1LVOA

Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replicase, hydrolase domain
publication title Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain.
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
molecule tags Hydrolase
total genus 82
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1lvoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA01
3VXEH 1GBFA 1XUIA 1O2UA 4GCHF 4ABIA 4X1RU 4CRCA 1KLJH 2ZTZA 1W2KH 1KDQA 2QYIA 1UVUH 1HJ9A 1S84A 3MWIU 1Q2WA 4A1VA 4U30A 2ZI2H 5TCAA 1T8NA 2V0BA 2BDYA 2BOKA 1BJUA 1MTUA 1PYTD 3UFAA 1CA8B 5EODA 2PTCE 1GMDF 3FP8E 1GHZA 2ZC9H 2F9VA 3UWIA 3ZYEA 3KIDU 1SVPA 1G3EA 4Y0YE 1ELVA 3UQVA 4DY7B 1K1OA 4WMDA 4WVPE 1L2EA 2BD9A 2OBQA 2QY0B 1MD7A 3H7OA 1GCTB 3A83A 1OWIA 3M35A 3LGYA 3RU4D 2ZECA 3VGCC 4B1TA 1WOFA 2NU3E 1O2XA 2QXIA 2O8TA 3PTNA 4MVNA 5FHTA 1MQ5A 2C4FH 2ZDVH 3F1SB 3RU4T 3SBKA 3U69H 3D65E 1TABE 4AYVB 2FYRA 1NPMA 1C5LH 1Z6EA 1VITF 4D7GA 1GHAF 1UMAH 5I46H 1VZQH 5DP4A 2ALPA 5BPEA 3URDA 2Y82A 1G30B 1CHOF 1QQUA 1LVYA 3PTBA 1C5WB 1GCDA 3NXPA 2O8WA 2ZFSA 2GV6A 2YNAA 1K1PA 2QGRA 1O2JA 1SLXB 3GY7A 4X6OA 1BHXF 3DA9B 1H9LB 1C5UA 2ANMH 1CHGA 1KTSB 5HYOA 4WXIA 2PKSC 4ABDA 2C3SA 3P95A 2QCYA 2SGAA 1AKSB 1ETRH 4I8LA 3A80A 4NIWA 2HRVA 1N8OC 3O8DA 1YPHE 5E0HA 1IQJA 2EI7A 1ZRBA 2A4RA 3RXUA 8LPRA 3VB3A 1VCPA 1ANDA 1BJVA 1AE8H 1FAKH 1ANEA 1A0JA 4XOJA 1Z8JB 4LK4A 3B23B 5J4SA 1AVXA 2BLQA 1K1IA 1Y8TA 3SI3H 4H4FA 2ZU4A 1ZTKA 1GJBB 2BM2A 1HIAA 1HAXB 4JZ1A 3QTVH 2VIVA 3MH5A 1H8IH 1TRNA 1TGBA 1EJNA 3PMHB 5SGAE 3BTFE 3M7UA 2ZU2A 1P02A 4A7IB 1YLCA 2A7JA 1MTNB 2OQUA 6CHAC 1W7GH 2BY5X 3GCTF 2STAE 5EGMA 2FTMA 3MMGA 3AASA 3TH2H 1QBOA 3S9AA 1K1LA 3QDZB 5L2ZH 1ELBA 2C8XB 2XWAA 2AMQA 3SUDA 1SGQE 1ESAA 1O2ZA 3A86A 3UUZA 1TA2A 1O2VA 3EBNA 6GCHG 1HBTH 4HTCH 2OUAA 1OPHB 1OKXA 1OX1A 1W10U 3A82A 4XBBA 2J94A 1KXDA 2VWNA 3Q77A 1H8DH 1AVWA 4AYYB 1TGSZ 1F0SA 1GI1A 3LPRA 3A7TA 1IQEA 2A45B 2AH4X 2VIPA 5F8ZA 7ESTE 1F5LA 3UIRA 1FLEE 4M7GA 1KIGH 1MKXH 2IPHA 2ZTYA 3U1IB 1WUNH 3KHVA 1S0RA 1O31A 2CJIA 5GIBA 1C1SA 1YPKH 3EA7A 2VIOA 4AG2A 2FM2A 4B2AA 1TIOA 4KTUA 1TPSA 2UUFB 1IHTH 1QNJA 1UCYK 5GCHG 4NIXA 5DP9A 1BTXA 2ILNA 4KP0A 1DWCH 5C67A 1C2IA 2A32A 5HM2A 3E0PB 3HGNA 5AF9H 5C5NA 1SFQB 1UHBB 3RXBA 2SFAA 1QJ1B 1YCPH 1BRBE 4BANB 1GG6C 3NPSA 4GHTA 4NGAH 1GHXH 3VB5A 2FOMB 2ZCLP 3KQCA 1FN8A 1SL3A 3H7TA 3ATMA 5EXMA 1RFNA 3LOXA 1ZLRA 2GMTC 1GJ9B 1UVSH 3A7YA 4MG3A 2VVCA 1WTHD 3KQBA 1T4UH 5CHAB 3NWUA 4H6SB 1NC6A 2STBE 1UO6A 1S6HA 3RC5A 2XBWA 2FODA 2PLXA 1ELDE 1NRRH 1ETTH 1A4WH 5K7RA 2Z3CA 3DT0H 1P04A 2JETB 3MO3A 3ZVFA 1V2OT 1Z7KA 5LGOA 1A46H 3HGPA 3M5LA 1WQVH 1MTSA 5EW2H 1EAIA 3GCNA 5C1XA 3MH6A 1ELGA 1GJDB 2HPQH 2VVVA 1SGPE 1OP8A 4UDWH 1O2HA 1LKBA 3TH4H 1HV7A 3ZZ4A 9ESTA 1CBWB 2NU1E 3PROA 1Y59T 3GY6A 4GAWA 1RXPA 1V2MT 1SLVB 1XMNB 3DD2H 2ZA5A 2F91A 1AY6H 5EQQA 1SGTA 5F8TA 4JZEH 2O8LA 4JZIA 1O0DH 1A61H 1O3HA 3ZYDA 2HNTE 3URCA 1YF4A 3G01A 1CO7E 2SGQE 4F49A 3HATH 1ESTA 3NK8A 1DFPA 1TRYA 1C1QA 3AW0A 2G5VA 5FX6A 1FXYA 2NWNA 3F9GA 3O8RA 1TNKA 1O38A 3BN9A 2TBSA 1DANH 1XUFA 5DP3A 4TWWA 3ZVCA 3SGQE 9LPRA 1GJAB 1FI8A 1GBTA 1KSNA 3TK5A 1F2SE 2FO9A 4CRBA 3KL6A 1ABIH 1DWDH 5DPAA 4FUHA 3OY5U 2ZDLA 3TGIE 1AUTC 2Z9GA 3RMOH 4Q80A 1A0LA 1GJ5H 1V2TT 3SV8A 1K1NA 1XUGA 4MDSA 1HJAB 1V2VT 1O39A 5AHGH 4LOYH 1CA0C 1ZMNA 3RXOA 4PROA 1Q3XA 2HWLB 1O3PB 3NUMA 3RMLH 3RXIA 3ENSB 1MU8B 1ARBA 2P93A 4IMQA 1YGCH 1O3JA 1FNIA 4HFPB 1DUEA 2R9PA 3ATLA 1EB1H 5DO4H 2G4TA 4JK6A 2XC0A 1GJCB 3PV4A 3ODDA 3LGIA 4A92A 2WPLS 4CH8B 1X7AC 3SOSA 4DIHH 1TBZH 3A88A 4X1NU 1DSTA 3P8FA 1PQ7A 2FYQA 3LU9B 1Z8GA 3LKWA 1Z1JA 3EGKH 2J95A 4OS5A 3EAJA 3R0FA 1O3EA 4NG9H 3P8OA 2D8WA 3BG8A 1A1RA 2VU8E 1TNJA 4INHA 2AFQB 1PPGE 2Q6DA 1TQ0B 2GX4A 1GVZA 5LPRA 3SV2H 1YLDA 1SPJA 1RTFB 2R3YA 3RXGA 1O3LA 2HGTH 1P2OA 3D49H 1IQNA 5FAHA 3BTTE 1Y3YA 1A5GH 1UK3A 1EZQA 2GDDA 2XBYA 2XYAA 1TPAE 3STJA 3ESTA 1BRUP 1TX8A 4ZKSU 1QTFA 3PMJA 3GY5A 1GL1A 4VGCB 4Y11E 3DFJA 1E36B 1K28D 3EDXB 1GHVH 4MTBA 1UTNA 4ISNA 2TGTA 4BXWA 2W3KA 3EE0B 5C3NA 3PM3A 4DGJA 3D62A 3ATWA 4X1PU 2B9LA 1HAOH 3M7QA 4X6PA 1NO9H 2FESH 1UVOA 3S9BA 1CGHA 3LT3A 1TNLA 1GDUA 2UWLA 3GCHB 3T27A 3QZRA 4JK5A 1AIXH 1DDJA 2XWBI 4B75A 1ZPCA 5BRRE 3SQHE 1BBRE 1BQYA 1UTJA 5TJXA 1WQSA 5FCRA 2YOLA 1BMMH 3ZZBA 2RA0A 1V2LT 2TPIZ 3ZVGA 4MLFB 1C5MD 1FONA 1JOUB 5DP6A 5LPEA 1GMHG 2P8OC 1P10A 1TONA 3I78A 1O5EH 4U01A 4UFEH 1C2HA 3KF2A 2PKSB 2V35A 1BUIA 4THNH 3ZVDA 3SUFA 2Z94A 1EKBB 1GMCG 1O3OA 3MO9A 1UK2A 1GHBF 1ZMJA 1DOJA 1N1LA 4YTAA 1EATA 2DE9A 1DXPA 3K6YA 4NA7A 1DPOA 2ULLA 1K1MA 1AQ7A 2BD4A 4JYUH 3SNEA 3IITA 4OS2A 1GGDB 2CF9H 1GJ7B 3TITA 1O2PA 4UE7H 1MBMA 2QXJA 1ZR0A 2V3HH 4HGCA 1AE5A 4X8VH 5IDKA 3GDVA 3TJVA 1NY22 4I33A 1O3GA 3TGKE 4GSOA 2ZHFH 3UNSA 1BBRH 2PV9B 3TVJB 5FBEA 2BDHA 2B8OH 1AZZA 2C8YB 1ELFA 1NFXA 1EB2A 3T26A 1ZTJA 2ZGHA 3E90B 2RA3A 1BRAA 3QGJA 3RXLA 1DS2E 1KXCA 2GZ8A 1YM0A 2JKHA 6CHAB 3BTQE 5G4BA 2FI4E 1FJSA 1O2RA 2R2MB 1TE0A 3KN2A 3TNSA 3KGPA 1P2IA 4CRFA 2ZG0H 1C2FA 2F3CE 4I8KA 2VIWA 1G37A 3PWCA 2BXUH 1TGTA 1QR3E 1ZMLA 1AO5A 2ZDKA 1VCQA 3OU0A 