3SNAA

Crystal structure of sars coronavirus main protease complexed with ac-nsfsq-h (soaking)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
total genus 74
structure length 301
sequence length 301
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3snaA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3snaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3snaA02
2W3IA 5FPYA 2Y5FA 3M35A 1D3TB 1SGNE 3P8NA 3CP7A 5GDSH 1GCDA 2ZU5A 2JKHA 1XX9A 2B5TB 2WYJA 2FI3E 1MKXK 2OQUA 2C3SA 1EB2A 4IC5A 3TK5A 3I78A 2ZHEH 3T27A 1TGBA 4IS5A 1BT7A 3EAJA 4H6TA 3M36A 3SHAH 4YTAA 2WUBA 1UTLM 1V2KT 2GZ9A 5E0JA 3SV9A 5HM9A 4SGAE 1TONA 1TX7A 2BD2A 5DGJA 1ARCA 3E0PB 1RD3B 1QGFA 2OC7A 1Z6EA 3MI4A 4MNWA 3SJKA 2F9OA 2G00A 1QURH 1GMCG 2P95A 1G37A 3TNTA 2Z6BD 1G3DA 1QRXA 4IMQA 1FY4A 2ZU4A 1ZPCA 2G52A 2AGIX 1CBWC 4FUCA 1UVPA 1Y59T 1YPHC 3ZVGA 4AFZA 2FI4E 2BD5A 4X2XA 3T2NA 1ABJH 1S6FA 1WAYB 4YZUA 4YO9A 1BMLA 1G2LA 1O2OA 4AG1A 3A88A 4X0WU 5PTPA 4ISHH 1LCYA 3BEFB 3GDSA 1YLDA 4DCDA 1JRTA 1HJAB 4MG3A 2QYIA 2ZDLA 2J94A 1GHAG 2NU0E 1P04A 1V2RT 1TPPA 3PWCA 1GL0E 2DUCA 3BEUA 4WXVA 1F92A 1MKWH 1C2JA 4ESTE 1ELTA 2XXLA 1BIOA 3R3GB 4X2YA 5LGOA 3SGBE 1ZPZA 1FJSA 4GSOA 1EOJA 3GICB 1LQDB 3DT0H 1KLJH 1OPHB 3LONA 1GJDB 1P2MA 4JK6A 5F8ZA 1MAYA 4ABIA 2CF8H 3SN8A 2FOGA 1GI0A 3RC6A 1SHHB 3QX5H 2P94A 1O3AA 1YPEH 1BTUA 3KQBA 3SZNA 2VWNA 1O2HA 3SUDA 1J8AA 1SL3A 4B2BA 3E90B 5C5NA 4MPVA 1O2XA 3MO9A 4LK4A 3OX7U 1Z1IA 2GCHG 2RA0A 5FXLA 1A0JA 1EQ9A 1AUTC 4OS6A 1QB9A 1KTSB 5HXFA 2O8TA 2WPHS 2GT8A 1GJ4H 1AFQB 4X6PA 1VJ9U 3M61U 1C1RA 4X1NU 1EPTC 1DWEH 2EI6A 2QA9E 4O97A 2FO9A 4NZQA 1LPGB 1ZSLA 2VWLA 1GBIA 1UTOA 4NA9H 3SW2B 1TMTH 3A82A 1P3CA 2FLBH 1BRAA 3A83A 1Y3YA 2OBOA 4FUJA 1IHTH 3SU0A 1BQYA 2A45B 4D9QA 3RXRA 5CE1A 5FPTA 2Z94A 1KXEA 3A7XA 3PO1C 2BXTH 5H4IB 2H1UA 1ANDA 1QJ6B 4J1YA 1S82A 3V12A 1DS2E 1GBAA 4WWYA 2G51A 5E0HA 5FPSA 6GCHG 3E8LA 1LVYA 2BVSH 4UD9H 1ZMNA 2EEKA 5A0AE 4U2WA 1C5SA 2H6MA 1KY9A 3URDA 1OSSA 4JZDH 2I6SA 1QA0A 5EQRA 1O2JA 2FDAA 2FS9A 2GZ8A 1O34A 4GHTA 2BMGB 4TWYA 2ZIQH 5JDUB 1ELGA 3TH2H 3A7YA 2Z9GA 2SGPE 5AVDA 2FOCA 1FV9A 1Q2WA 1GHZA 2ZQ2A 1RTKA 1O36A 1W2KH 5T6FA 3E1XB 2C8YB 1MZDA 1DT2A 2R2WU 1JRSA 2OC0A 2BDBA 4BNRA 1RGQA 4YLUA 1CVWH 1Z1JA 2ZPQA 1RS0A 4Y7BA 3JZ1B 2EI8A 2TGPZ 2FP7B 1GHYH 4AB8A 1OWHA 5EPYA 3Q3KA 2XC5A 3BTTE 1A3EH 3A85A 3LC3A 3SV8A 2STBE 1K1LA 1Y3WA 4WF8A 4WJG2 4DURA 1ZLRA 1O39A 2BVRH 1C5WB 3MO6A 1FUJA 2AGEX 1C5TA 2Y7ZA 1KIGH 4AYYB 3SOSA 4LZ4B 3T5FH 3PMHB 2J92A 1YPLH 1TFXA 2BLOA 4AB9A 2FYRA 4IW4E 4AGJA 4CRDA 1KTTB 3SNAA 3U1JB 1TA6A 1LDTT 2J4IA 3PM3A 4X1PU 2JH0D 4OS2A 1GHVH 4K69A 4Q7XA 1AVGH 2WPLS 3RXJA 1LVBA 3SU3A 5C1UA 5I46H 2CJIA 2RA3A 1V2WT 4THNH 4E7RG 3UTUH 5L2YH 1GMDG 3TH3H 1TGSZ 2F9UA 3MU5A 2PSXA 4AFSA 1ESBA 1SQOA 5C2ZA 1GI8B 1C4U2 4MNVA 2BM2A 2G5NA 2UUFB 2LNCA 1EZUC 2BZAA 4CR9A 1G3BA 2VU8E 3IG6B 3QZQA 3RXMA 4DIHH 1V6DA 4CH2B 1KLTA 1RXPA 4X6MA 4I8HA 1C2FA 1B0FA 3F9HA 1KDQB 3ZZ5A 3I29A 3ESTA 2W7UA 3OTJE 3GY7A 1J9CH 1DX5M 3QLPH 1BRUP 4A1XA 1V2ST 1F5KU 3EBNA 4B2CA 4AG2A 2GX4A 2CGAA 1UTQA 1NN6A 3L3TA 1HAIH 9LPRA 1FAXA 1T8MA 2B9LA 1ACBE 2QF0A 1Z8GA 2GGVB 4IN2A 5E2OA 5GCHF 1P02A 2O8MA 2Y82A 3PROA 4MLFB 4UFDH 1GBMA 5FCRA 3RMLH 4X8VH 2A7HA 2TRMA 1C5XB 3BTEE 1ANEA 1PQAA 1SQAA 5ETXA 1O2GH 4LZ1H 1MU6B 1GHAF 3RC5A 4AORA 3KEEA 1MUEB 2A5KA 5DKMA 1HCGA 2HVXA 2XYAA 2IPHA 1F0UA 4ZAEA 1GL1A 3SUGA 4U30A 3M3TA 1QHRB 1VITF 4I8KA 1O3BA 2ZU1A 1UVOA 3TPIZ 1TPOA 1NRNH 1MQ6A 2FWWA 1KLIH 4AYVB 1PPFE 1N8OC 2ZEBA 3ZZ7A 1P9UA 3CENA 1OWDA 2ZGBH 5EW1H 1CU1A 4IMZA 4O03A 2SNVA 3UNSA 1YP9A 3SV7A 2KAIA 1W12U 4XBCA 1E35B 1GBJA 4ASHA 5L30H 1ZJKA 2W3KA 1O33A 1PPBH 1QRZA 3SUEA 4Y76A 3ATWA 1O2LA 1OYQA 4ZXYH 5LPFA 2FOBA 2PLXA 3BTQE 3S7HB 4NGAH 2YNBA 3ATKA 2BDHA 4ZKOU 1Y5UT 2GDEH 1ZR0A 2A5IA 2JETC 2SGAA 1BBRE 2BHGA 2ZZUH 3TNSA 2SGEE 5EU8A 1XUGA 3RM0H 2BY5X 1O32A 1YC0A 1GJ5H 1XUKA 4H42U 5C5OA 1DSUA 2SGQE 3KQCA 4Y10E 1SBWA 5DO4H 2A32A 5T3HA 3TITA 3STJA 1GVZA 1Y8TA 1ID5H 5FCKA 1GMHG 2B8OH 2XWBI 3PMAB 5E2PA 3SU5A 2VWOA 2FEQH 1HJ8A 5SGAE 1XUJA 1MTWA 2BQWB 2ZFRH 1E34B 4WMFA 1FLEE 3SI3H 3URCA 6LPRA 2BVXH 5EQQA 1IQLA 2GMTB 2VIVA 6GCHF 1LHEH 1CT4E 5ABWA 2PV9B 3KIDU 1HFDA 3S7KB 1AO5A 1EZQA 1GBFA 1MAXA 3K2UA 3AVZA 1AGJA 1AE5A 1MKWK 1SOZA 3D49H 3NZIA 1F0RA 3SGQE 2H9EH 2ZFSA 2ZTZA 5HM2A 3R0FA 2G55A 1IQGA 1KSNA 4ZROA 1UHBA 4KP0A 4X1RU 3BG4B 1SGYE 4K3JA 2FMJA 3OY6U 3TJNA 1AWHB 5F8XA 1TA2A 2ALPA 4ZH8A 1BJUA 1LHGH 1YCPH 4LXBH 1O2ZA 3P8OA 5G4BA 1C5QA 1HYLA 1M9UA 1AQ7A 2VB0A 1E0FD 1PQ5A 2AEIH 3FZZA 1DWBH 1C2LA 1FN8A 3M7TA 1AMHA 1LMWB 1HAXB 1EZXC 5DG6A 1O2YA 1ELVA 4O3TA 1V2NT 1GDUA 4CRCA 3O8CA 4FUEA 3PTNA 3VB3A 1O5CB 1T8LA 4YM9A 2ANMH 3A7TA 3U8TH 3VGCB 1O2IA 3M7UA 1Z7KA 1SGDE 1ELCA 1T7CA 1G30B 3RXUA 1TB6H 3RLYH 3ELAH 2AS9A 3FP8E 4JYVH 2AERH 1YYY1 2R2MB 2SGFE 1C9PA 2O8WA 1GBKA 3BTHE 2CN0H 1LPZB 2A2XH 2EC9H 1OYTH 3SUFA 1EAXA 3TK6A 1TQ7B 5CHAC 3FVFB 1DOJA 3VPKA 3RXDA 1GJ6A 5C67A 1UTKA 5F03A 3PLBA 1INCA 1O3EA 1SGFA 3BTDE 5ESBA 3UWJH 2UWOA 1A1RA 2Y6TA 3PLPA 3D23A 1ZHRA 1GMDF 3RM2H 4TWWA 3SO3A 