1LVOA

Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
299
structure length
299
Chain Sequence
SGLRKMAQPSGLVEPCIVRVSYGNNVLNGLWLGDEVICPRHVIASDTTRVINYENEMSSVRLHNFSVSKNNVFLGVVSARYKGVNLVLKVNQVNPNTPEHKFKSIKAGESFNILACYEGCPGSVYGVNMRSQGTIKGSFIAGTCGSVGYVLENGILYFVYMHHLELGNGSHVGSNFEGEMYGGYEDQPSMQLEGTNVMSSDNVVAFLYAALINGERWFVTNTSMSLESYNTWAKTNSFTELSSTDAFSMLAAKTGQSVEKLLDSIVRLNKGFGGRTILSYGSLCDEFTPTEVIRQMYGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Replicase, hydrolase domain
publication title Structure of coronavirus main proteinase reveals combination of a chymotrypsin fold with an extra alpha-helical domain.
pubmed doi rcsb
source organism Transmissible gastroenteritis virus
total genus 82
structure length 299
sequence length 299
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 1lvoA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1lvoA01
1EASA 2BXTH 1DE7H 1OKXA 2C4FH 1A5GH 1SB1H 1UTPA 2BOKA 2P93A 1YF4A 3F9HA 2OCVB 4TPYA 3MH7A 2XW9A 1GI2A 1J8AA 3H5CB 5FCRA 3LC3A 3D49H 1XKAC 3BV9B 5DP6A 4AG1A 8KME2 1ESBA 1QL8A 3S69A 3SJ8A 1PQ8A 4I33A 3I29A 3RXEA 4FUEA 1TPAE 3RM0H 1K22H 2Z3CA 1W0ZU 1GHWH 2PKAB 1GCTB 2PTCE 4MLFB 4K1TA 2C8WB 1V3XA 2PKSB 4YOIA 1WOFA 2QIQA 1EX3A 1QHRB 1YYY1 4NSYA 3TGJE 1A7SA 1AZZA 5EOKA 3ZVAA 1AUTC 2SNVA 4I7YH 2GCTC 1ZTJA 1KTSB 1TX7A 3RU4T 3R3GB 1TPOA 1YP9A 1JMOH 1KY9A 1QURH 1ZRBA 5JBTA 2JH0D 3VFEA 1HAZB 1GMDG 1O2QA 1LDTT 1GJ8B 4Q7XA 1MD8A 1ANEA 3P8OA 1Y3XA 1FLEE 2PFEA 4IC5A 3SV7A 1L2EA 1LCYA 1G36A 3M5OA 1O34A 1Q3XA 3LH1A 3PTBA 2GDDA 1SGEE 1NZQH 4DVAU 1S0QA 1DWBH 2F9BH 1MBMA 1V2MT 1ZPBA 1U6QA 2Z94A 2XRCA 3OX7U 3SV6A 1MTUA 3ATKA 1HJ8A 2ZDMA 5JB9S 1AE8H 2V0BA 4YM9A 5DP4A 2FDAA 4AFUA 1EOJA 1V6DA 2ZU3A 1SGQE 1YCPK 4IW4E 2FS8A 4OS5A 3V13A 2ILNA 2GV7A 1YLDA 2SGFE 3A88A 1D9IA 1QNJA 2VIDA 2XC0A 4TYDA 1VJAU 1WV7H 1ZSJA 3LU9B 3SNEA 1YPLH 3OSYA 1THRH 1E34B 4UDWH 1YPKH 4ISLA 1UK3A 3VPKA 3ZZ6A 4NA9H 1T32A 4TY6A 1O3DA 1G37A 1Z6EA 3HGPA 1ESAA 1UVSH 1O3BA 1O2IA 2XWBI 1SLUB 4ABBA 5EPNA 1PQAA 1O2JA 4Z6AH 1LHEH 1BTHH 1UVTH 2FP7B 3FAOA 1TNHA 4X6MA 3U8RH 1EKBB 3SI4H 4OGYA 4ZKRU 4SGAE 2PUXB 2ZGHA 2P8OC 3PYHA 3RXUA 4HZHA 1UK4A 1KXCA 2FX4A 2GT8A 1ZYOA 1KXBA 5F8TA 1C2JA 1TRMA 4U01A 1QQ4A 4Y10E 4B2CA 4MG3A 3TVJB 4X6PA 1GBTA 1S0RA 2EC9H 2FOMB 3RM2H 2HVXA 4K5ZA 3ZVCA 5C20A 5TJXA 3I78A 3KGPA 3PB1E 4ABFA 1QBNA 4WWYA 3MU5A 1TMUH 4FU7A 2UWOA 3RXAA 1W12U 3S9AA 7GCHF 4X2WA 2A5KA 1H9LB 2NU3E 3MI4A 2H9TH 1VCPA 2ZA5A 4KTSA 1AKSA 4CRGA 5A0BA 1TABE 4YO9A 2TGTA 3BTDE 3UTUH 7GCHG 2PGBB 1C1WH 5E2OA 1EPTC 4IBLH 1LKBA 2BDIA 2BVRH 1V2ST 2NU4E 1LPZB 2BD3A 4GAWA 1KDQA 1D3DB 4XE4A 1UVUH 2FYQA 4XOJA 1BMMH 1IQNA 3ZZ4A 2A4OA 4NIWA 1A0HB 1W7GH 3DA9B 1A61H 1OWJA 1EB1H 4MNWA 2ZU4A 1C5WB 1RRKA 2ODYB 1OOKB 2TGDA 3TNSA 4K1EA 2JH5D 1CHOF 4ZKSU 2OC7A 3SO3A 2OC8A 1GBKA 1CHOG 1MUEB 1PQ7A 2Y82A 1C5NH 4UFGH 1IQEA 2FO9A 1W7XH 4X8SH 3JZ2B 4X6OA 2JH6D 2WINI 5FAHA 3MO6A 2PWXA 2PV9B 1C1MA 3O8BA 2HRVA 1O31A 3E0NB 1LVYA 1L1JA 1GDQA 1BRUP 5J4QA 1GCDA 5L6NH 4O03A 2GCTB 3ELAH 2FMJA 5A0AE 1K1NA 2CGAA 1FY8E 1NT1A 5GXPA 2Y5FA 3N7OA 4AX9H 1TX8A 1SOZA 3VB3A 3NXPA 3UR6A 1ORFA 2PHBA 2Y81A 4GUXA 2BVSH 4ZH8A 4NFEA 3SZNA 4U32A 1GJ6A 1S85A 2UUKB 3GY8A 3VXEH 1MTNC 2M5TA 3TH2H 2BD4A 1PPFE 3KQCA 1YPMH 1AIXH 1O0DH 2QC2A 2BQ7B 1P10A 3LKWA 3M37A 1FUJA 3A7XA 3LDXH 1GMHF 1GBIA 2ALVA 1OPHB 2J34A 2J95A 3OTJE 4E05H 4UONA 2VVVA 1GI8B 1GMHG 4NSVA 2ANYA 1UTKA 1AVXA 3Q77A 1O3FA 1DSTA 2GD4B 3TJOA 2SGEE 1O35A 2BD9A 3EA9A 3MU1A 2A7JA 2OQUA 3H7TA 1NC6A 2NWNA 4B75A 4FUIA 2VIQA 1V2WT 4RKJB 1O33A 5L2YH 3A87A 4FUGA 1IQIA 2HPQH 4X2XA 4FUFA 3UQVA 5C3NA 1P09A 3BSQA 2QXGA 2BHGA 1MTVA 3F1SB 3F68H 3TJVA 1SGYE 1YC0A 2AERH 1GI0A 1QFKH 1C5UA 3PMBB 2H5CA 2ZZUH 1YPJH 1V2OT 4BXSA 4X1PU 5T3HA 1LHDH 5HXFA 1HAOH 2PR3A 1GBHA 1O5BB 1OP8A 4A7IB 2VWLA 1GHZA 1YM0A 1HV7A 1W8BH 3VGCC 4UFDH 3EAJA 2O9QA 2P8OB 3TGKE 1YPEH 2F91A 4D9RA 1IQKA 2NU1E 2Q1JA 1G2LA 2Z9GA 8GCHF 1EJNA 1SL3A 3RXCA 2QA9E 6LPRA 1C4Y2 2QF0A 1CBWC 1TRYA 3ZVBA 1EAUA 8GCHG 5GIBA 3PLBA 1YPGH 3ATWA 3S9BA 4OS4A 5TCAA 1OWDA 1SQOA 1FPCH 4AGJA 4BAMB 2GV6A 5FBEA 4MQAA 1AO5A 2TGPZ 3E16B 2ZU1A 1HXEH 1O3KA 4GHTA 2J38A 4ISOA 3MO3A 1EPTB 4X8UH 2ZDVH 3ENSB 4KELA 1P01A 5A2MH 1C2DA 1SHHB 5DO4H 4YLQH 2QXHA 2UWLA 3MU8A 2DE8A 1ELAA 5DJ7A 1V2NT 1AU8A 2GKVE 1BIOA 1NU7B 3SV9A 4BTTB 1C5MD 3RDZA 1BJUA 2O8UA 4WXIA 1DUAA 3G01A 1FY1A 1J9CH 2ZI2H 1N8OB 1WU1A 1C2GA 2ZG0H 1FI8A 5A0CA 1X7AC 1NY22 1O3CA 1TNLA 2G4TA 2QAAA 3RXTA 3GDVA 4D7FA 2F83A 1VGCC 4FVDA 5E8EH 1SOTA 1P2MA 1RTFB 2B5TB 3TPIZ 3W95A 1GPZA 1MCTA 1AUJA 1C1QA 2B8OH 4Y71A 3M3SA 3URDA 3GICB 1FY3A 1LHFH 2XCFA 1QTFA 2OINA 1LO6A 1PPGE 1VITH 1BRAA 5JPMH 3DFLA 3L3TA 3ZZAA 2CF9H 2ZPSA 4KKDA 2AGIX 2ZWLH 2BTCE 3A8DA 1THPB 1TOMH 2ZTZA 4SGBE 1RGQA 4B74A 4DJZB 2ZHWH 3E1XB 3P92A 1CHGA 3DUXH 2A1DB 2OBOA 1V2LT 1ABJH 3NK8A 1C5ZB 1IAUA 2GX4A 1HAVB 5DKMA 1P02A 1BA8B 1MTNB 2R3UA 1C5PA 1F7ZA 3KIDU 3MFJA 3ATMA 1P2KA 1SFQB 3UWIA 4Z0KA 3HATH 1UTQA 2W5EA 3PMAB 1HB0B 2VVUA 1TFXA 3I77A 3NZIA 4X6NA 3RXJA 4Y7BA 3A7YA 4X0WU 2ZU2A 3GY2A 1TONA 4ZKNU 4K69A 1C5LH 1EJMA 3UIRA 2SFAA 4Y11E 5CMXH 1CGJE 3T62A 1SMFE 