1LVOA

Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
299
structure length
299
Chain Sequence
b'SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase, hydrolase domain
publication title Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain.
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
molecule tags Hydrolase
total genus 82
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1lvoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA01
5DO4H 5DPAA 1CT4E 1CVWH 3LT3A 2ZGBH 2R2WU 3MU5A 1H1BA 3F6UH 1V2NT 1C1QA 1HAIH 1WOFA 3TGIE 1PPFE 8GCHG 4FUGA 2ZTZA 4K3JA 3RXBA 5E2OA 5TJXA 4CRCA 1G36A 4I32A 1DSUA 3T25A 1C9PA 1O2YA 1W7GH 3SU4A 1QJ6B 2BTCE 4JZIA 1ID5H 4Y7BA 1TX8A 2Y80A 2WINI 1YCPK 4XBBA 1WQSA 3R3GB 1SGPE 1TB6H 4AFZA 3W95A 3VGCB 1ARBA 3P8GA 3QLPH 3STIA 2BQ7B 3LGTA 4O3TA 4X2VA 3WY8A 1LVMA 6GCHG 1QGFA 1KTSB 2SFAA 4BAOB 2A7HA 3DHKH 4AYVB 2FOFA 2GCTB 1BTWA 1T8LA 2JH0D 1VJAU 5B6OA 3S7HB 1F7ZA 5A8ZA 1PPZA 1DWEH 3A83A 3RXOA 4GUXA 1K28D 8ESTE 2ZPQA 1L2EA 1Y3WA 2PLXA 3U8TH 1CO7E 1JIMA 1ESTA 1YLDA 1RGQA 2P93A 1IQEA 5AFZH 1V2KT 1YPLH 1GBKA 1Y5AT 4UFEH 5ESTE 5DP4A 1V2PT 2GV6A 2PTCE 2YNAA 5I46H 3LJOA 5DP7A 2ULLA 4NIVA 3MH6A 1HAZB 1LHDH 1NRNH 5DP9A 2OC0A 2WPLS 1OP0A 2WYJA 4Y0YE 4IGDA 1MCVA 2Z3EA 4JYTA 4ZMAH 3T26A 1KDQB 2B8OH 2EA3A 1ZMNA 2K1QA 1CE5A 4BAHB 3SV7A 2VIDA 1UVTH 1ZSJA 4ZKSU 4BTIB 4DT7B 1RIWC 3GY6A 5GCHG 3VFEA 1GVZA 3M3SA 3R0FA 1Z1IA 1Y5UT 1OWJA 2FOCA 2R3YA 4YO9A 2XBYA 2CHAC 4NFEA 1C5NH 1NFUA 1NESE 1Y3YA 2YOLA 2FZZA 4JZ1A 1AZ8A 1PPBH 1NTPA 3UNSA 1D6WA 1SSXA 1O35A 3MH7A 1QL8A 4FXGH 4CRBA 1O2XA 2Q1JA 2Y81A 2BY8X 4DJZB 3V0XA 1MZDA 2TGPZ 4JZEH 2EI7A 1UTJA 5GPIB 3SGQE 1AUJA 4BXWA 3SV9A 5BRRE 2Y82A 1QB9A 2PUQH 1DX5M 3V3MA 3PLPA 2UWPA 1W13U 1C2KA 3FAOA 4TPYA 2G4UA 1O5BB 1DM4B 2H5DA 4NFFA 6CHAB 3MU8A 4NA9H 2VNTA 2GZ8A 3MNSA 1GG6B 3Q77A 1GHXH 3LGWA 1ELFA 2AMPA 3UIRA 1FY1A 1HIAB 1KLIH 1DXPA 4VGCC 2V3OH 5FX6A 1SVPA 1FNIA 2B0FA 4IN1A 1QY6A 1YM0A 1F5LA 1ELCA 1O3NA 1N6XA 2V3HH 3TIUA 1QBVH 2BVXH 1F0UA 4RN6A 4K5ZA 3ZYEA 1LKAA 2QGRA 2SGDE 4UE7H 2ALVA 1SGTA 5DGJA 3OTJE 1EATA 1P2OA 1XVOA 2ZGJA 3GY2A 2HGTH 4WVPE 2NU2E 3O8BA 1P12E 5AHGH 1CA8B 2YNBA 2OTVA 1D3PB 4YESB 3A86A 4OS4A 2O8UA 1LQEA 3BIVH 1RD3B 5C3NA 1JXPA 2OD3B 1CGJE 1TONA 4OS6A 5FXLA 3LPRA 1OYQA 1QFKH 1BBRH 3PMJA 1HAXB 3MO3A 1WBGB 4TPIZ 2WUBA 1TNIA 1GI0A 2BD3A 1QR3E 3BEIB 4FUBA 1O3OA 1SC8U 1QRZA 1P2IA 5JBAS 5JYIA 3KF2A 2HNTF 3GCOA 3E0NB 2UUKB 1UHBB 4XBCA 1MKWK 5EOKA 1CU1A 1TFXA 2Z9KA 4Y8YA 1QJ1B 2GVFA 1AY6H 2GT8A 3LDXH 1DFPA 1NO9H 1KXFA 4BTTB 1C4Y2 3PTBA 3A80A 3SBKA 2BDAA 5FHTA 2ZFPH 1WTHD 2SGPE 1EP5A 5TCAA 3SNDA 1HJ9A 3HK6B 1NFYA 1OOKB 2QY0B 2ZECA 1MTUA 3BG4B 2G8TA 2DE8A 3A84A 2BLOA 3BIUH 4K8BA 1GHWH 1HGTH 1A0HB 2EI8A 4NA8A 4B2BA 4Y76A 1HBTH 3ZZAA 1MTSA 1K1PA 2C90B 1MD8A 3LH3A 1V2RT 4MNXA 1AUTC 4IBLH 1NRRH 5AFYH 2OBOA 1TGCA 2TIOA 3GISB 1Z1JA 1C5OH 3T27A 1ELEE 1LVOA 2K7XA 4NSYA 1TIOA 1P01A 4BAQB 2CMYA 2PWXA 3TVJB 3BV9B 3MYWA 3JZ1B 3P92A 2H2ZA 3SU5A 1C1OA 3NZIA 1VGCB 1YBWA 1O2KA 2G4TA 3L33A 3FZDA 4K1TA 2WPMS 3RU4T 3U9AH 2FODA 1P57B 1GI4A 4IN2A 1CT0E 1P3EA 1V2TT 4ZKRU 2XW9A 3A7XA 2ESTE 1KYNA 5EODA 1NY22 1AMHA 2Y5FA 4I8KA 4SGBE 5FBIA 3SV2H 1Y8TA 1ELTA 2VWNA 4MPWA 4I8LA 4NCYA 1W0ZU 3A8AA 1QQ4A 1TWXB 4DIHH 1HJAC 3H7OA 2J34A 1SB1H 2FEQH 2W7UA 3PO1B 1O5DH 1P8VC 3SNBA 1FPHH 3VEQB 1O3EA 1C1VH 1SOZA 1E0FD 1GMHF 2ZP0H 3ZVFA 2FYQA 3Q76A 1FDPA 2RDLA 1DPOA 1TOCB 4BNRA 1GBLA 4HTCH 1XUJA 4XDEA 5K7RA 2F9BH 3SN8A 1G2MA 4B1TA 2GX4A 4Y8ZA 1GMCF 1AVXA 1AB9B 3RXQA 2ZQ2A 2ZFQH 3QDZB 2BD8A 3BTHE 4MVNA 4YLQH 2A5IA 1D3QB 1GI1A 1NU7B 3LGYA 2XRCA 1O30A 3VXEH 1IHSH 2ZZUH 2GT7A 1GMHG 4A5TS 3SJ8A 2ZHEH 1RRKA 2STBE 1MKXH 2ZTYA 5H4IB 2ZU3A 3VB5A 2PTNA 1JBUH 4ISOA 1HXFH 4WJG2 3BEFB 4B2AA 3PLBA 3ESTA 2GMTC 4X2WA 1NRQH 1XUKA 1BIOA 1GMDF 3EGKH 2GZ7A 2Y5HA 1GMCG 3IG6B 4JYUH 1TPPA 1LTOA 4QT8C 3T2NA 1V2VT 2Z9GA 2ZDNA 6LPRA 1PPEE 1GBMA 2P8OB 1S82A 2BVSH 2A0QB 4R8TB 3VB3A 1HAPH 1J15A 5EXLA 1ZTLA 5A2MH 1OP8A 3S0NA 1QB6A 3MI4A 1LHEH 1BOQA 2XBXA 4UFFH 1IAUA 1EPTA 1ELGA 2ZTXA 4CH8B 2AIQA 5FPTA 2W3KA 1JIRA 4M7GA 2A45B 2BLVA 1YPJH 3K9XB 3TNSA 1GBFA 3ATIA 2WYGA 2THFB 3DT0H 4AFQA 3P8OA 1BRCE 4HI3A 3KCGH 2OXSA 1O3KA 2BXTH 2XBWA 1PQ8A 3RXUA 2ZFRH 4SGAE 3E91A 2XYAA 1Q2WA 1BA8B 3A82A 5HXFA 3QO6A 1TNKA 3RMMH 1BCUH 3EA9A 1W11U 5LPEA 1MCTA 1TE0A 2OC7A 2XWBI 2Y7XA 1O5GH 1TYNA 3LC5A 1TMTH 4K1EA 2OCVB 1G30B 4ASHA 2P3TB 4LXBH 5HMAA 2O8TA 1Z8JB 3PTNA 1A0LA 3QN7A 3ZVGA 3EA8A 3Q3XA 3SI4H 4GHQA 1QNJA 3RDZA 2W5EA 1HJ8A 4X6OA 1HV7A 1QIXB 2DE9A 2XC0A 1GGDB 9ESTA 1GDUA 1BMLA 3SGAE 3SJOA 1E37B 3M5LA 2AFQB 3PB1E 1AFQB 1RXPA 2QAAA 1TALA 3UREA 1HCGA 2G51A 2ZDKA 1MBMA 1LQDB 4KTUA 1GVKB 1EUFA 1SPJA 1EOLA 1AIXH 1P11E 1SQTA 2WPIS 3F9FA 1C5QA 2GCHF 1G2LA 2ZF0H 4K60A 1TNLA 3C1KA 1GHAF 1C1TA 1FN8A 4WH6A 1O3MA 1C5VA 2R3UA 5HM2A 4A92A 1DLEA 1O2WA 5EXNA 1XKBC 4JYVH 1JRSA 2Y5GA 3VXFH 2CGAA 2P59A 3S9AA 1B0FA 1XXFA 3PLKA 1AKSA 2C8YB 1C5TA 2O8WA 4KGAA 2P3UB 4JK5A 1LPKB 1K1MA 3M5NA 2QXJA 3GY5A 5G4BA 3MO6A 1GCTC 2FOBA 2O8MA 2BD5A 3OYPA 3VPKA 4NA7A 3RXVA 3P8FA 