2Q6GA 1SHYA 3DT0H 3PYHA 5G4BA 2PV9B 2BM2A 1HGTH 4D76A 1T4VH 3PWCA 3ZZCA 1SMFE 1G9IE 3A7XA 3A8DA 1LVOA 4DJZB 5L6NH 5ABWA 2FS9A 2GV6A 4K1TA 1HJAC 1B5GH 5AF9H 2BY9X 1GI9B 2TPIZ 3ITIA 1O2OA 5JB9S 4I33A 1OWEA 5ESBA 3ODFA 4FXGH 3STJA 1ELFA 4UD9H 1F7ZA 2HNTF 1BTZA 5C5NA 1GVKB 2CV3A 1CU1A 1QJ1B 1W2KH 1ZOMA 2G4UA 1AY6H 2ANKH 1EUFA 4ZKNU 2OD3B 4O03A 1HIAA 1OXGA 2PSYA 4HI3A 1C1OA 4K1EA 1VITG 1BTWA 2ZDKA 4X6NA 3ZYDA 2C90B 1GHZA 1AQ7A 4YT6H 1CBWC 2W5EA 1CHOF 1C5NH 2VWLA 4CRAA 4GCHG 2ZA5A 1LVMA 1TX6A 5JB8S 1OWDA 1QURH 1ZRKA 1TLDA 3T25A 2WPLS 4BTTB 1UTKA 2P3UB 2TIOA 1VCPA 2WUCA 3TVJB 3V13A 4DT7B 5JBAS 4WH6A 2ALVA 1HAVA 1EXFA 1MAYA 4F4OC 1GI3A 3MU4A 1ELEE 2OCVB 3LGIA 3SQEE 2ZTZA 1GI6A 2GVFA 2A7HA 4DG4A 9LPRA 3ZVBA 1C4Y2 1C5PA 1KSNA 2OQ5A 3V0XA 1O38A 4NWKA 2F9BH 3SU4A 5GPIB 1QCPA 3UOPA 2FO9A 1JOUB 1WBGB
chains in the Genus database with same CATH superfamily
3BF6H 3P8GA 2G81E 3U28C 2KCPA 2PTNA 4BAKB 5IDKA 3LH3A 2EA3A 4YM9A 1P2QA 1HIAB 2QN5T 3SNAA 3W95A 5LPFA 2WPJS 1BMNH 1CO7E 2BTCE 4AYYB 5C2ZA 1U6QA 2VH6A 8KME2 3JZ2B 3LGWA 3P95A 3DA9B 3M36A 4YOJA 1JIRA 4Y8ZA 2W26A 2WYJA 5TJXA 3SU0A 4QT8C 5H4IB 3M5LA 1TOMH 1XUKA 3EA7A 1V2KT 4OGXA 1AHTH 1VITH 2GCHF 1TX7A 4JYUH 3BTTE 1HBTH 4ZCNA 3RM0H 3RXVA 2XRCA 3RMNH 1SC8U 1XM1A 3C27B 3LGTA 3P8OA 3M5NA 1OKXA 4CH8B 2BD3A 1C5ZB 2ZDNA 4OGYA 1ZLRA 4D8NA 4OS5A 1E79D 2V6NA 1SGDE 1GHYH 2V35A 3M3SA 1QCPA 1TA2A 2TGDA 4X2YA 1W11U 2ZFTA 3PLBA 1D3DB 3LGUA 4GLYA 1O3LA 3PTNA 3TLOA 1EOJA 4E7NA 4Y10E 1C9PA 5JBTA 1WQVH 1ZMNA 3UNQA 2UUKB 4XRNA 2Y5HA 5A8YA 2FOGA 3RXIA 5GXPA 1DICA 1TBQH 1S82A 1TNLA 1MTUA 3QZRA 1GDNA 1H9HE 2ZEBA 1ZJKA 2R2MB 2WSSD 1AKSA 1CT0E 4OS6A 2A45B 1WCZA 3UWJH 2AYWA 5E0JA 3SU1A 1YF4A 5LPEA 1L1GA 3PM3A 1ZSJA 1H8DH 3KQ5A 5E0GA 4XDEA 3SI4H 2FIRH 2OLGA 2OINA 1ELCA 1NC6A 2GV7A 1BJVA 1B0EA 3A83A 3F68H 2BZAA 1E38B 1BIOA 3A87A 3SQHE 4X2XA 4TT3D 3HK6B 1AI8H 1EZQA 1AFEH 1DS2E 5EQQA 1DVAH 1E36B 1P04A 5GJ4B 3AAUA 3TH2H 2PSXA 2I6QA 2FS8A 2P3FH 1O2UA 3QZQA 3ZZ9A 3UOUA 1V3XA 1DE7H 2ZDVH 4A6LA 1LVYA 2PGQB 1O2IA 1EJAA 1PQ5A 2ZU1A 4ZMAH 2Y7XA 4UEHH 2FI5E 1GMDG 5LH8A 1W3CA 1ZPCA 2IOTA 1V2WT 3KEEA 1PQAA 4DGJA 2A4QA 2DUCA 2OBQA 3GCTF 2ULLA 1GI5A 2P59A 4THNH 4AG2A 4E7RG 2O9QA 3D62A 1C4V2 3BSQA 4UFFH 8GCHG 5J4QA 2H5CA 4BXSA 4BNRA 1IOEA 1AFQB 1NFUA 3RXHA 1WU1A 3A7WA 1C1QA 1BTYA 1HAVB 3PMJA 1NO9H 1ZTKA 2ILNA 1THSH 3T2NA 3PRDA 4RKJB 3NCLA 4A92A 3O8RA 4DIHH 4AFUA 4B73A 1GG6B 4P00A 1K1OA 1C2KA 2BDBA 2Z9LA 2AHME 2VH0A 1TMBH 1W7GH 2VWOA 1DM4B 3DSPA 1DLEA 1HXEH 4E06H 2Z94A 1O3FA 3KIDU 2C8XB 3SW2B 2STBE 4B6FA 3LDXH 1XKAC 2ZHQH 1DFPA 3BTEE 3SHCH 4UDWH 3HKJB 3O8BA 3PTBA 1SGEE 1FN6A 1QGFA 5FPTA 2GDEH 1A3BH 3R0FA 1Z71A 3GY4A 4H4FA 2BXUH 1EB1H 1TAWA 2F9OA 1C5VA 2GCTB 2YMSB 3GDVA 1ZJDA 3TIUA 4ZUHA 1G37A 1N6XA 2Z3CA 1SFIA 1IHTH 1A0LA 3UUZA 2GDDA 4ZHAA 4R0IA 1O2QA 3Q3KA 1HAHH 1SG8B 1TNGA 3M7TA 1QBNA 2BXTH 2BYAX 2BDIA 2FXRA 2ZTXA 1W0ZU 3URDA 2GT8A 2VB0A 2VINA 2AS9A 5JDUB 4TYDA 3F3BA 4K60A 2ZQ2A 2CHAC 1NN6A 1EPTC 1QBVH 3H7OA 2M5TA 5C5OA 1HAXB 2ASUB 2QY0B 2D2DA 4ESTE 3K9XB 3WWBA 3ZYEA 4ISHH 3EYDA 4MG3A 4CRDA 1NU9A 3UAIC 2SGDE 5CHBA 2BLVA 2GT7A 2KX4A 2L74A 1ABIH 1NRNH 1ELVA 1O2MA 1C9TA 5F6MA 