2BX4A

Crystal structure of sars coronavirus main proteinase (p21212)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
298
structure length
298
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-LIKE PROTEINASE
publication title Ph-Dependent Conformational Flexibility of the Sars-Cov Main Proteinase (M(Pro)) Dimer: Molecular Dynamics Simulations and Multiple X-Ray Structure Analyses.
pubmed doi rcsb
source organism Sars coronavirus sin2774
total genus 72
structure length 298
sequence length 298
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2bx4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx4A02
3T26A 2OQUA 5AHGH 1IQFA 3ATWA 2ZCKP 3NUMA 2XCFA 1ZPCA 2BDYA 3A80A 2ZGCA 4X0WU 1LHDH 2QC2A 2UWLA 1P06A 3A7TA 2VH0A 1EAWA 1HB0B 1SLXB 5L6NH 3C27B 1L0ZA 5HXFA 1E35B 2CHAB 3RDZA 4YLUA 1H4WA 1SFQB 3SJOA 3BN9A 4JK5A 3SJIA 1IQNA 1TRMA 2OC1A 3FP6E 2R3UA 1JIMA 1SQAA 1O3DA 3GY8A 4B71A 3FP7E 1QCPA 3F9FA 1V2OT 1ZSJA 2BD5A 3A8BA 1SGQE 1C9TA 4AORA 3E91A 2F9UA 3Q3XA 1F0SA 1SLWB 2B5TB 2FESH 1A4WH 4BAMB 1QBOA 4RSPA 1S6HA 1TGNA 1ZLRA 1O2VA 1ELFA 1WSSH 1CHOG 1LTOA 3VFEA 3Q3KA 3SNDA 4B2BA 3RMNH 1P2KA 1UCYE 3F9HA 2J4IA 1B5GH 3MH4A 2A5IA 4JZFH 1UVTH 3E8LA 4ASHA 2Q6GA 1KDQB 2UWPA 3VEQB 4D8NA 1QRZA 4OS6A 1O2YA 1AZ8A 3U8TH 2PUXB 1TRYA 1HXFH 1O2GH 1EUFA 2B7DH 3RXJA 5A0BA 4YOJA 5FBEA 7GCHG 2BOKA 1HAPH 3M36A 1W0YH 1S0QA 1PPCE 2FOFA 3ZVBA 1UHBB 3QGJA 1D3DB 1T8OA 1TPOA 3QX5H 3EE0B 3PYHA 1OWIA 4H4FA 2ZU5A 1BTZA 4X8SH 1VCWA 2WYJA 2CF9H 1AVXA 2A45B 1IQEA 1ELEE 1PYTD 3BIVH 1MTUA 1O2ZA 2AGEX 4ISIH 3RXQA 3EAJA 3L33A 3ZVGA 3NK8A 2W7UA 5FAHA 1O2IA 1O37A 7ESTE 1K9OE 1GI4A 1ORFA 2FS9A 1O36A 1ELDE 1MTVA 1ZYOA 4Q80A 1J17T 2FPZA 1LPKB 1YPJH 2VWNA 3QTVH 3RU4T 1W7XH 2FOMB 3TK5A 4DY7B 2ZC9H 4B2CA 1SR5C 2BD4A 4Y0ZE 1MTNB 2ZHQH 1C5TA 4LZ4B 4UDWH 2CGAA 4B76A 3PWBA 1N1LA 3GCOA 1YPKH 3GYLB 1C4Y2 1OS8A 1P05A 1W8BH 4MNWA 