5CHAB 1LMWB 1TGSZ 2GCHG 5JB9S 1TGBA 1GHAG 1BHXB 1EKBB 3IITA 3PROA 2ZGHA 3DD2H 1H8IH 4J2YB 5SGAE 4X1SU 4I7YH 2HRVA 2Z6BD 2QC2A 1S84A 1G3EA 1A61H 2HNTE 1TNGA 1O3BA 3RU4E 2RA3A 1QA7A 1K22H 3FVFB 4CR9A 3M61U 1PQAA 1V3XA 1FIZA 4DCDA 5CMXH 4D7FA 1O31A 1GJ7B 2G81E 1O38A 5C1XA 3SU0A 2ZC9H 3EYDA 2VIPA 3ZZ6A 1Z8GA 8GCHF 1TBRH 1BHXF 3BTME 1DOJA 4Z0KA 3ZZ3A 3A7TA 2EI6A 3GY8A 4ABFA 5L30H 4E7NA 2ODQA 4CH2B 2ZGXH 1YKTA 2ANMH 2STAE 2G5NA 3A8CA 4TWYA 1TPSA 2A2QH 3QGNB 1YPHC 1GDQA 2VJ1A 4XE4A 4K2YA 1B5GH 1K9OE 2J2UA 1TGTA 1O3JA 1AVGH 2SGAA 1A3EH 2BZ6H 1BTZA 3A7WA 1GDNA 1SFIA 5GWZA 1O3PB 6GCHF 1P03A 3GCHB 5JB8S 1GBBA 1SGFA 1SGQE 3DFJA 4NG9H 1UCYE 1XUIA 1U6QA 1G3CA 2JH6D 2QV1A 3A87A 2A32A 1BTXA 1FQ3A 1P9UA 3MNCA 1YC0A 2AGIX 1FJSA 1LHCH 1IQHA 1JMOH 3GCNA 1BTHH 3DA9B 5A8YA 1VITF 2GD4B 3ZZCA 1C5WB 2ZA5A 2O9QA 3F68H 4UONA 5A09A 1IHTH 1S6FA 1GJ5H 1C5ZB 2TBSA 1O2MA 1M9UA 3D65E 3UWJH 3M36A 4Q7XA 6ESTA 1V2QT 3M7UA 1OWHA 1FY4A 1Z71A 1QL9A 2FI5E 1P09A 1ZHRA 1MU6B 1GJ9B 2W3IA 3SNAA 5EG4A 3RXDA 2VIVA 2ZGCA 3E0PB 1BT7A 1VITG 5BPEA 1ANDA 2WPKS 5GCHF 5EU8A 3RLYH 1OSSA 3RC5A 3W94A 1ZOMA 1FAKH 4NIYA 1D3DB 4B75A 1A7SA 1SMFE 4ZHLU 4NZLA 3SORA 1L1NA 4A1VA 2HALA 1GJ8B 3ZVBA 1O34A 1J14A 1XVMA 1EAWA 3LGUA 1SL3A 1G32B 3TGKE 1FMGA 1S81A 1EX3A 1UTOA 1GJ4H 1CT2E 1HXEH 4WF8A 1P06A 4CHAC 4AG2A 3A85A 2TPIZ 2IJOB 1ESBA 3RXGA 4CBOA 1O2UA 1MH0A 2FOHA 1EASA 7GCHG 4K1SA 2ZKSA 4LOYH 1WQVH 1HAVA 1O5AB 1G9IE 1MTNB 1FPCH 3JZ2B 1UJ1A 3LKWA 3RXFA 1P2NA 3SQHE 2FOGA 3P95A 2XC4A 3KIDU 1SGCA 4MNWA 1EZSC 2TRMA 2J95A 2A5AA 1MBQA 2BOHB 2ZQ1A 1A5IA 1XMNB 5EGMA 5LPRA 1O2LA 1RFNA 1NC6A 3MU4A 2P16A 3ODDA 2AS9A 1SQAA 3A7YA 1O2OA 2ANWA 4BXSA 1F5RA 2AERH 3GCTG 2PKSB 3UOUA 1UVPA 4ZXXH 1AQ7A 1OS8A 3MU1A 4GAWA 1DANH 1TPOA 3A8BA 1ZYOA 1C5PA 1EAUA 1T31A 4Y6DA 1RTLA 3E3TA 1DDJA 1V2JT 3VB4A 1EQ9A 3RXPA 1ELAA 2G55A 4WWYA 1OKXA 1MAXA 4TWWA 1T4VH 2XNIA 1V2ST 5FPSA 1UCYH 2V35A 1SGEE 1YGCH 4DG4A 1P2JA 1SLVB 3GY3A 3VB7A 1C5RA 2D2DA 5IDKA 2BY7X 3GOVB 2OC1A 3GYLB 1C1NA 4DGJA 1FY5A 2IOTA 1GCDA 1GJAB 1QHRB 1W0YH 4AX9H 2GZ9A 1T7CA 3M3TA 2F91A 1GI6A 1K2I1 2FPZA 1YPGH 2V6NA 2VWLA 1ABIH 1O37A 4A1TA 1ZGIA 2FLRH 2ANKH 1BB0B 1NM6A 1YYY1 3KL6A 1N8OB 4Q7YA 3D62A 3I77A 3RXMA 1B7XB 1F92A 2QN5T 1FV9A 1AHTH 2AGEX 1EPTB 3ZZ8A 2ILNA 5EPYA 1ZZZA 1DVAH 1BMAA 4I33A 2RCEA 1YF4A 4FUEA 2PSYA 1P0SH 1C1UH 3AW0A 3BTFE 1PJPA 4FUHA 4K69A 5CE1A 3S7KB 1SI5H 1GJDB 1ACBE 1ANCA 1HRTH 1RJXB 2Z3CA 1WU1A 3RXLA 1O2SA 1C2GA 2RG3A 3K2UA 3O8DA 3OU0A 1ETTH 2JETB 3M3VA 1G3DA 1QQUA 1AFQC 1VJ9U 1JRTA 2UUFB 3RC4A 4O03A 3T28A 1O5CB 4AYYB 3RXEA 1GBJA 1NN6A 4XOJA 3SUFA 1ZGVA 5ABWA 1AO5A 1BBRK 2AYWA 1DWBH 5T6GA 4ABEA 5C1UA 4X8UH 3D23A 1O39A 1EAIA 3SNEA 1CA0C 1TRMA 4BAKB 4X6PA 4DVAU 1BMMH 3UFAA 4X8VH 1AZZA 1SLWB 3E90B 3STJA 1MTWA 3RP2A 5LGOA 3LU9B 4DOQA 1EOJA 3SUGA 3TNTA 1PQ5A 1H8DH 1ELDE 4OS1A 1H9HE 1SGNE 3PWBA 1KXAA 3A7ZA 1K1LA 2BDHA 2XWAA 3KHVA 3DUXH 1C2FA 3GICB 1F2SE 2FOMB 5T6DA 3V12A 1G37A 1UTQA 3SU3A 4ISLA 4Z6AH 5J4SA 1NFWA 5EXMA 4GHTA 3BTTE 2P3FH 4OS2A 4ABDA 3OSYA 3MU0A 1ZPBA 1FAXA 1MZAA 1AKSB 4AZ2B 2PGBB 1UTLM 2SGEE 1C2LA 2EC9H 2BY9X 1A2CH 2XCNA 2J9NA 4UEHH 1DE7H 3TH4H 2PGQB 5FAHA 5JDUB 4ABBA 1NRPH 4I8GA 2GDEH 4U2WA 2VGCC 4JZFH 1FI8A 2ZU2A 4DURA 4B2CA 2O8LA 2OP9A 2ZCLP 1P2KA 2P94A 2FO9A 4ZH8A 4FU8A 1TLDA 3SU6A 3ZVDA 2BDBA 3ZVCA 1FN6A 5FBEA 3S69A 4H6SB 4AFSA 1P04A 2IPHA 3K6YA 4X2XA 2R9PA 1RTKA 3NK8A 5E2PA 3AVZA 2C4FH 4F49A 2ZDVH 3QX5H 3A7VA 3UY9A 1INCA 1IOEA 3P8NA 3G01A 1A4WH 3RC6A 3A8DA 2ZPSA 2ZHDA 5EW2H 3KEEA 2KAIA 1FONA 1VCPA 3VB6A 1DT2A 4MDSA 3DFLA 2JH5D 1V2LT 1UK3A 1KY9A 1CSOE 2HWLB 1RIWB 3RXAA 3ZZBA 1ZJDA 1C2MA 3MNXA 3U69H 3TH3H 1QBOA 1TNJA 3ZZ4A 1LVBA 4Y8XA 1OX1A 1AI8H 2AMQA 1ANEA 1P02A 2CHAB 3B8JA 3ZVEA 4NSVA 1IQLA 1ZRBA 2NU1E 3ATLA 1PPGE 3LGVA 4X8TH 3VGCC 5DP3A 3KQEA 5C5NA 1UTPA 1ZMLA 2H9HA 4CRAA 2Z94A 2FOAA 1YP9A 1BMNH 1HAOH 1L4ZA 4X1NU 3SV6A 2ODPA 2GCTC 1VR1H 2HVXA 3E1XB 1K1NA 1OYTH 3TLOA 2SNVA 8LPRA 3QGJA 4ESTE 3TU7H 1F5KU 1UK2A 4O3UA 1O2HA 2ZHQH 3EA7A 1LVYA 1S85A 3M7QA 1MKXK 1A0JA 1OPHB 3HK3B 5EQSA 5GXPA 1O36A 3D49H 3PWCA 1D3TB 3O8CA 2FI4E 2VWOA 4AB9A 4IW4E 1C1PA 4AOQA 1GBIA 3M5MA 4BAMB 1S0RA 2CF8H 5GIBA 4Q80A 3M7TA 1O2NA 1PPHE 4ABHA 5F8XA 2QXGA 4ISIH 3BTGE 1HUTH 2BDIA 4GSOA 4I8JA 2BQWB 4ZROA 1GI3A 1MUEB 2G5VA 1HLTH 1DITH 4RSPA 3UQVA 1N1LA 1DUEA 3LGIA 1GL1A 1TQ7B 2R0KA 3RMOH 5L2YH 3MHWU 1SGFG 1Z6EA 1W14U 1QRWA 1AN1E 1SHYA 3FP6E 4MNYA 1MTNC 2UUJB 1IQNA 1LKBA 1AWFH 3URCA 4NIXA 3V13A 1HAYB 1GHBF 2PR3A 5E0JA 1GJCB 3L3TA 4E7RG 3BTDE 4U01A 2F83A 2G52A 1EJMA 3BSQA 4KTCA 4LK4A 4YT7H 2D1JA 4TYDA 3O8RA 1TGNA 1AFEH 2ZCKP 1ETRH 4NWKA 1HAHH 1BRBE 1ZPZA 2ODYB 2PUXB 4YT6H 4MTBA 1YCPM 2GGVB 3RU4D 2PFEA 1OWDA 3S9CA 1FY8E 1HAVB 2FIRH 3RXHA 3U8RH 5C67A 4H4FA 3UPEA 5EQRA 1HFDA 2SGFE 3KQCA 2GDDA 1BDAA 4JMYA 2FM2A 5FCKA 1CQQA 1KXBA 1EJNA 2AEIH 6CHAC 3T62A 1XKAC 1GHBG 1L1GA 1O3DA 1GI9B 1TBZH 2ZHWH 5F6MA 1XUHA 2GP9B 1YLCA 3F9EA 1ZTJA 1ETSH 1MAYA 3MO9A 5E0GA 1GG6C 1BTYA 4X1PU 1NPMA 1KXEA 4Y0ZE 2BD4A 3P70B 3TK6A 1L0ZA 4YZUA 5GDSH 1J9CH 4AG1A 5PTPA 2CJIA 1EZXC 