2OINA

Crystal structure of hcv ns3-4a r155k muntant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFKAAVCTRGVAKAVDFIPVENLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprotein
publication title Phenotypic and structural analyses of hepatitis C virus NS3 protease Arg155 variants: sensitivity to telaprevir (VX-950) and interferon alpha.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 34
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oinA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oinA01
1J14A 1CT0E 4BANB 1YPLH 2V3OH 5A8XA 3P70B 2Y80A 1PQAA 3AW1A 4OM9A 3SUGA 1BIOA 8GCHF 1DWDH 3G01A 5E2OA 3MTYA 1ZHMA 2WPLS 4ISNA 1VGCB 2ZKSA 1F92A 4DIHH 4TWYA 3U8RH 1EAXA 4VGCB 1LKAA 3RU4T 4DJZB 1CHGA 4DVAU 4UFFH 2VVUA 1DITH 3LIWA 4IN2A 3MU0A 4AG1A 3SUFA 4JK5A 3ZZDA 4Y76A 1SMFE 2GZ9A 2FMJA 3H09A 1PQ7A 3SYJA 2HNTC 3AK5A 1PPCE 3P8GA 2FIRH 3A80A 1LO6A 4JZEH 5J4QA 2TRMA 1RXPA 2R2MB 2FS9A 2P16A 2J9NA 2BLWA 2K1QA 1GG6B 1TMTH 1TNJA 1AGJA 1Z8JB 2BLOA 4H4FA 3LONA 4X8SH 1CSOE 2FX6A 4NIWA 2RA3A 1Q3XA 1TNKA 2GTBA 1G3CA 3GY2A 1ZPBA 1P10A 2BDGA 1FY8E 5DP5A 1TPOA 2WYGA 2H1UA 2AYWA 1TONA 4ZAEA 3VGCB 1QB6A 3P8NA 2BY9X 1DY9A 2G81E 4MTBA 1S0RA 2FI3E 4ZKSU 7GCHF 2SGAA 4NCYA 1YCPM 1T8MA 2BXTH 5DO4H 2O8UA 2Q1JA 1Y3WA 1RTLA 1KXDA 4A7IB 1TB6H 2BDYA 1C4Y2 4X8VH 3RXFA 1H9HE 1O3KA 1FAKH 3HK6B 3GCOA 2GX4A 1B0FA 3MH7A 4NFEA 1K1IA 4U01A 7LPRA 1BMLA 1NFWA 1GG6C 1N8OC 3LGUA 1PPZA 4Y8ZA 1ID5H 1ZZZA 1C1QA 3F9FA 2B7DH 1S81A 3NPSA 4FU7A 4YOGA 2ZG0H 4XFQA 2DUCA 3V12A 4K8YA 1EZUC 5EXMA 2QXIA 2O8TA 2BTCE 1BTWA 1CU1A 2A4OA 2JH5D 1AHTH 2NU3E 1P2NA 4ABDA 2OTVA 3F6UH 4YM9A 4CHAC 1LVMA 1BCUH 2Z9LA 5C3NA 3SV9A 1TMBH 2XRCA 2OUAA 4KTUA 3UUZA 1MD8A 1UTMA 3ZZ3A 1NY22 2RDLA 4MQAA 1GI8B 5EW2H 2G52A 1GHAG 2Y5GA 2BD2A 2ZDNA 1AD8H 2GGVB 1IAUA 1O2PA 1TPPA 2QIQA 2ZGCA 3HKIB 2W26A 5FBEA 1MTNB 1Z6JH 4Y79A 2JH0D 1IQLA 3RU4D 5HM2A 3FZZA 2AIQA 1P2JA 4XBCA 2XBVA 1L0ZA 1DVAH 2BOHB 4UFEH 1ORFA 4TPIZ 1TPAE 1SHHB 1HDTH 2TGTA 4FUIA 4WXVA 2ZU5A 2ZGJA 3AW0A 2ZNKH 1QBVH 1K9OE 6CHAC 2BDBA 2SNVA 3TK5A 1GL0E 4JZ1A 2OQ5A 4WWYA 1C1VH 4JZIA 2A2XH 4YLUA 4ZMAH 3A85A 4BAKB 3TH2H 1MKXH 1SLVB 1UHBA 1W13U 4U2WA 3MFJA 2CF9H 1OP0A 2A7HA 4MDSA 1UTKA 5C2ZA 3TIUA 3UTUH 1K1OA 2GT7A 1C2MA 3F9GA 5C5OA 1FXYA 1SB1H 1MTNC 2M5TA 4K2YA 4J2YB 1YLCA 5GXPA 1D3DB 1A3BH 1L4DA 4B6FA 4U32A 4CREA 3SUDA 2AFQB 3T28A 4YOJA 4CBOA 1NRSH 1SGFA 1O3PB 3SGQE 1HAYB 4BNRA 8ESTE 2P8OB 3ELAH 2ZFPH 3BTEE 1IHSH 4THNH 2C3SA 4A1TA 3M5LA 2EI8A 4CR5A 1DLEA 1EB1H 4CRFA 3S9CA 2HALA 4OS2A 3GOVB 1NU7B 3MO9A 2A1DB 2FI5E 1O3IA 3LH3A 3VXFH 2H6MA 2W3KA 2G4UA 3SORA 3E91A 1YGCH 2VBCA 2Q6GA 5JB9S 1CQQA 1AVWA 1VR1H 4ZXYH 2EI6A 3FFGA 4PROA 1O39A 3UWJH 3ENSB 5JPMH 5GJ4B 4ISOA 4ABFA 1O2XA 3SI3H 1ZRKA 1GJ9B 2BDCA 1CHOF 2HNTF 1V2RT 1Y3UA 2W7SA 3T5FH 2ZU1A 1O2JA 2ZFTA 3GDVA 1KY9A 1NESE 1O3OA 2P8OC 2TGDA 4KELA 1RRKA 2XC5A 2QYIA 4MNYA 2ZFQH 5EQQA 2OP9A 8LPRA 1MZDA 3RXVA 1IQFA 2H5CA 4B73A 3H7OA 1WUNH 1O3BA 2WPIS 3VB7A 3SU4A 3PROA 3SU5A 2ZTXA 2ZTYA 4BTUB 3M7QA 1GMCG 3SJOA 1FN8A 2FOCA 1QJ6B 2HNTE 4KTSA 3WY8A 1TWXB 1TBQH 1ZJKA 1GJ6A 1T4VH 3DD2H 1QCPA 3PYHA 1GMDG 1N1LA 1ZTLA 3T26A 2XWBI 1QURH 3RXBA 3ZVAA 2QF0A 1QQ4A 2UWLA 3SU3A 1HXFH 5JBBS 3L6PA 1SLWB 1GBAA 1XXDA 5SGAE 2GZ7A 5AF9H 3SQEE 3DFJA 5J4SA 5DJ7A 3FAOA 2FWWA 2ZQ1A 4FU9A 4FUDA 3RUOA 5G4BA 3F68H 3S0NA 1SGTA 2BLQA 4B1TA 1T7CA 2GV7A 4JZFH 1MAYA 1P06A 1K22H 1HAIH 1TBRH 1A5GH 2R9PA 3AASA 1OOKB 3SOSA 1GI4A 5DKMA 1YPKH 3RXKA 1P2QA 4TWWA 1MTVA 3M5OA 4ZHLU 1C5OH 3RU4E 2ODQA 4SGAE 2P93A 4AYVB 1EZQA 1VCQA 3IWMA 1CGJE 4MNWA 4AGJA 1B7XB 4BOHA 1F0TA 1V6DA 2VB0A 1KLJH 2STAE 1VJ9U 1O3JA 2F9BH 5A8YA 1VITH 2OC0A 1NPMA 2QGRA 1O5GH 1PPHE 1K1LA 1GI2A 5LH8A 2IJOB 2FOEA 1IQMA 3KHVA 1VZQH 5A0BA 1LHDH 4OS7A 1P3CA 1O2YA 3AVZA 1CT4E 1HB0B 3PWBA 1TGSZ 1SSXA 1VITF 1W10U 4A5TS 5F8ZA 1GCTC 3PLKA 1TRMA 1AI8H 1PJPA 1EQ9A 4K60A 4GAWA 1YPMH 1V2VT 3FZDA 5C5NA 1FIZA 4BTIB 1MTSA 2JH6D 3M5MA 4K3JA 4GVUA 1QL9A 2SGQE 1EAWA 3V3MA 2VNTA 1QGFA 2FOGA 1C5SA 2G4TA 3A7VA 3MYWA 2P3TB 5L2YH 1TOMH 2OQUA 2BDIA 3E90B 3QK1A 2Z3CA 1DPOA 1IQKA 1F5LA 1IQEA 3ZVGA 2XTTB 4UEHH 1CHOG 2HPPH 3I29A 3SO3A 2KAIB 3BTTE 3K6ZA 1V2TT 2WINI 3URCA 4B74A 5LPFA 2ZQ2A 1MKXK 1W8BH 2PLXA 1EJNA 3LKWA 3MU1A 3STIA 2BOKA 4ZKNU 3LJJA 1SGCA 4B6EA 2QXJA 1W0ZU 1V2PT 1S82A 5A2MH 1HV7A 3RC4A 2AGIX 3TJOA 4M7GA 2VGCB 1CGHA 1YCPH 1NT1A 1XVOA 3A82A 3VFEA 2PGQB 4GUXA 1UK4A 5LPEA 1QJ7B 2XC0A 1FZZA 1TNGA 2ZGBH 2ZHWH 3PMAB 1ABIH 4ABAA 1QY6A 2XCFA 3IG6B 4YZUA 5L6NH 1GBIA 3K6YA 4BTTB 4JCNA 1AZZA 1AB9B 1O37A 3FVFB 1F5RA 2ZHEH 1HNEE 3SN8A 3U8OH 2NU4E 1C1TA 1C2DA 2R2WU 3SGBE 1HAOH 1O38A 3E6PH 1CO7E 7KMEH 1GBJA 1SGYE 2O8MA 1C1MA 2B5TB 1GBEA 4NSYA 4RI0A 1MH0A 1HAVB 1OXGA 5E0GA 1LTOA 2Y7ZA 2ALPA 2Y7XA 1XVMA 1SLXB 1SHYA 2ZGHA 3RXSA 2RCEA 4NZLA 1ETTH 1LMWB 2BX4A 2F9VA 4DCDA 3CS0A 3TNSA 3TH3H 2ANYA 3A89A 2GVFA 1TQ7B 3SV8A 3A88A 4ABJA 4IW4E 1ZGIA 2GDEH 1WAYB 2C4FH 1BQYA 3R0FA 2VH0A 1KXEA 2FZZA 2GDDA 4ZHAA 2G5NA 1HJAC 4TY6A 4CRDA 3LGTA 4JYUH 1HGTH 3FP8E 4F49A 3M3TA 4RKJB 4I8LA 1DS2E 1TX7A 3MNXA 4B2CA 1C2FA 4O03A 