4ZKOU 4XDEA 2BDHA 1O3MA 4WMEA 3HGPA 1FAKH 1WBGB 4RN6A 1O2QA 5T6GA 4HI3A 1H8IH 3BTTE 1DX5M 8KME2 3AASA 4A6LA 6GCHG 1C9PA 3SI3H 2P94A 1W7GH 1QL7A 3E0PB 4X1RU 1GI6A 1O5BB 5ETXA 4FU8A 3PV4A 3KQEA 1Z6EA 1IQHA 2GDDA 2A7JA 4X1NU 5C1YA 1OX1A 2XBWA 2FYQA 3TNTA 2Z9KA 2AMDA 3UIRA 1UTJA 2XC5A 3QDZB 2J34A 1AIXH 3RXKA 2ZDNA 1LVMA 1NRRH 4SGAE 1LVOA 2Y80A 1WAYB 6CHAB 1IHSH 2TGAA 1O3HA 1OP2A 1TYNA 1G2MA 4A1VA 1EJNA 2G51A 1RD3B 4K1SA 5DP3A 1N8OB 1LVBA 3UNQA 3M5NA 2ZQ1A 2XC4A 2ZA5A 2ZFRH 2AMPA 4UFEH 4X1SU 1ZJKA 2XWAA 3B23B 1GJ4H 2ESTE 1GBJA 3Q00A 1P01A 1GJ9B 2ZPQA 5JBAS 1SL3A 1O30A 2FS8A 1P10A 2Q6FA 3RM2H 3N7OA 1X7AC 1O3EA 4KTUA 4ZXYH 1CT2E 3PLBA 3M3TA 2BMGB 1HAHH 1XUKA 9LPRA 3TGJE 1SGYE 1XUJA 4INKA 2HLCA 1S5SA 1EPTA 4TY7A 5C5OA 4X6PA 2H6MA 1KXEA 5JB9S 4RKOB 1P2OA 1RS0A 3LGIA 4IN2A 1F5RA 1SHHB 2Z3CA 1QRXA 1GCDA 1UVSH 3ZVDA 1C5MD 1C2LA 2ALVA 2VU8E 4ISLA 5CMXH 1S83A 1BQYA 2ILNA 2W26A 4E05H 1AE5A 1BZXE 1V2JT 1G9IE 2THFB 4GLYA 3A88A 3U1JB 3RXLA 1DUEA 4GSOA 2R0LA 4F49A 1TAWA 5GDSH 8ESTE 2ZGJA 3ZYEA 2A4RA 2QXGA 1TGSZ 5FXLA 1C1UH 1FY8E 1O3AA 4ZKNU 1O2NA 3MHWU 2B8OH 2ZHDA 2PKAB 2BD7A 1W0ZU 3PLKA 3E0NB 2FLBH 1O3PB 1C2GA 3VB3A 1P3CA 2JKHA 1C1VH 2R2WU 3PO1B 3RXRA 1QNJA 1SOTA 3M35A 1NRNH 2ZU2A 2FI3E 4DIHH 1ZTKA 1QB6A 2TGPZ 1SBWA 5EXMA 1BT7A 1GG6B 1NS3A 1UJ1A 3KIDU 1C2FA 2GKVE 4GCHG 4MG3A 2GT8A 4AG2A 4KP0A 1Y3YA 2OC8A 2WPLS 4E7NA 1GBLA 2ODYB 3V3MA 1P9SA 4Z0KA 1EB2A 3JZ1B 2BY7X 3UR9A 2DE9A 1YLDA 2A7HA 1LQEA 3DFJA 3LDXH 3OYPA 1TA6A 2TRMA 1SGRE 1Y3WA 1PQ5A 1UHBA 4WMFA 1K1PA 1ABJH 1QQ4A 3LU9B 2WINI 5T6FA 2FOGA 4QT8C 3OSYA 5EOKA 3LGYA 3P8FA 1CHGA 3LGVA 3RXUA 2VWOA 1YGCH 1T8LA 3ZVCA 1AFQC 1ELVA 1TGBA 2ZU1A 1PQ8A 5C2ZA 1TPSA 1TWXB 1YCPH 4TY6A 3P95A 1UTNA 1C5SA 1NPMA 1F92A 4D9RA 1ZOMA 1YCPK 3SUEA 1P0SH 2XBXA 2XXLA 2A32A 2YOLA 1BBRE 1DWCH 1EASA 1C2IA 3NXPA 2BY9X 2BDBA 2KAIA 3LIWA 1EZUC 2UUFB 5B6OA 6GCHF 1CT0E 1D3QB 1UTQA 