2CF9H 3LOXA 3TGJE 4INKA 3V7TA 3HATH 4RKJB 1E35B 1IQJA 1W12U 3N7OA 3OX7U 3TJVA 3OY6U 2LNCA 4H6TA 1W3CA 2BLWA 1BZXE 2BY6X 2ZPRA 4X6MA 1SGDE 4UDWH 1AE8H 1C5XB 3GYMA 2A4QA 1WAYB 2FX4A 2TGDA 3ITIA 1C4U2 5FCRA 2ASUB 2A4OA 1ABJH 5A8XA 1Z7KA 2HNTC 1GBTA 4KKDA 4YM9A 1A5GH 4THNH 1K21H 2B5TB 5DP5A 5DP6A 3EAJA 4WY3A 1P3CA 2OUAA 4CBNA 1TMBH 2C8WB 2D8WA 2UWOA 3K65B 5E8EH 1SG8B 2RA0A 2NU0E 2WUCA 2GV7A 3QK1A 1DLKB 4K8YA 1UTKA 1D9IA 2ZDLA 4Y79A 1EZUC 2QCYA 1UTNA 2VH0A 1WSSH 3UR6A 3GDUA 2HOBA 1EB1H 1UVUH 4UFGH 4Q7ZA 1L4DA 1BITA 2BVRH 2V0BA 3MMGA 1ESAA 1LCYA 2JETC 1C1RA 1BRUP 4X0WU 3SHAH 1NFXA 4FUJA 4PROA 3HPTB 3P17H 1NRSH 2P95A 4GPGA 2EEKA 1O2VA 4WXVA 2H1UA 1KLJH 4AORA 5T3HA 1QURH 3BG4C 4YTAA 4BANB 1YCPH 1KXDA 3PMHB 4UD9H 3CENA 3KGPA 2Z7FE 2BB4A 4OGYA 4A7IB 3F9HA 4FUIA 2F9OA 3C27B 3SW2B 4BOHA 1GI5A 3SU2A 3U98H 2Q6GA 1A3BH 4GCHG 1AU8A 2VU8E 1SQOA 1BUIA 3B9FH 3MTYA 1SHHB 2A1DB 1WCZA 2J94A 3PMAB 2ZFTA 1GHZA 1ZSLA 1O3GA 3SU1A 1HPGA 2UWLA 4GVUA 1WTGH 5IYTA 3TK5A 5HGGA 5T6FA 3L6PA 1VGCC 1ZHPA 1CHOG 1BTPA 1UVSH 5I25A 1F0RA 2A4RA 2VINA 4HFPB 5HM9A 3UTUH 1E36B 1AWHB 5A0BA 2GMTB 1TX6A 2GTBA 1NT1A 2ZDMA 3RXSA 2VVVA 2J4IA 3SO3A 1V2WT 7GCHF 2PHBA 5JBCS 3BTQE 5EQQA 3PYHA 3GDSA 1NROH 3ATKA 4O9VA 1DWCH 1WYKA 3MWIU 1UVOA 2ZEBA 3U1JB 5FPYA 2BMGB 4Y10E 1GI7B 3TH2H 2ZG0H 3PO1C 3UUZA 3UNRA 5ESBA 3OY5U 1O2GH 1FLEE 1C2DA 1BBRE 3BEUA 1O2PA 1W8BH 4WXIA 1Y3UA 3ELAH 7ESTE 2FYRA 4GLYA 2H9TH 1IQGA 1O3LA 2FS8A 3K6ZA 1C2JA 1UMAH 1W2KH 3QUMP 4ABJA 1TQ0B 2ZFSA 1F0SA 3ENSB 1GPZA 3GCTF 4ISHH 4B74A 1D6RA 2QYIA 2CV3A 1C1SA 3RLWH 4INLA 2IN2A 1TRYA 1HB0B 1TNHA 4MG3A 1AB9C 1C2HA 1T4UH 4AGKA 3IWMA 3CP7A 1EXFA 5LPFA 1TRNA 2HLCA 1NZQH 4B71A 4OGXA 1ARCA 3AW1A 1ZPCA 1Z8RA 2CN0H 4MPUA 1ORFA 2C3SA 5JBTA 2FWWA 2BX4A 4AB8A 4MQAA 3BG8A 1Z6JH 1XXDA 1MQ5A 1SR5C 3SGBE 1Y59T 2B7DH 2BY5X 1EJAA 1ZMJA 2Y6TA 4Q2KA 3RM0H 1FZZA 1QB1A 4F4OC 2FP7B 3Q3KA 1BTUA 1O32A 1GBHA 1O2IA 4TY6A 4IC5A 1O3IA 1S6HA 2KAIB 2Q6DA 2BLQA 5K0HA 4WMEA 5DG6A 4ZUHA 1QL7A 2P8OC 4Y7AA 2PKAA 2NU3E 5LH8A 1QBNA 1FUJA 2A2XH 2LPRA 1IQMA 4WMDA 4CR5A 4DY7B 1KLTA 1GHYH 3KQBA 4ABGA 3M5OA 4U30A 1H4WA 1XX9A 1HNEE 5L6NH 1PQ7A 3GDVA 4X1QU 1RTFB 3UOPA 1GL0E 1Y3VA 3SI3H 1IQFA 2F3CE 4CRGA 2BHGA 1DSTA 5HYOA 4I31A 1EAXA 1GVLA 2ZDAH 4WH8A 1ELVA 1P2MA 1EB2A 4CRFA 4D9RA 3HGNA 4XBDA 3SUEA 4XSKU 2QF3A 1EP6A 2M5TA 4RKOB 1D4PB 1KSNA 1UCYK 1GJ6A 4HZHA 5FX5A 1ZRKA 1ZLRA 1GBDA 1GCTB 3ZZ7A 5GJ4B 2UUYA 1TAWA 4NGAH 2A7JA 1O2JA 5AVDA 1BJUA 2QF0A 3HGPA 4B73A 1E38B 7KMEH 3NUMA 2FESH 2R2MB 4IMZA 5AF9H 3BTWE 4ZXYH 3NKKA 3ZV8A 3M37A 2Y7ZA 3MNBA 3AASA 1X7AC 1MKWH 3Q3YA 3EBNA 1THPB 2TGTA 4MPVA 4WMFA 5EPNA 1RS0A 2W26A 3SQEE 3B23B 3RUOA 4CREA 1GGDC 1SOTA 3TJOA 1GBAA 4B76A 1DY9A 1O2QA 1N6YA 3RMNH 3HKIB 1VCWA 3P6ZB 3UQOA 4FU7A 4ABAA 1BRAA 2Z9LA 1CBWB 1TOMH 2ZFFH 4UFDH 2VVUA 1OP2A 1K1OA 2BYAX 2GKVE 3FP8E 2HPPH 2JKHA 4R0IA 3NPSA 4ZHMU 4FVBA 1J8AA 3BTKE 3MOCA 2ZCHP 2ZIQH 2BZAA 1UO6A 1PFXC 4Y71A 1ZSKA 4OS5A 1P2QA 1C2EA 3URDA 3ZZ5A 1O2ZA 1P9SA 1THSH 2BX3A 1EZQA 3F9GA 5EW1H 1OXGA 1VZQH 2XCFA 1HYLA 3UNQA 1AE5A 4ZHAA 3RM2H 3A88A 1Y3XA 1C5LH 5JPMH 4JZDH 1P10A 2OBQA 3EE0B 5CHAC 9LPRA 4Y11E 3A81A 1LPGB 2PSXA 3MH4A 1V2MT 1OWKA 1GBCA 1H9IE 4U32A 3Q00A 4NZQA 3NCLA 3NWUA 1C1MA 2J92A 4IS5A 2FX6A 4A1XA 2J38A 2ZU1A 3UWIA 1K1IA 2FDAA 2WPHS 4E05H 1O33A 1KIGH 5A0AE 1O5FH 5L2ZH 1SGYE 2ZNKH 4AGJA 2QXIA 1GI2A 3SNCA 4NWLA 2Z9JA 4MNVA 3RXCA 1DWDH 4HGCA 1GBEA 4FUCA 1WV7H 3QWCH 2SGQE 3BN9A 2QIQA 2FS9A 2ZWLH 4A6LA 2A4GA 2W7SA 5J4QA 1ZHMA 3FANA 2ZU5A 4IMQA 2BM2A 3HKJB 1T8MA 1J16A 3PV4A 1S83A 1IQKA 3RXKA 1KDQA 4YOJA 3SJ9A 3UR9A 4X8SH 4IC6A 1O2TA 1SFQB 1O2RA 2R0LA 3SJIA 2ZHFH 4ISNA 1TX7A 4D9QA 1TPAE 1O5EH 3RXRA 3RXJA 1V6DA 1B0EA 2AH4X 1C5SA 1K1JA 2C8ZB 3AAVA 2FOEA 3SOSA 3GCHC 2QXHA 1E34B 2WPJS 4CHAB 5C1YA 1LHGH 3LC3A 1TA2A 2BQ6B 1ZTKA 1T8OA 1V2OT 3M35A 2QA9E 1Q31A 1DUAA 3FP7E 1A1RA 1O3CA 1SLUB 1S5SA 1MQ6A 4FUFA 3BF6H 1V2UT 2FMJA 2PW8H 1HDTH 1DICA 1O3AA 1P05A 1ZJKA 4O97A 2H5CA 1NU9A 1SGRE 1O3FA 3MH5A 2VIQA 2OINA 1GHVH 1DXWA 4FUDA 3E8LA 3CS7A 1FXYA 3TPIZ 2FTMA 3ZZDA 1UK4A 4DIIH 2I6SA 2FTLE 1G3BA 3T5FH 2DUCA 2I6QA 2ZI2H 1IQIA 2H9EH 3ZZ9A 3BTEE 3RMLH 1XUGA 3EQ0H 2BDYA 2BD7A 1THRH 4KELA 1XM1A 4JK6A 2BXUH 2AGGX 2NU4E 3SUDA 1HIAA 3KQDA 2Q6FA 4INHA 5A0CA 1Y5BT 4FVDA 4AN7A 4MPXA 4I8HA 3KNXA 2BD2A 1A46H 3CS0A 1GJBB 2VB0A 2XXLA 1AD8H 2CXVA 2F9UA 3MFJA 1SBWA 4ZAEA 3TJNA 2OLGA 2C8XB 2G00A 1CGHA 1H9LB 2WV5A 4NIWA 4VGCB 3LIWA 2B9LA 2XBVA 1OWIA 1DS2E 3QTOH 3U1IB 1HAGE 2VH6A 1GMDG 5F8ZA 4LZ1H 5C5OA 1C5MD 3A89A 2F9VA 2D26C 1C4V2 3E16B 4ABIA 1C1WH 4DW2U 2TGAA 3H5CB 2VWMA 1C2IA 1AVWA 2VIWA 3ZVAA 5C20A 1Z8IB 2VVCA 2Z9IA 4OS7A 2OC8A 5TCCA 1JWTA 3SZNA 1UHBA 4BTUB 3ATWA 1TA6A 4X2YA 3RXIA 4AFUA 1TBQH 1XUFA 1O3HA 1KTTB 5DK1A 3I78A 2BDCA 2AMDA 1QCPA 4XFQA 1UTMA 2XC5A 5JBBS 2ZU4A 1FY3A 1MTVA 4ZKNU 4X6NA 3I29A 1L1JA 5DJ7A 2PKSC 1YPMH 7LPRA 4KP0A 3ATMA 3QZRA 2BOKA 1PPCE 1C5YB 1PYTD 1S0QA 3E6PH 1GI8B 1ANBA 3RXTA 4E06H 1VITH 4TY7A 1ELBA 1JOUB 1QA0A 3FFGA 2A5KA 1LPZB 2LIZA 1LDTT 1C5UA 1C9TA 1ZR0A 3PM3A 4FU9A 1MMJN 4X1RU 2F9NA 1SLXB 2Z3DA 3QTVH 1BJVA 1CA0B 2FI3E 3S9BA 2WV4A 1TMUH 4YLUA 3TITA 1QTFA 3U8OH 3SJKA 1YPKH 2BDGA 5E0HA 3ZYDA 3EDXB 2PKAB 3F1SB 2OQUA 4JCNA 1WUNH 2H6MA 4H42U 1N8OC 2ALPA 4ZKOU 1QRXA 5ETXA 1FIWA 1W7XH 1OWEA 4D8NA 1SGIB 2XTTB 1YPEH 4LZ4B 1QJ7B 1EPTC 3TJUA 2PV9B 4CRDA 1CGIE 3LONA 1BQYA 5DKMA 4KTSA 3AAUA 1KXCA 1J17T 1PYTC 5DP8A 2BD9A 1NS3A 4J1YA 3SV8A 1W10U 2OQ5A 2A31A 5F03A 5F8TA 2FLBH 1TABE 2A7CA 1T8NA 3GY7A 3T29A 1VCQA 1T32A 3SHCH 3LH1A 3ZV9A 2C93B 3QZQA 3PMBB 2FXRA 3LJJA 1F0TA 4D7GA 1O0DH 1CHGA 2AIPA 2VGCB 4GCHF 4YOIA 2VIOA 8KME2 1HJAB 3TK9A 3KN2A 1CBWC 2ZO3H 2F9PA 4YOGA 3ODFA 1LHFH 3GY4A 5C2ZA 1Q3XA 1LO6A 1DY8A 3FZZA 4MLFB 1A5HA 1MD7A 4D76A 1AGJA 2HPQH 1CHOF 1GWAA 2NWNA 3NXPA 1YPHE 3H7TA 1MU8B 2ANYA 2SNWA
