2OINA

Crystal structure of hcv ns3-4a r155k muntant
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
VEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFKAAVCTRGVAKAVDFIPVENLETTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Polyprotein
publication title Phenotypic and structural analyses of hepatitis C virus NS3 protease Arg155 variants: sensitivity to telaprevir (VX-950) and interferon alpha.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 34
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2007-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2oinA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2oinA01
4Y7AA 1EOLA 4TWWA 2TPIZ 3UREA 4LZ4B 1K21H 2ANKH 3TH4H 2BTCE 4MLFB 5EPYA 2FOAA 1Y5AT 3ZZ6A 2ZFQH 3STIA 2R3YA 3VEQB 2QC2A 1O36A 3LJJA 3QK1A 3D49H 1XUGA 1TONA 1QQUA 1ETRH 1DXPA 3RUOA 4ABGA 2I6SA 2GKVE 1NRQH 3LDXH 1TX6A 1B0FA 2EI8A 5JBAS 2D1JA 1W13U 2FM2A 3MTYA 1BQYA 5DP8A 1YP9A 4AX9H 2W3KA 4Q7YA 5E2PA 1V2JT 2JH0D 1CT4E 1INCA 3SV2H 1YPHC 2P16A 3RM2H 2Y7XA 3ATWA 1EUFA 1MTSA 2ZTZA 4LXBH 2GMTC 1CA0C 3SI3H 4IMZA 5AHGH 3MFJA 2VBCA 2Q6GA 3OU0A 1CSOE 1ZR0A 3GY2A 1ZZZA 1PQ7A 1TALA 5C1YA 1VCWA 5GIBA 1BMMH 3HPTB 2NU1E 1K28D 1ELCA 2CMYA 1O2ZA 4NA8A 3MU4A 3F1SB 2SGPE 1Q2WA 3F9FA 3RXAA 2ZGXH 3S9CA 1MZAA 1P9UA 3BEUA 3C27B 3LONA 3ESTA 1IOEA 1GHYH 3QUMP 2AFQB 3SO3A 3VGCB 1GDUA 1QL9A 5FCRA 3SNDA 1AZZA 3ZVBA 1UVTH 2RA3A 4BANB 2WV5A 1IQJA 1ZJDA 3AW1A 5LPFA 1T31A 4Y6DA 3MU8A 3MNXA 3P6ZB 3QZRA 1PPHE 1BZXE 3RM0H 3TK5A 1KTTB 2J92A 4BAKB 4X2WA 1C1PA 1TAWA 2ZNKH 1ELAA 4E7RG 1G9IE 4INKA 4ISIH 5IYTA 1E38B 4MPWA 1N8OB 5LH8A 1G32B 1UTKA 2STAE 2ZU1A 4E05H 2QY0B 7GCHG 1QURH 1K1MA 2BDYA 2ZU2A 2GZ9A 4B74A 4MVNA 1OP0A 5FPYA 1VCQA 2NWNA 3PWCA 1YLCA 3EGKH 1AI8H 1SGPE 1BMNH 1DUEA 1BTWA 3ZVFA 1QB1A 1VGCC 1NM6A 1XKBC 1DDJA 3HGNA 3SV6A 3ATMA 3BF6H 1ZRKA 4Q7ZA 1PQ5A 4FVBA 5TJXA 3GCNA 2GDEH 2R0KA 4D9QA 3KL6A 4JK5A 4AN7A 3QO6A 1HGTH 2O8TA 1O3BA 1Y3VA 1GL1A 1GHXH 4BXWA 2HOBA 1NO9H 1TMTH 2BVSH 5FBIA 1DT2A 5BRRE 1NU9A 3EA7A 3SU3A 3TK9A 1ABIH 4THNH 1BTHH 1GBEA 2PSXA 1ZSKA 1XMNB 1LO6A 4B71A 1ANCA 3IWMA 1ANEA 1ZGVA 4BTUB 3I77A 2WPHS 4GHTA 1UK4A 3MNBA 3GDUA 2ZCLP 1XXFA 2FOBA 3TPIZ 1BB0B 4B2BA 2FODA 1GBIA 1XKAC 2Y5FA 3D65E 1IQLA 1EAUA 1D6WA 1MKXH 4HZHA 2JETB 1DE7H 2ZDNA 1HAPH 1C1VH 1NRRH 3MO9A 3VPKA 2FO9A 1GI1A 2PTNA 4X6OA 3S9BA 1A2CH 1TPOA 5GWZA 4VGCB 1VCPA 3ZV8A 1C5VA 2H9EH 1EASA 1GI0A 2AYWA 1FIZA 4TPIZ 1EPTA 1WAYB 6CHAB 3HATH 1LMWB 5EXLA 5E0GA 3MNSA 1L4ZA 1D9IA 2D8WA 3UFAA 2CV3A 1L1JA 2VIVA 1KLIH 4Y76A 1HJAB 2ZGHA 1BTUA 5FPTA 3PO1B 2ZTXA 3ODFA 3FP6E 1E36B 1S0RA 4O9VA 4Q7XA 1YPGH 3M36A 2M5TA 3BTKE 2J94A 4HGCA 2XTTB 4OS4A 3QTOH 2B8OH 1CGIE 1EZSC 2J34A 1F2SE 3M7TA 1O2SA 1SR5C 2BVXH 4LK4A 1Q3XA 3SNBA 5L2YH 3P8OA 1VITH 4PROA 4ABEA 1TNHA 1S82A 1TPSA 2Z9IA 1P2MA 4YT6H 2ZPRA 1GHWH 2P8OC 4X8UH 3MH4A 5GDSH 2XYAA 3LH1A 4WXVA 2VH6A 3GCHB 3GISB 3M37A 1UTLM 2VVCA 1XM1A 1AHTH 2ZDKA 5DP6A 1GCDA 1O3NA 2SGFE 1MTNB 2VVVA 1SSXA 1GBJA 1K9OE 3M5OA 4X1PU 1XX9A 1ZHRA 4ZROA 5F03A 1AB9B 2TRMA 3GDVA 1JRTA 3VFEA 1C5MD 1MU6B 5HMAA 4UFGH 3GYLB 1CO7E 5FHTA 4AGKA 1Z7KA 4WH6A 1K1NA 2FDAA 3GDSA 1C5WB 3BTQE 1GJ9B 1DWBH 1YKTA 1O3MA 4CBNA 4X1NU 1MKWH 1P2NA 3IG6B 2XC4A 4BTIB 3RXIA 1Z6JH 4I31A 3U9AH 4ZXYH 2H5CA 4WY3A 2ZI2H 2GZ8A 1GMDG 4HTCH 7GCHF 3K65B 1PPGE 1K1OA 1WXRA 3O8CA 1C5RA 5K7RA 2PLXA 1FZZA 1P06A 1ZLRA 2JH6D 4YLUA 5C3NA 1SGYE 3KF2A 1MBQA 3VB4A 1C2EA 2G5NA 2V0BA 1KY9A 1SVPA 1ZJKA 4DIHH 1GL0E 1O5BB 1RIWB 1WQSA 1SGIB 3EDXB 3LH3A 1C1TA 1IQKA 2D26C 1G3DA 2PKAB 1BRAA 3PV4A 1OWDA 1IQGA 5J4QA 5EW1H 2B0FA 1MMJN 2Y7ZA 4UE7H 2BM2A 1HJ8A 2BYAX 5CE1A 1GJDB 1L2EA 2FOGA 2ZHFH 2WPJS 1FQ3A 2HPPH 4GHQA 2FX6A 9ESTA 1ELGA 4X2XA 4M7GA 3RC5A 1TA6A 3MH5A 4YLQH 3PWBA 3SHCH 1HXFH 5E0HA 1LPZB 3MH6A 6ESTA 4JZ1A 1QIXB 3RXVA 1V2ST 1IQHA 2WV9A 3F9EA 1C1SA 3UNSA 1SGRE 4OS1A 1AU8A 1HIAB 2ZDVH 2QGRA 1GBBA 2ZZUH 3KEEA 4MNXA 3SHAH 1D3QB 3FVFB 2DUCA 1AKSA 1O2HA 2A2QH 2KAIA 4A92A 4KP0A 1HNEE 1LCYA 3SJKA 2QA9E 3ZZ5A 2QV1A 2GGVB 1KXEA 2YNBA 1MAXA 1QL7A 3L33A 4FUHA 3SV7A 2VGCC 3R0FA 4NZLA 4TWYA 2BD4A 1AY6H 4X2YA 1GCTB 1C5YB 6GCHG 2W5EA 1ELTA 3EA9A 4BXSA 2PV9B 1IQFA 3F9HA 3AAVA 4ISHH 4MPXA 1WUNH 4IC5A 1TOCB 2F9BH 1GBAA 2XBYA 4DURA 1BMAA 1C1UH 2OD3B 2OINA 5A0AE 2FMJA 3AAUA 1Z71A 4BOHA 1HAVB 2Q6DA 4RKOB 3UOPA 2H1UA 1SB1H 2B9LA 1O3OA 2ZFTA 3I29A 3LIWA 1TWXB 1ZSLA 1EB2A 3UY9A 4UFEH 1WTHD 4NWLA 1QGFA 1OSSA 5DP4A 4AFQA 1ZTLA 1QCPA 2CGAA 1ZOMA 1THSH 2G5VA 1AVGH 1GBFA 2PFEA 4CREA 1O5EH 2HALA 4ZXXH 1T7CA 2BXTH 1GJ8B 1GJ4H 2ZHEH 5EXNA 1KXAA 3ZVEA 1TABE 1T8MA 1HLTH 1UTPA 1V2KT 2GD4B 4DT7B 5T1VA 4XBDA 2FOMB 1ZPBA 1JWTA 5E2OA 1GJ6A 1JRSA 1UK3A 1HV7A 1QTFA 5EODA 2FP7B 1P03A 2Z9GA 3FAOA 2BLVA 1CBWC 3RXOA 1FXYA 1SPJA 3PMJA 1HAXB 3LU9B 2V6NA 4B2AA 3SGQE 2W3IA 1RJXB 3NWUA 4R8TB 1GI7B 3BG4C 2P94A 4JCNA 1O3EA 1GI6A 3V3MA 1B7XB 1IQNA 4NFEA 1VGCB 1P0SH 1SGFA 2CHAB 1EPTC 1UVOA 1OP2A 1O2PA 3A7TA 3LGIA 2ANWA 2BZ6H 1NT1A 4NA7A 4ZH8A 4DCDA 1YLDA 3S9AA 1TA2A 2G55A 3UWIA 5DKMA 8KME2 4UFFH 1O2GH 1OS8A 2A5IA 2J4IA 1WSSH 5AFZH 1S6FA 2RA0A 4IS5A 3MH7A 1GMDF 4Q2KA 