5AFZH 4DURA 1A1RA 2EEKA 3A7VA 1G30B 3GY4A 4ABHA 1AZZA 1H1BA 1C5VA 3SUDA 4ISOA 3ATIA 4FUFA 3RC4A 3ODDA 5DP8A 1FY4A 1O2XA 2FX4A 4HZHA 4DIIH 4Y6DA 2ALPA 1C1OA 2PSXA 2H1UA 3LOXA 2H5DA 2QA9E 2A4GA 1RRKA 4NCYA 1HXEH 5EXNA 4K69A 3ZZCA 1AKSA 3DFLA 1EZQA 1L1JA 4CBNA 3P92A 3BV9B 4A92A 4DGJA 3A87A 1UO6A 3V0XA 2VVVA 1HCGA 3KCGH 2H9TH 4HGCA 1SSXA 1V2UT 2RA0A 4K8YA 1TNJA 3RXOA 3RXDA 2JH0D 1W10U 1ETRH 1MQ6A 2J2UA 2FLRH 1P57B 2M5TA 3UQOA 3FP8E 3SUGA 1EZXC 2V6NA 2ZCLP 4WH8A 4UEHH 3ZVAA 1IQIA 1C5QA 4GHQA 1HAXB 3V12A 4Y79A 1QTFA 4Q7YA 1GDQA 2BX4A 1TPPA 4Y8ZA 5GPIB 4AOQA 4CREA 2A2QH 1TMBH 5A2MH 1PQ7A 1K1JA 3SNEA 2ZEBA 2TPIZ 3O8CA 1HRTH 2BTCE 4DT7B 1UTPA 3QO6A 3SU3A 1WTGH 3SU1A 1MKWH 1YBWA 3RXVA 1JIRA 1CA0B 1TNIA 3BTGE 1MKWK 3RC5A 5JPMH 2ZHFH 4K8BA 1C1TA 1UTOA 1BMAA 3MI4A 1OP0A 2XWBI 2ZDKA 1GI7B 4WWYA 2V3HH 2AERH 1OWEA 4JYVH 5L2ZH 1O2TA 1SQOA 3EBNA 1C2KA 1TPAE 1JMOH 3K9XB 1O5GH 1C5UA 3RXSA 4GAWA 2C3SA 4WY3A 2ZNKH 1CBWB 4KTCA 1F0TA 2F3CE 1NU9A 3S9BA 1AQ7A 5H4IB 3RLWH 4WMDA 1HIAB 1Y3XA 1D9IA 1F0UA 1P2NA 5DO4H 2P16A 1TALA 2BQ7B 1E34B 2FWWA 3NWUA 1LKAA 1CQQA 3CS7A 2D8WA 1K22H 4Q7ZA 3M7TA 4BAOB 4YOIA 3GY2A 1B7XB 4THNH 2BXTH 5A0CA 2CMYA 2GCHG 2NU1E 3HKIB 3LKWA 1L4DA 3GDSA 3KQBA 2VIPA 4O3UA 1K1IA 5GCHF 4FVDA 2FODA 2GDEH 1DVAH 2ANWA 1O5DH 1GI5A 2J38A 1K1MA 5JBCS 4Y10E 1YPEH 2UUYA 2C8YB 1TMTH 1GMHG 4XE4A 3LJJA 4O97A 4R8TB 1RFNA 1TGTA 1T8NA 3PLPA 1V2ST 3B9FH 3PTBA 3SQEE 3OY5U 1ZTJA 3U8RH 1C5RA 1NU7B 5K0HA 1MU6B 1Y8TA 1LCYA 4NIWA 4K3JA 1TA2A 4JZIA 5E0GA 5T3HA 1MZAA 2H9HA 1RTFB 4XBCA 3GDVA 1A5GH 1L2EA 2F9PA 2JETC 5A0AE 1LKBA 5AVDA 3UUZA 4XFQA 2QF0A 3T5FH 3D49H 4SGBE 2BD9A 1IQLA 1AO5A 1Z6JH 3A84A 3MU1A 3QK1A 3PMJA 1FPCH 2BM2A 1DWBH 3BTFE 1V2WT 2C93B 4OS4A 2Z3DA 2R9PA 1DXWA 1LHGH 4FUHA 1UTMA 3SHCH 1BITA 3D62A 1NZQH 2VNTA 2ZCHP 2VWMA 3LH1A 1SGEE 4DW2U 1SPJA 1YYY1 1MTWA 1QBVH 2UUJB 2ZQ2A 3UFAA 3V13A 5F03A 3ZZAA 4YZUA 