chains in the Genus database with same CATH superfamily
5DO4H 5DPAA 1CT4E 1CVWH 3LT3A 2ZGBH 2R2WU 3MU5A 1H1BA 5HIZA 4ACBA 3F6UH 1V2NT 1C1QA 1HAIH 1WOFA 3TGIE 1PPFE 8GCHG 4FUGA 3CNRA 2ZTZA 4K3JA 3RXBA 5E2OA 5TJXA 4CRCA 1G36A 2W6ID 4I32A 1DSUA 3T25A 1C9PA 1O2YA 1W7GH 3SU4A 1QJ6B 2BTCE 4JZIA 1ID5H 4Y7BA 1TX8A 2Y80A 2WINI 1YCPK 4XBBA 1E1RD 1WQSA 3R3GB 1SGPE 1TB6H 4AFZA 3W95A 3VGCB 1ARBA 3P8GA 3QLPH 3STIA 2BQ7B 3LGTA 4O3TA 4X2VA 3WY8A 1LVMA 6GCHG 1QGFA 1KTSB 5DN6D 2SFAA 4BAOB 2A7HA 3DHKH 4AYVB 2FOFA 2GCTB 2RDEA 1BTWA 1T8LA 2JH0D 1VJAU 5B6OA 3S7HB 1F7ZA 5A8ZA 1PPZA 1DWEH 3A83A 3RXOA 4GUXA 1K28D 8ESTE 2ZPQA 1L2EA 1Y3WA 2PLXA 3U8TH 1CO7E 1JIMA 1ESTA 1YLDA 1RGQA 2P93A 1IQEA 5AFZH 1V2KT 1YPLH 1GBKA 1Y5AT 4UFEH 5ESTE 5DP4A 1V2PT 2GV6A 2PTCE 3WW7A 2YNAA 1EFRD 5I46H 3LJOA 5DP7A 2ULLA 4NIVA 3MH6A 4M9FA 1HAZB 1LHDH 1NRNH 5DP9A 2OC0A 2WPLS 1OP0A 2JJ1D 2WYJA 4Y0YE 4IGDA 1MCVA 2Z3EA 4JYTA 4ZMAH 3T26A 1KDQB 2B8OH 2EA3A 1ZMNA 2K1QA 1CE5A 4BAHB 3SV7A 2VIDA 1UVTH 1ZSJA 4ZKSU 4BTIB 4DT7B 1RIWC 3GY6A 5GCHG 3VFEA 1GVZA 3M3SA 3R0FA 1Z1IA 3AK5A 1Y5UT 1OWJA 2FOCA 2R3YA 4YO9A 1E1QD 2XBYA 2CHAC 4NFEA 2J98B 1C5NH 1NFUA 1NESE 1Y3YA 2YOLA 2FZZA 1UW7A 4JZ1A 1AZ8A 1PPBH 1NTPA 3UNSA 1D6WA 1SSXA 1O35A 3MH7A 1QL8A 4FXGH 4CRBA 1O2XA 2Q1JA 2Y81A 2BY8X 4DJZB 3V0XA 1MZDA 2TGPZ 4JZEH 2EI7A 1UTJA 5GPIB 3SGQE 1BMFD 1AUJA 4BXWA 3SV9A 5BRRE 2Y82A 1QB9A 2PUQH 1DX5M 3V3MA 3PLPA 2UWPA 1W13U 1C2KA 3FAOA 4TPYA 2G4UA 1O5BB 1DM4B 2H5DA 4NFFA 6CHAB 3MU8A 4NA9H 2VNTA 2GZ8A 3MNSA 1GG6B 2K0QA 3Q77A 1GHXH 3LGWA 1ELFA 2AMPA 3UIRA 1FY1A 1HIAB 1KLIH 1DXPA 4VGCC 2V3OH 5FX6A 1SVPA 1FNIA 2B0FA 4IN1A 1QY6A 1YM0A 1F5LA 1ELCA 1O3NA 1N6XA 2V3HH 3TIUA 1QBVH 2BVXH 1F0UA 2XNDD 4RN6A 4K5ZA 3ZYEA 1LKAA 2QGRA 2SGDE 4UE7H 2ALVA 1SGTA 1YY3A 3OTJE 5DGJA 1EATA 1P2OA 1XVOA 2ZGJA 3GY2A 2HGTH 2V7QD 4WVPE 3FKSD 2NU2E 3O8BA 1P12E 5AHGH 1CA8B 2YNBA 2OTVA 1D3PB 4YESB 3A86A 4OS4A 2O8UA 1LQEA 3BIVH 1RD3B 5C3NA 1JXPA 2OD3B 1CGJE 1TONA 4OS6A 5FXLA 3LPRA 1OYQA 1QFKH 2JIZD 1BBRH 3PMJA 1HAXB 3MO3A 1WBGB 4TPIZ 2WUBA 1TNIA 1GI0A 2BD3A 1QR3E 3BEIB 3FOAA 4FUBA 1O3OA 1SC8U 1QRZA 3F0PA 1P2IA 5JBAS 5JYIA 3KF2A 2HNTF 3GCOA 3E0NB 2UUKB 1UHBB 4XBCA 1MKWK 4OM9A 5EOKA 1CU1A 1TFXA 1W0JD 3KQ5A 2Z9KA 4Y8YA 5KECA 1QJ1B 2GVFA 1AY6H 2GT8A 3LDXH 5B6LA 1DFPA 1NO9H 1KXFA 2K8IA 1C4Y2 4BTTB 4DT4A 3PTBA 3U28C 3A80A 3SBKA 2BDAA 5FHTA 2ZFPH 1WTHD 2SGPE 1EP5A 5TCAA 3SNDA 1HJ9A 3HK6B 1NFYA 1OOKB 2QY0B 2ZECA 1MTUA 3BG4B 2G8TA 2DE8A 3A84A 2BLOA 3BIUH 4K8BA 1GHWH 1HGTH 1A0HB 2EI8A 4NA8A 4B2BA 4Y76A 1HBTH 3ZZAA 3EE7A 1MTSA 1K1PA 2C90B 1MD8A 3LH3A 1V2RT 3ZIAD 4MNXA 3F3BA 1AUTC 4IBLH 1NRRH 5AFYH 2OBOA 1TGCA 2TIOA 3GISB 1Z1JA 1C5OH 3T27A 1ELEE 1LVOA 2K7XA 4NSYA 1TIOA 1P01A 4BAQB 2CMYA 2PWXA 3TVJB 3BV9B 3MYWA 3JZ1B 3P92A 2H2ZA 3SU5A 1C1OA 3NZIA 1VGCB 1YBWA 1O2KA 2G4TA 3L33A 3FZDA 4K1TA 2WPMS 3RU4T 3U9AH 2FODA 1P57B 1GI4A 4IN2A 1CT0E 1P3EA 1V2TT 4ZKRU 3MQKC 1K0HA 2XW9A 3A7XA 2ESTE 1KYNA 5EODA 1NY22 1AMHA 2Y5FA 4I8KA 4SGBE 5FBIA 3SV2H 1Y8TA 1SQRA 1ELTA 2VWNA 4MPWA 4I8LA 4NCYA 1W0ZU 3A8AA 1QQ4A 1TWXB 4DIHH 1HJAC 3H7OA 2J34A 1SB1H 2FEQH 2W7UA 3PO1B 1O5DH 1P8VC 3SNBA 1FPHH 3VEQB 1O3EA 1C1VH 1SOZA 1E0FD 2WSSD 5KGOA 1GMHF 2ZP0H 3ZVFA 2FYQA 3Q76A 1FDPA 2RDLA 1DPOA 4TT3D 5FL7D 1TOCB 4BNRA 1GBLA 4HTCH 1XUJA 4XDEA 5K7RA 2F9BH 3SN8A 1G2MA 3SYJA 4B1TA 4F48B 2GX4A 4Y8ZA 1GMCF 1AVXA 1AB9B 3RXQA 2ZQ2A 2ZFQH 3QDZB 2BD8A 3BTHE 4MVNA 4YLQH 2A5IA 1D3QB 1GI1A 1NU7B 3LGYA 2XRCA 1O30A 3VXEH 1IHSH 2ZZUH 2GT7A 1GMHG 4A5TS 3SJ8A 2ZHEH 1RRKA 2STBE 1MKXH 2ZTYA 5H4IB 2ZU3A 3VB5A 2PTNA 1JBUH 4ISOA 1HXFH 4WJG2 3BEFB 4B2AA 3PLBA 2L74A 3ESTA 2GMTC 3PRDA 4X2WA 1NRQH 1XUKA 1BIOA 1GMDF 3EGKH 2GZ7A 2Y5HA 1GMCG 3IG6B 4JYUH 1TPPA 1LTOA 4QT8C 3T2NA 1V2VT 2Z9GA 2ZDNA 6LPRA 1PPEE 5CHBA 1GBMA 2KCPA 2P8OB 1S82A 2BVSH 2A0QB 4R8TB 3VB3A 1HAPH 1J15A 5EXLA 1H8ED 1ZTLA 5A2MH 1OP8A 3S0NA 1QB6A 3MI4A 1LHEH 1BOQA 2XBXA 4UFFH 1IAUA 1EPTA 2YMSB 1ELGA 2ZTXA 4CH8B 2AIQA 3H09A 5FPTA 2W3KA 1JIRA 4M7GA 2A45B 4ZCNA 2BLVA 1YPJH 3K9XB 3TNSA 1GBFA 3ATIA 2WYGA 2THFB 3DT0H 4AFQA 3P8OA 1BRCE 4HI3A 3KCGH 2OXSA 1O3KA 2BXTH 2XBWA 1PQ8A 3RXUA 2ZFRH 4SGAE 1WDIA 3E91A 2XYAA 1Q2WA 1BA8B 3A82A 5HXFA 3QO6A 3UB0A 1TNKA 3RMMH 1BCUH 3EA9A 1W11U 5LPEA 1MCTA 1TE0A 2OC7A 2XWBI 2Y7XA 1O5GH 1TYNA 3LC5A 1TMTH 4K1EA 2OCVB 1G30B 4ASHA 