3SV2H 4Q7ZA 3MNBA 1VCWA 3HGPA 4IC6A 2FOEA 4BAMB 4AGKA 4H6SB 1L1JA 1GBDA 2BQ7B 5BRRE 3SORA 1Z7KA 3H7TA 3BG4C 1FQ3A 1CE5A 3N7DA 1BHXF 1QRXA 4YOGA 1ARBA 2TBSA 3PV2A 5DSFA 4BAQB 1MUEB 5EU8A 1MU8B 4K5ZA 3KQCA 1AIXH 1C2HA 3M5OA 3BIUH 2BD9A 4YOIA 1CA0B 1TA6A 2SFAA 2FOHA 1PYTC 3KHVA 1PPHE 1HDTH 1LHFH 3GY6A 3HKIB 3QDZB 2ZECA 5DGJA 2G51A 1Y59T 5CHAC 1QJ6B 3U9AH 1GJ8B 1TGBA 4KTCA 1HAYB 1DWCH 1A2CH 1FY8E 1UCYH 4D7FA 4OS1A 2VIWA 1LQEA 4BTIB 4FU8A 1H8HD 4GHTA 5I25A 4NCYA 1C5SA 5GCHG 1HUTH 5AHGH 1D9IA 1BMAA 2OQUA 1IQHA 2Q6FA 1MD7A 1OWKA 1RJXB 1SOZA 5A09A 5C0UA 1AD8H 2A4RA 5C67A 2WYGA 3F0OA 3DCLA 4TPYA 1RD3B 2HOBA 3NKKA 1GL1A 1UTMA 1GJDB 1TOCB 2F91A 1SLUB 3NWUA 1GHWH 1QR3E 1VKYA 1YPGH 1A61H 4WMEA 2WV5A 2JH6D 2OBOA 2Q6DA 7LPRA 1S6FA 2XNDD 3U8TH 5DJ7A 4CRGA 3BEUA 5F8XA 4MPUA 2PGBB 1O2RA 5GWZA 1O3JA 2ZO3H 1DX5M 3AVZA 5JPMH 1SGQE 4BXWA 2KM0A 1ID5H 1GHVH 2FLRH 1XUHA 2EQNA 1GI2A 1QBOA 4A7IB 3RXTA 1FXYA 1Y3YA 3FFGA 3MH4A 2RG3A 2EEKA 1IQNA 4WXVA 1C1NA 4AFSA 4X2VA 1AO5A 1O2GH 3EQ0H 2FOAA 1GI1A 1GMDF 1QB1A 2VIDA 5GCHF 1NRPH 3RMMH 2GCHG 2ZFQH 1EAWA 2FODA 3A84A 3MFJA 4NIVA 2JJ1D 1J8AA 1DY8A 1ETRH 1O3MA 3URCA 1ORFA 3ZVAA 4LOYH 1P8VC 3SZNA 1O39A 2ZU3A 1S6HA 4Y6DA 4DOQA 1O2JA 5A0AE 2XW9A 4JMYA 1KXAA 1T8LA 3Q3XA 4Y0ZE 2BD7A 3GY8A 2C93B 2EY4C 1K28D 2ESTE 4ABJA 3DD2H 1S85A 1P9SA 4NA7A 4FUJA 5IYTA 3UREA 3MU0A 3SNBA 3RC6A 1UK4A 1AB9C 2F9UA 1TALA 3TJOA 2UUFB 1O5EH 4IS5A 1COWD 4A5TS 1NBME 3FZZA 3GISB 3SI3H 1TMTH 3VB5A 1EPTB 2FEQH 5HIZA 4KKDA 4FOUC 2KFWA 1BTPA 5FCKA 1UK2A 5KGOA 4ASUD 1LHGH 3PO1C 1BT7A 2BDAA 1THRH 2KZ4A 1WOFA 3B8JA 1SBWA 3GICB 3NUMA 4R8TB 3ZV8A 3F9HA 3UTUH 4XOJA 3TGIE 2XC0A 3GCTG 3KNXA 5E2PA 1KXDA 2JDID 3MH6A 1O37A 1O2HA 2PLXA 4FVBA 2BD8A 1ELAA 1W0JD 4WY3A 2PWXA 4HGCA 4K3JA 1SGRE 1G2LA 4M7GA 1ZTJA 3A8CA 3PB1E 2BDYA 2FTLE 5HKKD 5T1VA 2ZGHA 7ESTE 4RI0A 4PROA 3RU4E 4GUXA 3M7QA 4K69A 1O31A 3SU6A 2A1DB 2YNBA 1S81A 4I8HA 4CRBA 1V2UT 2Z9IA 2SGQE 1QHRB 1MTSA 1F5RA 2P16A 1S0QA 3D49H 5C94A 2Y81A 1PPBH 1V2RT 3A7TA 1ACBE 4TY7A 3VXFH 4Q80A 8ESTE 3VG8A 1OP8A 2UWOA 9ESTA 2F9VA 1XUGA 1XX9A 2HLDD 3SV6A 3E6PH 3RXGA 1AZ8A 3FKSD 4FUCA 1KMHB 1MD8A 1EJNA 3GY7A 5EJLA 5GDSH 2AMPA 2ZF0H 3QUMP 4FUDA 2A5IA 2BX3A 2BDGA 3ATWA 1CBWB 5FCRA 5JBBS 3OTJE 1WTGH 2BZ6H 4JZEH 1IQEA 3VGCB 1QRZA 1FJSA 2K7XA 1FDPA 1SQRA 1NU7B 3LC5A 1YPJH 3MU1A 1K1NA 2ZFFH 4ISLA 1SGCA 2XYAA 2IPQX 1WV7H 2BVSH 3L33A 1AUTC 1T8OA 1F0SA 1Z8GA 3FVFB 3RC4A 3BTHE 5JYIA 2ZU2A 4BTUB 4AFQA 5GIBA 1W0KD 2ZIQH 1UMAH 4M9FA 4AOQA 4F48B 1TQ0B 4ZROA 1NFYA 4U01A 1PPEE 1E35B 1V2VT 3BV9B 2WPHS 5HGGA 1AWFH 1DWDH 2SGEE 2QXJA 4YZUA 2J2UA 4D9RA 1SFQB 1GBCA 1L0ZA 4U32A 7KMEH 1XVOA 1O2SA 4MNWA 5LGOA 1LKAA 1V2PT 2O8MA 3WW7A 2ZPRA 1J14A 1HNEE 1GJCB 1WQSA 2AMQA 4A1TA 1C5RA 3UFAA 3DHKH 1K1JA 3P17H 1D3QB 5E0HA 1UTPA 2OC1A 4UFDH 3BTME 3C1KA 1OP2A 1MAXA 3SJOA 4TPIZ 1XXDA 1W0YH 1LQDB 1C1PA 3GDSA 3CENA 1TFXA 4I86A 4JK5A 1GPZA 4Y71A 3AW1A 4AFZA 1TPSA 2XC5A 4MPWA 1P11E 1QQUA 3CS0A 5GNDA 1QQ4A 1CGHA 2J94A 3ZVCA 3GDUA 4LXBH 5HXFA 3I29A 1NROH 2VIQA 1EZUC 2WPMS 3A7ZA 3UNRA 3M3VA 4MLFB 1BRBE 2VIVA 3A7YA 3RDZA 4IBLH 1O5CB 3FP6E 3T26A 1M9UA 2PTCE 1TRNA 1MTNB 1T32A 4Z0KA 1ETSH 8LPRA 