1OWDA 1TX8A 1C2JA 2AIQA 1SQTA 1CE5A 1HAVA 1Z71A 5A8YA 2ZHEH 4LOYH 1MCVA 4A5TS 1TX6A 1A0JA 1S6FA 3SV8A 3UTUH 2F9BH 1F5LA 1YC0A 1AHTH 1O0DH 2BLVA 3FZDA 1GHVH 3BSQA 2J94A 1V2QT 1FY5A 2D1JA 3KHVA 1FAXA 4FUCA 1O32A 2K7XA 2QXHA 4I8GA 2YNAA 3STJA 2VIOA 3TH2H 1TBQH 4HFPB 1O2JA 1Z8IB 2O8WA 3TH4H 2ZECA 2ZO3H 1BB0B 1HAIH 3LJOA 1FY1A 4IMZA 4UFGH 3BG8A 1GMDG 4I8JA 1TMUH 4DG4A 1DWDH 3GY6A 1C2MA 2BDCA 1MCTA 1OWKA 5F8ZA 4KGAA 5DP5A 5C1UA 2ASUB 1G3BA 4BAQB 1L1NA 4Y76A 4AGJA 1UK4A 2QXIA 3TK6A 2BDAA 2G81E 3RMMH 2WUCA 1VITH 3GY5A 1C5LH 3UOUA 2ZZUH 1O3FA 4FU9A 1GCTC 1TRNA 1DFPA 3K2UA 3SJKA 4E7RG 1NY22 2H2ZA 1P2QA 3HK6B 3VGCC 3BG4C 1IHTH 5I46H 4LZ1H 2VJ1A 3F9GA 4ABGA 1A5HA 2QN5T 3ITIA 1LVYA 1Z1IA 3VB5A 1EATA 1BJVA 2C8XB 3T28A 1G36A 1ZZZA 2Z6BD 3A7ZA 1QHRB 3DT0H 3PMHB 3W94A 1ZMJA 2A2XH 3ZZ8A 4BTTB 3TGIE 3EYDA 2SGFE 1ZSKA 1GHWH 1HYLA 4Y8YA 2GGVB 2PR3A 3SOSA 3PM3A 3NZIA 4IC5A 1GI8B 1QJ6B 1KIGH 1B0EA 2PW8H 3NCLA 5DP4A 3O8DA 1EPTC 2IPHA 1GJDB 2FP7B 2VIQA 1Z8JB 4U01A 5SGAE 1DSUA 1NFUA 1O2KA 1CVWH 1RIWC 2G4TA 3PROA 1BOQA 4X6NA 3I29A 4AFZA 1AE8H 2PTNA 1GBAA 1H9LB 1THSH 1ARCA 3SORA 2BLQA 2ANKH 3SU2A 3UR6A 2GP9B 5L30H 1T4VH 4JMYA 2ZTYA 3TIUA 5E0HA 2ZIQH 3ESTA 3URCA 5J4SA 1YCPM 2A4QA 3MFJA 4CHAC 1AUTC 2G55A 2ZDMA 1H8DH 1K1LA 2A4OA 2EI7A 3F9EA 3DD2H 1ABIH 3MYWA 3A86A 5LPRA 3MNXA 3ZZ7A 3IITA 1QRWA 1VITG 1J15A 3CP7A 4NSYA 2FOBA 2GZ9A 1YLCA 3S9AA 4IBLH 2AEIH 1QA7A 4ZMAH 1EJMA 2C8WB 5EW2H 1EB1H 2SFAA 2A0QB 3RXIA 3QUMP 1O5FH 1V2KT 1JWTA 1QQUA 2NU2E 1Z8GA 2JH6D 1T7CA 4CRDA 1AY6H 1EQ9A 1ESBA 4KELA 1A0LA 1OWJA 3MH7A 1PPHE 4CH2B 1O2SA 1KXFA 3EGKH 1GBCA 1FONA 2STBE 4FUJA 1BJUA 3TH3H 2H5CA 5E2OA 2Y7ZA 2LPRA 1GDUA 3WY8A 4IMQA 1XUIA 1O39A 1SI5H 1Y5BT 1THRH 2HNTF 2O8MA 2R2MB 2FTLE 3MU8A 3MTYA 4I33A 4UE7H 1BTPA 1GBTA 1VGCC 1OXGA 3FZZA 3A81A 2V35A 1GI2A 1MAXA 7KMEH 2IOTA 1D3PB 2BDGA 5C20A 1P04A 2BD3A 1MBQA 9ESTA 2Z3EA 4MNXA 4U2WA 4WJG2 