1QFKH 1NU9A 5HYOA 3DUXH 1P2OA 1K1OA 1WTHD 1C2KA 4K1EA 1LO6A 4YOGA 1TYNA 1A2CH 4AGKA 1T8NA 3FANA 1YPJH 3HK3B 1O5AB 3MU0A 5AHGH 4ZHMU 2ZDKA 3DA9B 1WSSH 1WQSA 2WPMS 2WV4A 6CHAB 1T32A 1TGTA 3B23B 1OP8A 1A5GH 1TNLA 2CXVA 4Y7AA 3O8RA 3A8CA 1CO7E 2GV6A 1U6QA 1P9SA 2QY0B 4KKDA 1GI5A 2FX6A 2TGDA 1AI8H 3C1KA 1G2MA 2TBSA 1CHOG 1EB1H 1SGCA 4X6NA 3P8FA 1CE5A 2BDAA 1BTPA 1C2HA 1ORFA 2QC2A 4QT8C 1QBNA 3RC4A 1P06A 1C1PA 5JPMH 3VFEA 4A1TA 1TBZH 2WPIS 1W10U 3V0XA 1MTUA 2GVFA 3E3TA 4XBDA 3PV4A 4O9VA 3ZZ9A 1NFWA 1AN1E 1YF4A 1O2MA 2Z3CA 4CHAC 4D76A 2PR3A 1VCQA 5LPEA 2VGCB 3EQ0H 4AZ2B 1P8VC 5A0BA 3MH6A 3MU4A 3P92A 4FU9A 3N7OA 3MH4A 1BDAA 3U9AH 4ISNA 2GT7A 4INLA 3P6ZB 5TJXA 3OY5U 4E06H 3ZVCA 4NG9H 9ESTA 1O3KA 1TNJA 4D8NA 1C2MA 1OOKB 3L6PA 4Y8XA 1GVLA 1SQTA 2BD8A 1TPAE 1HAVA 1C5PA 2RG3A 1GBDA 4YESB 3ZVBA 2OC1A 4UFFH 1ZMJA 4Y8ZA 2HOBA 1H8IH 5DP3A 4YT7H 1Z71A 3FP7E 4MTBA 4WY3A 1C2IA 1FXYA 4XOJA 3DFJA 3ITIA 2VINA 2F9NA 1FIWA 1O3GA 5GWZA 2FI5E 1CT2E 1EASA 1PQ7A 3RP2A 4TPIZ 1THPB 2ZDAH 1C2GA 3BTME 1DPOA 3TK9A 1AB9C 2WINI 4JYUH 2O8LA 3GYMA 3VXEH 3MNBA 1Z6JH 3RMMH 2PHBA 3RXIA 2IN2A 1TIOA 2A4GA 1L4DA 4TY6A 3Q3XA 2G4TA 1QL7A 1DM4B 1V2TT 1O5EH 3Q77A 2CHAC 2PGBB 3ZZ8A 1QBOA 4I33A 3TGKE 4UDWH 1GI7B 2ODYB 3RMNH 4ABDA 1V2PT 1FY1A 1ZSJA 2Y81A 3BSQA 3A8BA 1ELDE 2XW9A 3V13A 3AW0A 2QCYA 2ZCLP 1TNKA 4K1SA 1UMAH 4ZHAA 3SU1A 2PGQB 1ABIH 3ZV9A 3BTFE 3TLOA 2VIDA 3PYHA 1BRBE 2GP9B 1AY6H 4UFEH 2P3TB 1XUHA 1C4V2 3FFGA 2D2DA 2XRCA 3LGWA 5FAHA 2ZCKP 4FUGA 2WUCA 1SGTA 2O9QA 4UONA 2F9BH 2KAIB 3FP6E 1SLUB 3AAVA 1OS8A 3V3MA 2O8UA 1GDQA 1NROH 3QO6A 3SU4A 2STAE 4I8GA 2HGTH 2Y80A 4JZ1A 1XUIA 2AGGX 3QWCH 1IOEA 1OKXA 5IYTA 3VB5A 1HAPH 2HNTF 2TGTA 1DLEA 4PROA 3MHWU 2VIOA 5J4SA 4MPUA 1OXGA 5J4QA 3NXPA 2R9PA 5JBAS 2BY8X 1O3DA 1WOFA 1D4PB 2VVCA 3P70B 5IDKA 2M5TA 2OD3B 4KTSA 1AKSB 1O2RA 1O3HA 1RRKA 1C1UH 4FUFA 1YCPM 4DY7B 1TNGA 4HGCA 3LOXA 1MCTA 1EPTA 1IQFA 2C8WB 1OX1A 3W94A 5LH8A 1NU7B 1E38B 3A7ZA 4NA7A 2P8OB 1O3FA 2Q1JA 1W0ZU 1A61H 5A2MH 2AFQB 4OGYA 4B74A 1GG6C 1PFXC 1QTFA 1D3PB 4WXIA 4ABAA 4Y8YA 1MTNB 1L1GA 5JYIA 3SJIA 1MBQA 1O5BB 2ZFFH 1UCYK 2XNIA 4UE7H 5L2ZH 1UTNA 2ZO3H 1CSOE 3ZZDA 3RXHA 5JB8S 2W5EA 3GCNA 4RKJB 4FUDA 5T6GA 1GI6A 8GCHG 2H5CA 5FX6A 2ZHWH 1GBHA 2A4QA 4DOQA 4NFFA 2TGAA 2K7XA 2D1JA 1ZZZA 1EJAA 3S69A 2HNTE 2PKSB 1J17T 1YCPK 1TX6A 1BHXF 1RIWB 4WVPE 4GVUA 4ISIH 3ZYDA 2G8TA 2Y7XA 4VGCC 1V2JT 1GHBG 1C5LH 1WQVH 2ZPRA 4Q2KA 2GCTB 2GKVE 2PKAA 3E6PH 1LHCH 1VGCB 1CT0E 3GCHB 3S9BA 5ESTE 1F0SA 2BX4A 1XMNB 4JK5A 1O2TA 1AE8H 1GCTB 2P59A 1W7GH 2G5VA 4XSKU 2NU2E 1B5GH 1CHOF 4K1TA 5A09A 2ZCHP 3MH5A 1H8DH 4JZEH 3MNCA 5EW2H 4BAKB 1H9IE 1PPGE 1IQHA 4ISLA 2QAAA 3MNSA 1JXPA 1JOUB 2BX3A 1KXCA 5A0CA 3PTBA 1IQJA 1NESE 3SU2A 1V2UT 2ZFPH 4AX9H 1DSTA 4Y6DA 1MKXH 1QIXB 2G4UA 3DFLA 1BA8B 3WY8A 4LOYH 1UVUH 1V3XA 1CA0B 1VZQH 1SLXB 4TY7A 1QB6A 4GCHG 1C1QA 3KN2A 3BTWE 8LPRA 8ESTE 1HAOH 3RXGA 2ANWA 5I25A 1NZQH 4TYDA 1FNIA 1NFUA 5JB9S 1PQ8A 1O38A 2VH6A 1HUTH 3EA9A 1K9OE 1Y5BT 4DVAU 1O5GH 4KTCA 1K22H 1GGDB 7ESTE 3C27B 2BZ6H 1C5YB 1GMCF 3ZZAA 3MWIU 3NPSA 2OXSA 1TBRH 5EODA 3LGVA 4GPGA 3A8DA 1XUFA 1ZTJA 1HB0B 4I8JA 1HJAC 1V2VT 7LPRA 1P57B 2I6QA 2ASUB 2J2UA 4Q80A 3A86A 4ZMAH 3TJOA 2HPQH 2F9PA 3TIUA 1NS3A 1G3EA 2HLCA 1GJ8B 1Z8IB 2B7DH 4OGXA 4HTCH 1JWTA 1O3CA 4B71A 1FIZA 2QN5T 1BHXB 1RJXB 1TMBH 1F7ZA 4KELA 5DP8A 5DP6A 3GCTG 4WMDA 1TMUH 1O3NA 1THSH 3GCOA 2Q6DA 1D6RA 1SPJA 3BTGE 3B9FH 4XFQA 1V2MT 2BDYA 4Y79A 1EUFA 4FU8A 1TPSA 1XVOA 1ZHMA 1O2SA 2H5DA 1EJNA 3RXFA 3KHVA 1A0LA 1BZXE 3F1SB 1V2LT 1WBGB 2PWXA 1MCVA 3A84A 2C8XB 1D9IA 3RXTA 4D7GA 1HXFH 2ODPA 1IQEA 2ZTXA 4DT7B 2AMDA 1FPCH 4ABJA 1AWFH 1SFQB 1BCUH 2ESTE 1NFXA 1SR5C 1RTFB 1NT1A 1O0DH 2D8WA 1GI3A 3JZ2B 1OWKA 1S0RA 4CHAB 4JZIA 1BMMH 1PPZA 2VIQA 1AFQC 1HAVB 5A8YA 2GCHF 1PPCE 1TLDA 4GUXA 2ANYA 1TBQH 1JMOH 4OS7A 5C1XA 4F49A 3RXBA 3M5OA 4DJZB 3U69H 1W8BH 3I77A 3LU9B 4CH8B 2JH6D 2FIRH 2A4RA 3QN7A 3MU8A 2ZI2H 2J95A 4A5TS 4DG4A 1VR1H 1XKBC 2H9TH 5AFYH 3F68H 2ULLA 4GAWA 1QJ7B 1TABE 1TNIA 1A46H 3BF6H 3F9GA 1CQQA 1HLTH 4HI3A 1QCPA 2NWNA 1UTJA 2OCVB 4INHA 5TCCA 1DY9A 3QTOH 2OUAA 4IGDA 3RU4T 4BTIB 2JH5D 1UK2A 4R8TB 2A5AA 1SGRE 1ZJDA 1BRCE 1DWDH 1CBWB 1EAUA 1DUEA 4FU7A 3EYDA 1O2NA 2ZFQH 2GTBA 3VEQB 3BIVH 1GBCA 1O31A 3GY5A 1LHFH 1P0SH 1GHXH 1HAGE 2ZA5A 1FDPA 2QV1A 1W11U 4MQAA 3EGKH 3E0NB 3LGTA 3GISB 3PWBA 1ZTLA 1NM6A 5DJ7A 4K2YA 1MTVA 4Q7ZA 1W14U 1N6YA 3BTKE 1MZAA 1DICA 1ZSKA 1PPHE 2BYAX 4CRBA 5EXLA 2NU3E 1NRQH 1Q3XA 3EA8A 1O30A 3QGJA 3ZZ6A 1GJCB 1CHGA 2OLGA 2SNWA 3QDZB 4ABGA 1SOTA 8GCHF 2ODQA 2ALVA 1H9LB 3K6ZA 2ZGHA 2ZKSA 4Q7YA 1DE7H 3UUZA 2VIPA 3H5CB 3TJUA 1T4VH 2FODA 4CRGA 1HJ9A 1JBUH 1A3BH 1E36B 2SGDE 3T26A 2FOEA 2FPZA 3UWIA 4RKOB 4X8SH 2LIZA 5GPIB 3VB6A 1QJ1B 3T25A 4Z0KA 4BXWA 4MDSA 4M7GA 3UR9A 3T62A 1SG8B 3RMOH 4E7NA 4UFGH 2J9NA 2Y5GA 4WH8A 3SV6A 3E91A 1EPTB 3UQOA 3M5NA 1NRPH 2FOFA 4F4OC 1J15A 3ZYEA 2BLWA 5FBIA 1C5UA 1TAWA 1HDTH 1XXFA 4K8BA 3ZV8A 1J16A 1C4Y2 3MU1A 4BAHB 1BBRH 5HMAA 4IC6A 3PO1B 1OWIA 2V0BA 4GHQA 1V2QT 2FLRH 4H4FA 2AIQA 7GCHG 2VNTA 5EPNA 4BAQB 