1P06A 1DM4B 1AN1E 2AS9A 4K2YA 2BVXH 3RXIA 2ZDKA 3SQEE 1GI6A 2ZNKH 2ANMH 2FI5E 1UVOA 3QGJA 3QTOH 1EZXC 2ZTYA 3GDSA 5DPAA 4CRCA 5JYIA 2W3IA 1OP2A 1ZRKA 1L4ZA 2FZZA 2HNTE 5FCKA 5FHTA 1BMLA 3SJOA 3T25A 1AWFH 4FU9A 4LZ1H 5TCCA 1F92A 4UE7H 2BDGA 1ZHPA 2ANKH 2G5VA 1FY5A 1DLEA 1NFYA 2GCHF 1WUNH 3ATIA 3P17H 4ZROA 1O2ZA 3ZZCA 2GCHG 3SV2H 2HOBA 1EUFA 1O2MA 2ALPA 1C5SA 1N6XA 3TJUA 1HIAA 3VGCB 4KTUA 2PW8H 1C5YB 3TU7H 2TPIZ 2OUAA 1GMCG 1K2I1 2STBE 1CA8B 2V6NA 4H6TA 1BMNH 1T31A 1TGTA 1A0JA 3BTME 1CBWB 1W2KH 2IJOB 2ZFSA 3RXPA 1GL1A 1YPHC 2H9EH 2V35A 4FUBA 2VGCC 4GPGA 1S6FA 4YESB 2A7CA 2H1UA 1WSSH 2C8XB 1GHVH 1QB9A 1ANDA 1QA7A 1XMNB 3PO1C 2VIPA 4NIVA 1HAYB 3KN2A 5DGJA 3ZVDA 4RKOB 1JIRA 3K6ZA 1TIOA 2ZDAH 7LPRA 3GCHC 2BDHA 2CJIA 5JB8S 1S81A 1ZSLA 3SJKA 1HYLA 4ABDA 5A8XA 4AB8A 2BM2A 2UUFB 4AFZA 1VITG 4ABAA 1QJ1B 4K60A 1ZSKA 4H6SB 1V2RT 4E06H 2B0FA 3RXMA 3ITIA 1KXAA 2ZHDA 2PLXA 3BEUA 4AB9A 4KTCA 3LGUA 3LIWA 1ZHMA 1SQAA 3QWCH 2ZIQH 1IQJA 1O3GA 3A7VA 4I8KA 4DURA 1QY6A 3V12A 1ARCA 1F0UA 1UCYK 5PTPA 1SG8B 1UTMA 1QB6A 1C2KA 4D9QA 3S0NA 5EGMA 1AVGH 1YCPH 2OQ5A 1SGTA 5T6DA 2Z9KA 2OC0A 4MNXA 4PROA 5DP8A 3TLOA 1K9OE 1PJPA 2ZDLA 3SU0A 1MZDA 1C9PA 3UWJH 3SUFA 1AD8H 2WPHS 4NWLA 1TMBH 4WY3A 4ZHAA 1G9IE 3GY3A 1ZOMA 5EXMA 3QDZB 5E0JA 1T8LA 4AG2A 4WF8A 2ZP0H 1SGFA 4I32A 3RXOA 3UPEA 1EJAA 1TGBA 4BXWA 3FZDA 2DE9A 1E0FD 5FPSA 1O5AB 1P3CA 2NU0E 2F9PA 1B7XB 1SGFG 3ZVGA 5FPYA 1GMDF 1B0FA 1CGIE 4XBDA 1H9HE 1BDAA 1SGRE 2O8MA 1QGFA 1AZ8A 4J2YB 4AOQA 3UNSA 5FBIA 4XDEA 4MPXA 4WMFA 3K65B 2XBXA 1Y3WA 3TNTA 2ZCHP 3ESTA 3STIA 2SNWA 3MH6A 2QXIA 3P8GA 1OXGA 4AFQA 1XXFA 2QCYA 1O5GH 1MQ6A 2TRMA 3PMJA 1INCA 1J17T 1CVWH 1D3QB 1ZMNA 4ZHLU 1GJ5H 1P2NA 5HYOA 1ID5H 1W10U 2BQ6B 1BZXE 4NCYA 1P11E 4JYTA 2J92A 3GYMA 3KQEA 4OGXA 2PSYA 1GGDC 3QUMP 2A45B 1DANH 1TBRH 2Z3DA 3E6PH 2Y5GA 3RU4E 1MU6B 1TRNA 1NESE 3UR9A 1A3EH 3LH3A 1LPKB 5IYTA 4DIIH 1CT0E 1QL7A 2HGTH 1TPSA 1MKXH 1KDQB 3ZZ9A 1BBRH 2PTNA 4NIXA 4O9VA 2YNAA 1F0TA 2ZFPH 3UOUA 4YT7H 4A5TS 1QRZA 5EU8A 1AWHB 1O36A 3T2NA 1O3AA 3FFGA 1GBLA 4AFSA 1J14A 1SC8U 3A7ZA 1PPBH 3SBKA 1K1LA 1W11U 1XX9A 1SLWB 1O2SA 1P0SH 1LPGB 3RXFA 2G5NA 1QRWA 2GDEH 3QX5H 4JZFH 4BAQB 1DT2A 1K28D 3U1IB 3F9FA 5EXNA 1UK2A 1WQVH 3Q3XA 1VR1H 3NCLA 1VJ9U 4GVUA 1DUEA 1CQQA 2THFB 4WJG2 4CRFA 1PQ5A 1FAKH 1L0ZA 1Z8IB 3GY4A 1ELEE 4AN7A 4U2WA 5HGGA 2ZGCA 1GVLA 4OS7A 1F2SE 1SGIB 4BOHA 2VGCB 1IQFA 3V3MA 4B76A 1HBTH 4ABJA 2AH4X 1MCVA 4Y0YE 1ZTKA 1D4PB 2AEIH 3SHCH 1UCYE 1HAPH 5I46H 8LPRA 3K6YA 1AI8H 3D23A 1WTGH 3PO1B 3MWIU 2VB0A 5H4IB 4DW2U 4DIHH 1TNIA 1HJAC 2A32A 1NU9A 1SVPA 3P6ZB 2IN2A 4H42U 1LQDB 3GCHB 3LJJA 1ESTA 3S9CA 1MD7A 3SNCA 1XXDA 1THSH 2FPZA 3T5FH 3BG4C 1GHAF 2ZDNA 1O3OA 1O2VA 3T26A 2ZCKP 1ELFA 4MPWA 3RMNH 4DY7B 1WAYB 1GHAG 2FI4E 1FY4A 1MKXK 4NA7A 3KF2A 5EPYA 1OWHA 9ESTA 1BBRK 1MKWH 1MTWA 3DT0H 1C1TA 3MHWU 5ESTE 3SJ9A 2PSXA 4THNH 1BRBE 3SNDA 3EDXB 1TWXB 2A7HA 3RXDA 2ZPRA 4CH8B 3BF6H 4JYVH 2O8LA 1PPCE 2R3YA 3B8JA 1PPZA 5FX6A 2Q6GA 1DITH 1GBBA 1IQMA 4WMEA 1O5FH 1ZTLA 5A8YA 1T7CA 5A09A 1IOEA 4NFFA 3M3TA 5AFYH 3T28A 2KAIA 4YT6H 1C1SA 1TBQH 2D8WA 3E0PB 1NFXA 4BAHB 2VWMA 3SUDA 4AYYB 1T8OA 3O8RA 4K3JA 2NU2E 2K1QA 1MAYA 2P59A 5ETXA 5C1XA 3D62A 3UY9A 1P04A 3FP6E 2R0LA 1NRRH 4I8JA 2FOCA 3RXVA 4Y8YA 1M9UA 2ASUB 4U30A 1F0RA 3BTKE 1G3BA 2SGQE 2K7XA 1AFQC 4Q7ZA 3M36A 3M7UA 1Y3VA 2A4QA 2LIZA 1Z8GA 1YLCA 2QF3A 3A84A 2BDAA 4GSOA 1MKWK 3LT3A 2AFQB 3GCTF 4X2YA 1BTYA 1UHBA 3UQOA 2VIVA 1S83A 5C1YA 4BANB 5E0HA 4YTAA 1GGDB 1HNEE 1EAWA 3GCTG 4YOJA 5C2ZA 3VEQB 1EXFA 1KXDA 3SNBA 3AASA 1AY6H 3VB5A 4A92A 6CHAC 5FXLA 5EODA 1Y3YA 2GVFA 3RXHA 2ZGJA 3LGVA 2WV5A 3IG6B 5ESBA 3LC5A 2W7SA 1EAXA 2WPKS 4BTUB 1V2TT 1XKBC 5F8ZA 1DY9A 3HKJB 4VGCC 1ZLRA 4MPUA 2OLGA 1O32A 2G55A 1MU8B 3P70B 1NS3A 1FIZA 1BHXB 1GBMA 3BG8A 1D6WA 9LPRA 1LQEA 3HGNA 4I8HA 1JBUH 1O2HA 1AE5A 2SGDE 3C1KA 1GI5A 4ZXYH 3BTTE 3T29A 3AW1A 4D8NA 3V7TA 2BDCA 2VNTA 4ESTE 1Q31A 2GZ7A 1BBRE 1YPHE 2F9NA 3RLWH 2VWNA 2CXVA 4ASHA 3SJIA 1Y5BT 1EZSC 3MNCA 4Q2KA 1AVWA 2H6MA 4JYUH 2AGGX 1BRCE 2C8ZB 3MU4A 1F5RA 4X8VH 3RXGA 3LGWA 1EATA 3OU0A 5T6FA 2FM2A 1Z71A 2GT7A 5DP9A 1T4VH 2EEKA 2B7DH 2ZFRH 1LHGH 2FOHA 2A31A 1HJAB 4BTIB 1Y5UT 2WPJS 4ISHH 2XC5A 1UTOA 3S7HB 5EW2H 2ZTXA 3BTGE 1C1UH 2G51A 3RXQA 2V3OH 1SGNE 3TH4H 3VB4A 2HPPH 3BG4B 2FLBH 2BLVA 1NM6A 3RXBA 2BZ6H 3UOPA 1HUTH 4Q80A 1Z1IA 1O5EH 2P95A 3WY8A 1W0YH 1GBAA 1UTJA 2ODPA 3KEEA 1HCGA 3QTVH 2QGRA 1ZPZA 3P95A 3SW2B 3FVFB 1LKAA 1NRSH 1ZJKA 3FP8E 1DXWA 2GMTC 3RXLA 1V2KT 1EZUC 1DPOA 2Q6FA 1C1NA 4FUJA 1C1PA 2ZGXH 2FOAA 1HPGA 2P3UB 1D6RA 1ARBA 1S5SA 4QT8C 4INLA 3L6PA 2YNBA 1DX5M 1NN6A 2HNTF 2RA3A 3U1JB 2WUCA 1EQ9A 2VH0A 4FVBA 4F4OC 4KGAA 4OS1A 1L4DA 1WBGB 5DK1A 3TGIE 1BCUH 1ETTH 2O8TA 1DDJA 2ESTE 3EE0B 2RCEA 4M7GA 4CR5A 3MO9A 1MAXA 4B73A 3A7TA 2O8WA 2FX6A 1G3DA 1O3HA 4A1VA 4A6LA 4AYVB 4DG4A 1EAIA 4GHQA 4LZ4B 4O3UA 3RMLH 1DOJA 1PPHE 1GI7B 2A4GA 5C5NA 3A83A 1HIAB 1E36B 1OWIA 2W3KA 1P2OA 1V2VT 1W13U 2D2DA 1P9UA 1H4WA 1MH0A 1O3IA 2ZF0H 3PWBA 2IPHA 5BPEA 1HXFH 1HFDA 3CENA 2UWPA 3PMHB 5LPRA 1YBWA 5AFZH 2Y5HA 4NZQA 3TJNA 1XVOA 3SQHE 1CA0C 2Y7ZA 1GWAA 2ODQA 2FTLE 2ULLA 