1Y3VA 1GHAF 1SC8U 1YPLH 1RTLA 1GJ5H 2Q6DA 1GBHA 1QR3E 2FX6A 4VGCC 4WF8A 1GL0E 1MTNC 1D6WA 3MO3A 1SGTA 2XC0A 4X1PU 2OQ5A 3HK3B 5IYTA 1BRAA 1OYTH 1D4PB 1Y5UT 3U9AH 3UWJH 1GMDF 2PWXA 1BHXB 4K1TA 1BTWA 2GX4A 1YM0A 3LC5A 3LGTA 4KKDA 4X2YA 4H6SB 1FIWA 5GJ4B 1OOKB 4R0IA 4GPGA 4ZROA 2RA3A 1GHBG 2ZDLA 3OX7U 4BOHA 1L1GA 1UVUH 1KXBA 4X2WA 4FVBA 2ZGHA 2DE8A 4Y71A 1SMFE 3BTEE 1SFIA 1HJ9A 5J4QA 4CR5A 1CHOF 3EA8A 4MLFB 2ZFQH 3MNBA 4I7YH 1P03A 4ZHAA 1AN1E 3A7XA 5DP7A 1FDPA 4AFSA 1PFXC 4I32A 5TCCA 4BTUB 1AUJA 4U32A 4X8UH 4AX9H 1HNEE 1HPGA 1IQMA 5LPFA 1ZRKA 4JYTA 2IN2A 5E2PA 2OTVA 2CF8H 1C5XB 3EDXB 3Q3YA 2FOEA 2G00A 3GOVB 3VXEH 4D7GA 2PFEA 3R3GB 3GCHC 2O9QA 4ZKSU 7GCHF 2ZFTA 1AFQB 2VGCB 4O9VA 2ODPA 1G37A 2OUAA 1CO7E 1GJ7B 1WYKA 1ZMNA 3A7YA 5A09A 5GXPA 1KDQA 2SNVA 2FMJA 2PV9B 1SGFA 1LDTT 3GY7A 1JOUB 2A7CA 3ENSB 3EA9A 1SGPE 3AAUA 7LPRA 1O5AB 1MD7A 1OP8A 4B74A 1EX3A 3ATKA 2Y5HA 1GI3A 3M5OA 2HNTC 1NFYA 4ABFA 1HJAC 4ZKRU 1SVPA 1CSOE 4JYUH 2WUBA 3A83A 1AWHB 1XVOA 2OCVB 2ZP0H 1KXAA 2A5KA 3ZZ9A 2GTBA 1AWFH 4AG1A 1DY9A 1S0RA 1Q31A 4BAHB 4U30A 4ABIA 3DHKH 5JYIA 3P6ZB 3HKJB 1ZMLA 2PKSC 4I8HA 1FPHH 1G32B 3SBKA 1SHYA 2NU4E 5AFYH 1SOZA 1ZSLA 3ZV8A 1O31A 3PO1C 2ZFSA 4FUBA 1IQKA 1BUIA 1AB9C 1GGDC 1IQGA 1SLUB 2OC7A 4K2YA 3PWCA 1GG6C 1TBRH 1F5KU 2HALA 2R0KA 3UOPA 1KYNA 2PUQH 3GCTG 2PTCE 3ZZ4A 3BEFB 4NSVA 4IN1A 1XUFA 1CGHA 1S84A 1WV7H 3BTKE 1NT1A 1W12U 2HOBA 1XXDA 3M37A 4CRAA 3A8AA 2AH4X 2I6QA 4ZUHA 1YPMH 1SGIB 3MH5A 3P8GA 1DWEH 1PYTC 1ARBA 1A5IA 1LPZB 2P93A 1KTSB 2PLXA 5FPSA 3HGNA 4AYVB 2G52A 4BXSA 2STAE 1FMGA 1O2MA 1YPHE 2TGDA 1GJ8B 2AGGX 4H6TA 1BDAA 2Z9LA 1DLKB 4D7FA 1TQ7B 2VIWA 3GICB 3RXAA 4MPXA 1MQ5A 1NO9H 3SJ9A 1W13U 5CHAC 3EA7A 1PPBH 1MUEB 1V2LT 1SB1H 1ESAA 1K28D 1HAZB 2QIQA 1DDJA 4FUIA 1J14A 4ISNA 3QLPH 4X6OA 1WUNH 3ELAH 1FI8A 1OYQA 1AI8H 1BMNH 3QZRA 4I8KA 4YOGA 1WQVH 1S85A 2LIZA 2FO9A 1ZGVA 1D3TB 3NKKA 1HBTH 