4MNXA 3RXSA 3BIUH 3SNEA 1TOMH 4FXGH 3LJJA 3RLWH 1C5VA 4GCHF 4CR5A 5E8EH 2ZHQH 3ZZBA 1NY22 3ATMA 2XCNA 3S0NA 2BY9X 2CV3A 3U98H 4CBOA 2TPIZ 1S84A 2WPJS 2W26A 1VITH 1VJAU 1ZGIA 2Z3DA 1LVOA 1TWXB 3MTYA 3ZZ4A 1P01A 3UREA 5GIBA 3HATH 1UO6A 3LPRA 1AZZA 1NRRH 8KME2 1A0HB 1S81A 5EXNA 1SMFE 2AH4X 2YOLA 2V6NA 3F9EA 5GXPA 2ZHFH 2Q6GA 3U1IB 2PKAB 3UOUA 1C2DA 1EOLA 4FVBA 1BTWA 4I32A 1LKBA 5FHTA 1VCPA 1FY3A 3FZDA 3SJOA 1DANH 3L33A 2BY7X 1G9IE 1NC6A 1QY6A 1FPHH 3RXPA 2FM2A 3RXKA 4X2VA 1L4ZA 1YM0A 4FUBA 2UWLA 4IBLH 1LPKB 1PYTD 3GCTF 3GY4A 4ZKNU 3M3SA 1ZMLA 3SNCA 1G36A 2J34A 4JMYA 5A8ZA 3VXFH 1EP5A 5GJ4B 2AIPA 3GY3A 1YBWA 2VVUA 3SGAE 4RSPA 1S85A 3E16B 1O5FH 5FBEA 1AVXA 3HGPA 3MOCA 1O2QA 1QRWA 4D9RA 1P05A 3H7TA 3BG8A 4B76A 2UUKB 1H1BA 4ABHA 4R0IA 2PUXB 1BTHH 1GBLA 3UNQA 4TPYA 2QXJA 4XDEA 4HFPB 1XVMA 1FY8E 3TH4H 3A81A 4AN7A 2OP9A 1CGHA 2ZDMA 1XM1A 1EJMA 1C2EA 2HRVA 1QQUA 2H2ZA 3UIRA 3RXOA 1L2EA 1YKTA 4K5ZA 1W7XH 2AMQA 1MD7A 2XBXA 5E0GA 1UK4A 2A7CA 2NU4E 1W0YH 4JZFH 3NUMA 1GDNA 2XBVA 3EE0B 4U32A 3A8AA 4BXSA 1Y3XA 3HGNA 4UEHH 1ELEE 1S0QA 1GJ7B 1O3JA 3RXCA 1F5RA 4HZHA 1P2NA 4YOJA 1BJVA 3LGIA 2GMTC 3DHKH 3PLKA 5GCHG 3NCLA 1IQMA 1GMHF 4BANB 3BEIB 3RXEA 2A2QH 3HK6B 2HALA 1DWCH 3RUOA 1TALA 4NZLA 1IHSH 4B2AA 1S6HA 3SHCH 1BTXA 1K1PA 3UR6A 3CS0A 3AASA 2ZPSA 1LTOA 4NIVA 5C1YA 3BG4C 4BTUB 3RXVA 3S9CA 1VITG 1FN6A 2F91A 2Z9JA 1MBMA 3RU4D 3HPTB 5FX5A 5EOKA 3KQDA 1T31A 3PB1E 1BUIA 3SORA 3LH1A 3ZZ3A 5C3NA 1AD8H 3KGPA 2A0QB 1UTMA 2C8ZB 1XXDA 4ABEA 4IN1A 2A31A 1L1JA 1DY8A 1N8OB 1C1TA 1ETSH 4ZXXH 1L1NA 1ARBA 2ZGXH 5A8XA 1O2VA 3VGCC 1B7XB 1KXBA 1C1WH 3PMBB 2IJOB 2R0KA 1NTPA 3VB7A 3LC5A 1HXEH 3MFJA 1OP2A 3T29A 1C9TA 1SVPA 1QR3E 4JCNA 4ZKSU 3EDXB 4OS1A 5L6NH 2PUQH 4H6SB 1C1NA 1OP0A 2JETB 3MO3A 2IOTA 1GWAA 1HIAA 1ZRBA 2UUJB 1TGCA 1TRYA 5T6DA 4GLYA 1CGIE 1O3PB 2BD7A 3MYWA 2XTTB 3SJ9A 1GVKB 1O3IA 4K60A 1A5IA 2XC4A 4ZKRU 3SI4H 1P03A 2PTCE 2OTVA 5EQSA 2Z7FE 1QBVH 4JYTA 5F6MA 1Z8JB 3LDXH 1UHBB 5F8TA 4NFEA 2ZF0H 2LPRA 6CHAC 1FMGA 2BD9A 1ELFA 1O35A 1HBTH 1S5SA 7GCHF 3STIA 3BN9A 2ZGCA 2QXIA 1D3QB 3RU4E 2QIQA 2ZDVH 3QGNB 1EAIA 1WCZA 2A1DB 3KCGH 3CS7A 3U8RH 1YPKH 1MU8B 3M7QA 1DITH 1P10A 3Q00A 4I8LA 2THFB 2RDLA 1UK3A 3UPEA 1ZGVA 1ESTA 5C20A 4A7IB 5JBBS 2B0FA 4XBBA 4B1TA 3M37A 3EA7A 5K7RA 2V35A 1TRNA 3IWMA 3GDUA 2WYGA 1EP6A 2PSYA 3LGUA 3FAOA 1ZTKA 4NIWA 3RDZA 1WTGH 2ZTYA 2ZHDA 3A80A 3LH3A 2V3OH 1UJ1A 2FTLE 3KL6A 5LPRA 3O8BA 4FVDA 3MMGA 1Y3UA 1HGTH 3O8DA 1MQ5A 2VGCC 2WPKS 3RXQA 4X8TH 1GJBB 4AOQA 2BTCE 1TX8A 1EATA 3F9FA 1AVWA 1HAHH 1RTLA 3HKJB 1F5LA 2W7SA 1P2JA 1GBBA 3IITA 1SGIB 1YPGH 1QNJA 1T4UH 3ATIA 1FONA 1WU1A 1AZ8A 3TGIE 1SLWB 1GBTA 2BQ6B 5B6OA 2C4FH 4J2YB 4U01A 2QF3A 1LQEA 1ESAA 1G32B 4Y71A 2ZGJA 5CHAB 1ZPBA 3B8JA 4NCYA 1W3CA 3M5MA 1BBRK 2QXGA 1QB1A 3OYPA 2BQ7B 1BITA 1SHYA 1YLCA 1TNHA 2PTNA 3F6UH 3UNRA 2FTMA 2H9HA 2ZU3A 4WMEA 3P95A 2BOKA 5DP4A 3ZVFA 3A7VA 3A89A 1GBEA 1C5NH 1VCWA 2WV5A 3ENSB 4KGAA 2Q6FA 2ZWLH 2ZECA 3OU0A 1O2UA 2PFEA 3Q76A 1WYKA 1P2KA 2ZNKH 4NIYA 4MPXA 4WH6A 2Z9KA 1K28D 2BDGA 2Z9LA 1UCYE 3GY6A 1ZOMA 1W13U 1A4WH 2NU1E 1KYNA 3QK1A 1QQ4A 1SI5H 2CMYA 1ZYOA 1PPEE 5EGMA 1E37B 1UTPA 3ODFA 1D3DB 4Z6AH 3ZVDA 2EI7A 2YNAA 2XBWA 5CMXH 3LT3A 1NPMA 1O3MA 3SU6A 4X2WA 1GHWH 1B0EA 4CRFA 1GI2A 1WV7H 3QUMP 3NK8A 1GI4A 1EAWA 2BXUH 3SBKA 2K1QA 3ZVEA 5DP7A 1RFNA 4O3UA 2ZP0H 2BD4A 4ISOA 4SGBE 1HV7A 2HWLB 3UY9A 3RXAA 1K1MA 2Z3EA 1LKAA 2PW8H 4Y11E 4FUIA 4YLQH 1V2OT 3NWUA 1O2KA 3G01A 1PJPA 1ELBA 1IQNA 1SB1H 1PYTC 1MTSA 1DUAA 4CRAA 1C5RA 2F83A 4A6LA 1JIMA 2BDIA 3NKKA 3P17H 5DP5A 1NFYA 1TOCB 2OINA 3HKIB 3QZRA 1O3OA 1YPHE 5JBTA 1EKBB 3LKWA 1ETRH 2AMPA 4X1QU 3SQEE 3D62A 1Q31A 3ODDA 2FZZA 1TQ0B 2XCFA 1ANBA 3P8GA 2D26C 3UFAA 3SQHE 2UWPA 4NSYA 1HAYB 1DDJA 2Z9IA 4I7YH 1HAZB 1SLVB 2FXRA 4YOIA 1DVAH 2VIWA 3LGYA 3TU7H 1MMJN 1C1VH 1BMNH 2XBYA 1EX3A 1EXFA 4X6OA 4X1SU 1C5MD 1YPMH 5EXMA 1P12E 1L0ZA 2P8OC 2FS8A 3BV9B 4I31A 1AKSA 5DK1A 1KXDA 3U8OH 3K9XB 1AB9B 2VVVA 4NWKA 1ELAA 3GOVB 1MTNC 2BOHB 1WUNH 1DLKB 4OS4A 4NA8A 3ZVAA 1KXFA 7KMEH 1SFIA 2BB4A 1UVTH 2CHAB 2VH0A 2QXHA 3RXLA 3GYLB 2ILNA 1HRTH 1C5ZB 1H9HE 3KNXA 1UCYH 1K21H 2P16A 1C1MA 1QL9A 1GJ9B 4INKA 1C1OA 1C5OH 1BMAA 1TGNA 2PKSC 4AFUA 1JIRA 4DGJA 5BRRE 1FZZA 1RIWC 1G3CA 2FYQA 1DXPA 1FAKH 4E05H 1NO9H 1J14A 3DD2H 3SNBA 3QTVH 1AUJA 1KXAA 3OSYA 4YT6H 1MH0A 1O5DH 1O2PA 2GCTC 3LJOA 2J38A 1VGCC 3GCHC 1OWJA 3SV2H 2DE8A 1CA8B 3A7WA 5HGGA 6ESTA 2FX4A 3GDVA 3TJVA 1HNEE 1P2QA 3A87A 1GCTC 2C90B 2VJ1A 1A7SA 3S9AA 1AFEH 4AFQA 2ZC9H 2SFAA 1GHBF 4A92A 3TVJB 2VWMA 3SNDA 2HNTC 1P2IA 3K65B 4DIIH 2ZQ1A 4A1VA 2FOAA 1H4WA 2C93B 3W95A 1AU8A 4X8UH 3MH7A 2GV7A 3MNXA 1SGPE 2BD3A 4K8YA 2GZ7A 1NRSH 2XC0A 1K2I1 1Y3VA 1YGCH 4ZHLU 2FOMB 2P3UB 1QA7A 3UQVA 4BAOB 1MD8A 1GPZA 3KQEA 1SGEE 3LIWA 1LHDH 1HIAB 3D65E 5DPAA 1F0TA 1P3EA 1SGFG 2ANKH 2V3HH 1O2WA 2AYWA 1FY5A 4NIXA 2ZU2A 1CA0C 2P3FH 4ABBA 1LVMA 3GY2A 1N6XA 3KF2A 1ANCA 2A4OA 4RN6A 2OC8A 1P11E 2FESH 1IQKA 3M3VA 3AAUA 4KTUA 1QL8A 1TE0A 1BTZA 2BDCA 1Y5AT 4OS5A 1O3LA 2A7JA 5AF9H 4FUHA 2ZG0H 1TRMA 3ATLA 1IQIA 4B75A 2GDDA 4D7FA 4MNYA 3TGJE 1AHTH 1AIXH 3UOPA 4Y0ZE 1D6WA 1A5HA 1K1JA 5BPEA 1GGDC 1DFPA 1GI1A 1SGQE 1GI9B 1FQ3A 1ZHPA 4BOHA 1BOQA 1S83A 1N1LA 4CREA 1GG6B 1HPGA 1T8OA 2XWAA 4B73A 1KDQA 1K1NA 1Z8RA 4Y0YE 1BTYA 1BB0B 1GJAB 2OBQA 2BY6X 2DE9A 1O37A 3PMJA 2FOHA 4NSVA 2EA3A 5EG4A 1SSXA 2P93A 2R0LA 1UVSH 4NWLA 2R3UA 1THRH 4MPWA 3T28A 4DW2U 3M5LA 1IAUA 2HPPH 1K1IA 3K6YA 4BAMB 1C1SA 1P09A 1F2SE 4BTTB 2ZFTA 3V7TA 3VB4A 2F9VA 2UUYA 2RCEA 1X7AC 4CBNA 2OQ5A 4ZUHA 2GD4B 1SC8U 4VGCB 1EZSC 5K0HA 2R3YA 1CGJE 1FI8A 3GY8A 1DXWA 5AFZH 2F3CE 1ETTH 1ZRKA 2CF9H 3ZZCA 2BLVA 5DP9A 4MVNA 3SJ8A 3H7OA 2Y5HA 5TCAA 3Q3YA 2G81E 2QGRA 5JBCS 4XE4A 2ZDNA 2BLQA 2TIOA 1OWEA 1XKAC 3AW1A 4ABFA