2FXRA 1NFWA 3BN9A 1B5GH 5GDSH 1OWEA 1TOCB 3SNAA 4RN6A 3VB7A 3W94A 4MDSA 2UUYA 4ABEA 3SUEA 3STJA 1P05A 6CHAB 1EPTA 1C1RA 1JOUB 4O3TA 3RXKA 4X1RU 1DXPA 3VB6A 1GG6C 2Z9IA 1FZZA 3LJOA 4CR9A 1GHBF 1J15A 2V3HH 6ESTA 3BTEE 3UFAA 1CT4E 1UMAH 1GHBG 5K7RA 5T6GA 1TGCA 3TH3H 2ZKSA 2H9HA 2IOTA 4VGCB 4K1SA 2XTTB 4MVNA 1FNIA 1ZGIA 2JETC 5EXLA 1EZQA 2PUQH 4NGAH 4UD9H 1O2XA 4ZAEA 5J4SA 3GOVB 1A4WH 1O3EA 1ANBA 1UCYH 4JCNA 1O2UA 1O2RA 1ETSH 4HI3A 1GBCA 4B1TA 1GMCF 2SGPE 3NPSA 2GZ9A 2FIRH 4JZIA 2TBSA 1GJAB 1RJXB 3A8AA 1GBFA 1DICA 2VWOA 5EG4A 2ZFFH 3FZZA 3VXFH 1YCPM 3M5LA 4MNYA 3AAUA 1BT7A 4CBNA 1RIWC 1XUGA 2JKHA 1N6YA 5F03A 2QXJA 2RA0A 5B6OA 3F9EA 3OY5U 5HM2A 3OY6U 1GJ9B 1G30B 3GCOA 1SPJA 4K8YA 2LPRA 4X2VA 2ZGBH 4H4FA 2BY6X 1CGHA 1JIMA 1ELGA 1QA0A 3OYPA 2VH6A 2CMYA 3MNXA 1Z6JH 1ZHRA 2R2MB 3CS0A 1KIGH 1VITF 1ELBA 4B71A 1EP6A 4NWKA 1LVOA 2A2XH 4I31A 3B9FH 2GMTB 1V2UT 1O2YA 1TALA 2BDYA 2AGEX 4UFFH 3SORA 1ZGVA 5GJ4B 1XUFA 1MQ5A 2A0QB 1KTTB 1GJBB 3MH4A 4ZKOU 1DS2E 2FOBA 2DUCA 4CRBA 2ZFTA 2FODA 1VGCB 1QCPA 2Y6TA 3EYDA 1SSXA 1DWCH 1AFEH 2BLWA 3MOCA 4ZUHA 1GL0E 1KLTA 1GI9B 4XFQA 2ZHQH 2ZFQH 8ESTE 3RMOH 5E2PA 2Q6DA 4Y76A 3L33A 3EBNA 4E7NA 1LHCH 1AMHA 1QB1A 4ABGA 1WTHD 2TGAA 2F9VA 1IHTH 3U9AH 1HGTH 1RS0A 2FYRA 1IQLA 4IGDA 5JBBS 3A86A 3GISB 1A2CH 1DWEH 4FUHA 1MBQA 1FDPA 1NFUA 2AMPA 2RDLA 4UFEH 2AMQA 1FPHH 3U8TH 1ZZZA 4ZHMU 3LOXA 4NIYA 1CA0B 1QBOA 1FAXA 1AQ7A 3C27B 1H8DH 2I6SA 2G00A 3EA8A 3SV8A 3A82A 2BY8X 4LXBH 4Q7YA 4CRAA 3BTHE 4IMZA 1HRTH 3A85A 4YOGA 2XBYA 1FQ3A 3QO6A 2WPMS 3A7WA 3A8CA 5SGAE 1ELTA 1GDNA 4AORA 1GI4A 2UUJB 1GG6B 5CE1A 5HM9A 2P16A 2A5IA 1P3EA 1P2QA 3O8CA 1L1NA 5K0HA 1AKSB 1SHYA 3ODDA 3KL6A 2FESH 1YGCH 1C5TA 1MTSA 2ZEBA 1RFNA 3SU2A 5I25A 2JETB 1AHTH 1TE0A 2CN0H 1G2MA 1GVKB 2EI7A 3DD2H 1O38A 1SLVB 3UNQA 5JBAS 2XNIA 1JWTA 1FV9A 3E3TA 3MH5A 1GVZA 2HNTC 1Z8JB 3QZQA 3SOSA 4CBOA 1Y8TA 1GBJA 4IN2A 3KQBA 3LONA 1GDUA 2F9OA 1RIWB 2CF8H 2AYWA 1VCWA 2XBWA 3M61U 4JZDH 2PKAA 4XBBA 2F3CE 4JZEH 3LGIA 1TAWA 2G81E 1AB9C 1TNKA 2KAIB 1TYNA 2C90B 1GHXH 3KHVA 1WQSA 1TNGA 2C8YB 1BQYA 2ANWA 1FN6A 3TIUA 1QJ6B 1ELDE 4AZ2B 2P3FH 5G4BA 1NO9H 1OSSA 1GI1A 1Y59T 2Z3EA 3GDUA 3ZZDA 1VCQA 1CO7E 1C5QA 3B23B 4UEHH 3RUOA 3LGYA 1BTPA 2GZ8A 1IQGA 1HAHH 1WYKA 3BTQE 1J16A 3U69H 5LPFA 2OP9A 1JRSA 1SLXB 2BXUH 2BX4A 2HWLB 1C2LA 4F49A 4WH6A 5E0GA 1DFPA 4MTBA 3PM3A 5AHGH 1EB2A 1PYTD 1C2IA 5C1UA 2BZAA 4IS5A 2FEQH 2W7UA 1UHBB 3SGBE 3ZV8A 2BYAX 2FOEA 3KQDA 2A4RA 4KP0A 3PTNA 1K21H 3E90B 2EI6A 4Y7AA 2FI3E 3F9GA 2VINA 3SU3A 1QL9A 4INKA 3URCA 3RC4A 3U8OH 2WYGA 2XBVA 2VVCA 1D3TB 3TK6A 3CS7A 1TQ7B 1XUJA 3ZVFA 2Z9JA 3EGKH 4D7GA 5DP3A 3ZZBA 7KMEH 3UUZA 2WV4A 3SUGA 2R0KA 4E7RG 1V2QT 3M7QA 1ELVA 2LNCA 2J4IA 1TBZH 2BB4A 4XSKU 1H8IH 1HAIH 1NROH 4HGCA 2ZQ2A 4CHAC 1K1IA 2G4UA 3SU6A 1N8OC 1ZMLA 4BAKB 2G8TA 3ODFA 4WVPE 3TITA 4JMYA 2BD2A 3E91A 2Y80A 3Q00A 4FU8A 3MNBA 1IHSH 1DSUA 4Y79A 1RD3B 1VZQH 1HAGE 3RU4D 1JRTA 4RSPA 2BD8A 3V0XA 2GGVB 2CV3A 1A5IA 1FONA 4I8GA 4IN1A 1XUKA 1F5LA 1BMAA 1FXYA 5DP7A 4R0IA 2AIQA 3MYWA 1Z7KA 3S7KB 5C5OA 2R2WU 1GBDA 1Y5AT 2XCNA 1CT2E 5DG6A 2FLRH 1BJVA 4TY7A 3M3VA 4JK6A 2BLQA 5JDUB 1H9IE 1P03A 1T8NA 1NTPA 1O2LA 1F0SA 5AVDA 5EW1H 1D3PB 1C5OH 1HDTH 3BIVH 1ABIH 2ZPQA 1ZMJA 4BAOB 4FXGH 2HLCA 3ZYEA 1PYTC 1ZJDA 3ZYDA 1IQHA 1GI3A 1S84A 1P57B 1C2MA 1SQTA 2BX3A 4WH8A 1L1GA 2J9NA 2XC4A 1C5XB 3IITA 1QBVH 2ZO3H 3BTWE 1KXEA 3E8LA 2P94A 1RTKA 5EQQA 4IMQA 1TQ0B 3ZZ5A 5HMAA 5BRRE 1XUIA 2ZU5A 3R0FA 4FUCA 1K1MA 1W3CA 1P12E 1O37A 1K1OA 4ISNA 1S82A 4B2AA 1ELCA 2Z6BD 1C1OA 1EOLA 2J2UA 3UNRA 4GLYA 4ZXXH 3TK9A 2W26A 1LVBA 2OXSA 3GY7A 4YLUA 1TPPA 7ESTE 3QN7A 3AW0A 5F8XA 1O39A 4ZMAH 4ABHA 2RG3A 3PV4A 4YZUA 1TNJA 3TK5A 1O2WA 1A5HA 1Z8RA 4NZLA 3EA7A 2OTVA 4CREA 1O2OA 3QZRA 3F6UH 3JZ1B 2D1JA 4A1XA 5A8ZA 2BDBA 4D76A 1KLIH 3FANA 3BEIB 1AB9B 1GHYH 1T4UH 2VIOA 1HLTH 1CE5A 2WPIS 1DWDH 3EQ0H 4JK5A 4CRDA 3MTYA 1TMTH 1ZPCA 1YKTA 2OC1A 1C5RA 3RLYH 3M5MA 4X8TH 1QJ7B 4TWYA 1Y3UA 1TX6A 3BIUH 2EA3A 5LPEA 3ZZ3A 1NRQH 3LPRA 1O5CB 2OBQA 1ETRH 4X1SU 1BTZA 1SFIA 2Y7XA 4X1NU 1BTXA 4K8BA 2BY9X 3D65E 2CHAC 1UJ1A 2D26C 1UVPA 1AGJA 1SBWA 3DHKH 4Y6DA 4CH2B 1A3BH 1SI5H 1QIXB 2WUBA 3A80A 2QYIA 2VIWA 3QGNB 3ZZ8A 1O3PB 1BOQA 1XM1A 3K9XB 4DOQA 2HALA 2BD7A 2PGQB 3ZVEA 4HTCH 1BITA 3RC6A 2H5DA 4LK4A 2XYAA 2C3SA 3PWCA 5JBCS 4LOYH 2YOLA 3BEFB 4R8TB 1P9SA 1SGPE 1BTWA 1QQUA 3LGTA 3ZZ7A 5CHAC 3GYLB 4B2BA 3HK6B 4DCDA 4TPIZ 1KSNA 3NKKA 1XUHA 2A5AA 3P8FA 4INHA 2G52A 2FS9A 2Z7FE 4CHAB 1O3JA 1G3EA 3ZV9A 1EP5A 4IC6A 3SHAH 3H7OA 1RXPA 1BHXF 3Q76A 3KCGH 2FTMA 3SI3H 1O2GH 1FN8A 4AGKA 1O2TA 3SU1A 1O3MA 1TA2A 2A2QH 3HKIB 1O3LA 2BOHB 3PROA 1OP0A 2AMDA 3Q3KA 2GTBA 5L2ZH 1K1PA 3RC5A 1JXPA 1P8VC 1OS8A 1QR3E 3DFJA 1SR5C 3A89A 5LH8A 1O3NA 2ZECA 1C4U2 3U98H 4NG9H 2WYJA 2SGAA 1AFQB 4JZ1A 1GCTC 3SU4A 3A81A 3MNSA 3GCNA 2ZCLP 3PLKA 2PKSC 1NRNH 1DLKB 1FMGA 3RMMH 1TGNA 1TGSZ 3SGQE 4X1QU 1S6HA 1SGCA 1T8MA 3A8BA 1E37B 1XVMA 3HPTB 3P8NA 2FOFA 1C5VA 5DP5A 1ZR0A 5FX5A 4DGJA 3RXSA 4XBCA 1C4V2 1GJDB 1LVMA 3MU0A 1HJ9A 1UO6A 3QK1A 1SGDE 4TWWA 3CP7A 2H2ZA 3K2UA 3RP2A 2ZHFH 3MMGA 2BY7X 2BD5A 1HAXB 2P3TB 5EQSA 1GJ7B 1UTLM 