1C5RA 2B9LA 4DURA 1QL8A 4YTAA 1EOLA 2R0KA 1YPJH 1Z1JA 2TPIZ 1C5WB 1A5HA 1MCTA 3L33A 1AUJA 1FONA 2A2QH 1FY3A 1MMJN 2VWLA 1AKSB 1LHCH 3SHAH 1OWEA 3MH5A 1NFUA 3BG4B 4M9FA 1N6XA 2BB4A 1MBMA 1BZXE 3B23B 2IOTA 1AE8H 3GISB 2F3CE 1GI3A 1V2MT 4D8NA 5AFYH 1WQVH 3U9AH 1O33A 3GY3A 1SPJA 1TIOA 1UTJA 2G55A 3ITIA 2ZFRH 2IJD1 3SGAE 2BX3A 9LPRA 4X1QU 2WHXA 1TOCB 3RC6A 4HGCA 2BY8X 2VIPA 1SBWA 6LPRA 1C5MD 3ZVCA 1GJ5H 1XUKA 1O5FH 4F4OC 4JYVH 3UY9A 1W12U 1O5BB 5BRRE 3M3SA 4AZ2B 3VB6A 3LPRA 1T32A 1AO5A 3RM0H 1KXBA 1C1RA 1HBTH 3ZV8A 2Z9KA 4ISIH 2QN5T 1WTHD 5EQSA 1TRYA 1GHAF 4XBDA 4E7NA 2PHBA 2W5EA 1FAXA 2AERH 1TX6A 3BG4C 3KIDU 4A1XA 1EB2A 2W7UA 1P8VC 1CT2E 1N6YA 1Y3VA 2GZ8A 2ZDVH 3UQVA 1ARBA 1YBWA 2NWNA 1HAZB 3ZZAA 3MU8A 2WV9A 4Q2KA 4AFZA 1BTUA 1GJDB 1XUHA 2ZGXH 1PQ5A 1PPEE 1DSUA 3C27B 2AEIH 3LT3A 2BZ6H 1UVOA 5DG6A 1C1SA 1Y3XA 1SGRE 4DGJA 2AGEX 2XCNA 1QTFA 3SHCH 1F0UA 4INHA 4H6TA 4X2YA 2CXVA 2CN0H 3PTNA 5EU8A 1ESTA 1OKXA 3UR6A 4AGKA 1RTFB 1OWJA 3A7WA 3ZV9A 4YT7H 4TY7A 2A4GA 2THFB 2HPQH 1C5XB 2G5VA 4LZ1H 2BYAX 1OP8A 2J95A 4O3UA 2FTLE 1GDUA 3SNAA 1GJAB 5DP9A 1GBFA 1GHYH 6GCHG 1N8OB 1O5DH 1D6WA 4Y7AA 1L2EA 3QGNB 4UD9H 3BEIB 4Y8XA 1UTLM 4NA7A 5ABWA 1IQIA 3NKKA 4ZHMU 1EZXC 1TLDA 1UK3A 4OS6A 2HLCA 3UOUA 4R0IA 4WY3A 1DXPA 2D1JA 4LXBH 1O2OA 5A0AE 1B5GH 1YCPK 2XBWA 3ZVDA 4CHAB 2OK5A 2HRVA 1MAXA 1KLIH 1RIWC 2ODPA 2R3YA 1DM4B 1V3XA 2PKAB 2UUFB 1Z8GA 1RTKA 3KQCA 5AFZH 1TGNA 2Z9JA 1C1WH 1SGNE 3RXMA 1V2NT 3FP7E 1BBRE 1EAIA 3T29A 2FDAA 3RXAA 1NFYA 1ACBE 4K5ZA 3VB4A 1P04A 1P2OA 4AG2A 3A81A 2OBQA 4SGBE 3RXDA 4B76A 3BTDE 5I46H 1GVKB 2FPZA 1UJ1A 3ZYEA 1C1UH 4NIXA 3M37A 1XKBC 1HIAA 3RMOH 3QX5H 3SI4H 1X7AC 5FX6A 5EXNA 3KQBA 2J34A 3PV2A 3S7HB 2Q6FA 4MVNA 5T3HA 1FY5A 3OSYA 6CHAB 3RXOA 4Y0ZE 4CH8B 1Y5AT 4FUBA 4AORA 1V2QT 1SR5C 1EASA 2ZI2H 1P3EA 2ZWLH 1P2IA 2Z9IA 1GMCF 1RD3B 4HFPB 5C1UA 1ARCA 3QLPH 3SU1A 2A0QB 1O2QA 1OPHB 4D7FA 5ESTE 1C4U2 3ZVFA 3STJA 1FLEE 1EPTA 1O3GA 3GY6A 3S69A 1O2IA 2C8ZB 1BJVA 1GMDF 1SLUB 1RJXB 1AIXH 4I7YH 1OWHA 2CMYA 1FDPA 3A87A 5B6OA 4X2WA 4Z0KA 1NRQH 1ZYOA 1GI6A 1V2UT 2FTMA 4NA9H 1EP5A 4X1NU 5C20A 2QCYA 1LQDB 1NS3A 3QZRA 3OX7U 1XUIA 2WUCA 4LOYH 1GBCA 2QXGA 2ULLA 2XXLA 4K69A 2ZECA 1PPBH 4AX9H 1ABJH 3QN7A 4Q7YA 2PKSC 3LU9B 4NWLA 3QTVH 1AVGH 5ESBA 4JYTA 1SQTA 5FCRA 1Z8IB 1ELEE 1O2VA 2Q6DA 1G9IE 1P05A 1GVZA 2H5DA 1D9IA 1OP2A 2BDHA 1Z1IA 3TK9A 1O3MA 1YPGH 3CS7A 3PB1E 4FUCA 1T8OA 1BOQA 3O8DA 1FPCH 1GI5A 3UFAA 2SGDE 3W94A 2FXRA 5AHGH 2BHGA 2F83A 1FUJA 1EJMA 4BXSA 5JBTA 1QBOA 1Y3YA 4NG9H 2ZEBA 2OINA 3DFLA 4QT8C 2D2DA 3NK8A 3P6ZB 1EATA 1DSTA 2VWOA 5K0HA 5F6MA 1T8LA 2A45B 1W7XH 2FS8A 4D9QA 4WMFA 3M35A 4HTCH 1FV9A 1HLTH 2P3UB 1IHTH 5T6DA 4A1VA 1Y5UT 1C5QA 3TH4H 5DGJA 4AFSA 4XBBA 1CA0B 1P57B 3VB5A 4D7GA 4TPYA 3Q76A 2V35A 4INKA 3SNDA 1D4PB 1A0HB 2ZIQH 1ZPZA 2VIOA 1T31A 2ZP0H 5EG4A 3A8BA 1C2KA 2BLVA 3UWIA 4ZKOU 4ABIA 1KYNA 1TGTA 4ABEA 3GY4A 1ZLRA 3SJKA 2FX4A 1DWBH 3BG8A 2AH4X 2C90B 3GCTG 1DICA 2OCVB 3S7KB 4AOQA 4LZ4B 2PSXA 1KDQB 1TFXA 4BAQB 1QRWA 5L30H 1V2ST 4ABHA 2NU0E 1CBWB 4Y8YA 4FVDA 4Y71A 5EQRA 3QUMP 1TNLA 1C5TA 1CA0C 5C67A 3A86A 5L2ZH 4K1TA 3RXCA 1OYQA 1GGDB 1C5LH 2BVXH 3MHWU 1DUEA 3GCHC 1O32A 2ZO3H 4UDWH 1NROH 1NRPH 1P2MA 1ZHPA 4E06H 1XUGA 4NA8A 1NO9H 4KGAA 2Z94A 3L3TA 2O9QA 2VU8E 1DXWA 1J17T 2ZU3A 3MO6A 3Q3XA 1XKAC 1THRH 3W95A 1A0JA 1NC6A 1ZR0A 3BTWE 3SW2B 1O35A 3O8CA 2JKHA 2BDAA 3TJVA 4ABGA 2WUBA 1G2LA 1O2HA 2XYAA 1GCTB 1O2LA 5H4IB 4AFUA 1K2I1 1S84A 4XE4A 3URDA 1RFNA 1EKBB 1G37A 3E0NB 4ZXXH 1HCGA 4YO9A 1O0DH 1CBWC 4GPGA 1Y8TA 3P17H 1AQ7A 1UMAH 3A7YA 4CRAA 2OXSA 1A0LA 1EAUA 1GGDC 1LVBA 4RSPA 3TPIZ 1HAPH 5JYIA 1G3BA 3GDSA 1E38B 3RLWH 1ELTA 1CE5A 3HK3B 1KXAA 5HYOA 1O2TA 1UTNA 2A31A 1ANEA 1GMHG 4MPVA 3AAVA 1GWAA 4Y10E 2VJ1A 3ZVBA 1F0RA 2GP9B 3ESTA 3P8OA 2FODA 2ESTE 3PMBB 2ZF0H 3A8CA 4WH8A 2XBXA 3BIVH 3HGNA 5FHTA 3SNCA 2YNAA 3T27A 1SQAA 1P9UA 3BN9A 3QZQA 1GBDA 2ZCLP 4CBNA 3D23A 4OGYA 1V2KT 3MNSA 5GPIB 1C5YB 1GCDA 1VJAU 4OS4A 1ANBA 1MD7A 1JIRA 3A7XA 4AYYB 3RXHA 1AE5A 1MQ6A 3EE0B 3PLBA 4JMYA 2BQWB 1XMNB 3ZZ6A 2GT8A 1EUFA 2P94A 1TNIA 3M36A 1KTTB 4TYDA 5TJXA 2BM2A 5DP8A 1QB1A 1BTPA 2GKVE 3AAUA 1YC0A 3EA9A 2OC1A 4DW2U 2GD4B 4MPWA 1UTQA 1ZSKA 2AMDA 4NZQA 5BPEA 3JZ2B 5F8TA 1H9LB 1C9PA 1EZSC 1C2EA 1SC8U 4ZROA 1ESAA 1CGIE 5T1VA 1C9TA 1GVLA 1O2UA 3ODDA 1WU1A 4X0WU 2KAIA 4BAMB 3UNSA 4AN7A 1TRNA 2A5KA 1TABE 1WSSH 3TJUA 1JOUB 4JZDH 1P9SA 2ZFFH 1CA8B 2C8WB 1TYNA 1BITA 4ABBA 1NRRH 3U69H 1TGBA 2FYQA 5DP7A 7ESTE 1SG8B 3LGYA 3ZVEA 3PMJA 1XM1A 1L4ZA 5DP6A 5HGGA 3F9HA 2HGTH 2OC7A 1HJAB 2B0FA 2PTNA 3F9EA 1WXRA 3ZZ8A 2VWNA 1ETRH 4H42U 2J94A 4CRCA 4Q80A 2BZAA 3O8RA 2FM2A 1BRCE 1BDAA 3K65B 1K1NA 5A09A 1HUTH 3KGPA 2Z7FE 1J8AA 2ASUB 2ZTZA 2BD3A 2IPHA 1PYTD 1S6HA 1DANH 3ZYDA 2UUJB 2OD3B 4UONA 3UOPA 1JRSA 1GJBB 3BTFE 3D62A 1V2LT 3SQHE 1HFDA 1G3EA 1YPEH 2BMGB 3TGIE 4D76A 2R3UA 6GCHF 4HZHA 2OBOA 3EAJA 2WPKS 1P11E 3U1IB 1NTPA 2WV4A 1SGQE 1QRXA 4E7RG 4Y0YE 3NWUA 1TMUH 2ZPQA 1ZRBA 3BEUA 4NGAH 5JBAS 1TGCA 3TGKE 2GCHF 1D3QB 1K1MA 4CH2B 4GCHG 1H8DH 1GBLA 3B8JA 2PR3A 3O8BA 2VWMA 3DUXH 1C2JA 3E8LA 