2JJ2D 2P3TB 4LXBH 5HMAA 2O8TA 1Z8JB 3PTNA 1A0LA 3QN7A 3ZVGA 3EA8A 3Q3XA 4RT0A 3SI4H 4GHQA 1QNJA 3RDZA 2W5EA 1HJ8A 4X6OA 1HV7A 1QIXB 2DE9A 2XC0A 1GGDB 9ESTA 1GDUA 1BMLA 3SGAE 3SJOA 1E37B 5C0UA 3M5LA 2AFQB 3PB1E 1AFQB 1RXPA 2QAAA 1TALA 3UREA 1HCGA 2G51A 2ZDKA 1MBMA 1LQDB 3N7DA 1COWD 4KTUA 1GVKB 1EUFA 1SPJA 1EOLA 4RI0A 1AIXH 1P11E 1SQTA 2WPIS 3F9FA 1C5QA 2GCHF 1G2LA 2ZF0H 4K60A 1TNLA 3C1KA 1GHAF 1C1TA 1FN8A 4WH6A 1O3MA 1C5VA 2R3UA 5HM2A 4A92A 1DLEA 1O2WA 5EXNA 1XKBC 4JYVH 1JRSA 2Y5GA 3VXFH 2CGAA 2P59A 3S9AA 1B0FA 1XXFA 3PLKA 1AKSA 2C8YB 1C5TA 2O8WA 4KGAA 2P3UB 4JK5A 1LPKB 1K1MA 3M5NA 2QXJA 3GY5A 5G4BA 3MO6A 1GCTC 2FOBA 2O8MA 2BD5A 3OYPA 3VPKA 4NA7A 3RXVA 3P8FA 5CHAB 1LMWB 1TGSZ 2GCHG 2KFWA 5JB9S 5F53A 1TGBA 1GHAG 2L6OA 1BHXB 1EKBB 3IITA 3PROA 2ZGHA 3DD2H 1H8IH 4J2YB 5SGAE 4X1SU 4I7YH 4TSFD 2HRVA 2Z6BD 2QC2A 1S84A 1G3EA 1A61H 2HNTE 1TNGA 1O3BA 3RU4E 2RA3A 1QA7A 1K22H 3FVFB 4CR9A 2KZ4A 3M61U 1PQAA 1V3XA 1FIZA 4DCDA 5CMXH 4D7FA 1O31A 1GJ7B 2G81E 1O38A 5C1XA 3SU0A 2ZC9H 3EYDA 3DSOA 2VIPA 3ZZ6A 1Z8GA 8GCHF 1TBRH 1BHXF 3BTME 1DOJA 4Z0KA 3ZZ3A 3A7TA 2EI6A 3GY8A 4ABFA 5L30H 4E7NA 2ODQA 4CH2B 2ZGXH 1YKTA 2ANMH 2STAE 2G5NA 3A8CA 4TWYA 1TPSA 2A2QH 3QGNB 4F55A 1YPHC 1GDQA 2VJ1A 4XE4A 4K2YA 2IJD1 1B5GH 1K9OE 2J2UA 1TGTA 3DCLA 1O3JA 1AVGH 2SGAA 1A3EH 2BZ6H 1BTZA 3A7WA 1GDNA 1SFIA 5GWZA 1O3PB 6GCHF 1P03A 3GCHB 5JB8S 1GBBA 1SGFA 1SGQE 3DFJA 2JDID 4NG9H 1UCYE 1XUIA 1U6QA 1G3CA 2JH6D 2QV1A 3A87A 2A32A 1BTXA 1FQ3A 1P9UA 3MNCA 1YC0A 2AGIX 1FJSA 1LHCH 1IQHA 1JMOH 3GCNA 1BTHH 3DA9B 5A8YA 1VITF 2GD4B 3ZZCA 1C5WB 4HG6A 2ZA5A 2O9QA 3F68H 3UAIC 4UONA 1IHTH 5A09A 1S6FA 1GJ5H 1C5ZB 2TBSA 1O2MA 1M9UA 3D65E 3UWJH 3M36A 4Q7XA 6ESTA 1V2QT 3M7UA 1OWHA 1FY4A 1Z71A 1QL9A 2FI5E 1P09A 1ZHRA 1MU6B 5C17A 1GJ9B 2W3IA 3SNAA 2KCOA 5EG4A 3RXDA 2VIVA 2ZGCA 3E0PB 1BT7A 1VITG 5BPEA 1ANDA 2WPKS 5GCHF 5EU8A 3RLYH 1OSSA 3RC5A 3W94A 1ZOMA 1FAKH 4NIYA 1D3DB 4B75A 1A7SA 1SMFE 4ZHLU 4NZLA 3SORA 1L1NA 4A1VA 2HALA 1GJ8B 3ZVBA 1O34A 1J14A 1XVMA 1EAWA 3LGUA 1SL3A 1G32B 3TGKE 1FMGA 1S81A 1EX3A 1UTOA 1GJ4H 1CT2E 1HXEH 4WF8A 1P06A 4CHAC 4AG2A 3A85A 2M2AA 2TPIZ 2IJOB 1ESBA 3RXGA 5GNDA 4CBOA 1O2UA 1MH0A 2FOHA 1EASA 7GCHG 4K1SA 2ZKSA 4LOYH 1WQVH 1HAVA 1O5AB 1G9IE 1MTNB 1FPCH 3JZ2B 1UJ1A 3LKWA 3RXFA 1P2NA 3SQHE 2FOGA 2KCAA 5KEDA 3P95A 2XC4A 3KIDU 1SGCA 4MNWA 1EZSC 2TRMA 2J95A 2A5AA 1MBQA 2BOHB 2ZQ1A 1A5IA 1XMNB 5EGMA 5LPRA 1O2LA 1RFNA 1NC6A 3MU4A 2P16A 3ODDA 2AS9A 1SQAA 3A7YA 1O2OA 2ANWA 4BXSA 1F5RA 2AERH 3GCTG 2PKSB 3UOUA 1UVPA 2LELA 4ZXXH 1AQ7A 1OS8A 3MU1A 4GAWA 1DANH 1TPOA 3A8BA 1ZYOA 1C5PA 1EAUA 1T31A 4Y6DA 1RTLA 3E3TA 1DDJA 1V2JT 3VB4A 1EQ9A 3RXPA 1ELAA 2G55A 4WWYA 1OKXA 1MAXA 4I86A 4TWWA 1T4VH 2XNIA 1V2ST 5FPSA 1UCYH 2V35A 1SGEE 1YGCH 4DG4A 1P2JA 1SLVB 3GY3A 3VB7A 1C5RA 2D2DA 5IDKA 2BY7X 3GOVB 2OC1A 3GYLB 1C1NA 4DGJA 1FY5A 2YMSC 2IOTA 1GCDA 1GJAB 1QHRB 1W0YH 4AX9H 2GZ9A 1T7CA 1VKYA 3M3TA 2F91A 1GI6A 1K2I1 2FPZA 1YPGH 2V6NA 2VWLA 1ABIH 1O37A 4A1TA 1ZGIA 2FLRH 2CK3D 2ANKH 1BB0B 1NM6A 1YYY1 3KL6A 1N8OB 4Q7YA 3D62A 3I77A 3RXMA 1B7XB 1F92A 2QN5T 1FV9A 1AHTH 2AGEX 3W1EA 1EPTB 3ZZ8A 2ILNA 5EPYA 5CDFE 1ZZZA 4FOUC 1DVAH 3WWFA 1BMAA 4I33A 2RCEA 1YF4A 4FUEA 2PSYA 1P0SH 1C1UH 3AW0A 3BTFE 1PJPA 4FUHA 4K69A 5CE1A 3S7KB 1SI5H 1GJDB 1ACBE 1ANCA 1HRTH 1RJXB 2Z3CA 1WU1A 3RXLA 1O2SA 1C2GA 2RG3A 3K2UA 3O8DA 3OU0A 1ETTH 5HIYA 2JETB 3M3VA 3F2GA 1G3DA 1QQUA 1AFQC 1VJ9U 1JRTA 2UUFB 3RC4A 4O03A 3T28A 1O5CB 4AYYB 3RXEA 1GBJA 1NN6A 4XOJA 3SUFA 1ZGVA 5ABWA 1AO5A 1BBRK 2AYWA 1DWBH 5T6GA 4ABEA 5C1UA 4X8UH 3D23A 1O39A 1EAIA 3SNEA 1CA0C 1TRMA 4BAKB 3F2FA 4X6PA 4DVAU 1BMMH 3UFAA 4X8VH 1AZZA 1SLWB 3E90B 3STJA 1MTWA 3RP2A 1KMHB 5LGOA 3LU9B 4DOQA 1EOJA 3SUGA 3TNTA 1PQ5A 1H8DH 1ELDE 2HVYB 4OS1A 1H9HE 1SGNE 3PWBA 1KXAA 3A7ZA 1K1LA 2BDHA 2XWAA 3KHVA 3OFND 3DUXH 1C2FA 3GICB 1F2SE 2FOMB 2F43B 5T6DA 3V12A 1G37A 1UTQA 3SU3A 4ISLA 4Z6AH 5J4SA 1NFWA 5EXMA 4GHTA 3BTTE 2P3FH 2KCYA 4OS2A 4ABDA 3OSYA 3MU0A 1ZPBA 1FAXA 1MZAA 1AKSB 4AZ2B 2PGBB 1UTLM 2SGEE 1C2LA 2EC9H 2BY9X 1A2CH 2XCNA 2J9NA 4UEHH 1DE7H 3TH4H 2PGQB 5FAHA 5JDUB 4ABBA 1NRPH 4I8GA 2GDEH 4U2WA 2VGCC 4JZFH 1FI8A 2ZU2A 4DURA 4B2CA 2O8LA 2OP9A 2ZCLP 4B6FA 1P2KA 2P94A 2FO9A 4ZH8A 4FU8A 1TLDA 3SU6A 3ZVDA 2BDBA 3OEED 3ZVCA 1FN6A 5FBEA 3S69A 4H6SB 4AFSA 1P04A 2IPHA 3K6YA 4X2XA 2R9PA 1RTKA 3NK8A 5E2PA 3AVZA 2C4FH 4F49A 2ZDVH 3QX5H 2J98A 3A7VA 3UY9A 1INCA 1IOEA 3P8NA 3G01A 1A4WH 3RC6A 3A8DA 2ZPSA 2ZHDA 5EW2H 3KEEA 2KAIA 1FONA 1VCPA 3VB6A 1DT2A 4MDSA 3DFLA 3F0OA 2JH5D 1V2LT 1UK3A 3OAAD 1KY9A 1CSOE 2HWLB 1RIWB 3DSGA 3RXAA 3ZZBA 1ZJDA 1C2MA 3MNXA 3U69H 3TH3H 1QBOA 1TNJA 3ZZ4A 1LVBA 4Y8XA 1OX1A 1AI8H 2AMQA 1ANEA 1P02A 2CHAB 3B8JA 3ZVEA 4NSVA 1IQLA 1ZRBA 2NU1E 3ATLA 1PPGE 3LGVA 3DSPA 4X8TH 3VGCC 5DP3A 3KQEA 5C5NA 1UTPA 1ZMLA 2H9HA 4CRAA 2Z94A 2FOAA 1YP9A 1BMNH 1HAOH 1L4ZA 4X1NU 3SV6A 2ODPA 2GCTC 1VR1H 2HVXA 3E1XB 1K1NA 1OYTH 3TLOA 2SNVA 8LPRA 3QGJA 4ESTE 3TU7H 1F5KU 2V3MA 1UK2A 4O3UA 1O2HA 2ZHQH 3EA7A 1LVYA 1S85A 3M7QA 1MKXK 1A0JA 1OPHB 3HK3B 5EQSA 5GXPA 1O36A 3D49H 3PWCA 1D3TB 