1SGTA 2QXIA 5E8EH 1MKXK 2BQ6B 3A8AA 3D65E 3W1EA 2R3YA 1UTJA 3QO6A 1XUIA 1TGCA 3RP2A 3LH1A 1W12U 2HRVA 5A0CA 2J9NA 1GHAG 2XTTB 1P12E 3RXRA 4ABBA 3TK6A 2K0QA 2J38A 2G5VA 1H8ED 4FUFA 3PMBB 2QE7D 1GBLA 2VWMA 1YPLH 2A31A 4AX9H 4ACAA 3BEFB 1TGNA 4BOHA 4JYTA 2FX4A 2JETB 7GCHF 1NFXA 2G8TA 4WF8A 1OHHD 2PFEA 3RXOA 3LPRA 1GMHG 1V2LT 2NWNA 1UK3A 1Z8IB 3DSOA 3V7TA 2HLCA 1GI8B 3L6PA 1O3GA 1Q2WA 4ISOA 3V12A 2Y6TA 1C1RA 3LJJA 4WMDA 1YLCA 2JIZD 3NZIA 2WV4A 2BOKA 1EB2A 4ZXYH 1XXFA 5K0HA 1O5FH 1BTXA 4DT4A 3LGVA 2BHGA 2FYQA 1KDQB 2YOLA 1T7CA 1YWUA 1O2WA 1DOJA 1P2JA 1SGNE 4HFPB 3GYLB 2AERH 5EXMA 2ZGXH 1GDUA 4DVAU 3VXEH 4GHQA 1GCTC 2VIOA 1ABJH 1P2NA 1P2OA 2FI4E 1V2NT 4X6MA 3M5MA 1KTSB 3MNSA 1N6YA 1MU6B 1O2ZA 4GAWA 5EPNA 2BLOA 3TJNA 3LKWA 4ISIH 2PR3A 1BB0B 1LTOA 3PWBA 1EZSC 2OTVA 3MH5A 1SLXB 1BUIA 1G36A 3MO3A 3VB4A 1WAYB 2CF9H 3U1IB 1MQ6A 1V2MT 2BY5X 2NU2E 3LIWA 4J2YB 1KXEA 4X6PA 1KY9A 4YO9A 1NRRH 2ZCKP 4MPXA 4FUIA 1QL8A 1V2JT 4A1XA 1T8NA 4O3UA 5EJZA 3RXJA 5JBCS 1UTOA 4XBDA 4AYVB 1F92A 2KCOA 5FL7D 3MWIU 2LPRA 3ZZ8A 1K21H 1P03A 1BITA 1CT4E 1TYNA 3U69H 2GCTC 3A86A 4J1YA 3RLWH 1ZHPA 4SGAE 4LK4A 4CBOA 1A7SA 1ANCA 1SQOA 1TRMA 2P95A 2UUJB 1BTUA 1O2TA 1DXPA 3A81A 1C2EA 1DSUA 2KAIA 1QFKH 2JH5D 2PHBA 3MI4A 2A7JA 2J98A 3M3TA 1FMGA 2RFKC 3LJOA 1OYTH 2ZHFH 3H5CB 3ATMA 2WPIS 2VNTA 4E05H 3F9GA 4ISNA 4X8TH 4Z6AH 3I78A 1C1SA 1ZR0A 1N8OC 1MQ5A 1T4UH 2EC9H 3WY8A 1ZHMA 4NZLA 1Q31A 2OC7A 2IPHA 1H9IE 2XBXA 1RRKA 2OXSA 2QV1A 1WUNH 3AASA 3ZZAA 3K6YA 1Y3VA 3TJVA 2Z9GA 2Z9KA 4TWYA 1P05A 1GHBF 1C5QA 2BDCA 1O5DH 4BAOB 2CGAA 5F53A 2KCAA 3P70B 3SNCA 3MU5A 2D1JA 1UCYE 1VGCC 1XUFA 2ZWLH 1KXFA 1EX3A 3UOPA 4UFGH 2GZ7A 3UY9A 2KCYA 3SOSA 5CDFE 3BG4B 1O2NA 2GJGA 5KECA 1O3DA 1Y5BT 2HALA 3P92A 4B71A 1IQMA 1UTNA 4B76A 3F2FA 3BG8A 5TCAA 3OY6U 4ASHA 1E1QD 3TU7H 4JZFH 4DW2U 1SGFA 1GCDA 5C20A 1KTTB 1LCYA 5EOKA 2GD4B 1DSTA 1EFRD 1FY5A 3VPKA 1JIMA 1GBTA 4HG6A 3BTKE 2ODYB 1F5KU 3U8RH 3SJKA 2O8TA 1KLIH 1P06A 2Z3DA 1A3EH 4GSOA 1EZXC 2RDEA 4YLQH 3ELAH 1PJPA 4ABFA 3Q76A 1ELTA 2O8LA 5DP4A 3TH3H 4NIYA 4HTCH 3OAAD 1VJAU 2YNAA 2CF8H 2A2QH 1TBRH 2DE8A 3A82A 2Y5FA 1W10U 2PUXB 2OC0A 1O2PA 3NRLA 2UUYA 3SGAE 5LPRA 4I8LA 1IQLA 2FWWA 3TNTA 3DFJA 1TPOA 2Y7ZA 1SGIB 2BQWB 1PQ8A 1QB9A 2ZPQA 2A7CA 5DP7A 1BA8B 1JBUH 3FZDA 4LZ1H 1E1RD 1D6WA 1KLJH 4ZXXH 5DP8A 5FX6A 1NT1A 3E8LA 1LMWB 1BJUA 2LELA 2HVXA 1VITF 3ZVEA 2O8UA 1GBKA 4KELA 1V6DA 1LHEH 2CN0H 2BY6X 3ZZ7A 2NU1E 1A4WH 2O8WA 3OYPA 1Y5UT 5DP3A 2BVRH 1PPFE 3OY5U 4XD7D 1IQIA 3HK3B 3EBNA 2ZC9H 4U2WA 1KIGH 3QLPH 3BTGE 1C2DA 1Y3XA 1S84A 2JJ2D 1L4DA 2QXGA 2SNWA 5AVDA 2FTMA 2ZGJA 5J4SA 6ESTA 2STAE 1KYNA 2I6SA 2GKVE 2ZCHP 4ZKRU 6GCHF 3ESTA 1UVPA 2ZP0H 1D3PB 1ZHRA 2EI7A 2QF4A 1OX1A 1TGSZ 3GY5A 2Y80A 1EP6A 3LGYA 2P3TB 4IC5A 4F49A 4D9QA 3DUXH 1GVZA 2G52A 4FUGA 1HAPH 1EQ9A 1DT2A 4IGDA 4YT7H 4BAHB 3KQDA 1UVUH 4ZH8A 4AC9A 3QGJA 1P10A 1PQ7A 1N8OB 3T27A 1GHBG 1NY22 1C5MD 4YTAA 2PP6A 1AB9B 3RXEA 4CBNA 5C1XA 1CHOG 2RA0A 5C3NA 1F0TA 2R0KA 4ZKOU 4JYVH 2C8YB 1HRTH 1O35A 3T28A 1AE5A 1C5LH 2ZFRH 1K1MA 1AGJA 3L3TA 3FAOA 1TX8A 3I77A 1A0HB 1WXRA 4O9VA 1NM6A 2G5NA 3PO1B 1O5GH 1ZGVA 4Y79A 1QRWA 3MO6A 1ELBA 1P01A 5CE1A 2J34A 4KTUA 