4FXGH 4D9QA 1TNHA 4ABDA 2C90B 1NTPA 4B73A 1T32A 2BVXH 4INHA 4OS1A 3BTDE 1WTHD 5I25A 2P3TB 1A3BH 1ZRBA 2QGRA 3BIUH 3FVFB 1CA8B 1GVLA 3TJOA 1O3NA 4JZEH 1BRUP 2ANYA 2BY8X 1O35A 2BQWB 2VIDA 4H42U 5EPYA 1TIOA 3VB7A 1GBMA 2ZGBH 1VR1H 4XOJA 4PROA 2C4FH 3A89A 2GT7A 1XVMA 1T4UH 3JZ2B 4YO9A 4Y0YE 1W11U 1UTLM 2A1DB 4MTBA 4XBDA 5C67A 2XW9A 4AYYB 4GCHF 3FAOA 1DT2A 2BHGA 2PKAA 1MMJN 1VJ9U 2JETB 1C4V2 3OTJE 1A2CH 4HTCH 3RU4D 1LQDB 2VH6A 2V0BA 1GHYH 4MPWA 1TGCA 5EQQA 3ZVFA 4XSKU 1G3DA 2EC9H 5DP9A 5T6DA 3SV2H 1CT4E 1H9IE 1LHCH 2ZDVH 3UNRA 1TNKA 3RP2A 1ESTA 3H7OA 4ZXXH 2GZ7A 4FUEA 2HVXA 1D6RA 3MNSA 1QJ7B 3E16B 1QB9A 3O8RA 4MNVA 2QV1A 1FLEE 5F8XA 4Y11E 1GVKB 5EXLA 1ZPZA 1O3GA 3P8OA 3OY6U 1K21H 4NWLA 4NZQA 1EP6A 1NFWA 5F8TA 1AU8A 4NG9H 3TLOA 1CBWC 1MKXH 3VB4A 4K5ZA 1TQ0B 3ATMA 1MKXK 3RC6A 2ZG0H 1GJCB 2BX3A 2OXSA 1JRTA 2VVUA 2H9EH 4MPVA 1LHFH 1DSTA 1G3CA 1P02A 1TONA 2BYAX 4IW4E 4MDSA 2FYRA 2FOCA 1N6YA 3VB6A 1S81A 3MU5A 1UTKA 1AD8H 6ESTA 2ZFFH 3MH6A 1GHXH 1K1OA 2RCEA 3S7HB 2EI6A 4IS5A 5EPNA 1MBMA 2XRCA 1O34A 2BQ6B 3Q76A 1WOFA 3TU7H 4WH6A 1THPB 2OINA 2P8OC 5AF9H 2ZU4A 1A46H 2D26C 2BLOA 1GCTB 4NFEA 1V2VT 4WXIA 4B75A 3UNSA 2XNIA 2FOAA 1KLJH 1RGQA 4DVAU 3A7WA 2BD2A 4JZDH 1ETSH 3VGCB 3BG4B 2GMTC 1S82A 3URDA 3RM0H 1F0RA 1Z7KA 1SLVB 4UFDH 2HRVA 2ZKSA 2GVFA 4E06H 4OGXA 1J16A 3RXPA 4ZHMU 5PTPA 1O5CB 2BVSH 3TJNA 3LH3A 1E37B 2W3IA 1C5OH 3AAVA 2BZAA 2J9NA 3M7QA 1UCYH 1Y5AT 4NA7A 5HM9A 1GJ6A 1UCYK 3S0NA 3KGPA 1DUAA 1F2SE 1OKXA 4ESTE 1RJXB 1EPTB 2B9LA 3BTME 3QN7A 1O3OA 1DICA 4CRBA 3H7TA 1KY9A 1OPHB 1V6DA 3RXHA 3P8NA 1ZJDA 1DXPA 3A8DA 2VB0A 1MH0A 1RIWB 3TK9A 1NROH 1OWHA 1ELAA 1HAYB 4UONA 3E1XB 1ZHPA 2WV4A 1C5NH 1NRPH 3M3VA 5FCKA 1HJ8A 3TJVA 1C1MA 1QFKH 1C1WH 2EI8A 1ELBA 1SGNE 3G01A 1BIOA 4X8TH 1TBZH 1W3CA 1A61H 1QL9A 1AMHA 3L6PA 1MD8A 4CHAB 3RMOH 1ELCA 1NM6A 2HPQH 3SO3A 4TYDA 3LONA 3SI4H 4MPUA 2F9OA 3ZZ3A 2YNBA 2GCTC 