4YO9A 2OD3B 1ZHRA 2VIQA 2A0QB 5E0GA 4ZXYH 3RLWH 4DURA 4YT6H 5E0JA 2SGFE 1MU6B 2TRMA 4QT8C 2BDIA 3P70B 2CV3A 3TJNA 1EQ9A 4AGKA 1V3XA 2D26C 4NIVA 1DVAH 1IOEA 1AD8H 1O5BB 1GI0A 1GI9B 2RDLA 2WUCA 1SB1H 3RXAA 4IN1A 1C9TA 1QL9A 4I8JA 2K1QA 5I25A 4TY7A 4AOQA 1HAPH 4K8BA 5DGJA 5A0BA 1TFXA 1SI5H 1VR1H 2FS9A 3EYDA 4Q7YA 3SU6A 3ZVBA 4E7RG 1QGFA 2PGBB 2ZHQH 2HALA 2ZCKP 1EUFA 1W12U 4YOIA 1YP9A 4JYTA 1P2NA 1P57B 3V7TA 5A0AE 4FVDA 3Q3YA 2FIRH 1ORFA 1NT1A 4IGDA 1H4WA 1FIZA 1ZZZA 2ZWLH 2UUYA 3TK9A 2R0LA 1DUAA 4DJZB 1OYQA 1TAWA 2OXSA 1OYTH 4KELA 2BLWA 2WPIS 2P95A 1GG6B 5JPMH 4UEHH 2BVXH 1TRMA 1EPTB 3KEEA 2Z3DA 4D8NA 4ZHAA 4FUIA 3S9CA 4XBDA 2ZFFH 4O97A 1NESE 3TNTA 4TWYA 2Q6GA 1EJAA 1A3BH 1DITH 1U6QA 1FY4A 4CBOA 5FBIA 1O3FA 1LPKB 4WH8A 1MCVA 2WPKS 2WPHS 4XSKU 1O3KA 2ANWA 2BDCA 3N7OA 3SU5A 1D4PB 3BG4B 4INKA 5DK1A 1MZAA 2AIQA 1RS0A 2WV4A 1W3CA 4MNVA 1SGDE 2SNVA 1EZSC 3OY6U 3FP6E 5L6NH 1F92A 2QIQA 1NU7B 3ZZCA 4HI3A 3A84A 2CN0H 4JZFH 3RLYH 1V6DA 2SGEE 3SNBA 3QUMP 1A5HA 1SGFG 3SW2B 1XVOA 2ODPA 2A5IA 3FP7E 1O3MA 4TYDA 4Y8XA 1VITH 1QIXB 1Z1IA 1TWXB 3DFLA 2P16A 1PPCE 5T3HA 3FAOA 1S0QA 2WPMS 2OTVA 5A0CA 2OC0A 3K9XB 4J2YB 1GBCA 1BTPA 3QWCH 1L0ZA 4K1EA 4CH2B 2PGQB 1BITA 1YCPK 3B8JA 1BTZA 1MZDA 3SHCH 1FY1A 2BD8A 3T25A 2A1DB 4Q7ZA 4FUCA 1GBIA 3ATIA 2DUCA 1O2LA 2ZQ1A 3QTOH 2OINA 4D76A 3VB4A 2GCTC 5F8XA 1O3NA 2FOEA 4ABJA 1C4Y2 1CSOE 4I8HA 3RUOA 1Y3WA 1B5GH 1C5VA 1GBBA 5GDSH 1C5TA 2XBXA 2PW8H 3SJIA 1L1JA 2ZCHP 5FPSA 1SBWA 2ODQA 4XBCA 1DX5M 1RJXB 1WV7H 2H1UA 4OS1A 1XKBC 1UTPA 2GKVE 1BTYA 1NRQH 2EC9H 3ATKA 4K8YA 2I6QA 1C1WH 2KAIA 2D1JA 2ZFPH 4I31A 4OS7A 1MAYA 1V2ST 3U8TH 1GI3A 2XRCA 1ZJKA 2THFB 1HAYB 4ZKNU 4B71A 4YOJA 5HMAA 3RMMH 3HK3B 2AGIX 5EU8A 1GI7B 3OTJE 2A5AA 3VB7A 2GGVB 4CHAB 1AWFH 1O37A 1F5RA 1LPGB 2F9UA 3P8GA 2GCHF 2BHGA 4TPYA 4LZ1H 4NWLA 2SNWA 1HPGA 2A2XH 4BOHA 4AFUA 1XXFA 1QJ6B 1DY8A 4CR9A 5ESBA 5CE1A 4GCHG 1QQ4A 3QZQA 2OC7A 1IQIA 1GBEA 4IBLH 3RM0H 3OYPA 2VIDA 3RMNH 1MAXA 5GXPA 4Y6DA 5DP5A 1GVKB 4NCYA 3AW1A 2J38A 4XDEA 2PWXA 4NFFA 5AVDA 1CGJE 3B9FH 3ZZ5A 1C5PA 1AZ8A 1Y5UT 4AG1A 1ELEE 2VH0A 1TX6A 1LHGH 3PWBA 4SGBE 2VWOA 4KTCA 1CU1A 1OWKA 4ISOA 4D7FA 2O8MA 1BCUH 3DUXH 3QN7A 2FS8A 1SQTA 1OWHA 1NTPA 4A6LA 3RC4A 4ZH8A 2Z9JA 1T4VH 1INCA 1SGIB 2G00A 2Y80A 5DG6A 1UHBA 1QBVH 3EA8A 2J4IA 2CHAC 3ZVEA 4OS6A 1O35A 2XNIA 2FX6A 3LIWA 2XBVA 1IQGA 4CBNA 2BY8X 2P59A 2ZIQH 1UTMA 1O3AA 4B2CA 1XUKA 1Q31A 3QO6A 1C1UH 3GY8A 2BZ6H 1GHAG 3A7XA 1L4ZA 3BTEE 3WY8A 3MHWU 2YNBA 2G4UA 1QRZA 3UQOA 1CHOG 1F5KU 3LH1A 3M5MA 4ZHMU 5T6DA 1C5QA 1H1BA 2P94A 1VCWA 3BIUH 1E35B 1DXWA 5J4QA 1ANCA 3MO6A 3RC6A 3A8DA 1A7SA 5JBBS 4FU8A 1DSUA 4X2WA 1G36A 1P09A 3A85A 1O2IA 3PLBA 3W95A 2ZFTA 3ZZ6A 1BOQA 4A5TS 4J1YA 1IQLA 3GY2A 1LMWB 2ZO3H 2DE8A 4DW2U 3ZZDA 3L6PA 3GISB 2ZHWH 2G81E 1EOJA 5C1UA 1D3DB 2GTBA 1TGCA 1V2UT 1A5IA 3S7HB 5JB9S 2PFEA 3BF6H 1T32A 1GBJA 2GZ9A 3V3MA 4FU9A 3QLPH 1OP0A 1J14A 1O5GH 1H9HE 4UFFH 1ZRKA 2XXLA 1TLDA 4ABBA 1SSXA 3UWJH 4AORA 1T8LA 1ZYOA 1MH0A 3CS7A 4Z6AH 1KXBA 1L1NA 2R0KA 3GCTG 3SV9A 1DY9A 4RN6A 1PQAA 1W8BH 3PYHA 1TPPA 3SU4A 1PYTC 5FCKA 1NRSH 3QGNB 3SHAH 1G2LA 1GVLA 1DT2A 3MU8A 1VJAU 1YKTA 1PJPA 2M5TA 2PTNA 1Z8RA 3I77A 1P2QA 2Z9IA 4CR5A 1A3EH 1EZUC 4FVBA 4GHQA 2H9HA 1QCPA 1C5RA 3E91A 1B7XB 1LKAA 1Y3XA 1OS8A 1TQ7B 3GDUA 4ZUHA 1LVMA 2FX4A 4X1SU 1GI2A 3SNAA 4K3JA 1PPFE 4F4OC 1KTTB 1NS3A 1PQ5A 5LPFA 2SGDE 4ABAA 4DOQA 4LXBH 3BTME 2A7CA 4H42U 4FUGA 5EW1H 1EP5A 2VWLA 4YESB 3RP2A 4AB9A 4B2BA 4FUBA 4NFEA 1SR5C 2F9OA 2PHBA 3R3GB 2PUXB 2Q6FA 3BTDE 3UR9A 1RRKA 3RU4E 1HXEH 1LVBA 2FPZA 3A7VA 3TLOA 1FY3A 1TMUH 1C4U2 5JDUB 1S82A 1O2NA 5LH8A 1UCYH 3RXCA 1BBRK 3D23A 2H5CA 2ZPQA 4B74A 3M3TA 2Z9LA 4JMYA 1GI8B 1MTNC 1SOTA 2P3UB 3E0NB 2HVXA 4MPXA 1ZJDA 3L3TA 4KTSA 2BD5A 3BIVH 4Q2KA 1MQ6A 3VPKA 1BHXB 1N6YA 4AZ2B 2F9PA 2GT7A 3SU2A 1C1RA 2Y7ZA 3FANA 2VINA 2BY7X 1FN6A 4I7YH 4X2YA 1P05A 1DLEA 1NFYA 2ZDAH 4B76A 1UTLM 1P01A 2EA3A 2P3TB 3S69A 4UD9H 2D2DA 1G2MA 5AFZH 1LHEH 2VB0A 2TGAA 4Q7XA 2BXTH 2WINI 4RKOB 1LHCH 3U98H 1BB0B 4Y7BA 1EJMA 2P3FH 2H9EH 4O3TA 1CT4E 1ETSH 1Y5AT 4ZHLU 3RDZA 4K60A 2BQ6B 1FMGA 3A7WA 3NZIA 1JRSA 2CF8H 4JZDH 3VGCB 1MD8A 3IWMA 4MPWA 4ISHH 5EOKA 4LZ4B 3EA9A 5AFYH 4AGJA 3CENA 1DM4B 1UTKA 2FOHA 5JBCS 3A8CA 3E16B 4UFGH 2BX3A 1K21H 1B0FA 3SNDA 1D6RA 1AFQC 2ODYB 1Y5BT 2W7UA 4X0WU 1V2KT 3ZV8A 5E2PA 2BLOA 1YPEH 3PLKA 5EG4A 2AYWA 2EEKA 1AVGH 2JH5D 5DP8A 2OQ5A 3RXJA 1DICA 4Y79A 2W26A 1HAVA 1QBNA 2ZKSA 2TIOA 1FY8E 1KLIH 3BTWE 5A8YA 3ZZ7A 1MKWH 1C5NH 2B0FA 2W3IA 1ZGVA 1WSSH 4B73A 3SGAE 2GCTB 3BV9B 1UTOA 1N8OB 1C5YB 2UUJB 3Q00A 2FOGA 3UR6A 1AI8H 4R0IA 2RCEA 4NSYA 2AMPA 1DWEH 3GY3A 3W94A 7GCHG 1AWHB 1B0EA 1C9PA 2BQ7B 4UONA 1LCYA 1EAUA 3BTGE 2HPPH 2LIZA 2IOTA 2JETC 4FUFA 3RXSA 1BTHH 1SQOA 4ABFA 4K2YA 3PO1C 4Y0ZE 3TJOA 3UNRA 1O5CB 5EPNA 1YPGH 2WYJA 3KQDA 4CRAA 1P03A 2H2ZA 1S81A 3BEUA 2GVFA 3JZ2B 4A1TA 4R8TB 4MNWA 1CBWC 2OBOA 1FIWA 7KMEH 1M9UA 3FZDA 4K69A 1LPZB 2H9TH 1QRWA 5C1YA 4E05H 1ACBE 3SQEE 3VXFH 3L33A 2Y5FA 1FPHH 3QK1A 3V13A 4ZMAH 1O2QA 1O2SA 4IS5A 5DP7A 3SZNA 1ZSLA 3SJKA 