4X1RU 5A0BA 4I8JA 1SLWB 3RXKA 1B7XB 1S5SA 5FPYA 3HGNA 1K22H 1T8MA 5IK2D 1TWXB 1Y8TA 3FN8A 4MVNA 2K8IA 1HLTH 1K1LA 2AGIX 3OFND 1UO6A 1GMHF 1RS0A 3QN7A 2W3KA 5K7RA 1E34B 4IN1A 1HAOH 1QTFA 5DO4H 4X1SU 4AZ2B 1GHAF 1KXCA 3JZ1B 4B75A 4AN7A 1TNJA 2HNTE 2KAIB 3SV9A 2ZQ1A 1GJAB 8GCHF 3EA9A 1C2IA 1SVPA 1FNIA 3KQBA 3T62A 1FIZA 3CS7A 4JZDH 1MKWK 3RMLH 1ANEA 3IWMA 4ABDA 3KYGA 1XUJA 1QJ7B 2M2AA 1TMUH 3GY2A 2VBCA 4MDSA 1FY1A 2NU0E 4DURA 1AN1E 5AFYH 3KF2A 3GCHB 1BBRE 2YMSD 3PRBA 1S0RA 2V3OH 4AB8A 3K2UA 4WH8A 4K8BA 2OC8A 3SUDA 3NK8A 1TE0A 1RTKA 4AB9A 2WUBA 1ESAA 1NBMD 3BEIB 1OSSA 1Z8JB 6CHAC 1YCPM 2XBVA 4Q2KA 3A7VA 2ZI2H 4MTBA 3S69A 4B2BA 2WV9A 3E0NB 1SKYE 3H09A 1BDAA 1EJMA 3G01A 3ZV9A 1WDIA 2ZHDA 2ZFSA 1H4WA 2QF0A 1JRSA 1PPGE 3PROA 4ABAA 5FX5A 3A89A 2VWNA 2Y82A 3GS9A 2P8OC 1WTHD 2F3CE 1AE8H 4Y0YE 2AMDA 3ZZ3A 2FYRA 3SHAH 1UTLM 4INLA 2BLWA 1BOQA 3OX7U 2ZCLP 1C5XB 4U30A 3FOAA 1DUAA 1GGDB 1P57B 1SGFG 3BN9A 6LPRA 4WJG2 5TCCA 3SU5A 1SGYE 4HZHA 2PKAB 2RDLA 3M7UA 5DN6D 1TRYA 4KGAA 2BDHA 2QCYA 3RU4T 3SJ9A 2DE9A 1FAXA 3LU9B 3QGNB 1OWJA 1IQGA 1DLKB 1OWIA 4UFEH 1LHCH 4B2CA 4KTSA 4GPGA 4RKOB 2WPKS 1C4U2 1O0DH 1XMNB 3SJIA 1P02A 1FUJA 1L4ZA 3A8BA 3EE7A 3QWCH 3U98H 4OM9A 3E90B 1LKBA 1LPGB 4NSVA 2ZHEH 2OP9A 2ZFPH 4NIXA 1EAXA 3SNDA 1YYY1 1Z6EA 2H9TH 1YP9A 4B6EA 2XWBI 1ELDE 1MH0A 3BTQE 3VGCC 1AVGH 5FHTA 1RTFB 5A8XA 3SYJA 1HPGA 5T6FA 1BCUH 3AAVA 1HV7A 1NRQH 4KP0A 3U8OH 1AUJA 2VVUA 1TNHA 2ANWA 3T29A 1ZMLA 4INKA 2Y5GA 1BRUP 2P93A 1NPMA 3KGPA 5F8ZA 2XCFA 5B6LA 1OPHB 5EW1H 1X7AC 1GI4A 5F03A 1A5GH 1TPAE 1C2JA 1FX0B 1ESBA 2A4OA 3D23A 1AVXA 3SUEA 4AG1A 4K1SA 4AGJA 1GBMA 1YLNA 3OTPA 1CVWH 4Q7XA 1C1TA 3TITA 1L2EA 1GBIA 1FY4A 3SU2A 4Q63A 1O5BB 1C5YB 2GGVB 4P02A 1C1VH 1UHBB 2PW8H 2FDAA 2FESH 1KLTA 1CGIE 2BVXH 4X0WU 3PLKA 2EI8A 1INCA 1YC0A 2G00A 3F9FA 4TSFD 5EQSA 2ODQA 3P8NA 1V2TT 4O97A 2Q1JA 5C17A 1IQKA 2HVYB 1SR5C 5A8ZA 3ZVDA 4X8VH 5FBEA 1W7XH 3GY3A 2TGPZ 3PV4A 5FXLA 4MPVA 4FETA 2SGPE 3UR9A 1BRCE 1VJ9U 1RIWC 3ZVGA 3TGJE 4NG9H 3S9AA 3E0PB 3PMAB 3MH7A 2ZDMA 3F6UH 1QNJA 3RXPA 2NU3E 4WXIA 4OS2A 3SV8A 4FVDA 1PPZA 1ZPZA 4VGCC 3ZVFA 2AIQA 1FI8A 1D4PB 3AK5A 2QC2A 1GCTB 1LPZB 1WYKA 5EXLA 1ZPBA 1O3EA 1MCTA 1MTNC 2QYIA 4IMQA 1CA8B 1F0UA 1BZXE 4X8UH 1C5WB 1GHXH 2GMTB 3A85A 2FI3E 2SNVA 4K8YA 3SV7A 4RT1A 4TY6A 1K1PA 1TIOA 2FPZA 1NRSH 4Z1MD 5EJ1A 2W3IA 1ETTH 1UTQA 5ESTE 2ZG0H 1UVSH 5AFZH 1E37B 1NFWA 2P8OB 4NA9H 2SGAA 1JMOH 1A5IA 1HJAB 2GX4A 1P3CA 3U1JB 2HPQH 3S7HB 3DFLA 1E0FD 1OS8A 5EXNA 4UONA 5EIYA 1DITH 2QGRA 1O3AA 2JETC 3E91A 4X1PU 3HATH 5T6GA 2FOBA 4BANB 1O3HA 2QA9E 4XBBA 1YPHC 1GJBB 1GI0A 3ENSB 1GBAA 1QA0A 1ZTLA 3SGQE 1AWHB 4IMZA 1A1RA 1CT2E 2WHXA 3EDXB 4Y11E 3RUOA 1IQFA 3RM2H 1QL7A 2ZGCA 2J5UA 1S83A 2BD5A 1MKXH 3TK9A 2FLBH 2G4TA 2F9NA 2ZU4A 1J9CH 4FU7A 1CQQA 5FAHA 4DCDA 3AW0A 2PKAA 1O5AB 1O2YA 2VVVA 3RXDA 2A0QB 1CGJE 2Z7FE 3SU3A 4JZIA 4MQAA 3EGKH 1EP5A 1MKWH 3QTVH 1FV9A 1BMLA 3SJ8A 3HPTB 1O34A 5SGAE 1EASA 3O8DA 3SZEA 5DP5A 1UJ1A 1HYLA 3RXFA 1C5UA 2H1UA 1QB6A 1DUEA 3PMHB 1ARCA 3OSYA 1Y5AT 4RT0A 4O3TA 3BTDE 1GJ4H 4XSKU 1UCYK 5T3HA 1C2MA 2FM2A 2R2WU 2XCNA 3TGKE 1FPCH 4ZHLU 2HGTH 4MNYA 1GJ7B 1ANDA 2Z9JA 1SGPE 1IQJA 1BRAA 