2V0BA 3S9BA 4K8BA 3LGVA 1K21H 1MBQA 1GL1A 2ZZUH 3U8TH 1ZOMA 3FANA 3BTGE 2PSYA 4DOQA 3LC5A 4MPUA 2V6NA 5IDKA 1NN6A 3A84A 5TCCA 3DA9B 1EJAA 1SQOA 2FESH 1H9IE 1W14U 3TNTA 2A32A 1GJ4H 3PO1B 6ESTA 1BMMH 1MTUA 2BD5A 3EGKH 1J16A 2LPRA 1VCWA 1TQ0B 4XSKU 3LDXH 3NCLA 3MMGA 3SV2H 1BT7A 4OS5A 2ZU2A 2ALVA 1Q2WA 1THSH 1BUIA 1T8NA 1ELGA 2C8YB 1ZMLA 1AKSA 3VB3A 2ANWA 1HYLA 3A83A 1A61H 1LHFH 2PW8H 1DLKB 5E0JA 1C2LA 4LK4A 3S9AA 5K7RA 3MWIU 4Y7BA 2V3HH 1WYKA 3D49H 4FXGH 2ZC9H 3SUEA 1AVXA 4Y11E 2BD9A 1OWKA 1L1GA 4YT6H 1M9UA 4AFQA 4B71A 2Z3EA 1UTOA 3JZ1B 2R0LA 2FLBH 1GHVH 4Y6DA 5HMAA 3BEFB 1AWHB 1ZMJA 2ANMH 4X6MA 4FUJA 4X8UH 1BTHH 1TA2A 3PO1C 2VINA 1F5KU 3MU5A 2ANKH 3RMNH 4X8TH 2QF3A 3KEEA 3UNRA 3MH6A 2Z9GA 1BJUA 4A92A 1FI8A 4MNXA 2BD7A 1Z6EA 2H9HA 1LHEH 5LGOA 2AIPA 5E2PA 1O2KA 2HOBA 2QXHA 1ZSJA 1ZSLA 3B9FH 4GLYA 1JMOH 3DHKH 3SJIA 1BHXF 1INCA 5ETXA 2FOAA 3UQOA 1HXEH 1O3HA 1GHBG 1OYTH 1SI5H 1U6QA 3PTBA 4XDEA 1RIWB 2ZDKA 1HJ8A 1GJ8B 1G30B 3E3TA 3MI4A 2GMTC 1SGIB 1V2JT 2BVRH 3K9XB 1BBRH 1ELCA 5F8XA 2BY5X 1A7SA 3RXPA 2ZDLA 3I77A 4FUHA 3R3GB 4MLFB 4UFDH 1ZHRA 4B2BA 5HM9A 2ILNA 1SGFG 5FXLA 3BV9B 3OY6U 3V0XA 4JK6A 4R8TB 2GCHG 1WQSA 3BTKE 1BTYA 1S83A 4MG3A 1YP9A 4RKOB 4X1RU 1QBNA 2H9EH 2JETB 3RXTA 3OTJE 2XNIA 1P03A 3Q3KA 1HRTH 1SGPE 3PM3A 3BF6H 5EODA 1ANDA 2EC9H 1Z7KA 4HI3A 1XX9A 3RXRA 4DIIH 1UK2A 3I78A 4BAOB 2Y5HA 2A5IA 2AMPA 3ZZ4A 3GICB 2STBE 1QB9A 2PKAA 1NFXA 2W3IA 1BRAA 1YYY1 3P95A 1VGCC 4FUEA 2Y81A 2CGAA 1UVPA 4VGCC 1YM0A 1KIGH 5T6GA 4O97A 2XC4A 2ZA5A 2F9PA 2ZPRA 1TBZH 5PTPA 1ELDE 1GDNA 1AU8A 3ATMA 2H2ZA 1S0QA 3MNCA 1KSNA 5GNDA 1DE7H 3GCTF 1B0EA 1HIAB 1NRNH 4Q7ZA 1W3CA 2JETC 2TIOA 2PKSB 1QJ1B 3C1KA 3RXEA 1O2ZA 1AMHA 1FY1A 3A8AA 1QA0A 3FP6E 1QQUA 2P95A 1W7GH 4INLA 4ISHH 2ZHQH 4OGXA 3HATH 2UUKB 1LKBA 4OS1A 1D3PB 1SFQB 4UE7H 4ZH8A 3TITA 2FI4E 4FUGA 1SOTA 3VGCC 3F1SB 5DP4A 4K1SA 5GDSH 4X6NA 2ZCKP 2UUYA 1A5IA 4Z6AH 1LPKB 4WXIA 1O5EH 1HAXB 1V2OT 1EPTB 2BVSH 1QA7A 1AWFH 2ODYB 3LC3A 2EI7A 2FOHA 1Y59T 3RDZA 2PWXA 1FNIA 2FOFA 5JBCS 1W2KH 3TVJB 1O2WA 1V2WT 1O2RA 1TE0A 1GDQA 4KKDA 3ATWA 1O3NA 3KL6A 1F7ZA 2BY6X 1UVUH 1SL3A 1NM6A 4X1SU 1MCVA 2BD8A 1ELFA 1LVOA 4GHTA 1C4V2 2NU2E 5A0CA 4WF8A 3A7TA 1FPHH 4D9RA 2Y82A 8GCHG 2HWLB 1ANCA 1O2MA 3V13A 1TX8A 1G36A 1UCYH 1E34B 4I8GA 4IS5A 3RC5A 1UHBB 1K28D 2VVVA 3T25A 4ZUHA 1P01A 5CMXH 1GI1A 1GMHF 2G00A 1JXPA 2F9OA 1EPTC 5DP3A 3SV7A 1UVSH 1C1NA 1OSSA 5E0HA 1O2SA 2FLRH 1P12E 3DT0H 3SU6A 4GHQA 4DY7B 1C1PA 4IC6A 1G3DA 3KQEA 1ZJDA 5CHAB 2UWPA 3CP7A 2ZFSA 4WVPE 2BQ7B 1QFKH 1S5SA 1O36A 1WOFA 3Q00A 1P0SH 1O30A 5F03A 1GHWH 1LPGB 1G2MA 1AN1E 4YLQH 1Z71A 1E35B 2P3FH 1JBUH 2GCTB 2J2UA 3U98H 5EOKA 1SOZA 5I25A 2UWOA 3RXGA 1BMNH 1L1NA 3GCNA 4BAHB 2G51A 1O2GH 2PFEA 1UCYE 2PUXB 3GCHB 1ZTJA 4J1YA 3HGPA 3KQDA 2YNBA 2J92A 3TU7H 2TBSA 4I8HA 1OWDA 1VCPA 7GCHG 3MH4A 3GYLB 1Y5BT 1PQ8A 1J9CH 3OY5U 2F9UA 4MNVA 1MKWH 3QWCH 4O9VA 2RA0A 5CHAC 5EW1H 1BBRK 4WJG2 4E05H 1BRBE 3HKJB 1GBTA 5FPTA 1P2KA 2SGEE 3A7ZA 4X2VA 1GBBA 2J38A 5A8ZA 3SZNA 1TPSA 3LOXA 5FPYA 1KDQA 2GCTC 1GHZA 1W0YH 4ESTE 2QC2A 1JRTA 2VIWA 3K2UA 3MNBA 1DFPA 1O5CB 1RS0A 3E16B 1C5ZB 4Q7XA 2SFAA 1K1JA 1IQJA 5EPNA 3ATIA 5C1XA 1WV7H 4I8KA 2GV6A 1MQ5A 3PMHB 2ZHFH 3TLOA 3GYMA 1YPHC 1GI0A 2I6QA 3HPTB 1YKTA 1KXCA 3PV5A 1LCYA 5E8EH 5EGMA 1C2IA 5GCHF 4O3TA 1RGQA 2YOLA 4CRGA 1O5AB 3ZZCA 1ETSH 2ZDMA 2XBYA 2DE8A 4I31A 1LHGH 1BRUP 2BY7X 1QL7A 1D6RA 1LPZB 2FO9A 1IQGA 1FIWA 2VVCA 1AFQB 4KP0A 3D65E 9ESTA 1BHXB 3BTME 2C93B 3ZZ7A 3TK6A 2A4QA 1DDJA 3GY8A 3SNBA 4I8JA 4IN1A 3QDZB 2FEQH 3RLYH 1H1BA 3RM2H 1DOJA 4ASHA 2HVXA 2TGPZ 4GCHF 5FPSA 5FX5A 3UPEA 1YF4A 1TA6A 2G8TA 4I33A 5GWZA 3EYDA 4YESB 1AUTC 3LGWA 3H7TA 4ISLA 4WMDA 3MOCA 2WPHS 1XUFA 3RMMH 5JB8S 1KXFA 4UFGH 2WPMS 1MU6B 2VH6A 3GY5A 3SBKA 1P09A 1SVPA 1GBMA 4ZKRU 1BTZA 1DWCH 1YLDA 4IMZA 3T2NA 1O31A 4CR9A 1SFIA 2Y5FA 2WZQA 3PV4A 2ZHDA 3E0PB 3SJ9A 1ELAA 1S85A 1AZ8A 1C5NH 2VIDA 1IQNA 3SJ8A 3T62A 3M7UA 1AFQC 1FN6A 3M61U 1C2GA 1OS8A 4FUFA 1QR3E 1E36B 3E1XB 2A4RA 3EA8A 1FJSA 3RP2A 3SU2A 3VXEH 3P92A 2EA3A 4FU8A 4NWKA 1THPB 2IN2A 1QRZA 2EEKA 3QTOH 1ELVA 1PYTC 3ODFA 3EA7A 3BTQE 3LJOA 2SNWA 3RXQA 1FQ3A 1EP6A 4MPXA 1A3EH 1Z8RA 4I32A 1H8IH 4X1PU 1C5VA 3Q3YA 1ZTKA 3QGJA 3RXJA 1D3TB 2O8WA 1GI9B 2XWAA 3IITA 2TGAA 3LGIA 2XW9A 1UCYK 2ZU4A 4AB9A 1MZAA 3KF2A 1O3AA 1WTGH 1A46H 2Z6BD 1DT2A 2WV5A 1BB0B 4WMEA 1DX5M 3LH1A 5C1YA 2CV3A 1Q31A 1PFXC 1KTSB 3ZZ5A 1O3FA 1ZPCA 5GIBA 1C5PA 3OTPA 3N7OA 4IC5A 5AVDA 1HJ9A 4IGDA 3RXIA 3NUMA 3ATKA 2F9NA 4IBLH 1LDTT 1JIMA 3UR9A 1PPFE 2B8OH 1QHRB 2CF8H 4YOIA 3M5NA 4K1EA 3CENA 2ZCHP 1GHBF 5FCKA 1UTPA 2BD4A 1QIXB 2WPJS 1BMAA 2I6SA 1T4UH 5GCHG 4AB8A 3SZEA 1GI7B 1C5UA 3A8DA 1NZQH 1P02A 3SV6A 1E37B 1ESBA 3M7TA 3KN2A 1CVWH 3PWCA 4GSOA 3ZZ9A 1FY4A 3BSQA 1BA8B 2A7JA 3UIRA 1O3LA 2QV1A 1OWIA 3H5CB 2VIQA 1JWTA 1HAVA 4IMQA 2QA9E 2SGFE 1SGEE 5FAHA 3VPKA 1K1PA 3MU4A 1EXFA 4X6PA 1SGDE 2D8WA 4H6SB 5HXFA 5DPAA 2BQ6B 1LQEA 1E0FD 3P8FA 1MKWK 1UO6A 2AGGX 2SGPE 1O34A 1S6FA 2LNCA 4XOJA 5LPRA 3OYPA 3UNQA 1A2CH 2VGCC 2FOMB 2C8XB 2BXUH 4X2XA 1DY8A 2QAAA 4NSVA 4X6OA 1O2NA 1DUAA 