3SNAA

Crystal structure of sars coronavirus main protease complexed with ac-nsfsq-h (soaking)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Peptide aldehyde inhibitors challenge the substrate specificity of the SARS-coronavirus main protease.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 74
structure length 301
sequence length 301
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-06-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3snaA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3snaA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3snaA02
1SLWB 5FHTA 4O3UA 1V3XA 2ZZUH 3SU1A 4JZIA 1IQHA 1G3BA 2QIQA 1MH0A 1QL8A 5HYOA 1V2QT 2ZKSA 4BOHA 3M7TA 3RP2A 2SGDE 4CRCA 1DANH 1MCTA 1KXCA 3UTUH 1B7XB 2BQ7B 4GAWA 1HAXB 2ZECA 3SOSA 1BTYA 1PPHE 2QXJA 3VB7A 5AFYH 1F2SE 1P3EA 2WPMS 1EOJA 2EC9H 3OY6U 4WWYA 3MU5A 1A2CH 3AVZA 2H1UA 1GHBG 1UTMA 3PLBA 2JH0D 1GJ7B 1OWEA 1SG8B 4RN6A 4ASHA 2UWPA 1MMJN 3H7TA 3ZZ8A 1A61H 2ZPRA 1L1GA 3SGAE 4YTAA 1MTWA 3V7TA 1Z6JH 3KQCA 1A4WH 3O8DA 3EAJA 1O34A 2TBSA 1ARBA 3EE0B 4MTBA 1BMLA 4DIIH 3DUXH 4IC5A 4UE7H 4Y0YE 4WXIA 2VINA 2CHAB 3IG6B 2JETB 1AQ7A 5A09A 1RIWC 1S6FA 3E0PB 1OP8A 1GPZA 4WMDA 1DUAA 2UUJB 1DT2A 1NS3A 1E34B 3I78A 4JZ1A 1P3CA 1CHGA 1QL9A 2THFB 1HV7A 3H5CB 1O3AA 5EU8A 1NRQH 4D9QA 5DP4A 1N8OC 4DCDA 5DP5A 1EQ9A 1O3DA 1TNLA 1O30A 3A82A 2QY0B 2OINA 3GYMA 1FLEE 1WQVH 2PV9B 2AGGX 2O8MA 1GJ6A 3D49H 1SGYE 3FP8E 2VIQA 2VWOA 2BLOA 1ELAA 2BX3A 4JZDH 4CHAB 2ZHQH 3ODDA 1EB2A 1MZAA 1ZHRA 1FI8A 2W3IA 3BG8A 2G5NA 3LKWA 5FPTA 4ZHLU 1XUJA 3GDUA 2ZHEH 1VITG 1NPMA 3UUZA 3LDXH 3Q3XA 4YOIA 1MTUA 1UVUH 1XKBC 2BD2A 2GZ7A 3SJOA 1GHWH 2A7CA 1QB6A 1T8LA 2Z9KA 4ESTE 1DSTA 3GY6A 1UK4A 3UOUA 4MDSA 3A8BA 4OS5A 1O3CA 1SFIA 2Y5FA 2A7JA 1QB1A 5E0GA 2GCTC 1ANCA 1E36B 2C93B 1O2TA 1A0HB 1ABJH 4D76A 1LPZB 2XBYA 1NM6A 1C5WB 4X8VH 2ALVA 3BG4B 4X1RU 2BD7A 1UTKA 1PQAA 2H5CA 2F9PA 3ZVAA 1EOLA 2P94A 1G2MA 4BANB 2BVRH 4CRBA 4YLUA 2FS8A 1GHYH 3KQEA 3A81A 4ZUHA 4LOYH 1A1RA 3BTEE 1E38B 5DG6A 5DP3A 1SOZA 5C5OA 5GCHF 1O5BB 2GGVB 1B0FA 2BD4A 3C27B 1VCPA 3HPTB 3SUEA 3SU4A 2VVUA 1ZHMA 1SBWA 3VGCC 1BBRH 1QB9A 2W7UA 1RTFB 4XBCA 3SNEA 3OYPA 2SGEE 4OS6A 2PKAA 3KGPA 2R2MB 1VZQH 2FPZA 4NZQA 2PFEA 5HM9A 4CRGA 4ABGA 3K6YA 1V2MT 2ZGHA 3FZZA 4Y8XA 3TK6A 5JBBS 2ZFSA 1P2JA 2W26A 1PJPA 2STAE 1PYTC 1VGCC 5AHGH 3K2UA 2F91A 2P8OC 3BTFE 7GCHF 3N7OA 1MTSA 3MMGA 2ZDKA 2G51A 2JH5D 3RLWH 2A2XH 2H9TH 1DWCH 4B71A 3M7QA 3ZVBA 3BEFB 3K6ZA 4A6LA 3URDA 1TOMH 3O8BA 1SGNE 3RXDA 1DX5M 1CGJE 1L2EA 3FP6E 2P3UB 2ZDVH 5L2YH 2WV5A 1E35B 3GOVB 4Y8YA 2J95A 2ZTXA 4NSVA 5AF9H 1P05A 3A7TA 1J17T 1TNKA 1TYNA 1SB1H 3EDXB 3UY9A 2SGPE 3F9EA 1H1BA 3SU2A 4ISLA 1C5NH 4YM9A 1IQNA 1EUFA 2KAIB 1UJ1A 1X7AC 1HNEE 1J15A 3VB6A 1S0RA 4Q2KA 3ZVGA 2C4FH 3BTWE 5HXFA 3RXEA 3SHCH 2LPRA 5BPEA 3CP7A 4BTTB 1BOQA 3SV8A 4B2BA 3ENSB 5C20A 1O39A 5ABWA 1TPSA 2H9EH 1QURH 3RXHA 4ZHMU 1NO9H 5EW2H 1BQYA 2PTCE 4ISOA 4FVBA 3SV2H 4SGAE 4OGXA 2P93A 4MNVA 1RIWB 5E8EH 1BRCE 1P2OA 1A46H 2C3SA 1ZJDA 1O2WA 1AVXA 1ZGVA 1AB9C 1OP0A 2C8XB 1WOFA 1Q2WA 2GT7A 4F49A 1FY3A 1N1LA 1TALA 2OD3B 1V2WT 4R0IA 4D7FA 3U1JB 2F83A 1K2I1 1Z8JB 1B5GH 3SV9A 1F0UA 1YPEH 5E0JA 3TU7H 5G4BA 2ZCLP 2ZC9H 3RMOH 4FUDA 1YYY1 1HLTH 1XMNB 2BY6X 1EAUA 1XXFA 1GMHF 3QX5H 1AGJA 3RXGA 3TK9A 3MU4A 3T26A 2BZAA 3SU3A 1GJ8B 1EKBB 1SQTA 3UFAA 3P8OA 3ZZ5A 1W2KH 2F9NA 3F6UH 2AMQA 1Y5BT 1YCPM 2PGQB 3JZ1B 3PMAB 2W7SA 3SN8A 1ZLRA 3M5LA 2PUQH 5DP9A 3S7HB 1DITH 1CA0C 3PLKA 1FQ3A 2R2WU 2GV6A 4Y79A 2WUBA 2QA9E 1BDAA 1UTQA 1AKSB 1KDQB 4JZEH 1TQ7B 2BTCE 2FYQA 2OBQA 1WV7H 1NZQH 1W8BH 3M7UA 3Q76A 1GI3A 1G3DA 4NA8A 2BQ6B 1XX9A 3P70B 1GL0E 1W7GH 4WH8A 5L2ZH 3Q77A 1ZJKA 2WV4A 5FAHA 5FPYA 4BAHB 2B5TB 4E06H 1Z8IB 2PWXA 3SBKA 4AG1A 1CHOG 4LZ1H 4BAMB 5JB8S 1TOCB 1JOUB 1O3EA 3B9FH 2FESH 1SQOA 5JDUB 1HJAC 2PKSB 1K1LA 2UUKB 3SORA 1UHBA 3SGBE 1QR3E 5F03A 6CHAB 1P03A 3UWIA 1QHRB 5GPIB 2QYIA 2ZU2A 4O03A 4A5TS 2O8LA 1FAXA 3QWCH 1CE5A 1G9IE 3ZZ3A 2BZ6H 1GBDA 1LPKB 2FYRA 1HAVA 1TNJA 1C4V2 1QY6A 4ABAA 2GD4B 3FZDA 1UK2A 1YKTA 1GJ5H 1MTNB 3R3GB 1BMAA 2V35A 1RFNA 2OCVB 1O2RA 2WPIS 3HGPA 5FX6A 1C2LA 2ZGJA 4TY7A 5J4SA 1BRUP 1O2SA 2XBWA 5DK1A 3LGIA 3M36A 1D3TB 1KLIH 1EZUC 1O2XA 4X8TH 3I29A 1TGNA 4THNH 1LQEA 2ZEBA 2ZDAH 1P2NA 2ZWLH 1RRKA 2B8OH 1A5GH 1IQMA 1QIXB 1TWXB 4A1TA 3SI4H 1GI7B 2ZIQH 2F9OA 1EPTA 2VIVA 4OS1A 3MO3A 1SSXA 3SNAA 1FY4A 3MH7A 1BTPA 3A8DA 1T32A 3GCTF 1W14U 2FI4E 3HKIB 4FUFA 3RMMH 1LVMA 3B8JA 2GDDA 2ZF0H 3MTYA 1E0FD 1F5LA 1OWDA 7GCHG 1L1NA 3LGVA 1LVYA 1GI4A 2VNTA 5C2ZA 3SU6A 1BRAA 3KCGH 1O2JA 1MU6B 3BIVH 4X8UH 3ZZ7A 3QZQA 4BAQB 1NROH 5EPNA 2V0BA 3EA9A 1JIMA 3DT0H 1O2NA 5A8ZA 1XKAC 3QGNB 1KY9A 1HJ8A 1O2OA 1DM4B 2FX6A 1H8IH 4AN7A 2ZFFH 1V2RT 4SGBE 2C8WB 9LPRA 1LDTT 1TABE 3ZZCA 4X6OA 1GJ4H 1ZHPA 2PSXA 1TONA 3PTNA 4AGJA 3PMJA 2ZO3H 2EI8A 4B75A 2AIPA 2XCFA 1IHTH 3CS7A 2R3UA 3VXFH 2IN2A 2I6SA 4GPGA 3QN7A 2ZHDA 4OS4A 5TJXA 4JMYA 2Y7XA 2XXLA 4JK5A 2G5VA 1ZMNA 5CHAC 1O38A 1XUGA 2QV1A 3M37A 3RU4T 1TIOA 2ZFRH 3ODFA 2A45B 1FDPA 1GBJA 1Y5AT 4K2YA 1O5AB 4Y76A 3RXKA 3BTME 3K9XB 2QF0A 1F0SA 2ILNA 