2B7DH 1F0RA 1TNKA 1YLDA 1VGCB 1G2MA 1LHDH 2VVCA 2W7UA 3UWIA 2BD4A 4FUEA 4INHA 2EI6A 1HFDA 1XKBC 4Y76A 1UHBA 2FZZA 1ZZZA 5DG6A 1CSOE 2ZDLA 1SL3A 1C5TA 3UQOA 1O3KA 3QK1A 2AFQB 4ABEA 2C3SA 3IITA 1UVTH 3ATKA 2V3MA 2XXLA 3UIRA 1SOTA 1F2SE 2H9HA 4I32A 4ACBA 3N7OA 2QF5A 3ZZ6A 1GMCG 5F8TA 2BOHB 4XBCA 2VGCC 4CHAB 2UWLA 3NPSA 1RIWB 1HXFH 1O2KA 1MTWA 3B9FH 2XOKD 5DP6A 3LC3A 3RXBA 2C8ZB 2NU4E 3S0NA 2B9LA 4VGCB 1MCVA 1YPMH 1BQYA 3QTOH 3K6ZA 1FIWA 2OK5A 4F55A 1VZQH 2FX6A 1HAZB 1AMHA 3S9BA 1GJ5H 2WINI 3M35A 3LOXA 3MHWU 2VJ1A 4ABHA 5L30H 2IN2A 4K2YA 3GCOA 3W94A 4CH2B 3BTWE 3GYMA 4Y7BA 2GMTC 2B0FA 3VFEA 2UWPA 2ZPSA 1QIXB 4NGAH 3RXUA 3V3MA 4DIIH 1QY6A 5T6DA 4YLUA 3B23B 4CR5A 1L1NA 3CNRA 4GVUA 1Z1JA 1Z6JH 1LPKB 2GP9B 1PFXC 4Y7AA 3P6ZB 1BBRK 1GWAA 1O30A 3UR6A 1GG6C 4CREA 3F2HA 3OU0A 4Y8YA 2FOFA 4RSPA 2XBYA 1YPHE 3ZZ4A 1SB1H 1GMCF 1FZZA 1C2GA 1OP0A 1P0SH 2BLQA 1P9UA 4Q7YA 3LT3A 3LONA 3F0PA 2A32A 2D8WA 1MBMA 1VCQA 2BX4A 1J17T 3TPIZ 4B2AA 4WMFA 1ELGA 2R3UA 5EQRA 1H9LB 1P2KA 1MABB 3FO8D 4I31A 1G32B 1EAUA 1LO6A 1Q3XA 1THPB 1AU8A 3F9EA 4Y8XA 1K1IA 3P8FA 1JRTA 1ZYOA 1K2I1 1G3EA 1O3BA 2ANYA 4RN6A 4CR9A 3KCGH 5EG4A 3T5FH 2C8WB 2PKSC 2F43B 1GBFA 3VB3A 4JK6A 4WVPE 5E2OA 3TH4H 1ZGIA 3ZZDA 4I7YH 1K0HA 3PLPA 1W14U 5DP9A 2R9PA 1MBQA 4LZ4B 3ZIAD 4H42U 4ABIA 1OWHA 2G55A 3RXAA 3FP8E 1GDQA 2FOCA 2XBWA 2XWAA 3SNEA 3EE0B 4FU9A 3K65B 2BD2A 1RGQA 1YCPH 1N1LA 1YPEH 3SUGA 1O3CA 4ZAEA 4NWLA 4FUHA 5L2YH 3M61U 1DDJA 3S9CA 1AFQC 2CXVA 4AORA 4D7GA 1EATA 5B6OA 2JKHA 1DPOA 3RU4D 1FN8A 1VR1H 1JWTA 1NS3A 2IJD1 1NZQH 1JXPA 1J16A 3VB6A 2ZU5A 1ZMJA 1ESTA 1ZRBA 2TGTA 3SO3A 3MU8A 2A2XH 6GCHG 1TABE 4I8KA 1TQ7B 3SUFA 1LDTT 1NTPA 1CA0C 4ZKSU 3E1XB 1P09A 1G3DA 1O3NA 4GCHF 4TWWA 1SPJA 1C5OH 3TNSA 3RLYH 2AGGX 2QAAA 3S7KB 1UVOA 2CJIA 2PUQH 5A2MH 1MZDA 3FP7E 1B0FA 3MYWA 1NESE 2VGCB 1IHSH 4CHAC 1DWBH 4B74A 1FLEE 4NSYA 2CMYA 2YMSC 4XE4A 5EPYA 2OUAA 2XC4A 1C1WH 3QX5H 4DY7B 1A5HA 1P2IA 1QZ8A 2LIZA 3CP7A 1TGTA 4WWYA 1O3PB 3EAJA 1HAGE 3MMGA 1G30B 2B5TB 1KXBA 1S6LA 4SGBE 2GTBA 1C1UH 1G3BA 1HCGA 3DSGA 3WWFA 2CHAB 1H8IH 1IAUA 2F83A 2ZTYA 2ZGBH 2J92A 1V2OT 4ZHMU 3RMOH 2LNCA 5EGMA 2ZZUH 1W13U 3MTYA 3M37A 2WZQA 1Z1IA 3IG6B 2AIPA 1GBJA 3GCHC 1TBZH 1YBWA 4NIWA 1FONA 1YCPK 1DANH 1CHGA 4NFEA 2A5KA 4CRCA 1QL9A 3A88A 4XFQA 3NXPA 2ZHWH 1TPPA 5C0TA 3MNXA 2AGEX 1AZZA 3ATLA 3MO9A 3RXQA 1RTLA 2Z3EA 4JZ1A 5CMXH 1G3CA 3A80A 1FPHH 1OYQA 3UQVA 3F2GA 4FUBA 1BHXB 1EPTA 5FBIA 3OEHD 3O8CA 2J95A 1BMMH 2THFB 1MMJN 6CHAB 1SQTA 1GBEA 1Y3WA 2ZDAH 1A0JA 2FOMB 4B1TA 2SGFE 7GCHG 2A4GA 1YKTA 2C4FH 2H6MA 1GL0E 1BBRH 2Z6BD 1O3OA 1GGDC 2GZ9A 1MTVA 4MNXA 1C2FA 1MZAA 2QXHA 1TB6H 1W8BH 2FMJA 4ABGA 5CHAB 2H2ZA 2ZNKH 2J98B 1SI5H 2HPPH 4A1VA 1DY9A 3TK5A 2GZ8A 1YM0A 5HYOA 2WPDD 1ANBA 1HJ8A 3R3GB 2JH0D 1HB0B 3N99A 3KQEA 3ZZBA 3EA8A 5DK1A 4X8SH 2PKSB 1AVWA 3ATIA 4I8GA 1K9OE 2BY7X 1V2QT 2H9EH 3ODDA 3RXMA 2FP7B 1YPKH 3E16B 2RCEA 1EKBB 5EODA 5ETXA 2BB4A 2QF3A 5C1YA 3MOCA 1SLVB 5L2ZH 5FPSA 4X2WA 3F1SB 4JCNA 1RFNA 2ALPA 2L6OA 1PYTD 1V2ST 1GVLA 3SN8A 1D3TB 1EOLA 3Q3YA 1WSSH 3RXSA 3VB7A 1TNIA 1GBBA 1Z8RA 2QIQA 2A5AA 1QA7A 3KYFA 1SSXA 4IN2A 1OOKB 3BIVH 4X1QU 1LVBA 1A46H 1DXWA 5DKMA 1AKSB 