2J94A 4Y8XA 1LTOA 1CU1A 1MZAA 1V2PT 5C67A 2QV1A 1E38B 4OS2A 2EI8A 2XWAA 6GCHF 1KXFA 1BB0B 1WCZA 1BUIA 1O2KA 2STAE 1DVAH 1H1BA 5F6MA 4J1YA 4ISIH 4Y0ZE 6GCHG 3KNXA 1NPMA 1PFXC 1BTUA 2VU8E 3Q3YA 1PPEE 5GPIB 5L30H 2VJ1A 1C2FA 5FPTA 4OS6A 1GBEA 1B0EA 5GCHF 2ZQ1A 4HFPB 1C1VH 4NA8A 3BTFE 4A1TA 1LMWB 2BQWB 4O97A 2F9UA 5GCHG 3UREA 1A46H 3IWMA 1QRXA 3NWUA 1Q2WA 1C2EA 1MMJN 1OYQA 1RTLA 3T27A 2TIOA 5LGOA 1W14U 5EQRA 1O2NA 1E35B 1O2PA 3M5NA 1A1RA 1A0LA 3HK3B 5ABWA 1KLJH 2FWWA 1HAVA 1ACBE 3RXRA 1ANCA 4BNRA 1OX1A 4DT7B 1O30A 1C9TA 1C2HA 4FUDA 3NUMA 4MNVA 3FP7E 1N1LA 5GWZA 1FJSA 1FIWA 2CHAB 2FOGA 1P2IA 4GCHF 1O5DH 2C93B 3O8DA 5AF9H 1OWKA 2B9LA 1KYNA 1Z1JA 4GCHG 3SN8A 3QLPH 2BMGB 4WXVA 2Z9LA 4Y8ZA 2OD3B 2WPLS 1TB6H 3AVZA 1CSOE 1G32B 1TA6A 3AAVA 1GJ4H 1OYTH 1UTNA 3M35A 5IDKA 2I6QA 3GY6A 4WMDA 3GY5A 1F5KU 5CHAB 2BLOA 1V2JT 2QN5T 3M7TA 4I8LA 1DY8A 1P2JA 2QY0B 2GP9B 1GJCB 1NRPH 4ABIA 1K1JA 2ZC9H 3SU5A 4MPVA 3SGAE 1TLDA 2R9PA 3ATLA 3PLPA 1G3CA 2BY5X 2AIPA 2ZHEH 2XXLA
chains in the Genus database with same CATH superfamily
3PRBA 1EASA 2BXTH 1DE7H 1OKXA 2C4FH 1A5GH 1SB1H 1UTPA 2BOKA 2P93A 1YF4A 3F9HA 2OCVB 4TPYA 3MH7A 2XW9A 1GI2A 1J8AA 3H5CB 5FCRA 3LC3A 2KCYA 1XKAC 3D49H 3BV9B 5DP6A 4AG1A 8KME2 1ESBA 1QL8A 3S69A 3SJ8A 1PQ8A 4I33A 3I29A 3RXEA 4FUEA 1TPAE 3RM0H 3UB0A 1K22H 2Z3CA 1W0ZU 1GHWH 2PKAB 1GCTB 2PTCE 4MLFB 4K1TA 2C8WB 1V3XA 2PKSB 4I86A 4YOIA 1WOFA 2QIQA 1EX3A 1QHRB 1YYY1 4NSYA 3TGJE 1A7SA 1AZZA 2J98A 5EOKA 3ZVAA 1AUTC 2JIZD 2SNVA 4I7YH 2GCTC 1ZTJA 1KTSB 1TX7A 3RU4T 3R3GB 1TPOA 1YP9A 1JMOH 1KY9A 1QURH 1ZRBA 5EJ1A 5JBTA 2JH0D 3VFEA 1HAZB 1GMDG 1O2QA 1LDTT 1GJ8B 4Q7XA 1MD8A 1ANEA 3P8OA 1Y3XA 1FLEE 2PFEA 4IC5A 3SV7A 1L2EA 1LCYA 1G36A 3M5OA 1O34A 1Q3XA 3LH1A 3PTBA 2GDDA 1SGEE 1NZQH 4DVAU 1S0QA 1DWBH 2F9BH 1MBMA 1V2MT 1ZPBA 1U6QA 2Z94A 2XRCA 3OX7U 3SV6A 1MTUA 3ATKA 1HJ8A 2ZDMA 5JB9S 1H8ED 1AE8H 2V0BA 4YM9A 5DP4A 2FDAA 4AFUA 1EOJA 1V6DA 2ZU3A 1SGQE 1YCPK 4IW4E 2FS8A 4OS5A 3V13A 2ILNA 2GV7A 1YLDA 2SGFE 2WPDD 3A88A 1D9IA 1QNJA 2VIDA 2XC0A 4TYDA 1VJAU 1WV7H 1ZSJA 3LU9B 3SNEA 3FO8D 1YPLH 3OSYA 1THRH 1E34B 4UDWH 1YPKH 4ISLA 1UK3A 3VPKA 3ZZ6A 4NA9H 1T32A 4TY6A 1O3DA 1G37A 1Z6EA 3HGPA 1ESAA 1UVSH 1O3BA 1O2IA 2XWBI 1SLUB 4ABBA 5EPNA 5C94A 1PQAA 1O2JA 4Z6AH 1LHEH 1BTHH 3MQKC 1K0HA 1UVTH 2FP7B 3FAOA 1TNHA 4X6MA 3U8RH 1EKBB 3SI4H 4OGYA 4ZKRU 4SGAE 1W0KD 2PUXB 2ZGHA 2P8OC 3PYHA 3RXUA 4OM9A 4HZHA 1UK4A 1KXCA 2FX4A 2GT8A 2JJ1D 1ZYOA 1KXBA 3ZIAD 5F8TA 4P02A 1C2JA 1TRMA 4U01A 1QQ4A 4Y10E 3KYGA 4B2CA 4MG3A 3TVJB 4X6PA 1GBTA 1S0RA 2EC9H 2FOMB 3RM2H 2HVXA 4K5ZA 3ZVCA 5C20A 5TJXA 3I78A 3KGPA 3PB1E 4ABFA 1QBNA 4WWYA 3MU5A 1TMUH 4FU7A 2UWOA 3RXAA 1W12U 3S9AA 7GCHF 4X2WA 2A5KA 1H9LB 2NU3E 3MI4A 2H9TH 1VCPA 2ZA5A 4KTSA 1AKSA 4CRGA 5A0BA 1TABE 4YO9A 2KCPA 2TGTA 2WZQA 3BTDE 3UTUH 7GCHG 2PGBB 1C1WH 5E2OA 1EPTC 4IBLH 1LKBA 2BDIA 2BVRH 1V2ST 2NU4E 1LPZB 2BD3A 4GAWA 1KDQA 1D3DB 4XE4A 4RT1A 1UVUH 2FYQA 4XOJA 1BMMH 1IQNA 3ZZ4A 2A4OA 4NIWA 1A0HB 1W7GH 4F48B 3DA9B 1A61H 3CNRA 1OWJA 1EB1H 4MNWA 2ZU4A 1C5WB 1RRKA 2ODYB 1OOKB 2KR7A 2TGDA 3TNSA 4K1EA 2JH5D 1CHOF 4ZKSU 2OC7A 3SO3A 2OC8A 1GBKA 1CHOG 1MUEB 1PQ7A 2Y82A 1C5NH 4UFGH 1IQEA 2FO9A 1W7XH 4X8SH 3JZ2B 4X6OA 2JH6D 2KZ4A 2WINI 5FAHA 3MO6A 2PWXA 2PV9B 1C1MA 3O8BA 2HRVA 1O31A 3E0NB 1LVYA 1L1JA 1GDQA 1VKYA 1BRUP 5J4QA 1GCDA 5L6NH 4O03A 2GCTB 3ELAH 3OTPA 2FMJA 4F55A 5A0AE 1K1NA 2CGAA 1FY8E 1NT1A 5GXPA 2Y5FA 3N7OA 4AX9H 1TX8A 1SOZA 3VB3A 3NXPA 3UR6A 1ORFA 2PHBA 2Y81A 4GUXA 2BVSH 4ZH8A 4NFEA 3SZNA 4U32A 1GJ6A 1S85A 2J5UA 2UUKB 3GY8A 3VXEH 1MTNC 2M5TA 3TH2H 2BD4A 1PPFE 3KQCA 1YPMH 1AIXH 1O0DH 2XNDD 2QC2A 2BQ7B 3OFND 1P10A 3LKWA 3M37A 1FUJA 3A7XA 3LDXH 1GMHF 1GBIA 2ALVA 1OPHB 2J34A 2J95A 3OTJE 4E05H 4UONA 2VVVA 1GI8B 1GMHG 4NSVA 2ANYA 1UTKA 1AVXA 3Q77A 1O3FA 1DSTA 2GD4B 3TJOA 2SGEE 3VG8A 3N7DA 2KFWA 2PP6A 1O35A 2BD9A 3EA9A 3MU1A 2A7JA 2OQUA 3H7TA 1NC6A 2NWNA 4B75A 4FUIA 2VIQA 1V2WT 4RKJB 1O33A 5L2YH 3A87A 4FUGA 1IQIA 2HPQH 4X2XA 4FUFA 3UQVA 2EY4C 5C3NA 1P09A 3BSQA 2QXGA 2BHGA 1MTVA 3F1SB 3F68H 3TJVA 1SGYE 1YC0A 2AERH 1GI0A 1QFKH 4Q63A 1C5UA 3PMBB 2H5CA 2ZZUH 1YPJH 1V2OT 1EFRD 4BXSA 4X1PU 5T3HA 1LHDH 5HXFA 1HAOH 2PR3A 1GBHA 1O5BB 1OP8A 4A7IB 2VWLA 1GHZA 1YM0A 1HV7A 1W8BH 4TT3D 3VGCC 4UFDH 3EAJA 2O9QA 2P8OB 3TGKE 1YPEH 2F91A 4D9RA 1IQKA 2NU1E 2Q1JA 1G2LA 2Z9GA 8GCHF 1EJNA 1SL3A 3RXCA 2QA9E 6LPRA 1C4Y2 2QF0A 1CBWC 1TRYA 3ZVBA 1EAUA 8GCHG 5GIBA 3PLBA 1YPGH 3ATWA 3S9BA 4OS4A 5TCAA 1OWDA 1SQOA 1FPCH 4AGJA 4BAMB 2GV6A 5FBEA 4MQAA 1AO5A 2TGPZ 3E16B 2ZU1A 1HXEH 1O3KA 4GHTA 2J38A 4ISOA 3MO3A 1SQRA 1EPTB 4X8UH 2ZDVH 3ENSB 4KELA 1P01A 5A2MH 1C2DA 1SHHB 5DO4H 4YLQH 2QXHA 2UWLA 3MU8A 2DE8A 1ELAA 3PV2A 5DJ7A 1V2NT 1AU8A 1W0JD 2GKVE 1BIOA 1NU7B 3SV9A 4BTTB 1C5MD 3RDZA 1BJUA 2O8UA 4WXIA 1DUAA 3G01A 4HG6A 1FY1A 1J9CH 2ZI2H 1N8OB 1WU1A 1C2GA 2ZG0H 1FI8A 5A0CA 1X7AC 1NY22 1O3CA 1TNLA 2G4TA 2QAAA 3RXTA 3GDVA 4D7FA 2F83A 1VGCC 4FVDA 5E8EH 1SOTA 1P2MA 1RTFB 2B5TB 3TPIZ 3W95A 1GPZA 1MCTA 1AUJA 1C1QA 2B8OH 1QZ8A 4Y71A 3M3SA 3URDA 3GICB 1FY3A 1LHFH 2XCFA 1QTFA 2OINA 1LO6A 1PPGE 1VITH 1BRAA 5JPMH 3DFLA 3L3TA 