3QGJA 1V6DA 4RKOB 1EJNA 5PTPA 1JBUH 4E7NA 4AORA 1Z7KA 1UVOA 1VJ9U 4Z6AH 2OC0A 1O3OA 1ELBA 1TPAE 1O3FA 1IHSH 3KNXA 1OS8A 1CA8B 1UTOA 2ZDLA 1HAHH 4BAKB 1O33A 5A2MH 2YOLA 2BLQA 3BSQA 5EG4A 3QO6A 1O2MA 2OUAA 1ETTH 1MAYA 3TGJE 1VR1H 1OOKB 3A89A 4TWWA 2GZ8A 2J94A 4K8BA 3KIDU 3PO1C 4AFZA 1KYNA 1O3GA 4KKDA 1PPZA 1WTGH 4AZ2B 3E6PH 3MH6A 2V6NA 2ANWA 1UTPA 1YF4A 3U98H 2QXGA 2ZCHP 1LHEH 2ZPSA 1O2GH 1HAYB 1YPGH 2BDGA 3O8RA 2A7HA 2Z3CA 2ZPQA 4KP0A 1Y3YA 1FJSA 1ZTLA 1GCDA 3Q3YA 4VGCB 2G4TA 1MD8A 2H5DA 1UVPA 1DUEA 1AFQC 3AAUA 3LJOA 1SQAA 1IQIA 4U2WA 1CSOE 2FO9A 3A7YA 1C2HA 3A8AA 1TMTH 3MFJA 2A1DB 3BTTE 3UQOA 1H4WA 2VGCC 3PTBA 1OYTH 1O2YA 4ISIH 2PW8H 3MU1A 4AX9H 4Y10E 1TBQH 4NIVA 1AMHA 2XNIA 3W94A 1GBEA 2ZFPH 2OBOA 4FU9A 2ESTE 3NWUA 4O3TA 2ZGXH 4KTUA 1O35A 1P9UA 3UPEA 4IS5A 1MKXH 1SR5C 1ELEE 3F68H 2A5KA 3QK1A 1UVTH 2CGAA 2GV7A 4F4OC 2P3FH 1O5FH 3GCHB 3ZV9A 3UIRA 1LQDB 1HDTH 3EQ0H 1HIAA 1AI8H 4UFDH 2VB0A 4XE4A 3G01A 1PQ5A 2Z3DA 1O0DH 1FUJA 3VEQB 3RXUA 4MPWA 2BB4A 1A5HA 4XOJA 1C5PA 4ZKOU 4B2AA 4RSPA 1PPGE 3GDSA 2CN0H 3WY8A 1SGPE 4GLYA 1HAGE 2ZNKH 3S9AA 1Y8TA 7KMEH 1GG6C 1TPOA 2HVXA 1F5RA 4MNXA 2BOKA 1T7CA 3UR6A 3EYDA 4NFEA 3MNSA 3LOXA 4GSOA 4A1VA 1U6QA 5IYTA 2FWWA 2IPHA 3A7VA 5A8YA 4UFEH 1HFDA 1BHXB 3LU9B 3PMBB 1ZRBA 3NCLA 2A4OA 3SO3A 1H9LB 1NU9A 4TPIZ 3RXFA 1WUNH 5DO4H 1MD7A 1W3CA 2PGBB 1T31A 2HPQH 1P04A 1BIOA 2LNCA 5BRRE 3SJKA 2FOBA 2ZFQH 1A0JA 1WBGB 1WSSH 1L4DA 1V2TT 1CHOF 1SGIB 4DT7B 1LCYA 1OYQA 2VWNA 3IITA 3GCTG 4BXWA 1GJBB 4X2VA 4HFPB 5LPEA 2R0KA 4B74A 3KF2A 4LXBH 3LH3A 4GUXA 3SV7A 3ITIA 2ULLA 5EOKA 5C67A 1D9IA 3UNRA 3KHVA 4HZHA 4CH8B 2TRMA 4Y71A 1H8DH 2XWAA 3SUFA 3CS0A 1GHZA 2W5EA 8LPRA 2ZP0H 1V2VT 3KQBA 4X2YA 1T4UH 3A84A 4U01A 5GDSH 4ZMAH 1MKWK 1YPLH 4YOGA 3GY8A 1JMOH 1EP5A 3V12A 2BLWA 3GCOA 3DA9B 5ESTE 4XBBA 5GXPA 2CF8H 3E91A 3NUMA 2PKAB 1ZR0A 1UCYH 4K60A 1YBWA 2G8TA 8ESTE 1GJAB 1DICA 2ZHWH 1SVPA 3ZZDA 1GCTC 3RU4E 3RDZA 1W12U 1ZMJA 4IMQA 5B6OA 4TYDA 3PV4A 1BTWA 2BDYA 3FVFB 1VJAU 1CBWC 4DW2U 3BTKE 3TVJB 1S5SA 3PWCA 5C1XA 3RXVA 4X6NA 4UFGH 5TCCA 2EEKA 1GJCB 3S9BA 4NG9H 1EATA 4WMFA 3P17H 4MNYA 5LH8A 1YPMH 1V2PT 1NRNH 3QLPH 2UWLA 1EAWA 1GBAA 2GMTB 4ZH8A 4GVUA 1Y5UT 2OC8A 3ZZ9A 4MG3A 4FUHA 1K21H 3HKJB 5DJ7A 5C5NA 2FLBH 3A80A 4NWLA 3VB5A 1QRXA 2STBE 3GDVA 3EBNA 1EPTC 1C2KA 1Y3XA 2FOEA 5GIBA 1NRPH 7LPRA 4XFQA 1C4Y2 2BQWB 1CVWH 1DDJA 4IC6A 1AFQB 5K0HA 1O32A 1FIZA 4D7GA 3BEIB 3TPIZ 2GKVE 2CMYA 1NESE 1VITH 4OGYA 1FIWA 2OC1A 3LGYA 1CT0E 3HATH 1GDUA 1O3HA 1C9TA 2WINI 3MYWA 1EZXC 1C5OH 2XYAA 2TIOA 1O2LA 4ABBA 1FAKH 4FUJA 3JZ2B 4INLA 4IW4E 1J9CH 4X8SH 1DY8A 2D26C 1LVOA 2VIOA 1O5CB 2WPJS 1F0TA 1B0EA 2PLXA 2BY8X 4ZKSU 2AH4X 1NRSH 1SGCA 2EI6A 1C1PA 3LC5A 4I33A 2Y7ZA 3SJIA 4TWYA 3F9GA 1CQQA 5CMXH 1AVGH 3BTDE 2SNWA 1K1IA 2FIRH 4H6TA 4A7IB 1A5IA 1GHAF 3GICB 1AZZA 3LC3A 2R0LA 1HPGA 1P0SH 2AERH 2RA3A 1TNHA 1AUJA 5GWZA 1IQJA 2FMJA 1Q31A 1KIGH 4U32A 1Z1IA 1XUKA 5DP7A 1TRNA 4ABFA 3S69A 1C5MD 1ELGA 2R9PA 4ZXXH 3VB4A 1ABIH 5JPMH 1HAIH 1CGHA 1OWIA 2FLRH 4WXVA 3VFEA 3V13A 2XC0A 2D2DA 1N8OB 1C5QA 2ZU3A 3RXMA 1O5GH 4O97A 2BYAX 2WPLS 4I8GA 4NZLA 6LPRA 1V2OT 3MNBA 4X1SU 4JYTA 2Z6BD 1N6XA 1PPCE 4WF8A 1W10U 3OX7U 5AFZH 1TGSZ 5GJ4B 4KELA 1EZQA 1FV9A 2BLVA 1NY22 2FTMA 1AE5A 4HTCH 4YO9A 9ESTA 2VWMA 4K1EA 4ABIA 2H9HA 2XBXA 5IDKA 1GMCG 4ZKNU 1TPPA 1F0RA 3LT3A 1MZDA 1O2UA 4ZHAA 5F8ZA 1DWEH 2BDBA 4R8TB 4OS2A 1ARCA 1Y3VA 2XC5A 4E7RG 3PM3A 1EJMA 2XBVA 1EAIA 3NZIA 1S82A 2HPPH 1C5XB 5DP8A 1YCPK 4ABEA 3S0NA 2GP9B 2AMPA 2VVCA 5HMAA 3SV6A 1YC0A 3A7WA 1ZPBA 5C3NA 1LKBA 1GBTA 1QTFA 2QAAA 2GCTB 1LMWB 4XDEA 1K28D 1AO5A 1ZSKA 1GBBA 3M5MA 5AVDA 1GWAA 1ELVA 4E05H 2Z3EA 3OY5U 4UFFH 3RC5A 3QZRA 4ZAEA 3UR9A 1AIXH 2JKHA 4Z0KA 1C1WH 4D9RA 1IQKA 4AFUA 3S9CA 1YPHC 1GMDF 1DVAH 4FUCA 4X0WU 5F6MA 5FCKA 1IAUA 4UD9H 3VGCB 1P8VC 4O9VA 1GGDC 2O9QA 1SLXB 1MQ6A 5EQSA 5T6DA 3EA8A 5L30H 1O2HA 4CRDA 2AIQA 3MNXA 2GZ9A 1KDQA 1QBOA 1ESTA 5A0CA 1KXBA 2EI7A 5FPSA 2BM2A 1AWFH 3E0NB 2OTVA 1GVZA 1QQ4A 2BDIA 1ESAA 2WYJA 1XVOA 2HNTF 2NWNA 1QQUA 4ABHA 1MKWH 1VGCB 1CT4E 1HYLA 1G37A 4WY3A 2P8OB 4I7YH 1P2MA 1XXDA 3VPKA 4OS7A 1GBLA 1YPHE 4ISNA 4AFQA 1WCZA 2ZU4A 1HAOH 2Z9IA 2FOAA 1O2KA 3D23A 3SGQE 1P02A 4K1SA 3T2NA 1S6HA 5FX5A 1QJ1B 1GBKA 2WPHS 1BT7A 2BY7X 1AWHB 4FUGA 3NK8A 1ESBA 4WH6A 1DXPA 1GBCA 1S0QA 3B23B 1LHFH 2WUCA 1BTXA 1P9SA 5A8XA 4H6SB 1RGQA 1PYTD 3TIUA 1PPBH 1EP6A 4YESB 4B1TA 3RM0H 4NFFA 1C1MA 2AS9A 3DHKH 3TK5A 1HUTH 1C1OA 4INHA 3UREA 1INCA 2O8UA 3UWJH 2VU8E 3LH1A 2HNTC 5K7RA 4MPUA 4CREA 4IN2A 3T5FH 4IMZA 1RTLA 1KXEA 2YNAA 5L6NH 1BMNH 2UUFB 2NU3E 1C2MA 1G30B 1P12E 1T8NA 2J38A 3ESTA 2CXVA 5F8XA 2P59A 3M3VA 2CHAC 2JETC 2FS9A 1WAYB 2SGAA 1FNIA 1MBQA 4MLFB 4JYVH 1V2JT 3F9FA 1MQ5A 1TQ0B 1C1QA 1ELDE 3LJJA 1O3IA 2P95A 4I32A 2HNTE 2AMDA 2M5TA 1YPKH 1F5KU 1FY5A 1AB9B 5C1YA 3SHAH 3VB3A 1TBRH 1UMAH 1C2DA 2ZG0H 4X1QU 1KTTB 2SNVA 3IWMA 3L33A 1EAXA 2PHBA 3M5OA 4AG2A 1L4ZA 1YP9A 1ELCA 2ANYA 1V2UT 1A7SA 1DPOA 1SGQE 4CHAC 1P01A 1HAPH 1GVKB 2JH6D 1GHAG 1QL7A 1G2LA 2A0QB 1BMMH 1O2QA 2RA0A 1BBRE 1FY1A 3A8CA 1S81A 1S85A 1Q3XA 4I8JA 2ODQA 3OU0A 