chains in the Genus database with same CATH superfamily
2W3IA 5FPYA 2Y5FA 3M35A 1D3TB 1SGNE 3P8NA 3CP7A 5GDSH 1GCDA 2ZU5A 2JKHA 1XX9A 2B5TB 2WYJA 2FI3E 1MKXK 2OQUA 2C3SA 1EB2A 4IC5A 3TK5A 3I78A 2ZHEH 3T27A 1TGBA 1WXRA 4IS5A 1BT7A 3EAJA 4H6TA 3M36A 3SHAH 4YTAA 2WUBA 4M9FA 1UTLM 1V2KT 2GZ9A 5E0JA 3SV9A 5HM9A 4SGAE 1TONA 1TX7A 2BD2A 3DSGA 5DGJA 1ARCA 3E0PB 1RD3B 1QGFA 2OC7A 1Z6EA 3MI4A 4MNWA 3SJKA 2F9OA 2G00A 1QURH 1GMCG 2P95A 1G37A 3TNTA 2Z6BD 1G3DA 1QRXA 4ASUD 4IMQA 3KQ5A 1FY4A 2ZU4A 1ZPCA 2G52A 2AGIX 1CBWC 4FUCA 1UVPA 1Y59T 1YPHC 3ZVGA 4AFZA 2FI4E 2BD5A 4X2XA 3T2NA 1ABJH 1S6FA 1WAYB 4YZUA 4YO9A 1BMLA 1G2LA 2W6ID 1O2OA 4AG1A 5KECA 3A88A 4X0WU 5PTPA 4ISHH 1LCYA 3BEFB 3GDSA 1YLDA 4DCDA 1JRTA 1HJAB 4MG3A 2QYIA 2ZDLA 2J94A 1GHAG 2NU0E 1P04A 1V2RT 1TPPA 3PWCA 1GL0E 2DUCA 4HG6A 3BEUA 4WXVA 3DCLA 1F92A 1MKWH 1C2JA 4ESTE 1ELTA 2XXLA 1BIOA 3R3GB 4X2YA 5LGOA 3ZIAD 3SGBE 3F2FA 1ZPZA 1FJSA 4GSOA 1EOJA 3GICB 4B6EA 1LQDB 3DT0H 1KLJH 5EJ1A 1OPHB 3LONA 1GJDB 1P2MA 4JK6A 5F8ZA 1MAYA 4ABIA 2CF8H 3SN8A 2FOGA 1GI0A 3RC6A 1SHHB 3QX5H 2P94A 1O3AA 1YPEH 1BTUA 3KQBA 3SZNA 2VWNA 1O2HA 3SUDA 1J8AA 1SL3A 4B2BA 3E90B 5C5NA 4MPVA 1O2XA 3MO9A 4LK4A 3OX7U 1Z1IA 2GCHG 2RA0A 5FXLA 1A0JA 1EQ9A 1AUTC 4OS6A 1QB9A 1KTSB 4FETA 5HXFA 2O8TA 2WPHS 2GT8A 1GJ4H 1AFQB 4X6PA 3DSPA 1VJ9U 3M61U 1C1RA 4X1NU 1EPTC 1DWEH 2EI6A 2QA9E 4O97A 2FO9A 4NZQA 1LPGB 1ZSLA 2EY4C 2VWLA 1GBIA 1UTOA 2J5UA 4NA9H 3SW2B 1TMTH 3A82A 1P3CA 2FLBH 1BRAA 3A83A 1Y3YA 2OBOA 4FUJA 1IHTH 3SU0A 1BQYA 2A45B 4D9QA 3RXRA 5CE1A 5FPTA 2Z94A 1KXEA 3A7XA 3NRLA 3PO1C 4FOUC 2BXTH 5H4IB 2H1UA 1ANDA 1QJ6B 4J1YA 1S82A 3V12A 1DS2E 4ACBA 1GBAA 4WWYA 2G51A 5E0HA 5FPSA 6GCHG 3E8LA 1LVYA 2BVSH 4UD9H 1ZMNA 2EEKA 5A0AE 4U2WA 1C5SA 5CDFE 2H6MA 1KY9A 3URDA 4F55A 1OSSA 2J97A 4JZDH 2I6SA 1QA0A 5EQRA 3F0OA 1O2JA 2FDAA 2FS9A 2GZ8A 1O34A 4GHTA 2BMGB 4TWYA 3H09A 2ZIQH 5JDUB 1ELGA 3TH2H 3A7YA 2Z9GA 2SGPE 5AVDA 2FOCA 1FV9A 1Q2WA 1GHZA 2ZQ2A 1RTKA 1O36A 1W2KH 5T6FA 3E1XB 2C8YB 1MZDA 1DT2A 2R2WU 1JRSA 2OC0A 2BDBA 4BNRA 1RGQA 5EIYA 4YLUA 1CVWH 1Z1JA 2ZPQA 1RS0A 1COWD 4Y7BA 3JZ1B 2EI8A 2TGPZ 2FP7B 1GHYH 4AB8A 1OWHA 5EPYA 3Q3KA 2XC5A 3BTTE 1A3EH 5C94A 3A85A 3LC3A 3SV8A 2STBE 1K1LA 1Y3WA 4WF8A 4WJG2 4DURA 1ZLRA 1O39A 2BVRH 1C5WB 3MO6A 1FUJA 2AGEX 1C5TA 2Y7ZA 1KIGH 4AYYB 3SOSA 4LZ4B 3T5FH 3PMHB 2J92A 1YPLH 1TFXA 2BLOA 4AB9A 2FYRA 4IW4E 4AGJA 4CRDA 1KTTB 3SNAA 3U1JB 1TA6A 1LDTT 2J4IA 3PM3A 4X1PU 2JH0D 4OS2A 1GHVH 4K69A 4Q7XA 1AVGH 2WPLS 2LELA 3RXJA 1LVBA 3SU3A 5C1UA 5I46H 2CJIA 2RA3A 1V2WT 4THNH 4E7RG 3UTUH 5L2YH 1GMDG 3TH3H 1TGSZ 2F9UA 3MU5A 2PSXA 4AFSA 1ESBA 1SQOA 5C2ZA 1GI8B 1C4U2 4MNVA 2BM2A 2G5NA 2UUFB 2LNCA 1EZUC 2BZAA 4CR9A 1G3BA 2VU8E 3IG6B 3QZQA 3RXMA 4DIHH 1V6DA 4CH2B 1KLTA 1RXPA 4X6MA 4I8HA 1C2FA 1B0FA 3F9HA 1KDQB 3ZZ5A 3I29A 2HLDD 3ESTA 2W7UA 3OTJE 3GY7A 1J9CH 1DX5M 1S6LA 3QLPH 1BRUP 4A1XA 1V2ST 1F5KU 3EBNA 4B2CA 4AG2A 2GX4A 2CGAA 1UTQA 1NN6A 3L3TA 1HAIH 9LPRA 1FAXA 1T8MA 2B9LA 1ACBE 2QF0A 1Z8GA 3WW7A 2GGVB 4IN2A 5E2OA 5GCHF 2RFKC 1P02A 2O8MA 2Y82A 3PROA 4MLFB 4UFDH 1GBMA 5CHBA 5FCRA 3RMLH 4X8VH 2A7HA 2TRMA 1C5XB 3BTEE 1ANEA 1PQAA 1SQAA 5ETXA 1O2GH 4LZ1H 1MU6B 1GHAF 3RC5A 4AORA 3KEEA 1MUEB 2A5KA 5DKMA 3OE7D 1HCGA 2HVXA 2XYAA 2IPHA 1F0UA 4ZAEA 1GL1A 3SUGA 4U30A 3M3TA 5C0UA 5F53A 1QHRB 1VITF 4I8KA 1O3BA 2ZU1A 1UVOA 3TPIZ 1TPOA 3SZEA 1NRNH 1MQ6A 2FWWA 1KLIH 2CK3D 4AYVB 2WV9A 1PPFE 1N8OC 2ZEBA 3ZZ7A 1P9UA 3CENA 3OTPA 1OWDA 2ZGBH 5EJZA 5EW1H 1CU1A 4IMZA 4O03A 2SNVA 3UNSA 1YP9A 3SV7A 2KAIA 1W12U 4XBCA 1E35B 1GBJA 4ASHA 3CNRA 5L30H 1ZJKA 2W3KA 1O33A 1PPBH 1QRZA 3SUEA 4Y76A 3ATWA 1O2LA 1OYQA 4ZXYH 5LPFA 2FOBA 2PLXA 3BTQE 3S7HB 4NGAH 2YNBA 3ATKA 2BDHA 4ZKOU 1Y5UT 2GDEH 1ZR0A 2A5IA 2JETC 4XD7D 2SGAA 1BBRE 2BHGA 2ZZUH 3TNSA 2SGEE 5EU8A 1XUGA 3RM0H 2BY5X 1O32A 1YC0A 1GJ5H 1XUKA 4H42U 2AHME 5C5OA 1DSUA 2SGQE 3KQCA 4Y10E 1SBWA 5DO4H 2A32A 5T3HA 3TITA 3STJA 1GVZA 1Y8TA 1ID5H 5FCKA 1GMHG 2B8OH 2XWBI 3PMAB 5E2PA 3SU5A 2VWOA 2FEQH 1HJ8A 5SGAE 1XUJA 1MTWA 2BQWB 2ZFRH 1E34B 4WMFA 1FLEE 3SI3H 3URCA 6LPRA 3N7DA 2BVXH 5EQQA 1IQLA 2GMTB 2VIVA 6GCHF 1LHEH 1CT4E 5ABWA 2PV9B 3KIDU 1HFDA 2J98A 3S7KB 1AO5A 1EZQA 1GBFA 1MAXA 3K2UA 3AVZA 1AGJA 1AE5A 1MKWK 1SOZA 2HVYB 3D49H 3NZIA 1F0RA 3SGQE 2H9EH 2ZFSA 2ZTZA 5HM2A 3R0FA 2G55A 1IQGA 1KSNA 4ZROA 1UHBA 4KP0A 4X1RU 3BG4B 1SGYE 4K3JA 2FMJA 3OY6U 3TJNA 1AWHB 