4GVUA 1C1MA 4ISIH 4X8SH 5A09A 1TBRH 2PKAA 1HRTH 1EZXC 4Y71A 1RTLA 1TGNA 1O3IA 1S6FA 1OP2A 4ISLA 4YT7H 1ESBA 1W11U 1NFUA 1PPEE 3F9FA 1SHYA 3C27B 3CS0A 2VJ1A 1CQQA 4IC6A 5A8ZA 5HM9A 2G8TA 1TOMH 2B5TB 2AGEX 1MUEB 3HKIB 3S0NA 2O9QA 3MTYA 1P8VC 3TK6A 2XCNA 1QL7A 1L4DA 2ZU1A 1K22H 2FDAA 3LGTA 2VH6A 1O34A 1HJAC 2BZAA 2ANKH 3M61U 1QHRB 5DKMA 1GDQA 4FUJA 2J2UA 1LQDB 1SGNE 1C1TA 4Y10E 2FLRH 1FDPA 1GJ4H 2UWPA 1EPTA 2VVUA 1TMBH 1QL8A 4AFQA 3IG6B 2EI8A 1P11E 1C2EA 1HB0B 4DT7B 1C2KA 4OS4A 1S85A 1YPJH 5E8EH 3TPIZ 2GMTB 4WMFA 3TH3H 4AB8A 2ZDNA 1PPZA 1C2DA 3HKJB 1J8AA 2QAAA 3ZV9A 2AERH 1P2KA 3T28A 5JBAS 1SLUB 1P3CA 3M7TA 1TB6H 2ASUB 2IJOB 5HXFA 1GDNA 2FOAA 2ZTXA 3SU3A 2R3UA 6GCHF 2QA9E 3LONA 1C5SA 3U1JB 1KDQB 1ZHPA 1N6XA 1GHBG 3M3VA 5FX5A 1OWJA 1AFEH 2UWOA 2Y81A 2Z7FE 2FLBH 3P6ZB 1G3CA 5F03A 4CRGA 3Q3XA 3RXEA 1TNHA 2Z6BD 1YBWA 1QJ7B 1MKXK 2Y7XA 5H4IB 2QC2A 2ZDMA 3T29A 1PQ8A 2W5EA 1YPMH 2GDEH 1XVMA 3SNCA 8GCHG 3GYMA 4RSPA 1D3TB 3A89A 4FXGH 3RXVA 2A4OA 4Y8YA 4VGCC 1W13U 1SOZA 1O2YA 4WMEA 5GCHF 1ZOMA 1T31A 6ESTA 4YM9A 1SFIA 1JMOH 1EP6A 3Q3KA 5EPYA 2ZEBA 2RG3A 1TOCB 1FPCH 1P9SA 4H6TA 4D9QA 5FPYA 2OCVB 2A4QA 1EASA 4NIYA 3K6ZA 1AKSA 2W7SA 1THPB 3GCHC 3JZ1B 3RXFA 2CGAA 2FOFA 1W0YH 2BVRH 2PR3A 3RXKA 1GI6A 1OSSA 1FV9A 1D3PB 1YC0A 1AB9C 3AVZA 1LVOA 1P0SH 1BMAA 1SQAA 4XFQA 2FWWA 1F7ZA 5T6GA 4E7NA 1GHYH 2ZU3A 2AEIH 3O8BA 1YPHC 3BTHE 3RXPA 2AMDA 2A7HA 2PSYA 1VGCC 3T62A 1FQ3A 4MNXA 1KXAA 2ZHDA 2QN5T 3HK6B 2UUKB 1CA0B 1QFKH 4TY6A 1GBMA 1D6WA 1YYY1 1V2NT 1D9IA 1HXFH 1O2MA 1THSH 1C1VH 1O2GH 1GGDC 2A2QH 1E34B 1OOKB 4RKJB 5FPTA 4Y7AA 1AUJA 3TJUA 1OXGA 3H5CB 4BAQB 1LTOA 4ESTE 1T8OA 1FY5A 3RXTA 3GDSA 1QRXA 3PMAB 4DIIH 4I8GA 2KAIB 4X6MA 1ELTA 2TGDA 4BXSA 1AMHA 1TYNA 2VGCC 1BT7A 2CMYA 4X2XA 5ESTE 1RIWC 2ESTE 1HIAB 3M36A 4ZAEA 1CGIE 5CMXH 1ABJH 2J9NA 1NFWA 2JH6D 1K2I1 3ZZ9A 1O5FH 1P2MA 4O9VA 1IAUA 3RXMA 4GUXA 2FI3E 5EXNA 3RXQA 1C5XB 2BD3A 2C8WB 2NU0E 1P06A 1WYKA 1Y3UA 3BSQA 3RXRA 4ASHA 3SV7A 1ARCA 2BY6X 2SGPE 4I32A 1LQEA 1V2PT 1MBQA 1SG8B 1GJ6A 1GMDG 2FZZA 3MH7A 3MU1A 1ID5H 2BB4A 4TPIZ 4OGYA 3BTKE 3F9EA 3A81A 4MNYA 1IHSH 3PMBB 4K5ZA 2Z3EA 2C90B 1SGFA 1TX7A 2B7DH 1O30A 1GBKA 1T7CA 3BEIB 4WXVA 1BIOA 2WUBA 2Q1JA 5GWZA 4U2WA 1SGRE 1S83A 2C8ZB 2A5KA 4BAMB 3LGUA 3DHKH 3QX5H 2FTLE 3LGWA 4NA8A 1HAHH 2GV7A 1PPHE 3F68H 3MNBA 1BA8B 3T5FH 4D9RA 4E06H 3CP7A 2QXGA 1P3EA 2XTTB 5A2MH 1GI4A 1LHFH 4HZHA 4NZQA 1GBHA 2K7XA 2C93B 1A0HB 1TPOA 1C2MA 1IQHA 3GYLB 2ZPSA 1F0UA 1SGCA 1WU1A 1VITG 3K65B 1S5SA 1AFQB 5ETXA 2FOBA 1SGYE 2ZGJA 4FUDA 2NU4E 4WJG2 1G32B 1O33A 5C5OA 3V12A 1C5ZB 1E0FD 1Z6JH 1QY6A 2ZGBH 4SGAE 1ZHMA 1TNGA 1O36A 1O5AB 3VFEA 2ZGCA 4BNRA 1HLTH 1V2WT 2P8OB 1NROH 1HJ8A 1ZPZA 3ELAH 8ESTE 1EPTC 1F0RA 4Z0KA 3T2NA 3K2UA 5B6OA 1TA6A 5HGGA 2OLGA 1IQKA 3RM2H 3E1XB 2H6MA 3GY4A 3SJOA 4NSVA 1AN1E 3S7KB 2BDAA 3M5NA 1NZQH 1O32A 2QF0A 3UNQA 3SN8A 3LC5A 3BEFB 1JIRA 2VNTA 1GL0E 1K9OE 4MPUA 3FVFB 3BG4C 1QA7A 1HCGA 1JIMA 1VJ9U 3PLPA 5A8XA 2WV5A 1OWDA 4BTTB 3PO1B 2AS9A 1ELCA 1GCTC 1MTVA 2ZZUH 4IMZA 4IN2A 1JWTA 2Y5GA 3OSYA 3M5OA 4FUEA 2J92A 2ZP0H 3SU0A 1TALA 1CVWH 1MCTA 3HPTB 1AHTH 4WY3A 5E2OA 4YOGA 1SC8U 2BOHB 2HNTC 1BMNH 1HGTH 1E38B 2GCHG 3TIUA 4JYVH 1P9UA 4YZUA 3LGVA 3MU5A 4DG4A 3U8OH 3VEQB 2GZ7A 1W7XH 1UCYE 5F6MA 2FMJA 1XXDA 2OC8A 1EXFA 3LDXH 5ABWA 2WYGA 1ZTLA 4NA9H 1DE7H 2F9NA 1GMHF 1TNIA 1C5OH 1V2QT 4BAHB 1MMJN 4UFDH 1W0ZU 3O8CA 1MKWK 1FUJA 3SI4H 3STIA 1GMCF 3P8NA 1XX9A 1GBLA 4YLUA 1AU8A 4A1XA 4BAKB 5FXLA 1IQMA 2BTCE 1KXEA 2O8UA 3LH3A 3SUGA 3A87A 1O2KA 2A31A 1OWEA 1UK4A 3I29A 1L1GA 2BLVA 2R2WU 4MQAA 2XCFA 3VB6A 1QB6A 7GCHF 3A8AA 1C1NA 2ZHEH 4BTUB 1THRH 1WBGB 4OGXA 1V2JT 2Z9KA 3SGBE 3NCLA 4WWYA 4ZROA 1FZZA 3ZZ3A 1P2JA 3U9AH 3C1KA 1QB1A 2BVSH 2LPRA 1CT2E 5EQRA 2FOCA 1NN6A 2ZNKH 3E8LA 2HNTF 5IYTA 2F83A 2IN2A 4YLQH 3M3SA 1ZGIA 4CHAC 3FZZA 2TGPZ 1O5DH 3UOUA 1BDAA 2BMGB 1EOLA 5C2ZA 3ZVAA 2HOBA 1O3DA 1SMFE 1W14U 2WPJS 4AFSA 1XKAC 1Z71A 2BD2A 3MU0A 2PUQH 3ZZ8A 1RGQA 2BDBA 2ZGXH 1UJ1A 2G5NA 1KXFA 2BD7A 4GLYA 3F9HA 1EAXA 1G9IE 1GWAA 2GP9B 1LDTT 4Y8ZA 2BX4A 1GPZA 2XW9A 4AN7A 2ZFQH 5PTPA 3SUEA 3LJOA 2Y6TA 1CT0E 1YCPM 3RXHA 1NRPH 3MOCA 2GT8A 1D3QB 3SJ9A 1G3BA 3A8BA 4K1SA 2F9BH 2ANYA 3SO3A 4ZXXH 2AIPA 5GJ4B 1BMLA 1NRNH 5JBTA 1KY9A 1NU9A 2QV1A 1EAWA 1WAYB 3MU4A 3SU1A 1EX3A 3MYWA 4BAOB 3F6UH 3ITIA 1IQFA 1DWBH 3UOPA 5T6FA 2XC5A 2FXRA 5JB8S 1O3CA 1RTKA 4K1TA 5DJ7A 2VWMA 5C20A 1GJ8B 1DLKB 2ALVA 3TU7H 3ODFA 2BDGA 3AAUA 3GCOA 2XC4A 4CREA 3ZZAA 1QB9A 1HAIH 1BTWA 1UVPA 3MI4A 1CE5A 2NU2E 4XE4A 2ZPRA 5EQSA 2V3OH 1Y3VA 2HLCA 4X8TH 1ANBA 1UTQA 1XUHA 4IC5A 3V0XA 3GICB 1JRTA 4ABHA 2FEQH 3FFGA 1BRCE 3SJ8A 2FP7B 3SORA 1MTWA 2AGGX 3LC3A 1RD3B 1G3DA 1PFXC 1AB9B 1ZSJA 3GOVB 4FU7A 3U8RH 4ABEA 1ZPBA 5CHAC 2OP9A 1SLWB 2FI5E 2G51A 3AAVA 1AGJA 3E6PH 6LPRA 1J9CH 3UTUH 1VGCB 4BTIB 1O2OA 1LHDH 1QA0A 3MNSA 1HUTH 2JH0D 8KME2 2EI6A 1HAVB 4U32A 2Y5HA 1GBDA 1HAZB 1PPBH 4NWKA 1T8MA 1KYNA 1BZXE 1WCZA 5JYIA 3SV6A 4JCNA 2BYAX 1GHWH 1SGEE 4MPVA 4X6NA 1O2WA 4X1QU 2GD4B 2QF3A 3MNCA 4AX9H 1A2CH 2BY9X 3KCGH 3PB1E 4O03A 8GCHF 3UREA 4CRDA 1KLTA 1C2GA 1BTUA 2J34A 4O3UA 4AFZA 1C1PA 3UY9A 3Q76A 4GPGA 2VGCB 4X8UH 3LJJA 3MNXA 1RIWB 1J15A 1V2RT 1WTGH 4KGAA 1UVTH 3OX7U 1GI5A 1QURH 3UPEA 1ZSKA 1HNEE 2G52A 4Y76A 1LO6A 4ZKRU 1XUJA 1TMTH 2ZF0H 4WH6A 4DCDA 2ZFRH 3A7ZA 5EXLA 4INLA 3EQ0H 1H9IE 1SHHB 1HAGE 4ZKOU 2A4GA 2BQWB 7LPRA 5L30H 1C2JA 2PSXA 4WF8A 3P92A 1GBAA 2H5DA 4IW4E 3M37A 4KKDA 1HFDA 3E3TA 4ABGA 3RXDA 1O2TA 3KQEA 3KNXA 2PKAB 1FAXA 1YPLH 5K0HA 5GPIB 1O3BA 2G55A 3NKKA 1E37B 4NZLA 1P12E 1Z8IB 4DVAU 1XM1A 2CHAB 4X2VA 1C4V2 1JXPA 2CXVA 2ZQ2A 2I6SA 2LNCA 3MH4A 2V6NA 1ELAA 1C1OA 1HDTH 3P17H 1JBUH 3TGJE 2OC1A 3MFJA 1J17T 1HYLA 5L2YH 5TCCA 1C2LA 1NM6A 1F0TA 2ZU5A 1TBQH 1J16A 1K1JA 2QXHA