1CA0B 5ESBA 2K7XA 3D62A 3MI4A 1ID5H 1F7ZA 1UTLM 3GY5A 2RDLA 1FN6A 1D6RA 2OLGA 1P2QA 1SL3A 2BD9A 4PROA 3ZVCA 4Q80A 2GT8A 2F9VA 4B2CA 2BD3A 1BTHH 5DGJA 1ZYOA 1ZSJA 1BZXE 3QTOH 1OWJA 2BVXH 1J16A 1THPB 2QGRA 1VCQA 1WU1A 1DXWA 1HCGA 1K1JA 3BG4C 1EJAA 2ZTYA 1RD3B 1SFQB 2VIDA 2ZQ1A 3L6PA 2QN5T 3DFJA 1MUEB 4GHTA 3ZZBA 4QT8C 1FXYA 4H42U 1K9OE 1GI2A 4J2YB 3RMLH 1IQFA 2I6QA 3M61U 2FI5E 1G3CA 1MU8B 3BIUH 2Y81A 1HJAB 3A88A 2FOHA 2FXRA 1RJXB 1JRSA 4K1TA 4XBDA 3SI3H 2ZHFH 1HJ9A 1TNGA 2ODYB 2BOHB 3DD2H 3TNSA 1NFUA 1ETRH 1O3PB 4CBNA 3SNBA 1HB0B 1HIAB 4X2WA 2WPKS 1BTZA 3BTHE 3ATMA 4J1YA 3V3MA 1SGDE 2VH0A 3RXAA 3P95A 3FAOA 5DP6A 1C2IA 1O31A 5FCRA 2C8ZB 2VVVA 2FM2A 1TX8A 1EXFA 4CH2B 2ASUB 5EXMA 3H7OA 4LZ4B 1BUIA 1H9IE 4HGCA 4Y7BA 2Y5GA 5EXLA 1AZ8A 2NU4E 1TBZH 2WYGA 1O3JA 2PSYA 2VIWA 1PPEE 3EGKH 1GI5A 2AFQB 1DY9A 1RTKA 1V2NT 2HWLB 1GMDG 1NC6A 2HOBA 1W0ZU 2ZTZA 3U9AH 2HGTH 1C1VH 2ANKH 4AB9A 1GI0A 2A5AA 2W3KA 1O2ZA 4D8NA 1YPJH 5EPYA 3TITA 2GDEH 3TLOA 1D3PB 3TGIE 1TGTA 2ZGCA 1Z6EA 1ZSLA 3W95A 1Y59T 2HLCA 5FBIA 1SMFE 2CV3A 2BX4A 3MO9A 1GMCF 1O5EH 2XTTB 2ZGBH 1NTPA 1OKXA 4TPYA 2D1JA 3GY7A 3T28A 3VXEH 4AB8A 1HXFH 2P3TB 1NFXA 1G36A 1ZRKA 3M35A 4DOQA 1W0YH 1BJUA 1KXAA 2Z7FE 1UTNA 1W11U 4X2XA 3RXQA 1ELFA 3LGTA 1O3BA 4NIXA 2F9BH 3E3TA 1KLTA 4FXGH 2G55A 1C5UA 2SGQE 1BB0B 2OC7A 4Q7ZA 3LIWA 4IBLH 1AE8H 1SPJA 4DIHH 1P06A 5JB9S 3TGKE 1MCVA 1ZTJA 3TH2H 7ESTE 3P8GA 5LPFA 1J8AA 2LIZA 5TCAA 4Y6DA 1C1SA 2BHGA 2BDHA 3U8RH 3PLPA 1FONA 2A4GA 2DE9A 5CHAB 2DUCA 1YM0A 4ZKRU 1GBHA 3V0XA 1P11E 2TPIZ 3FANA 1SC8U 2BDCA 2ZDMA 2G00A 4DURA 3RXSA 1FN8A 2BD8A 2FZZA 5EODA 5H4IB 1ZZZA 4AYYB 3MHWU 1TAWA 3GISB 1TB6H 2NU1E 1PQ8A 4AYVB 4UONA 1W7XH 2ODPA 4K3JA 2SFAA 1LHGH 3A85A 3ZVFA 1JWTA 3HGNA 3SNDA 3FFGA 1NFYA 3GY2A 3RXIA 3UOPA 1O37A 2PTNA 1T8OA 2ZU5A 2O8TA 1C2JA 2IJOB 3ATWA 3NPSA 1PFXC 1D3QB 2XCNA 2OP9A 4X1PU 4BTIB 2V3OH 1TX6A 3PO1B 1OWHA 1FY8E 4NGAH 1O2VA 1GI9B 1G3EA 1OWKA 2FOCA 2NU0E 5J4QA 1SI5H 2PUXB 1QBNA 1ANBA 3LGUA 1ETSH 4U30A 1DOJA 3HK6B 2F9UA 2QC2A 2RCEA 1GBFA 2C90B 6GCHF 2PKSC 1S84A 4Y7AA 1TGBA 1FMGA 1EX3A 3S7KB 1O2IA 2FODA 3ATKA 1P57B 6CHAC 3A83A 1IOEA 3CENA 3STIA 1LTOA 3PYHA 3MNCA 4Y8ZA 2ZCKP 3SNCA 2OXSA 3SZNA 1V2KT 4FUEA 3GCNA 1OP2A 1KXDA 1K1PA 2GCHF 3MO6A 2UUYA 2QF3A 4NWKA 4Y11E 1EASA 2VGCB 1XVMA 3OTJE 3ZV8A 8GCHF 2Q6FA 3LPRA 1FZZA 1ZOMA 5E0HA 3OSYA 2BY9X 5ETXA 4X1NU 2Z9LA 3KN2A 1MTNC 4AFSA 1LHCH 1D6WA 1TMBH 1C2EA 3EA7A 3KEEA 2XRCA 1IQLA 3ATIA 1GI1A 5HM2A 3ZYEA 1QJ6B 2BD5A 2FX4A 4MVNA 5EW1H 2BDAA 2TGAA 1Y3UA 5E2PA 4IGDA 2J9NA 1O3MA 2Y5HA 3GY3A 2B0FA 1XUIA 2GVFA 1E37B 1DE7H 2Y82A 1QA7A 3ZVEA 3NKKA 3HK3B 5T6FA 1QA0A 1GI6A 1OPHB 3PB1E 4BNRA 3P8NA 2BXUH 2ZDNA 4GCHF 1GG6B 2ZU1A 2FTLE 3BF6H 1JRTA 1TX7A 3E8LA 3C1KA 3U8TH 4CBOA 1J14A 1ZGIA 1OX1A 3SJ8A 4WVPE 3M3SA 1L0ZA 1O3NA 3BTGE 4A92A 1TLDA 4YOJA 4ZXYH 3BEUA 3RXPA 2O8WA 1GBIA 3DFLA 2VH6A 1TRMA 3E16B 3U69H 4NIYA 2J92A 2PR3A 1MAXA 1N6YA 1O3LA 3P6ZB 4BTUB 3ZZAA 4K5ZA 1C1TA 2ALPA 2KAIA 2ZFTA 2G52A 1HXEH 1BITA 3TJNA 4MNWA 4KGAA 2A31A 2GX4A 4H4FA 1TE0A 4FUBA 5JBAS 1A3BH 3T62A 1SLVB 2F3CE 1P10A 1XUHA 2J2UA 3BN9A 3RUOA 3TH3H 3LONA 3ZVDA 1GHVH 1A0LA 1KTSB 4MPVA 2ZI2H 1O36A 1DS2E 2J34A 3U8OH 3E90B 1HBTH 1SGFG 1ANEA 1AHTH 4NA9H 1KXFA 1QGFA 1LHDH 1F92A 4ABJA 4WMEA 1GI8B 3TNTA 1LPGB 4NSYA 1D4PB 2XC4A 4JZFH 4UEHH 1UHBB 4Q7YA 1LVBA 2FOMB 1C5VA 4HI3A 1H9HE 2Z94A 2P16A 5JBTA 2AGEX 1WTHD 1C9PA 4B76A 2BXTH 1C1RA 1SGRE 1GJDB 5C1UA 2CJIA 3GY4A 1K1NA 3T25A 3NXPA 1C1NA 3RXCA 1CU1A 3UNQA 3RU4D 3BTQE 5A0BA 1SGFA 1GCTB 5LPRA 2H2ZA 2Y80A 1HAVB 3L3TA 3A86A 3RXTA 3URCA 1CBWB 1MKXK 4JYUH 4I31A 3RMNH 3ZZ4A 3SJ9A 3AASA 3RXBA 3RXRA 4FU7A 2A4RA 3RXLA 1S83A 1NN6A 4GHQA 4CRFA 2K1QA 4YT6H 1Z8GA 2HRVA 1P2IA 3ELAH 4XSKU 3Q3KA 1NU7B 1YLDA 2CF9H 1AKSA 3I77A 1AFEH 1GHBF 2TGDA 2A32A 4VGCC 1TFXA 2VIPA 3MOCA 5EQQA 2Z9GA 5F8TA 3R0FA 5E2OA 5LGOA 1Z1JA 1BTUA 3T29A 3TJUA 5JYIA 2Q6GA 1C5TA 1EPTB 2FDAA 4I8LA 4BAOB 5FBEA 3ATLA 4NIWA 1CT2E 1LKAA 1EB1H 1L1JA 4WJG2 1DLKB 2VJ1A 1GJ9B 4YT7H 1AU8A 2D8WA 1CGIE 1TGCA 4AGKA 4I8KA 2ANMH 5DPAA 4MPXA 1NFWA 2FI3E 1WYKA 1Z8RA 3SU5A 1BCUH 1C5LH 1DWDH 2G81E 4KTCA 1C5SA 5EGMA 1GBMA 1YGCH 4ZROA 1A3EH 1QBVH 3QDZB 1C2FA 3A7XA 2XW9A 1QCPA 1ACBE 2HALA 2QCYA 2OQUA 2TGPZ 1OSSA 1HAZB 3TJVA 2A2QH 1YLCA 1SHYA 1BRBE 1BHXF 6GCHG 1Z71A 2BMGB 3MU0A 3ZYDA 3GCHC 3LGWA 5GCHG 1SGEE 3K65B 1UTJA 1UO6A 3QTVH 6ESTA 1P09A 1QJ7B 1IQEA 1K22H 4RKJB 4Y0ZE 2Q1JA 1AD8H 2V3HH 3A7ZA 4B73A 4K8YA 2GCHG 1RS0A 1AN1E 5EQRA 1SGTA 3F1SB 1C1UH 2ZQ2A 3KQDA 3RC4A 1TNIA 4CR9A 4DG4A 1TMUH 2VWLA 8GCHG 1ANDA 1EZSC 1VITF 2Y6TA 1V2ST 1THRH 1C2GA 2TGTA 1O5DH 2OQ5A 1XUFA 2XWBI 2GTBA 3TJOA 3BV9B 2NU2E 5I46H 1GDNA 1JXPA 3KL6A 5JBCS 1K1OA 3GYLB 1UCYK 3RXJA 1DLEA 2ZA5A 4NA7A 1K1MA 2YNBA 1UCYE 4YLQH 1AUTC 1O2PA 3AW0A 2BVSH 4NCYA 4FVDA 3M3TA 1ELTA 1C5YB 1P2KA 1M9UA 3TH4H 3SUDA 2FOFA 5T6GA 3QUMP 3PROA 4JCNA 1GL1A 3D65E 3SQEE 2BY5X 3Q00A 4I8HA 3SUGA 1BA8B 1QRZA 1W13U 5I25A 5T3HA 1BBRK 2EA3A 3O8CA 2FOGA 1LO6A 1KSNA 1MTVA 1TRYA 2AEIH 2SGFE 1IQGA 4TY6A 4ISHH 1KLJH 3SW2B 1TA6A 4GCHG 4MQAA 2G4UA 1AVWA 1UK3A 8KME2 1ZMLA 