4DG4A 2RG3A 1MUEB 2NU1E 4WH6A 4DT7B 3ZZBA 4KTCA 1AB9C 3U1JB 5B6LA 5CE1A 3RMLH 1NU9A 1WBGB 5IYTA 1KLTA 2OC8A 1H4WA 1IOEA 3ATLA 2FOBA 3KCGH 1GBHA 1DWEH 2PGBB 4FVBA 2CJIA 4U30A 3GY7A 3VEQB 3EQ0H 2Y6TA 4BXWA 3NXPA 2PUQH 1TALA 1ELBA 4A6LA 1O3DA 4CRBA 1MU8B 1TNHA 2AS9A 3RXUA 1HPGA 1ZGVA 1W11U 1EX3A 4NIVA 1VITG 2D26C 2J4IA 2A7CA 2CHAB 2QY0B 2H9TH 5FBIA 3TGJE 1A4WH 1AFEH 1GJCB 1YPHE 4B2AA 1L1JA 3RXLA 8KME2 2AMQA 3TJNA 2ZPSA 1G32B 1OX1A 3KNXA 1TAWA 4NIYA 1F0SA 2O8LA 5EPYA 5T6FA 2P59A 3QO6A 2OLGA 5TCAA 3PLPA 1QNJA 1ZMNA 2FP7B 1FMGA 2GMTB 3BIUH 1BTXA 1GHXH 1WCZA 1F2SE 1C2HA 1O3CA 1PPGE 2VIVA 3Q77A 2F4LA 1EOJA 1AY6H 1GJ7B 1XUJA 1C1OA 3OU0A 1IQHA 1UVTH 4NFFA 3V7TA 2F91A 5JDUB 1LVYA 1MTWA 2WYJA 2FYRA 1HAGE 2Z3DA 3UREA 1A1RA 4RN6A 3BTHE 2A5AA 3SU0A 2ZDAH 3MO3A 2CHAC 3SNEA 1HAHH 3EDXB 5DK1A 2PTCE 2PV9B 5EXLA 1GBKA 1O3EA 4B75A 3M3VA 3GDUA 1J15A 2DE9A 1XXFA 3NZIA 1GPZA
chains in the Genus database with same CATH superfamily
1J14A 1CT0E 4BANB 1YPLH 2V3OH 2KX4A 5A8XA 3P70B 2Y80A 1PQAA 3AW1A 4OM9A 3DCLA 3SUGA 1BIOA 8GCHF 1DWDH 3G01A 4ZCNA 5E2OA 3MTYA 1ZHMA 2WPLS 4ISNA 4TSFD 1VGCB 2ZKSA 1K0HA 1F92A 4DIHH 4TWYA 3U8RH 1EAXA 4VGCB 1LKAA 3RU4T 4ACAA 1CHGA 4DJZB 4DVAU 4UFFH 2VVUA 2RFKC 1DITH 3LIWA 4IN2A 3MU0A 4AG1A 3SUFA 4JK5A 3ZZDA 4Y76A 1SMFE 2GZ9A 2FMJA 3H09A 1PQ7A 3SYJA 2HNTC 3AK5A 1PPCE 3P8GA 2FIRH 3A80A 1LO6A 4JZEH 5J4QA 2TRMA 1RXPA 2R2MB 2FS9A 2P16A 2J9NA 2BLWA 2K1QA 1GG6B 2RDEA 1TMTH 1TNJA 1UW7A 1AGJA 1Z8JB 2BLOA 4H4FA 3LONA 4X8SH 1CSOE 2FX6A 4NIWA 2RA3A 1Q3XA 1TNKA 2GTBA 1G3CA 3GY2A 1ZPBA 1OHHD 1P10A 2BDGA 1FY8E 5DP5A 1TPOA 2WYGA 2H1UA 2AYWA 1TONA 4ZAEA 1YWUA 3VGCB 1QB6A 3P8NA 2BY9X 1DY9A 3CNRA 2G81E 4MTBA 4I86A 1S0RA 2FI3E 4ZKSU 7GCHF 2SGAA 4NCYA 1YCPM 3DSPA 1T8MA 2BXTH 5DO4H 2O8UA 2Q1JA 1Y3WA 1RTLA 1KXDA 4A7IB 1TB6H 2BDYA 1C4Y2 1SKYE 4X8VH 3RXFA 1H9HE 1O3KA 1FAKH 3HK6B 3GCOA 2GX4A 1B0FA 3MH7A 3U28C 4NFEA 1K1IA 4U01A 5HIYA 7LPRA 1BMLA 1NFWA 1GG6C 1N8OC 3LGUA 1PPZA 4Y8ZA 1ID5H 1ZZZA 1C1QA 3F9FA 2B7DH 1S81A 3NPSA 4FU7A 4YOGA 2ZG0H 4XFQA 2DUCA 3V12A 4K8YA 1EZUC 5EXMA 2QXIA 2O8TA 2BTCE 5C0TA 1BTWA 1CU1A 2A4OA 2JH5D 1AHTH 2NU3E 1P2NA 4ABDA 2OTVA 3F6UH 4YM9A 4CHAC 1LVMA 1BCUH 2Z9LA 5C3NA 3SV9A 1TMBH 2XRCA 2OUAA 1MABB 4KTUA 3UUZA 1MD8A 1UTMA 4FOUC 3ZZ3A 1NY22 2RDLA 4MQAA 1GI8B 5EW2H 2G52A 1GHAG 2Y5GA 2BD2A 2ZDNA 1AD8H 2GGVB 1IAUA 1O2PA 1TPPA 2QIQA 2ZGCA 3HKIB 2W26A 5FBEA 1MTNB 1Z6JH 4Y79A 2JH0D 1IQLA 3RU4D 5HM2A 3FZZA 2AIQA 1P2JA 4XBCA 3ZIAD 2XBVA 1L0ZA 1DVAH 2BOHB 4UFEH 1ORFA 4TPIZ 1TPAE 1SHHB 1HDTH 2TGTA 4FUIA 4WXVA 2ZU5A 2ZGJA 3AW0A 2ZNKH 1QBVH 1K9OE 6CHAC 2BDBA 2SNVA 3TK5A 1GL0E 4JZ1A 2OQ5A 4WWYA 1C1VH 4JZIA 2AHME 2A2XH 4YLUA 4ZMAH 3A85A 4BAKB 3TH2H 1MKXH 1SLVB 1UHBA 1W13U 4U2WA 3MFJA 2CF9H 1OP0A 2A7HA 4MDSA 1UTKA 5C2ZA 3TIUA 3UTUH 1K1OA 2GT7A 1C2MA 3F9GA 5C5OA 1FXYA 1SB1H 1MTNC 2M5TA 4K2YA 4J2YB 1YLCA 5GXPA 1D3DB 2KR7A 1A3BH 1L4DA 4B6FA 4U32A 4CREA 3SUDA 2AFQB 3T28A 4YOJA 4CBOA 1NRSH 1SGFA 1O3PB 3SGQE 1HAYB 4BNRA 8ESTE 2P8OB 3ELAH 2ZFPH 3BTEE 1IHSH 4THNH 4RT1A 2C3SA 4A1TA 3M5LA 5EJ1A 2EI8A 4CR5A 1DLEA 1EB1H 4CRFA 3S9CA 2HALA 4OS2A 3GOVB 1NU7B 3MO9A 2A1DB 2FI5E 1O3IA 3LH3A 1EFRD 3VXFH 2H6MA 2W3KA 2G4UA 3SORA 3E91A 1YGCH 2VBCA 2Q6GA 5JB9S 1CQQA 1AVWA 1VR1H 4ZXYH 2EI6A 3FFGA 4PROA 1O39A 3UWJH 3ENSB 5JPMH 5GJ4B 4ISOA 4ABFA 1O2XA 3SI3H 1ZRKA 1GJ9B 2BDCA 1CHOF 2HNTF 1V2RT 1Y3UA 2KM0A 2W7SA 3T5FH 2ZU1A 1O2JA 2ZFTA 3GDVA 1KY9A 1NESE 1O3OA 2P8OC 2TGDA 4KELA 1RRKA 2XC5A 1H8HD 2QYIA 4MNYA 2ZFQH 5EQQA 2OP9A 8LPRA 1MZDA 3RXVA 1IQFA 2H5CA 4B73A 3H7OA 4P02A 1WUNH 1O3BA 2WPIS 3VB7A 3SU4A 3PROA 3SU5A 2ZTXA 2ZTYA 4BTUB 3M7QA 1GMCG 3SJOA 1FN8A 2FOCA 1QJ6B 2HNTE 2KCOA 4KTSA 3WY8A 1TWXB 1TBQH 1ZJKA 1GJ6A 1T4VH 3DD2H 1QCPA 3PYHA 1GMDG 1N1LA 1ZTLA 3T26A 2XWBI 1QURH 3RXBA 3ZVAA 4ASUD 2QF0A 1QQ4A 2UWLA 3PRBA 3SU3A 1HXFH 5JBBS 3L6PA 1SLWB 1GBAA 1XXDA 5SGAE 2GZ7A 5AF9H 3SQEE 3DFJA 5J4SA 5DJ7A 3FAOA 2FWWA 2ZQ1A 4FU9A 4FUDA 3RUOA 5G4BA 3F68H 3S0NA 1SGTA 2BLQA 4F48B 4B1TA 1T7CA 2GV7A 4JZFH 1MAYA 1P06A 1K22H 1HAIH 1TBRH 1A5GH 2R9PA 3AASA 1OOKB 3SOSA 1GI4A 5DKMA 1YPKH 3RXKA 1P2QA 4TWWA 1MTVA 3M5OA 4ZHLU 1C5OH 3RU4E 2ODQA 4SGAE 2P93A 4AYVB 1EZQA 1VCQA 3IWMA 1CGJE 4MNWA 4AGJA 1B7XB 4BOHA 1F0TA 1V6DA 2VB0A 1KLJH 2STAE 1VJ9U 1O3JA 2F9BH 5A8YA 1VITH 2OC0A 1NPMA 2QGRA 1O5GH 1PPHE 1K1LA 1GI2A 5LH8A 2IJOB 2FOEA 1IQMA 3KHVA 1VZQH 5A0BA 1LHDH 4OS7A 1P3CA 1O2YA 3AVZA 1CT4E 1HB0B 3PWBA 1TGSZ 3W1EA 3OAAD 1SSXA 1VITF 1W10U 4A5TS 5F8ZA 1GCTC 3PLKA 1TRMA 1AI8H 1PJPA 1EQ9A 5CHBA 4K60A 4GAWA 1YPMH 1V2VT 3FZDA 5C5NA 1H8ED 1FIZA 4BTIB 1MTSA 2JH6D 3F0OA 3M5MA 4K3JA 4GVUA 1QL9A 2SGQE 1EAWA 3V3MA 2VNTA 1QGFA 2FOGA 1C5SA 4XD7D 2G4TA 3A7VA 3MYWA 2P3TB 5L2YH 1TOMH 2OQUA 2BDIA 3E90B 3QK1A 2Z3CA 1DPOA 1IQKA 2J97A 4DT4A 1F5LA 1IQEA 5EIYA 3ZVGA 2XTTB 4UEHH 1FX0B 1CHOG 2HPPH 3I29A 3SO3A 2KAIB 3BTTE 3K6ZA 1V2TT 2WINI 3URCA 4B74A 5LPFA 2ZQ2A 1YY3A 1MKXK 1W8BH 2PLXA 1EJNA 3LKWA 3MU1A 3STIA 2BOKA 4ZKNU 3LJJA 1SGCA 4B6EA 2QXJA 1W0ZU 1V2PT 1S82A 5A2MH 1HV7A 3RC4A 2AGIX 3TJOA 4M7GA 2VGCB 1CGHA 1YCPH 1NT1A 1XVOA 