3ZZAA 2CF9H 2ZPSA 4KKDA 2AGIX 2ZWLH 2BTCE 3A8DA 1THPB 1TOMH 2ZTZA 4SGBE 1RGQA 4B74A 4DJZB 2ZHWH 3E1XB 3P92A 1CHGA 3DUXH 2A1DB 2OBOA 1V2LT 4YXWD 1ABJH 3NK8A 1C5ZB 1IAUA 4DT4A 2GX4A 1HAVB 5DKMA 1P02A 1BA8B 5T1VA 1MTNB 2R3UA 1C5PA 1F7ZA 3KIDU 3MFJA 3ATMA 1P2KA 1SFQB 3UWIA 4Z0KA 3HATH 1UTQA 2W5EA 3PMAB 1HB0B 2VVUA 1TFXA 3I77A 3NZIA 4X6NA 3RXJA 4Y7BA 3A7YA 4X0WU 2ZU2A 3GY2A 1TONA 4ZKNU 4K69A 1C5LH 1EJMA 3UIRA 2SFAA 4Y11E 5CMXH 1CGJE 3T62A 1SMFE 1P06A 1DM4B 3SYJA 1AN1E 2AS9A 4K2YA 2GJGA 2BVXH 3RXIA 2ZDKA 3SQEE 1GI6A 2ZNKH 2ANMH 2FI5E 1UVOA 3QGJA 3QTOH 1EZXC 2ZTYA 3GDSA 5DPAA 4B6EA 4CRCA 5JYIA 2W3IA 1OP2A 1ZRKA 1L4ZA 2FZZA 2HNTE 5FCKA 5FHTA 1BMLA 3SJOA 3T25A 1AWFH 4FU9A 4LZ1H 3F2GA 5TCCA 1F92A 4UE7H 2BDGA 1ZHPA 2ANKH 2G5VA 1FY5A 1DLEA 2K8IA 1NFYA 2GCHF 1WUNH 3ATIA 3P17H 4ZROA 1O2ZA 3ZZCA 2IPQX 1YWUA 1S6LA 2GCHG 3OEHD 3SV2H 2HOBA 1EUFA 1O2MA 2ALPA 1C5SA 1N6XA 3TJUA 3F0PA 1HIAA 3VGCB 4KTUA 2PW8H 1C5YB 3TU7H 2TPIZ 4AC9A 2KCAA 2OUAA 1GMCG 1K2I1 2STBE 1CA8B 2V6NA 4H6TA 1BMNH 1T31A 1TGTA 1A0JA 3BTME 1CBWB 1W2KH 2IJOB 2ZFSA 3RXPA 1GL1A 1YPHC 2H9EH 2V35A 4FUBA 2VGCC 4GPGA 4RI0A 2RDEA 1S6FA 4YESB 2A7CA 2H1UA 1WSSH 2J98B 2HLDD 2C8XB 1GHVH 1QB9A 1ANDA 1QA7A 1XMNB 3PO1C 2VIPA 4NIVA 1HAYB 3KN2A 5DGJA 3ZVDA 4RKOB 1JIRA 3K6ZA 1TIOA 2ZDAH 4TSFD 7LPRA 3GCHC 2BDHA 2CJIA 5JB8S 1S81A 5HKKD 1ZSLA 3SJKA 1HYLA 4ABDA 5A8XA 4AB8A 2BM2A 2UUFB 4AFZA 1VITG 4ABAA 1QJ1B 4K60A 1ZSKA 4H6SB 1V2RT 4E06H 2B0FA 3RXMA 3ITIA 1KXAA 2ZHDA 2PLXA 3BEUA 4AB9A 4KTCA 3LGUA 3LIWA 1ZHMA 1SQAA 3QWCH 2ZIQH 1IQJA 1O3GA 3A7VA 4I8KA 4DURA 1QY6A 2QF5A 3V12A 1ARCA 1F0UA 1UCYK 5PTPA 1SG8B 1UTMA 1QB6A 1C2KA 4D9QA 3S0NA 5EGMA 1AVGH 1YCPH 2OQ5A 1SGTA 5T6DA 3KYFA 2Z9KA 2OC0A 4MNXA 4PROA 5DP8A 3TLOA 1K9OE 2LELA 1PJPA 2ZDLA 3SU0A 1MZDA 1C9PA 3UWJH 3SUFA 3WWBA 1AD8H 2WPHS 4NWLA 1TMBH 4WY3A 4ZHAA 1G9IE 3GY3A 1ZOMA 3FOAA 3QDZB 5E0JA 1T8LA 5EXMA 4AG2A 4WF8A 2ZP0H 1SGFA 4I32A 3RXOA 3UPEA 1EJAA 1TGBA 4BXWA 3FZDA 2DE9A 1E0FD 5FPSA 1O5AB 1P3CA 2NU0E 2F9PA 1B7XB 1SGFG 3ZVGA 5FPYA 3KQ5A 5CHBA 1GMDF 1B0FA 1CGIE 4XBDA 1H9HE 1BDAA 1SGRE 2O8MA 1QGFA 1AZ8A 4J2YB 4AOQA 3UNSA 5FBIA 4XDEA 4MPXA 4WMFA 3K65B 2XBXA 3AK5A 1Y3WA 3TNTA 2ZCHP 3ESTA 3STIA 2SNWA 3MH6A 2QXIA 3P8GA 1OXGA 4AFQA 1XXFA 2QCYA 1O5GH 1MQ6A 2TRMA 3PMJA 1INCA 1J17T 1CVWH 1D3QB 1ZMNA 4ZHLU 1GJ5H 1P2NA 5HYOA 1ID5H 1W10U 2BQ6B 1BZXE 4NCYA 1P11E 5DSFA 4JYTA 2J92A 3GYMA 3KQEA 4OGXA 2PSYA 2WV9A 1GGDC 3QUMP 2A45B 1DANH 1TBRH 2Z3DA 3E6PH 2Y5GA 3RU4E 1MU6B 1TRNA 1NESE 3UR9A 1A3EH 3LH3A 1LPKB 5IYTA 4DIIH 1CT0E 1QL7A 2HGTH 1TPSA 1MKXH 1KDQB 3ZZ9A 1BBRH 2PTNA 4NIXA 4O9VA 2YNAA 1F0TA 2ZFPH 3UOUA 4YT7H 4A5TS 1QRZA 5EU8A 1OHHD 1AWHB 1O36A 3T2NA 1O3AA 3FFGA 1GBLA 4AFSA 1J14A 1SC8U 3A7ZA 1PPBH 2JDID 3SBKA 1K1LA 1W11U 1XX9A 1SLWB 1O2SA 1P0SH 1LPGB 3RXFA 2G5NA 2XOKD 1QRWA 2GDEH 3QX5H 4JZFH 4BAQB 1DT2A 1K28D 3U1IB 3F9FA 5EXNA 1UK2A 1WQVH 3Q3XA 1VR1H 3NCLA 1VJ9U 4GVUA 1DUEA 1CQQA 2THFB 4WJG2 4CRFA 1PQ5A 1FAKH 1L0ZA 1Z8IB 3GY4A 1ELEE 4AN7A 4U2WA 5HGGA 2ZGCA 1GVLA 4OS7A 1F2SE 1SGIB 4BOHA 3DCLA 2VGCB 1IQFA 3V3MA 4B76A 1HBTH 4ABJA 2AH4X 1MCVA 4Y0YE 1ZTKA 1D4PB 2AEIH 3PRDA 3SHCH 1UCYE 1HAPH 5I46H 8LPRA 3K6YA 1AI8H 3D23A 1WTGH 3PO1B 3MWIU 2VB0A 5H4IB 4DW2U 4DIHH 1TNIA 1HJAC 2A32A 1NU9A 1SVPA 3P6ZB 2IN2A 4H42U 1LQDB 3GCHB 3LJJA 1ESTA 3S9CA 4XD7D 1MD7A 3SNCA 1XXDA 1THSH 2FPZA 3T5FH 3BG4C 1GHAF 2ZDNA 1O3OA 3WWFA 1O2VA 3T26A 2ZCKP 1ELFA 4ZCNA 4MPWA 3RMNH 4DY7B 1WAYB 1GHAG 2FI4E 1FY4A 1MKXK 4NA7A 3KF2A 5EPYA 1OWHA 9ESTA 1BBRK 1MKWH 1MTWA 3DT0H 1C1TA 3MHWU 5ESTE 3SJ9A 2PSXA 4THNH 1BRBE 3SNDA 3EDXB 1TWXB 2A7HA 3RXDA 2ZPRA 4CH8B 3BF6H 4JYVH 2O8LA 1PPCE 2R3YA 3B8JA 3OAAD 1PPZA 5FX6A 2Q6GA 1DITH 1GBBA 1IQMA 4WMEA 1O5FH 1ZTLA 5A8YA 1T7CA 5A09A 1IOEA 4NFFA 3M3TA 5AFYH 3T28A 2KAIA 4YT6H 1C1SA 1TBQH 2D8WA 3E0PB 1NFXA 2IJD1 4BAHB 2VWMA 3SUDA 4AYYB 1T8OA 3O8RA 4K3JA 2NU2E 2K1QA 1MAYA 2P59A 5ETXA 1NBME 5C1XA 3D62A 3UY9A 1P04A 3FP6E 2R0LA 1NRRH 4I8JA 2FOCA 3RXVA 4Y8YA 1M9UA 2ASUB 4U30A 1F0RA 3BTKE 1G3BA 5F53A 2SGQE 5C17A 2K7XA 1AFQC 4Q7ZA 3M36A 3M7UA 1Y3VA 2A4QA 2LIZA 1Z8GA 1YLCA 2QF3A 3A84A 2BDAA 4GSOA 1MKWK 3LT3A 2AFQB 3GCTF 4X2YA 1BTYA 1UHBA 2JJ2D 2VIVA 3UQOA 1S83A 5C1YA 4BANB 5E0HA 4YTAA 1GGDB 1HNEE 1EAWA 3NRLA 3GCTG 4YOJA 5C2ZA 3VEQB 1EXFA 1KXDA 3SNBA 3AASA 1AY6H 3VB5A 4A92A 6CHAC 5FXLA 5EODA 1Y3YA 2GVFA 3RXHA 2ZGJA 3LGVA 2WV5A 3IG6B 5ESBA 3LC5A 2W7SA 1EAXA 1YY3A 2WPKS 4BTUB 1V2TT 1XKBC 5F8ZA 1DY9A 3HKJB 4VGCC 1ZLRA 4MPUA 2OLGA 2AHME 1O32A 2G55A 1MU8B 3P70B 1NS3A 1FIZA 1BHXB 1GBMA 3BG8A 4XRNA 1D6WA 5C0UA 9LPRA 2LP6A 1LQEA 3HGNA 4I8HA 1JBUH 1O2HA 1AE5A 2SGDE 3C1KA 1GI5A 4ZXYH 3BTTE 3T29A 3AW1A 4D8NA 3V7TA 2BDCA 2VNTA 4ESTE 1Q31A 2GZ7A 1BBRE 1YPHE 2F9NA 3RLWH 2VWNA 2CXVA 4ASHA 3SJIA 1Y5BT 1EZSC 3MNCA 4Q2KA 1AVWA 2H6MA 4JYUH 2AGGX 1BRCE 2C8ZB 3MU4A 1F5RA 4X8VH 3RXGA 3F2HA 3LGWA 1EATA 3OU0A 5T6FA 2FM2A 1Z71A 2GT7A 5DP9A 1T4VH 2EEKA 2B7DH 2ZFRH 1LHGH 2FOHA 2A31A 1HJAB 4BTIB 1Y5UT 2WPJS 4ISHH 2XC5A 1UTOA 3S7HB 5EW2H 3W1EA 2ZTXA 3BTGE 1C1UH 2G51A 3RXQA 2V3OH 1SGNE 3TH4H 3VB4A 5HIYA 2HPPH 3BG4B 2FLBH 2BLVA 1NM6A 3RXBA 2BZ6H 3UOPA 1HUTH 