1JIRA 4JK6A 1DSUA 4LK4A 4UDWH 4KTSA 2C8YB 4DVAU 1THSH 1O3KA 3A87A 2J4IA 1ZPCA 2AGIX 1PPFE 2FP7B 5FXLA 3RC6A 1GHXH 2DE8A 1BJVA 4A1XA 3U1IB 3F9HA 1VCWA 2UWOA 1QNJA 1SHHB 2B9LA 1D3DB 3PWBA 1DWBH 1C4U2 1HGTH 3FP7E 3E1XB 4X6PA 1T4VH 1XM1A 3MH4A 2A4QA 2H6MA 4FU8A 2Q6DA 5DKMA 2AYWA 5A0AE 2QXHA 5HGGA 3RXOA 4ABDA 3T27A 1ZPZA 1NT1A 1QRWA 1RXPA 2B7DH 4DY7B 1FPHH 2A5IA 5EXNA 4DJZB 1SLUB 1GDQA 1AY6H 4DGJA 2FEQH 4FUIA 4M7GA 3SQHE 1C5ZB 4YZUA 1WQSA 1FPCH 1UVSH 1PQ7A 5SGAE 1SOTA 1C5RA 2IOTA 1GMHG 1NRRH 3ZZ6A 3RM2H 1DFPA 4CR5A 3P8FA 4X6MA 2GMTC 3AAVA 3STJA 1GGDB 1TA2A 1GVLA 1G32B 1Y3WA 3AW1A 1QFKH 3RLYH 4Q7XA 1CO7E 3SU0A 4AOQA 3UNSA 4INKA 3MWIU 3UQVA 3MH5A 4IN1A 1ORFA 1V2LT 2Z9JA 3P92A 2RG3A 3M5NA 2R3YA 5CE1A 3PMHB 1HRTH 4BXSA 1OXGA 1ZTKA 2QXIA 1YCPH 4CRAA 1T8MA 3MU8A 1MBMA 4K69A
chains in the Genus database with same CATH superfamily
1SLWB 5FHTA 4O3UA 1V3XA 2ZZUH 3SU1A 4JZIA 1IQHA 1G3BA 2QIQA 1MH0A 1QL8A 5HYOA 1V2QT 2ZKSA 4BOHA 3M7TA 3RP2A 2SGDE 4CRCA 1DANH 1MCTA 1KXCA 3UTUH 1B7XB 5HIYA 2LELA 2BQ7B 4GAWA 1HAXB 2ZECA 3SOSA 1BTYA 1PPHE 2QXJA 2WSSD 3VB7A 5AFYH 1F2SE 2KCOA 1P3EA 2WPMS 1EOJA 2EC9H 3F2GA 3OY6U 4WWYA 3MU5A 1A2CH 3AVZA 2H1UA 1GHBG 1UTMA 2XNDD 3PLBA 2JH0D 1GJ7B 1OWEA 1SG8B 4RN6A 4ASHA 2UWPA 1MMJN 3H7TA 3PRDA 3ZZ8A 1A61H 2ZPRA 1L1GA 3SGAE 4YTAA 1MTWA 3V7TA 1Z6JH 3KQCA 1A4WH 3O8DA 3EAJA 1O34A 2TBSA 1ARBA 3EE0B 4MTBA 1BMLA 4DIIH 5HKKD 3DUXH 4IC5A 4UE7H 4Y0YE 4WXIA 2VINA 2CHAB 3IG6B 2JETB 1AQ7A 5A09A 1RIWC 5KEDA 1S6FA 3E0PB 1OP8A 1GPZA 4WMDA 1DUAA 2UUJB 1DT2A 1NS3A 1E34B 3I78A 4JZ1A 1P3CA 1CHGA 1QL9A 2THFB 1HV7A 3H5CB 1O3AA 5EU8A 1NRQH 4D9QA 5DP4A 1N8OC 4DCDA 5DP5A 1EQ9A 1O3DA 1TNLA 1O30A 3A82A 2QY0B 2JIZD 2OINA 3GYMA 1FLEE 1WQVH 2PV9B 2AGGX 2O8MA 1GJ6A 3D49H 1SGYE 3FP8E 2VIQA 2VWOA 2BLOA 4ACAA 1ELAA 2BX3A 4JZDH 4CHAB 2ZHQH 2J5UA 2JJ1D 3ODDA 1EB2A 1MZAA 1ZHRA 1FI8A 2W3IA 3BG8A 2G5NA 3LKWA 5FPTA 4ZHLU 1XUJA 3GDUA 2ZHEH 1VITG 1NPMA 3UUZA 3LDXH 3Q3XA 4YOIA 1MTUA 1UVUH 1XKBC 2BD2A 2GZ7A 4P02A 3SJOA 1GHWH 2A7CA 1QB6A 1T8LA 2Z9KA 5CDFE 4ESTE 1DSTA 3GY6A 1UK4A 3UOUA 4MDSA 3A8BA 4OS5A 1O3CA 1SFIA 2Y5FA 2A7JA 1QB1A 2WV9A 5E0GA 2GCTC 1K0HA 1ANCA 1E36B 2C93B 1O2TA 1A0HB 1ABJH 4D76A 1LPZB 2XBYA 1NM6A 1C5WB 4X8VH 2ALVA 3BG4B 5C0TA 4X1RU 2BD7A 1UTKA 1PQAA 4AC9A 2H5CA 2F9PA 4FETA 3ZVAA 1EOLA 2P94A 1G2MA 4BANB 2BVRH 4CRBA 4YLUA 2FS8A 1GHYH 2KX4A 4M9FA 3KQEA 3A81A 4ZUHA 4LOYH 1A1RA 3BTEE 1E38B 5DG6A 5DP3A 1SOZA 5C5OA 5GCHF 1O5BB 2GGVB 1B0FA 2BD4A 3C27B 3F0OA 1VCPA 3HPTB 3SUEA 3SU4A 2VVUA 1ZHMA 1SBWA 3VGCC 1BBRH 1QB9A 2W7UA 1RTFB 4XBCA 3SNEA 3OYPA 2SGEE 4OS6A 2PKAA 3KGPA 2R2MB 1VZQH 2FPZA 4NZQA 2PFEA 5EJ1A 5HM9A 4CRGA 3PV5A 4ABGA 3K6YA 1V2MT 2ZGHA 3FZZA 4Y8XA 3TK6A 5JBBS 2ZFSA 1P2JA 2W26A 1PJPA 2STAE 1PYTC 1VGCC 5AHGH 3K2UA 2F91A 2P8OC 3BTFE 7GCHF 3N7OA 1MTSA 3MMGA 2ZDKA 2G51A 2JH5D 3RLWH 2A2XH 2H9TH 1DWCH 4B71A 3M7QA 3ZVBA 3BEFB 3K6ZA 4A6LA 2YMSC 3URDA 1TOMH 3O8BA 1SGNE 3RXDA 1DX5M 1CGJE 1L2EA 3FP6E 2P3UB 2ZDVH 5L2YH 2OK5A 2WV5A 1E35B 3GOVB 4OM9A 4Y8YA 2J95A 2ZTXA 4NSVA 5AF9H 1P05A 3A7TA 1J17T 1TNKA 1TYNA 1SB1H 3EDXB 3UY9A 2IJD1 2SGPE 3F9EA 1H1BA 3SU2A 4ISLA 1C5NH 4YM9A 1IQNA 1EUFA 1VKYA 2KAIB 1UJ1A 1X7AC 1HNEE 1J15A 3VB6A 1S0RA 4Q2KA 3ZVGA 2C4FH 3BTWE 5HXFA 3RXEA 3SHCH 2LPRA 5BPEA 3CP7A 4BTTB 1BOQA 3SV8A 4B2BA 3ENSB 5C20A 1O39A 5ABWA 1TPSA 2H9EH 1QURH 3RXHA 4ZHMU 3F2HA 1NO9H 5EW2H 1BQYA 2PTCE 4ISOA 4FVBA 3SV2H 3PV2A 4SGAE 4OGXA 2P93A 4MNVA 1RIWB 5E8EH 1BRCE 1P2OA 1A46H 2C3SA 1ZJDA 1O2WA 1AVXA 1ZGVA 1AB9C 1OP0A 2C8XB 1WOFA 1Q2WA 2GT7A 4F49A 1FY3A 1N1LA 1TALA 2OD3B 1V2WT 4R0IA 4D7FA 3U1JB 3WW7A 2F83A 1K2I1 1UW7A 1Z8JB 1B5GH 3SV9A 1F0UA 1YPEH 5E0JA 3TU7H 5G4BA 2ZCLP 2ZC9H 3RMOH 4FUDA 1YYY1 1HLTH 1XMNB 2BY6X 1EAUA 1XXFA 1GMHF 2V7QD 3QX5H 1AGJA 3RXGA 3TK9A 3MU4A 3T26A 2BZAA 2F4LA 3SU3A 1GJ8B 1EKBB 1SQTA 3UFAA 3P8OA 3ZZ5A 1W2KH 2F9NA 3F6UH 2AMQA 1Y5BT 1YCPM 2PGQB 3JZ1B 3PMAB 2W7SA 3SN8A 1ZLRA 3M5LA 2PUQH 5DP9A 3S7HB 1DITH 1CA0C 3PLKA 1FQ3A 2R2WU 2GV6A 4Y79A 2WUBA 2QA9E 1BDAA 1UTQA 1AKSB 1KDQB 4JZEH 1TQ7B 2BTCE 2FYQA 2OBQA 1WV7H 1NZQH 1W8BH 3M7UA 3Q76A 1GI3A 1G3DA 4NA8A 2BQ6B 1XX9A 3P70B 1GL0E 1W7GH 4WH8A 5L2ZH 3Q77A 1ZJKA 2WV4A 5FAHA 5FPYA 4BAHB 2B5TB 4E06H 1Z8IB 2PWXA 3N7EA 3SBKA 4AG1A 1CHOG 4LZ1H 4BAMB 5JB8S 1TOCB 1JOUB 1O3EA 3B9FH 2FESH 1SQOA 2J98A 5JDUB 1HJAC 2PKSB 1K1LA 2UUKB 3SORA 1UHBA 3SGBE 1QR3E 5F03A 6CHAB 1P03A 3UWIA 1QHRB 5GPIB 2QYIA 2ZU2A 4O03A 4A5TS 2O8LA 1FAXA 3QWCH 1CE5A 1G9IE 3ZZ3A 2BZ6H 1GBDA 1LPKB 2FYRA 1HAVA 1TNJA 1C4V2 1QY6A 5C17A 4ABAA 2GD4B 3FZDA 1UK2A 1YKTA 1GJ5H 3FOAA 1MTNB 2W6JD 3R3GB 4P00A 1BMAA 2V35A 1RFNA 2OCVB 1O2RA 2WPIS 3HGPA 5FX6A 1C2LA 2ZGJA 1COWD 4TY7A 5J4SA 1BRUP 1O2SA 2XBWA 5DK1A 3LGIA 3M36A 1D3TB 1KLIH 1EZUC 1O2XA 4X8TH 3I29A 1TGNA 4THNH 1LQEA 2ZEBA 2ZDAH 1P2NA 2ZWLH 1RRKA 2B8OH 1A5GH 1IQMA 1QIXB 1TWXB 4A1TA 3SI4H 1GI7B 2ZIQH 2F9OA 1EPTA 2VIVA 4OS1A 1H8HD 3MO3A 1SSXA 3SNAA 1FY4A 3MH7A 1BTPA 3A8DA 1T32A 2K0QA 3GCTF 1W14U 2FI4E 3HKIB 4FUFA 3RMMH 1LVMA 3B8JA 2GDDA 2ZF0H 3MTYA 1E0FD 1F5LA 1OWDA 7GCHG 1L1NA 2YMSD 3LGVA 1LVYA 1GI4A 2VNTA 