chains in the Genus database with same CATH superfamily
3VXEH 1GBFA 1XUIA 1O2UA 4GCHF 4ABIA 4X1RU 4CRCA 1KLJH 2ZTZA 1W2KH 1E1RD 1KDQA 2QYIA 1UVUH 1HJ9A 1S84A 3MWIU 1Q2WA 4A1VA 4U30A 2ZI2H 5TCAA 1T8NA 2V0BA 2BDYA 2BOKA 1BJUA 1MTUA 1PYTD 3F3BA 2LP6A 3UFAA 1CA8B 5EODA 2PTCE 1GMDF 3FP8E 1GHZA 2ZC9H 2F9VA 2WHXA 3UWIA 3ZYEA 3KIDU 1SVPA 1G3EA 4Y0YE 4RT1A 1ELVA 3UQVA 4DY7B 1K1OA 4WMDA 4WVPE 1L2EA 2BD9A 2OBQA 2QY0B 1MD7A 3H7OA 1GCTB 3A83A 1MABB 1OWIA 3M35A 2JDID 5KGOA 3LGYA 3RU4D 2ZECA 3VGCC 4B1TA 1WOFA 2NU3E 1O2XA 2QXIA 2O8TA 3PTNA 4MVNA 5FHTA 1MQ5A 4M9FA 2C4FH 2ZDVH 3F1SB 3RU4T 3SBKA 3U69H 3D65E 1TABE 4AYVB 2FYRA 2M2AA 1NPMA 1C5LH 1Z6EA 1VITF 4FETA 4D7GA 1GHAF 1UMAH 5I46H 1VZQH 5DP4A 2ALPA 5BPEA 3URDA 2Y82A 1G30B 1CHOF 1QQUA 1LVYA 3PTBA 1C5WB 1GCDA 3NXPA 2O8WA 2ZFSA 2GV6A 2YNAA 1K1PA 2QGRA 1O2JA 5HKKD 1SLXB 3GY7A 4X6OA 1BHXF 3DA9B 1H9LB 1C5UA 2ANMH 1CHGA 1KTSB 5HYOA 4WXIA 2PKSC 4ABDA 2C3SA 3P95A 2QCYA 2SGAA 1AKSB 1ETRH 4I8LA 3A80A 4NIWA 2HRVA 2RFKC 1N8OC 3O8DA 1YPHE 5E0HA 1IQJA 2EI7A 1ZRBA 2A4RA 2KCAA 2QF4A 3RXUA 8LPRA 3VB3A 1VCPA 1ANDA 1BJVA 1AE8H 1FAKH 1ANEA 1A0JA 4XOJA 1Z8JB 4LK4A 3B23B 5J4SA 1AVXA 2BLQA 1K1IA 1UW7A 1Y8TA 2J98A 3SI3H 4H4FA 2ZU4A 1ZTKA 1GJBB 2BM2A 1HIAA 1HAXB 4JZ1A 3QTVH 2VIVA 3MH5A 4HG6A 1H8IH 1TRNA 1TGBA 1EJNA 3PMHB 5SGAE 3BTFE 3M7UA 2ZU2A 1P02A 4A7IB 1YLCA 2A7JA 1MTNB 2OQUA 6CHAC 1W7GH 2BY5X 3GCTF 2STAE 5EGMA 2FTMA 3MMGA 3AASA 3TH2H 1QBOA 3S9AA 1K1LA 3QDZB 5L2ZH 1ELBA 2C8XB 2XWAA 2AMQA 3SUDA 1SGQE 1ESAA 1O2ZA 3A86A 3UUZA 1TA2A 1O2VA 3EBNA 6GCHG 1HBTH 4HTCH 2OUAA 1OPHB 1OKXA 1OX1A 1W10U 3A82A 4XBBA 2J94A 1KXDA 2VWNA 3Q77A 1H8DH 2L74A 5FL7D 1AVWA 4AYYB 1TGSZ 1F0SA 1GI1A 3LPRA 5C0UA 3A7TA 1IQEA 2A45B 2AH4X 2VIPA 5F8ZA 7ESTE 3H09A 4Q4LA 1F5LA 3UIRA 1FLEE 4M7GA 1KIGH 1MKXH 2IPHA 2ZTYA 3U1IB 1WUNH 3KHVA 2JJ2D 1S0RA 1O31A 2CJIA 5GIBA 1C1SA 1YPKH 3EA7A 2VIOA 4AG2A 2FM2A 4B2AA 1TIOA 4KTUA 1TPSA 2UUFB 1IHTH 1QNJA 1UCYK 5GCHG 4NIXA 5DP9A 1BTXA 2ILNA 4KP0A 3FKSD 1DWCH 5C67A 1C2IA 2A32A 5HM2A 3E0PB 3HGNA 5AF9H 5C5NA 1SFQB 1UHBB 3RXBA 2SFAA 1K0HA 1QJ1B 1YCPH 1BRBE 4BANB 1GG6C 3NPSA 4GHTA 4NGAH 1GHXH 3VB5A 2FOMB 5EJLA 2ZCLP 3KQCA 1FN8A 1SL3A 3H7TA 3ATMA 5EXMA 1RFNA 3LOXA 1ZLRA 2GMTC 1GJ9B 1UVSH 3A7YA 4MG3A 2VVCA 1WTHD 3KQBA 1T4UH 5CHAB 3NWUA 3GS9A 4H6SB 1NC6A 2STBE 1UO6A 1S6HA 3RC5A 3DCLA 2XBWA 2FODA 2PLXA 1ELDE 1NRRH 1ETTH 1A4WH 5K7RA 2Z3CA 3DT0H 1P04A 2JETB 3MO3A 3ZVFA 1V2OT 1Z7KA 5LGOA 1A46H 3HGPA 3M5LA 1WQVH 1MTSA 5EW2H 1EAIA 3GCNA 5C1XA 3MH6A 1ELGA 1GJDB 2HPQH 2VVVA 1SGPE 1OP8A 4UDWH 1O2HA 1LKBA 3TH4H 1HV7A 3ZZ4A 9ESTA 1CBWB 2NU1E 3PROA 1Y59T 3GY6A 4GAWA 1RXPA 1V2MT 1SLVB 1XMNB 3DD2H 3ZIAD 2ZA5A 2F91A 1AY6H 5EQQA 1SGTA 5F8TA 4JZEH 2O8LA 4JZIA 1O0DH 1A61H 1O3HA 3ZYDA 2HNTE 3URCA 1YF4A 3G01A 1CO7E 2SGQE 4F49A 3HATH 1ESTA 3NK8A 1DFPA 1TRYA 1E79D 1C1QA 3AW0A 2G5VA 5FX6A 1FXYA 2NWNA 3F9GA 3O8RA 1TNKA 1O38A 3BN9A 2TBSA 1DANH 1XUFA 2KM0A 5DP3A 4TWWA 3ZVCA 3SGQE 9LPRA 1GJAB 1FI8A 1GBTA 1KSNA 3TK5A 1F2SE 2FO9A 4CRBA 3KL6A 4RI0A 1ABIH 1DWDH 5DPAA 4FUHA 3OY5U 2ZDLA 3TGIE 1AUTC 2Z9GA 3RMOH 4Q80A 1A0LA 1GJ5H 1V2TT 3SV8A 1K1NA 1XUGA 4MDSA 1HJAB 1V2VT 1O39A 5AHGH 1H8ED 1CA0C 1ZMNA 4LOYH 4PROA 3RXOA 1Q3XA 2HWLB 1O3PB 3NUMA 3RMLH 4OM9A 3RXIA 2GJGA 3ENSB 1MU8B 1ARBA 2P93A 4IMQA 1YGCH 1O3JA 1FNIA 4HFPB 1DUEA 2R9PA 3ATLA 1EB1H 5DO4H 2G4TA 4JK6A 2XC0A 3KYFA 1GJCB 3PV4A 3ODDA 3LGIA 4A92A 2WPLS 4CH8B 1X7AC 3SOSA 4DIHH 1TBZH 3A88A 4X1NU 1DSTA 3P8FA 1PQ7A 2FYQA 1E1QD 3LU9B 1Z8GA 3LKWA 1Z1JA 3EGKH 2J95A 4OS5A 3EAJA 3R0FA 1O3EA 4NG9H 3P8OA 2D8WA 3BG8A 1A1RA 2VU8E 1TNJA 4INHA 2AFQB 1PPGE 2Q6DA 1TQ0B 2GX4A 1GVZA 5LPRA 3SV2H 1YLDA 1SPJA 1RTFB 2R3YA 3RXGA 1O3LA 2HGTH 1P2OA 3D49H 1IQNA 5FAHA 3BTTE 2WZQA 1Y3YA 3FN8A 1A5GH 5EJ1A 1UK3A 1EZQA 2GDDA 2XBYA 2XYAA 1TPAE 3STJA 3ESTA 1BRUP 1TX8A 4ZKSU 1QTFA 3PMJA 3GY5A 1GL1A 4VGCB 2KCYA 4Y11E 3DFJA 1E36B 1K28D 3EDXB 1GHVH 4MTBA 1UTNA 4ISNA 2TGTA 4BXWA 2W3KA 3EE0B 5C3NA 3PM3A 4DGJA 3D62A 3ATWA 4X1PU 2B9LA 1HAOH 3M7QA 4X6PA 1W0KD 1NO9H 2FESH 1UVOA 3S9BA 1CGHA 3LT3A 1TNLA 1GDUA 3KYGA 2UWLA 3GCHB 3T27A 3QZRA 4JK5A 1AIXH 1DDJA 2XWBI 4B75A 1ZPCA 2LELA 3SQHE 1BBRE 1BQYA 1UTJA 5TJXA 5BRRE 1WQSA 2CK3D 5FCRA 2YOLA 1BMMH 3ZZBA 2RA0A 1V2LT 2TPIZ 3ZVGA 4ASUD 4MLFB 1C5MD 1FONA 1JOUB 5DP6A 5LPEA 1GMHG 2P8OC 1P10A 1TONA 3I78A 2VBCA 1O5EH 4U01A 5C94A 4UFEH 1C2HA 3KF2A 