1J15A 1O36A 2HWLB 2J4IA 2AEIH 1GJ9B 1Y3UA 2XNIA 2LP6A 3SBKA 1XVMA 1TONA 2W6JD 4NA8A 1HAIH 2VIPA 4X1NU 4UE7H 3KN2A 1O2VA 4NZQA 1PPCE 2P94A 2HNTC 1ZSKA 2B8OH 1UW7A 3KL6A 4IW4E 3GCNA 3UNSA 5DPAA 4OS4A 3RC5A 1P3EA 1HJ9A 2W7SA 3E3TA 1GI7B 1ZSLA 5C1UA 4OS7A 1KDQA 5KEDA 4CRFA 5HM2A 2BY8X 1F5LA 3STIA 2TGAA 1FAKH 1C1MA 1C2LA 3Q00A 4NFFA 2AH4X 2V3HH 1GJ6A 1O2XA 4H6TA 4YESB 2RA3A 2H5DA 2K1QA 1O32A 2IJOB 1GBHA 1BTHH 1P2MA 5BPEA 2TRMA 1D6RA 1O3IA 5I46H 1RXPA 3GOVB 1O2LA 3UPEA 5HMAA 3OEED 1YGCH 2W6ID 5HM9A 2V0BA 1T31A 2BMGB 2ODPA 2R0LA 3Q77A 4MNVA 4Q4LA 5PTPA 1H1BA 1SHHB 1DWEH 3SGBE 2ANMH 4X6OA 1O33A 2VU8E 2ZKSA 3VEQB 2F9PA 3RXLA 1EAIA 3N7EA 1SQAA 1FY3A 5EW2H 2D26C 3ZZ5A 3TJUA 3MNCA 3FANA 3RXCA 3BTFE 2Q6GA 1SHYA 3DT0H 3PYHA 5G4BA 2PV9B 2V7QD 2BM2A 1HGTH 4D76A 1T4VH 1BMFD 3PWCA 3ZZCA 1YY3A 1SMFE 2CK3D 1G9IE 3A7XA 3MQKC 3A8DA 3PV5A 1LVOA 4DJZB 5L6NH 5ABWA 2FS9A 2GV6A 4K1TA 1HJAC 1B5GH 5AF9H 2BY9X 1GI9B 2TPIZ 3ITIA 1O2OA 5JB9S 4I33A 1OWEA 5ESBA 3ODFA 4FXGH 3STJA 1ELFA 4UD9H 1F7ZA 2HNTF 1BTZA 5C5NA 1GVKB 2CV3A 1CU1A 1QJ1B 1W2KH 1ZOMA 2G4UA 1AY6H 2ANKH 1EUFA 4ZKNU 2OD3B 4O03A 1HIAA 1OXGA 2PSYA 4HI3A 1C1OA 4K1EA 1VITG 1BTWA 2ZDKA 4X6NA 3ZYDA 2F4LA 2C90B 1GHZA 1AQ7A 4YT6H 1CBWC 2W5EA 1CHOF 1C5NH 4YXWD 2VWLA 4CRAA 4GCHG 2ZA5A 3OE7D 1LVMA 1TX6A 5JB8S 1OWDA 1QURH 1ZRKA 1TLDA 3T25A 2WPLS 4BTTB 1UTKA 2P3UB 2TIOA 1VCPA 2WUCA 3TVJB 3V13A 4DT7B 5JBAS 4WH6A 2ALVA 1HAVA 1EXFA 1MAYA 4F4OC 1GI3A 3MU4A 1ELEE 2OCVB 3LGIA 3SQEE 2ZTZA 1GI6A 2GVFA 2A7HA 4DG4A 9LPRA 3ZVBA 2J97A 1C4Y2 5HIYA 1C5PA 1KSNA 2OQ5A 3V0XA 1O38A 4NWKA 2F9BH 3SU4A 5GPIB 2KR7A 3UB0A 2FO9A 1JOUB 1WBGB
chains in the Genus database with same CATH topology
3BF6H 3P8GA 2G81E 4BAKB 2PTNA 5IDKA 3LH3A 2EA3A 4YM9A 1P2QA 1HIAB 2QN5T 3SNAA 3W95A 5LPFA 2WPJS 1BMNH 1CO7E 2BTCE 4AYYB 5C2ZA 1U6QA 2VH6A 8KME2 3JZ2B 3LGWA 3P95A 3DA9B 3M36A 4YOJA 1JIRA 4Y8ZA 2W26A 2WYJA 5TJXA 3SU0A 4QT8C 5H4IB 3M5LA 1TOMH 1XUKA 3EA7A 1V2KT 4OGXA 1AHTH 1VITH 2GCHF 1TX7A 4JYUH 3BTTE 1HBTH 3RM0H 3RXVA 2XRCA 3RMNH 1SC8U 1XM1A 3C27B 3LGTA 3P8OA 3M5NA 1OKXA 4CH8B 2BD3A 1C5ZB 2ZDNA 4OGYA 1ZLRA 4D8NA 4OS5A 2V6NA 1SGDE 1GHYH 2V35A 3M3SA 1TA2A 2TGDA 4X2YA 1W11U 2ZFTA 3PLBA 1D3DB 3LGUA 4GLYA 1O3LA 3PTNA 3TLOA 1EOJA 4E7NA 4Y10E 1C9PA 5JBTA 1WQVH 1ZMNA 3UNQA 2UUKB 2Y5HA 5A8YA 2FOGA 3RXIA 5GXPA 1DICA 1TBQH 1S82A 1TNLA 1MTUA 3QZRA 1GDNA 1H9HE 2ZEBA 1ZJKA 2R2MB 1AKSA 1CT0E 4OS6A 2A45B 1WCZA 3UWJH 2AYWA 5E0JA 3SU1A 1YF4A 5LPEA 1L1GA 3PM3A 1ZSJA 1H8DH 5E0GA 4XDEA 3SI4H 2FIRH 2OLGA 2OINA 1ELCA 1NC6A 2GV7A 1BJVA 1B0EA 3A83A 3F68H 2BZAA 1E38B 1BIOA 3A87A 3SQHE 4X2XA 3HK6B 1AI8H 1EZQA 1AFEH 1DS2E 5EQQA 1DVAH 1E36B 1P04A 5GJ4B 3AAUA 3TH2H 2PSXA 2I6QA 2FS8A 2P3FH 1O2UA 3QZQA 3ZZ9A 3UOUA 1V3XA 1DE7H 2ZDVH 4A6LA 1LVYA 2PGQB 1O2IA 1EJAA 1PQ5A 2ZU1A 4ZMAH 2Y7XA 4UEHH 2FI5E 1GMDG 5LH8A 1W3CA 1ZPCA 2IOTA 1V2WT 3KEEA 1PQAA 4DGJA 2A4QA 2DUCA 2OBQA 3GCTF 2ULLA 1GI5A 2P59A 4THNH 4AG2A 4E7RG 2O9QA 3D62A 1C4V2 3BSQA 4UFFH 8GCHG 5J4QA 2H5CA 4BXSA 4BNRA 1IOEA 1AFQB 1NFUA 3RXHA 1WU1A 3A7WA 1C1QA 1BTYA 1HAVB 3PMJA 1NO9H 1ZTKA 2ILNA 1THSH 3T2NA 4RKJB 3NCLA 4A92A 3O8RA 4DIHH 4AFUA 4B73A 1GG6B 1K1OA 1C2KA 