3KQCA 2PUXB 2VIDA 3TH3H 1IHTH 3P92A 4ISOA 1WOFA 5GCHG 2A32A 2CF9H 2GCHG 3P8NA 4K69A 4O03A 5DG6A 4U2WA 4AFSA 2GZ7A 4K8BA 1UTMA 4Y0YE 3ZZ9A 3P8FA 3BV9B 1A3EH 3PYHA 1W0YH 4UDWH 4Y8XA 4D7FA 1H1BA 1NESE 2UUKB 1GVKB 1Q31A 1P9SA 1KSNA 1ZHMA 4UFDH 3SU5A 5DO4H 1HAHH 5C1UA 2ANYA 1SL3A 5E8EH 1G3EA 4B75A 3GY7A 1Y5UT 4GAWA 3GOVB 1E34B 1TGSZ 2HPQH 1WU1A 4OS7A 2ODPA 2GT8A 1SLWB 8ESTE 3P8GA 1UCYH 1G2LA 1AWHB 2QXHA 1D4PB 1LTOA 2TBSA 1FV9A 1C9PA 4WMFA 4FUJA 4Y8YA 2BOHB 3A7VA 3K6ZA 2VB0A 2ANMH 4ESTE 3VXFH 5HGGA 1UMAH 3ENSB 4LOYH 1ZGIA 4WVPE 3U8OH 2Z9LA 3T26A 1SI5H 4I8HA 1A4WH 1UVUH 1EAIA 2OC8A 1D6RA 1EB1H 1SGTA 3GYMA 3KCGH 1H9IE 1GGDB 2A5KA 5GNDA 1XUIA 1KXDA 1PFXC 4AG2A 3ATIA 2F83A 1CT2E 1OX1A 2OP9A 2UUJB 3P70B 4FVDA 1UTOA 3HKJB 3FANA 1YPJH 2PKSC 4IN1A 3R3GB 1GI9B 1V2VT 2GX4A 3SBKA 1FPCH 1H9HE 4IC6A 2GCTB 4X1SU 5B6LA 5G4BA 3TJNA 1FLEE 6GCHF 1UK2A 3RXCA 3RXGA 1YCPM 3E90B 5DP7A 2OQUA 2BY7X 4INHA 4K5ZA 1ELVA 1LVYA 1TOMH 2THFB 1KLJH 2P93A 4ISLA 3H7TA 1SGNE 2A5AA 2CF8H 2GDDA 2BDAA 1O31A 1O2MA 2ZO3H 4X8VH 3U69H 1Z8IB 5K0HA 1WQVH 4JYVH 3S69A 3P95A 4AZ2B 2WUBA 3QGNB 4XOJA 3AASA 4ZHAA 2ZCKP 2BY5X 3UTUH 1O3HA 1GBHA 2P95A 3D62A 1DSTA 1BTXA 7ESTE 4JYUH 5EOKA 3SJOA 1WBGB 1DANH 3UQOA 3TIUA 3DT0H 4NIYA 3ZYEA 4GVUA 1QJ1B 1C4Y2 1QY6A 2R3UA 4DW2U 3OX7U 3V12A 1J14A 1RRKA 1O2NA 1N1LA 2OBOA 2RG3A 3EE0B 3RXUA 1H8IH 4GCHF 3SGAE 3V7TA 4LZ1H 2A4GA 4CRAA 3E1XB 4XE4A 1GJ5H 1YCPK 2JKHA 1EAXA 3VXEH 1THRH 1HAYB 2NU3E 1AFQC 2OLGA 4SGAE 1C1NA 5HYOA 4ABDA 4YOJA 2PHBA 1W12U 3RXDA 3U8RH 4FU7A 2ZTYA 1SLXB 5A8YA 3A80A 1SFQB 2AMPA 2R2WU 1HXEH 1A0HB 3U1IB 3M7QA 2XNIA 1YCPH 1C2DA 1Z1JA 1W11U 1BRBE 1GG6C 3PMHB 2P59A 1O38A 2R0LA 5AFYH 1CT0E 2FESH 1FIWA 1C5XB 2ZGJA 2J95A 1IQMA 4XFQA 1P2KA 2DE8A 3H7OA 4I7YH 1O2YA 2A4OA 2BD7A 4FUGA 3RC6A 1BTPA 2G4UA 3BTGE 3OY6U 3TGJE 2TIOA 1CHOG 3NCLA 1DWEH 2XW9A 4X8TH 4SGBE 1TX7A 1SQTA 1CGJE 2HNTE 1NRPH 1CU1A 2FWWA 3SUGA 4AFZA 3MU5A 4J2YB 3D23A 3DA9B 4CRGA 3GCTF 1TX8A 3M3SA 5GCHF 1AN1E 2OXSA 2GCHF 1S84A 1SMFE 1LVBA 1DOJA 1FY1A 4RKJB 1P57B 3BN9A 2Q6FA 4GPGA 2ZPQA 4K8YA 2BDBA 1ZTKA 3KIDU 4ASHA 1TE0A 3SOSA 4D9RA 1F5KU 4ZHLU 1V2RT 1BJUA 1EOJA 3RMOH 1LVOA 2ZWLH 4MDSA 3TGKE 4FUFA 1Y3UA 4CRBA 3UQVA 4UEHH 2Z3CA 4J1YA 2TGDA 5DPAA 2F4LA 1C1OA 1W3CA 1TRNA 4YESB 4XSKU 3UOUA 3U8TH 2BDHA 2BHGA 2AIPA 5T6GA 1V2TT 1Z1IA 1SFIA 5AF9H 3OY5U 5J4SA 3E0PB 1T4UH 2BLQA 3M3TA 1H9LB 1OYTH 1VJAU 4MNWA 1AE8H 1QQ4A 4TY7A 3SW2B 1UHBB 4BAOB 4XBCA 1A5IA 1O3IA 2QN5T 1AFEH 2OC7A 1UVPA 3GY6A 1F92A 3EA8A 1Z6EA 1GBDA 4K3JA 1GHBG 2H9TH 4YOIA 2PKAA 1FI8A 3T5FH 4YTAA 3QLPH 3C1KA 3NZIA 4NSYA 1B5GH 4AFUA 3SU6A 1YYY1 1IAUA 2QF0A 4I32A 6LPRA 3K6YA 3PLKA 1W7XH 1Z8RA 1Y3XA 1O3LA 5DGJA 4CR5A 3ZZDA 1W14U 2F3CE 5CHAB 1YPHE 3Q3KA 4H6SB 1AQ7A 2O8UA 1F5LA 1ESAA 3VGCC 1VZQH 2SGAA 3LC5A 3SGBE 3LGYA 1KDQB 4JZIA 1P2IA 4I33A 2SNVA 1TMUH 2O9QA 1NFUA 1HIAA 4OS5A 1X7AC 3A7ZA 5H4IB 3QGJA 1RTFB 1SGDE 3MO3A 2AEIH 1O3PB 2WPKS 2ZF0H 3VB7A 3BIVH 4NIVA 1GJ7B 5DP3A 1EATA 2HRVA 1GBMA 1N8OC 1FN8A 5ABWA 4B2CA 2PGQB 1HJ9A 1PPCE 5LPEA 4K60A 1JIMA 1KTSB 3G01A 5FX6A 4NIWA 3DUXH 4TY6A 2WYGA 1S0QA 4A1XA 2HGTH 1GMHG 1YC0A 4YO9A 2WINI 1O39A 2A4RA 1QL8A 4O3UA 3UWJH 1BBRK 5L30H 4CHAB 4U01A 1C2HA 1JOUB 4D8NA 1BBRE 1GPZA 3A7WA 4NCYA 4DJZB 3LGTA 4OS2A 1HAVA 1KLTA 3ATKA 4Y79A 2OC0A 4FU9A 4Y0ZE 1HFDA 2UUFB 1EJMA 2RCEA 1P05A 4O3TA 4DOQA 2FTMA 2VINA 3TH2H 1ID5H 1BA8B 1SOZA 2ZEBA 5GJ4B 3A83A 3F68H 2CXVA 3O8DA 1AUTC 1V2QT 1SG8B 1VITG 1HDTH 1HAGE 1GHAF 2F9VA 1W10U 2EEKA 3GY5A 2XRCA 3CENA 3ATLA 2ALPA 3W94A 1O5AB 1TFXA 1P02A 1TRMA 5T6FA 4A1TA 1CVWH 1TLDA 1O2TA 1MU8B 1YPLH 4ZKOU 2ZA5A 2Y5GA 2F9PA 4ZKNU 1TRYA 2AGGX 1MCTA 4BAMB 4CRDA 5C67A 1O3JA 1O3DA 2ZKSA 1FY5A 2XCNA 1HB0B 2C4FH 1CHOF 1AE5A 1PPEE 2LNCA 3SU4A 1Z8JB 2R9PA 3LKWA 2JETC 1MD8A 4K1EA 3ODDA 1J15A 1GI2A 3SNEA 2ZGBH 3JZ2B 2VIPA 3A8DA 1ETTH 2ZU5A 1FONA 1Y3YA 3SQEE 4WF8A 7KMEH 1D3PB 1Y8TA 1C5NH 2J9NA 1DXWA 5DK1A 3LGWA 2TGPZ 1EJAA 1V2WT 3IITA 3ITIA 1V2OT 3TU7H 1SHYA 1WYKA 1S85A 2XC5A 1QHRB 1F0SA 1GBKA 1SGEE 1HJAC 3A8CA 1TNJA 3PV2A 2UWLA 3K9XB 3MMGA 4ABJA 3PO1C 3LGUA 1V2LT 2GMTB 1CA0B 2BY6X 1A5HA 2AMQA 3SORA 2ZFFH 1P01A 1TBQH 1PPBH 1E0FD 2WPLS 1C4V2 2HWLB 1MCVA 3F9GA 2BZAA 3BSQA 3MHWU 2Y5HA 4ZKRU 2PTCE 1S6HA 2VIWA 3RXPA 5C20A 2ZHDA 1O32A 1YM0A 3BTFE 1ARCA 4AORA 3MNCA 1OWHA 2QAAA 4DGJA 1EJNA 2FPZA 4XBBA 1C1RA 2EA3A 2AH4X 3PTNA 4INLA 1V2PT 5FX5A 4AGJA 1DS2E 1MTVA 1NFXA 1A46H 1YBWA 4Z6AH 8LPRA 1RTKA 1QRXA 1SC8U 3VB3A 3RXLA 2ZFSA 2B7DH 1GHBF 2BX3A 4I8GA 3WY8A 1LVMA 1MQ5A 2BLWA 4MPUA 3ZYDA 2SGQE 2WHXA 2GV6A 4CH8B 1FPHH 1HRTH 1N6YA 5JBBS 3W95A 1K1IA 2IN2A 1WCZA 2BQ7B 4GCHG 4B1TA 1O2QA 2O8LA 3ZZBA 4X2VA 1QBOA 3A82A 4JMYA 4CR9A 1VR1H 2FI5E 4CRFA 3QTVH 4I8JA 2O8WA 1G3CA 1AB9C 4X0WU 3RMNH 2BQWB 1A1RA 5EPNA 1Z8GA 2BY8X 1FN6A 4H4FA 2F9UA 3RMMH 1UTNA 4JZEH 2ZHWH 1O2RA 4R0IA 5A0CA 1FDPA 2ZFRH 1O2LA 4D76A 3ZZ8A 1DM4B 1P8VC 2ZP0H 4D7GA 1TGBA 1LHEH 1O3GA 1OWEA 1YPEH 1TGCA 3FP7E 3SJIA 1FNIA 2ZPSA 4ABBA 3SJ9A 3MU0A 1U6QA 3URCA 4BNRA 5EW2H 3KHVA 2XWBI 5C5NA 5JPMH 1ZSJA 4K2YA 4IBLH 2W26A 3KNXA 3BTEE 2YOLA 1F5RA 3KQBA 3UR9A 1ABJH 