3O8CA 2FI4E 2VWOA 4AB9A 4IW4E 1C1PA 4AOQA 1GBIA 3M5MA 4BAMB 1S0RA 2CF8H 2VBCA 5GIBA 4Q80A 3M7TA 1O2NA 1PPHE 4ABHA 5F8XA 2QXGA 4ISIH 3BTGE 1HUTH 2BDIA 4GSOA 4I8JA 2BQWB 4ZROA 1GI3A 1MUEB 2G5VA 1HLTH 1DITH 4RSPA 3UQVA 1N1LA 1DUEA 3LGIA 1GL1A 1TQ7B 2R0KA 3RMOH 5L2YH 3MHWU 1SGFG 1Z6EA 1W14U 1QRWA 1AN1E 1SHYA 3FP6E 4MNYA 1MTNC 2UUJB 1IQNA 1LKBA 1AWFH 3URCA 4NIXA 3V13A 1HAYB 1GHBF 2PR3A 5E0JA 1GJCB 3L3TA 4E7RG 3BTDE 4U01A 2F83A 2G52A 1EJMA 3BSQA 4KTCA 4LK4A 4YT7H 2D1JA 4TYDA 3O8RA 1TGNA 1AFEH 2ZCKP 1ETRH 4NWKA 1HAHH 1BRBE 1ZPZA 2ODYB 2PUXB 4YT6H 4MTBA 1YCPM 2GGVB 3RU4D 2PFEA 1OWDA 3S9CA 1FY8E 1HAVB 2FIRH 3RXHA 3U8RH 5C67A 4H4FA 3UPEA 5EQRA 1HFDA 2SGFE 2WV9A 3KQCA 2GDDA 1BDAA 4JMYA 2FM2A 5FCKA 1CQQA 1KXBA 1EJNA 2AEIH 6CHAC 3T62A 1XKAC 1GHBG 1L1GA 1O3DA 1GI9B 1TBZH 2ZHWH 5C94A 5F6MA 1XUHA 2GP9B 1YLCA 3F9EA 1ZTJA 1ETSH 1MAYA 3MO9A 5E0GA 5EJ1A 1GG6C 1BTYA 4X1PU 1NPMA 1KXEA 4Y0ZE 2BD4A 3P70B 3TK6A 1L0ZA 4YZUA 5GDSH 1J9CH 4AG1A 5PTPA 2CJIA 1EZXC 2CF9H 3LOXA 3TGJE 4INKA 3V7TA 3HATH 4RKJB 1E35B 1IQJA 1W12U 3N7OA 3OX7U 3TJVA 3OY6U 2LNCA 4H6TA 1W3CA 2BLWA 1BZXE 2BY6X 2ZPRA 4X6MA 1SGDE 4UDWH 1AE8H 1C5XB 3GYMA 2A4QA 2QF4A 1WAYB 4AC9A 2FX4A 2TGDA 3ITIA 1C4U2 5FCRA 2ASUB 2A4OA 1ABJH 5A8XA 1Z7KA 2HNTC 4XD7D 1GBTA 4KKDA 4YM9A 1A5GH 4THNH 1K21H 2B5TB 5DP5A 5DP6A 3EAJA 4WY3A 1P3CA 2OUAA 2OK5A 2QF5A 4CBNA 1TMBH 2C8WB 2D8WA 2UWOA 3K65B 1E79D 5E8EH 1SG8B 2RA0A 2NU0E 2WUCA 2GV7A 3QK1A 1DLKB 4K8YA 1UTKA 1D9IA 2ZDLA 4Y79A 1EZUC 2QCYA 3FO8D 1UTNA 2VH0A 3PRBA 1WSSH 3UR6A 3GDUA 2HOBA 1EB1H 1UVUH 2AHME 4UFGH 3VG8A 4Q7ZA 1L4DA 1BITA 2BVRH 2V0BA 3MMGA 1ESAA 1LCYA 2JETC 1C1RA 1BRUP 4X0WU 3SHAH 1NFXA 4FUJA 3WWBA 4PROA 3HPTB 3P17H 1NRSH 2P95A 4GPGA 2EEKA 1O2VA 4WXVA 2H1UA 1KLJH 4AORA 5T3HA 1QURH 3BG4C 4YTAA 4BANB 1YCPH 1KXDA 3PMHB 4UD9H 3CENA 3KGPA 2Z7FE 2BB4A 4OGYA 4A7IB 3F9HA 4FUIA 2F9OA 3C27B 3SW2B 4BOHA 1GI5A 3SU2A 3U98H 2Q6GA 1A3BH 4GCHG 1AU8A 2VU8E 1SQOA 1BUIA 3B9FH 3MTYA 1SHHB 2A1DB 1WCZA 2J94A 3PMAB 2ZFTA 1GHZA 1ZSLA 1O3GA 3SU1A 1HPGA 2UWLA 4GVUA 1WTGH 4FETA 5IYTA 3TK5A 5HGGA 5T6FA 3L6PA 1VGCC 5DSFA 1ZHPA 1CHOG 1BTPA 1UVSH 5I25A 1F0RA 1NBME 2A4RA 2VINA 4HFPB 5HM9A 3UTUH 1E36B 1AWHB 5A0BA 2GMTB 1TX6A 2GTBA 1NT1A 2ZDMA 3RXSA 2VVVA 2J4IA 3SO3A 1V2WT 7GCHF 2PHBA 5JBCS 3BTQE 5EQQA 3PYHA 2WHXA 3GDSA 1NROH 3ATKA 4O9VA 1DWCH 1WYKA 3MWIU 1UVOA 2ZEBA 2IPQX 3U1JB 5FPYA 2BMGB 2KR7A 4Y10E 1GI7B 3TH2H 2ZG0H 3PO1C 3UUZA 3UNRA 5ESBA 3OY5U 1O2GH 1FLEE 1C2DA 1BBRE 3BEUA 1O2PA 1W8BH 4WXIA 1Y3UA 3ELAH 7ESTE 2FYRA 4GLYA 2H9TH 1IQGA 1O3LA 2FS8A 3K6ZA 1C2JA 1UMAH 1W2KH 3QUMP 4ABJA 1TQ0B 2KM0A 2ZFSA 1F0SA 3ENSB 1GPZA 3GCTF 4ISHH 4B74A 2YMSD 1D6RA 2QYIA 2CV3A 1C1SA 3RLWH 4INLA 2IN2A 1TRYA 1HB0B 1TNHA 4MG3A 3SZEA 1AB9C 1C2HA 2HLDD 1T4UH 4AGKA 3IWMA 3CP7A 1EXFA 5LPFA 1TRNA 2HLCA 1NZQH 4B71A 4OGXA 2J5UA 1ARCA 3AW1A 1ZPCA 1Z8RA 2CN0H 4MPUA 1ORFA 2C3SA 5JBTA 2FWWA 2BX4A 4AB8A 4MQAA 3BG8A 1Z6JH 5T1VA 1XXDA 1MQ5A 1SR5C 3SGBE 1Y59T 2B7DH 2BY5X 1EJAA 1ZMJA 2Y6TA 4Q2KA 1YWUA 3RM0H 4B6EA 1FZZA 1QB1A 4F4OC 2FP7B 3Q3KA 1BTUA 3F2HA 1O32A 1GBHA 1O2IA 4TY6A 4IC5A 1O3IA 1S6HA 2KAIB 2Q6DA 2BLQA 5K0HA 4WMEA 5DG6A 4ZUHA 1QL7A 2P8OC 4Y7AA 2PKAA 2NU3E 5LH8A 1QBNA 1FUJA 2A2XH 2LPRA 1IQMA 4WMDA 4CR5A 4DY7B 1KLTA 1GHYH 3KQBA 4ABGA 3M5OA 4U30A 1H4WA 1XX9A 1HNEE 5L6NH 5EIYA 1PQ7A 3GDVA 4X1QU 1RTFB 3UOPA 1GL0E 1Y3VA 3SI3H 1IQFA 2F3CE 4CRGA 2BHGA 1DSTA 5HYOA 4I31A 1EAXA 1GVLA 2ZDAH 4WH8A 1ELVA 1P2MA 1EB2A 4CRFA 4D9RA 3HGNA 4XBDA 3SUEA 4XSKU 2QF3A 1EP6A 2M5TA 4RKOB 1D4PB 1KSNA 1UCYK 1GJ6A 4HZHA 5FX5A 1ZRKA 1ZLRA 1GBDA 1GCTB 3ZZ7A 5GJ4B 2UUYA 1TAWA 4NGAH 2A7JA 1O2JA 5AVDA 1BJUA 2QF0A 3HGPA 4B73A 1E38B 7KMEH 3NUMA 2FESH 2R2MB 4IMZA 5AF9H 3BTWE 4ACAA 4ZXYH 1MABB 3NKKA 3ZV8A 3M37A 2Y7ZA 3MNBA 3AASA 1X7AC 1MKWH 3Q3YA 3EBNA 1THPB 2TGTA 3PV2A 4MPVA 4WMFA 2W6JD 3FN8A 5EPNA 1RS0A 2W26A 3SQEE 3B23B 3RUOA 4CREA 1GGDC 1SOTA 3TJOA 1GBAA 4B76A 1DY9A 1O2QA 1N6YA 3RMNH 1FX0B 3HKIB 1VCWA 3P6ZB 3UQOA 4FU7A 4ABAA 1BRAA 2Z9LA 1CBWB 5EJLA 1TOMH 2ZFFH 4UFDH 2VVUA 1OP2A 1K1OA 2BYAX 5HKKD 2GKVE 3FP8E 2HPPH 2JKHA 4R0IA 3NPSA 4ZHMU 4P02A 4FVBA 1J8AA 3BTKE 3MOCA 2ZCHP 2ZIQH 2BZAA 1UO6A 1PFXC 4Y71A 1ZSKA 4OS5A 1P2QA 1C2EA 3URDA 3ZZ5A 1O2ZA 1P9SA 1THSH 2BX3A 3PV5A 1WXRA 1EZQA 3F9GA 5EW1H 1OXGA 1VZQH 2XCFA 1HYLA 3UNQA 1AE5A 4ZHAA 3RM2H 3A88A 1Y3XA 1C5LH 5JPMH 4JZDH 1P10A 2OBQA 3EE0B 5CHAC 9LPRA 4Y11E 3A81A 1LPGB 2PSXA 3MH4A 1V2MT 1OWKA 1GBCA 1H9IE 4U32A 3Q00A 2RFKC 4NZQA 2EQNA 3NCLA 3NWUA 1C1MA 2J92A 4IS5A 2FX6A 4A1XA 3OEHD 2J38A 2ZU1A 3UWIA 1K1IA 2FDAA 2WPHS 4E05H 1O33A 1KIGH 5A0AE 1O5FH 5L2ZH 1SGYE 2ZNKH 4AGJA 2QXIA 1GI2A 3SNCA 4NWLA 2Z9JA 4MNVA 3RXCA 5EJZA 1DWDH 4RT1A 4HGCA 1GBEA 4FUCA 1WV7H 3QWCH 2SGQE 2XOKD 3BN9A 2QIQA 2FS9A 2ZWLH 4A6LA 2A4GA 2W7SA 5J4QA 1ZHMA 3FANA 2ZU5A 4IMQA 2BM2A 3HKJB 1T8MA 1J16A 3PV4A 1S83A 1IQKA 3RXKA 1KDQA 4YOJA 3SJ9A 3UR9A 3GS9A 4X8SH 4IC6A 1O2TA 1SFQB 1O2RA 2R0LA 3SJIA 2ZHFH 4ISNA 1YLNA 3NRLA 1TX7A 4D9QA 1TPAE 1O5EH 3RXRA 3RXJA 1V6DA 1B0EA 2AH4X 1C5SA 1K1JA 2C8ZB 3AAVA 1QZ8A 2FOEA 3SOSA 3GCHC 2QXHA 1E34B 