2BDBA 2Z9LA 2VH0A 1TMBH 1W7GH 2VWOA 1DM4B 1DLEA 1HXEH 4E06H 2Z94A 1O3FA 3KIDU 2C8XB 3SW2B 2STBE 3LDXH 1XKAC 2ZHQH 1DFPA 3BTEE 3SHCH 4UDWH 3HKJB 3O8BA 3PTBA 1SGEE 1FN6A 1QGFA 5FPTA 2GDEH 1A3BH 3R0FA 1Z71A 3GY4A 4H4FA 2BXUH 1EB1H 1TAWA 2F9OA 1C5VA 2GCTB 3GDVA 1ZJDA 3TIUA 4ZUHA 1G37A 1N6XA 2Z3CA 1SFIA 1IHTH 1A0LA 3UUZA 2GDDA 4ZHAA 4R0IA 1O2QA 3Q3KA 1HAHH 1SG8B 1TNGA 3M7TA 1QBNA 2BXTH 2BYAX 2BDIA 2FXRA 2ZTXA 1W0ZU 3URDA 2GT8A 2VB0A 2VINA 2AS9A 5JDUB 4TYDA 4K60A 2ZQ2A 2CHAC 1NN6A 1EPTC 1QBVH 3H7OA 2M5TA 5C5OA 1HAXB 2ASUB 2QY0B 2D2DA 4ESTE 3K9XB 3ZYEA 4ISHH 3EYDA 4MG3A 4CRDA 1NU9A 2SGDE 2BLVA 2GT7A 1ABIH 1NRNH 1ELVA 1O2MA 1C9TA 5F6MA 3SV2H 4Q7ZA 3MNBA 1VCWA 3HGPA 4IC6A 2FOEA 4BAMB 4AGKA 4H6SB 1L1JA 1GBDA 2BQ7B 5BRRE 3SORA 1Z7KA 3H7TA 3BG4C 1FQ3A 1CE5A 1BHXF 1QRXA 4YOGA 1ARBA 2TBSA 4BAQB 1MUEB 5EU8A 1MU8B 4K5ZA 3KQCA 1AIXH 1C2HA 3M5OA 3BIUH 2BD9A 4YOIA 1CA0B 1TA6A 2SFAA 2FOHA 1PYTC 3KHVA 1PPHE 1HDTH 1LHFH 3GY6A 3HKIB 3QDZB 2ZECA 5DGJA 2G51A 1Y59T 5CHAC 1QJ6B 3U9AH 1GJ8B 1TGBA 4KTCA 1HAYB 1DWCH 1A2CH 1FY8E 1UCYH 4D7FA 4OS1A 2VIWA 1LQEA 4BTIB 4FU8A 4GHTA 5I25A 4NCYA 1C5SA 5GCHG 1HUTH 5AHGH 1D9IA 1BMAA 2OQUA 1IQHA 2Q6FA 1MD7A 1OWKA 1RJXB 1SOZA 5A09A 1AD8H 2A4RA 5C67A 2WYGA 4TPYA 1RD3B 2HOBA 3NKKA 1GL1A 1UTMA 1GJDB 1TOCB 2F91A 1SLUB 3NWUA 1GHWH 1QR3E 1YPGH 1A61H 4WMEA 2WV5A 2JH6D 2OBOA 2Q6DA 7LPRA 1S6FA 3U8TH 5DJ7A 4CRGA 3BEUA 5F8XA 4MPUA 2PGBB 1O2RA 5GWZA 1O3JA 2ZO3H 1DX5M 3AVZA 5JPMH 1SGQE 4BXWA 1ID5H 1GHVH 2FLRH 1XUHA 1GI2A 1QBOA 4A7IB 3RXTA 1FXYA 1Y3YA 3FFGA 3MH4A 2RG3A 2EEKA 1IQNA 4WXVA 1C1NA 4AFSA 4X2VA 1AO5A 1O2GH 3EQ0H 2FOAA 1GI1A 1GMDF 1QB1A 2VIDA 5GCHF 1NRPH 3RMMH 2GCHG 2ZFQH 1EAWA 2FODA 3A84A 3MFJA 4NIVA 1J8AA 1DY8A 1ETRH 1O3MA 3URCA 1ORFA 3ZVAA 4LOYH 1P8VC 3SZNA 1O39A 2ZU3A 1S6HA 4Y6DA 4DOQA 1O2JA 5A0AE 2XW9A 4JMYA 1KXAA 1T8LA 3Q3XA 4Y0ZE 2BD7A 3GY8A 2C93B 1K28D 2ESTE 4ABJA 3DD2H 1S85A 1P9SA 4NA7A 4FUJA 5IYTA 3UREA 3MU0A 3SNBA 3RC6A 1UK4A 1AB9C 2F9UA 1TALA 3TJOA 2UUFB 1O5EH 4IS5A 4A5TS 3FZZA 3GISB 3SI3H 1TMTH 3VB5A 1EPTB 2FEQH 4KKDA 1BTPA 5FCKA 1UK2A 1LHGH 3PO1C 1BT7A 2BDAA 1THRH 1WOFA 3B8JA 1SBWA 3GICB 3NUMA 4R8TB 3ZV8A 3F9HA 3UTUH 4XOJA 3TGIE 2XC0A 3GCTG 3KNXA 5E2PA 1KXDA 3MH6A 1O37A 1O2HA 2PLXA 4FVBA 2BD8A 1ELAA 4WY3A 2PWXA 4HGCA 4K3JA 1SGRE 1G2LA 4M7GA 1ZTJA 3A8CA 3PB1E 2BDYA 2FTLE 7ESTE 2ZGHA 4PROA 3RU4E 4GUXA 3M7QA 4K69A 1O31A 3SU6A 2A1DB 2YNBA 1S81A 4I8HA 4CRBA 1V2UT 2Z9IA 2SGQE 1QHRB 1MTSA 1F5RA 2P16A 1S0QA 3D49H 2Y81A 1PPBH 1V2RT 3A7TA 1ACBE 4TY7A 3VXFH 4Q80A 8ESTE 1OP8A 2UWOA 9ESTA 2F9VA 1XUGA 1XX9A 3SV6A 3E6PH 3RXGA 1AZ8A 4FUCA 1MD8A 1EJNA 3GY7A 5GDSH 2AMPA 2ZF0H 3QUMP 4FUDA 2A5IA 2BX3A 2BDGA 3ATWA 1CBWB 5FCRA 5JBBS 3OTJE 1WTGH 2BZ6H 4JZEH 1IQEA 3VGCB 1QRZA 1FJSA 2K7XA 1FDPA 1NU7B 3LC5A 1YPJH 3MU1A 1K1NA 2ZFFH 4ISLA 1SGCA 2XYAA 1WV7H 2BVSH 3L33A 1AUTC 1T8OA 1F0SA 1Z8GA 3FVFB 3RC4A 3BTHE 5JYIA 2ZU2A 4BTUB 4AFQA 5GIBA 2ZIQH 1UMAH 4AOQA 1TQ0B 4ZROA 1NFYA 4U01A 1PPEE 1E35B 1V2VT 3BV9B 2WPHS 5HGGA 1AWFH 1DWDH 2SGEE 2QXJA 4YZUA 2J2UA 4D9RA 1SFQB 1GBCA 1L0ZA 4U32A 7KMEH 1XVOA 1O2SA 4MNWA 5LGOA 1LKAA 1V2PT 2O8MA 2ZPRA 1J14A 1HNEE 1GJCB 1WQSA 2AMQA 4A1TA 1C5RA 