5F8XA 4Z1MD 1TA2A 2ALPA 4ZH8A 1BJUA 1LHGH 1YCPH 4LXBH 1O2ZA 3P8OA 5G4BA 1C5QA 1HYLA 1M9UA 1AQ7A 2VB0A 1E0FD 1PQ5A 2AEIH 3FZZA 1DWBH 1C2LA 1FN8A 3M7TA 1AMHA 1LMWB 1HAXB 1EZXC 2KX4A 5DG6A 1O2YA 1ELVA 4O3TA 1V2NT 1GDUA 4CRCA 3O8CA 4FUEA 3PTNA 3VB3A 1O5CB 1T8LA 4YM9A 2ANMH 3A7TA 3U8TH 3VGCB 1O2IA 3M7UA 1Z7KA 1SGDE 1ELCA 1T7CA 1G30B 3RXUA 1TB6H 3RLYH 3ELAH 2AS9A 3FP8E 4JYVH 3PV5A 2AERH 1YYY1 2R2MB 2SGFE 1C9PA 2WPDD 2O8WA 1GBKA 3BTHE 2CN0H 1LPZB 2A2XH 2EC9H 1OYTH 3SUFA 1EAXA 3TK6A 1TQ7B 5CHAC 3FVFB 1DOJA 3VPKA 3RXDA 1GJ6A 5C67A 1UTKA 5F03A 3PLBA 1INCA 1O3EA 1SGFA 3BTDE 5ESBA 3UWJH 2UWOA 1A1RA 2Y6TA 3PLPA 2IJD1 3D23A 1ZHRA 1GMDF 3RM2H 4TWWA 3SO3A 1QFKH 1NU9A 5HYOA 3DUXH 1P2OA 1K1OA 1WTHD 1C2KA 4K1EA 1LO6A 4YOGA 1TYNA 3AK5A 1A2CH 4AGKA 1T8NA 3F2GA 3FANA 1YPJH 3HK3B 1O5AB 3MU0A 5AHGH 4ZHMU 2ZDKA 3DA9B 1WSSH 1WQSA 2WPMS 2WV4A 6CHAB 1T32A 1TGTA 3B23B 1OP8A 2JJ1D 1A5GH 1TNLA 5DSFA 2CXVA 4Y7AA 3O8RA 3A8CA 1CO7E 2GV6A 1U6QA 1P9SA 2QY0B 4KKDA 1GI5A 5DN6D 2FX6A 2TGDA 1AI8H 3C1KA 3FOAA 1G2MA 2TBSA 1CHOG 1EB1H 1SGCA 4X6NA 3P8FA 1CE5A 2BDAA 1BTPA 1C2HA 2QF4A 1ORFA 2QC2A 4QT8C 1QBNA 3RC4A 1P06A 1C1PA 5JPMH 3VFEA 4A1TA 1TBZH 3OAAD 2WPIS 1W10U 3V0XA 1MTUA 2GVFA 3E3TA 4XBDA 3PV4A 4O9VA 3ZZ9A 1NFWA 1SQRA 1AN1E 1YF4A 1O2MA 2Z3CA 4CHAC 4D76A 2PR3A 1VCQA 5LPEA 5HKKD 2VGCB 3EQ0H 4AZ2B 1P8VC 1YLNA 5A0BA 3MH6A 3MU4A 2KCOA 3P92A 4FU9A 5EJLA 3N7OA 3MH4A 1BDAA 3U9AH 4ISNA 2GT7A 4INLA 3P6ZB 5TJXA 3OY5U 4E06H 3ZVCA 4NG9H 9ESTA 1O3KA 1TNJA 4D8NA 1C2MA 1OOKB 3L6PA 4Y8XA 1GVLA 1SQTA 2BD8A 1TPAE 1HAVA 4I86A 1C5PA 2RG3A 1GBDA 4YESB 3ZVBA 2OC1A 4UFFH 1ZMJA 4Y8ZA 2HOBA 1H8IH 5DP3A 4YT7H 1Z71A 3FP7E 4MTBA 4WY3A 1C2IA 1FXYA 4XOJA 3DFJA 3ITIA 2VINA 2F9NA 1FIWA 1O3GA 5GWZA 2FI5E 1CT2E 1EASA 1PQ7A 3RP2A 4TPIZ 1THPB 2ZDAH 1C2GA 3BTME 1DPOA 3TK9A 3MQKC 1AB9C 2WINI 4JYUH 2O8LA 2KCPA 3GYMA 3MNBA 1Z6JH 3VXEH 3RMMH 2PHBA 3RXIA 2IN2A 1TIOA 2L74A 2A4GA 1L4DA 4TY6A 3Q3XA 2G4TA 1QL7A 1DM4B 1V2TT 1O5EH 3Q77A 2CHAC 2PGBB 3KYFA 3ZZ8A 1QBOA 4I33A 3TGKE 4UDWH 1GI7B 2ODYB 3RMNH 4ABDA 1V2PT 1FY1A 1ZSJA 2Y81A 3BSQA 3A8BA 1ELDE 2XW9A 3V13A 3AW0A 2QCYA 2ZCLP 1TNKA 4K1SA 1UMAH 4ZHAA 3SU1A 2PGQB 1ABIH 2KM0A 3ZV9A 3BTFE 3TLOA 2VIDA 3PYHA 1BRBE 2GP9B 1AY6H 4UFEH 2P3TB 1XUHA 1C4V2 3FFGA 2D2DA 2XRCA 3LGWA 5FAHA 2ZCKP 4FUGA 2WUCA 1SGTA 2O9QA 4UONA 3N7EA 2F9BH 2KAIB 3FP6E 1SLUB 3AAVA 1OS8A 3V3MA 2O8UA 1GDQA 1NROH 3QO6A 3SU4A 2STAE 4I8GA 2HGTH 2Y80A 4JZ1A 1XUIA 2AGGX 3QWCH 1IOEA 1OKXA 5IYTA 3VB5A 1HAPH 2OK5A 2HNTF 2TGTA 1DLEA 4PROA 3MHWU 2VIOA 5J4SA 4MPUA 1OXGA 3W1EA 5J4QA 3NXPA 2R9PA 5JBAS 2BY8X 1O3DA 1WOFA 1D4PB 2VVCA 3P70B 5IDKA 2M5TA 2OD3B 4KTSA 1AKSB 1O2RA 1O3HA 1RRKA 1C1UH 3PRBA 4FUFA 1YCPM 4DY7B 1TNGA 4HGCA 2YMSD 3LOXA 1MCTA 1EPTA 1IQFA 2C8WB 1OX1A 3W94A 5LH8A 1NU7B 1E38B 3A7ZA 1W0KD 4NA7A 2P8OB 1O3FA 2Q1JA 1W0ZU 1A61H 5A2MH 2AFQB 4OGYA 1E79D 3UAIC 2J98B 4B74A 3UB0A 1GG6C 1PFXC 1QTFA 1D3PB 4WXIA 4ABAA 4Y8YA 1VKYA 1MTNB 1L1GA 5JYIA 3SJIA 1MBQA 1O5BB 2ZFFH 1UCYK 2XNIA 4UE7H 5L2ZH 1UTNA 2ZO3H 3N99A 1CSOE 3ZZDA 3RXHA 5JB8S 2W5EA 3GCNA 4RKJB 4FUDA 5T6GA 1GI6A 8GCHG 2H5CA 5FX6A 2ZHWH 1GBHA 2A4QA 4DOQA 4NFFA 2TGAA 2K7XA 2D1JA 1ZZZA 1EJAA 3S69A 2HNTE 2PKSB 1J17T 1YCPK 1TX6A 1BHXF 1RIWB 4WVPE 4GVUA 4ISIH 3ZYDA 2G8TA 2Y7XA 4VGCC 1V2JT 1GHBG 1C5LH 1WQVH 2PP6A 2ZPRA 4Q2KA 2GCTB 2GKVE 2PKAA 3E6PH 1LHCH 1VGCB 1CT0E 3GCHB 3S9BA 5ESTE 1F0SA 2BX4A 1XMNB 4JK5A 1O2TA 1AE8H 1GCTB 2P59A 1W7GH 2G5VA 4XSKU 2NU2E 1B5GH 1CHOF 4K1TA 5A09A 4RT0A 2ZCHP 3MH5A 1H8DH 2V3MA 3MNCA 4JZEH 5EW2H 4BAKB 1H9IE 1PPGE 1IQHA 4ISLA 2QAAA 3MNSA 4XRNA 1JXPA 1E1QD 1JOUB 2BX3A 1KXCA 5A0CA 3PTBA 1IQJA 1NESE 3SU2A 1V2UT 2ZFPH 4AX9H 1DSTA 4Y6DA 1MKXH 1QIXB 2G4UA 3DFLA 1BA8B 3WY8A 4LOYH 1UVUH 1V3XA 1CA0B 1VZQH 1SLXB 4TY7A 1QB6A 4GCHG 1C1QA 3KN2A 3BTWE 8LPRA 8ESTE 1HAOH 3RXGA 2ANWA 5I25A 1NZQH 4TYDA 1FNIA 3OEHD 1NFUA 5JB9S 1PQ8A 2YMSB 1O38A 5KEDA 2VH6A 1HUTH 3EA9A 1K9OE 1Y5BT 4DVAU 1O5GH 4KTCA 1K22H 1GGDB 7ESTE 3C27B 2BZ6H 1C5YB 1GMCF 3ZZAA 4Q4LA 3MWIU 3NPSA 2OXSA 1TBRH 5EODA 3LGVA 4GPGA 3A8DA 4F48B 1XUFA 1ZTJA 1HB0B 4I8JA 1HJAC 1V2VT 7LPRA 1P57B 2I6QA 2ASUB 2J2UA 4Q80A 3A86A 4ZMAH 3TJOA 2HPQH 2F9PA 3TIUA 1NS3A 1G3EA 2HLCA 1GJ8B 1Z8IB 2B7DH 4OGXA 4HTCH 1JWTA 1O3CA 4B71A 1FIZA 5IK2D 2QN5T 1BHXB 1RJXB 1TMBH 1F7ZA 4KELA 5DP8A 5DP6A 3GCTG 4WMDA 1TMUH 1O3NA 1THSH 3GCOA 2Q6DA 1D6RA 1SPJA 3BTGE 3B9FH 4XFQA 1V2MT 2BDYA 4Y79A 1EUFA 4FU8A 1TPSA 1XVOA 1ZHMA 3OFND 1O2SA 2H5DA 1EJNA 3RXFA 3KHVA 1A0LA 1BZXE 3F1SB 1V2LT 1WBGB 4OM9A 2PWXA 1MCVA 3A84A 2C8XB 1D9IA 3RXTA 4D7GA 1HXFH 2ODPA 1IQEA 2ZTXA 4DT7B 2AMDA 1FPCH 4ABJA 1AWFH 1SFQB 1BCUH 2ESTE 1NFXA 1SR5C 2JJ2D 1RTFB 1NT1A 1O0DH 2D8WA 1GI3A 3JZ2B 1OWKA 1S0RA 4CHAB 4JZIA 1BMMH 1PPZA 2VIQA 1AFQC 1HAVB 2VBCA 5A8YA 2GCHF 4DT4A 1PPCE 1TLDA 4GUXA 2ANYA 1TBQH 4TSFD 1JMOH 4OS7A 5C1XA 4F49A 3RXBA 3M5OA 4DJZB 3U69H 1W8BH 3I77A 3LU9B 4CH8B 2JH6D 2FIRH 2A4RA 3QN7A 3MU8A 2ZI2H 2J95A 4A5TS 4DG4A 1VR1H 1XKBC 2H9TH 5AFYH 3F68H 2ULLA 4GAWA 1QJ7B 1TABE 1TNIA 1A46H 3BF6H 3F9GA 1CQQA 1HLTH 4HI3A 1QCPA 2NWNA 1UTJA 2OCVB 