2WPJS 4CHAB 5C1YA 1LHGH 3LC3A 1TA2A 2BQ6B 1ZTKA 1T8OA 1V2OT 3M35A 2QA9E 1Q31A 1DUAA 3FP7E 1A1RA 1O3CA 1SLUB 1S5SA 1MQ6A 4FUFA 3BF6H 1V2UT 2FMJA 2PW8H 1HDTH 1DICA 1O3AA 1P05A 1ZJKA 4O97A 2H5CA 1NU9A 1SGRE 1O3FA 3MH5A 2VIQA 2OINA 1GHVH 1DXWA 4FUDA 3E8LA 3CS7A 1FXYA 3TPIZ 2FTMA 1SKYE 3ZZDA 1UK4A 4DIIH 2I6SA 2FTLE 1G3BA 3T5FH 2DUCA 2I6QA 2ZI2H 1IQIA 2H9EH 3ZZ9A 3BTEE 3RMLH 1XUGA 3EQ0H 2BDYA 2BD7A 1THRH 4KELA 1XM1A 4JK6A 2BXUH 2AGGX 2NU4E 3SUDA 1HIAA 2EY4C 2LP6A 3KQDA 2Q6FA 4INHA 5A0CA 1Y5BT 4FVDA 4AN7A 4MPXA 4I8HA 3KNXA 2BD2A 1A46H 3CS0A 1GJBB 2VB0A 2XXLA 1AD8H 2CXVA 2F9UA 3MFJA 1SBWA 4ZAEA 3TJNA 2OLGA 2C8XB 2G00A 1CGHA 1H9LB 2WV5A 4Q63A 4NIWA 4VGCB 3LIWA 2B9LA 2XBVA 1OWIA 1DS2E 3QTOH 3KYFA 3U1IB 1HAGE 2VH6A 1GMDG 5F8ZA 4LZ1H 5C5OA 1C5MD 3A89A 2F9VA 2D26C 1C4V2 3E16B 4ABIA 2GJGA 1C1WH 4P00A 4DW2U 2TGAA 3H5CB 2VWMA 1C2IA 1AVWA 2VIWA 3ZVAA 5C20A 1Z8IB 2VVCA 2Z9IA 3N99A 2OC8A 4OS7A 5TCCA 2J97A 1JWTA 3SZNA 1UHBA 4BTUB 3ATWA 1TA6A 1OHHD 4X2YA 3RXIA 4AFUA 1TBQH 1XUFA 3KYGA 1O3HA 1KTTB 2F4LA 5DK1A 3I78A 2BDCA 2AMDA 1QCPA 4XFQA 1UTMA 4Z1MD 2XC5A 5JBBS 2ZU4A 1FY3A 1MTVA 4ZKNU 4X6NA 3I29A 1L1JA 3OTPA 5DJ7A 2PKSC 1YPMH 7LPRA 4KP0A 3ATMA 3QZRA 2BOKA 1PPCE 1C5YB 1PYTD 1S0QA 3E6PH 2PP6A 1GI8B 1ANBA 3RXTA 4E06H 1VITH 4TY7A 1ELBA 1JOUB 1QA0A 3FFGA 2A5KA 1LPZB 2LIZA 1LDTT 1C5UA 1C9TA 1ZR0A 3PM3A 4FU9A 1MMJN 4X1RU 2F9NA 1SLXB 2Z3DA 3QTVH 1BJVA 1CA0B 4Q4LA 2FI3E 3S9BA 2KX4A 2QE7D 2WV4A 1TMUH 4YLUA 3TITA 1QTFA 1S6LA 3U8OH 3SJKA 1YPKH 2BDGA 5E0HA 3ZYDA 3EDXB 2PKAB 3F1SB 2WPDD 2OQUA 4JCNA 1WUNH 2H6MA 4H42U 5C0TA 1N8OC 2ALPA 5IK2D 4ZKOU 1QRXA 5ETXA 1FIWA 1W7XH 1OWEA 4D8NA 1SGIB 2XTTB 1YPEH 4LZ4B 1QJ7B 1EPTC 4XRNA 3TJUA 2PV9B 4CRDA 1CGIE 3LONA 1BQYA 5DKMA 4KTSA 3AAUA 1KXCA 1J17T 1PYTC 5DP8A 2BD9A 2WZQA 1NS3A 4J1YA 3SV8A 1W10U 2OQ5A 2A31A 5F03A 3N7EA 2FLBH 5F8TA 1TABE 2A7CA 4YXWD 1T8NA 3OE7D 3GY7A 1NBMD 3T29A 4ASUD 1VCQA 1T32A 3SHCH 3LH1A 3ZV9A 2C93B 3QZQA 3PMBB 2FXRA 3LJJA 1F0TA 4D7GA 1O0DH 1CHGA 2AIPA 2VGCB 4GCHF 4YOIA 2VIOA 8KME2 1HJAB 3TK9A 3KN2A 1CBWC 2ZO3H 2F9PA 4YOGA 3ODFA 1LHFH 3GY4A 5C2ZA 1Q3XA 1LO6A 1DY8A 1W0KD 3FZZA 4MLFB 1H8HD 1A5HA 1MD7A 4D76A 1AGJA 2HPQH 1CHOF 1GWAA 2NWNA 3NXPA 1YPHE 3H7TA 1MU8B 2ANYA 2SNWA
chains in the Genus database with same CATH topology
5DO4H 5DPAA 1CT4E 1CVWH 3LT3A 2ZGBH 2R2WU 3MU5A 1H1BA 3F6UH 1V2NT 1C1QA 1HAIH 1WOFA 3TGIE 1PPFE 8GCHG 4FUGA 2ZTZA 4K3JA 3RXBA 5E2OA 5TJXA 4CRCA 1G36A 4I32A 1DSUA 3T25A 1C9PA 1O2YA 1W7GH 3SU4A 1QJ6B 2BTCE 4JZIA 1ID5H 4Y7BA 1TX8A 2Y80A 2WINI 1YCPK 4XBBA 1WQSA 3R3GB 1SGPE 1TB6H 4AFZA 3W95A 3VGCB 1ARBA 3P8GA 3QLPH 3STIA 2BQ7B 3LGTA 4O3TA 4X2VA 3WY8A 1LVMA 6GCHG 1QGFA 1KTSB 2SFAA 4BAOB 2A7HA 3DHKH 4AYVB 2FOFA 2GCTB 1BTWA 1T8LA 2JH0D 1VJAU 5B6OA 3S7HB 1F7ZA 5A8ZA 1PPZA 1DWEH 3A83A 3RXOA 4GUXA 1K28D 8ESTE 2ZPQA 1L2EA 1Y3WA 2PLXA 3U8TH 1CO7E 1JIMA 1ESTA 1YLDA 1RGQA 2P93A 1IQEA 5AFZH 1V2KT 1YPLH 1GBKA 1Y5AT 4UFEH 5ESTE 5DP4A 1V2PT 2GV6A 2PTCE 2YNAA 5I46H 3LJOA 5DP7A 2ULLA 4NIVA 3MH6A 1HAZB 1LHDH 1NRNH 5DP9A 2OC0A 2WPLS 1OP0A 2WYJA 4Y0YE 4IGDA 1MCVA 2Z3EA 4JYTA 4ZMAH 3T26A 1KDQB 2B8OH 2EA3A 1ZMNA 2K1QA 1CE5A 4BAHB 3SV7A 2VIDA 1UVTH 1ZSJA 4ZKSU 4BTIB 4DT7B 1RIWC 3GY6A 5GCHG 3VFEA 1GVZA 3M3SA 3R0FA 1Z1IA 1Y5UT 1OWJA 2FOCA 2R3YA 4YO9A 2XBYA 2CHAC 4NFEA 1C5NH 1NFUA 1NESE 1Y3YA 2YOLA 2FZZA 4JZ1A 1AZ8A 1PPBH 1NTPA 3UNSA 1D6WA 1SSXA 1O35A 3MH7A 1QL8A 4FXGH 4CRBA 1O2XA 2Q1JA 2Y81A 2BY8X 4DJZB 3V0XA 1MZDA 2TGPZ 4JZEH 2EI7A 1UTJA 5GPIB 3SGQE 1AUJA 4BXWA 3SV9A 5BRRE 2Y82A 1QB9A 2PUQH 1DX5M 3V3MA 3PLPA 2UWPA 1W13U 1C2KA 3FAOA 4TPYA 2G4UA 1O5BB 1DM4B 2H5DA 4NFFA 6CHAB 3MU8A 4NA9H 2VNTA 2GZ8A 3MNSA 1GG6B 3Q77A 1GHXH 3LGWA 1ELFA 2AMPA 3UIRA 1FY1A 1HIAB 1KLIH 1DXPA 4VGCC 2V3OH 5FX6A 1SVPA 1FNIA 2B0FA 4IN1A 1QY6A 1YM0A 1F5LA 1ELCA 1O3NA 1N6XA 2V3HH 3TIUA 1QBVH 2BVXH 1F0UA 4RN6A 4K5ZA 3ZYEA 1LKAA 2QGRA 2SGDE 4UE7H 2ALVA 1SGTA 5DGJA 3OTJE 1EATA 1P2OA 1XVOA 2ZGJA 3GY2A 2HGTH 4WVPE 2NU2E 3O8BA 1P12E 5AHGH 1CA8B 2YNBA 2OTVA 1D3PB 4YESB 3A86A 4OS4A 2O8UA 1LQEA 3BIVH 1RD3B 5C3NA 1JXPA 2OD3B 1CGJE 1TONA 4OS6A 5FXLA 3LPRA 1OYQA 1QFKH 1BBRH 3PMJA 1HAXB 3MO3A 1WBGB 4TPIZ 2WUBA 1TNIA 1GI0A 2BD3A 1QR3E 3BEIB 4FUBA 1O3OA 1SC8U 1QRZA 1P2IA 5JBAS 5JYIA 3KF2A 2HNTF 3GCOA 3E0NB 2UUKB 1UHBB 4XBCA 1MKWK 5EOKA 1CU1A 1TFXA 2Z9KA 4Y8YA 1QJ1B 2GVFA 1AY6H 2GT8A 3LDXH 1DFPA 1NO9H 1KXFA 4BTTB 1C4Y2 3PTBA 3A80A 3SBKA 2BDAA 5FHTA 2ZFPH 1WTHD 2SGPE 1EP5A 5TCAA 3SNDA 1HJ9A 3HK6B 1NFYA 1OOKB 2QY0B 2ZECA 1MTUA 3BG4B 2G8TA 2DE8A 3A84A 2BLOA 3BIUH 4K8BA 1GHWH 1HGTH 1A0HB 2EI8A 4NA8A 4B2BA 4Y76A 1HBTH 3ZZAA 1MTSA 1K1PA 2C90B 1MD8A 3LH3A 1V2RT 4MNXA 1AUTC 4IBLH 1NRRH 5AFYH 2OBOA 1TGCA 2TIOA 3GISB 1Z1JA 1C5OH 3T27A 1ELEE 1LVOA 2K7XA 4NSYA 1TIOA 1P01A 4BAQB 2CMYA 2PWXA 3TVJB 3BV9B 3MYWA 3JZ1B 3P92A 2H2ZA 3SU5A 1C1OA 3NZIA 1VGCB 1YBWA 1O2KA 2G4TA 3L33A 3FZDA 4K1TA 2WPMS 3RU4T 3U9AH 2FODA 1P57B 1GI4A 4IN2A 1CT0E 1P3EA 1V2TT 4ZKRU 2XW9A 3A7XA 2ESTE 1KYNA 5EODA 1NY22 1AMHA 2Y5FA 4I8KA 4SGBE 5FBIA 3SV2H 1Y8TA 1ELTA 2VWNA 4MPWA 4I8LA 4NCYA 1W0ZU 