4Q80A 1Z1IA 1O5EH 2P95A 3WY8A 4ACAA 1W0YH 1GBAA 1UTJA 2ODPA 3KEEA 1HCGA 3QTVH 2QGRA 1ZPZA 3P95A 3SW2B 3FVFB 1LKAA 1NRSH 1ZJKA 3FP8E 1KMHB 1DXWA 2GMTC 3RXLA 1V2KT 1EZUC 1DPOA 2Q6FA 1C1NA 4FUJA 4Q4LA 1C1PA 2ZGXH 2FOAA 1HPGA 2P3UB 1D6RA 1ARBA 1S5SA 4QT8C 4INLA 3L6PA 2YNBA 1DX5M 1NN6A 5KGOA 2HNTF 2RA3A 3U1JB 2WUCA 1EQ9A 2VH0A 4FVBA 4F4OC 2CK3D 4KGAA 4OS1A 1L4DA 1WBGB 5DK1A 3TGIE 1BCUH 1ETTH 2O8TA 1DDJA 2ESTE 3EE0B 2RCEA 4M7GA 4CR5A 3MO9A 1MAXA 4B73A 1COWD 3A7TA 2O8WA 2FX6A 1G3DA 1O3HA 4A1VA 4A6LA 4AYVB 4DG4A 1EAIA 4GHQA 4LZ4B 4O3UA 3RMLH 2V7QD 1DOJA 1PPHE 1GI7B 2A4GA 5C5NA 3A83A 1HIAB 1E36B 1OWIA 2W3KA 1P2OA 5IK2D 1V2VT 1W13U 2D2DA 1P9UA 1H4WA 1MH0A 1O3IA 2YMSD 2ZF0H 3PWBA 2IPHA 5BPEA 1HXFH 1HFDA 3CENA 2UWPA 3PMHB 5LPRA 1YBWA 5AFZH 2Y5HA 4NZQA 3TJNA 1XVOA 3SQHE 1CA0C 2Y7ZA 1GWAA 2ODQA 4ASUD 2FTLE 2ULLA 2FXRA 1NFWA 3BN9A 1B5GH 5GDSH 1OWEA 1TOCB 3SNAA 4RN6A 3VB7A 3EE7A 3W94A 4MDSA 2UUYA 4ABEA 3SUEA 3STJA 1P05A 6CHAB 1EPTA 1C1RA 1JOUB 4O3TA 3RXKA 4X1RU 1DXPA 3VB6A 1GG6C 2Z9IA 1FZZA 3LJOA 4CR9A 1GHBF 1J15A 2V3HH 6ESTA 3BTEE 3UFAA 1CT4E 1UMAH 1GHBG 5K7RA 5T6GA 1TGCA 3TH3H 2ZKSA 2H9HA 2IOTA 4VGCB 4K1SA 2XTTB 4MVNA 1FNIA 3H09A 1ZGIA 2JETC 5EXLA 1UW7A 1EZQA 2PUQH 4NGAH 1E1RD 4UD9H 2WHXA 1O2XA 4ZAEA 5J4SA 3GOVB 1A4WH 1O3EA 1ANBA 1UCYH 4JCNA 1O2UA 2K0QA 1O2RA 1ETSH 4HI3A 1GBCA 4B1TA 1GMCF 2SGPE 3NPSA 2L74A 2GZ9A 2FIRH 4JZIA 2TBSA 1GJAB 1RJXB 3A8AA 1GBFA 1DICA 2VWOA 5EG4A 2ZFFH 3FZZA 2YMSC 3VXFH 1YCPM 3M5LA 4MNYA 3AAUA 1BT7A 4CBNA 1RIWC 1XUGA 2JKHA 1N6YA 5F03A 2QXJA 2RA0A 5B6OA 3F9EA 2L6OA 3OY5U 5HM2A 2EQNA 3OY6U 1GJ9B 4FETA 1G30B 3GCOA 1SPJA 4K8YA 2LPRA 4X2VA 2ZGBH 4H4FA 2BY6X 1CGHA 1JIMA 1ELGA 1QA0A 3OYPA 2VH6A 2CMYA 3MNXA 1Z6JH 1ZHRA 2R2MB 3CS0A 1KIGH 1VITF 1ELBA 4B71A 1EP6A 4NWKA 1LVOA 2A2XH 4I31A 3B9FH 2GMTB 1V2UT 1O2YA 1TALA 2BDYA 2AGEX 4UFFH 3SORA 1ZGVA 5GJ4B 1XUFA 1MQ5A 2A0QB 1KTTB 1GJBB 3MH4A 4ZKOU 1DS2E 2FOBA 2DUCA 4CRBA 2ZFTA 2FODA 1VGCB 1QCPA 2Y6TA 3EYDA 1SSXA 1DWCH 1AFEH 2BLWA 3MOCA 4ZUHA 1GL0E 1KLTA 1GI9B 4XFQA 2ZHQH 2ZFQH 8ESTE 3RMOH 5E2PA 2Q6DA 4Y76A 3L33A 3N99A 3EBNA 3F2FA 4E7NA 1LHCH 1AMHA 1QB1A 4ABGA 1WTHD 3F3BA 2TGAA 2F9VA 1IHTH 3U9AH 1HGTH 1RS0A 2FYRA 2W6ID 1IQLA 4IGDA 5JBBS 3A86A 2M2AA 3PV5A 3GISB 1A2CH 1DWEH 4FUHA 1MBQA 1FDPA 1NFUA 2AMPA 2RDLA 4UFEH 2AMQA 1FPHH 3U8TH 1ZZZA 1E1QD 4ZHMU 3LOXA 4NIYA 1CA0B 1QBOA 1FAXA 1AQ7A 3C27B 1H8DH 2I6SA 2G00A 3EA8A 3SV8A 3A82A 2BY8X 4LXBH 4Q7YA 5GNDA 4CRAA 3BTHE 4IMZA 1HRTH 3A85A 4YOGA 2XBYA 1FQ3A 3QO6A 2WPMS 3A7WA 3A8CA 5SGAE 1ELTA 1GDNA 4AORA 1GI4A 2UUJB 1GG6B 4M9FA 5CE1A 5HM9A 2P16A 2A5IA 1P3EA 1P2QA 3O8CA 1L1NA 5K0HA 1AKSB 1SHYA 3ODDA 3KL6A 2FESH 1YGCH 5CDFE 1C5TA 1MTSA 2ZEBA 1RFNA 3SU2A 5I25A 5DN6D 2JETB 1AHTH 1TE0A 2CN0H 1G2MA 1GVKB 2EI7A 3DD2H 1O38A 1SLVB 3UNQA 5JBAS 2XNIA 1JWTA 1FV9A 3E3TA 3MH5A 1GVZA 2HNTC 2J97A 1Z8JB 3QZQA 3SOSA 4CBOA 1Y8TA 1GBJA 4IN2A 3KQBA 2YMSB 3LONA 1GDUA 2F9OA 1RIWB 2CF8H 2AYWA 1VCWA 2XBWA 3M61U 4JZDH 2PKAA 4XBBA 2V3MA 2F3CE 4JZEH 3LGIA 1TAWA 2G81E 1AB9C 1TNKA 3OEED 2KAIB 1TYNA 2C90B 1GHXH 3KHVA 1WQSA 1TNGA 2C8YB 1BQYA 2ANWA 1FN6A 3TIUA 1QJ6B 1ELDE 4AZ2B 2P3FH 5G4BA 1NO9H 1OSSA 1GI1A 1Y59T 2Z3EA 3GDUA 3ZZDA 1VCQA 1CO7E 1C5QA 3B23B 1FX0B 4UEHH 3RUOA 3LGYA 1BTPA 2F43B 2GZ8A 1IQGA 1HAHH 1WYKA 3BTQE 1J16A 3U69H 5LPFA 2OP9A 1JRSA 1SLXB 2BXUH 2BX4A 2HWLB 1C2LA 2QE7D 4F49A 4WH6A 5E0GA 1DFPA 4MTBA 3PM3A 5AHGH 1EB2A 1PYTD 1C2IA 5C1UA 2BZAA 4IS5A 2FEQH 2W7UA 1UHBB 3SGBE 3ZV8A 2BYAX 2FOEA 3KQDA 2A4RA 4KP0A 3PTNA 1K21H 3E90B 2EI6A 4Y7AA 2FI3E 4ACBA 3F9GA 1YLNA 2VINA 3F0OA 3SU3A 1QL9A 4INKA 3URCA 3RC4A 3U8OH 2WYGA 2XBVA 2VVCA 1D3TB 3TK6A 3CS7A 1TQ7B 1XUJA 3ZVFA 2Z9JA 3EGKH 4D7GA 5DP3A 3ZZBA 7KMEH 3UUZA 2WV4A 3SUGA 2R0KA 4E7RG 1V2QT 3M7QA 1ELVA 2LNCA 2J4IA 1TBZH 2BB4A 4XSKU 1H8IH 1HAIH 1NROH 4HGCA 2ZQ2A 4CHAC 5EIYA 1K1IA 2G4UA 3SU6A 1N8OC 1ZMLA 3U28C 4BAKB 2G8TA 3ODFA 4WVPE 3TITA 4JMYA 2BD2A 3E91A 2Y80A 3Q00A 4FU8A 3MNBA 1IHSH 1DSUA 4Y79A 1RD3B 1VZQH 1HAGE 3RU4D 1JRTA 4RSPA 2BD8A 3V0XA 2GGVB 2CV3A 1A5IA 1FONA 4I8GA 4IN1A 2KM0A 1XUKA 1F5LA 1BMAA 1FXYA 5DP7A 4R0IA 2AIQA 3MYWA 1Z7KA 3S7KB 5C5OA 2R2WU 1GBDA 1Y5AT 2XCNA 1CT2E 5DG6A 2FLRH 1BJVA 4TY7A 3M3VA 4JK6A 2BLQA 5JDUB 1H9IE 3DSPA 1P03A 1T8NA 1NTPA 1O2LA 1F0SA 5AVDA 5EW1H 1D3PB 1C5OH 1HDTH 3BIVH 1ABIH 2ZPQA 3UAIC 1ZMJA 4BAOB 4FXGH 2HLCA 3ZYEA 4RT0A 1PYTC 1ZJDA 3ZYDA 2HVYB 1IQHA 1GI3A 3FN8A 1S84A 1P57B 5FL7D 1C2MA 1SQTA 2BX3A 4WH8A 1L1GA 2J9NA 2XC4A 1C5XB 3IITA 1QBVH 2ZO3H 3BTWE 1KXEA 3E8LA 2P94A 1RTKA 5EQQA 4IMQA 1TQ0B 3ZZ5A 5HMAA 5BRRE 1XUIA 5EJLA 2ZU5A 3R0FA 4FUCA 1K1MA 1W3CA 1P12E 1O37A 1K1OA 4ISNA 1MABB 1S82A 4B2AA 1ELCA 2Z6BD 1C1OA 1EOLA 2J2UA 3UNRA 4GLYA 4ZXXH 3TK9A 2W26A 1LVBA 2OXSA 3GY7A 4YLUA 1TPPA 7ESTE 2KX4A 3QN7A 3AW0A 5F8XA 1O39A 4ZMAH 3WW7A 4ABHA 2RG3A 3PV4A 4YZUA 1TNJA 3TK5A 1O2WA 1A5HA 1Z8RA 4NZLA 3EA7A 2OTVA 4CREA 1O2OA 3QZRA 3F6UH 3JZ1B 2D1JA 4A1XA 5A8ZA 3FKSD 2BDBA 4D76A 1KLIH 3FANA 3BEIB 1AB9B 1GHYH 1T4UH 2VIOA 4Z1MD 1HLTH 1CE5A 2WPIS 1DWDH 3EQ0H 4JK5A 4CRDA 3MTYA 5HIZA 1TMTH 1ZPCA 1YKTA 1WDIA 2OC1A 1C5RA 3RLYH 3M5MA 4X8TH 5C0TA 1QJ7B 4TWYA 