3UFAA 3DHKH 1K1JA 3P17H 1D3QB 5E0HA 1UTPA 2OC1A 4UFDH 3BTME 3C1KA 1OP2A 1MAXA 3SJOA 4TPIZ 1XXDA 1W0YH 1LQDB 1C1PA 3GDSA 3CENA 1TFXA 4JK5A 1GPZA 4Y71A 3AW1A 4AFZA 1TPSA 2XC5A 4MPWA 1P11E 1QQUA 3CS0A 1QQ4A 1CGHA 2J94A 3ZVCA 3GDUA 4LXBH 5HXFA 3I29A 1NROH 2VIQA 1EZUC 2WPMS 3A7ZA 3UNRA 3M3VA 4MLFB 1BRBE 2VIVA 3A7YA 3RDZA 4IBLH 1O5CB 3FP6E 3T26A 1M9UA 2PTCE 1TRNA 1MTNB 1T32A 4Z0KA 1ETSH 8LPRA 1SGTA 2QXIA 5E8EH 1MKXK 2BQ6B 3A8AA 3D65E 2R3YA 1UTJA 3QO6A 1XUIA 1TGCA 3RP2A 3LH1A 1W12U 2HRVA 5A0CA 2J9NA 1GHAG 2XTTB 1P12E 3RXRA 4ABBA 3TK6A 2J38A 2G5VA 4FUFA 3PMBB 1GBLA 2VWMA 1YPLH 2A31A 4AX9H 3BEFB 1TGNA 4BOHA 4JYTA 2FX4A 2JETB 7GCHF 1NFXA 2G8TA 4WF8A 2PFEA 3RXOA 3LPRA 1GMHG 1V2LT 2NWNA 1UK3A 1Z8IB 3V7TA 2HLCA 1GI8B 3L6PA 1O3GA 1Q2WA 4ISOA 3V12A 2Y6TA 1C1RA 3LJJA 4WMDA 1YLCA 3NZIA 2WV4A 2BOKA 1EB2A 4ZXYH 1XXFA 5K0HA 1O5FH 1BTXA 3LGVA 2BHGA 2FYQA 1KDQB 2YOLA 1T7CA 1O2WA 1DOJA 1P2JA 1SGNE 4HFPB 3GYLB 2AERH 5EXMA 2ZGXH 1GDUA 4DVAU 3VXEH 4GHQA 1GCTC 2VIOA 1ABJH 1P2NA 1P2OA 2FI4E 1V2NT 4X6MA 3M5MA 1KTSB 3MNSA 1N6YA 1MU6B 1O2ZA 4GAWA 5EPNA 2BLOA 3TJNA 3LKWA 4ISIH 2PR3A 1BB0B 1LTOA 3PWBA 1EZSC 2OTVA 3MH5A 1SLXB 1BUIA 1G36A 3MO3A 3VB4A 1WAYB 2CF9H 3U1IB 1MQ6A 1V2MT 2BY5X 2NU2E 3LIWA 4J2YB 1KXEA 4X6PA 1KY9A 4YO9A 1NRRH 2ZCKP 4MPXA 4FUIA 1QL8A 1V2JT 4A1XA 1T8NA 4O3UA 3RXJA 5JBCS 1UTOA 4XBDA 4AYVB 1F92A 3MWIU 2LPRA 3ZZ8A 1K21H 1P03A 1BITA 1CT4E 1TYNA 3U69H 2GCTC 3A86A 4J1YA 3RLWH 1ZHPA 4SGAE 4LK4A 4CBOA 1A7SA 1ANCA 1SQOA 1TRMA 2P95A 2UUJB 1BTUA 1O2TA 1DXPA 3A81A 1C2EA 1DSUA 2KAIA 1QFKH 2PHBA 2JH5D 3MI4A 2A7JA 3M3TA 1FMGA 3LJOA 1OYTH 2ZHFH 3H5CB 3ATMA 2WPIS 2VNTA 4E05H 3F9GA 4ISNA 4X8TH 4Z6AH 3I78A 1C1SA 1ZR0A 1N8OC 1MQ5A 1T4UH 2EC9H 3WY8A 1ZHMA 4NZLA 1Q31A 2OC7A 2IPHA 1H9IE 2XBXA 1RRKA 2OXSA 2QV1A 1WUNH 3AASA 3ZZAA 3K6YA 1Y3VA 3TJVA 2Z9GA 2Z9KA 4TWYA 1P05A 1GHBF 1C5QA 2BDCA 1O5DH 4BAOB 2CGAA 3P70B 3SNCA 3MU5A 2D1JA 1UCYE 1VGCC 1XUFA 2ZWLH 1KXFA 1EX3A 4UFGH 2GZ7A 3UY9A 3SOSA 3BG4B 1O2NA 1O3DA 1Y5BT 2HALA 3P92A 4B71A 1IQMA 1UTNA 4B76A 3BG8A 5TCAA 3OY6U 4ASHA 3TU7H 4JZFH 4DW2U 1SGFA 1GCDA 5C20A 1KTTB 1LCYA 5EOKA 2GD4B 1DSTA 1FY5A 3VPKA 1JIMA 1GBTA 3BTKE 2ODYB 1F5KU 3U8RH 3SJKA 2O8TA 1KLIH 1P06A 2Z3DA 1A3EH 4GSOA 1EZXC 4YLQH 3ELAH 1PJPA 4ABFA 3Q76A 1ELTA 2O8LA 5DP4A 3TH3H 4NIYA 4HTCH 1VJAU 2YNAA 2CF8H 2A2QH 1TBRH 2DE8A 3A82A 2Y5FA 1W10U 2PUXB 2OC0A 1O2PA 3SGAE 2UUYA 5LPRA 4I8LA 1IQLA 2FWWA 3TNTA 3DFJA 1TPOA 2Y7ZA 1SGIB 2BQWB 1PQ8A 1QB9A 2ZPQA 2A7CA 5DP7A 1BA8B 1JBUH 3FZDA 4LZ1H 1D6WA 1KLJH 4ZXXH 5DP8A 5FX6A 1NT1A 3E8LA 1LMWB 1BJUA 2HVXA 1VITF 3ZVEA 2O8UA 1GBKA 4KELA 1V6DA 1LHEH 2CN0H 2BY6X 3ZZ7A 2NU1E 1A4WH 2O8WA 3OYPA 1Y5UT 5DP3A 2BVRH 1PPFE 3OY5U 1IQIA 3HK3B 3EBNA 2ZC9H 4U2WA 1KIGH 3QLPH 3BTGE 1C2DA 1Y3XA 1S84A 2QXGA 1L4DA 2SNWA 5AVDA 2FTMA 2ZGJA 5J4SA 6ESTA 2STAE 1KYNA 2I6SA 2GKVE 2ZCHP 4ZKRU 6GCHF 3ESTA 1UVPA 2ZP0H 1D3PB 1ZHRA 2EI7A 1OX1A 1TGSZ 3GY5A 2Y80A 1EP6A 3LGYA 2P3TB 4IC5A 4F49A 4D9QA 3DUXH 1GVZA 2G52A 4FUGA 1HAPH 1EQ9A 1DT2A 4IGDA 4YT7H 4BAHB 3KQDA 1UVUH 4ZH8A 3QGJA 1P10A 1PQ7A 1N8OB 3T27A 1GHBG 1NY22 1C5MD 4YTAA 1AB9B 3RXEA 4CBNA 5C1XA 1CHOG 2RA0A 5C3NA 1F0TA 2R0KA 4ZKOU 4JYVH