3U98H 1GMHF 2CN0H 1DUAA 2FI4E 3A81A 4MNVA 1ESTA 2ZDMA 3GCTG 4B76A 1NN6A 1PYTC 5FAHA 2RDLA 3OSYA 4FUCA 3P17H 1AZ8A 2W7SA 2NU4E 2BD5A 2QXGA 4WJG2 1RIWC 5F8TA 4KTUA 3V13A 1F0TA 4GSOA 1QJ6B 1TGNA 4B6EA 4RSPA 3AK5A 1A0LA 3BEFB 3T29A 1SQOA 1O37A 1A3BH 2G8TA 3ZZCA 3T27A 1MQ6A 4KKDA 1BCUH 1A7SA 3LGVA 1ELDE 3A89A 1FMGA 3RXJA 3K2UA 1UTJA 1VITF 1BDAA 1SGFG 5T3HA 3LPRA 1T8LA 3Q76A 1QJ7B 1QNJA 2G00A 2WZQA 4KTCA 3CS7A 5L6NH 4JZDH 2SFAA 4NGAH 1EP5A 3ZZ3A 2TGAA 3L3TA 2J38A 2OQ5A 4CBOA 1NRNH 1ZHPA 1QRWA 3O8BA 3RU4T 3MU1A 2XBWA 1FY8E 4Y8ZA 2FZZA 2FTLE 5A8XA 1ESBA 1V6DA 2PWXA 1GMCG 5E0JA 1FY4A 1FUJA 2VVUA 2Z6BD 3RDZA 1G30B 4ZMAH 4ZAEA 1HAZB 5F8ZA 1JBUH 5EU8A 2ZHQH 3ZZAA 2K1QA 3E0NB 4YZUA 1ANDA 2ZDLA 2C8WB 3M5LA 4Y71A 5GXPA 4NZQA 1RTLA 1C2GA 1GCTC 2IOTA 2OK5A 1BHXF 1AIXH 2WYJA 2C8YB 2V3HH 3SQHE 3T2NA 3E16B 1K2I1 1GJCB 2Z9JA 1NZQH 4JK6A 3Q00A 3QDZB 4NSVA 2W7UA 2GTBA 1O33A 4X1RU 3VB5A 3SUDA 1GVZA 1EX3A 1GI5A 1WV7H 3U1JB 2BDGA 1E37B 2P8OB 1P09A 1CA8B 2J2UA 3GCOA 1C5TA 1NU7B 2Y80A 1O2UA 2ODYB 5GPIB 3SU1A 4Z0KA 3TITA 3RXEA 3ZZ4A 1O2XA 1QRZA 1TPPA 1S83A 4BTTB 2STBE 3JZ1B 1C5UA 3KGPA 5EQRA 1LQDB 3TK6A 3M7UA 3T28A 2PR3A 1GBCA 3A7YA 5CMXH 2VIQA 4X6NA 1AD8H 1QBNA 3RXFA 5FBEA 1GI4A 3RLYH 1T8NA 5EXMA 2ZGCA 5LGOA 2AIQA 1F0UA 2H9HA 4DVAU 3RU4D 1WTGH 3UPEA 5PTPA 3AW0A 2ZECA 1K22H 1C5OH 3TGIE 3UIRA 3M5MA 4WH8A 3LJOA 5EQSA 1TBRH 5TCAA 3RXRA 5C2ZA 4WWYA 5ESBA 1AVWA 1EZQA 2UWPA 1H8DH 4FUIA 2VWOA 1GDQA 1UVSH 3GY3A 4DIIH 3DD2H 1LQEA 3M5NA 1KXCA 2FX4A 1HBTH 1S5SA 2I6QA 1O34A 4XDEA 3SNCA 2SNWA 1SQAA 2ILNA 1DSUA 2IPHA 4Q80A 3ZVCA 3HK6B 1DPOA 2ZCHP 3RXTA 1UHBA 2OBQA 5FXLA 4ZKSU 4A6LA 1LPKB 1L1NA 4KTSA 2CJIA 2CHAC 3UNQA 1J8AA 1NS3A 1XUHA 2SGDE 3SZEA 1GHAG 2FOFA 4A7IB 4CH2B 3RXQA 1HUTH 4KGAA 4B73A 1J17T 1D3DB 3ZV9A 7LPRA 4BAHB 1C2MA 3PV5A 3SV9A 3KQEA 4AYVB 1K1JA 5B6OA 3F6UH 3T62A 2WUCA 1TMBH 4AB9A 4MQAA 1TGTA 2GVFA 1O5GH 3PLBA 1TQ0B 2AS9A 3TJVA 4I8LA 3UNRA 2PGBB 4U30A 3S7KB 5DJ7A 3PTBA 2QYIA 3PROA 1QB9A 2ZQ2A 2A7HA 5L2ZH 1KDQA 1DY8A 1MKXK 1O35A 1O2OA 2XXLA 4ZHMU 4DG4A 1TB6H 2BX4A 2XC0A 3B8JA 1GJAB 3A87A 2SGEE 4IW4E 2VWNA 2AERH 3ZVGA 2V3OH 2OCVB 1Y3WA 1BRUP 1O5CB 2G52A 2EI6A 4Y7BA 5C1XA 3E91A 3O8RA 2GP9B 2HVXA 5HXFA 1FY3A 3EYDA 1A61H 1ORFA 2XCFA 1TYNA 1THPB 2A45B 3DFLA 5DP5A 1PQ8A 5SGAE 3OTJE 4NFFA 5AVDA 1O3KA 2WPMS 1FJSA 1LDTT 1LKBA 1OWJA 3Q77A 4MTBA 4UONA 1ZMNA 2F9OA 3GY8A 1HPGA 3E3TA 1XXDA 4X6MA 2LPRA 3RLWH 3TVJB 2Y82A 2VGCB 3M3VA 4JZFH 2EC9H 2FXRA 1YPMH 1C1WH 1SGCA 1TIOA 1XVMA 1ZPCA 1TNGA 2YNAA 1RGQA 5JB9S 2NU2E 4IN2A 1NFWA 4YM9A 1ELBA 2BQ6B 1ANBA 2ODQA 1A0JA 1GJBB 1O2IA 4AYYB 4TYDA 3SZNA 1C2JA 1G36A 1DFPA 1EAWA 1MAYA 1QBVH 1GMCF 1ZMJA 1GGDC 1NFYA 1RD3B 2BVRH 2H6MA 3B9FH 1ARBA 1BIOA 1G37A 3TNSA 1OYQA 1LHFH 5FPSA 1C2FA 1ZRBA 2XBVA 3B23B 1P10A 2UUYA 5JB8S 2FI3E 1NRSH 1AWFH 1LPGB 1ZYOA 2GCTC 3CP7A 1DICA 3S7HB 3Q3YA 4F49A 1BJVA 2FYQA 2Z9KA 1AO5A 2A31A 3M61U 4AB8A 3GICB 2R2MB 4IGDA 1MBMA 1BT7A 1OP8A 2B5TB 2ZFPH 1B0EA 3A84A 4OS6A 3SU0A 1BITA 1UTQA 3L6PA 3SN8A 1PPFE 2WV4A 1P2QA 5C5OA 1AVXA 1ELFA 1DWDH 1C2IA 2VH0A 1BUIA 3SUEA 1F0RA 1T8OA 5JYIA 3RU4E 3BTWE 5EGMA 4ZUHA 1GWAA 1QA0A 3NKKA 2P3FH 1CBWB 2FEQH 1GI8B 3ZZ7A 3NUMA 3KQDA 2P3TB 1K1PA 1O5DH 3H5CB 1ZTJA 1C5PA 1HAIH 5JBCS 4NWKA 1C9TA 2A1DB 2V35A 1GHVH 4H42U 1O2WA 1OXGA 4FU8A 1MKWK 3LOXA 4FXGH 4I8KA 2BD3A 3OYPA 4AOQA 1OWIA 1RFNA 2A0QB 3VB6A 3BG4B 3FZZA 3RXMA 1EQ9A 2D2DA 3EAJA 1BRCE 5A09A 1LHDH 1EPTB 1KXFA 4RN6A 2G4TA 4FUBA 5JDUB 1C1MA 1CHGA 1P11E 1HAOH 3E8LA 2F91A 1DWCH 1L4DA 2FOEA 1IQIA 1A5GH 4U32A 2BY9X 1OPHB 3RP2A 1W0ZU 1AMHA 1C5SA 1EZXC 3DFJA 2Z7FE 5I25A 2C8XB 3RXHA 2BB4A 3SNAA 3TJUA 1RXPA 3SU2A 1BBRH 3N7OA 1EZUC 1LHGH 4OGYA 4Y11E 8GCHG 5BPEA 1J9CH 4NA9H 4B6FA 3SYJA 1AGJA 1NC6A 1XUKA 2BDIA 2XBXA 1V2NT 1C5QA 4Y10E 2QXJA 3LT3A 4GLYA 3AVZA 4F4OC 3ELAH 1ACBE 2HLCA 3A88A 1SLVB 2ZG0H 3A86A 1C4U2 1UO6A 3S0NA 1NY22 1TNIA 5EG4A 3A85A 3ZVAA 1NROH 2OC1A 2OUAA 2OTVA 1K1LA 3GY4A 2EI7A 1DVAH 3BG8A 4ABHA 1T4VH 1QFKH 3QZQA 1CE5A 2Y6TA 2ZDAH 2BMGB 1OWKA 2Z3DA 3NK8A 5ETXA 1XVOA 4X6PA 3TNTA 3URDA 3V0XA 2ZU3A 4X8SH 4RI0A 2BXUH 2O8MA 2XWAA 2WPIS 1HCGA 2BD9A 4VGCC 9LPRA 2ASUB 2A7CA 2VWLA 3NPSA 1W2KH 2VJ1A 1O2KA 4OGXA 6CHAC 3BTTE 3BTME 4AG1A 1C5LH 2AGEX 4FUDA 4HFPB 2GT7A 4KELA 2VWMA 1GHZA 2Y81A 1SLUB 3QN7A 1CQQA 2C8ZB 1TQ7B 3MOCA 2H5DA 4WMDA 2GV7A 2VNTA 4BAQB 2QXIA 4K1SA 3SV8A 1P12E 1D3TB 1SBWA 4M9FA 1GDNA 3MO6A 2G51A 3QX5H 1JXPA 1SHHB 1O3FA 2PKSB 4YOGA 1O3AA 4WMEA 1OOKB 2P3UB 1DLKB 4ABIA 3CS0A 1S81A 5A8ZA 3EQ0H 3ZVDA 1V3XA 1XUFA 3RXSA 3PLPA 3BEIB 1YF4A 3MYWA 1P3EA 2IJOB 1JIRA 3BTHE 4WXIA 4NG9H 2C3SA 4YT7H 3MWIU 4UD9H 1F7ZA 1TPAE 1MUEB 2ZC9H 1QR3E 1Y59T 4DY7B 4NIXA 3PMAB 3RMLH 2ZQ1A 5HM9A 2DE9A 1UJ1A 3STJA 1KIGH 1Y5BT 1PJPA 4MG3A 1BHXB 3QWCH 4IMQA 1ZPZA 3RXBA 1CGHA 3T25A 1QA7A 1MD7A 3HKIB 2BD2A 4ISNA 1O2VA 4E7NA 3HGPA 1MZDA 3TLOA 4JYTA 5CHAC 1ETSH 3GCHC 1C5ZB 1L0ZA 2FS8A 4E06H 5A0BA 1O2JA 1EXFA 1BOQA 3HK3B 1M9UA 2C90B 1C2LA 1MTWA 3SUFA 1LKAA 1DX5M 1FAKH 2FIRH 1MTNC 4GUXA 3TJOA 1O0DH 4CRCA 2FS9A 2ALVA 2FYRA 2Z94A 1V2MT 1DITH 1SGQE 1W8BH 4FUEA 1O3CA 1P2OA 4HI3A 4QT8C 