3A82A 3VFEA 2PGQB 4GUXA 1UK4A 5LPEA 1QJ7B 2XC0A 1FZZA 1TNGA 2ZGBH 2ZHWH 3PMAB 1ABIH 4P00A 4ABAA 1QY6A 2XCFA 3IG6B 4YZUA 4TT3D 5L6NH 1GBIA 3K6YA 4BTTB 4JCNA 1AZZA 1AB9B 1O37A 3FVFB 1F5RA 2ZHEH 1HNEE 3SN8A 3U8OH 2NU4E 1C1TA 1C2DA 2R2WU 3SGBE 1HAOH 1O38A 3E6PH 1CO7E 7KMEH 1GBJA 1SGYE 2O8MA 1C1MA 2B5TB 1GBEA 4NSYA 4RI0A 3KYFA 3FO8D 1MH0A 1HAVB 1OXGA 5E0GA 1LTOA 2Y7ZA 2ALPA 2Y7XA 5EJZA 1XVMA 1SLXB 1SHYA 2ZGHA 3RXSA 2RCEA 4NZLA 1ETTH 1LMWB 2BX4A 2F9VA 4DCDA 5F53A 3CS0A 3TNSA 3TH3H 2ANYA 3A89A 2GVFA 1TQ7B 3SV8A 3A88A 4ABJA 4IW4E 2QE7D 1ZGIA 2GDEH 1WAYB 2C4FH 1BQYA 3R0FA 2VH0A 1KXEA 2FZZA 2GDDA 4ZHAA 2G5NA 1HJAC 4TY6A 4CRDA 3LGTA 4JYUH 1HGTH 3FP8E 4F49A 3M3TA 4RKJB 4I8LA 3OFND 1DS2E 1TX7A 3MNXA 3OEHD 4B2CA 1C2FA 4O03A 1C5RA 2B9LA 4DURA 1QL8A 4YTAA 1EOLA 2R0KA 1YPJH 5HKKD 1Z1JA 2TPIZ 1C5WB 1A5HA 1MCTA 3L33A 1AUJA 1FONA 3GS9A 2A2QH 1FY3A 1MMJN 2VWLA 1AKSB 1LHCH 3SHAH 1OWEA 3MH5A 1NFUA 3BG4B 4M9FA 1N6XA 2BB4A 1MBMA 1BZXE 3B23B 2IOTA 1AE8H 3GISB 2F3CE 2XNDD 1GI3A 1V2MT 4D8NA 5AFYH 1WQVH 3U9AH 1E1QD 1O33A 3GY3A 1SPJA 1TIOA 1UTJA 2G55A 2IJD1 2ZFRH 3ITIA 3SGAE 2BX3A 9LPRA 4X1QU 2WHXA 1TOCB 3RC6A 4HGCA 1W0KD 2LELA 2BY8X 2VIPA 1SBWA 6LPRA 1C5MD 3ZVCA 1GJ5H 1XUKA 1O5FH 4F4OC 4JYVH 3UY9A 1W12U 1O5BB 4XRNA 5BRRE 3M3SA 4AZ2B 3VB6A 3LPRA 1T32A 1AO5A 3RM0H 1KXBA 1C1RA 1HBTH 3ZV8A 2Z9KA 4ISIH 2QN5T 1WTHD 5EQSA 1TRYA 1GHAF 4XBDA 4E7NA 2PHBA 2W5EA 1FAXA 2AERH 1TX6A 3BG4C 3KIDU 4A1XA 1EB2A 2W7UA 1P8VC 1CT2E 1N6YA 1Y3VA 2GZ8A 2ZDVH 3UQVA 1ARBA 1YBWA 2NWNA 1HAZB 2HVYB 3ZZAA 3MU8A 2WV9A 2IPQX 4Q2KA 4AFZA 1BTUA 1GJDB 1XUHA 2ZGXH 1PQ5A 1PPEE 1DSUA 3C27B 2AEIH 3N7EA 3LT3A 2BZ6H 1UVOA 5DG6A 1C1SA 1Y3XA 1SGRE 4DGJA 2AGEX 2XCNA 1QTFA 3SHCH 1F0UA 4INHA 4H6TA 4X2YA 2CXVA 2CN0H 3PTNA 5EU8A 1ESTA 1OKXA 3UR6A 4AGKA 1RTFB 1OWJA 3A7WA 3ZV9A 4YT7H 4TY7A 2A4GA 2THFB 2W6ID 2HPQH 1C5XB 2G5VA 4LZ1H 2BYAX 1OP8A 2J95A 4O3UA 2FTLE 1GDUA 3SNAA 1GJAB 5DP9A 1GBFA 1GHYH 6GCHG 1N8OB 1O5DH 1D6WA 4Y7AA 2J98B 1L2EA 3QGNB 3FN8A 4UD9H 3BEIB 4Y8XA 1UTLM 4NA7A 5ABWA 1IQIA 3NKKA 4ZHMU 1EZXC 1TLDA 1UK3A 4OS6A 2HLCA 3UOUA 4R0IA 4WY3A 1DXPA 2D1JA 4LXBH 1O2OA 5A0AE 1B5GH 1YCPK 2XBWA 3ZVDA 4CHAB 2OK5A 2HRVA 1MAXA 1KLIH 1RIWC 2ODPA 2R3YA 1DM4B 1V3XA 2PKAB 2UUFB 1Z8GA 1RTKA 3KQCA 5AFZH 1TGNA 2Z9JA 1C1WH 1SGNE 3RXMA 1V2NT 3FP7E 1BBRE 1EAIA 3T29A 2FDAA 3RXAA 1NFYA 1ACBE 4K5ZA 3VB4A 1P04A 3DSOA 1P2OA 4AG2A 3A81A 2OBQA 4SGBE 3RXDA 4B76A 3BTDE 5I46H 1GVKB 2FPZA 1UJ1A 3ZYEA 1C1UH 4NIXA 3M37A 1XKBC 4FETA 1HIAA 3RMOH 3QX5H 3SI4H 1X7AC 5FX6A 5EXNA 3KQBA 2J34A 3PV2A 2KFWA 2Q6FA 4MVNA 3S7HB 5T3HA 1FY5A 3OSYA 6CHAB 3RXOA 4Y0ZE 4CH8B 1Y5AT 4FUBA 4AORA 1V2QT 1SR5C 1SQRA 1EASA 2ZI2H 1P3EA 2ZWLH 1P2IA 2Z9IA 1GMCF 1RD3B 4HFPB 5C1UA 1ARCA 3QLPH 3SU1A 2A0QB 1O2QA 1OPHB 2JJ1D 4D7FA 5ESTE 1C4U2 3ZVFA 3STJA 1FLEE 1EPTA 2EY4C 1O3GA 3GY6A 3S69A 1O2IA 2C8ZB 1BJVA 1GMDF 1SLUB 1RJXB 1AIXH 4I7YH 1OWHA 2CMYA 1FDPA 3A87A 5B6OA 4X2WA 4Z0KA 1NRQH 1ZYOA 1GI6A 1V2UT 2FTMA 4NA9H 1EP5A 4X1NU 5C20A 2QCYA 1LQDB 1NS3A 3QZRA 3OX7U 1XUIA 2WUCA 4LOYH 1GBCA 2QXGA 2ULLA 2XXLA 4K69A 2ZECA 1PPBH 4AX9H 1ABJH 3QN7A 4Q7YA 2PKSC 3LU9B 4NWLA 3QTVH 1AVGH 5ESBA 4JYTA 1SQTA 5FCRA 1Z8IB 1ELEE 1O2VA 2Q6DA 1G9IE 1P05A 1GVZA 2H5DA 1D9IA 1OP2A 2BDHA 1Z1IA 3TK9A 1O3MA 1YPGH 3CS7A 3PB1E 4FUCA 1T8OA 1BOQA 3O8DA 1FPCH 1GI5A 3UFAA 2J5UA 2SGDE 3W94A 2FXRA 2L6OA 5AHGH 2BHGA 2F83A 1FUJA 1EJMA 4BXSA 5JBTA 1QBOA 1Y3YA 4NG9H 2ZEBA 2OINA 3DFLA 4QT8C 2D2DA 3NK8A 3P6ZB 1EATA 1DSTA 2VWOA 5K0HA 5F6MA 1T8LA 2A45B 1W7XH 2FS8A 4D9QA 4WMFA 3M35A 4HTCH 1FV9A 1HLTH 2P3UB 1IHTH 5T6DA 4A1VA 1Y5UT 1C5QA 3TH4H 5DGJA 4AFSA 1S6LA 4XBBA 1CA0B 2V7QD 1P57B 3VB5A 4D7GA 4TPYA 3Q76A 2V35A 4INKA 3SNDA 1D4PB 1A0HB 2ZIQH 1ZPZA 2VIOA 1T31A 2ZP0H 5EG4A 3A8BA 1C2KA 2BLVA 3UWIA 4ZKOU 4ABIA 1KYNA 1TGTA 1E1RD 4ABEA 3GY4A 1ZLRA 3SJKA 2FX4A 1DWBH 3BG8A 2AH4X 2C90B 3GCTG 1DICA 2OCVB 3S7KB 4AOQA 4LZ4B 2PSXA 1KDQB 1TFXA 4BAQB 1QRWA 5L30H 1V2ST 4ABHA 2NU0E 1CBWB 4Y8YA 4FVDA 4Y71A 5EQRA 3QUMP 1TNLA 1C5TA 1CA0C 5C67A 3A86A 5L2ZH 4K1TA 1WDIA 3RXCA 1OYQA 1GGDB 1C5LH 2BVXH 3MHWU 5IK2D 1DUEA 3GCHC 1O32A 2ZO3H 4UDWH 1NROH 1NRPH 1P2MA 1ZHPA 4E06H 1XUGA 4NA8A 1NO9H 4KGAA 2Z94A 3L3TA 2O9QA 2VU8E 1DXWA 1J17T 2ZU3A 3MO6A 3Q3XA 1XKAC 1THRH 3W95A 1A0JA 1NC6A 1ZR0A 3BTWE 3SW2B 1O35A 3O8CA 2JKHA 2BDAA 3TJVA 4ABGA 2WUBA 1G2LA 1O2HA 2XYAA 1GCTB 1O2LA 5H4IB 4AFUA 1K2I1 1S84A 4XE4A 3URDA 1RFNA 1EKBB 1G37A 3E0NB 4ZXXH 2K8IA 1HCGA 4YO9A 1O0DH 1CBWC 4GPGA 1Y8TA 3P17H 1AQ7A 1UMAH 3A7YA 4CRAA 2OXSA 1A0LA 1EAUA 1GGDC 1LVBA 4RSPA 3TPIZ 1HAPH 5JYIA 1G3BA 3GDSA 1E38B 3RLWH 1ELTA 1CE5A 3HK3B 1KXAA 5HYOA 1O2TA 1UTNA 2A31A 1ANEA 1GMHG 4MPVA 3AAVA 1GWAA 5DSFA 4Y10E 2VJ1A 3ZVBA 1F0RA 2GP9B 3EE7A 3ESTA 3P8OA 3FKSD 2FODA 5C17A 2ESTE 3PMBB 2ZF0H 3A8CA 4WH8A 2XBXA 3BIVH 3HGNA 5FHTA 3SNCA 2YNAA 3T27A 1SQAA 1P9UA 3BN9A 3QZQA 1GBDA 2ZCLP 4CBNA 3D23A 4OGYA 1V2KT 3MNSA 5GPIB 1C5YB 1GCDA 1VJAU 4OS4A 1ANBA 1MD7A 1JIRA 3A7XA 4AYYB 3RXHA 1AE5A 1MQ6A 3EE0B 3PLBA 4JMYA 2BQWB 1XMNB 3ZZ6A 2GT8A 1EUFA 2P94A 1TNIA 3M36A 1KTTB 4TYDA 5TJXA 2BM2A 3FOAA 5DP8A 