3A8AA 1QQ4A 1TWXB 4DIHH 1HJAC 3H7OA 2J34A 1SB1H 2FEQH 2W7UA 3PO1B 1O5DH 1P8VC 3SNBA 1FPHH 3VEQB 1O3EA 1C1VH 1SOZA 1E0FD 1GMHF 2ZP0H 3ZVFA 2FYQA 3Q76A 1FDPA 2RDLA 1DPOA 1TOCB 4BNRA 1GBLA 4HTCH 1XUJA 4XDEA 5K7RA 2F9BH 3SN8A 1G2MA 4B1TA 2GX4A 4Y8ZA 1GMCF 1AVXA 1AB9B 3RXQA 2ZQ2A 2ZFQH 3QDZB 2BD8A 3BTHE 4MVNA 4YLQH 2A5IA 1D3QB 1GI1A 1NU7B 3LGYA 2XRCA 1O30A 3VXEH 1IHSH 2ZZUH 2GT7A 1GMHG 4A5TS 3SJ8A 2ZHEH 1RRKA 2STBE 1MKXH 2ZTYA 5H4IB 2ZU3A 3VB5A 2PTNA 1JBUH 4ISOA 1HXFH 4WJG2 3BEFB 4B2AA 3PLBA 3ESTA 2GMTC 4X2WA 1NRQH 1XUKA 1BIOA 1GMDF 3EGKH 2GZ7A 2Y5HA 1GMCG 3IG6B 4JYUH 1TPPA 1LTOA 4QT8C 3T2NA 1V2VT 2Z9GA 2ZDNA 6LPRA 1PPEE 1GBMA 2P8OB 1S82A 2BVSH 2A0QB 4R8TB 3VB3A 1HAPH 1J15A 5EXLA 1ZTLA 5A2MH 1OP8A 3S0NA 1QB6A 3MI4A 1LHEH 1BOQA 2XBXA 4UFFH 1IAUA 1EPTA 1ELGA 2ZTXA 4CH8B 2AIQA 5FPTA 2W3KA 1JIRA 4M7GA 2A45B 2BLVA 1YPJH 3K9XB 3TNSA 1GBFA 3ATIA 2WYGA 2THFB 3DT0H 4AFQA 3P8OA 1BRCE 4HI3A 3KCGH 2OXSA 1O3KA 2BXTH 2XBWA 1PQ8A 3RXUA 2ZFRH 4SGAE 3E91A 2XYAA 1Q2WA 1BA8B 3A82A 5HXFA 3QO6A 1TNKA 3RMMH 1BCUH 3EA9A 1W11U 5LPEA 1MCTA 1TE0A 2OC7A 2XWBI 2Y7XA 1O5GH 1TYNA 3LC5A 1TMTH 4K1EA 2OCVB 1G30B 4ASHA 2P3TB 4LXBH 5HMAA 2O8TA 1Z8JB 3PTNA 1A0LA 3QN7A 3ZVGA 3EA8A 3Q3XA 3SI4H 4GHQA 1QNJA 3RDZA 2W5EA 1HJ8A 4X6OA 1HV7A 1QIXB 2DE9A 2XC0A 1GGDB 9ESTA 1GDUA 1BMLA 3SGAE 3SJOA 1E37B 3M5LA 2AFQB 3PB1E 1AFQB 1RXPA 2QAAA 1TALA 3UREA 1HCGA 2G51A 2ZDKA 1MBMA 1LQDB 4KTUA 1GVKB 1EUFA 1SPJA 1EOLA 1AIXH 1P11E 1SQTA 2WPIS 3F9FA 1C5QA 2GCHF 1G2LA 2ZF0H 4K60A 1TNLA 3C1KA 1GHAF 1C1TA 1FN8A 4WH6A 1O3MA 1C5VA 2R3UA 5HM2A 4A92A 1DLEA 1O2WA 5EXNA 1XKBC 4JYVH 1JRSA 2Y5GA 3VXFH 2CGAA 2P59A 3S9AA 1B0FA 1XXFA 3PLKA 1AKSA 2C8YB 1C5TA 2O8WA 4KGAA 2P3UB 4JK5A 1LPKB 1K1MA 3M5NA 2QXJA 3GY5A 5G4BA 3MO6A 1GCTC 2FOBA 2O8MA 2BD5A 3OYPA 3VPKA 4NA7A 3RXVA 3P8FA 5CHAB 1LMWB 1TGSZ 2GCHG 5JB9S 1TGBA 1GHAG 1BHXB 1EKBB 3IITA 3PROA 2ZGHA 3DD2H 1H8IH 4J2YB 5SGAE 4X1SU 4I7YH 2HRVA 2Z6BD 2QC2A 1S84A 1G3EA 1A61H 2HNTE 1TNGA 1O3BA 3RU4E 2RA3A 1QA7A 1K22H 3FVFB 4CR9A 3M61U 1PQAA 1V3XA 1FIZA 4DCDA 5CMXH 4D7FA 1O31A 1GJ7B 2G81E 1O38A 5C1XA 3SU0A 2ZC9H 3EYDA 2VIPA 3ZZ6A 1Z8GA 8GCHF 1TBRH 1BHXF 3BTME 1DOJA 4Z0KA 3ZZ3A 3A7TA 2EI6A 3GY8A 4ABFA 5L30H 4E7NA 2ODQA 4CH2B 2ZGXH 1YKTA 2ANMH 2STAE 2G5NA 3A8CA 4TWYA 1TPSA 2A2QH 3QGNB 1YPHC 1GDQA 2VJ1A 4XE4A 4K2YA 1B5GH 1K9OE 2J2UA 1TGTA 1O3JA 1AVGH 2SGAA 1A3EH 2BZ6H 1BTZA 3A7WA 1GDNA 1SFIA 5GWZA 1O3PB 6GCHF 1P03A 3GCHB 5JB8S 1GBBA 1SGFA 1SGQE 3DFJA 4NG9H 1UCYE 1XUIA 1U6QA 1G3CA 2JH6D 2QV1A 3A87A 2A32A 1BTXA 1FQ3A 1P9UA 3MNCA 1YC0A 2AGIX 1FJSA 1LHCH 1IQHA 1JMOH 3GCNA 1BTHH 3DA9B 5A8YA 1VITF 2GD4B 3ZZCA 1C5WB 2ZA5A 2O9QA 3F68H 4UONA 5A09A 1IHTH 1S6FA 1GJ5H 1C5ZB 2TBSA 1O2MA 1M9UA 3D65E 3UWJH 3M36A 4Q7XA 6ESTA 1V2QT 3M7UA 1OWHA 1FY4A 1Z71A 1QL9A 2FI5E 1P09A 1ZHRA 1MU6B 1GJ9B 2W3IA 3SNAA 5EG4A 3RXDA 2VIVA 2ZGCA 3E0PB 1BT7A 1VITG 5BPEA 1ANDA 2WPKS 5GCHF 5EU8A 3RLYH 1OSSA 3RC5A 3W94A 1ZOMA 1FAKH 4NIYA 1D3DB 4B75A 1A7SA 1SMFE 4ZHLU 4NZLA 3SORA 1L1NA 4A1VA 2HALA 1GJ8B 3ZVBA 1O34A 1J14A 1XVMA 1EAWA 3LGUA 1SL3A 1G32B 3TGKE 1FMGA 1S81A 1EX3A 1UTOA 1GJ4H 1CT2E 1HXEH 4WF8A 1P06A 4CHAC 4AG2A 3A85A 2TPIZ 2IJOB 1ESBA 3RXGA 4CBOA 1O2UA 1MH0A 2FOHA 1EASA 7GCHG 4K1SA 2ZKSA 4LOYH 1WQVH 1HAVA 1O5AB 1G9IE 1MTNB 1FPCH 3JZ2B 1UJ1A 3LKWA 3RXFA 1P2NA 3SQHE 2FOGA 3P95A 2XC4A 3KIDU 1SGCA 4MNWA 1EZSC 2TRMA 2J95A 2A5AA 1MBQA 2BOHB 2ZQ1A 1A5IA 1XMNB 5EGMA 5LPRA 1O2LA 1RFNA 1NC6A 3MU4A 2P16A 3ODDA 2AS9A 1SQAA 3A7YA 1O2OA 2ANWA 4BXSA 1F5RA 2AERH 3GCTG 2PKSB 3UOUA 1UVPA 4ZXXH 1AQ7A 1OS8A 3MU1A 4GAWA 1DANH 1TPOA 3A8BA 1ZYOA 1C5PA 1EAUA 1T31A 4Y6DA 1RTLA 3E3TA 1DDJA 1V2JT 3VB4A 1EQ9A 3RXPA 1ELAA 2G55A 4WWYA 1OKXA 1MAXA 4TWWA 1T4VH 2XNIA 1V2ST 5FPSA 1UCYH 2V35A 1SGEE 1YGCH 4DG4A 1P2JA 1SLVB 3GY3A 3VB7A 1C5RA 2D2DA 5IDKA 2BY7X 3GOVB 2OC1A 3GYLB 1C1NA 4DGJA 1FY5A 2IOTA 1GCDA 1GJAB 1QHRB 1W0YH 4AX9H 2GZ9A 1T7CA 3M3TA 2F91A 1GI6A 1K2I1 2FPZA 1YPGH 2V6NA 2VWLA 1ABIH 1O37A 4A1TA 1ZGIA 2FLRH 2ANKH 1BB0B 1NM6A 1YYY1 3KL6A 1N8OB 4Q7YA 3D62A 3I77A 3RXMA 1B7XB 1F92A 2QN5T 1FV9A 1AHTH 2AGEX 1EPTB 3ZZ8A 2ILNA 5EPYA 1ZZZA 1DVAH 1BMAA 4I33A 2RCEA 1YF4A 4FUEA 2PSYA 1P0SH 1C1UH 3AW0A 3BTFE 1PJPA 4FUHA 4K69A 5CE1A 3S7KB 1SI5H 1GJDB 1ACBE 1ANCA 1HRTH 1RJXB 2Z3CA 1WU1A 3RXLA 1O2SA 1C2GA 2RG3A 3K2UA 3O8DA 3OU0A 1ETTH 2JETB 3M3VA 1G3DA 1QQUA 1AFQC 1VJ9U 1JRTA 2UUFB 3RC4A 4O03A 3T28A 1O5CB 4AYYB 3RXEA 1GBJA 1NN6A 4XOJA 3SUFA 1ZGVA 5ABWA 1AO5A 1BBRK 2AYWA 1DWBH 5T6GA 4ABEA 5C1UA 4X8UH 3D23A 1O39A 1EAIA 3SNEA 1CA0C 1TRMA 4BAKB 4X6PA 4DVAU 1BMMH 3UFAA 4X8VH 1AZZA 1SLWB 3E90B 3STJA 1MTWA 3RP2A 5LGOA 3LU9B 4DOQA 1EOJA 3SUGA 3TNTA 1PQ5A 1H8DH 1ELDE 4OS1A 1H9HE 1SGNE 3PWBA 1KXAA 3A7ZA 1K1LA 2BDHA 2XWAA 3KHVA 3DUXH 1C2FA 3GICB 1F2SE 2FOMB 5T6DA 3V12A 1G37A 1UTQA 3SU3A 4ISLA 4Z6AH 5J4SA 1NFWA 5EXMA 4GHTA 3BTTE 2P3FH 4OS2A 4ABDA 3OSYA 3MU0A 1ZPBA 1FAXA 1MZAA 1AKSB 4AZ2B 2PGBB 1UTLM 2SGEE 1C2LA 2EC9H 2BY9X 1A2CH 2XCNA 2J9NA 4UEHH 1DE7H 3TH4H 2PGQB 5FAHA 5JDUB 4ABBA 1NRPH 4I8GA 2GDEH 4U2WA 2VGCC 4JZFH 1FI8A 2ZU2A 4DURA 4B2CA 2O8LA