1Y3UA 1TX6A 3BIUH 2EA3A 5LPEA 3ZZ3A 1NRQH 3LPRA 1O5CB 1E79D 2OBQA 1ETRH 4X1SU 1BTZA 1SFIA 2Y7XA 4X1NU 1BTXA 4K8BA 2BY9X 3D65E 2CHAC 1UJ1A 2D26C 1UVPA 3OE7D 1AGJA 1SBWA 3DHKH 4Y6DA 4CH2B 1A3BH 1SI5H 1QIXB 2WUBA 3A80A 2QYIA 2VIWA 3QGNB 3ZZ8A 4B6FA 1O3PB 1BOQA 1NBMD 1XM1A 3K9XB 4DOQA 2HALA 2BD7A 2PGQB 3ZVEA 4HTCH 1BITA 3RC6A 2H5DA 4LK4A 2XYAA 2C3SA 3PWCA 5JBCS 3GS9A 4LOYH 2YOLA 3BEFB 4R8TB 1P9SA 1SGPE 1BTWA 1QQUA 3LGTA 3ZZ7A 5CHAC 3GYLB 4B2BA 3HK6B 4DCDA 4TPIZ 1KSNA 3NKKA 1XUHA 2A5AA 3P8FA 4INHA 5KECA 2G52A 2FS9A 2Z7FE 2RFKC 4CHAB 1O3JA 1G3EA 3ZV9A 1EP5A 4IC6A 2QF4A 3SHAH 3H7OA 1RXPA 1BHXF 3Q76A 3KCGH 2FTMA 3SI3H 1O2GH 1FN8A 4AGKA 1O2TA 3SU1A 1O3MA 1TA2A 2A2QH 3HKIB 2VBCA 1O3LA 2BOHB 3PROA 1OP0A 2AMDA 3Q3KA 2GTBA 5L2ZH 1K1PA 3RC5A 1JXPA 1P8VC 1OS8A 1QR3E 3DFJA 1SR5C 3A89A 5LH8A 3SZEA 1O3NA 2ZECA 1C4U2 3U98H 4NG9H 2WYJA 2SGAA 1AFQB 4JZ1A 1GCTC 3SU4A 1SKYE 3A81A 3MNSA 3GCNA 2ZCLP 3PLKA 2PKSC 1NRNH 1DLKB 1FMGA 3RMMH 1TGNA 1TGSZ 3SGQE 4X1QU 1S6HA 1SGCA 1T8MA 3A8BA 1E37B 1XVMA 2OK5A 3HPTB 3P8NA 2FOFA 1C5VA 2KCOA 1H8HD 1ZR0A 5DP5A 5FX5A 4DGJA 3RXSA 4XBCA 1C4V2 1GJDB 1LVMA 3MU0A 1HJ9A 1UO6A 3QK1A 1SGDE 4TWWA 3CP7A 4FOUC 2H2ZA 3K2UA 3RP2A 2ZHFH 3MMGA 2BY7X 2BD5A 1HAXB 2P3TB 5EQSA 1GJ7B 1UTLM 2J94A 4Y8XA 1LTOA 1CU1A 1MZAA 1V2PT 5C67A 2QV1A 1E38B 4OS2A 2EI8A 2XWAA 6GCHF 1KXFA 1BB0B 1WCZA 4P00A 1BUIA 1O2KA 2STAE 1DVAH 1H1BA 5F6MA 2F4LA 4J1YA 4ISIH 4Y0ZE 6GCHG 3KNXA 1NPMA 1PFXC 1BTUA 2VU8E 3Q3YA 1PPEE 5GPIB 5L30H 2VJ1A 1C2FA 5FPTA 4OS6A 1GBEA 1B0EA 5GCHF 2ZQ1A 4HFPB 1C1VH 4NA8A 3BTFE 4A1TA 1LMWB 2BQWB 4O97A 2F9UA 5GCHG 3UREA 1A46H 3IWMA 1QRXA 3NWUA 1Q2WA 1C2EA 1MMJN 1OYQA 1RTLA 3T27A 2TIOA 5LGOA 2W6JD 1W14U 5EQRA 1O2NA 1E35B 1O2PA 3M5NA 1A1RA 1A0LA 3HK3B 5ABWA 1KLJH 2FWWA 1HAVA 1ACBE 3RXRA 1ANCA 4BNRA 1OX1A 4DT7B 1O30A 1C9TA 1C2HA 4FUDA 5KEDA 3NUMA 4MNVA 3FP7E 1N1LA 2WSSD 5GWZA 1FJSA 1FIWA 2CHAB 2FOGA 1P2IA 4GCHF 1O5DH 2C93B 3DSOA 3O8DA 5AF9H 1OWKA 2B9LA 1KYNA 1Z1JA 4GCHG 3SN8A 3QLPH 2BMGB 4WXVA 2Z9LA 4Y8ZA 2OD3B 2WPLS 1TB6H 3AVZA 1CSOE 1G32B 1TA6A 3AAVA 1GJ4H 1OYTH 1UTNA 3M35A 5B6LA 5IDKA 2I6QA 3GY6A 4WMDA 3GY5A 1F5KU 5CHAB 1BMFD 2BLOA 1V2JT 2QN5T 3M7TA 4I8LA 1DY8A 1P2JA 2QY0B 5EJZA 2GP9B 1GJCB 1NRPH 4ABIA 1K1JA 2ZC9H 3N7EA 3SU5A 4MPVA 3DSGA 3SGAE 1TLDA 2R9PA 3ATLA 1WXRA 3PLPA 1G3CA 2BY5X 2AIPA 2ZHEH 2XXLA
chains in the Genus database with same CATH topology
1EASA 2BXTH 1DE7H 1OKXA 2C4FH 1A5GH 1SB1H 1UTPA 2BOKA 2P93A 1YF4A 3F9HA 2OCVB 4TPYA 3MH7A 2XW9A 1GI2A 1J8AA 3H5CB 5FCRA 3LC3A 3D49H 1XKAC 3BV9B 5DP6A 4AG1A 8KME2 1ESBA 1QL8A 3S69A 3SJ8A 1PQ8A 4I33A 3I29A 3RXEA 4FUEA 1TPAE 3RM0H 1K22H 2Z3CA 1W0ZU 1GHWH 2PKAB 1GCTB 2PTCE 4MLFB 4K1TA 2C8WB 1V3XA 2PKSB 4YOIA 1WOFA 2QIQA 1EX3A 1QHRB 1YYY1 4NSYA 3TGJE 1A7SA 1AZZA 5EOKA 3ZVAA 1AUTC 2SNVA 4I7YH 2GCTC 1ZTJA 1KTSB 1TX7A 3RU4T 3R3GB 1TPOA 1YP9A 1JMOH 1KY9A 1QURH 1ZRBA 5JBTA 2JH0D 3VFEA 1HAZB 1GMDG 1O2QA 1LDTT 1GJ8B 4Q7XA 1MD8A 1ANEA 3P8OA 1Y3XA 1FLEE 2PFEA 4IC5A 3SV7A 1L2EA 1LCYA 1G36A 3M5OA 1O34A 1Q3XA 3LH1A 3PTBA 2GDDA 1SGEE 1NZQH 4DVAU 1S0QA 1DWBH 2F9BH 1MBMA 1V2MT 1ZPBA 1U6QA 2Z94A 2XRCA 3OX7U 3SV6A 1MTUA 3ATKA 1HJ8A 2ZDMA 5JB9S 1AE8H 2V0BA 4YM9A 5DP4A 2FDAA 4AFUA 1EOJA 1V6DA 2ZU3A 1SGQE 1YCPK 4IW4E 2FS8A 4OS5A 3V13A 2ILNA 2GV7A 1YLDA 2SGFE 3A88A 1D9IA 1QNJA 2VIDA 2XC0A 4TYDA 1VJAU 1WV7H 1ZSJA 3LU9B 3SNEA 1YPLH 3OSYA 1THRH 1E34B 4UDWH 1YPKH 4ISLA 1UK3A 3VPKA 3ZZ6A 4NA9H 1T32A 4TY6A 1O3DA 1G37A 1Z6EA 3HGPA 1ESAA 1UVSH 1O3BA 1O2IA 2XWBI 1SLUB 4ABBA 5EPNA 1PQAA 1O2JA 4Z6AH 1LHEH 1BTHH 1UVTH 2FP7B 3FAOA 1TNHA 4X6MA 3U8RH 1EKBB 3SI4H 4OGYA 4ZKRU 4SGAE 2PUXB 2ZGHA 2P8OC 3PYHA 3RXUA 4HZHA 1UK4A 1KXCA 2FX4A 2GT8A 1ZYOA 1KXBA 5F8TA 1C2JA 1TRMA 4U01A 1QQ4A 4Y10E 4B2CA 4MG3A 3TVJB 4X6PA 1GBTA 1S0RA 2EC9H 2FOMB 3RM2H 2HVXA 4K5ZA 3ZVCA 5C20A 5TJXA 3I78A 3KGPA 3PB1E 4ABFA 1QBNA 4WWYA 3MU5A 1TMUH 4FU7A 2UWOA 3RXAA 1W12U 3S9AA 7GCHF 4X2WA 2A5KA 1H9LB 2NU3E 3MI4A 2H9TH 1VCPA 2ZA5A 4KTSA 1AKSA 4CRGA 5A0BA 1TABE 4YO9A 2TGTA 3BTDE 3UTUH 7GCHG 2PGBB 1C1WH 5E2OA 1EPTC 4IBLH 1LKBA 2BDIA 2BVRH 1V2ST 2NU4E 1LPZB 2BD3A 4GAWA 1KDQA 1D3DB 4XE4A 1UVUH 2FYQA 4XOJA 1BMMH 1IQNA 3ZZ4A 2A4OA 4NIWA 1A0HB 1W7GH 3DA9B 1A61H 1OWJA 1EB1H 4MNWA 2ZU4A 1C5WB 1RRKA 2ODYB 1OOKB 2TGDA 3TNSA 4K1EA 2JH5D 1CHOF 4ZKSU 2OC7A 3SO3A 2OC8A 1GBKA 1CHOG 1MUEB 1PQ7A 2Y82A 1C5NH 4UFGH 1IQEA 2FO9A 1W7XH 4X8SH 3JZ2B 4X6OA 2JH6D 2WINI 5FAHA 3MO6A 2PWXA 2PV9B 1C1MA 3O8BA 2HRVA 1O31A 3E0NB 1LVYA 1L1JA 1GDQA 1BRUP 5J4QA 1GCDA 5L6NH 4O03A 2GCTB 3ELAH 2FMJA 5A0AE 1K1NA 2CGAA 1FY8E 1NT1A 5GXPA 2Y5FA 3N7OA 4AX9H 1TX8A 1SOZA 3VB3A 3NXPA 3UR6A 1ORFA 2PHBA 2Y81A 4GUXA 2BVSH 4ZH8A 4NFEA 3SZNA 4U32A 1GJ6A 1S85A 2UUKB 3GY8A 3VXEH 1MTNC 2M5TA 3TH2H 2BD4A 1PPFE 3KQCA 1YPMH 1AIXH 1O0DH 2QC2A 2BQ7B 1P10A 3LKWA 3M37A 1FUJA 3A7XA 3LDXH 1GMHF 1GBIA 2ALVA 1OPHB 2J34A 2J95A 3OTJE 4E05H 4UONA 2VVVA 1GI8B 1GMHG 4NSVA 2ANYA 1UTKA 1AVXA 3Q77A 1O3FA 1DSTA 2GD4B 3TJOA 2SGEE 1O35A 2BD9A 3EA9A 3MU1A 2A7JA 2OQUA 3H7TA 1NC6A 2NWNA 4B75A 4FUIA 2VIQA 1V2WT 4RKJB 1O33A 5L2YH 3A87A 4FUGA 1IQIA 2HPQH 4X2XA 4FUFA 3UQVA 5C3NA 1P09A 