1QB1A 1BTPA 2GKVE 3AAUA 1YC0A 3EA9A 2OC1A 4DW2U 2GD4B 4MPWA 1UTQA 1ZSKA 2AMDA 4NZQA 5BPEA 3JZ2B 5F8TA 1H9LB 1C9PA 1BMFD 1EZSC 1C2EA 1SC8U 4ZROA 1ESAA 1CGIE 5T1VA 1C9TA 1GVLA 1O2UA 3ODDA 1WU1A 4X0WU 2KAIA 4BAMB 3UNSA 2M2AA 4AN7A 1TRNA 2A5KA 1TABE 1WSSH 3TJUA 1JOUB 4JZDH 1P9SA 2ZFFH 1CA8B 2C8WB 1TYNA 1BITA 4ABBA 1NRRH 3U69H 1TGBA 2FYQA 5DP7A 7ESTE 1SG8B 3LGYA 3ZVEA 3PMJA 1XM1A 1L4ZA 5DP6A 5HGGA 3F9HA 2HGTH 2OC7A 1HJAB 2B0FA 2PTNA 3F9EA 2YMSC 1WXRA 3ZZ8A 2VWNA 1ETRH 4H42U 2J94A 2LP6A 4CRCA 4Q80A 2BZAA 3O8RA 2FM2A 1BRCE 1BDAA 3K65B 1K1NA 5A09A 1HUTH 3KGPA 3F2HA 2Z7FE 1J8AA 2ASUB 2ZTZA 2BD3A 2IPHA 1PYTD 1S6HA 1DANH 3ZYDA 5KECA 2UUJB 2OD3B 4UONA 3UOPA 1JRSA 1GJBB 3BTFE 3D62A 1V2LT 3SQHE 1HFDA 1G3EA 1YPEH 2BMGB 3TGIE 4D76A 2R3UA 6GCHF 4HZHA 2KCAA 2OBOA 3EAJA 2WPKS 1P11E 3U1IB 1NTPA 2WV4A 1SGQE 1QRXA 4E7RG 4Y0YE 3NWUA 1TMUH 2ZPQA 1ZRBA 3BEUA 4NGAH 3MQKC 5JBAS 1TGCA 3TGKE 2GCHF 1D3QB 1K1MA 4CH2B 4GCHG 1H8DH 1GBLA 3B8JA 2PR3A 3O8BA 2VWMA 3DUXH 1C2JA 3E8LA 2V0BA 3S9BA 4K8BA 3LGVA 1K21H 1MBQA 1GL1A 2ZZUH 3U8TH 1ZOMA 3FANA 3BTGE 2PSYA 4DOQA 3LC5A 4MPUA 3N99A 2V6NA 5IDKA 1NN6A 3A84A 5TCCA 3DA9B 1EJAA 1SQOA 2YMSD 2FESH 1H9IE 1W14U 3TNTA 2A32A 1GJ4H 3PO1B 6ESTA 1BMMH 1MTUA 2BD5A 3EGKH 1J16A 2LPRA 1VCWA 1TQ0B 4XSKU 3LDXH 3NCLA 3MMGA 3SV2H 1BT7A 4OS5A 2ZU2A 2ALVA 1Q2WA 1THSH 1BUIA 1T8NA 1ELGA 2C8YB 1ZMLA 1AKSA 3VB3A 2ANWA 1HYLA 3A83A 1A61H 1LHFH 2PW8H 1DLKB 5E0JA 1C2LA 4LK4A 2HLDD 3S9AA 5K7RA 3MWIU 4Y7BA 2V3HH 1WYKA 3D49H 2V3MA 4FXGH 2ZC9H 3SUEA 1AVXA 3F3BA 4Y11E 2BD9A 1OWKA 1L1GA 4YT6H 1M9UA 4AFQA 4B71A 2Z3EA 1UTOA 3JZ1B 2R0LA 2FLBH 1GHVH 4Y6DA 5HMAA 3BEFB 1AWHB 3VG8A 1ZMJA 2ANMH 4X6MA 3F0PA 4FUJA 4X8UH 1BTHH 1TA2A 3F2FA 3PO1C 2VINA 1F5KU 3MU5A 2ANKH 3RMNH 4X8TH 2QF3A 3KEEA 3UNRA 3MH6A 2Z9GA 1BJUA 4A92A 1FI8A 4MNXA 2EQNA 2BD7A 1Z6EA 2H9HA 1LHEH 5LGOA 2AIPA 5E2PA 1O2KA 2HOBA 2QXHA 1ZSJA 1ZSLA 3B9FH 4GLYA 1JMOH 3DHKH 3SJIA 1BHXF 1INCA 5ETXA 2W6JD 2FOAA 3UQOA 1HXEH 1O3HA 1GHBG 1OYTH 1SI5H 1U6QA 3PTBA 4XDEA 1RIWB 2ZDKA 1HJ8A 1GJ8B 1G30B 3E3TA 3MI4A 2GMTC 1SGIB 1E79D 1V2JT 2BVRH 3K9XB 1BBRH 1ELCA 5F8XA 2BY5X 1A7SA 3RXPA 2ZDLA 3I77A 4FUHA 3R3GB 4MLFB 4UFDH 5EJLA 1ZHRA 4B2BA 5HM9A 2ILNA 1SGFG 5FXLA 3BV9B 3OY6U 3V0XA 4JK6A 4R8TB 2GCHG 1WQSA 3BTKE 1BTYA 1S83A 4MG3A 1YP9A 2J98A 4RKOB 4X1RU 1QBNA 2H9EH 2JETB 3RXTA 4AC9A 3OTJE 2XNIA 1P03A 3Q3KA 1HRTH 1SGPE 3PM3A 3BF6H 5EODA 1ANDA 2EC9H 1Z7KA 4HI3A 1XX9A 4Z1MD 3RXRA 4DIIH 1UK2A 3I78A 4BAOB 2Y5HA 2A5IA 2AMPA 3ZZ4A 3GICB 2STBE 1QB9A 2PKAA 1NFXA 2W3IA 1BRAA 3OE7D 1YYY1 3P95A 1VGCC 4FUEA 2Y81A 2CGAA 1UVPA 4VGCC 1YM0A 1KIGH 5T6GA 4O97A 2XC4A 2ZA5A 2F9PA 2ZPRA 1YLNA 1TBZH 5PTPA 1ELDE 1GDNA 1AU8A 3OEED 3ATMA 2H2ZA 1S0QA 3MNCA 1KSNA 5GNDA 1DE7H 3GCTF 1B0EA 2GJGA 1HIAB 1NRNH 4Q7ZA 1W3CA 2JETC 2TIOA 2PKSB 1QJ1B 3C1KA 3RXEA 4YXWD 1O2ZA 1AMHA 1FY1A 3A8AA 1QA0A 3FP6E 1QQUA 2P95A 1W7GH 4INLA 4ISHH 2ZHQH 4OGXA 3HATH 1VKYA 2UUKB 1LKBA 4OS1A 1D3PB 1SFQB 4UE7H 4ZH8A 3TITA 2FI4E 4FUGA 1SOTA 3VGCC 3F1SB 5DP4A 4K1SA 5GDSH 4X6NA 2ZCKP 2UUYA 1A5IA 4Z6AH 1LPKB 4WXIA 1O5EH 1HAXB 1V2OT 1EPTB 2BVSH 3WWBA 1QA7A 1AWFH 2ODYB 3LC3A 2EI7A 2FOHA 1Y59T 3RDZA 2PWXA 1FNIA 2FOFA 5JBCS 1W2KH 3TVJB 1O2WA 1V2WT 1O2RA 1TE0A 1GDQA 4KKDA 3ATWA 3KQ5A 1O3NA 4Q4LA 3KL6A 1F7ZA 2BY6X 1UVUH 1SL3A 1NM6A 2WSSD 1MCVA 2BD8A 4X1SU 1ELFA 5HIZA 1LVOA 4GHTA 1C4V2 2NU2E 5A0CA 4WF8A 3A7TA 1FPHH 4D9RA 2Y82A 8GCHG 2HWLB 1ANCA 1O2MA 3V13A 4F55A 1TX8A 1G36A 1UCYH 1E34B 4I8GA 4IS5A 3RC5A 1UHBB 1K28D 2VVVA 3T25A 4ZUHA 1P01A 5CMXH 1GI1A 1GMHF 2G00A 1JXPA 2F9OA 1EPTC 5DP3A 3SV7A 1UVSH 1C1NA 1OSSA 5E0HA 1O2SA 2FLRH 1P12E 3DT0H 3SU6A 4GHQA 4DY7B 1C1PA 3NRLA 4IC6A 1G3DA 3KQEA 1ZJDA 5CHAB 2UWPA 3CP7A 2ZFSA 4WVPE 2BQ7B 1QFKH 1COWD 1O36A 1S5SA 1WOFA 3Q00A 1P0SH 1O30A 5F03A 1GHWH 1LPGB 1G2MA 1AN1E 2L74A 4YLQH 1Z71A 2K0QA 1E35B 1NBMD 2P3FH 1JBUH 2GCTB 2J2UA 3U98H 5EOKA 1SOZA 5I25A 2UWOA 3RXGA 1BMNH 1L1NA 3UB0A 3GCNA 4BAHB 2G51A 1O2GH 2PFEA 1UCYE 2PUXB 3GCHB 3PRDA 2CK3D 1ZTJA 4J1YA 3HGPA 2WPDD 5FL7D 3KQDA 2YNBA 2J92A 3TU7H 2TBSA 4I8HA 1OWDA 1VCPA 7GCHG 3MH4A 3GYLB 1Y5BT 1PQ8A 1J9CH 3OY5U 2QF5A 2F9UA 4MNVA 4Q63A 1MKWH 3QWCH 4O9VA 2RA0A 5DN6D 5CHAC 5EW1H 1BBRK 4WJG2 1KMHB 4E05H 1BRBE 3HKJB 1GBTA 5FPTA 5C0UA 1P2KA 2SGEE 3A7ZA 4X2VA 1GBBA 2J38A 5A8ZA 3SZNA 1TPSA 3LOXA 5FPYA 1KDQA 2GCTC 1GHZA 1W0YH 4ESTE 2QC2A 1JRTA 3N7DA 2VIWA 3K2UA 3MNBA 1DFPA 1O5CB 1RS0A 3E16B 1C5ZB 4Q7XA 2SFAA 1K1JA 1IQJA 5EPNA 3ATIA 4HG6A 5C1XA 1WV7H 4I8KA 2GV6A 1MQ5A 3PMHB 2ZHFH 3TLOA 3GYMA 1YPHC 1GI0A 2I6QA 3HPTB 1YKTA 2JDID 1KXCA 2KCYA 3PV5A 1LCYA 5E8EH 5EGMA 1C2IA 5GCHF 4O3TA 1RGQA 4ACBA 2YOLA 4CRGA 1O5AB 3ZZCA 1ETSH 2ZDMA 2XBYA 2DE8A 4I31A 1LHGH 1BRUP 2BY7X 1QL7A 1D6RA 1LPZB 2FO9A 1IQGA 1FIWA 2VVCA 1AFQB 2KZ4A 4KP0A 3D65E 9ESTA 1BHXB 2JIZD 3BTME 2C93B 3ZZ7A 3TK6A 2A4QA 1DDJA 3GY8A 3SNBA 4I8JA 4IN1A 3QDZB 2FEQH 3RLYH 1H1BA 3RM2H 1DOJA 4ASHA 2HVXA 2TGPZ 4GCHF 2F43B 5FPSA 5FX5A 3UPEA 1YF4A 3F2GA 1TA6A 2G8TA 4I33A 5GWZA 3EYDA 4YESB 1AUTC 3LGWA 3H7TA 4ISLA 4WMDA 3MOCA 2WPHS 1XUFA 3RMMH 5JB8S 1KXFA 4UFGH 2WPMS 1MU6B 