2A2XH 3A8BA 4H6TA 1ZMLA 1DY9A 2A7JA 2UWOA 1BTZA 4OM9A 1G2MA 5F6MA 3I78A 3PMBB 3E6PH 1PQAA 4MNYA 3RXKA 5F8XA 1E35B 1W7GH 1NTPA 1P3CA 1TNLA 2PW8H 2JH5D 3M35A 4X1QU 1YGCH 1AKSB 2KAIB 2ZU4A 1L1GA 2HNTF 2FLBH 5DP9A 3A8AA 2PSYA 1AFQB 3FP8E 1P04A 4K1TA 3A7XA 1ELEE 2BDCA 1EP6A 1HYLA 4ABAA 2FOCA 5TCCA 1QB6A 2FOHA 1GI3A 3UUZA 1LHCH 1PPZA 1AUJA 1MTUA 2F9NA 5EQQA 3SI4H 1O5FH 2BD8A 3FFGA 3Q3XA 1GG6B 2ESTE 3KN2A 2QF3A 5T6DA 3SJ8A 4CHAC 1YPKH 2VU8E 1G3BA 1NPMA 3H09A 2HNTC 5LPRA 1P2JA 5HM2A 1DLEA 2A4QA 5A2MH 1GVLA 3RC4A 1H4WA 3PB1E 3UR6A 2BOKA 1O30A 2G81E 1RS0A 4TPYA 3BTDE 3MI4A 1C2KA 2IJD1 8GCHF 5I46H 1C1QA 5IDKA 2FLRH 2QIQA 1OKXA 1SOTA 4ABFA 1GBLA 5ESTE 1T32A 3PM3A 1BTYA 1V2UT 3OTPA 3BIUH 4A5TS 2BLOA 2ULLA 3DHKH 1TNKA 2QCYA 2H2ZA 3FZDA 4O97A 1EKBB 2AGIX 1KXBA 1J16A 2PUQH 1BMLA 1PYTD 5JBTA 1IQEA 1N6XA 2C93B 2VIOA 4A1VA 2Z3EA 1UCYK 1MH0A 2Q1JA 1VJ9U 1KYNA 2AMDA 1FAXA 2TGTA 5FCKA 1GBTA 1JMOH 1TBZH 1IHSH 2ZIQH 1XUJA 1UCYE 4MPVA 2NU0E 3NXPA 3LC3A
chains in the Genus database with same CATH superfamily
4Y7AA 1EOLA 4TWWA 2TPIZ 3UREA 4LZ4B 1K21H 2ANKH 3TH4H 2BTCE 4MLFB 5EPYA 2FOAA 1Y5AT 3ZZ6A 2ZFQH 3STIA 2R3YA 3VEQB 2QC2A 1H8ED 1O36A 3LJJA 3QK1A 3D49H 1XUGA 1TONA 1QQUA 1ETRH 1DXPA 3RUOA 4ABGA 2I6SA 2GKVE 1NRQH 3LDXH 1TX6A 1B0FA 2EI8A 5JBAS 2D1JA 1W13U 2FM2A 3MTYA 1BQYA 5DP8A 1YP9A 4AX9H 2W3KA 4Q7YA 5E2PA 1V2JT 2JH0D 1CT4E 1INCA 3SV2H 1YPHC 2P16A 3RM2H 2Y7XA 3ATWA 1EUFA 4P00A 1MTSA 2ZTZA 4LXBH 2GMTC 1CA0C 3SI3H 4IMZA 5AHGH 3MFJA 2VBCA 2Q6GA 3OU0A 1CSOE 1QZ8A 1ZR0A 3GY2A 1ZZZA 1PQ7A 1TALA 5C1YA 1VCWA 5GIBA 1BMMH 3HPTB 2NU1E 1K28D 1ELCA 2CMYA 1O2ZA 4NA8A 3MU4A 3F1SB 2SGPE 1Q2WA 3F9FA 3RXAA 2ZGXH 3S9CA 1MZAA 1P9UA 3BEUA 3C27B 3LONA 3ESTA 1IOEA 1GHYH 3QUMP 2AFQB 3SO3A 3VGCB 1GDUA 1QL9A 5FCRA 3SNDA 1AZZA 3ZVBA 1UVTH 2RA3A 4BANB 2WV5A 1IQJA 1ZJDA 3AW1A 5LPFA 1T31A 4Y6DA 3MU8A 3MNXA 3P6ZB 2GJGA 3QZRA 1PPHE 1BZXE 3RM0H 3TK5A 1KTTB 2J92A 4BAKB 4X2WA 1C1PA 1TAWA 2ZNKH 1ELAA 4E7RG 1G9IE 4INKA 3PRDA 4ISIH 5IYTA 1E38B 4MPWA 1N8OB 5LH8A 1G32B 1UTKA 2STAE 2ZU1A 4E05H 2QY0B 7GCHG 1QURH 1K1MA 2BDYA 3DSOA 2ZU2A 2GZ9A 4B74A 4MVNA 1OP0A 5FPYA 1VCQA 2NWNA 3PWCA 1YLCA 3EGKH 1AI8H 1SGPE 3FKSD 1BMNH 1DUEA 1BTWA 3ZVFA 2F43B 1QB1A 1VGCC 1NM6A 1XKBC 1DDJA 2QE7D 3HGNA 3ATMA 3SV6A 3BF6H 1ZRKA 4Q7ZA 1PQ5A 4FVBA 5TJXA 3GCNA 2GDEH 2R0KA 4D9QA 3KL6A 4JK5A 4AN7A 3QO6A 1HGTH 2O8TA 1O3BA 1Y3VA 1GL1A 1GHXH 2KFWA 3UAIC 4BXWA 2HOBA 1NO9H 1TMTH 2BVSH 5FBIA 1DT2A 5BRRE 1NU9A 3EA7A 3SU3A 3TK9A 1ABIH 4THNH 1BTHH 1GBEA 2K0QA 2PSXA 1ZSKA 1XMNB 1LO6A 4B71A 1ANCA 3IWMA 1ANEA 1ZGVA 4BTUB 3I77A 2WPHS 4GHTA 1UK4A 3MNBA 3GDUA 2ZCLP 1XXFA 2FOBA 3TPIZ 1BB0B 4B2BA 2FODA 1GBIA 1XKAC 3EE7A 2Y5FA 3D65E 1IQLA 1EAUA 1D6WA 1MKXH 4HZHA 2JETB 1DE7H 2ZDNA 1HAPH 1C1VH 1NRRH 3MO9A 5KECA 3VPKA 2FO9A 1GI1A 2PTNA 4X6OA 3S9BA 1A2CH 1TPOA 4XRNA 5GWZA 4VGCB 1VCPA 3ZV8A 5KEDA 1C5VA 2H9EH 1EASA 1GI0A 2AYWA 1FIZA 4TPIZ 1EPTA 1WAYB 6CHAB 3HATH 1LMWB 5EXLA 5E0GA 3MNSA 2J98A 1L4ZA 1D9IA 2D8WA 3UFAA 2CV3A 1L1JA 2VIVA 1KLIH 4Y76A 1HJAB 2ZGHA 1BTUA 5FPTA 3PO1B 2ZTXA 3ODFA 3FP6E 1E36B 1S0RA 4O9VA 4Q7XA 1YPGH 3M36A 2M5TA 3BTKE 2J94A 4HGCA 2XTTB 4OS4A 3QTOH 3VG8A 2B8OH 1CGIE 1EZSC 2J34A 1F2SE 3M7TA 1O2SA 1SR5C 2BVXH 4LK4A 1Q3XA 3SNBA 5L2YH 3FOAA 3P8OA 1VITH 4PROA 4ABEA 1TNHA 1S82A 1TPSA 2Z9IA 1P2MA 4YT6H 2ZPRA 1GHWH 2P8OC 4X8UH 3MH4A 5GDSH 2XYAA 3LH1A 4Q63A 4WXVA 2VH6A 3GCHB 3GISB 3M37A 1UTLM 2VVCA 2V3MA 1XM1A 1AHTH 2ZDKA 5DP6A 4ACBA 1GCDA 1O3NA 2SGFE 1MTNB 2VVVA 1SSXA 1GBJA 1K9OE 3M5OA 4X1PU 1XX9A 1ZHRA 4ZROA 5F03A 1AB9B 2TRMA 3GDVA 1JRTA 3VFEA 5C0UA 1C5MD 1MU6B 5HMAA 4UFGH 3F2GA 3GYLB 1CO7E 5FHTA 4AGKA 3DSPA 1Z7KA 4WH6A 1K1NA 2FDAA 3GDSA 1C5WB 3BTQE 1GJ9B 1DWBH 1YKTA 1O3MA 4CBNA 4X1NU 1MKWH 1P2NA 3IG6B 2M2AA 2XC4A 4BTIB 3RXIA 1Z6JH 4I31A 3U9AH 3U28C 4ZXYH 2H5CA 4WY3A 2ZI2H 2GZ8A 1GMDG 4HTCH 7GCHF 3K65B 1PPGE 1K1OA 1WXRA 3O8CA 1C5RA 5K7RA 2PLXA 1FZZA 1P06A 1ZLRA 2JH6D 4YLUA 5C3NA 1SGYE 3KF2A 1MBQA 3VB4A 5CHBA 1C2EA 2G5NA 2V0BA 1UW7A 1KY9A 1SVPA 1ZJKA 4DIHH 1GL0E 1O5BB 1RIWB 1WQSA 1SGIB 3EDXB 3LH3A 1C1TA 1IQKA 2D26C 3OEHD 1G3DA 2PKAB 1BRAA 3PV4A 1OWDA 1IQGA 4TSFD 5J4QA 5EW1H 2B0FA 1MMJN 2Y7ZA 4UE7H 2BM2A 1HJ8A 2BYAX 5CE1A 1GJDB 1L2EA 2FOGA 2ZHFH 2WPJS 1FQ3A 1BMFD 1E79D 2HPPH 4GHQA 2FX6A 9ESTA 1ELGA 4X2XA 4M7GA 3RC5A 1TA6A 3MH5A 4YLQH 3PWBA 3SHCH 1HXFH 5E0HA 1LPZB 3MH6A 6ESTA 4JZ1A 1QIXB 1EFRD 3RXVA 1V2ST 1IQHA 2WV9A 3F9EA 1C1SA 3UNSA 1SGRE 4OS1A 1AU8A 1HIAB 2ZDVH 2QGRA 1GBBA 2ZZUH 3KEEA 4MNXA 3SHAH 1D3QB 3FVFB 1YY3A 2DUCA 1AKSA 1O2HA 2A2QH 2KAIA 2PP6A 4A92A 4KP0A 1HNEE 1LCYA 3SJKA 2QA9E 3ZZ5A 2QV1A 2GGVB 1KXEA 2YNBA 1MAXA 1QL7A 3L33A 4FUHA 3SV7A 2VGCC 3OAAD 3R0FA 4NZLA 4TWYA 2BD4A 1AY6H 4X2YA 1GCTB 1C5YB 6GCHG 2W5EA 1ELTA 3EA9A 4BXSA 2PV9B 1IQFA 3F9HA 3AAVA 4ISHH 4MPXA 1WUNH 4IC5A 2F9BH 1TOCB 1GBAA 2XBYA 4DURA 3KYGA 1BMAA 1C1UH 2OD3B 2OINA 5A0AE 2FMJA 3AAUA 1Z71A 4BOHA 1HAVB 2Q6DA 4RKOB 3UOPA 2H1UA 1SB1H 2B9LA 1O3OA 2ZFTA 3I29A 3LIWA 1TWXB 1ZSLA 1EB2A 3UY9A 4UFEH 1WTHD 4NWLA 1QGFA 2JJ1D 1OSSA 5DP4A 1E1RD 2JIZD 4AFQA 1ZTLA 1QCPA 2CGAA 1ZOMA 1THSH 