5C2ZA 3SU6A 1BRAA 3KCGH 1O2JA 1MU6B 3BIVH 4X8UH 3ZZ7A 1YWUA 3QZQA 4BAQB 3WWBA 1NROH 5EPNA 2V0BA 3EA9A 1JIMA 3DT0H 1O2NA 5A8ZA 1XKAC 3QGNB 1KY9A 1HJ8A 1O2OA 1DM4B 2FX6A 1H8IH 4AN7A 2ZFFH 1V2RT 4FOUC 4SGBE 1WDIA 2C8WB 9LPRA 1LDTT 1TABE 3ZZCA 4X6OA 1GJ4H 1ZHPA 2KFWA 4YXWD 2PSXA 1TONA 3PTNA 4AGJA 3PMJA 2ZO3H 2EI8A 2KCAA 4B75A 2AIPA 2WPDD 1E1RD 1IHTH 2XCFA 3CS7A 2R3UA 3OEED 3VXFH 2IN2A 2I6SA 4GPGA 3QN7A 2ZHDA 4OS4A 5TJXA 4JMYA 2Y7XA 2XXLA 4JK5A 2G5VA 1ZMNA 5CHAC 1O38A 1XUGA 2QV1A 3M37A 3RU4T 1TIOA 2ZFRH 3ODFA 2A45B 1FDPA 1GBJA 1Y5AT 4K2YA 1O5AB 4Y76A 3RXKA 3BTME 3K9XB 2QF0A 1F0SA 2ILNA 3QGJA 1V6DA 4ASUD 4RKOB 1EJNA 5PTPA 1JBUH 4E7NA 4AORA 1Z7KA 1UVOA 1VJ9U 4Z6AH 2OC0A 1O3OA 1ELBA 1TPAE 1O3FA 1IHSH 3KNXA 1OS8A 1CA8B 1UTOA 3SYJA 2ZDLA 1HAHH 2WHXA 4BAKB 1O33A 5A2MH 2YOLA 2BLQA 3BSQA 5EG4A 3QO6A 1O2MA 2OUAA 1ETTH 1MAYA 3TGJE 1VR1H 1OOKB 3A89A 4TWWA 2GZ8A 2J94A 4K8BA 3KIDU 3PO1C 1E1QD 4AFZA 5CHBA 4Q63A 1KYNA 1O3GA 4KKDA 1PPZA 1WTGH 4AZ2B 3E6PH 3MH6A 2V6NA 2ANWA 1UTPA 1YF4A 3U98H 2QXGA 2ZCHP 1LHEH 2ZPSA 1O2GH 1HAYB 1YPGH 4F48B 2BDGA 3O8RA 2A7HA 2Z3CA 2ZPQA 4KP0A 4XRNA 1Y3YA 1FJSA 1ZTLA 1GCDA 3Q3YA 4VGCB 2G4TA 1MD8A 2H5DA 1UVPA 1DUEA 1W0KD 1AFQC 3AAUA 3LJOA 1SQAA 1IQIA 4U2WA 1CSOE 2FO9A 3A7YA 1C2HA 3A8AA 1TMTH 3MFJA 2A1DB 3BTTE 3UQOA 1H4WA 2VGCC 3PTBA 1OYTH 1O2YA 4ISIH 2PW8H 3AK5A 3MU1A 4AX9H 4Y10E 1TBQH 4NIVA 1AMHA 2XNIA 3W94A 1GBEA 2ZFPH 2OBOA 4FU9A 2ESTE 3NWUA 4O3TA 2ZGXH 1H8ED 4KTUA 1O35A 1P9UA 3UPEA 4IS5A 1MKXH 1SR5C 1ELEE 3F68H 2A5KA 3QK1A 1UVTH 2CGAA 2GV7A 3CNRA 4F4OC 2P3FH 1O5FH 3GCHB 3ZV9A 3UIRA 1LQDB 1HDTH 3EQ0H 1HIAA 1AI8H 4UFDH 2RDEA 2VB0A 4XE4A 3G01A 1PQ5A 2Z3DA 1O0DH 1FUJA 3VEQB 3RXUA 4MPWA 1BMFD 2BB4A 1A5HA 4XOJA 1C5PA 3H09A 4ZKOU 4B2AA 4RSPA 2KZ4A 1PPGE 2JDID 3GDSA 1YY3A 2CN0H 3WY8A 1SGPE 4GLYA 1HAGE 2ZNKH 3S9AA 1Y8TA 1NBME 7KMEH 1GG6C 1TPOA 2HVXA 1F5RA 4MNXA 2BOKA 1T7CA 3UR6A 3EYDA 4NFEA 3DSPA 3MNSA 3LOXA 4GSOA 4A1VA 1U6QA 5IYTA 2FWWA 2IPHA 3A7VA 5A8YA 4UFEH 1HFDA 1BHXB 3LU9B 3PMBB 1ZRBA 3NCLA 2A4OA 3SO3A 1H9LB 1NU9A 4TPIZ 4XD7D 3RXFA 1WUNH 5DO4H 1MD7A 1W3CA 2PGBB 1T31A 2HPQH 1P04A 1BIOA 2LNCA 5BRRE 3SJKA 2FOBA 2ZFQH 1A0JA 1WBGB 1WSSH 1L4DA 3EE7A 1V2TT 1CHOF 1SGIB 4DT4A 4DT7B 1LCYA 1OYQA 2VWNA 3IITA 3GCTG 4BXWA 1GJBB 4X2VA 4HFPB 5LPEA 2R0KA 4B74A 3KF2A 4LXBH 3LH3A 4GUXA 3SV7A 5KECA 3ITIA 2ULLA 5EOKA 5C67A 1D9IA 3UNRA 3KHVA 4HZHA 4CH8B 2TRMA 4Y71A 1H8DH 2XWAA 3SUFA 3CS0A 1GHZA 2W5EA 8LPRA 2ZP0H 1V2VT 3KQBA 4X2YA 1T4UH 3A84A 4U01A 5GDSH 4ZMAH 1MKWK 1YPLH 4YOGA 3GY8A 1JMOH 1EP5A 5EIYA 3V12A 2BLWA 3GCOA 3DA9B 5ESTE 4XBBA 5GXPA 2CF8H 3E91A 3NUMA 2PKAB 1ZR0A 1UCYH 4K60A 1YBWA 2G8TA 8ESTE 1GJAB 1DICA 2ZHWH 1SVPA 3ZZDA 1GCTC 3RU4E 3RDZA 1W12U 1ZMJA 4IMQA 5B6OA 4TYDA 3PV4A 1BTWA 2BDYA 1EFRD 1VJAU 3FVFB 1CBWC 4DW2U 3BTKE 3TVJB 1S5SA 3PWCA 5C1XA 3RXVA 4X6NA 4UFGH 5TCCA 2EEKA 1GJCB 3S9BA 4NG9H 1EATA 4WMFA 3P17H 4MNYA 5LH8A 1YPMH 1V2PT 1NRNH 3QLPH 2UWLA 1EAWA 1GBAA 2GMTB 4ZH8A 4GVUA 1Y5UT 2OC8A 3ZZ9A 4MG3A 4FUHA 1K21H 3HKJB 5DJ7A 5C5NA 2FLBH 3DSGA 3A80A 4NWLA 3VB5A 1QRXA 2STBE 3GDVA 3EBNA 1EPTC 1C2KA 1Y3XA 2FOEA 5GIBA 1NRPH 7LPRA 4XFQA 1C4Y2 2BQWB 1CVWH 1DDJA 4IC6A 1AFQB 5K0HA 1O32A 1FIZA 4D7GA 3BEIB 3TPIZ 2GKVE 2CMYA 1NESE 1VITH 4OGYA 1FIWA 2OC1A 3LGYA 1CT0E 3HATH 1GDUA 1O3HA 1C9TA 2KCPA 2WINI 3MYWA 1EZXC 1C5OH 2XYAA 2TIOA 1O2LA 4ABBA 1FAKH 3GS9A 4FUJA 3JZ2B 4INLA 4IW4E 1J9CH 4X8SH 1DY8A 2D26C 1LVOA 2VIOA 1O5CB 2WPJS 1F0TA 1B0EA 2PLXA 2BY8X 4ZKSU 2AH4X 1NRSH 1SGCA 5F53A 2EI6A 1C1PA 3LC5A 4I33A 2Y7ZA 4Q4LA 3SJIA 4TWYA 3F9GA 1CQQA 5CMXH 1AVGH 3BTDE 2SNWA 1K1IA 2HVYB 2FIRH 4H6TA 2EY4C 1WXRA 4A7IB 1A5IA 1GHAF 2K8IA 3GICB 1AZZA 3LC3A 2R0LA 3F3BA 1HPGA 1P0SH 2AERH 2RA3A 1TNHA 1AUJA 5GWZA 1IQJA 2FMJA 1Q31A 1KIGH 4U32A 1Z1IA 1XUKA 5DP7A 1TRNA 4ABFA 1S6LA 3S69A 1C5MD 1ELGA 2R9PA 4ZXXH 3VB4A 1ABIH 5JPMH 4TSFD 1HAIH 1CGHA 1OWIA 2FLRH 4WXVA 3VFEA 3V13A 2XC0A 2D2DA 1N8OB 1C5QA 2ZU3A 3RXMA 1O5GH 4O97A 2BYAX 2WPLS 4I8GA 4NZLA 6LPRA 1V2OT 3MNBA 4X1SU 4JYTA 2Z6BD 1N6XA 1PPCE 4WF8A 1W10U 3OX7U 5AFZH 1TGSZ 5GJ4B 4KELA 1EZQA 1FV9A 2BLVA 1NY22 2FTMA 1AE5A 2W6ID 4YO9A 1E79D 4HTCH 9ESTA 2VWMA 4K1EA 4ABIA 2H9HA 2XBXA 5IDKA 1GMCG 4ZKNU 1TPPA 1F0RA 3LT3A 1MZDA 1O2UA 4ZHAA 5F8ZA 1DWEH 2BDBA 4R8TB 4OS2A 1ARCA 1Y3VA 2XC5A 4E7RG 3U28C 3PM3A 1EJMA 2XBVA 1EAIA 3NZIA 1S82A 2HPPH 1C5XB 2J98B 5DP8A 1YCPK 4ABEA 3S0NA 2GP9B 2AMPA 2VVCA 5HMAA 3SV6A 1YC0A 3A7WA 1ZPBA 5C3NA 1LKBA 1GBTA 1QTFA 2QAAA 2GCTB 1LMWB 4XDEA 1K28D 1AO5A 1ZSKA 3N7DA 1GBBA 3M5MA 5AVDA 1GWAA 1ELVA 4E05H 2Z3EA 3OY5U 4UFFH 3RC5A 3QZRA 4ZAEA 3UR9A 1AIXH 2JKHA 4Z0KA 1C1WH 4D9RA 1IQKA 2VBCA 4AFUA 3S9CA 1YPHC 1GMDF 1DVAH 2KM0A 4FUCA 4X0WU 5F6MA 5FCKA 1IAUA 4UD9H 3VGCB 1P8VC 4O9VA 1GGDC 2O9QA 1SLXB 1MQ6A 5EQSA 5T6DA 3EA8A 5L30H 1O2HA 4CRDA 2AIQA 3MNXA 2GZ9A 1KDQA 1QBOA 1ESTA 5A0CA 1KXBA 2EI7A 5FPSA 2BM2A 1AWFH 3E0NB 2OTVA 1GVZA 1QQ4A 2M2AA 2BDIA 1ESAA 2WYJA 1XVOA 2HNTF 2NWNA 1QQUA 4ABHA 1MKWH 1VGCB 1CT4E 1HYLA 1G37A 4WY3A 2P8OB 4I7YH 1P2MA 3PRBA 1XXDA 3VPKA 4OS7A 1GBLA 1YPHE 4ISNA 4AFQA 1WCZA 2ZU4A 1HAOH 2Z9IA 2FOAA 