2PKSB 2V35A 1BUIA 4THNH 3ZVDA 3SUFA 2Z94A 1EKBB 1GMCG 1O3OA 3MO9A 1UK2A 1GHBF 1ZMJA 1DOJA 1N1LA 4B6EA 4YTAA 1EATA 2DE9A 1DXPA 3K6YA 4NA7A 1DPOA 2ULLA 1K1MA 1AQ7A 2BD4A 4JYUH 3SNEA 2KFWA 3IITA 4OS2A 1GGDB 2CF9H 1GJ7B 3TITA 1O2PA 4UE7H 1MBMA 2QXJA 1ZR0A 2V3HH 4HGCA 1AE5A 3EE7A 4X8VH 3GDVA 5IDKA 3TJVA 1NY22 4I33A 1O3GA 1YY3A 3TGKE 4GSOA 2ZHFH 3UNSA 1BBRH 4B6FA 2PV9B 3TVJB 5FBEA 2BDHA 2B8OH 1AZZA 2C8YB 1ELFA 1NFXA 1EB2A 3T26A 1ZTJA 2ZGHA 3E90B 2RA3A 1BRAA 3QGJA 3RXLA 1DS2E 1KXCA 2GZ8A 1YM0A 2JKHA 6CHAB 3BTQE 5G4BA 2FI4E 1FJSA 1O2RA 2R2MB 3AK5A 1TE0A 3KN2A 3TNSA 3KGPA 1P2IA 4CRFA 2ZG0H 1C2FA 2F3CE 4I8KA 2VIWA 1G37A 3PWCA 3N7DA 2BXUH 1TGTA 1QR3E 1ZMLA 1AO5A 2ZDKA 1VCQA 3OU0A 4YO9A 2OD3B 1ZHRA 2VIQA 2W6JD 2YMSB 2A0QB 5E0GA 4ZXYH 3RLWH 4DURA 4YT6H 5E0JA 2SGFE 1MU6B 2TRMA 4QT8C 2BDIA 3P70B 2CV3A 3TJNA 1EQ9A 4Z1MD 4AGKA 1V3XA 2D26C 4NIVA 1DVAH 1IOEA 1AD8H 1O5BB 1GI0A 1GI9B 2RDLA 2WUCA 1SB1H 3RXAA 4IN1A 1C9TA 4ACAA 1QL9A 3SYJA 4I8JA 2K1QA 5I25A 4TY7A 4AOQA 1HAPH 4K8BA 2WPDD 5DGJA 2KCPA 5A0BA 1TFXA 4TSFD 1SI5H 1VR1H 2FS9A 3EYDA 4Q7YA 3SU6A 3ZVBA 1W0JD 4E7RG 1QGFA 2PGBB 2ZHQH 2HALA 2J5UA 1EUFA 2ZCKP 1W12U 4YOIA 1YP9A 4JYTA 1P2NA 1P57B 3V7TA 5A0AE 4FVDA 3Q3YA 2FIRH 1ORFA 1NT1A 4IGDA 1H4WA 1FIZA 1ZZZA 2ZWLH 2UUYA 3TK9A 2R0LA 1DUAA 4DJZB 1OYQA 1TAWA 2OXSA 1OYTH 5DSFA 4KELA 2BLWA 2WPIS 2P95A 1GG6B 5JPMH 4UEHH 2BVXH 1TRMA 1EPTB 3KEEA 2Z3DA 4D8NA 3UAIC 4ZHAA 4FUIA 3S9CA 4XBDA 2ZFFH 4O97A 1NESE 3TNTA 4TWYA 2Q6GA 1EJAA 1A3BH 1DITH 3UB0A 1YWUA 1U6QA 1FY4A 4CBOA 5FBIA 1O3FA 1LPKB 4WH8A 1MCVA 2WPKS 2WPHS 4XSKU 1O3KA 2ANWA 2BDCA 3N7OA 3SU5A 1D4PB 3BG4B 4INKA 5DK1A 1MZAA 2AIQA 1RS0A 2WV4A 1W3CA 4MNVA 1SGDE 2SNVA 1EZSC 3OY6U 3FP6E 5L6NH 3DSOA 1F92A 2QIQA 1NU7B 3ZZCA 4HI3A 3A84A 2CN0H 4JZFH 3RLYH 1V6DA 2SGEE 3SNBA 3QUMP 1A5HA 1SGFG 3SW2B 1XVOA 2ODPA 2A5IA 3FP7E 1O3MA 4TYDA 4Y8XA 1VITH 1QIXB 1Z1IA 1TWXB 3DFLA 2P16A 1PPCE 5T3HA 3FAOA 1S0QA 2WPMS 2OTVA 5A0CA 2OC0A 3K9XB 4J2YB 1GBCA 1BTPA 3QWCH 2WSSD 1L0ZA 4K1EA 4CH2B 2PGQB 1BITA 1YCPK 3B8JA 1BTZA 2W6ID 1MZDA 3SHCH 1FY1A 2BD8A 3T25A 2A1DB 4Q7ZA 4FUCA 1GBIA 3ATIA 2DUCA 1O2LA 2ZQ1A 3QTOH 2OINA 4D76A 3VB4A 2GCTC 5F8XA 1O3NA 2FOEA 4ABJA 1C4Y2 1CSOE 4I8HA 3RUOA 1Y3WA 1B5GH 1C5VA 1GBBA 5GDSH 1C5TA 2XBXA 2PW8H 3SJIA 1L1JA 2ZCHP 5FPSA 2JIZD 1SBWA 2ODQA 4XBCA 1DX5M 1RJXB 1WV7H 2H1UA 4OS1A 1XKBC 4FOUC 1UTPA 2GKVE 1BTYA 1NRQH 2EC9H 3ATKA 4K8YA 2I6QA 1C1WH 2KAIA 2D1JA 2ZFPH 4I31A 4OS7A 1MAYA 1V2ST 3U8TH 1GI3A 2XRCA 1ZJKA 2THFB 1HAYB 5HIYA 4ZKNU 4B71A 4YOJA 5HMAA 3RMMH 3HK3B 2AGIX 5EU8A 2XOKD 1GI7B 3OTJE 2A5AA 3VB7A 2GGVB 4CHAB 1AWFH 1O37A 1F5RA 1LPGB 3OEHD 2F9UA 3P8GA 2GCHF 2BHGA 4TPYA 4LZ1H 4NWLA 2SNWA 1HPGA 2A2XH 4BOHA 4AFUA 1XXFA 1QJ6B 1DY8A 4CR9A 5ESBA 2J98B 2EY4C 5T1VA 5CE1A 4GCHG 1QQ4A 3QZQA 2OC7A 1IQIA 1GBEA 4IBLH 3RM0H 3OYPA 2VIDA 3RMNH 1MAXA 5GXPA 4Y6DA 1EFRD 1H8HD 5DP5A 1GVKB 4F55A 4NCYA 3AW1A 2J38A 4XDEA 2PWXA 4NFFA 5AVDA 1CGJE 1SQRA 3B9FH 1C5PA 1AZ8A 3ZZ5A 1Y5UT 4AG1A 1ELEE 2VH0A 1TX6A 1LHGH 3PWBA 4SGBE 2VWOA 4KTCA 1CU1A 1OWKA 4ISOA 4D7FA 2O8MA 1NBMD 1BCUH 3DUXH 3QN7A 2FS8A 1SQTA 1OWHA 1NTPA 4A6LA 3RC4A 4ZH8A 2Z9JA 1T4VH 1INCA 1SGIB 2G00A 2Y80A 5DG6A 1UHBA 5GNDA 1QBVH 3EA8A 2J4IA 2CHAC 3ZVEA 4OS6A 1O35A 2XNIA 2FX6A 3LIWA 2XBVA 1IQGA 4CBNA 2BY8X 2P59A 2ZIQH 1UTMA 1O3AA 4B2CA 1XUKA 1Q31A 3QO6A 1C1UH 3GY8A 2BZ6H 3PV2A 1GHAG 2F43B 3A7XA 1L4ZA 3BTEE 3WY8A 1QZ8A 3MHWU 2YNBA 2G4UA 1QRZA 3UQOA 1CHOG 1F5KU 3LH1A 3M5MA 4ZHMU 5T6DA 1C5QA 1H1BA 2P94A 4ZCNA 1VCWA 3BIUH 1E35B 1DXWA 5J4QA 1ANCA 3MO6A 3RC6A 3A8DA 1A7SA 5JBBS 4FU8A 1DSUA 4X2WA 2KCOA 1G36A 1P09A 3A85A 1O2IA 3PLBA 3W95A 2IPQX 2ZFTA 1BOQA 3ZZ6A 4A5TS 4J1YA 1IQLA 3GY2A 1LMWB 2ZO3H 2DE8A 4DW2U 2XNDD 3ZZDA 3L6PA 3GISB 2ZHWH 3N99A 2G81E 1EOJA 2IJD1 5C1UA 1D3DB 2GTBA 1TGCA 1V2UT 1A5IA 3S7HB 5JB9S 2PFEA 3BF6H 1T32A 1GBJA 2HVYB 2GZ9A 3V3MA 4FU9A 3QLPH 1OP0A 1J14A 1O5GH 1H9HE 4UFFH 1ZRKA 2XXLA 1TLDA 4ABBA 1SSXA 3UWJH 4AORA 1T8LA 3DSPA 1ZYOA 1MH0A 3CS7A 3SZEA 4Z6AH 1KXBA 1L1NA 2R0KA 3GCTG 3SV9A 1DY9A 4RN6A 1PQAA 1W8BH 3PYHA 1TPPA 3SU4A 1PYTC 2QF5A 5FCKA 1NRSH 3QGNB 3SHAH 1G2LA 1GVLA 1DT2A 3MU8A 1VJAU 1YKTA 1PJPA 2M5TA 2PTNA 1Z8RA 3I77A 1P2QA 2Z9IA 4CR5A 1A3EH 1EZUC 4FVBA 4GHQA 2H9HA 1QCPA 1C5RA 3E91A 1B7XB 1LKAA 1Y3XA 1OS8A 1TQ7B 2KX4A 5C0TA 3GDUA 4ZUHA 1LVMA 2FX4A 4X1SU 3NRLA 1GI2A 3SNAA 4K3JA 1PPFE 4F4OC 1KTTB 1NS3A 1PQ5A 5LPFA 2SGDE 4ABAA 4DOQA 4LXBH 3BTME 2A7CA 4H42U 4FUGA 5EW1H 1EP5A 2KR7A 2VWLA 4YESB 3RP2A 4AB9A 4B2BA 4FUBA 4NFEA 1SR5C 2F9OA 2PHBA 3R3GB 2PUXB 3OFND 2Q6FA 3BTDE 3UR9A 1RRKA 3RU4E 1HXEH 1LVBA 2FPZA 3A7VA 3TLOA 1FY3A 1TMUH 1C4U2 5JDUB 1S82A 1O2NA 5LH8A 1UCYH 3RXCA 1BBRK 3D23A 2H5CA 2ZPQA 4B74A 3M3TA 2Z9LA 4JMYA 1GI8B 1MTNC 1SOTA 2P3UB 3E0NB 2HVXA 4MPXA 1ZJDA 3L3TA 4KTSA 2BD5A 3BIVH 4Q2KA 1MQ6A 3VPKA 1BHXB 1N6YA 4AZ2B 2F9PA 2GT7A 3SU2A 1C1RA 2Y7ZA 3FANA 2VINA 3KQ5A 2BY7X 1FN6A 4I7YH 4X2YA 1P05A 1DLEA 1NFYA 2ZDAH 4B76A 1UTLM 1P01A 2EA3A 2P3TB 3S69A 4UD9H 2D2DA 1G2MA 5AFZH 1LHEH 2VB0A 2TGAA 4Q7XA 2BXTH 2WINI 4RKOB 1LHCH 3U98H 1BB0B 4Y7BA 