2G5VA 1AVGH 1GBFA 2PFEA 4CREA 1O5EH 2HALA 4ZXXH 1T7CA 2BXTH 1GJ8B 1GJ4H 2ZHEH 5EXNA 1KXAA 3ZVEA 1TABE 1T8MA 1HLTH 1UTPA 1V2KT 2GD4B 5T1VA 4DT7B 4XBDA 2FOMB 1ZPBA 1JWTA 5E2OA 1GJ6A 1JRSA 1UK3A 1HV7A 2K8IA 1QTFA 5EODA 2FP7B 1P03A 2Z9GA 3FAOA 2BLVA 1CBWC 3RXOA 1FXYA 1SPJA 3PMJA 1HAXB 3LU9B 2V6NA 4B2AA 3SGQE 2W3IA 1RJXB 3NWUA 4R8TB 1GI7B 3BG4C 2P94A 4JCNA 1O3EA 1GI6A 3V3MA 1B7XB 1IQNA 4NFEA 1VGCB 1P0SH 1SGFA 2CHAB 1EPTC 1UVOA 1OP2A 1O2PA 3A7TA 3LGIA 3GS9A 1KMHB 2ANWA 2BZ6H 1NT1A 4NA7A 4ZH8A 4DCDA 1YLDA 3S9AA 1TA2A 2G55A 3UWIA 5DKMA 8KME2 4UFFH 1O2GH 1OS8A 2A5IA 2J4IA 1WSSH 5AFZH 1S6FA 2RA0A 4IS5A 3MH7A 1GMDF 4Q2KA 3WWFA 3KQCA 2PUXB 2VIDA 3TH3H 1IHTH 3P92A 4ISOA 1WOFA 5GCHG 2A32A 2CF9H 2GCHG 3P8NA 4K69A 4O03A 5DG6A 4U2WA 4AFSA 2GZ7A 4K8BA 1UTMA 4Y0YE 3ZZ9A 3P8FA 3BV9B 1A3EH 3PYHA 1W0YH 4UDWH 4Y8XA 4D7FA 1H1BA 1NESE 2UUKB 1GVKB 1Q31A 1P9SA 1KSNA 1ZHMA 4Q4LA 4UFDH 3SU5A 5DO4H 1HAHH 5C1UA 5KGOA 2ANYA 1SL3A 5E8EH 1G3EA 4B75A 3GY7A 1Y5UT 4GAWA 3GOVB 1E34B 1TGSZ 2HPQH 1WU1A 4OS7A 2ODPA 2GT8A 1SLWB 8ESTE 3P8GA 1UCYH 1G2LA 1AWHB 2QXHA 1D4PB 1LTOA 2TBSA 1FV9A 1C9PA 4WMFA 4FUJA 4Y8YA 2BOHB 3A7VA 3K6ZA 2VB0A 2ANMH 4ESTE 3VXFH 5HGGA 1UMAH 3ENSB 4LOYH 1ZGIA 4WVPE 3U8OH 2Z9LA 3T26A 1SI5H 4I8HA 2RDEA 1A4WH 1UVUH 1EAIA 2OC8A 1D6RA 1EB1H 1SGTA 3GYMA 1NBMD 3KCGH 1H9IE 1GGDB 2A5KA 5GNDA 5C17A 1XUIA 1KXDA 1PFXC 4AG2A 3ATIA 1H8HD 2F83A 1CT2E 1OX1A 2OP9A 2UUJB 3P70B 4FVDA 1UTOA 3HKJB 3FANA 1YPJH 2PKSC 4IN1A 3R3GB 1GI9B 1V2VT 2GX4A 3SBKA 1FPCH 1H9HE 4IC6A 2GCTB 4X1SU 5B6LA 5G4BA 3TJNA 1FLEE 6GCHF 1UK2A 3RXCA 3RXGA 1YCPM 3E90B 5DP7A 2OQUA 2BY7X 4INHA 4K5ZA 1ELVA 1LVYA 1TOMH 2THFB 1KLJH 2P93A 4ISLA 3H7TA 1SGNE 2A5AA 2CF8H 2GDDA 5FL7D 2BDAA 3OE7D 1O31A 1O2MA 2ZO3H 4X8VH 3U69H 1Z8IB 5K0HA 1WQVH 4JYVH 3S69A 3P95A 4AZ2B 2WUBA 3OEED 3QGNB 4XOJA 3AASA 2EQNA 4ZHAA 2ZCKP 2YMSC 2BY5X 3UTUH 1O3HA 1GBHA 2P95A 1K0HA 3D62A 1DSTA 1BTXA 7ESTE 4JYUH 5EOKA 3SJOA 1WBGB 1DANH 3UQOA 3TIUA 3DT0H 1MABB 4NIYA 3ZYEA 3F2HA 4GVUA 1QJ1B 1C4Y2 1QY6A 3F3BA 2R3UA 4DW2U 3OX7U 3V12A 1J14A 2W6JD 1RRKA 1O2NA 1N1LA 2OBOA 2RG3A 3EE0B 3RXUA 1H8IH 4GCHF 3SGAE 3V7TA 4LZ1H 2A4GA 4CRAA 3E1XB 4XE4A 1GJ5H 1YCPK 2JKHA 1EAXA 3VXEH 1THRH 1HAYB 2NU3E 1AFQC 2OLGA 4SGAE 1C1NA 5HYOA 4ABDA 4YOJA 2PHBA 1W12U 3RXDA 3U8RH 4FU7A 2ZTYA 1SLXB 5A8YA 3A80A 1SFQB 2AMPA 2R2WU 1HXEH 1A0HB 3U1IB 3M7QA 2XNIA 1YCPH 1C2DA 1Z1JA 1W11U 1BRBE 1GG6C 3PMHB 2P59A 1O38A 2R0LA 5AFYH 1CT0E 2FESH 5EJ1A 1FIWA 1C5XB 2ZGJA 2J95A 1IQMA 4XFQA 1P2KA 2DE8A 3H7OA 4I7YH 4RT0A 1O2YA 2A4OA 2BD7A 4FUGA 3RC6A 1BTPA 2KM0A 4YXWD 4DT4A 2G4UA 3BTGE 3OY6U 3TGJE 2HVYB 2TIOA 1CHOG 3NCLA 1DWEH 2XW9A 4X8TH 4SGBE 1TX7A 1SQTA 1CGJE 2HNTE 1NRPH 1CU1A 2FWWA 3SUGA 4AFZA 3MU5A 4J2YB 3D23A 3DA9B 4CRGA 3GCTF 1TX8A 3M3SA 5GCHF 1AN1E 2OXSA 2GCHF 1S84A 1SMFE 1LVBA 1DOJA 1FY1A 4RKJB 1P57B 3BN9A 2Q6FA 4GPGA 2ZPQA 4K8YA 2BDBA 1ZTKA 3KIDU 4ASHA 1TE0A 3SOSA 4D9RA 1F5KU 4ZHLU 1V2RT 1BJUA 1EOJA 3RMOH 1LVOA 2ZWLH 1W0KD 4MDSA 3TGKE 3F2FA 4FUFA 1Y3UA 4CRBA 3UQVA 4UEHH 2Z3CA 4J1YA 2TGDA 2F4LA 5DPAA 1C1OA 1W3CA 1TRNA 4YESB 4XSKU 3UOUA 3U8TH 2BDHA 2BHGA 2AIPA 5T6GA 1V2TT 1Z1IA 1SFIA 1NBME 5AF9H 3OY5U 5J4SA 3E0PB 1T4UH 2BLQA 3M3TA 1H9LB 1OYTH 1VJAU 4MNWA 1AE8H 1QQ4A 4TY7A 3SW2B 1UHBB 4BAOB 4XBCA 1A5IA 1FX0B 1O3IA 2QN5T 1AFEH 2OC7A 1UVPA 3GY6A 1F92A 3EA8A 1Z6EA 1GBDA 4K3JA 1GHBG 2H9TH 4YOIA 2PKAA 1FI8A 3T5FH 4YTAA 3QLPH 3C1KA 3NZIA 4NSYA 1B5GH 4AFUA 3SU6A 1YYY1 1IAUA 2QF0A 4I32A 6LPRA 3K6YA 3PLKA 1W7XH 1Z8RA 1Y3XA 1O3LA 5DGJA 4CR5A 3ZZDA 1W14U 2F3CE 5CHAB 1YPHE 2W6ID 3Q3KA 2J97A 4H6SB 1AQ7A 2O8UA 1F5LA 1ESAA 3VGCC 1VZQH 2SGAA 3LC5A 3SGBE 1COWD 3LGYA 1KDQB 4JZIA 1P2IA 4I33A 2SNVA 1TMUH 2O9QA 1NFUA 1HIAA 4OS5A 1YWUA 1X7AC 3A7ZA 5H4IB 5DN6D 3QGJA 1RTFB 1SGDE 3DCLA 2AEIH 3MO3A 3MQKC 1O3PB 2WPKS 2ZF0H 3PRBA 3VB7A 3BIVH 4NIVA 1GJ7B 5DP3A 1EATA 2HRVA 1GBMA 1N8OC 1FN8A 5ABWA 4B2CA 2PGQB 4ZCNA 1HJ9A 1PPCE 5LPEA 4K60A 1JIMA 1KTSB 3G01A 5FX6A 4NIWA 3DUXH 4TY6A 2WYGA 1S0QA 4A1XA 2HGTH 1GMHG 1YC0A 4YO9A 2WINI 1O39A 2A4RA 1QL8A 4O3UA 3UWJH 1BBRK 5L30H 4CHAB 4U01A 4F55A 1C2HA 1JOUB 4D8NA 1BBRE 1GPZA 3A7WA 4NCYA 4DJZB 3LGTA 4OS2A 1HAVA 1KLTA 3ATKA 4Y79A 2OC0A 4FU9A 4Y0ZE 1HFDA 2UUFB 1EJMA 2RCEA 1P05A 4O3TA 4DOQA 2FTMA 2VINA 3TH2H 1ID5H 1BA8B 1SOZA 2ZEBA 5GJ4B 3A83A 3F68H 2CXVA 3O8DA 4HG6A 4ACAA 1AUTC 1V2QT 1SG8B 1VITG 1HDTH 5CDFE 1HAGE 1GHAF 2F9VA 1W10U 2EEKA 3GY5A 2XRCA 3CENA 3ATLA 2ALPA 3W94A 1O5AB 1TFXA 1P02A 1TRMA 5T6FA 4A1TA 1CVWH 1TLDA 1O2TA 1MU8B 1YPLH 4ZKOU 2ZA5A 2Y5GA 2F9PA 4ZKNU 1TRYA 2AGGX 1MCTA 4BAMB 4CRDA 5C67A 1O3JA 1O3DA 2ZKSA 1FY5A 2XCNA 1HB0B 2C4FH 1CHOF 1AE5A 1PPEE 2LNCA 3SU4A 1Z8JB 2R9PA 3LKWA 2JETC 1MD8A 4K1EA 3ODDA 1J15A 1GI2A 3SNEA 2ZGBH 3JZ2B 3WW7A 2VIPA 3A8DA 1ETTH 2ZU5A 1FONA 1Y3YA 3SQEE 3UB0A 4WF8A 7KMEH 1D3PB 1Y8TA 1C5NH 2J9NA 1DXWA 5DK1A 3LGWA 2TGPZ 1EJAA 1V2WT 3IITA 3ITIA 1V2OT 3TU7H 1SHYA 1WYKA 1S85A 2XC5A 1QHRB 1F0SA 1GBKA 1SGEE 1HJAC 3A8CA 1TNJA 3PV2A 2UWLA 3K9XB 3MMGA 4ABJA 3PO1C 3LGUA 1V2LT 2GMTB 1CA0B 2BY6X 1A5HA 2AMQA 3DSGA 2ZFFH 1P01A 3SORA 1TBQH 1PPBH 1E0FD 2WPLS 1C4V2 