1O2KA 3D23A 3SGQE 1P02A 4K1SA 3T2NA 1S6HA 5FX5A 1QJ1B 2YMSB 1GBKA 2WPHS 1BT7A 2BY7X 1AWHB 4FUGA 3NK8A 1ESBA 4WH6A 1DXPA 1GBCA 1S0QA 3B23B 1LHFH 2WUCA 1BTXA 1P9SA 5A8XA 4H6SB 1RGQA 1PYTD 3TIUA 1PPBH 1EP6A 4YESB 4B1TA 3RM0H 4NFFA 1C1MA 2AS9A 3DHKH 3TK5A 1HUTH 2PP6A 1C1OA 4INHA 3UREA 1INCA 2O8UA 3UWJH 2VU8E 3LH1A 5HIZA 2V3MA 2HNTC 5K7RA 4MPUA 4CREA 4IN2A 3T5FH 4IMZA 1RTLA 1KXEA 2YNAA 5L6NH 1BMNH 2UUFB 2EQNA 2NU3E 1C2MA 1G30B 1P12E 1T8NA 2J38A 3ESTA 2CXVA 5F8XA 2P59A 3M3VA 2CHAC 2JETC 2FS9A 1WAYB 2SGAA 1FNIA 1MBQA 4MLFB 4JYVH 5KGOA 1V2JT 3F9FA 1MQ5A 1TQ0B 1C1QA 1ELDE 3LJJA 1O3IA 2P95A 4I32A 2HNTE 2AMDA 2M5TA 1YPKH 1F5KU 1FY5A 1AB9B 5C1YA 3SHAH 3VB3A 1TBRH 1UMAH 1C2DA 2ZG0H 4RT0A 4X1QU 1KTTB 2SNVA 3IWMA 2QE7D 3L33A 1EAXA 4Z1MD 2PHBA 3M5OA 4AG2A 1L4ZA 1YP9A 1ELCA 5EJLA 2ANYA 1V2UT 1A7SA 1DPOA 1SGQE 4CHAC 1P01A 1HAPH 1GVKB 2JH6D 1GHAG 1QL7A 1G2LA 2A0QB 1BMMH 1O2QA 2RA0A 1BBRE 1FY1A 2RFKC 3A8CA 1S81A 1S85A 1Q3XA 4I8JA 2ODQA 3OU0A 1CA0B 5ESBA 2K7XA 3D62A 3MI4A 1ID5H 5DN6D 1F7ZA 1UTLM 3GY5A 2RDLA 1FN6A 1D6RA 2OLGA 1P2QA 1SL3A 2BD9A 4PROA 3ZVCA 4Q80A 2GT8A 2F9VA 4B6FA 4B2CA 2BD3A 1BTHH 5DGJA 1ZYOA 1ZSJA 1BZXE 3QTOH 1OWJA 2BVXH 1J16A 1THPB 2QGRA 1VCQA 1WU1A 1DXWA 3FKSD 1HCGA 1K1JA 3BG4C 1EJAA 2ZTYA 4F55A 1RD3B 1SFQB 2VIDA 2ZQ1A 3L6PA 2QN5T 3DFJA 1MUEB 4GHTA 3ZZBA 4QT8C 1FXYA 4H42U 1K9OE 1GI2A 4J2YB 3RMLH 1IQFA 2I6QA 3M61U 2FI5E 1G3CA 1MU8B 3BIUH 2Y81A 1HJAB 3A88A 2FOHA 2FXRA 1RJXB 1JRSA 4K1TA 4XBDA 3SI3H 2ZHFH 1HJ9A 1TNGA 2ODYB 2BOHB 3DD2H 3TNSA 1NFUA 1ETRH 1O3PB 4CBNA 3SNBA 1HB0B 1HIAB 4X2WA 2WPKS 1BTZA 3BTHE 3ATMA 4J1YA 3V3MA 1SGDE 2VH0A 3RXAA 3P95A 3FAOA 5DP6A 4ACBA 1C2IA 1O31A 5FCRA 2C8ZB 2VVVA 2FM2A 1TX8A 1EXFA 4CH2B 2ASUB 5EXMA 3H7OA 4LZ4B 1BUIA 1H9IE 4HGCA 4Y7BA 2Y5GA 5EXLA 1AZ8A 2NU4E 1TBZH 2WYGA 1O3JA 2PSYA 2VIWA 1PPEE 3EGKH 1GI5A 2AFQB 1DY9A 1RTKA 1V2NT 2HWLB 2J97A 1GMDG 1NC6A 2HOBA 1W0ZU 1OHHD 2ZTZA 3U9AH 2HGTH 1C1VH 2ANKH 4AB9A 1GI0A 2A5AA 3F2FA 2W3KA 1O2ZA 4D8NA 1YPJH 5EPYA 3TITA 3KQ5A 2GDEH 3TLOA 1D3PB 3TGIE 1TGTA 2ZGCA 1Z6EA 1ZSLA 3W95A 1Y59T 2HLCA 3OE7D 5FBIA 1SMFE 2CV3A 2BX4A 3MO9A 1GMCF 1O5EH 2XTTB 3UB0A 2ZGBH 1NTPA 1OKXA 4TPYA 2D1JA 3GY7A 3T28A 3VXEH 4AB8A 1HXFH 4HG6A 2P3TB 1NFXA 1G36A 1ZRKA 3M35A 4DOQA 2LP6A 1W0YH 1BJUA 1KXAA 3N99A 2Z7FE 1UTNA 1W11U 4X2XA 3RXQA 1ELFA 3LGTA 1O3BA 4NIXA 2F9BH 3E3TA 1KLTA 4FXGH 2G55A 1C5UA 2SGQE 1BB0B 2OC7A 5EJZA 3FO8D 4Q7ZA 3LIWA 4IBLH 1AE8H 1SPJA 4DIHH 1P06A 5JB9S 3TGKE 1MCVA 1ZTJA 3TH2H 7ESTE 3P8GA 5LPFA 1J8AA 3OTPA 2LIZA 5TCAA 4Y6DA 1C1SA 2BHGA 2BDHA 3U8RH 3PLPA 1FONA 2A4GA 2DE9A 5CHAB 2DUCA 1YM0A 4ZKRU 1GBHA 3V0XA 1P11E 2TPIZ 3FANA 1SC8U 2BDCA 2ZDMA 2G00A 4DURA 3RXSA 1FN8A 2BD8A 2FZZA 5EODA 5H4IB 1ZZZA 4AYYB 3MHWU 1FX0B 1TAWA 3GISB 1TB6H 2NU1E 1PQ8A 4AYVB 4UONA 1W7XH 2ODPA 4K3JA 2SFAA 1LHGH 3A85A 3ZVFA 1JWTA 3HGNA 3SNDA 3VG8A 3FFGA 1NFYA 3GY2A 3RXIA 3UOPA 1O37A 2PTNA 1T8OA 2ZU5A 2O8TA 1C2JA 2IJOB 3ATWA 3NPSA 1PFXC 1D3QB 2XCNA 2OP9A 4X1PU 4BTIB 2V3OH 1TX6A 3NRLA 3PO1B 1OWHA 1FY8E 4NGAH 1O2VA 1GI9B 1G3EA 1OWKA 2FOCA 2NU0E 5J4QA 1SI5H 2PUXB 1QBNA 1ANBA 5GNDA 3LGUA 1ETSH 4U30A 1DOJA 3HK6B 2F9UA 2QC2A 2RCEA 1GBFA 2C90B 4RI0A 6GCHF 2PKSC 1S84A 4Y7AA 5DSFA 1TGBA 1FMGA 1EX3A 3S7KB 1O2IA 2FODA 3ATKA 1P57B 6CHAC 3A83A 1IOEA 3CENA 3STIA 1LTOA 3PYHA 3MNCA 4Y8ZA 2ZCKP 3SNCA 2OXSA 3SZNA 1V2KT 4FUEA 3GCNA 1OP2A 1KXDA 1K1PA 2GCHF 3MO6A 1QZ8A 2UUYA 2QF3A 4NWKA 4Y11E 3OFND 1EASA 2VGCB 1XVMA 3OTJE 3ZV8A 8GCHF 2Q6FA 3LPRA 1FZZA 1ZOMA 5E0HA 3OSYA 2BY9X 5ETXA 4X1NU 2Z9LA 3F0PA 3KN2A 1MTNC 4AFSA 1LHCH 1D6WA 2HLDD 1TMBH 1C2EA 3EA7A 3KEEA 3DSOA 2XRCA 1IQLA 3ATIA 1GI1A 5HM2A 3ZYEA 1QJ6B 3W1EA 2BD5A 2FX4A 4MVNA 5EW1H 2BDAA 2TGAA 1Y3UA 5E2PA 4IGDA 2J9NA 1O3MA 2Y5HA 3GY3A 2B0FA 1XUIA 2GVFA 1E37B 1DE7H 2Y82A 1QA7A 3ZVEA 3NKKA 3HK3B 5T6FA 1QA0A 1GI6A 1OPHB 1NBMD 3PB1E 4BNRA 3P8NA 2BXUH 2ZDNA 4GCHF 1GG6B 2ZU1A 2FTLE 3BF6H 1JRTA 1TX7A 2L74A 3E8LA 3C1KA 3U8TH 4CBOA 1J14A 1ZGIA 1OX1A 3SJ8A 2F43B 4WVPE 3M3SA 1L0ZA 1O3NA 3BTGE 4A92A 1TLDA 4YOJA 4ZXYH 3BEUA 3RXPA 2O8WA 1GBIA 3DFLA 2VH6A 1TRMA 3E16B 3U69H 4NIYA 3MQKC 2J92A 2PR3A 1MAXA 1N6YA 1O3LA 3P6ZB 4BTUB 3ZZAA 4K5ZA 1C1TA 2ALPA 2KAIA 2ZFTA 2G52A 1HXEH 1BITA 3TJNA 4MNWA 4KGAA 2A31A 2GX4A 4H4FA 1TE0A 4FUBA 5JBAS 1A3BH 3T62A 1SLVB 2F3CE 1P10A 1XUHA 2J2UA 3BN9A 3RUOA 3TH3H 3UAIC 3LONA 3ZVDA 1GHVH 1A0LA 1KTSB 4MPVA 2ZI2H 1O36A 1DS2E 2J34A 3U8OH 3E90B 1HBTH 1SGFG 1ANEA 1AHTH 4NA9H 1KXFA 1QGFA 1LHDH 1F92A 4ABJA 4WMEA 3KYGA 5IK2D 1GI8B 3TNTA 1LPGB 4NSYA 1D4PB 2XC4A 4JZFH 4UEHH 1UHBB 4Q7YA 1LVBA 2FOMB 3WWFA 1C5VA 4HI3A 1H9HE 2Z94A 2P16A 5JBTA 2AGEX 1WTHD 3KYFA 1C9PA 4B76A 1YLNA 2BXTH 1C1RA 1SGRE 1GJDB 5C1UA 5FL7D 2CJIA 3GY4A 1K1NA 3T25A 3NXPA 1C1NA 3RXCA 5C94A 1CU1A 1SKYE 3UNQA 3RU4D 3BTQE 5A0BA 1SGFA 1GCTB 5LPRA 2H2ZA 2Y80A 1HAVB 3L3TA 3A86A 3RXTA 3URCA 1CBWB 1MKXK 4JYUH 4I31A 3RMNH 3ZZ4A 3SJ9A 3AASA 3RXBA 3RXRA 4FU7A 2A4RA 3RXLA 1S83A 1NN6A 4GHQA 3SZEA 4CRFA 2K1QA 4YT6H 1Z8GA 2HRVA 1P2IA 3ELAH 4XSKU 3Q3KA 1NU7B 1YLDA 2CF9H 1AKSA 3I77A 1AFEH 1GHBF 2TGDA 2A32A 4ZCNA 4VGCC 1TFXA 2VIPA 3MOCA 