1EJMA 2P3FH 2H9EH 4O3TA 1CT4E 1ETSH 1Y5AT 4ZHLU 3RDZA 4K60A 2BQ6B 1FMGA 3A7WA 3NZIA 1JRSA 2CF8H 4JZDH 3VGCB 1MD8A 3IWMA 4MPWA 4ISHH 5EOKA 4LZ4B 3EA9A 5AFYH 4AGJA 3CENA 1DM4B 1UTKA 2FOHA 5JBCS 3A8CA 3E16B 1OHHD 4UFGH 2BX3A 1K21H 1B0FA 3SNDA 1D6RA 1AFQC 2ODYB 1Y5BT 2W7UA 4X0WU 1V2KT 3ZV8A 5E2PA 2BLOA 1YPEH 3PLKA 5EG4A 2AYWA 2EEKA 1AVGH 2JH5D 5DP8A 2WV9A 2OQ5A 3RXJA 1DICA 4Y79A 2W26A 3F2GA 1HAVA 1QBNA 2ZKSA 2TIOA 1FY8E 1KLIH 3BTWE 5A8YA 3ZZ7A 1MKWH 1C5NH 2B0FA 2W3IA 1ZGVA 1WSSH 4B73A 3SGAE 2GCTB 5DN6D 3BV9B 1UTOA 1N8OB 1C5YB 2UUJB 3Q00A 2FOGA 5CHBA 1AI8H 3UR6A 4R0IA 2RCEA 4NSYA 4F48B 2AMPA 1DWEH 3GY3A 3W94A 7GCHG 1AWHB 1B0EA 1C9PA 2BQ7B 4UONA 5IK2D 1LCYA 1EAUA 3BTGE 2HPPH 3WW7A 2LIZA 2IOTA 2JETC 4FUFA 3RXSA 1BTHH 1SQOA 4ABFA 4K2YA 2V3MA 3PO1C 4Y0ZE 3TJOA 3UNRA 1O5CB 5EPNA 1YPGH 2WYJA 2YMSD 3KQDA 4CRAA 1P03A 2H2ZA 1S81A 3BEUA 2GVFA 3JZ2B 4A1TA 4R8TB 4MNWA 1CBWC 2OBOA 1FIWA 7KMEH 1M9UA 3FZDA 4K69A 1LPZB 2H9TH 1QRWA 5C1YA 4E05H 1ACBE 3SQEE 3VXFH 3L33A 3OEED 1WXRA 2Y5FA 1FPHH 3QK1A 3V13A 4ZMAH 1O2QA 1O2SA 4IS5A 5DP7A 3SZNA 1ZSLA 2K0QA 3SJKA 4GVUA 1C1MA 4ISIH 4X8SH 5A09A 1TBRH 2PKAA 1HRTH 1EZXC 4Y71A 1RTLA 1TGNA 1O3IA 1S6FA 1OP2A 4ISLA 4YT7H 1ESBA 1W11U 2JJ1D 1NFUA 1PPEE 3F9FA 1SHYA 3C27B 3CS0A 2VJ1A 1CQQA 4IC6A 5A8ZA 5HM9A 2G8TA 1TOMH 2B5TB 2AGEX 1MUEB 3HKIB 3S0NA 2O9QA 3MTYA 1P8VC 3TK6A 2XCNA 3F0PA 1QL7A 1L4DA 2ZU1A 4AC9A 1K22H 2FDAA 3LGTA 2VH6A 1O34A 1HJAC 2BZAA 2ANKH 2F4LA 3M61U 1QHRB 5DKMA 1GDQA 4FUJA 2J2UA 1LQDB 1SGNE 1C1TA 4Y10E 2FLRH 1FDPA 2HLDD 1GJ4H 2UWPA 1EPTA 2VVUA 1TMBH 1QL8A 4AFQA 3IG6B 2EI8A 1P11E 1C2EA 1HB0B 4DT7B 1KMHB 3VG8A 1C2KA 4OS4A 2AHME 1S85A 3PRBA 1YPJH 5E8EH 3TPIZ 3FO8D 2GMTB 4WMFA 3TH3H 4AB8A 2ZDNA 1PPZA 1C2DA 3HKJB 3OAAD 1J8AA 2QAAA 3ZV9A 2AERH 1P2KA 3T28A 5JBAS 1SLUB 1P3CA 3M7TA 1TB6H 2ASUB 2IJOB 5B6LA 2L6OA 5HXFA 1GDNA 2FOAA 2ZTXA 3SU3A 2R3UA 6GCHF 2QA9E 3LONA 1C5SA 3U1JB 1KDQB 1ZHPA 1N6XA 1GHBG 3M3VA 5FX5A 1OWJA 1AFEH 2UWOA 2Y81A 2Z7FE 2FLBH 3P6ZB 1G3CA 5F03A 4CRGA 3Q3XA 3RXEA 1TNHA 2Z6BD 1YBWA 1QJ7B 1MKXK 2Y7XA 5H4IB 5HIZA 2QC2A 2ZDMA 3T29A 1PQ8A 2W5EA 1YPMH 2GDEH 1XVMA 1WDIA 3SNCA 8GCHG 3GYMA 4RSPA 1D3TB 3A89A 4FXGH 4P02A 3RXVA 2A4OA 4Y8YA 4VGCC 1W13U 1SOZA 1O2YA 4WMEA 5GCHF 1ZOMA 1T31A 6ESTA 4YM9A 1SFIA 4TT3D 1JMOH 1EP6A 3Q3KA 5EPYA 2ZEBA 2RG3A 1TOCB 1FPCH 1P9SA 4H6TA 4D9QA 5FPYA 2OCVB 2A4QA 1EASA 4NIYA 3K6ZA 1AKSA 2W7SA 1THPB 3GCHC 3JZ1B 3RXFA 2CGAA 2FOFA 1W0YH 2BVRH 2PR3A 3F2HA 3RXKA 1GI6A 1OSSA 1FV9A 1D3PB 1YC0A 1AB9C 3AVZA 1LVOA 1P0SH 1BMAA 1SQAA 4XFQA 2FWWA 1F7ZA 5T6GA 4E7NA 1GHYH 2ZU3A 2AEIH 3O8BA 1YPHC 3BTHE 3RXPA 2AMDA 2A7HA 2PSYA 1VGCC 3T62A 1FQ3A 4MNXA 1KXAA 2ZHDA 2QN5T 3HK6B 2UUKB 1CA0B 1QFKH 4TY6A 1GBMA 1D6WA 2QE7D 1YYY1 1V2NT 1D9IA 1HXFH 1O2MA 2KZ4A 1THSH 1C1VH 1FX0B 1O2GH 1GGDC 2A2QH 1E34B 1OOKB 4RKJB 5FPTA 4Y7AA 1AUJA 3TJUA 1OXGA 3H5CB 4BAQB 1LTOA 4ESTE 1T8OA 1FY5A 3RXTA 3GDSA 1QRXA 3PMAB 4DIIH 4I8GA 2KAIB 4X6MA 1ELTA 2TGDA 4BXSA 1AMHA 1TYNA 2VGCC 1BT7A 2CMYA 4X2XA 5ESTE 1RIWC 3PRDA 2ESTE 1HIAB 3M36A 4ZAEA 1CGIE 5CMXH 1ABJH 2J9NA 1NFWA 2JH6D 1K2I1 3ZZ9A 1O5FH 1P2MA 4O9VA 1IAUA 3RXMA 4GUXA 2FI3E 5EXNA 3RXQA 1C5XB 2BD3A 2C8WB 2NU0E 1P06A 1WYKA 1Y3UA 3BSQA 3RXRA 4ASHA 3SV7A 1ARCA 2BY6X 2SGPE 4I32A 1LQEA 1V2PT 1MBQA 1SG8B 1GJ6A 1GMDG 2FZZA 3MH7A 3MU1A 1ID5H 2BB4A 4TPIZ 4OGYA 3BTKE 3F9EA 1BMFD 3A81A 4MNYA 1IHSH 3PMBB 4K5ZA 2Z3EA 2C90B 1SGFA 1TX7A 2B7DH 1O30A 1GBKA 4P00A 1T7CA 2YMSC 3BEIB 4WXVA 1BIOA 2WUBA 2Q1JA 5GWZA 4U2WA 1SGRE 1S83A 2C8ZB 2A5KA 4BAMB 3LGUA 3DHKH 3QX5H 2FTLE 3LGWA 4NA8A 1HAHH 2GV7A 1PPHE 3F68H 3MNBA 1BA8B 3T5FH 4D9RA 4E06H 3CP7A 2QXGA 1P3EA 2XTTB 5A2MH 1GI4A 1LHFH 4HZHA 4NZQA 1GBHA 2K7XA 2C93B 1A0HB 1TPOA 1C2MA 5EIYA 1IQHA 3GYLB 2ZPSA 1F0UA 1SGCA 1WU1A 1VITG 3K65B 1S5SA 1AFQB 5ETXA 2FOBA 1SGYE 2ZGJA 4FUDA 2NU4E 1COWD 4WJG2 1G32B 1O33A 5C5OA 3V12A 1C5ZB 1E0FD 1Z6JH 1QY6A 2ZGBH 4SGAE 1ZHMA 1TNGA 1O36A 1O5AB 3VFEA 2ZGCA 4BNRA 1HLTH 1V2WT 2P8OB 1NROH 1HJ8A 1ZPZA 5KEDA 2J97A 3ELAH 8ESTE 1EPTC 1F0RA 4Z0KA 3T2NA 3K2UA 5B6OA 1TA6A 5HGGA 2OLGA 1IQKA 3RM2H 3E1XB 2H6MA 3GY4A 3SJOA 5EJZA 4NSVA 3N7EA 1AN1E 3WWFA 3S7KB 2BDAA 3M5NA 3OTPA 1NZQH 1O32A 2QF0A 3UNQA 3SN8A 3LC5A 3BEFB 1JIRA 2VNTA 1GL0E 1K9OE 4MPUA 3FVFB 3BG4C 3U28C 3MQKC 1QA7A 1HCGA 1JIMA 1VJ9U 3PLPA 5A8XA 2WV5A 1OWDA 4BTTB 3PO1B 2AS9A 1ELCA 1GCTC 1MTVA 2ZZUH 3CNRA 4IMZA 4IN2A 1JWTA 2Y5GA 3OSYA 3M5OA 4FUEA 2J92A 2ZP0H 3SU0A 4DT4A 1TALA 1CVWH 1MCTA 3HPTB 4YXWD 1AHTH 4WY3A 5E2OA 4YOGA 1SC8U 2BOHB 2HNTC 1BMNH 1HGTH 1E38B 2GCHG 3TIUA 4JYVH 1P9UA 4YZUA 3LGVA 3MU5A 4DG4A 3U8OH 3VEQB 2K8IA 2GZ7A 1W7XH 1UCYE 5F6MA 2FMJA 1XXDA 2OC8A 1EXFA 2RDEA 3LDXH 5ABWA 2WYGA 1ZTLA 4Q63A 4NA9H 1DE7H 2F9NA 1GMHF 1TNIA 1C5OH 1V2QT 4BAHB 1MMJN 4UFDH 1W0ZU 3O8CA 3F2FA 1MKWK 1FUJA 3SI4H 3STIA 1GMCF 3P8NA 1XX9A 1GBLA 4YLUA 1AU8A 4A1XA 4BAKB 3FOAA 5FXLA 1IQMA 2BTCE 4XD7D 2EQNA 1KXEA 2O8UA 3LH3A 3SUGA 2OK5A 3A87A 1O2KA 2A31A 1OWEA 1UK4A 3I29A 1L1GA 2BLVA 2R2WU 4MQAA 2XCFA 1VKYA 3VB6A 1QB6A 7GCHF 3A8AA 1C1NA 2ZHEH 4BTUB 1THRH 1WBGB 4OGXA 