2HWLB 1MCVA 3F9GA 2BZAA 3BSQA 3MHWU 2Y5HA 4ZKRU 2PTCE 2J5UA 4P02A 1S6HA 2VIWA 3RXPA 5C20A 2ZHDA 1O32A 1YM0A 3BTFE 1ARCA 4AORA 3MNCA 3N7DA 1OWHA 2QAAA 4DGJA 1EJNA 2FPZA 4XBBA 1C1RA 2EA3A 2AH4X 3PTNA 4INLA 1V2PT 5FX5A 4AGJA 1DS2E 1MTVA 1NFXA 1A46H 1YBWA 4Z6AH 8LPRA 1RTKA 1QRXA 1SC8U 3VB3A 3RXLA 2ZFSA 2B7DH 1GHBF 2BX3A 4I8GA 3WY8A 1LVMA 1MQ5A 2BLWA 4MPUA 3ZYDA 2SGQE 2WHXA 2GV6A 4CH8B 1FPHH 1HRTH 1N6YA 5JBBS 3W95A 1K1IA 2HLDD 2IN2A 1WCZA 2BQ7B 4GCHG 4B1TA 1O2QA 2O8LA 3ZZBA 4X2VA 2YMSB 1QBOA 3A82A 4JMYA 4CR9A 1VR1H 2FI5E 4CRFA 3QTVH 4I8JA 2O8WA 1G3CA 1AB9C 4X0WU 3RMNH 2BQWB 1A1RA 5EPNA 1Z8GA 2BY8X 1FN6A 4H4FA 2F9UA 3RMMH 1UTNA 4JZEH 2ZHWH 1O2RA 4R0IA 5A0CA 1FDPA 2ZFRH 1O2LA 4D76A 3ZZ8A 1DM4B 1P8VC 2ZP0H 4D7GA 1TGBA 1LHEH 1O3GA 1OWEA 1YPEH 1TGCA 3FP7E 3SJIA 1FNIA 2ZPSA 4ABBA 3SJ9A 3MU0A 1U6QA 3URCA 4BNRA 5EW2H 3KHVA 2XWBI 5C5NA 5JPMH 1ZSJA 4K2YA 4IBLH 2W26A 3KNXA 3BTEE 2YOLA 1F5RA 3KQBA 3UR9A 1ABJH 3U98H 1GMHF 2CN0H 1DUAA 2FI4E 3A81A 4MNVA 1ESTA 2ZDMA 3GCTG 4B76A 1NN6A 1PYTC 5FAHA 2RDLA 3OSYA 4FUCA 3P17H 2KCYA 1AZ8A 2W7SA 2NU4E 2BD5A 2QXGA 4WJG2 1RIWC 5F8TA 4KTUA 3V13A 1F0TA 4GSOA 1QJ6B 1TGNA 4B6EA 4RSPA 3AK5A 1A0LA 3BEFB 3T29A 1SQOA 1O37A 1A3BH 2G8TA 3ZZCA 3T27A 1MQ6A 4KKDA 1BCUH 1A7SA 3LGVA 1ELDE 3A89A 1FMGA 3RXJA 3K2UA 1UTJA 1VITF 1BDAA 1SGFG 5T3HA 3LPRA 1T8LA 3Q76A 1QJ7B 1QNJA 2G00A 2WZQA 4KTCA 3CS7A 5L6NH 4JZDH 2SFAA 4NGAH 1EP5A 3ZZ3A 2L74A 2TGAA 3L3TA 2J38A 2OQ5A 4CBOA 1NRNH 1ZHPA 1QRWA 3O8BA 3RU4T 3MU1A 2XBWA 1FY8E 4Y8ZA 2FZZA 2FTLE 5A8XA 1ESBA 1V6DA 2PWXA 1GMCG 5E0JA 1FY4A 1FUJA 2VVUA 2Z6BD 3RDZA 1G30B 4ZMAH 4ZAEA 1HAZB 2JJ2D 1JBUH 5F8ZA 5EU8A 2ZHQH 3ZZAA 2K1QA 3E0NB 4YZUA 1ANDA 2ZDLA 2C8WB 3M5LA 4Y71A 5GXPA 4NZQA 1RTLA 1C2GA 1GCTC 2IOTA 2OK5A 1BHXF 1AIXH 2WYJA 2C8YB 2V3HH 3SQHE 3T2NA 3E16B 1K2I1 1GJCB 2Z9JA 1NZQH 4JK6A 3Q00A 3QDZB 4NSVA 2W7UA 2GTBA 1O33A 5HKKD 5EJLA 1S6LA 4X1RU 3VB5A 3SUDA 1GVZA 1EX3A 1GI5A 1WV7H 3U1JB 2BDGA 4I86A 1E37B 2P8OB 1P09A 1CA8B 2J2UA 3GCOA 1C5TA 1NU7B 2Y80A 1O2UA 2ODYB 5GPIB 3SU1A 4Z0KA 3TITA 3RXEA 1W0JD 3ZZ4A 1O2XA 1QRZA 1TPPA 1S83A 4BTTB 2STBE 3JZ1B 1C5UA 3KGPA 5EQRA 1LQDB 3TK6A 3M7UA 3T28A 2PR3A 4RT1A 1GBCA 3A7YA 5CMXH 2VIQA 4X6NA 1AD8H 1QBNA 3RXFA 5FBEA 1GI4A 3RLYH 3KQ5A 1T8NA 1YLNA 5EXMA 2ZGCA 5LGOA 2AIQA 1F0UA 2H9HA 5HIYA 4DVAU 3RU4D 1WTGH 3UPEA 5PTPA 3AW0A 2ZECA 1K22H 1C5OH 3NRLA 3TGIE 3UIRA 3M5MA 4WH8A 3LJOA 5EQSA 1TBRH 5TCAA 3RXRA 3KYFA 5C2ZA 4WWYA 5ESBA 1AVWA 1EZQA 2UWPA 1H8DH 4FUIA 2VWOA 1GDQA 1UVSH 3GY3A 4DIIH 3DD2H 1LQEA 3M5NA 1KXCA 2FX4A 1HBTH 1S5SA 2I6QA 1O34A 4XDEA 3SNCA 2SNWA 1SQAA 2ILNA 1DSUA 2IPHA 4Q80A 3ZVCA 3HK6B 1DPOA 2YMSD 2ZCHP 3RXTA 1UHBA 2OBQA 5FXLA 4ZKSU 4A6LA 1LPKB 1L1NA 4KTSA 2CJIA 2CHAC 3UNQA 1J8AA 1NS3A 1XUHA 2SGDE 3SZEA 1GHAG 2FOFA 4A7IB 4CH2B 3RXQA 1HUTH 4KGAA 2WSSD 4B73A 1J17T 1D3DB 3ZV9A 7LPRA 4BAHB 1C2MA 3PV5A 3SV9A 3KQEA 4AYVB 1K1JA 5B6OA 3F6UH 3T62A 2WUCA 1TMBH 4AB9A 4MQAA 1TGTA 2GVFA 1O5GH 3PLBA 1TQ0B 2AS9A 3N99A 3TJVA 4I8LA 3UNRA 2PGBB 4U30A 2QF5A 3S7KB 5DJ7A 3PTBA 2QYIA 3PROA 1QB9A 2ZQ2A 4Z1MD 2A7HA 5L2ZH 1KDQA 5C94A 1DY8A 1MKXK 1O35A 1O2OA 1OHHD 2XXLA 4ZHMU 4DG4A 1TB6H 2BX4A 2XC0A 3B8JA 1GJAB 3A87A 2SGEE 4IW4E 2VWNA 2AERH 3ZVGA 2V3OH 2OCVB 1Y3WA 1BRUP 1O5CB 2G52A 2EI6A 4Y7BA 4XD7D 5C1XA 3E91A 3O8RA 2GP9B 2HVXA 5HXFA 1FY3A 2XNDD 3EYDA 1A61H 1ORFA 2XCFA 1TYNA 1THPB 2A45B 3DFLA 5DP5A 1PQ8A 5SGAE 3OTJE 1WDIA 4NFFA 5AVDA 1O3KA 2WPMS 1FJSA 1LDTT 1LKBA 1OWJA 3Q77A 4MTBA 4UONA 1ZMNA 2F9OA 3GY8A 1HPGA 3E3TA 1XXDA 4X6MA 2LPRA 3RLWH 3TVJB 2Y82A 2VGCB 3M3VA 4JZFH 2EC9H 2FXRA 1YPMH 1C1WH 1SGCA 1TIOA 1XVMA 1ZPCA 1TNGA 2YNAA 1RGQA 5JB9S 2NU2E 4IN2A 3W1EA 1NFWA 4YM9A 1ELBA 2BQ6B 1ANBA 2ODQA 1A0JA 1GJBB 1O2IA 4AYYB 4TYDA 3SZNA 1C2JA 1G36A 1DFPA 4FETA 1EAWA 1MAYA 1QBVH 1GMCF 1ZMJA 1GGDC 1NFYA 1RD3B 2BVRH 2H6MA 3B9FH 1ARBA 1BIOA 1G37A 3TNSA 1OYQA 1LHFH 5FPSA 1C2FA 1ZRBA 2XBVA 3B23B 1P10A 2UUYA 5JB8S 2FI3E 1NRSH 1AWFH 1LPGB 1ZYOA 2GCTC 3CP7A 1DICA 3S7HB 3Q3YA 4F49A 1BJVA 2FYQA 2Z9KA 1AO5A 2A31A 3M61U 4AB8A 3GICB 2R2MB 4IGDA 2L6OA 2KCPA 1MBMA 1BT7A 1OP8A 5IK2D 3N7EA 2B5TB 4ASUD 2ZFPH 1B0EA 3A84A 4OS6A 3SU0A 1BITA 1UTQA 3L6PA 3SN8A 1PPFE 2WV4A 1P2QA 5C5OA 1AVXA 1ELFA 1DWDH 5EJZA 1C2IA 2VH0A 1BUIA 3SUEA 1F0RA 1T8OA 5JYIA 3RU4E 3BTWE 5EGMA 1VKYA 4ZUHA 1GWAA 1QA0A 3NKKA 2P3FH 1CBWB 2FEQH 1GI8B 3ZZ7A 3NUMA 3KQDA 2P3TB 1K1PA 1O5DH 3H5CB 1E1QD 1C5PA 1HAIH 1ZTJA 5JBCS 4NWKA 1C9TA 2A1DB 2V35A 1GHVH 2KCAA 2KR7A 1O2WA 1OXGA 3FN8A 1MKWK 3LOXA 4FU8A 4FXGH 4H42U 2BD3A 3OYPA 4I8KA 1OWIA 4AOQA 1RFNA 2A0QB 3VB6A 2JDID 3BG4B 3FZZA 3RXMA 1EQ9A 2D2DA 3EAJA 1BRCE 5A09A 1LHDH 1EPTB 1KXFA 4RN6A 2G4TA 4FUBA 5JDUB 1C1MA 1CHGA 2J98B 1P11E 1HAOH 2EY4C 3E8LA 3FO8D 4F48B 2F91A 1DWCH 1L4DA 2FOEA 1IQIA 4AC9A 1A5GH 4U32A 2BY9X 1OPHB 3RP2A 1W0ZU 1AMHA 1C5SA 1EZXC 2IPQX 2Z7FE 3DFJA 5I25A 2C8XB 3RXHA 2BB4A 3SNAA 3TJUA 1RXPA 3SU2A 1BBRH 2AHME 3N7OA 1EZUC 1LHGH 4OGYA 4Y11E 8GCHG 5BPEA 1J9CH 4NA9H 4B6FA 2RFKC 3SYJA 1AGJA 1NC6A 1XUKA 2BDIA 3ZIAD 2XBXA 2LELA 1V2NT 1C5QA 4Y10E 2QXJA 3LT3A 4GLYA 3AVZA 4F4OC 3ELAH 5F53A 1ACBE 2HLCA 3A88A 