3BSQA 2QXGA 2BHGA 1MTVA 3F1SB 3F68H 3TJVA 1SGYE 1YC0A 2AERH 1GI0A 1QFKH 1C5UA 3PMBB 2H5CA 2ZZUH 1YPJH 1V2OT 4BXSA 4X1PU 5T3HA 1LHDH 5HXFA 1HAOH 2PR3A 1GBHA 1O5BB 1OP8A 4A7IB 2VWLA 1GHZA 1YM0A 1HV7A 1W8BH 3VGCC 4UFDH 3EAJA 2O9QA 2P8OB 3TGKE 1YPEH 2F91A 4D9RA 1IQKA 2NU1E 2Q1JA 1G2LA 2Z9GA 8GCHF 1EJNA 1SL3A 3RXCA 2QA9E 6LPRA 1C4Y2 2QF0A 1CBWC 1TRYA 3ZVBA 1EAUA 8GCHG 5GIBA 3PLBA 1YPGH 3ATWA 3S9BA 4OS4A 5TCAA 1OWDA 1SQOA 1FPCH 4AGJA 4BAMB 2GV6A 5FBEA 4MQAA 1AO5A 2TGPZ 3E16B 2ZU1A 1HXEH 1O3KA 4GHTA 2J38A 4ISOA 3MO3A 1EPTB 4X8UH 2ZDVH 3ENSB 4KELA 1P01A 5A2MH 1C2DA 1SHHB 5DO4H 4YLQH 2QXHA 2UWLA 3MU8A 2DE8A 1ELAA 5DJ7A 1V2NT 1AU8A 2GKVE 1BIOA 1NU7B 3SV9A 4BTTB 1C5MD 3RDZA 1BJUA 2O8UA 4WXIA 1DUAA 3G01A 1FY1A 1J9CH 2ZI2H 1N8OB 1WU1A 1C2GA 2ZG0H 1FI8A 5A0CA 1X7AC 1NY22 1O3CA 1TNLA 2G4TA 2QAAA 3RXTA 3GDVA 4D7FA 2F83A 1VGCC 4FVDA 5E8EH 1SOTA 1P2MA 1RTFB 2B5TB 3TPIZ 3W95A 1GPZA 1MCTA 1AUJA 1C1QA 2B8OH 4Y71A 3M3SA 3URDA 3GICB 1FY3A 1LHFH 2XCFA 1QTFA 2OINA 1LO6A 1PPGE 1VITH 1BRAA 5JPMH 3DFLA 3L3TA 3ZZAA 2CF9H 2ZPSA 4KKDA 2AGIX 2ZWLH 2BTCE 3A8DA 1THPB 1TOMH 2ZTZA 4SGBE 1RGQA 4B74A 4DJZB 2ZHWH 3E1XB 3P92A 1CHGA 3DUXH 2A1DB 2OBOA 1V2LT 1ABJH 3NK8A 1C5ZB 1IAUA 2GX4A 1HAVB 5DKMA 1P02A 1BA8B 1MTNB 2R3UA 1C5PA 1F7ZA 3KIDU 3MFJA 3ATMA 1P2KA 1SFQB 3UWIA 4Z0KA 3HATH 1UTQA 2W5EA 3PMAB 1HB0B 2VVUA 1TFXA 3I77A 3NZIA 4X6NA 3RXJA 4Y7BA 3A7YA 4X0WU 2ZU2A 3GY2A 1TONA 4ZKNU 4K69A 1C5LH 1EJMA 3UIRA 2SFAA 4Y11E 5CMXH 1CGJE 3T62A 1SMFE 1P06A 1DM4B 1AN1E 2AS9A 4K2YA 2BVXH 3RXIA 2ZDKA 3SQEE 1GI6A 2ZNKH 2ANMH 2FI5E 1UVOA 3QGJA 3QTOH 1EZXC 2ZTYA 3GDSA 5DPAA 4CRCA 5JYIA 2W3IA 1OP2A 1ZRKA 1L4ZA 2FZZA 2HNTE 5FCKA 5FHTA 1BMLA 3SJOA 3T25A 1AWFH 4FU9A 4LZ1H 5TCCA 1F92A 4UE7H 2BDGA 1ZHPA 2ANKH 2G5VA 1FY5A 1DLEA 1NFYA 2GCHF 1WUNH 3ATIA 3P17H 4ZROA 1O2ZA 3ZZCA 2GCHG 3SV2H 2HOBA 1EUFA 1O2MA 2ALPA 1C5SA 1N6XA 3TJUA 1HIAA 3VGCB 4KTUA 2PW8H 1C5YB 3TU7H 2TPIZ 2OUAA 1GMCG 1K2I1 2STBE 1CA8B 2V6NA 4H6TA 1BMNH 1T31A 1TGTA 1A0JA 3BTME 1CBWB 1W2KH 2IJOB 2ZFSA 3RXPA 1GL1A 1YPHC 2H9EH 2V35A 4FUBA 2VGCC 4GPGA 1S6FA 4YESB 2A7CA 2H1UA 1WSSH 2C8XB 1GHVH 1QB9A 1ANDA 1QA7A 1XMNB 3PO1C 2VIPA 4NIVA 1HAYB 3KN2A 5DGJA 3ZVDA 4RKOB 1JIRA 3K6ZA 1TIOA 2ZDAH 7LPRA 3GCHC 2BDHA 2CJIA 5JB8S 1S81A 1ZSLA 3SJKA 1HYLA 4ABDA 5A8XA 4AB8A 2BM2A 2UUFB 4AFZA 1VITG 4ABAA 1QJ1B 4K60A 1ZSKA 4H6SB 1V2RT 4E06H 2B0FA 3RXMA 3ITIA 1KXAA 2ZHDA 2PLXA 3BEUA 4AB9A 4KTCA 3LGUA 3LIWA 1ZHMA 1SQAA 3QWCH 2ZIQH 1IQJA 1O3GA 3A7VA 4I8KA 4DURA 1QY6A 3V12A 1ARCA 1F0UA 1UCYK 5PTPA 1SG8B 1UTMA 1QB6A 1C2KA 4D9QA 3S0NA 5EGMA 1AVGH 1YCPH 2OQ5A 1SGTA 5T6DA 2Z9KA 2OC0A 4MNXA 4PROA 5DP8A 3TLOA 1K9OE 1PJPA 2ZDLA 3SU0A 1MZDA 1C9PA 3UWJH 3SUFA 1AD8H 2WPHS 4NWLA 1TMBH 4WY3A 4ZHAA 1G9IE 3GY3A 1ZOMA 5EXMA 3QDZB 5E0JA 1T8LA 4AG2A 4WF8A 2ZP0H 1SGFA 4I32A 3RXOA 3UPEA 1EJAA 1TGBA 4BXWA 3FZDA 2DE9A 1E0FD 5FPSA 1O5AB 1P3CA 2NU0E 2F9PA 1B7XB 1SGFG 3ZVGA 5FPYA 1GMDF 1B0FA 1CGIE 4XBDA 1H9HE 1BDAA 1SGRE 2O8MA 1QGFA 1AZ8A 4J2YB 4AOQA 3UNSA 5FBIA 4XDEA 4MPXA 4WMFA 3K65B 2XBXA 1Y3WA 3TNTA 2ZCHP 3ESTA 3STIA 2SNWA 3MH6A 2QXIA 3P8GA 1OXGA 4AFQA 1XXFA 2QCYA 1O5GH 1MQ6A 2TRMA 3PMJA 1INCA 1J17T 1CVWH 1D3QB 1ZMNA 4ZHLU 1GJ5H 1P2NA 5HYOA 1ID5H 1W10U 2BQ6B 1BZXE 4NCYA 1P11E 4JYTA 2J92A 3GYMA 3KQEA 4OGXA 2PSYA 1GGDC 3QUMP 2A45B 1DANH 1TBRH 2Z3DA 3E6PH 2Y5GA 3RU4E 1MU6B 1TRNA 1NESE 3UR9A 1A3EH 3LH3A 1LPKB 5IYTA 4DIIH 1CT0E 1QL7A 2HGTH 1TPSA 1MKXH 1KDQB 3ZZ9A 1BBRH 2PTNA 4NIXA 4O9VA 2YNAA 1F0TA 2ZFPH 3UOUA 4YT7H 4A5TS 1QRZA 5EU8A 1AWHB 1O36A 3T2NA 1O3AA 3FFGA 1GBLA 4AFSA 1J14A 1SC8U 3A7ZA 1PPBH 3SBKA 1K1LA 1W11U 1XX9A 1SLWB 1O2SA 1P0SH 1LPGB 3RXFA 2G5NA 1QRWA 2GDEH 3QX5H 4JZFH 4BAQB 1DT2A 1K28D 3U1IB 3F9FA 5EXNA 1UK2A 1WQVH 3Q3XA 1VR1H 3NCLA 1VJ9U 4GVUA 1DUEA 1CQQA 2THFB 4WJG2 4CRFA 1PQ5A 1FAKH 1L0ZA 1Z8IB 3GY4A 1ELEE 4AN7A 4U2WA 5HGGA 2ZGCA 1GVLA 4OS7A 1F2SE 1SGIB 4BOHA 2VGCB 1IQFA 3V3MA 4B76A 1HBTH 4ABJA 2AH4X 1MCVA 4Y0YE 1ZTKA 1D4PB 2AEIH 3SHCH 1UCYE 1HAPH 5I46H 8LPRA 3K6YA 1AI8H 3D23A 1WTGH 3PO1B 3MWIU 2VB0A 5H4IB 4DW2U 4DIHH 1TNIA 1HJAC 2A32A 1NU9A 1SVPA 3P6ZB 2IN2A 4H42U 1LQDB 3GCHB 3LJJA 1ESTA 3S9CA 1MD7A 3SNCA 1XXDA 1THSH 2FPZA 3T5FH 3BG4C 1GHAF 2ZDNA 1O3OA 1O2VA 3T26A 2ZCKP 1ELFA 4MPWA 3RMNH 4DY7B 1WAYB 1GHAG 2FI4E 1FY4A 1MKXK 4NA7A 3KF2A 5EPYA 1OWHA 9ESTA 1BBRK 1MKWH 1MTWA 3DT0H 1C1TA 3MHWU 5ESTE 3SJ9A 2PSXA 4THNH 1BRBE 3SNDA 3EDXB 1TWXB 2A7HA 3RXDA 2ZPRA 4CH8B 3BF6H 4JYVH 2O8LA 1PPCE 2R3YA 3B8JA 1PPZA 5FX6A 2Q6GA 1DITH 1GBBA 1IQMA 4WMEA 1O5FH 1ZTLA 5A8YA 1T7CA 5A09A 1IOEA 4NFFA 3M3TA 5AFYH 3T28A 2KAIA 4YT6H 1C1SA 1TBQH 2D8WA 3E0PB 1NFXA 4BAHB 2VWMA 3SUDA 4AYYB 1T8OA 3O8RA 4K3JA 2NU2E 2K1QA 1MAYA 2P59A 5ETXA 5C1XA 3D62A 3UY9A 1P04A 3FP6E 2R0LA 1NRRH 4I8JA 2FOCA 3RXVA 4Y8YA 1M9UA 2ASUB 4U30A 1F0RA 3BTKE 1G3BA 2SGQE 2K7XA 1AFQC 4Q7ZA 3M36A 3M7UA 1Y3VA 2A4QA 2LIZA 1Z8GA 1YLCA 2QF3A 3A84A 2BDAA 4GSOA 1MKWK 3LT3A 2AFQB 3GCTF 4X2YA 1BTYA 1UHBA 3UQOA 2VIVA 1S83A 5C1YA 4BANB 5E0HA 4YTAA 1GGDB 1HNEE 1EAWA 3GCTG 4YOJA 5C2ZA 3VEQB 1EXFA 1KXDA 3SNBA 3AASA 1AY6H 3VB5A 4A92A 6CHAC 5FXLA 5EODA 1Y3YA 2GVFA 3RXHA 2ZGJA 3LGVA