5EQQA 2Z9GA 5F8TA 3R0FA 5E2OA 5LGOA 1Z1JA 1BTUA 3T29A 3TJUA 5JYIA 2Q6GA 1C5TA 1EPTB 2FDAA 4I8LA 4BAOB 5FBEA 3ATLA 4NIWA 1CT2E 1LKAA 1EB1H 1L1JA 4WJG2 1DLKB 2VJ1A 1GJ9B 4YT7H 1AU8A 2D8WA 1CGIE 1TGCA 4AGKA 2JJ2D 4I8KA 2ANMH 5DPAA 4MPXA 1NFWA 2FI3E 1WYKA 1Z8RA 3SU5A 1BCUH 1C5LH 3OEHD 1DWDH 2G81E 2L6OA 4KTCA 1C5SA 3OAAD 5EGMA 1GBMA 1YGCH 4ZROA 1A3EH 1QBVH 3DCLA 3QDZB 1C2FA 3A7XA 2XW9A 1QCPA 1ACBE 2CK3D 2HALA 2QCYA 2OQUA 4B6EA 2TGPZ 1OSSA 1HAZB 3TJVA 2A2QH 1YLCA 1SHYA 2IPQX 1KMHB 1BRBE 1BHXF 6GCHG 1Z71A 2BMGB 3MU0A 3ZYDA 3GCHC 3LGWA 5GCHG 1SGEE 3K65B 1UTJA 1UO6A 3QTVH 6ESTA 1P09A 1QJ7B 1IQEA 1K22H 4RKJB 4Y0ZE 2Q1JA 1W0JD 1AD8H 2V3HH 3A7ZA 4B73A 4K8YA 2GCHG 1RS0A 1AN1E 5EQRA 1SGTA 3F1SB 1C1UH 2ZQ2A 3KQDA 2KR7A 3RC4A 1TNIA 4CR9A 4DG4A 1TMUH 2VWLA 8GCHG 5C0UA 1ANDA 1EZSC 1VITF 2Y6TA 1V2ST 1THRH 1C2GA 2TGTA 1O5DH 2OQ5A 1XUFA 2XWBI 2GTBA 3TJOA 3BV9B 2NU2E 5I46H 1GDNA 1JXPA 3KL6A 5JBCS 1K1OA 3GYLB 5B6LA 1UCYK 3RXJA 1DLEA 2GJGA 2ZA5A 4TT3D 4I86A 4NA7A 1K1MA 2YNBA 1UCYE 1SQRA 4YLQH 1AUTC 1O2PA 3AW0A 2BVSH 4NCYA 4FVDA 3M3TA 1ELTA 1C5YB 1P2KA 1M9UA 3TH4H 3SUDA 2FOFA 5T6GA 3QUMP 3PROA 4JCNA 1GL1A 3D65E 3SQEE 4RT1A 2BY5X 3Q00A 4I8HA 3SUGA 1BA8B 1QRZA 1W13U 5I25A 5T3HA 1BBRK 2EA3A 3O8CA 2FOGA 1LO6A 1KSNA 1MTVA 2KCYA 1TRYA 2AEIH 2SGFE 1IQGA 4TY6A 4ISHH 1KLJH 3SW2B 1TA6A 4GCHG 4MQAA 2G4UA 2AHME 1AVWA 1UK3A 2WZQA 8KME2 1ZMLA 1JIRA 4JK6A 1DSUA 2XOKD 4LK4A 4UDWH 4KTSA 2C8YB 4DVAU 1THSH 1O3KA 3A87A 2J4IA 1ZPCA 2AGIX 1PPFE 2FP7B 5FXLA 3RC6A 1GHXH 2DE8A 1BJVA 4A1XA 3U1IB 3F9HA 1VCWA 2UWOA 1QNJA 1SHHB 2B9LA 1D3DB 3PWBA 3ZIAD 1DWBH 1C4U2 1HGTH 3FP7E 3E1XB 4X6PA 1T4VH 1XM1A 3MH4A 2A4QA 2H6MA 2QF4A 4FU8A 2Q6DA 5DKMA 2AYWA 5A0AE 2QXHA 5HGGA 3RXOA 4ABDA 3T27A 1ZPZA 1NT1A 1QRWA 1RXPA 2B7DH 4DY7B 1FPHH 2A5IA 5EXNA 4DJZB 1SLUB 1GDQA 1AY6H 4DGJA 2FEQH 4FUIA 4M7GA 3SQHE 5T1VA 1C5ZB 4YZUA 1WQSA 1FPCH 1UVSH 1PQ7A 5SGAE 1SOTA 1C5RA 2IOTA 1GMHG 1NRRH 3ZZ6A 3RM2H 1DFPA 4CR5A 3P8FA 4X6MA 2GMTC 3AAVA 3STJA 1GGDB 1TA2A 1GVLA 1G32B 1Y3WA 3FN8A 3AW1A 1QFKH 3RLYH 4Q7XA 1CO7E 3SU0A 4AOQA 3UNSA 4INKA 1MABB 3MWIU 3UQVA 3MH5A 4IN1A 1ORFA 1V2LT 2Z9JA 2QF5A 3P92A 2RG3A 3M5NA 2R3YA 5CE1A 3PMHB 1HRTH 4BXSA 1OXGA 1ZTKA 2QXIA 1YCPH 4CRAA 1T8MA 3MU8A 1MBMA 4K69A
chains in the Genus database with same CATH topology
1SLWB 5FHTA 4O3UA 1V3XA 2ZZUH 3SU1A 4JZIA 1IQHA 1G3BA 2QIQA 1MH0A 1QL8A 5HYOA 1V2QT 2ZKSA 4BOHA 3M7TA 3RP2A 2SGDE 4CRCA 1DANH 1MCTA 1KXCA 3UTUH 1B7XB 2BQ7B 4GAWA 1HAXB 2ZECA 3SOSA 1BTYA 1PPHE 2QXJA 3VB7A 5AFYH 1F2SE 1P3EA 2WPMS 1EOJA 2EC9H 3OY6U 4WWYA 3MU5A 1A2CH 3AVZA 2H1UA 1GHBG 1UTMA 3PLBA 2JH0D 1GJ7B 1OWEA 1SG8B 4RN6A 4ASHA 2UWPA 1MMJN 3H7TA 3ZZ8A 1A61H 2ZPRA 1L1GA 3SGAE 4YTAA 1MTWA 3V7TA 1Z6JH 3KQCA 1A4WH 3O8DA 3EAJA 1O34A 2TBSA 1ARBA 3EE0B 4MTBA 1BMLA 4DIIH 3DUXH 4IC5A 4UE7H 4Y0YE 4WXIA 2VINA 2CHAB 3IG6B 2JETB 1AQ7A 5A09A 1RIWC 1S6FA 3E0PB 1OP8A 1GPZA 4WMDA 1DUAA 2UUJB 1DT2A 1NS3A 1E34B 3I78A 4JZ1A 1P3CA 1CHGA 1QL9A 2THFB 1HV7A 3H5CB 1O3AA 5EU8A 1NRQH 4D9QA 5DP4A 1N8OC 4DCDA 5DP5A 1EQ9A 1O3DA 1TNLA 1O30A 3A82A 2QY0B 2OINA 3GYMA 1FLEE 1WQVH 2PV9B 2AGGX 2O8MA 1GJ6A 3D49H 1SGYE 3FP8E 2VIQA 2VWOA 2BLOA 1ELAA 2BX3A 4JZDH 4CHAB 2ZHQH 3ODDA 1EB2A 1MZAA 1ZHRA 1FI8A 2W3IA 3BG8A 2G5NA 3LKWA 5FPTA 4ZHLU 1XUJA 3GDUA 2ZHEH 1VITG 1NPMA 3UUZA 3LDXH 3Q3XA 4YOIA 1MTUA 1UVUH 1XKBC 2BD2A 2GZ7A 3SJOA 1GHWH 2A7CA 1QB6A 1T8LA 2Z9KA 4ESTE 1DSTA 3GY6A 1UK4A 3UOUA 4MDSA 3A8BA 4OS5A 1O3CA 1SFIA 2Y5FA 2A7JA 1QB1A 5E0GA 2GCTC 1ANCA 1E36B 2C93B 1O2TA 1A0HB 1ABJH 4D76A 1LPZB 2XBYA 1NM6A 1C5WB 4X8VH 2ALVA 3BG4B 4X1RU 2BD7A 1UTKA 1PQAA 2H5CA 2F9PA 3ZVAA 1EOLA 2P94A 1G2MA 4BANB 2BVRH 4CRBA 4YLUA 2FS8A 1GHYH 3KQEA 3A81A 4ZUHA 4LOYH 1A1RA 3BTEE 1E38B 5DG6A 5DP3A 1SOZA 5C5OA 5GCHF 1O5BB 2GGVB 1B0FA 2BD4A 3C27B 1VCPA 3HPTB 3SUEA 3SU4A 2VVUA 1ZHMA 1SBWA 3VGCC 1BBRH 1QB9A 2W7UA 1RTFB 4XBCA 3SNEA 3OYPA 2SGEE 4OS6A 2PKAA 3KGPA 2R2MB 1VZQH 2FPZA 4NZQA 2PFEA 5HM9A 4CRGA 4ABGA 3K6YA 1V2MT 2ZGHA 3FZZA 4Y8XA 3TK6A 5JBBS 2ZFSA 1P2JA 2W26A 1PJPA 2STAE 1PYTC 1VGCC 5AHGH 3K2UA 2F91A 2P8OC 3BTFE 7GCHF 3N7OA 1MTSA 3MMGA 2ZDKA 2G51A 2JH5D 3RLWH 2A2XH 2H9TH 1DWCH 4B71A 3M7QA 3ZVBA 3BEFB 3K6ZA 4A6LA 3URDA 1TOMH 3O8BA 1SGNE 3RXDA 1DX5M 1CGJE 1L2EA 3FP6E 2P3UB 2ZDVH 5L2YH 2WV5A 1E35B 3GOVB 4Y8YA 2J95A 2ZTXA 4NSVA 5AF9H 1P05A 3A7TA 1J17T 1TNKA 1TYNA 1SB1H 3EDXB 3UY9A 2SGPE 3F9EA 1H1BA 3SU2A 4ISLA 1C5NH 4YM9A 1IQNA 1EUFA 2KAIB 1UJ1A 1X7AC 1HNEE 1J15A 3VB6A 1S0RA 4Q2KA 3ZVGA 2C4FH 3BTWE 5HXFA 3RXEA 3SHCH 2LPRA 5BPEA 3CP7A 4BTTB 1BOQA 3SV8A 4B2BA 3ENSB 5C20A 1O39A 5ABWA 1TPSA 2H9EH 1QURH 3RXHA 4ZHMU 1NO9H 5EW2H 1BQYA 2PTCE 4ISOA 4FVBA 3SV2H 4SGAE 4OGXA 2P93A 4MNVA 1RIWB 5E8EH 1BRCE 1P2OA 1A46H 2C3SA 1ZJDA 1O2WA 1AVXA 1ZGVA 1AB9C 1OP0A 2C8XB 1WOFA 1Q2WA 2GT7A 4F49A 1FY3A 1N1LA 1TALA 2OD3B 1V2WT 4R0IA 4D7FA 3U1JB 2F83A 1K2I1 1Z8JB 1B5GH 3SV9A 1F0UA 1YPEH 5E0JA 3TU7H 5G4BA 2ZCLP 2ZC9H 3RMOH 4FUDA 1YYY1 1HLTH 1XMNB 2BY6X 1EAUA 1XXFA 1GMHF 3QX5H 1AGJA 3RXGA 3TK9A 3MU4A 3T26A 2BZAA 3SU3A 1GJ8B 1EKBB 1SQTA 3UFAA 3P8OA 3ZZ5A 1W2KH 2F9NA 3F6UH 