2KCPA 2VH6A 3GY5A 3SBKA 1P09A 1SVPA 1GBMA 4ZKRU 1BTZA 1DWCH 1YLDA 4IMZA 3T2NA 5C94A 1O31A 4CR9A 1SFIA 2Y5FA 2WZQA 3PV4A 2ZHDA 3E0PB 3SJ9A 1ELAA 1S85A 3UAIC 1AZ8A 1C5NH 2VIDA 1IQNA 5KGOA 3SJ8A 3T62A 3M7UA 1AFQC 1FN6A 3M61U 1C2GA 1OS8A 4FUFA 1QR3E 1E36B 3E1XB 1QZ8A 2A4RA 3EA8A 1FJSA 3RP2A 3SU2A 3VXEH 3P92A 2EA3A 4FU8A 4NWKA 1THPB 2IN2A 1QRZA 2EEKA 3QTOH 1ELVA 1PYTC 3ODFA 2YMSB 3EA7A 3BTQE 3LJOA 2SNWA 3RXQA 1FQ3A 1EP6A 1NBME 4MPXA 1A3EH 1Z8RA 4I32A 1H8IH 4X1PU 1C5VA 3Q3YA 1ZTKA 3QGJA 3RXJA 1D3TB 2O8WA 1GI9B 2XWAA 3IITA 2TGAA 3LGIA 2XW9A 1UCYK 2ZU4A 4RT0A 4AB9A 1MZAA 3KF2A 1O3AA 1WTGH 1A46H 2Z6BD 3DSGA 1DT2A 2WV5A 1BB0B 4WMEA 1DX5M 3LH1A 5C1YA 2CV3A 1Q31A 1PFXC 1KTSB 3ZZ5A 1O3FA 1W0JD 1ZPCA 5GIBA 2PP6A 1C5PA 3OTPA 3N7OA 4IC5A 5AVDA 1HJ9A 4IGDA 3RXIA 3NUMA 3ATKA 2F9NA 4IBLH 1LDTT 1JIMA 3UR9A 1PPFE 2B8OH 1QHRB 2CF8H 4YOIA 3M5NA 4K1EA 3CENA 2ZCHP 1GHBF 5FCKA 1UTPA 2BD4A 1QIXB 2WPJS 1BMAA 2I6SA 1T4UH 5GCHG 3SZEA 4AB8A 1GI7B 1C5UA 3A8DA 1NZQH 1P02A 3SV6A 1E37B 1ESBA 3M7TA 3KN2A 1CVWH 3PWCA 4GSOA 3ZZ9A 1FY4A 3BSQA 1BA8B 2A7JA 3UIRA 1O3LA 2QV1A 1OWIA 3H5CB 2VIQA 1JWTA 1HAVA 4IMQA 2QA9E 2SGFE 1SGEE 5FAHA 3VPKA 1K1PA 3MU4A 1EXFA 4X6PA 2JJ2D 1SGDE 2D8WA 4H6SB 5HXFA 5DPAA 2BQ6B 1LQEA 1E0FD 3P8FA 1MKWK 1UO6A 2AGGX 2SGPE 1O34A 1S6FA 2LNCA 2XOKD 4XOJA 5LPRA 3OYPA 5KEDA 3UNQA 1A2CH 2VGCC 2FOMB 2C8XB 2BXUH 4X2XA 1DY8A 2QAAA 4NSVA 4X6OA 1O2NA 1DUAA 4DG4A 2RG3A 1MUEB 2NU1E 4WH6A 4DT7B 3ZZBA 4KTCA 1AB9C 5B6LA 3U1JB 5CE1A 3RMLH 1NU9A 1WBGB 5IYTA 1KLTA 2OC8A 1H4WA 1IOEA 3ATLA 2FOBA 3KCGH 1GBHA 1DWEH 2PGBB 4FVBA 2CJIA 4U30A 3GY7A 3VEQB 3EQ0H 2Y6TA 4BXWA 3NXPA 2PUQH 1TALA 1ELBA 4A6LA 1O3DA 4CRBA 1MU8B 1TNHA 2AS9A 3RXUA 1HPGA 1ZGVA 1W11U 1EX3A 4NIVA 1VITG 2D26C 2J4IA 2A7CA 2CHAB 2QY0B 2H9TH 5CDFE 5FBIA 3TGJE 1A4WH 1AFEH 1GJCB 1YPHE 4B2AA 1L1JA 3RXLA 8KME2 2AMQA 3TJNA 2ZPSA 1G32B 1OX1A 3KNXA 1TAWA 4NIYA 1F0SA 2O8LA 5EPYA 5T6FA 2P59A 3QO6A 2OLGA 5TCAA 3PLPA 3WW7A 1QNJA 1ZMNA 2FP7B 1FMGA 2GMTB 3BIUH 1BTXA 1GHXH 1WCZA 1F2SE 1C2HA 1O3CA 1PPGE 2VIVA 3Q77A 2F4LA 1EOJA 1AY6H 1GJ7B 1XUJA 1C1OA 3OU0A 1IQHA 1UVTH 4NFFA 3V7TA 2F91A 5JDUB 1LVYA 1MTWA 2WYJA 2FYRA 1HAGE 2Z3DA 3UREA 1A1RA 2QF4A 4RN6A 3BTHE 2A5AA 3SU0A 2ZDAH 3MO3A 2CHAC 3SNEA 1HAHH 3EDXB 5DK1A 2PTCE 2PV9B 5EXLA 1GBKA 3WWFA 1O3EA 4B75A 3KYGA 3M3VA 3GDUA 1J15A 2DE9A 1XXFA 3NZIA 1GPZA
chains in the Genus database with same CATH topology
1J14A 1CT0E 4BANB 1YPLH 2V3OH 5A8XA 3P70B 2Y80A 1PQAA 3AW1A 4OM9A 3DCLA 3SUGA 1BIOA 8GCHF 1DWDH 3G01A 4ZCNA 5E2OA 3MTYA 1ZHMA 2WPLS 4ISNA 4TSFD 1VGCB 2ZKSA 1F92A 4DIHH 4TWYA 3U8RH 1EAXA 4VGCB 1LKAA 3RU4T 4DJZB 1CHGA 4DVAU 4UFFH 2VVUA 1DITH 3LIWA 4IN2A 3MU0A 4AG1A 3SUFA 4JK5A 3ZZDA 4Y76A 1SMFE 2GZ9A 2FMJA 3H09A 1PQ7A 3SYJA 2HNTC 3AK5A 1PPCE 3P8GA 2FIRH 3A80A 1LO6A 4JZEH 5J4QA 2TRMA 1RXPA 2R2MB 2FS9A 2P16A 2J9NA 2BLWA 2K1QA 1GG6B 1TMTH 1TNJA 1AGJA 1Z8JB 2BLOA 4H4FA 3LONA 4X8SH 1CSOE 2FX6A 4NIWA 2RA3A 1Q3XA 1TNKA 2GTBA 1G3CA 3GY2A 1ZPBA 1OHHD 1P10A 2BDGA 1FY8E 5DP5A 1TPOA 2WYGA 2H1UA 2AYWA 1TONA 4ZAEA 3VGCB 1QB6A 3P8NA 2BY9X 1DY9A 2G81E 4MTBA 1S0RA 2FI3E 4ZKSU 7GCHF 2SGAA 4NCYA 1YCPM 3DSPA 1T8MA 2BXTH 5DO4H 2O8UA 2Q1JA 1Y3WA 1RTLA 1KXDA 4A7IB 1TB6H 2BDYA 1C4Y2 1SKYE 4X8VH 3RXFA 1H9HE 1O3KA 1FAKH 3HK6B 3GCOA 2GX4A 1B0FA 3MH7A 4NFEA 1K1IA 4U01A 7LPRA 1BMLA 1NFWA 1GG6C 1N8OC 3LGUA 1PPZA 4Y8ZA 1ID5H 1ZZZA 1C1QA 3F9FA 2B7DH 1S81A 3NPSA 4FU7A 4YOGA 2ZG0H 4XFQA 2DUCA 3V12A 4K8YA 1EZUC 5EXMA 2QXIA 2O8TA 2BTCE 5C0TA 1BTWA 1CU1A 2A4OA 2JH5D 1AHTH 2NU3E 1P2NA 4ABDA 2OTVA 3F6UH 4YM9A 4CHAC 1LVMA 1BCUH 2Z9LA 5C3NA 3SV9A 1TMBH 2XRCA 2OUAA 4KTUA 1MABB 3UUZA 1MD8A 1UTMA 3ZZ3A 1NY22 2RDLA 4MQAA 1GI8B 5EW2H 2G52A 1GHAG 2Y5GA 2BD2A 2ZDNA 1AD8H 2GGVB 1IAUA 1O2PA 1TPPA 2QIQA 2ZGCA 3HKIB 2W26A 5FBEA 1MTNB 1Z6JH 4Y79A 2JH0D 1IQLA 3RU4D 5HM2A 3FZZA 2AIQA 1P2JA 4XBCA 3ZIAD 2XBVA 1L0ZA 1DVAH 2BOHB 4UFEH 1ORFA 4TPIZ 1TPAE 1SHHB 1HDTH 2TGTA 4FUIA 4WXVA 2ZU5A 2ZGJA 3AW0A 2ZNKH 1QBVH 1K9OE 6CHAC 2BDBA 2SNVA 3TK5A 1GL0E 4JZ1A 2OQ5A 4WWYA 1C1VH 4JZIA 2AHME 2A2XH 4YLUA 4ZMAH 3A85A 4BAKB 3TH2H 1MKXH 1SLVB 1UHBA 1W13U 4U2WA 3MFJA 2CF9H 1OP0A 2A7HA 4MDSA 1UTKA 5C2ZA 3TIUA 3UTUH 1K1OA 2GT7A 1C2MA 3F9GA 5C5OA 1FXYA 1SB1H 1MTNC 2M5TA 4K2YA 4J2YB 1YLCA 5GXPA 1D3DB 2KR7A 1A3BH 1L4DA 4B6FA 4U32A 4CREA 3SUDA 2AFQB 3T28A 4YOJA 4CBOA 1NRSH 1SGFA 1O3PB 3SGQE 1HAYB 4BNRA 8ESTE 2P8OB 3ELAH 2ZFPH 3BTEE 1IHSH 4THNH 2C3SA 4A1TA 3M5LA 2EI8A 4CR5A 1DLEA 1EB1H 4CRFA 3S9CA 2HALA 4OS2A 3GOVB 1NU7B 3MO9A 2A1DB 2FI5E 1O3IA 3LH3A 3VXFH 1EFRD 2H6MA 2W3KA 2G4UA 3SORA 3E91A 1YGCH 2VBCA 2Q6GA 5JB9S 1CQQA 1AVWA 1VR1H 4ZXYH 2EI6A 3FFGA 4PROA 1O39A 3UWJH 3ENSB 5JPMH 5GJ4B 4ISOA 4ABFA 1O2XA 3SI3H 1ZRKA 1GJ9B 2BDCA 1CHOF 2HNTF 1V2RT 1Y3UA 2W7SA 3T5FH 2KM0A 2ZU1A 1O2JA 2ZFTA 3GDVA 1KY9A 1NESE 1O3OA 2P8OC 2TGDA 4KELA 1RRKA 2XC5A 1H8HD 2QYIA 4MNYA 2ZFQH 5EQQA 2OP9A 8LPRA 1MZDA 3RXVA 1IQFA 2H5CA 4B73A 3H7OA 1WUNH 1O3BA 2WPIS 3VB7A 3SU4A 3PROA 3SU5A 2ZTXA 2ZTYA 4BTUB 3M7QA 1GMCG 3SJOA 1FN8A 2FOCA 1QJ6B 2HNTE 2KCOA 4KTSA 3WY8A 1TWXB 1TBQH 1ZJKA 1GJ6A 