1V2JT 2Z9KA 3SGBE 3NCLA 4WWYA 4ZROA 1FZZA 3ZZ3A 1P2JA 3U9AH 3C1KA 3DSGA 1QB1A 2BVSH 2LPRA 1CT2E 5EQRA 2FOCA 1NN6A 2ZNKH 3E8LA 2HNTF 5IYTA 2F83A 2IN2A 4YLQH 3M3SA 1ZGIA 5F53A 4CHAC 3FZZA 2TGPZ 1O5DH 3UOUA 1BDAA 2BMGB 1EOLA 5C2ZA 1YLNA 3ZVAA 2HOBA 1O3DA 1SMFE 1W14U 2WPJS 4AFSA 1XKAC 1Z71A 2BD2A 3MU0A 2PUQH 3ZZ8A 1RGQA 2BDBA 2ZGXH 1UJ1A 2G5NA 1KXFA 2BD7A 4GLYA 3F9HA 1EAXA 1G9IE 1GWAA 2GP9B 1LDTT 4Y8ZA 2BX4A 1GPZA 2XW9A 4AN7A 2ZFQH 5PTPA 3SUEA 3LJOA 2Y6TA 1CT0E 1YCPM 3RXHA 1NRPH 3MOCA 2GT8A 1D3QB 3SJ9A 1G3BA 3A8BA 4K1SA 2F9BH 2ANYA 3SO3A 4ZXXH 2AIPA 5GJ4B 1BMLA 1NRNH 5JBTA 1KY9A 1NU9A 2QV1A 1EAWA 1WAYB 3MU4A 3SU1A 1EX3A 3MYWA 4BAOB 3F6UH 5KECA 3ITIA 1IQFA 1DWBH 3UOPA 5T6FA 2XC5A 2FXRA 5JB8S 1O3CA 1RTKA 4K1TA 5DJ7A 2VWMA 5C20A 1GJ8B 1DLKB 2ALVA 3TU7H 1SKYE 3ODFA 2BDGA 3AAUA 3GCOA 2XC4A 3WWBA 4CREA 3ZZAA 1QB9A 1HAIH 1BTWA 1UVPA 3MI4A 1CE5A 2NU2E 4XE4A 2ZPRA 5EQSA 2V3OH 4RT0A 1Y3VA 4ACBA 2HLCA 4X8TH 1ANBA 1UTQA 1XUHA 4IC5A 3V0XA 3GICB 1JRTA 4ABHA 2FEQH 2PP6A 3FFGA 1BRCE 3SJ8A 2FP7B 3SORA 1MTWA 2AGGX 3LC3A 1RD3B 1G3DA 4I86A 1PFXC 1AB9B 1ZSJA 3GOVB 4FU7A 3U8RH 4ABEA 1ZPBA 3F0OA 5CHAC 2OP9A 1SLWB 2FI5E 2G51A 3AAVA 1AGJA 3E6PH 6LPRA 1J9CH 3UTUH 1VGCB 4BTIB 1O2OA 1LHDH 1QA0A 3MNSA 1HUTH 2JH0D 8KME2 1NBME 2EI6A 1HAVB 4U32A 2Y5HA 1GBDA 1HAZB 1PPBH 4NWKA 1T8MA 1KYNA 1BZXE 1WCZA 5JYIA 3SV6A 4JCNA 2BYAX 1GHWH 1SGEE 4MPVA 4X6NA 1O2WA 4X1QU 2GD4B 2QF3A 3MNCA 4AX9H 2BY9X 1A2CH 1S6LA 3KCGH 3PB1E 4O03A 8GCHF 3UREA 4CRDA 1KLTA 1C2GA 1BTUA 2J34A 4O3UA 4AFZA 1C1PA 3UY9A 3OE7D 3Q76A 4GPGA 2VGCB 4X8UH 3LJJA 3MNXA 1RIWB 1J15A 1V2RT 1WTGH 4KGAA 1UVTH 3OX7U 1GI5A 1QURH 3UPEA 1ZSKA 1HNEE 2G52A 4Y76A 1LO6A 4ZKRU 1XUJA 1TMTH 2ZF0H 4WH6A 4DCDA 5C17A 2ZFRH 3A7ZA 5EXLA 4INLA 3EQ0H 1H9IE 1SHHB 1HAGE 4ZKOU 2A4GA 2BQWB 3PV5A 7LPRA 5L30H 1C2JA 2PSXA 4WF8A 3P92A 1GBAA 2H5DA 4IW4E 3M37A 4KKDA 1HFDA 3E3TA 4ABGA 3RXDA 2V7QD 1O2TA 3KQEA 3KNXA 2PKAB 4XRNA 1FAXA 1YPLH 5K0HA 5GPIB 1O3BA 2G55A 3NKKA 1E37B 4NZLA 1P12E 1Z8IB 4DVAU 1XM1A 2CHAB 4X2VA 1C4V2 1JXPA 2CXVA 2ZQ2A 2I6SA 2LNCA 3MH4A 2V6NA 1ELAA 1C1OA 3W1EA 1HDTH 3P17H 1JBUH 3TGJE 2OC1A 3MFJA 1J17T 1HYLA 5L2YH 5TCCA 1C2LA 1NM6A 5CDFE 1F0TA 2ZU5A 1TBQH 1J16A 1K1JA 2QXHA
chains in the Genus database with same CATH topology
3VXEH 1GBFA 1XUIA 1O2UA 4GCHF 4ABIA 4X1RU 4CRCA 1KLJH 2ZTZA 1W2KH 1KDQA 2QYIA 1UVUH 1HJ9A 1S84A 3MWIU 1Q2WA 4A1VA 4U30A 2ZI2H 5TCAA 1T8NA 2V0BA 2BDYA 2BOKA 1BJUA 1MTUA 1PYTD 3UFAA 1CA8B 5EODA 2PTCE 1GMDF 3FP8E 1GHZA 2ZC9H 2F9VA 3UWIA 3ZYEA 3KIDU 1SVPA 1G3EA 4Y0YE 1ELVA 3UQVA 4DY7B 1K1OA 4WMDA 4WVPE 1L2EA 2BD9A 2OBQA 2QY0B 1MD7A 3H7OA 1GCTB 3A83A 1OWIA 3M35A 3LGYA 3RU4D 2ZECA 3VGCC 4B1TA 1WOFA 2NU3E 1O2XA 2QXIA 2O8TA 3PTNA 4MVNA 5FHTA 1MQ5A 2C4FH 2ZDVH 3F1SB 3RU4T 3SBKA 3U69H 3D65E 1TABE 4AYVB 2FYRA 1NPMA 1C5LH 1Z6EA 1VITF 4D7GA 1GHAF 1UMAH 5I46H 1VZQH 5DP4A 2ALPA 5BPEA 3URDA 2Y82A 1G30B 1CHOF 1QQUA 1LVYA 3PTBA 1C5WB 1GCDA 3NXPA 2O8WA 2ZFSA 2GV6A 2YNAA 1K1PA 2QGRA 1O2JA 1SLXB 3GY7A 4X6OA 1BHXF 3DA9B 1H9LB 1C5UA 2ANMH 1CHGA 1KTSB 5HYOA 4WXIA 2PKSC 4ABDA 2C3SA 3P95A 2QCYA 2SGAA 1AKSB 1ETRH 4I8LA 3A80A 4NIWA 2HRVA 1N8OC 3O8DA 1YPHE 5E0HA 1IQJA 2EI7A 1ZRBA 2A4RA 3RXUA 8LPRA 3VB3A 1VCPA 1ANDA 1BJVA 1AE8H 1FAKH 1ANEA 1A0JA 4XOJA 1Z8JB 4LK4A 3B23B 5J4SA 1AVXA 2BLQA 1K1IA 1Y8TA 3SI3H 4H4FA 2ZU4A 1ZTKA 1GJBB 2BM2A 1HIAA 1HAXB 4JZ1A 3QTVH 2VIVA 3MH5A 1H8IH 1TRNA 1TGBA 1EJNA 3PMHB 5SGAE 3BTFE 3M7UA 2ZU2A 1P02A 4A7IB 1YLCA 2A7JA 1MTNB 2OQUA 6CHAC 1W7GH 2BY5X 3GCTF 2STAE 5EGMA 2FTMA 3MMGA 3AASA 3TH2H 1QBOA 3S9AA 1K1LA 3QDZB 5L2ZH 1ELBA 2C8XB 2XWAA 2AMQA 3SUDA 1SGQE 1ESAA 1O2ZA 3A86A 3UUZA 1TA2A 1O2VA 3EBNA 6GCHG 1HBTH 4HTCH 2OUAA 1OPHB 1OKXA 1OX1A 1W10U 3A82A 4XBBA 2J94A 1KXDA 2VWNA 3Q77A 1H8DH 1AVWA 4AYYB 1TGSZ 1F0SA 1GI1A 3LPRA 3A7TA 1IQEA 2A45B 2AH4X 2VIPA 5F8ZA 7ESTE 1F5LA 3UIRA 1FLEE 4M7GA 1KIGH 1MKXH 2IPHA 2ZTYA 3U1IB 1WUNH 3KHVA 1S0RA 1O31A 2CJIA 5GIBA 1C1SA 1YPKH 3EA7A 2VIOA 4AG2A 2FM2A 4B2AA 1TIOA 4KTUA 1TPSA 2UUFB 1IHTH 1QNJA 1UCYK 5GCHG 4NIXA 5DP9A 1BTXA 2ILNA 4KP0A 1DWCH 5C67A 1C2IA 2A32A 5HM2A 3E0PB 3HGNA 5AF9H 5C5NA 1SFQB 1UHBB 3RXBA 2SFAA 1QJ1B 1YCPH 1BRBE 4BANB 1GG6C 3NPSA 4GHTA 4NGAH 1GHXH 3VB5A 2FOMB 2ZCLP 3KQCA 1FN8A 1SL3A 3H7TA 3ATMA 5EXMA 1RFNA 3LOXA 1ZLRA 2GMTC 1GJ9B 1UVSH 3A7YA 4MG3A 2VVCA 1WTHD 3KQBA 1T4UH 5CHAB 3NWUA 4H6SB 1NC6A 2STBE 1UO6A 1S6HA 3RC5A 2XBWA 2FODA 2PLXA 1ELDE 1NRRH 1ETTH 1A4WH 5K7RA 2Z3CA 3DT0H 1P04A 2JETB 3MO3A 3ZVFA 1V2OT 1Z7KA 5LGOA 1A46H 3HGPA 3M5LA 1WQVH 1MTSA 5EW2H 1EAIA 3GCNA 5C1XA 3MH6A 1ELGA 1GJDB 2HPQH 2VVVA 1SGPE 1OP8A 4UDWH 1O2HA 1LKBA 3TH4H 1HV7A 3ZZ4A 9ESTA 1CBWB 2NU1E 3PROA 1Y59T 3GY6A 4GAWA 1RXPA 1V2MT 1SLVB 1XMNB 3DD2H 2ZA5A 2F91A 1AY6H 5EQQA 1SGTA 5F8TA 4JZEH 2O8LA 4JZIA 1O0DH 1A61H 1O3HA 3ZYDA 2HNTE 3URCA 1YF4A 3G01A 1CO7E 2SGQE 4F49A 3HATH 1ESTA 3NK8A 1DFPA 1TRYA 1C1QA 3AW0A 2G5VA 5FX6A 1FXYA 2NWNA 3F9GA 3O8RA 1TNKA 1O38A 3BN9A 2TBSA 1DANH 1XUFA 5DP3A 4TWWA 3ZVCA 3SGQE 9LPRA 1GJAB 1FI8A 1GBTA 1KSNA 3TK5A 1F2SE 2FO9A 4CRBA 3KL6A 1ABIH 1DWDH 