1SLVB 2ZG0H 3A86A 1C4U2 1UO6A 3S0NA 1NY22 1TNIA 5EG4A 3A85A 3ZVAA 1NROH 2OC1A 2OUAA 2OTVA 2V7QD 1K1LA 3F0PA 2EI7A 3F0OA 3GY4A 1DVAH 3BG8A 4FOUC 4ABHA 1T4VH 1QFKH 3QZQA 1CE5A 5EIYA 2Y6TA 2ZDAH 2BMGB 1OWKA 2Z3DA 3NK8A 5ETXA 1XVOA 4X6PA 3TNTA 3URDA 3V0XA 2ZU3A 4X8SH 4RI0A 2BXUH 2O8MA 2XWAA 2WPIS 1HCGA 2BD9A 4VGCC 9LPRA 2ASUB 2A7CA 2VWLA 3NPSA 1W2KH 2VJ1A 1O2KA 2WPDD 4OGXA 6CHAC 2KZ4A 3BTTE 3BTME 4AG1A 1C5LH 2AGEX 4FUDA 4HFPB 2GT7A 4KELA 2VWMA 1GHZA 2Y81A 1SLUB 3QN7A 1CQQA 2C8ZB 1TQ7B 3MOCA 2H5DA 4WMDA 2GV7A 2VNTA 4BAQB 2QXIA 4K1SA 4TT3D 3SV8A 1P12E 1D3TB 1SBWA 4M9FA 3OFND 1GDNA 3MO6A 2G51A 3QX5H 1JXPA 1SHHB 1O3FA 2PKSB 4YOGA 1O3AA 4WMEA 1OOKB 2P3UB 1DLKB 4ABIA 3CS0A 1S81A 5A8ZA 3EQ0H 3ZVDA 1V3XA 1XUFA 3RXSA 3PLPA 3BEIB 1YF4A 3MYWA 1P3EA 2IJOB 1JIRA 3BTHE 2LP6A 4WXIA 4NG9H 2C3SA 4YT7H 3MWIU 4UD9H 1F7ZA 1TPAE 1MUEB 2ZC9H 1QR3E 1Y59T 3WWBA 4DY7B 4NIXA 3PMAB 3RMLH 2ZQ1A 5HM9A 2DE9A 1UJ1A 3STJA 1KIGH 1Y5BT 1PJPA 4MG3A 1BHXB 3QWCH 4IMQA 1ZPZA 3RXBA 1CGHA 3T25A 1QA7A 1MD7A 3HKIB 2BD2A 4ISNA 1O2VA 2KCOA 5DSFA 4E7NA 3HGPA 1MZDA 3TLOA 4JYTA 5CHAC 1ETSH 3GCHC 1C5ZB 1L0ZA 2FS8A 4E06H 5A0BA 1O2JA 1EXFA 1BOQA 1SQRA 2CK3D 3HK3B 1M9UA 2C90B 1C2LA 1MTWA 3SUFA 1LKAA 1DX5M 1FAKH 2FIRH 1MTNC 4GUXA 3TJOA 1O0DH 4CRCA 2FS9A 2ALVA 3CNRA 2FYRA 2Z94A 1V2MT 1DITH 1SGQE 1W8BH 4FUEA 1O3CA 1P2OA 4HI3A 4QT8C 2A2XH 3A8BA 4H6TA 1ZMLA 1DY9A 2A7JA 2UWOA 1BTZA 4OM9A 1G2MA 5F6MA 3I78A 3PMBB 3E6PH 1PQAA 4MNYA 3RXKA 5F8XA 1E35B 1W7GH 1NTPA 1P3CA 1TNLA 2PW8H 2JH5D 3M35A 4X1QU 1YGCH 1AKSB 2KAIB 2ZU4A 1L1GA 2HNTF 2FLBH 5C0TA 5DP9A 3A8AA 2PSYA 1AFQB 3FP8E 1P04A 4K1TA 3A7XA 1ELEE 2BDCA 1EP6A 1HYLA 4ABAA 2FOCA 5HIZA 1QB6A 2FOHA 5TCCA 1GI3A 3UUZA 1LHCH 1PPZA 1AUJA 1MTUA 2F9NA 5EQQA 3SI4H 1O5FH 2BD8A 3FFGA 3Q3XA 1GG6B 2ESTE 3KN2A 2QF3A 5T6DA 3SJ8A 4CHAC 1YPKH 2VU8E 1G3BA 1NPMA 3H09A 2HNTC 5LPRA 2KX4A 1P2JA 5HM2A 1DLEA 2A4QA 5A2MH 1GVLA 3RC4A 1H4WA 3PB1E 3UR6A 2BOKA 1O30A 2G81E 1RS0A 4TPYA 3BTDE 3MI4A 2QF4A 1C2KA 2IJD1 8GCHF 5I46H 1C1QA 5IDKA 2FLRH 2QIQA 1OKXA 1SOTA 4ABFA 1GBLA 5ESTE 1T32A 3PM3A 1BTYA 1V2UT 3OTPA 3BIUH 4A5TS 2XOKD 2BLOA 2ULLA 3DHKH 1TNKA 2QCYA 2H2ZA 3FZDA 4O97A 1EKBB 2AGIX 1KXBA 1J16A 2PUQH 1BMLA 1PYTD 5JBTA 1SKYE 1IQEA 1N6XA 2C93B 2VIOA 4A1VA 2Z3EA 1UCYK 1MH0A 2Q1JA 1VJ9U 1KYNA 2AMDA 1FAXA 2TGTA 5FCKA 1GBTA 1JMOH 1TBZH 1IHSH 2ZIQH 1XUJA 1UCYE 4MPVA 2NU0E 3NXPA 3LC3A
chains in the Genus database with same CATH topology
4Y7AA 1EOLA 4TWWA 2TPIZ 3UREA 4LZ4B 1K21H 2ANKH 3TH4H 2BTCE 4MLFB 5EPYA 2FOAA 1Y5AT 3ZZ6A 2ZFQH 3STIA 2R3YA 3VEQB 2QC2A 1H8ED 1O36A 3LJJA 3QK1A 3D49H 1XUGA 1TONA 1QQUA 1ETRH 1DXPA 3RUOA 4ABGA 2I6SA 2GKVE 1NRQH 3LDXH 1TX6A 1B0FA 2EI8A 5JBAS 2D1JA 1W13U 2FM2A 3MTYA 1BQYA 5DP8A 1YP9A 4AX9H 2W3KA 4Q7YA 5E2PA 1V2JT 2JH0D 1CT4E 1INCA 3SV2H 1YPHC 2P16A 3RM2H 2Y7XA 3ATWA 1EUFA 1MTSA 2ZTZA 4LXBH 2GMTC 1CA0C 3SI3H 4IMZA 5AHGH 3MFJA 2VBCA 2Q6GA 3OU0A 1CSOE 1ZR0A 3GY2A 1ZZZA 1PQ7A 1TALA 5C1YA 1VCWA 5GIBA 1BMMH 3HPTB 2NU1E 1K28D 1ELCA 2CMYA 1O2ZA 4NA8A 3MU4A 3F1SB 2SGPE 1Q2WA 3F9FA 3RXAA 2ZGXH 3S9CA 1MZAA 1P9UA 3BEUA 3C27B 3LONA 3ESTA 1IOEA 1GHYH 3QUMP 2AFQB 3SO3A 3VGCB 1GDUA 1QL9A 5FCRA 3SNDA 1AZZA 3ZVBA 1UVTH 2RA3A 4BANB 2WV5A 1IQJA 1ZJDA 3AW1A 5LPFA 1T31A 4Y6DA 3MU8A 3MNXA 3P6ZB 3QZRA 1PPHE 1BZXE 3RM0H 3TK5A 1KTTB 2J92A 4BAKB 4X2WA 1C1PA 1TAWA 2ZNKH 1ELAA 4E7RG 1G9IE 4INKA 3PRDA 4ISIH 5IYTA 1E38B 4MPWA 1N8OB 5LH8A 1G32B 1UTKA 2STAE 2ZU1A 4E05H 2QY0B 7GCHG 1QURH 1K1MA 2BDYA 3DSOA 2ZU2A 2GZ9A 4B74A 4MVNA 1OP0A 5FPYA 1VCQA 2NWNA 3PWCA 1YLCA 3EGKH 1AI8H 1SGPE 3FKSD 1BMNH 1DUEA 1BTWA 3ZVFA 2F43B 1QB1A 1VGCC 1NM6A 1XKBC 1DDJA 3HGNA 3SV6A 3ATMA 2QE7D 3BF6H 1ZRKA 4Q7ZA 1PQ5A 4FVBA 5TJXA 3GCNA 2GDEH 2R0KA 4D9QA 3KL6A 4JK5A 4AN7A 3QO6A 1HGTH 2O8TA 1O3BA 1Y3VA 1GL1A 1GHXH 2KFWA 4BXWA 2HOBA 1NO9H 1TMTH 2BVSH 5FBIA 1DT2A 5BRRE 1NU9A 3EA7A 3SU3A 3TK9A 1ABIH 4THNH 1BTHH 1GBEA 2K0QA 2PSXA 1ZSKA 1XMNB 1LO6A 4B71A 1ANCA 3IWMA 1ANEA 1ZGVA 4BTUB 3I77A 2WPHS 4GHTA 1UK4A 3MNBA 3GDUA 2ZCLP 1XXFA 2FOBA 3TPIZ 1BB0B 4B2BA 2FODA 1GBIA 1XKAC 2Y5FA 3D65E 1IQLA 1EAUA 1D6WA 1MKXH 4HZHA 2JETB 1DE7H 2ZDNA 1HAPH 1C1VH 1NRRH 3MO9A 3VPKA 2FO9A 1GI1A 2PTNA 4X6OA 3S9BA 1A2CH 1TPOA 5GWZA 4VGCB 1VCPA 3ZV8A 1C5VA 2H9EH 1EASA 1GI0A 2AYWA 1FIZA 4TPIZ 1EPTA 1WAYB 6CHAB 3HATH 1LMWB 5EXLA 5E0GA 3MNSA 1L4ZA 1D9IA 2D8WA 3UFAA 2CV3A 1L1JA 2VIVA 1KLIH 4Y76A 1HJAB 2ZGHA 1BTUA 5FPTA 3PO1B 2ZTXA 3ODFA 3FP6E 1E36B 1S0RA 4O9VA 4Q7XA 1YPGH 3M36A 2M5TA 3BTKE 2J94A 4HGCA 2XTTB 4OS4A 3QTOH 3VG8A 2B8OH 1CGIE 1EZSC 2J34A 1F2SE 3M7TA 1O2SA 1SR5C 2BVXH 4LK4A 1Q3XA 3SNBA 5L2YH 3FOAA 3P8OA 1VITH 4PROA 4ABEA 1TNHA 1S82A 1TPSA 2Z9IA 1P2MA 4YT6H 2ZPRA 1GHWH 2P8OC 4X8UH 3MH4A 5GDSH 2XYAA 3LH1A 4Q63A 4WXVA 2VH6A 3GCHB 3GISB 3M37A 1UTLM 2VVCA 1XM1A 1AHTH 2ZDKA 5DP6A 1GCDA 1O3NA 2SGFE 1MTNB 2VVVA 1SSXA 1GBJA 1K9OE 3M5OA 4X1PU 1XX9A 1ZHRA 4ZROA 5F03A 1AB9B 2TRMA 3GDVA 1JRTA 3VFEA 5C0UA 1C5MD 1MU6B 5HMAA 4UFGH 3F2GA 3GYLB 1CO7E 5FHTA 4AGKA 3DSPA 1Z7KA 4WH6A 1K1NA 2FDAA 3GDSA 1C5WB 3BTQE 1GJ9B 1DWBH 1YKTA 1O3MA 4CBNA 4X1NU 1MKWH 1P2NA 3IG6B 