2AMQA 1Y5BT 1YCPM 2PGQB 3JZ1B 3PMAB 2W7SA 3SN8A 1ZLRA 3M5LA 2PUQH 5DP9A 3S7HB 1DITH 1CA0C 3PLKA 1FQ3A 2R2WU 2GV6A 4Y79A 2WUBA 2QA9E 1BDAA 1UTQA 1AKSB 1KDQB 4JZEH 1TQ7B 2BTCE 2FYQA 2OBQA 1WV7H 1NZQH 1W8BH 3M7UA 3Q76A 1GI3A 1G3DA 4NA8A 2BQ6B 1XX9A 3P70B 1GL0E 1W7GH 4WH8A 5L2ZH 3Q77A 1ZJKA 2WV4A 5FAHA 5FPYA 4BAHB 2B5TB 4E06H 1Z8IB 2PWXA 3SBKA 4AG1A 1CHOG 4LZ1H 4BAMB 5JB8S 1TOCB 1JOUB 1O3EA 3B9FH 2FESH 1SQOA 5JDUB 1HJAC 2PKSB 1K1LA 2UUKB 3SORA 1UHBA 3SGBE 1QR3E 5F03A 6CHAB 1P03A 3UWIA 1QHRB 5GPIB 2QYIA 2ZU2A 4O03A 4A5TS 2O8LA 1FAXA 3QWCH 1CE5A 1G9IE 3ZZ3A 2BZ6H 1GBDA 1LPKB 2FYRA 1HAVA 1TNJA 1C4V2 1QY6A 4ABAA 2GD4B 3FZDA 1UK2A 1YKTA 1GJ5H 1MTNB 3R3GB 1BMAA 2V35A 1RFNA 2OCVB 1O2RA 2WPIS 3HGPA 5FX6A 1C2LA 2ZGJA 4TY7A 5J4SA 1BRUP 1O2SA 2XBWA 5DK1A 3LGIA 3M36A 1D3TB 1KLIH 1EZUC 1O2XA 4X8TH 3I29A 1TGNA 4THNH 1LQEA 2ZEBA 2ZDAH 1P2NA 2ZWLH 1RRKA 2B8OH 1A5GH 1IQMA 1QIXB 1TWXB 4A1TA 3SI4H 1GI7B 2ZIQH 2F9OA 1EPTA 2VIVA 4OS1A 3MO3A 1SSXA 3SNAA 1FY4A 3MH7A 1BTPA 3A8DA 1T32A 3GCTF 1W14U 2FI4E 3HKIB 4FUFA 3RMMH 1LVMA 3B8JA 2GDDA 2ZF0H 3MTYA 1E0FD 1F5LA 1OWDA 7GCHG 1L1NA 3LGVA 1LVYA 1GI4A 2VNTA 5C2ZA 3SU6A 1BRAA 3KCGH 1O2JA 1MU6B 3BIVH 4X8UH 3ZZ7A 3QZQA 4BAQB 1NROH 5EPNA 2V0BA 3EA9A 1JIMA 3DT0H 1O2NA 5A8ZA 1XKAC 3QGNB 1KY9A 1HJ8A 1O2OA 1DM4B 2FX6A 1H8IH 4AN7A 2ZFFH 1V2RT 4SGBE 2C8WB 9LPRA 1LDTT 1TABE 3ZZCA 4X6OA 1GJ4H 1ZHPA 2PSXA 1TONA 3PTNA 4AGJA 3PMJA 2ZO3H 2EI8A 4B75A 2AIPA 2XCFA 1IHTH 3CS7A 2R3UA 3VXFH 2IN2A 2I6SA 4GPGA 3QN7A 2ZHDA 4OS4A 5TJXA 4JMYA 2Y7XA 2XXLA 4JK5A 2G5VA 1ZMNA 5CHAC 1O38A 1XUGA 2QV1A 3M37A 3RU4T 1TIOA 2ZFRH 3ODFA 2A45B 1FDPA 1GBJA 1Y5AT 4K2YA 1O5AB 4Y76A 3RXKA 3BTME 3K9XB 2QF0A 1F0SA 2ILNA 3QGJA 1V6DA 4RKOB 1EJNA 5PTPA 1JBUH 4E7NA 4AORA 1Z7KA 1UVOA 1VJ9U 4Z6AH 2OC0A 1O3OA 1ELBA 1TPAE 1O3FA 1IHSH 3KNXA 1OS8A 1CA8B 1UTOA 2ZDLA 1HAHH 4BAKB 1O33A 5A2MH 2YOLA 2BLQA 3BSQA 5EG4A 3QO6A 1O2MA 2OUAA 1ETTH 1MAYA 3TGJE 1VR1H 1OOKB 3A89A 4TWWA 2GZ8A 2J94A 4K8BA 3KIDU 3PO1C 4AFZA 1KYNA 1O3GA 4KKDA 1PPZA 1WTGH 4AZ2B 3E6PH 3MH6A 2V6NA 2ANWA 1UTPA 1YF4A 3U98H 2QXGA 2ZCHP 1LHEH 2ZPSA 1O2GH 1HAYB 1YPGH 2BDGA 3O8RA 2A7HA 2Z3CA 2ZPQA 4KP0A 1Y3YA 1FJSA 1ZTLA 1GCDA 3Q3YA 4VGCB 2G4TA 1MD8A 2H5DA 1UVPA 1DUEA 1AFQC 3AAUA 3LJOA 1SQAA 1IQIA 4U2WA 1CSOE 2FO9A 3A7YA 1C2HA 3A8AA 1TMTH 3MFJA 2A1DB 3BTTE 3UQOA 1H4WA 2VGCC 3PTBA 1OYTH 1O2YA 4ISIH 2PW8H 3MU1A 4AX9H 4Y10E 1TBQH 4NIVA 1AMHA 2XNIA 3W94A 1GBEA 2ZFPH 2OBOA 4FU9A 2ESTE 3NWUA 4O3TA 2ZGXH 4KTUA 1O35A 1P9UA 3UPEA 4IS5A 1MKXH 1SR5C 1ELEE 3F68H 2A5KA 3QK1A 1UVTH 2CGAA 2GV7A 4F4OC 2P3FH 1O5FH 3GCHB 3ZV9A 3UIRA 1LQDB 1HDTH 3EQ0H 1HIAA 1AI8H 4UFDH 2VB0A 4XE4A 3G01A 1PQ5A 2Z3DA 1O0DH 1FUJA 3VEQB 3RXUA 4MPWA 2BB4A 1A5HA 4XOJA 1C5PA 4ZKOU 4B2AA 4RSPA 1PPGE 3GDSA 2CN0H 3WY8A 1SGPE 4GLYA 1HAGE 2ZNKH 3S9AA 1Y8TA 7KMEH 1GG6C 1TPOA 2HVXA 1F5RA 4MNXA 2BOKA 1T7CA 3UR6A 3EYDA 4NFEA 3MNSA 3LOXA 4GSOA 4A1VA 1U6QA 5IYTA 2FWWA 2IPHA 3A7VA 5A8YA 4UFEH 1HFDA 1BHXB 3LU9B 3PMBB 1ZRBA 3NCLA 2A4OA 3SO3A 1H9LB 1NU9A 4TPIZ 3RXFA 1WUNH 5DO4H 1MD7A 1W3CA 2PGBB 1T31A 2HPQH 1P04A 1BIOA 2LNCA 5BRRE 3SJKA 2FOBA 2ZFQH 1A0JA 1WBGB 1WSSH 1L4DA 1V2TT 1CHOF 1SGIB 4DT7B 1LCYA 1OYQA 2VWNA 3IITA 3GCTG 4BXWA 1GJBB 4X2VA 4HFPB 5LPEA 2R0KA 4B74A 3KF2A 4LXBH 3LH3A 4GUXA 3SV7A 3ITIA 2ULLA 5EOKA 5C67A 1D9IA 3UNRA 3KHVA 4HZHA 4CH8B 2TRMA 4Y71A 1H8DH 2XWAA 3SUFA 3CS0A 1GHZA 2W5EA 8LPRA 2ZP0H 1V2VT 3KQBA 4X2YA 1T4UH 3A84A 4U01A 5GDSH 4ZMAH 1MKWK 1YPLH 4YOGA 3GY8A 1JMOH 1EP5A 3V12A 2BLWA 3GCOA 3DA9B 5ESTE 4XBBA 5GXPA 2CF8H 3E91A 3NUMA 2PKAB 1ZR0A 1UCYH 4K60A 1YBWA 2G8TA 8ESTE 1GJAB 1DICA 2ZHWH 1SVPA 3ZZDA 1GCTC 3RU4E 3RDZA 1W12U 1ZMJA 4IMQA 5B6OA 4TYDA 3PV4A 1BTWA 2BDYA 3FVFB 1VJAU 1CBWC 4DW2U 3BTKE 3TVJB 1S5SA 3PWCA 5C1XA 3RXVA 4X6NA 4UFGH 5TCCA 2EEKA 1GJCB 3S9BA 4NG9H 1EATA 4WMFA 3P17H 4MNYA 5LH8A 1YPMH 1V2PT 1NRNH 3QLPH 2UWLA 1EAWA 1GBAA 2GMTB 4ZH8A 4GVUA 1Y5UT 2OC8A 3ZZ9A 4MG3A 4FUHA 1K21H 3HKJB 5DJ7A 5C5NA 2FLBH 3A80A 4NWLA 3VB5A 1QRXA 2STBE 3GDVA 3EBNA 1EPTC 1C2KA 1Y3XA 2FOEA 5GIBA 1NRPH 7LPRA 4XFQA 1C4Y2 2BQWB 1CVWH 1DDJA 4IC6A 1AFQB 5K0HA 1O32A 1FIZA 4D7GA 3BEIB 3TPIZ 2GKVE 2CMYA 1NESE 1VITH 4OGYA 1FIWA 2OC1A 3LGYA 1CT0E 3HATH 1GDUA 1O3HA 1C9TA 2WINI 3MYWA 1EZXC 1C5OH 2XYAA 2TIOA 1O2LA 4ABBA 1FAKH 4FUJA 3JZ2B 4INLA 4IW4E 1J9CH 4X8SH 1DY8A 2D26C 1LVOA 2VIOA 1O5CB 2WPJS 1F0TA 1B0EA 2PLXA 2BY8X 4ZKSU 2AH4X 1NRSH 1SGCA 2EI6A 1C1PA 3LC5A 4I33A 2Y7ZA 3SJIA 4TWYA 3F9GA 1CQQA 5CMXH 1AVGH 3BTDE 2SNWA 1K1IA 2FIRH 4H6TA 4A7IB 1A5IA 1GHAF 3GICB 1AZZA 3LC3A 2R0LA 1HPGA 1P0SH 2AERH 2RA3A 1TNHA 1AUJA 5GWZA 1IQJA 2FMJA 1Q31A 1KIGH 4U32A 1Z1IA 1XUKA 5DP7A 1TRNA 4ABFA 3S69A 1C5MD 1ELGA 2R9PA 4ZXXH 3VB4A 1ABIH 5JPMH 1HAIH 1CGHA 1OWIA 2FLRH 4WXVA 3VFEA 3V13A 2XC0A 2D2DA 1N8OB 1C5QA 2ZU3A 3RXMA 1O5GH 4O97A 2BYAX 2WPLS 4I8GA 4NZLA 6LPRA 1V2OT 3MNBA 4X1SU 4JYTA 2Z6BD 1N6XA 1PPCE 4WF8A 1W10U 3OX7U 5AFZH 1TGSZ 5GJ4B 4KELA 1EZQA 1FV9A 2BLVA 1NY22 2FTMA 1AE5A 4HTCH 4YO9A 9ESTA 2VWMA 4K1EA 4ABIA 2H9HA 2XBXA 5IDKA 1GMCG 4ZKNU 1TPPA 1F0RA 3LT3A 1MZDA 1O2UA 4ZHAA 5F8ZA 1DWEH 2BDBA 4R8TB