4INHA 5TCCA 1DY9A 3QTOH 2OUAA 4IGDA 3RU4T 4BTIB 2JH5D 1UK2A 4R8TB 2A5AA 1SGRE 1ZJDA 1BRCE 1DWDH 1CBWB 1EAUA 1DUEA 4FU7A 3EYDA 1O2NA 2ZFQH 2GTBA 3VEQB 3BIVH 1GBCA 1O31A 3GY5A 1LHFH 1P0SH 1GHXH 1HAGE 2ZA5A 1FDPA 2QV1A 1W11U 4MQAA 3EGKH 3E0NB 3LGTA 2LP6A 3GISB 3PWBA 1ZTLA 1NM6A 5DJ7A 2F4LA 4K2YA 1MTVA 4Q7ZA 1W14U 1N6YA 3BTKE 1MZAA 1DICA 1ZSKA 3F3BA 1PPHE 2BYAX 4CRBA 5EXLA 2NU3E 1NRQH 1Q3XA 3EA8A 1O30A 3QGJA 3ZZ6A 1GJCB 1CHGA 2OLGA 2SNWA 3QDZB 4ABGA 1SOTA 8GCHF 2ODQA 2ALVA 1H9LB 3K6ZA 2ZGHA 2ZKSA 4Q7YA 1DE7H 3UUZA 2VIPA 2V7QD 3H5CB 3TJUA 1T4VH 2FODA 4CRGA 1HJ9A 1JBUH 1A3BH 1E36B 2SGDE 3T26A 2FOEA 2FPZA 3UWIA 4RKOB 4X8SH 2LIZA 5GPIB 3VB6A 1QJ1B 3T25A 4Z0KA 4BXWA 4MDSA 4M7GA 3UR9A 3T62A 1SG8B 3RMOH 4E7NA 4UFGH 2J9NA 1SKYE 2Y5GA 4WH8A 3SV6A 3E91A 1EPTB 3UQOA 3M5NA 1NRPH 2FOFA 4F4OC 3DSOA 1J15A 3ZYEA 2BLWA 5FBIA 1C5UA 1TAWA 2F43B 1HDTH 1XXFA 4K8BA 3ZV8A 1J16A 1NBMD 1C4Y2 3MU1A 4BAHB 1BBRH 5HMAA 4IC6A 3PO1B 1OWIA 2V0BA 4GHQA 1MABB 3U28C 1V2QT 2FLRH 2W6JD 4H4FA 2AIQA 7GCHG 2VNTA 5EPNA 4BAQB 4MNXA 3RXSA 3BIUH 3SNEA 1TOMH 4FXGH 1BMFD 3LJJA 3RLWH 1C5VA 4GCHF 4CR5A 5E8EH 2ZHQH 3ZZBA 1NY22 3ATMA 2XCNA 3S0NA 2BY9X 2CV3A 4TT3D 3U98H 4CBOA 2TPIZ 1S84A 2WPJS 2W26A 2WZQA 1VITH 1VJAU 1ZGIA 2Z3DA 1LVOA 4AC9A 3PRDA 1TWXB 3MTYA 3ZZ4A 1P01A 3UREA 5GIBA 3HATH 1UO6A 3LPRA 1AZZA 1NRRH 8KME2 1A0HB 1S81A 5EXNA 1SMFE 2AH4X 2YOLA 2V6NA 3F9EA 5GXPA 2ZHFH 2Q6GA 3U1IB 2PKAB 2KZ4A 3UOUA 1C2DA 1EOLA 4FVBA 1BTWA 4I32A 1LKBA 4B6FA 5FHTA 1VCPA 1FY3A 3FZDA 3SJOA 1DANH 3L33A 2BY7X 1G9IE 1NC6A 5FL7D 1QY6A 1FPHH 3RXPA 2FM2A 3RXKA 4X2VA 1L4ZA 1YM0A 4FUBA 2UWLA 4IBLH 1LPKB 1PYTD 3GCTF 2JIZD 2WSSD 3GY4A 4ZKNU 3M3SA 1ZMLA 3SNCA 1G36A 2J34A 4JMYA 5A8ZA 3VXFH 1EP5A 5GJ4B 2AIPA 3GY3A 1YBWA 2VVUA 3SGAE 4RI0A 1EFRD 4RSPA 1S85A 3E16B 1O5FH 5FBEA 1AVXA 3HGPA 3MOCA 1O2QA 1QRWA 4D9RA 1NBME 1P05A 3H7TA 3BG8A 4B76A 2UUKB 1H1BA 4ABHA 4R0IA 2PUXB 1BTHH 1GBLA 3UNQA 4TPYA 2QXJA 4XDEA 4HFPB 1XVMA 1FY8E 3TH4H 3A81A 4AN7A 2OP9A 1CGHA 2ZDMA 1XM1A 1EJMA 3F2HA 1C2EA 2HRVA 1QQUA 2H2ZA 3UIRA 3RXOA 1L2EA 1YKTA 4K5ZA 1W7XH 2AMQA 1MD7A 2XBXA 5KGOA 5E0GA 1UK4A 2A7CA 2NU4E 1W0YH 4JZFH 3NUMA 1GDNA 2XBVA 3EE0B 3GS9A 3A8AA 4U32A 4BXSA 1Y3XA 3HGNA 4UEHH 1ELEE 1S0QA 1GJ7B 1O3JA 3RXCA 1F5RA 4HZHA 1P2NA 4YOJA 1BJVA 3LGIA 2GMTC 3DHKH 3PLKA 5GCHG 3NCLA 1IQMA 1GMHF 4BANB 3BEIB 3RXEA 2A2QH 3HK6B 2HALA 1DWCH 3RUOA 1TALA 4NZLA 1IHSH 4B2AA 1S6HA 3SHCH 1BTXA 1K0HA 1K1PA 3UR6A 3CS0A 3AASA 2ZPSA 1LTOA 4NIVA 5C1YA 3BG4C 4BTUB 3RXVA 5B6LA 3S9CA 1VITG 1FN6A 1QZ8A 2F91A 2Z9JA 1MBMA 3RU4D 3HPTB 5FX5A 5EOKA 3KQDA 1T31A 3PB1E 1BUIA 3SORA 3LH1A 3ZZ3A 5C3NA 1AD8H 3KGPA 2A0QB 4ZCNA 1UTMA 2C8ZB 1XXDA 4ABEA 4IN1A 2A31A 1L1JA 1DY8A 1N8OB 1C1TA 1ETSH 4ZXXH 1L1NA 1ARBA 2ZGXH 5A8XA 1O2VA 3VGCC 1B7XB 1KXBA 1C1WH 3PMBB 2IJOB 2R0KA 1NTPA 3VB7A 3LC5A 1HXEH 3PV2A 3MFJA 1OP2A 3T29A 1C9TA 1SVPA 1QR3E 4JCNA 4ZKSU 3EDXB 4OS1A 5L6NH 2PUQH 4H6SB 1C1NA 1OP0A 2JETB 3MO3A 2IOTA 1GWAA 1HIAA 1ZRBA 2UUJB 1TGCA 1TRYA 3OEED 5C17A 5T6DA 4GLYA 1CGIE 1O3PB 2BD7A 2K8IA 3MYWA 2XTTB 3SJ9A 1GVKB 1O3IA 4K60A 1A5IA 2XC4A 4ZKRU 3SI4H 1P03A 2PTCE 2OTVA 5EQSA 2L6OA 2Z7FE 1QBVH 4JYTA 5F6MA 1Z8JB 3LDXH 1UHBB 5F8TA 4NFEA 2ZF0H 2LPRA 6CHAC 1FMGA 2BD9A 1ELFA 1O35A 1HBTH 1S5SA 7GCHF 3STIA 3BN9A 2ZGCA 2QXIA 1D3QB 3RU4E 3WWBA 2QIQA 2KCAA 2ZDVH 3QGNB 1EAIA 1WCZA 2A1DB 3KCGH 3CS7A 3U8RH 1YPKH 1MU8B 3M7QA 1DITH 1P10A 3Q00A 4I8LA 2THFB 2RDLA 1UK3A 3UPEA 1ZGVA 1ESTA 5C20A 4A7IB 5JBBS 2B0FA 4XBBA 4B1TA 3M37A 3EA7A 4RT1A 2V35A 5K7RA 1TRNA 3IWMA 3GDUA 2WYGA 1EP6A 1W0JD 2PSYA 3LGUA 3FAOA 1ZTKA 4NIWA 3RDZA 1WTGH 2ZTYA 2ZHDA 3A80A 3LH3A 2V3OH 1UJ1A 2FTLE 3KL6A 5LPRA 3O8BA 4FVDA 3MMGA 1Y3UA 1HGTH 3O8DA 1MQ5A 2VGCC 2WPKS 3RXQA 4X8TH 1GJBB 4AOQA 2BTCE 1TX8A 1EATA 3F9FA 1AVWA 1HAHH 1RTLA 3HKJB 1F5LA 2W7SA 1P2JA 1GBBA 3IITA 4ACAA 1SGIB 1YPGH 1QNJA 1T4UH 3ATIA 1FONA 1WU1A 1AZ8A 3TGIE 1SLWB 1GBTA 2BQ6B 5B6OA 2C4FH 4J2YB 4U01A 2QF3A 1LQEA 1ESAA 1G32B 4Y71A 2ZGJA 5CHAB 1ZPBA 2KFWA 3B8JA 4NCYA 1W3CA 3M5MA 1BBRK 2QXGA 1QB1A 3OYPA 2BQ7B 3FN8A 1BITA 1SHYA 1YLCA 1TNHA 2PTNA 3F6UH 1H8ED 3UNRA 2FTMA 2H9HA 2ZU3A 4WMEA 3P95A 2BOKA 5DP4A 3ZVFA 3A7VA 3A89A 1GBEA 1C5NH 1VCWA 2WV5A 3ENSB 4KGAA 2Q6FA 2ZWLH 2ZECA 3OU0A 1O2UA 2PFEA 5GNDA 3Q76A 1WYKA 1H8HD 1P2KA 2ZNKH 4NIYA 3EE7A 4MPXA 4WH6A 2Z9KA 1K28D 2BDGA 2Z9LA 1UCYE 3GY6A 1ZOMA 1W13U 1A4WH 2NU1E 1E1RD 1KYNA 3QK1A 1QQ4A 3SYJA 1SI5H 2CMYA 1ZYOA 1PPEE 5EGMA 1E37B 1UTPA 3ODFA 1D3DB 2QF5A 1YWUA 4Z6AH 3ZVDA 2EI7A 2YNAA 2XBWA 3FKSD 5CMXH 3LT3A 1NPMA 1O3MA 3SU6A 4X2WA 1GHWH 4YXWD 1B0EA 4CRFA 1GI2A 1WV7H 2QE7D 3QUMP 3NK8A 1GI4A 1EAWA 2BXUH 2KR7A 5T1VA 2K1QA 3SBKA 5DP7A 3ZVEA 1RFNA 4O3UA 2ZP0H 2BD4A 4ISOA 4SGBE 1HV7A 2HWLB 3UY9A 3RXAA 1K1MA 2Z3EA 1LKAA 2PW8H 4Y11E 4FUIA 4YLQH 1V2OT 3NWUA 1O2KA 3G01A 2XNDD 1PJPA 1ELBA 1IQNA 1SB1H 1PYTC 1MTSA 1DUAA 4CRAA 1KMHB 1C5RA 2F83A 4A6LA 1JIMA 2BDIA 3NKKA 3P17H 5DP5A 2WHXA 1NFYA 1TOCB 2OINA 3HKIB 3QZRA 1O3OA 1YPHE 5JBTA 1EKBB 3LKWA 1ETRH 2AMPA 4X1QU 3SQEE 3D62A 1Q31A 3ODDA 2FZZA 1TQ0B 2XCFA 1ANBA 5HIZA 3P8GA 