2XC4A 4BTIB 2M2AA 3RXIA 1Z6JH 4I31A 3U9AH 4ZXYH 2H5CA 4WY3A 2ZI2H 2GZ8A 1GMDG 4HTCH 7GCHF 3K65B 1PPGE 1K1OA 1WXRA 3O8CA 1C5RA 5K7RA 2PLXA 1FZZA 1P06A 1ZLRA 2JH6D 4YLUA 5C3NA 1SGYE 3KF2A 1MBQA 3VB4A 5CHBA 1C2EA 2G5NA 2V0BA 1KY9A 1SVPA 1ZJKA 4DIHH 1GL0E 1O5BB 1RIWB 1WQSA 1SGIB 3EDXB 3LH3A 1C1TA 1IQKA 2D26C 3OEHD 1G3DA 2PKAB 1BRAA 3PV4A 1OWDA 1IQGA 4TSFD 5J4QA 5EW1H 2B0FA 1MMJN 2Y7ZA 4UE7H 2BM2A 1HJ8A 2BYAX 5CE1A 1GJDB 1L2EA 2FOGA 2ZHFH 2WPJS 1FQ3A 1BMFD 1E79D 2HPPH 4GHQA 2FX6A 9ESTA 1ELGA 4X2XA 4M7GA 3RC5A 1TA6A 3MH5A 4YLQH 3PWBA 3SHCH 1HXFH 5E0HA 1LPZB 3MH6A 6ESTA 4JZ1A 1QIXB 1EFRD 3RXVA 1V2ST 1IQHA 2WV9A 3F9EA 1C1SA 3UNSA 1SGRE 4OS1A 1AU8A 1HIAB 2ZDVH 2QGRA 1GBBA 2ZZUH 3KEEA 4MNXA 3SHAH 1D3QB 3FVFB 2DUCA 1AKSA 1O2HA 2A2QH 2KAIA 4A92A 4KP0A 1HNEE 1LCYA 3SJKA 2QA9E 3ZZ5A 2QV1A 2GGVB 1KXEA 2YNBA 1MAXA 1QL7A 3L33A 4FUHA 3SV7A 2VGCC 3OAAD 3R0FA 4NZLA 4TWYA 2BD4A 1AY6H 4X2YA 1GCTB 1C5YB 6GCHG 2W5EA 1ELTA 3EA9A 4BXSA 2PV9B 1IQFA 3F9HA 3AAVA 4ISHH 4MPXA 1WUNH 4IC5A 1TOCB 2F9BH 1GBAA 2XBYA 4DURA 1BMAA 1C1UH 2OD3B 2OINA 5A0AE 2FMJA 3AAUA 1Z71A 4BOHA 1HAVB 2Q6DA 4RKOB 3UOPA 2H1UA 1SB1H 2B9LA 1O3OA 2ZFTA 3I29A 3LIWA 1TWXB 1ZSLA 1EB2A 3UY9A 4UFEH 1WTHD 4NWLA 1QGFA 2JJ1D 1OSSA 5DP4A 1E1RD 4AFQA 2JIZD 1ZTLA 1QCPA 2CGAA 1ZOMA 1THSH 2G5VA 1AVGH 1GBFA 2PFEA 4CREA 1O5EH 2HALA 4ZXXH 1T7CA 2BXTH 1GJ8B 1GJ4H 2ZHEH 5EXNA 1KXAA 3ZVEA 1TABE 1T8MA 1HLTH 1UTPA 1V2KT 2GD4B 4DT7B 5T1VA 4XBDA 2FOMB 1ZPBA 1JWTA 5E2OA 1GJ6A 1JRSA 1UK3A 1HV7A 2K8IA 1QTFA 5EODA 2FP7B 1P03A 2Z9GA 3FAOA 2BLVA 1CBWC 3RXOA 1FXYA 1SPJA 3PMJA 1HAXB 3LU9B 2V6NA 4B2AA 3SGQE 2W3IA 1RJXB 3NWUA 4R8TB 1GI7B 3BG4C 2P94A 4JCNA 1O3EA 1GI6A 3V3MA 1B7XB 1IQNA 4NFEA 1VGCB 1P0SH 1SGFA 2CHAB 1EPTC 1UVOA 1OP2A 1O2PA 3A7TA 3LGIA 3GS9A 1KMHB 2ANWA 2BZ6H 1NT1A 4NA7A 4ZH8A 4DCDA 1YLDA 3S9AA 1TA2A 2G55A 3UWIA 5DKMA 8KME2 4UFFH 1O2GH 1OS8A 2A5IA 2J4IA 1WSSH 5AFZH 1S6FA 2RA0A 4IS5A 3MH7A 1GMDF 4Q2KA 3WWFA 3KQCA 2PUXB 2VIDA 3TH3H 1IHTH 3P92A 4ISOA 1WOFA 5GCHG 2A32A 2CF9H 2GCHG 3P8NA 4K69A 4O03A 5DG6A 4U2WA 4AFSA 2GZ7A 4K8BA 1UTMA 4Y0YE 3ZZ9A 3P8FA 3BV9B 1A3EH 3PYHA 1W0YH 4UDWH 4Y8XA 4D7FA 1H1BA 1NESE 2UUKB 1GVKB 1Q31A 1P9SA 1KSNA 1ZHMA 4UFDH 3SU5A 4Q4LA 5DO4H 1HAHH 5C1UA 2ANYA 1SL3A 5E8EH 1G3EA 4B75A 3GY7A 1Y5UT 4GAWA 3GOVB 1E34B 1TGSZ 2HPQH 1WU1A 4OS7A 2ODPA 2GT8A 1SLWB 8ESTE 3P8GA 1UCYH 1G2LA 1AWHB 2QXHA 1D4PB 1LTOA 2TBSA 1FV9A 1C9PA 4WMFA 4FUJA 4Y8YA 2BOHB 3A7VA 3K6ZA 2VB0A 2ANMH 4ESTE 3VXFH 5HGGA 1UMAH 3ENSB 4LOYH 1ZGIA 4WVPE 3U8OH 2Z9LA 3T26A 1SI5H 4I8HA 1A4WH 1UVUH 1EAIA 2OC8A 1D6RA 1EB1H 1SGTA 3GYMA 1NBMD 3KCGH 1H9IE 1GGDB 2A5KA 5GNDA 5C17A 1XUIA 1KXDA 1PFXC 4AG2A 3ATIA 1H8HD 2F83A 1CT2E 1OX1A 2OP9A 2UUJB 3P70B 4FVDA 1UTOA 3HKJB 3FANA 1YPJH 2PKSC 4IN1A 3R3GB 1GI9B 1V2VT 2GX4A 3SBKA 1FPCH 1H9HE 4IC6A 2GCTB 4X1SU 5B6LA 5G4BA 3TJNA 1FLEE 6GCHF 1UK2A 3RXCA 3RXGA 1YCPM 3E90B 5DP7A 2OQUA 2BY7X 4INHA 4K5ZA 1ELVA 1LVYA 1TOMH 2THFB 1KLJH 2P93A 4ISLA 3H7TA 1SGNE 2A5AA 2CF8H 2GDDA 5FL7D 2BDAA 3OE7D 1O31A 1O2MA 2ZO3H 4X8VH 3U69H 1Z8IB 5K0HA 1WQVH 4JYVH 3S69A 3P95A 4AZ2B 2WUBA 3QGNB 4XOJA 3OEED 3AASA 4ZHAA 2ZCKP 2YMSC 2BY5X 3UTUH 1O3HA 1GBHA 2P95A 3D62A 1DSTA 1BTXA 7ESTE 4JYUH 5EOKA 3SJOA 1WBGB 1DANH 3UQOA 3TIUA 3DT0H 4NIYA 1MABB 3ZYEA 3F2HA 4GVUA 1QJ1B 1C4Y2 1QY6A 3F3BA 2R3UA 4DW2U 3OX7U 3V12A 1J14A 2W6JD 1RRKA 1O2NA 1N1LA 2OBOA 2RG3A 3EE0B 3RXUA 1H8IH 4GCHF 3SGAE 3V7TA 4LZ1H 2A4GA 4CRAA 3E1XB 4XE4A 1GJ5H 1YCPK 2JKHA 1EAXA 3VXEH 1THRH 1HAYB 2NU3E 1AFQC 2OLGA 4SGAE 1C1NA 5HYOA 4ABDA 4YOJA 2PHBA 1W12U 3RXDA 3U8RH 4FU7A 2ZTYA 1SLXB 5A8YA 3A80A 1SFQB 2AMPA 2R2WU 1HXEH 1A0HB 3U1IB 3M7QA 2XNIA 1YCPH 1C2DA 1Z1JA 1W11U 1BRBE 1GG6C 3PMHB 2P59A 1O38A 2R0LA 5AFYH 1CT0E 2FESH 1FIWA 1C5XB 2ZGJA 2J95A 1IQMA 4XFQA 1P2KA 2DE8A 3H7OA 4I7YH 1O2YA 2A4OA 2BD7A 4FUGA 3RC6A 1BTPA 2KM0A 4YXWD 4DT4A 2G4UA 3BTGE 3OY6U 3TGJE 2TIOA 1CHOG 3NCLA 1DWEH 2XW9A 4X8TH 4SGBE 1TX7A 1SQTA 1CGJE 2HNTE 1NRPH 1CU1A 2FWWA 3SUGA 4AFZA 3MU5A 4J2YB 3D23A 3DA9B 4CRGA 3GCTF 1TX8A 3M3SA 5GCHF 1AN1E 2OXSA 2GCHF 1S84A 1SMFE 1LVBA 1DOJA 1FY1A 4RKJB 1P57B 3BN9A 2Q6FA 4GPGA 2ZPQA 4K8YA 2BDBA 1ZTKA 3KIDU 4ASHA 1TE0A 3SOSA 4D9RA 1F5KU 4ZHLU 1V2RT 1BJUA 1EOJA 3RMOH 1LVOA 2ZWLH 1W0KD 4MDSA 3TGKE 3F2FA 4FUFA 1Y3UA 4CRBA 3UQVA 4UEHH 2Z3CA 4J1YA 2TGDA 5DPAA 2F4LA 1C1OA 1W3CA 1TRNA 4YESB 4XSKU 3UOUA 3U8TH 2BDHA 2BHGA 2AIPA 5T6GA 1V2TT 1Z1IA 1SFIA 1NBME 5AF9H 3OY5U 5J4SA 3E0PB 1T4UH 2BLQA 3M3TA 1H9LB 1OYTH 1VJAU 4MNWA 1AE8H 1QQ4A 4TY7A 3SW2B 1UHBB 4BAOB 4XBCA 1A5IA 1FX0B 1O3IA 2QN5T 1AFEH 2OC7A 1UVPA 3GY6A 1F92A 3EA8A 1Z6EA 1GBDA 4K3JA 1GHBG 2H9TH 4YOIA 2PKAA 1FI8A 3T5FH 4YTAA 3QLPH 3C1KA 3NZIA 4NSYA 1B5GH 4AFUA 3SU6A 1YYY1 1IAUA 2QF0A 4I32A 6LPRA 3K6YA 3PLKA 1W7XH 1Z8RA 1Y3XA 1O3LA 5DGJA 4CR5A 3ZZDA 1W14U 2F3CE 5CHAB 1YPHE 2W6ID 3Q3KA 4H6SB 1AQ7A 2O8UA 1F5LA 1ESAA 3VGCC 1VZQH 2SGAA 3LC5A 3SGBE 1COWD 3LGYA 1KDQB 4JZIA 1P2IA 4I33A 2SNVA 1TMUH 2O9QA 1NFUA 1HIAA 4OS5A 1X7AC 3A7ZA 5H4IB 5DN6D 3QGJA 1RTFB 1SGDE 3MO3A 2AEIH 3DCLA 1O3PB 2WPKS 2ZF0H 3PRBA 3VB7A 3BIVH 4NIVA 1GJ7B 5DP3A 1EATA 2HRVA