5DPAA 4FUHA 3OY5U 2ZDLA 3TGIE 1AUTC 2Z9GA 3RMOH 4Q80A 1A0LA 1GJ5H 1V2TT 3SV8A 1K1NA 1XUGA 4MDSA 1HJAB 1V2VT 1O39A 5AHGH 4LOYH 1CA0C 1ZMNA 3RXOA 4PROA 1Q3XA 2HWLB 1O3PB 3NUMA 3RMLH 3RXIA 3ENSB 1MU8B 1ARBA 2P93A 4IMQA 1YGCH 1O3JA 1FNIA 4HFPB 1DUEA 2R9PA 3ATLA 1EB1H 5DO4H 2G4TA 4JK6A 2XC0A 1GJCB 3PV4A 3ODDA 3LGIA 4A92A 2WPLS 4CH8B 1X7AC 3SOSA 4DIHH 1TBZH 3A88A 4X1NU 1DSTA 3P8FA 1PQ7A 2FYQA 3LU9B 1Z8GA 3LKWA 1Z1JA 3EGKH 2J95A 4OS5A 3EAJA 3R0FA 1O3EA 4NG9H 3P8OA 2D8WA 3BG8A 1A1RA 2VU8E 1TNJA 4INHA 2AFQB 1PPGE 2Q6DA 1TQ0B 2GX4A 1GVZA 5LPRA 3SV2H 1YLDA 1SPJA 1RTFB 2R3YA 3RXGA 1O3LA 2HGTH 1P2OA 3D49H 1IQNA 5FAHA 3BTTE 1Y3YA 1A5GH 1UK3A 1EZQA 2GDDA 2XBYA 2XYAA 1TPAE 3STJA 3ESTA 1BRUP 1TX8A 4ZKSU 1QTFA 3PMJA 3GY5A 1GL1A 4VGCB 4Y11E 3DFJA 1E36B 1K28D 3EDXB 1GHVH 4MTBA 1UTNA 4ISNA 2TGTA 4BXWA 2W3KA 3EE0B 5C3NA 3PM3A 4DGJA 3D62A 3ATWA 4X1PU 2B9LA 1HAOH 3M7QA 4X6PA 1NO9H 2FESH 1UVOA 3S9BA 1CGHA 3LT3A 1TNLA 1GDUA 2UWLA 3GCHB 3T27A 3QZRA 4JK5A 1AIXH 1DDJA 2XWBI 4B75A 1ZPCA 5BRRE 3SQHE 1BBRE 1BQYA 1UTJA 5TJXA 1WQSA 5FCRA 2YOLA 1BMMH 3ZZBA 2RA0A 1V2LT 2TPIZ 3ZVGA 4MLFB 1C5MD 1FONA 1JOUB 5DP6A 5LPEA 1GMHG 2P8OC 1P10A 1TONA 3I78A 1O5EH 4U01A 4UFEH 1C2HA 3KF2A 2PKSB 2V35A 1BUIA 4THNH 3ZVDA 3SUFA 2Z94A 1EKBB 1GMCG 1O3OA 3MO9A 1UK2A 1GHBF 1ZMJA 1DOJA 1N1LA 4YTAA 1EATA 2DE9A 1DXPA 3K6YA 4NA7A 1DPOA 2ULLA 1K1MA 1AQ7A 2BD4A 4JYUH 3SNEA 3IITA 4OS2A 1GGDB 2CF9H 1GJ7B 3TITA 1O2PA 4UE7H 1MBMA 2QXJA 1ZR0A 2V3HH 4HGCA 1AE5A 4X8VH 5IDKA 3GDVA 3TJVA 1NY22 4I33A 1O3GA 3TGKE 4GSOA 2ZHFH 3UNSA 1BBRH 2PV9B 3TVJB 5FBEA 2BDHA 2B8OH 1AZZA 2C8YB 1ELFA 1NFXA 1EB2A 3T26A 1ZTJA 2ZGHA 3E90B 2RA3A 1BRAA 3QGJA 3RXLA 1DS2E 1KXCA 2GZ8A 1YM0A 2JKHA 6CHAB 3BTQE 5G4BA 2FI4E 1FJSA 1O2RA 2R2MB 1TE0A 3KN2A 3TNSA 3KGPA 1P2IA 4CRFA 2ZG0H 1C2FA 2F3CE 4I8KA 2VIWA 1G37A 3PWCA 2BXUH 1TGTA 1QR3E 1ZMLA 1AO5A 2ZDKA 1VCQA 3OU0A 4YO9A 2OD3B 1ZHRA 2VIQA 2A0QB 5E0GA 4ZXYH 3RLWH 4DURA 4YT6H 5E0JA 2SGFE 1MU6B 2TRMA 4QT8C 2BDIA 3P70B 2CV3A 3TJNA 1EQ9A 4AGKA 1V3XA 2D26C 4NIVA 1DVAH 1IOEA 1AD8H 1O5BB 1GI0A 1GI9B 2RDLA 2WUCA 1SB1H 3RXAA 4IN1A 1C9TA 1QL9A 4I8JA 2K1QA 5I25A 4TY7A 4AOQA 1HAPH 4K8BA 5DGJA 5A0BA 1TFXA 1SI5H 1VR1H 2FS9A 3EYDA 4Q7YA 3SU6A 3ZVBA 4E7RG 1QGFA 2PGBB 2ZHQH 2HALA 2ZCKP 1EUFA 1W12U 4YOIA 1YP9A 4JYTA 1P2NA 1P57B 3V7TA 5A0AE 4FVDA 3Q3YA 2FIRH 1ORFA 1NT1A 4IGDA 1H4WA 1FIZA 1ZZZA 2ZWLH 2UUYA 3TK9A 2R0LA 1DUAA 4DJZB 1OYQA 1TAWA 2OXSA 1OYTH 4KELA 2BLWA 2WPIS 2P95A 1GG6B 5JPMH 4UEHH 2BVXH 1TRMA 1EPTB 3KEEA 2Z3DA 4D8NA 4ZHAA 4FUIA 3S9CA 4XBDA 2ZFFH 4O97A 1NESE 3TNTA 4TWYA 2Q6GA 1EJAA 1A3BH 1DITH 1U6QA 1FY4A 4CBOA 5FBIA 1O3FA 1LPKB 4WH8A 1MCVA 2WPKS 2WPHS 4XSKU 1O3KA 2ANWA 2BDCA 3N7OA 3SU5A 1D4PB 3BG4B 4INKA 5DK1A 1MZAA 2AIQA 1RS0A 2WV4A 1W3CA 4MNVA 1SGDE 2SNVA 1EZSC 3OY6U 3FP6E 5L6NH 1F92A 2QIQA 1NU7B 3ZZCA 4HI3A 3A84A 2CN0H 4JZFH 3RLYH 1V6DA 2SGEE 3SNBA 3QUMP 1A5HA 1SGFG 3SW2B 1XVOA 2ODPA 2A5IA 3FP7E 1O3MA 4TYDA 4Y8XA 1VITH 1QIXB 1Z1IA 1TWXB 3DFLA 2P16A 1PPCE 5T3HA 3FAOA 1S0QA 2WPMS 2OTVA 5A0CA 2OC0A 3K9XB 4J2YB 1GBCA 1BTPA 3QWCH 1L0ZA 4K1EA 4CH2B 2PGQB 1BITA 1YCPK 3B8JA 1BTZA 1MZDA 3SHCH 1FY1A 2BD8A 3T25A 2A1DB 4Q7ZA 4FUCA 1GBIA 3ATIA 2DUCA 1O2LA 2ZQ1A 3QTOH 2OINA 4D76A 3VB4A 2GCTC 5F8XA 1O3NA 2FOEA 4ABJA 1C4Y2 1CSOE 4I8HA 3RUOA 1Y3WA 1B5GH 1C5VA 1GBBA 5GDSH 1C5TA 2XBXA 2PW8H 3SJIA 1L1JA 2ZCHP 5FPSA 1SBWA 2ODQA 4XBCA 1DX5M 1RJXB 1WV7H 2H1UA 4OS1A 1XKBC 1UTPA 2GKVE 1BTYA 1NRQH 2EC9H 3ATKA 4K8YA 2I6QA 1C1WH 2KAIA 2D1JA 2ZFPH 4I31A 4OS7A 1MAYA 1V2ST 3U8TH 1GI3A 2XRCA 1ZJKA 2THFB 1HAYB 4ZKNU 4B71A 4YOJA 5HMAA 3RMMH 3HK3B 2AGIX 5EU8A 1GI7B 3OTJE 2A5AA 3VB7A 2GGVB 4CHAB 1AWFH 1O37A 1F5RA 1LPGB 2F9UA 3P8GA 2GCHF 2BHGA 4TPYA 4LZ1H 4NWLA 2SNWA 1HPGA 2A2XH 4BOHA 4AFUA 1XXFA 1QJ6B 1DY8A 4CR9A 5ESBA 5CE1A 4GCHG 1QQ4A 3QZQA 2OC7A 1IQIA 1GBEA 4IBLH 3RM0H 3OYPA 2VIDA 3RMNH 1MAXA 5GXPA 4Y6DA 5DP5A 1GVKB 4NCYA 3AW1A 2J38A 4XDEA 2PWXA 4NFFA 5AVDA 1CGJE 3B9FH 3ZZ5A 1C5PA 1AZ8A 1Y5UT 4AG1A 1ELEE 2VH0A 1TX6A 1LHGH 3PWBA 4SGBE 2VWOA 4KTCA 1CU1A 1OWKA 4ISOA 4D7FA 2O8MA 1BCUH 3DUXH 3QN7A 2FS8A 1SQTA 1OWHA 1NTPA 4A6LA 3RC4A 4ZH8A 2Z9JA 1T4VH 1INCA 1SGIB 2G00A 2Y80A 5DG6A 1UHBA 1QBVH 3EA8A 2J4IA 2CHAC 3ZVEA 4OS6A 1O35A 2XNIA 2FX6A 3LIWA 2XBVA 1IQGA 4CBNA 2BY8X 2P59A 2ZIQH 1UTMA 1O3AA 4B2CA 1XUKA 1Q31A 3QO6A 1C1UH 3GY8A 2BZ6H 1GHAG 3A7XA 1L4ZA 3BTEE 3WY8A 3MHWU 2YNBA 2G4UA 1QRZA 3UQOA 1CHOG 1F5KU 3LH1A 3M5MA 4ZHMU 5T6DA 1C5QA 1H1BA 2P94A 1VCWA 3BIUH 1E35B 1DXWA 5J4QA 1ANCA 3MO6A 3RC6A 3A8DA 1A7SA 5JBBS 4FU8A 1DSUA 4X2WA 1G36A 1P09A 3A85A 1O2IA 3PLBA 3W95A 2ZFTA 3ZZ6A 1BOQA 4A5TS 4J1YA 1IQLA 3GY2A 1LMWB 2ZO3H 2DE8A 4DW2U 3ZZDA 3L6PA 3GISB 2ZHWH 2G81E 1EOJA 5C1UA 1D3DB 2GTBA 1TGCA 1V2UT 1A5IA 3S7HB 5JB9S 2PFEA 3BF6H 1T32A 1GBJA 2GZ9A 3V3MA 4FU9A 3QLPH 1OP0A 1J14A 1O5GH 1H9HE 4UFFH 1ZRKA 2XXLA 1TLDA 4ABBA 1SSXA 3UWJH 4AORA 1T8LA 1ZYOA 1MH0A 3CS7A 4Z6AH 1KXBA 1L1NA 2R0KA 3GCTG 3SV9A 1DY9A 4RN6A 1PQAA 1W8BH 3PYHA 1TPPA 3SU4A 1PYTC 5FCKA 1NRSH 3QGNB 3SHAH 1G2LA 1GVLA 1DT2A 3MU8A 1VJAU 1YKTA 1PJPA 2M5TA