2D26C 3UFAA 3SQHE 2UWPA 4NSYA 1HAYB 1DDJA 2Z9IA 4I7YH 1HAZB 1WDIA 1SLVB 2FXRA 4YOIA 1DVAH 2VIWA 3LGYA 3TU7H 2KCYA 1MMJN 1C1VH 1BMNH 2XBYA 1EX3A 1EXFA 4X6OA 4X1SU 1C5MD 1YPMH 5EXMA 1P12E 1L0ZA 2P8OC 2FS8A 3BV9B 4I31A 1AKSA 5DK1A 1KXDA 3U8OH 3K9XB 1AB9B 2VVVA 4NWKA 1ELAA 3GOVB 1MTNC 2BOHB 1WUNH 1DLKB 4OS4A 4NA8A 3ZVAA 1KXFA 7KMEH 1SFIA 2BB4A 1UVTH 2CHAB 2VH0A 2QXHA 3RXLA 3GYLB 2ILNA 1HRTH 1C5ZB 1H9HE 3KNXA 1UCYH 1K21H 3F0PA 2P16A 1C1MA 1QL9A 1GJ9B 2EQNA 2GJGA 4INKA 1C1OA 1C5OH 1BMAA 1TGNA 2PKSC 4AFUA 1JIRA 1OHHD 4DGJA 5BRRE 1FZZA 1RIWC 1G3CA 3WWFA 2FYQA 1DXPA 1FAKH 4E05H 1NO9H 1J14A 3DD2H 3SNBA 3QTVH 1AUJA 1KXAA 3OSYA 4YT6H 1MH0A 1O5DH 1O2PA 2GCTC 3LJOA 2J38A 1VGCC 3GCHC 1OWJA 3SV2H 2DE8A 1CA8B 3A7WA 5HGGA 6ESTA 2FX4A 3GDVA 3TJVA 1HNEE 1P2QA 3A87A 1GCTC 2C90B 2VJ1A 1A7SA 3S9AA 1AFEH 4AFQA 2ZC9H 2SFAA 1GHBF 4A92A 3TVJB 2VWMA 3SNDA 2HNTC 1P2IA 3K65B 4DIIH 2ZQ1A 4A1VA 2FOAA 1H4WA 2C93B 3W95A 1AU8A 4X8UH 3MH7A 2GV7A 2IPQX 3MNXA 1SGPE 2BD3A 4K8YA 2GZ7A 1NRSH 2XC0A 1K2I1 1Y3VA 1YGCH 4ZHLU 2FOMB 2P3UB 4P00A 1QA7A 3UQVA 4BAOB 2M2AA 1MD8A 1GPZA 3KQEA 1SGEE 3LIWA 1LHDH 1HIAB 3D65E 5DPAA 1F0TA 1P3EA 1SGFG 2ANKH 2V3HH 1O2WA 2AYWA 1FY5A 4NIXA 2ZU2A 5C0TA 4P02A 1CA0C 2P3FH 4ABBA 1LVMA 3GY2A 1N6XA 3KF2A 1ANCA 2A4OA 4RN6A 2OC8A 1P11E 2FESH 1IQKA 4Q63A 3M3VA 3AAUA 4KTUA 1QL8A 1TE0A 1BTZA 2BDCA 1Y5AT 4OS5A 1O3LA 2A7JA 5AF9H 4FUHA 1YY3A 1TRMA 2ZG0H 1IQIA 2YMSC 3ATLA 4B75A 2GDDA 4D7FA 4MNYA 3TGJE 1AHTH 1AIXH 3UOPA 4Y0ZE 1D6WA 1A5HA 1K1JA 5BPEA 1GGDC 1DFPA 1GI1A 1SGQE 1GI9B 3KYGA 1FQ3A 1ZHPA 2K0QA 4BOHA 1BOQA 1S83A 1N1LA 4CREA 1GG6B 1HPGA 1T8OA 2XWAA 4B73A 1KDQA 1K1NA 1Z8RA 1FX0B 4Y0YE 1BTYA 1BB0B 3VG8A 3FO8D 1GJAB 2OBQA 2BY6X 2DE9A 1O37A 3PMJA 2FOHA 4NSVA 2EA3A 2JDID 5EG4A 1SSXA 1UW7A 2P93A 1UVSH 2R0LA 4NWLA 2R3UA 1THRH 4MPWA 3T28A 4DW2U 3M5LA 1IAUA 2HPPH 1K1IA 3K6YA 4BAMB 1C1SA 1P09A 1F2SE 4BTTB 2RDEA 2ZFTA 5HIYA 3V7TA 3VB4A 2F9VA 2UUYA 2RCEA 1X7AC 4CBNA 2OQ5A 4ZUHA 2GD4B 1SC8U 4VGCB 1EZSC 5K0HA 2R3YA 1CGJE 1FI8A 3GY8A 1DXWA 5AFZH 2F3CE 1ETTH 1ZRKA 2CF9H 3ZZCA 2BLVA 5DP9A 4MVNA 3SJ8A 3H7OA 2Y5HA 5TCAA 3Q3YA 2G81E 2QGRA 5JBCS 2XOKD 4XE4A 2ZDNA 2BLQA 2TIOA 1OWEA 1XKAC 3AW1A 4ABFA
chains in the Genus database with same CATH topology
2W3IA 5FPYA 2Y5FA 3M35A 1D3TB 1SGNE 3P8NA 3CP7A 5GDSH 1GCDA 2ZU5A 2JKHA 1XX9A 2B5TB 2WYJA 2FI3E 1MKXK 2OQUA 2C3SA 1EB2A 4IC5A 3TK5A 3I78A 2ZHEH 3T27A 1TGBA 4IS5A 1BT7A 3EAJA 4H6TA 3M36A 3SHAH 4YTAA 2WUBA 1UTLM 1V2KT 2GZ9A 5E0JA 3SV9A 5HM9A 4SGAE 1TONA 1TX7A 2BD2A 5DGJA 1ARCA 3E0PB 1RD3B 1QGFA 2OC7A 1Z6EA 3MI4A 4MNWA 3SJKA 2F9OA 2G00A 1QURH 1GMCG 2P95A 1G37A 3TNTA 2Z6BD 1G3DA 1QRXA 4IMQA 1FY4A 2ZU4A 1ZPCA 2G52A 2AGIX 1CBWC 4FUCA 1UVPA 1Y59T 1YPHC 3ZVGA 4AFZA 2FI4E 2BD5A 4X2XA 3T2NA 1ABJH 1S6FA 1WAYB 4YZUA 4YO9A 1BMLA 1G2LA 1O2OA 4AG1A 3A88A 4X0WU 5PTPA 4ISHH 1LCYA 3BEFB 3GDSA 1YLDA 4DCDA 1JRTA 1HJAB 4MG3A 2QYIA 2ZDLA 2J94A 1GHAG 2NU0E 1P04A 1V2RT 1TPPA 3PWCA 1GL0E 2DUCA 3BEUA 4WXVA 1F92A 1MKWH 1C2JA 4ESTE 1ELTA 2XXLA 1BIOA 3R3GB 4X2YA 5LGOA 3SGBE 1ZPZA 1FJSA 4GSOA 1EOJA 3GICB 1LQDB 3DT0H 1KLJH 1OPHB 3LONA 1GJDB 1P2MA 4JK6A 5F8ZA 1MAYA 4ABIA 2CF8H 3SN8A 2FOGA 1GI0A 3RC6A 1SHHB 3QX5H 2P94A 1O3AA 1YPEH 1BTUA 3KQBA 3SZNA 2VWNA 1O2HA 3SUDA 1J8AA 1SL3A 4B2BA 3E90B 5C5NA 4MPVA 1O2XA 3MO9A 4LK4A 3OX7U 1Z1IA 2GCHG 2RA0A 5FXLA 1A0JA 1EQ9A 1AUTC 4OS6A 1QB9A 1KTSB 5HXFA 2O8TA 2WPHS 2GT8A 1GJ4H 1AFQB 4X6PA 1VJ9U 3M61U 1C1RA 4X1NU 1EPTC 1DWEH 2EI6A 2QA9E 4O97A 2FO9A 4NZQA 1LPGB 1ZSLA 2VWLA 1GBIA 1UTOA 4NA9H 3SW2B 1TMTH 3A82A 1P3CA 2FLBH 1BRAA 3A83A 1Y3YA 2OBOA 4FUJA 1IHTH 3SU0A 1BQYA 2A45B 4D9QA 3RXRA 5CE1A 5FPTA 2Z94A 1KXEA 3A7XA 3PO1C 2BXTH 5H4IB 2H1UA 1ANDA 1QJ6B 4J1YA 1S82A 3V12A 1DS2E 1GBAA 4WWYA 2G51A 5E0HA 5FPSA 6GCHG 3E8LA 1LVYA 2BVSH 4UD9H 1ZMNA 2EEKA 5A0AE 4U2WA 1C5SA 2H6MA 1KY9A 3URDA 1OSSA 4JZDH 2I6SA 1QA0A 5EQRA 1O2JA 2FDAA 2FS9A 2GZ8A 1O34A 4GHTA 2BMGB 4TWYA 2ZIQH 5JDUB 1ELGA 3TH2H 3A7YA 2Z9GA 2SGPE 5AVDA 2FOCA 1FV9A 1Q2WA 1GHZA 2ZQ2A 1RTKA 1O36A 1W2KH 5T6FA 3E1XB 2C8YB 1MZDA 1DT2A 2R2WU 1JRSA 2OC0A 2BDBA 4BNRA 1RGQA 4YLUA 1CVWH 1Z1JA 2ZPQA 1RS0A 4Y7BA 3JZ1B 2EI8A 2TGPZ 2FP7B 1GHYH 4AB8A 1OWHA 5EPYA 3Q3KA 2XC5A 3BTTE 1A3EH 3A85A 3LC3A 3SV8A 2STBE 1K1LA 1Y3WA 4WF8A 4WJG2 4DURA 1ZLRA 1O39A 2BVRH 1C5WB 3MO6A 1FUJA 2AGEX 1C5TA 2Y7ZA 1KIGH 4AYYB 3SOSA 4LZ4B 3T5FH 3PMHB 2J92A 1YPLH 1TFXA 2BLOA 4AB9A 2FYRA 4IW4E 4AGJA 4CRDA 1KTTB 3SNAA 3U1JB 1TA6A 1LDTT 2J4IA 3PM3A 4X1PU 2JH0D 4OS2A 1GHVH 4K69A 4Q7XA 1AVGH 2WPLS 3RXJA 1LVBA 3SU3A 5C1UA 5I46H 2CJIA 2RA3A 1V2WT 4THNH 4E7RG 3UTUH 5L2YH 1GMDG 3TH3H 1TGSZ 2F9UA 3MU5A 2PSXA 4AFSA 1ESBA 1SQOA 5C2ZA 1GI8B 1C4U2 4MNVA 2BM2A 2G5NA 2UUFB 2LNCA 1EZUC 2BZAA 4CR9A 1G3BA 2VU8E 3IG6B 3QZQA 3RXMA 4DIHH 1V6DA 4CH2B 1KLTA 1RXPA 4X6MA 4I8HA 1C2FA 1B0FA 3F9HA 1KDQB 3ZZ5A 3I29A 3ESTA 2W7UA 3OTJE 3GY7A 1J9CH 1DX5M 3QLPH 1BRUP 4A1XA 1V2ST 1F5KU 3EBNA 4B2CA 4AG2A 2GX4A 2CGAA 1UTQA 1NN6A 3L3TA 1HAIH 9LPRA 1FAXA 1T8MA 2B9LA 1ACBE 2QF0A 1Z8GA 2GGVB 4IN2A 5E2OA 5GCHF 1P02A 2O8MA 2Y82A 3PROA 4MLFB 