1T4VH 3DD2H 1QCPA 3PYHA 1GMDG 1N1LA 1ZTLA 3T26A 2XWBI 1QURH 3RXBA 3ZVAA 4ASUD 2QF0A 1QQ4A 2UWLA 3PRBA 3SU3A 1HXFH 5JBBS 3L6PA 1SLWB 1GBAA 1XXDA 5SGAE 2GZ7A 5AF9H 3SQEE 3DFJA 5J4SA 5DJ7A 3FAOA 2FWWA 2ZQ1A 4FU9A 4FUDA 3RUOA 5G4BA 3F68H 3S0NA 1SGTA 2BLQA 4B1TA 1T7CA 2GV7A 4JZFH 1MAYA 1P06A 1K22H 1HAIH 1TBRH 1A5GH 2R9PA 3AASA 1OOKB 3SOSA 1GI4A 5DKMA 1YPKH 3RXKA 1P2QA 4TWWA 1MTVA 3M5OA 4ZHLU 1C5OH 3RU4E 2ODQA 4SGAE 2P93A 4AYVB 1EZQA 1VCQA 3IWMA 1CGJE 4MNWA 4AGJA 1B7XB 4BOHA 1F0TA 1V6DA 2VB0A 1KLJH 2STAE 1VJ9U 1O3JA 2F9BH 5A8YA 1VITH 2OC0A 1NPMA 2QGRA 1O5GH 1PPHE 1K1LA 1GI2A 5LH8A 2IJOB 2FOEA 1IQMA 3KHVA 1VZQH 5A0BA 1LHDH 4OS7A 1P3CA 1O2YA 3AVZA 1CT4E 1HB0B 3PWBA 1TGSZ 3W1EA 3OAAD 1SSXA 1VITF 1W10U 4A5TS 5F8ZA 1GCTC 3PLKA 1TRMA 1AI8H 1PJPA 1EQ9A 5CHBA 4K60A 4GAWA 1YPMH 1V2VT 3FZDA 5C5NA 1H8ED 1FIZA 4BTIB 1MTSA 2JH6D 3M5MA 3F0OA 4K3JA 4GVUA 1QL9A 2SGQE 1EAWA 3V3MA 2VNTA 1QGFA 2FOGA 1C5SA 4XD7D 2G4TA 3A7VA 3MYWA 2P3TB 5L2YH 1TOMH 2OQUA 2BDIA 3E90B 3QK1A 2Z3CA 1DPOA 1IQKA 4DT4A 1F5LA 1IQEA 3ZVGA 2XTTB 4UEHH 1FX0B 1CHOG 2HPPH 3I29A 3SO3A 2KAIB 3BTTE 3K6ZA 1V2TT 2WINI 3URCA 4B74A 5LPFA 2ZQ2A 1MKXK 1W8BH 2PLXA 1EJNA 3LKWA 3MU1A 3STIA 2BOKA 4ZKNU 3LJJA 1SGCA 4B6EA 2QXJA 1W0ZU 1V2PT 1S82A 5A2MH 1HV7A 3RC4A 2AGIX 3TJOA 4M7GA 2VGCB 1CGHA 1YCPH 1NT1A 1XVOA 3A82A 3VFEA 2PGQB 4GUXA 1UK4A 5LPEA 1QJ7B 2XC0A 1FZZA 1TNGA 2ZGBH 2ZHWH 3PMAB 1ABIH 4ABAA 1QY6A 2XCFA 3IG6B 4YZUA 5L6NH 4TT3D 1GBIA 3K6YA 4BTTB 4JCNA 1AZZA 1AB9B 1O37A 3FVFB 1F5RA 2ZHEH 1HNEE 3SN8A 3U8OH 2NU4E 1C1TA 1C2DA 2R2WU 3SGBE 1HAOH 1O38A 3E6PH 1CO7E 7KMEH 1GBJA 1SGYE 2O8MA 1C1MA 2B5TB 1GBEA 4NSYA 4RI0A 3FO8D 1MH0A 1HAVB 1OXGA 5E0GA 1LTOA 2Y7ZA 2ALPA 2Y7XA 1XVMA 1SLXB 1SHYA 2ZGHA 3RXSA 2RCEA 4NZLA 1ETTH 1LMWB 2BX4A 2F9VA 4DCDA 5F53A 3CS0A 3TNSA 3TH3H 2ANYA 3A89A 2GVFA 1TQ7B 3SV8A 3A88A 4ABJA 4IW4E 2QE7D 1ZGIA 2GDEH 1WAYB 2C4FH 1BQYA 3R0FA 2VH0A 1KXEA 2FZZA 2GDDA 4ZHAA 2G5NA 1HJAC 4TY6A 4CRDA 3LGTA 4JYUH 1HGTH 3FP8E 4F49A 3M3TA 4RKJB 4I8LA 3OFND 1DS2E 1TX7A 3MNXA 3OEHD 4B2CA 1C2FA 4O03A 1C5RA 2B9LA 4DURA 1QL8A 4YTAA 1EOLA 2R0KA 1YPJH 5HKKD 1Z1JA 2TPIZ 1C5WB 1A5HA 1MCTA 3L33A 1AUJA 1FONA 3GS9A 2A2QH 1FY3A 1MMJN 2VWLA 1AKSB 1LHCH 3SHAH 1OWEA 3MH5A 1NFUA 3BG4B 4M9FA 1N6XA 2BB4A 1MBMA 1BZXE 3B23B 2IOTA 1AE8H 3GISB 2F3CE 2XNDD 1GI3A 1V2MT 4D8NA 5AFYH 1WQVH 3U9AH 1E1QD 1O33A 3GY3A 1SPJA 1TIOA 1UTJA 2G55A 3ITIA 2ZFRH 2IJD1 3SGAE 2BX3A 9LPRA 4X1QU 2WHXA 1TOCB 3RC6A 4HGCA 1W0KD 2LELA 2BY8X 2VIPA 1SBWA 6LPRA 1C5MD 3ZVCA 1GJ5H 1XUKA 1O5FH 4F4OC 4JYVH 3UY9A 1W12U 1O5BB 5BRRE 3M3SA 4AZ2B 3VB6A 3LPRA 1T32A 1AO5A 3RM0H 1KXBA 1C1RA 1HBTH 3ZV8A 2Z9KA 4ISIH 2QN5T 1WTHD 5EQSA 1TRYA 1GHAF 4XBDA 4E7NA 2PHBA 2W5EA 1FAXA 2AERH 1TX6A 3BG4C 3KIDU 4A1XA 1EB2A 2W7UA 1P8VC 1CT2E 1N6YA 1Y3VA 2GZ8A 2ZDVH 3UQVA 1ARBA 1YBWA 2NWNA 1HAZB 3ZZAA 3MU8A 2WV9A 4Q2KA 4AFZA 1BTUA 1GJDB 1XUHA 2ZGXH 1PQ5A 1PPEE 1DSUA 3C27B 2AEIH 3N7EA 3LT3A 2BZ6H 1UVOA 5DG6A 1C1SA 1Y3XA 1SGRE 4DGJA 2AGEX 2XCNA 1QTFA 3SHCH 1F0UA 4INHA 4H6TA 4X2YA 2CXVA 2CN0H 3PTNA 5EU8A 1ESTA 1OKXA 3UR6A 4AGKA 1RTFB 1OWJA 3A7WA 3ZV9A 4YT7H 4TY7A 2A4GA 2THFB 2W6ID 2HPQH 1C5XB 2G5VA 4LZ1H 2BYAX 1OP8A 2J95A 4O3UA 2FTLE 1GDUA 3SNAA 1GJAB 5DP9A 1GBFA 1GHYH 6GCHG 1N8OB 1O5DH 1D6WA 4Y7AA 1L2EA 3QGNB 4UD9H 3FN8A 3BEIB 4Y8XA 1UTLM 4NA7A 5ABWA 1IQIA 3NKKA 4ZHMU 1EZXC 1TLDA 1UK3A 4OS6A 2HLCA 3UOUA 4R0IA 4WY3A 1DXPA 2D1JA 4LXBH 1O2OA 5A0AE 1B5GH 1YCPK 2XBWA 3ZVDA 4CHAB 2OK5A 2HRVA 1MAXA 1KLIH 1RIWC 2ODPA 2R3YA 1DM4B 1V3XA 2PKAB 2UUFB 1Z8GA 1RTKA 3KQCA 5AFZH 1TGNA 2Z9JA 1C1WH 1SGNE 3RXMA 1V2NT 3FP7E 1BBRE 1EAIA 3T29A 2FDAA 3RXAA 1NFYA 1ACBE 4K5ZA 3VB4A 1P04A 3DSOA 1P2OA 4AG2A 3A81A 2OBQA 4SGBE 3RXDA 4B76A 3BTDE 5I46H 1GVKB 2FPZA 1UJ1A 3ZYEA 1C1UH 4NIXA 3M37A 1XKBC 4FETA 1HIAA 3RMOH 3QX5H 3SI4H 1X7AC 5FX6A 5EXNA 3KQBA 2J34A 3PV2A 3S7HB 2Q6FA 4MVNA 2KFWA 5T3HA 1FY5A 3OSYA 6CHAB 3RXOA 4Y0ZE 4CH8B 1Y5AT 4FUBA 4AORA 1V2QT 1SR5C 1EASA 2ZI2H 1P3EA 2ZWLH 1P2IA 2Z9IA 1GMCF 1RD3B 4HFPB 5C1UA 1ARCA 3QLPH 3SU1A 2A0QB 1O2QA 1OPHB 2JJ1D 4D7FA 5ESTE 1C4U2 3ZVFA 3STJA 1FLEE 1EPTA 1O3GA 3GY6A 3S69A 1O2IA 2C8ZB 1BJVA 1GMDF 1SLUB 1RJXB 1AIXH 4I7YH 1OWHA 2CMYA 1FDPA 3A87A 5B6OA 4X2WA 4Z0KA 1NRQH 1ZYOA 1GI6A 1V2UT 2FTMA 4NA9H 1EP5A 4X1NU 5C20A 2QCYA 1LQDB 1NS3A 3QZRA 3OX7U 1XUIA 2WUCA 4LOYH 1GBCA 2QXGA 2ULLA 2XXLA 4K69A 2ZECA 1PPBH 4AX9H 1ABJH 3QN7A 4Q7YA 2PKSC 3LU9B 4NWLA 3QTVH 1AVGH 5ESBA 4JYTA 1SQTA 5FCRA 1Z8IB 1ELEE 1O2VA 2Q6DA 1G9IE 1P05A 1GVZA 2H5DA 1D9IA 1OP2A 2BDHA 1Z1IA 3TK9A 1O3MA 1YPGH 3CS7A 3PB1E 4FUCA 1T8OA 1BOQA 3O8DA 1FPCH 1GI5A 3UFAA 2J5UA 2SGDE 3W94A 2FXRA 5AHGH 2L6OA 2BHGA 2F83A 1FUJA 1EJMA 4BXSA 5JBTA 1QBOA 1Y3YA 4NG9H 2ZEBA 2OINA 3DFLA 4QT8C 2D2DA 3NK8A 3P6ZB 1EATA 1DSTA 2VWOA 5K0HA 5F6MA 1T8LA 2A45B 1W7XH 2FS8A 4D9QA 4WMFA 3M35A 4HTCH 1FV9A 1HLTH 2P3UB 1IHTH 5T6DA 4A1VA 1Y5UT 1C5QA 3TH4H 5DGJA 4AFSA 1S6LA 4XBBA 1CA0B 2V7QD 1P57B 3VB5A 4D7GA 4TPYA 3Q76A 2V35A 4INKA 3SNDA 1D4PB 1A0HB 2ZIQH 1ZPZA 2VIOA 1T31A 2ZP0H 5EG4A 3A8BA 1C2KA 2BLVA 3UWIA 4ZKOU 4ABIA 1KYNA 1TGTA 1E1RD 4ABEA