4UFDH 1GBMA 5FCRA 3RMLH 4X8VH 2A7HA 2TRMA 1C5XB 3BTEE 1ANEA 1PQAA 1SQAA 5ETXA 1O2GH 4LZ1H 1MU6B 1GHAF 3RC5A 4AORA 3KEEA 1MUEB 2A5KA 5DKMA 1HCGA 2HVXA 2XYAA 2IPHA 1F0UA 4ZAEA 1GL1A 3SUGA 4U30A 3M3TA 1QHRB 1VITF 4I8KA 1O3BA 2ZU1A 1UVOA 3TPIZ 1TPOA 1NRNH 1MQ6A 2FWWA 1KLIH 4AYVB 1PPFE 1N8OC 2ZEBA 3ZZ7A 1P9UA 3CENA 1OWDA 2ZGBH 5EW1H 1CU1A 4IMZA 4O03A 2SNVA 3UNSA 1YP9A 3SV7A 2KAIA 1W12U 4XBCA 1E35B 1GBJA 4ASHA 5L30H 1ZJKA 2W3KA 1O33A 1PPBH 1QRZA 3SUEA 4Y76A 3ATWA 1O2LA 1OYQA 4ZXYH 5LPFA 2FOBA 2PLXA 3BTQE 3S7HB 4NGAH 2YNBA 3ATKA 2BDHA 4ZKOU 1Y5UT 2GDEH 1ZR0A 2A5IA 2JETC 2SGAA 1BBRE 2BHGA 2ZZUH 3TNSA 2SGEE 5EU8A 1XUGA 3RM0H 2BY5X 1O32A 1YC0A 1GJ5H 1XUKA 4H42U 5C5OA 1DSUA 2SGQE 3KQCA 4Y10E 1SBWA 5DO4H 2A32A 5T3HA 3TITA 3STJA 1GVZA 1Y8TA 1ID5H 5FCKA 1GMHG 2B8OH 2XWBI 3PMAB 5E2PA 3SU5A 2VWOA 2FEQH 1HJ8A 5SGAE 1XUJA 1MTWA 2BQWB 2ZFRH 1E34B 4WMFA 1FLEE 3SI3H 3URCA 6LPRA 2BVXH 5EQQA 1IQLA 2GMTB 2VIVA 6GCHF 1LHEH 1CT4E 5ABWA 2PV9B 3KIDU 1HFDA 3S7KB 1AO5A 1EZQA 1GBFA 1MAXA 3K2UA 3AVZA 1AGJA 1AE5A 1MKWK 1SOZA 3D49H 3NZIA 1F0RA 3SGQE 2H9EH 2ZFSA 2ZTZA 5HM2A 3R0FA 2G55A 1IQGA 1KSNA 4ZROA 1UHBA 4KP0A 4X1RU 3BG4B 1SGYE 4K3JA 2FMJA 3OY6U 3TJNA 1AWHB 5F8XA 1TA2A 2ALPA 4ZH8A 1BJUA 1LHGH 1YCPH 4LXBH 1O2ZA 3P8OA 5G4BA 1C5QA 1HYLA 1M9UA 1AQ7A 2VB0A 1E0FD 1PQ5A 2AEIH 3FZZA 1DWBH 1C2LA 1FN8A 3M7TA 1AMHA 1LMWB 1HAXB 1EZXC 5DG6A 1O2YA 1ELVA 4O3TA 1V2NT 1GDUA 4CRCA 3O8CA 4FUEA 3PTNA 3VB3A 1O5CB 1T8LA 4YM9A 2ANMH 3A7TA 3U8TH 3VGCB 1O2IA 3M7UA 1Z7KA 1SGDE 1ELCA 1T7CA 1G30B 3RXUA 1TB6H 3RLYH 3ELAH 2AS9A 3FP8E 4JYVH 2AERH 1YYY1 2R2MB 2SGFE 1C9PA 2O8WA 1GBKA 3BTHE 2CN0H 1LPZB 2A2XH 2EC9H 1OYTH 3SUFA 1EAXA 3TK6A 1TQ7B 5CHAC 3FVFB 1DOJA 3VPKA 3RXDA 1GJ6A 5C67A 1UTKA 5F03A 3PLBA 1INCA 1O3EA 1SGFA 3BTDE 5ESBA 3UWJH 2UWOA 1A1RA 2Y6TA 3PLPA 3D23A 1ZHRA 1GMDF 3RM2H 4TWWA 3SO3A 1QFKH 1NU9A 5HYOA 3DUXH 1P2OA 1K1OA 1WTHD 1C2KA 4K1EA 1LO6A 4YOGA 1TYNA 1A2CH 4AGKA 1T8NA 3FANA 1YPJH 3HK3B 1O5AB 3MU0A 5AHGH 4ZHMU 2ZDKA 3DA9B 1WSSH 1WQSA 2WPMS 2WV4A 6CHAB 1T32A 1TGTA 3B23B 1OP8A 1A5GH 1TNLA 2CXVA 4Y7AA 3O8RA 3A8CA 1CO7E 2GV6A 1U6QA 1P9SA 2QY0B 4KKDA 1GI5A 2FX6A 2TGDA 1AI8H 3C1KA 1G2MA 2TBSA 1CHOG 1EB1H 1SGCA 4X6NA 3P8FA 1CE5A 2BDAA 1BTPA 1C2HA 1ORFA 2QC2A 4QT8C 1QBNA 3RC4A 1P06A 1C1PA 5JPMH 3VFEA 4A1TA 1TBZH 2WPIS 1W10U 3V0XA 1MTUA 2GVFA 3E3TA 4XBDA 3PV4A 4O9VA 3ZZ9A 1NFWA 1AN1E 1YF4A 1O2MA 2Z3CA 4CHAC 4D76A 2PR3A 1VCQA 5LPEA 2VGCB 3EQ0H 4AZ2B 1P8VC 5A0BA 3MH6A 3MU4A 3P92A 4FU9A 3N7OA 3MH4A 1BDAA 3U9AH 4ISNA 2GT7A 4INLA 3P6ZB 5TJXA 3OY5U 4E06H 3ZVCA 4NG9H 9ESTA 1O3KA 1TNJA 4D8NA 1C2MA 1OOKB 3L6PA 4Y8XA 1GVLA 1SQTA 2BD8A 1TPAE 1HAVA 1C5PA 2RG3A 1GBDA 4YESB 3ZVBA 2OC1A 4UFFH 1ZMJA 4Y8ZA 2HOBA 1H8IH 5DP3A 4YT7H 1Z71A 3FP7E 4MTBA 4WY3A 1C2IA 1FXYA 4XOJA 3DFJA 3ITIA 2VINA 2F9NA 1FIWA 1O3GA 5GWZA 2FI5E 1CT2E 1EASA 1PQ7A 3RP2A 4TPIZ 1THPB 2ZDAH 1C2GA 3BTME 1DPOA 3TK9A 1AB9C 2WINI 4JYUH 2O8LA 3GYMA 3VXEH 3MNBA 1Z6JH 3RMMH 2PHBA 3RXIA 2IN2A 1TIOA 2A4GA 1L4DA 4TY6A 3Q3XA 2G4TA 1QL7A 1DM4B 1V2TT 1O5EH 3Q77A 2CHAC 2PGBB 3ZZ8A 1QBOA 4I33A 3TGKE 4UDWH 1GI7B 2ODYB 3RMNH 4ABDA 1V2PT 1FY1A 1ZSJA 2Y81A 3BSQA 3A8BA 1ELDE 2XW9A 3V13A 3AW0A 2QCYA 2ZCLP 1TNKA 4K1SA 1UMAH 4ZHAA 3SU1A 2PGQB 1ABIH 3ZV9A 3BTFE 3TLOA 2VIDA 3PYHA 1BRBE 2GP9B 1AY6H 4UFEH 2P3TB 1XUHA 1C4V2 3FFGA 2D2DA 2XRCA 3LGWA 5FAHA 2ZCKP 4FUGA 2WUCA 1SGTA 2O9QA 4UONA 2F9BH 2KAIB 3FP6E 1SLUB 3AAVA 1OS8A 3V3MA 2O8UA 1GDQA 1NROH 3QO6A 3SU4A 2STAE 4I8GA 2HGTH 2Y80A 4JZ1A 1XUIA 2AGGX 3QWCH 1IOEA 1OKXA 5IYTA 3VB5A 1HAPH 2HNTF 2TGTA 1DLEA 4PROA 3MHWU 2VIOA 5J4SA 4MPUA 1OXGA 5J4QA 3NXPA 2R9PA 5JBAS 2BY8X 1O3DA 1WOFA 1D4PB 2VVCA 3P70B 5IDKA 2M5TA 2OD3B 4KTSA 1AKSB 1O2RA 1O3HA 1RRKA 1C1UH 4FUFA 1YCPM 4DY7B 1TNGA 4HGCA 3LOXA 1MCTA 1EPTA 1IQFA 2C8WB 1OX1A 3W94A 5LH8A 1NU7B 1E38B 3A7ZA 4NA7A 2P8OB 1O3FA 2Q1JA 1W0ZU 1A61H 5A2MH 2AFQB 4OGYA 4B74A 1GG6C 1PFXC 1QTFA 1D3PB 4WXIA 4ABAA 4Y8YA 1MTNB 1L1GA 5JYIA 3SJIA 1MBQA 1O5BB 2ZFFH 1UCYK 2XNIA 4UE7H 5L2ZH 1UTNA 2ZO3H 1CSOE 3ZZDA 3RXHA 5JB8S 2W5EA 3GCNA 4RKJB 4FUDA 5T6GA 1GI6A 8GCHG 2H5CA 5FX6A 2ZHWH 1GBHA 2A4QA 4DOQA 4NFFA 2TGAA 2K7XA 2D1JA 1ZZZA 1EJAA 3S69A 2HNTE 2PKSB 1J17T 1YCPK 1TX6A 1BHXF 1RIWB 4WVPE 4GVUA 4ISIH 3ZYDA 2G8TA 2Y7XA 4VGCC 1V2JT 1GHBG 1C5LH 1WQVH 2ZPRA 4Q2KA 2GCTB 2GKVE 2PKAA 3E6PH 1LHCH 1VGCB 1CT0E 3GCHB 3S9BA 5ESTE 1F0SA 2BX4A 1XMNB 4JK5A 1O2TA 1AE8H 1GCTB 2P59A 1W7GH 2G5VA 4XSKU 2NU2E 1B5GH 1CHOF 4K1TA 5A09A 2ZCHP 3MH5A 1H8DH 4JZEH 3MNCA 5EW2H 4BAKB 1H9IE 1PPGE 1IQHA 4ISLA 2QAAA 3MNSA 1JXPA 1JOUB 2BX3A 1KXCA 5A0CA 3PTBA 1IQJA 1NESE 3SU2A 1V2UT 2ZFPH 4AX9H 1DSTA 4Y6DA 1MKXH 1QIXB 2G4UA 3DFLA 1BA8B 3WY8A 4LOYH 1UVUH 1V3XA 1CA0B 1VZQH 1SLXB 4TY7A 1QB6A 4GCHG 1C1QA 3KN2A 3BTWE 8LPRA 8ESTE 1HAOH 3RXGA 2ANWA 5I25A 1NZQH 4TYDA 1FNIA 1NFUA 5JB9S 1PQ8A 1O38A 2VH6A 1HUTH 3EA9A 1K9OE 1Y5BT 4DVAU 1O5GH 4KTCA 1K22H 1GGDB 7ESTE 3C27B 2BZ6H 1C5YB 1GMCF 3ZZAA 3MWIU 3NPSA 2OXSA 1TBRH 5EODA 3LGVA 4GPGA 3A8DA 1XUFA 1ZTJA 1HB0B 4I8JA 1HJAC 1V2VT 7LPRA 1P57B 2I6QA 2ASUB 2J2UA 4Q80A 3A86A