1GJAB 1TOMH 4AFUA 2BOHB 4NIYA 2FOHA 3RXCA 2ZPSA 2SGQE 3AVZA 1GPZA 3TVJB 5ESBA 2ODQA 2Z7FE 1XMNB 3AW1A 3T25A 2SNWA 3KF2A 2CXVA 1GJBB 5LPEA 2Q1JA 4A7IB 2RG3A 1C2EA 2GCHF 2I6SA 2FZZA 5K7RA 1P12E 1O38A 1AFEH 1HLTH 1T8MA 1BRCE 8LPRA 1CGJE 2BLWA 2CHAC 2BB4A 4I31A 1J9CH 1HIAA 4OS2A 1O2OA 3K65B 2C8ZB 2A5AA 3TPIZ 1QJ1B 2FI5E 3L3TA 4INLA 1BTYA 3SU6A 1QURH 4ABAA 2BXUH 3KL6A 3STIA 4ZAEA 3PTNA 5LGOA 5BRRE 2HPPH 1GMHF 4ZH8A 1EP5A 1V2PT 2ZDAH 1A7SA 3U1IB 4TPYA 1GI1A 3E90B 5HMAA 1VGCB 1WQSA 1IAUA 3S9CA 3I78A 4LK4A 1L4ZA 1HGTH 1QGFA 1KLIH 1O3BA 4KTSA 3SUFA 2O8UA 1MAYA 2ZFPH 1WU1A 1E38B 2P3FH 2F9VA 3PMAB 3QWCH 1O3LA 1P11E 2QCYA 4AGKA 2AS9A 2KAIB 1GDNA 3P17H 5LH8A 1PPFE 1BHXF 1F7ZA 2GV6A 3EQ0H 1A0HB 1N6XA 2O8TA 4K60A 4VGCB 1V2RT 1BTHH 3KQDA 1C1PA 3GYMA 1YPHC 1FV9A 1UMAH 1JXPA 1C1QA 3V7TA 1TNLA 3ZYDA 3ZV9A 2XYAA 1EZSC 3P70B 2XBYA 3RXMA 4YM9A 1NN6A 2FIRH 1K2I1 4YT6H 3W95A 2Z9IA 5HGGA 1TOCB 1LO6A 1Q2WA 5FHTA 3M61U 1QY6A 3RXGA 2VVCA 2UWOA 1TNGA 2AYWA 3MOCA 5GWZA 3BEUA 1C1NA 1SG8B 3TITA 3SU0A 1AKSB 1C4U2 3BF6H 1JRSA 3HPTB 3SW2B 3D65E 2CJIA 1C5PA 2FI4E 2O8LA 1XM1A 1VCQA 1MU8B 2TIOA 1K1NA 5FX5A 1PJPA 3SGBE 1HAGE 1NESE 1W14U 3E6PH 4MQAA 4RKJB 1GBFA 3T29A 4NZLA 6LPRA 2WPMS 1HUTH 2IJOB 4AN7A 1AGJA 4CR9A 4TWYA 2G4UA 4BXWA 3GDUA 4M7GA 4NA9H 1INCA 2K1QA 5DKMA 3PB1E 2OD3B 1G2LA 3GCHB 1P9UA 1Y3UA 3RXTA 1AVGH 2ZPRA 3M7UA 1EOJA 3MMGA 4J1YA 1KTTB 3M5MA 2OP9A 2BDIA 3Q77A 5FPTA 1XKAC 3AW0A 3UPEA 4K1EA 4ABEA 2ZGXH 2QYIA 4CRCA 4UFFH 1DM4B 5JDUB 5DJ7A 1TE0A 1P2IA 4FUGA 3PMBB 1XUHA 4DOQA 1IQJA 1ELGA 1O2UA 2EA3A 1O2WA 1AVWA 2FXRA 1FIZA 1YP9A 3SGQE 1HJAB 1FZZA 2Y81A 5EU8A 6CHAC 4ABJA 2TBSA 1GVZA 1ID5H 3RUOA 1UVOA 1DANH 2ZU3A 4CRFA 4BAKB 2OLGA 1N8OC 2BY5X 3HATH 1XXFA 3U8OH 5E8EH 2J92A 3CS0A 2CN0H 4YTAA 2FTMA 1UK3A 4OGYA 2W7SA 1LMWB 1NC6A 4AB8A 1VZQH 1ELTA 2PKSB 1C5YB 1FN8A 1PQAA 1HDTH 1FNIA 1ZGIA 2J95A 1MTSA 3F1SB 1C5WB 1Z8RA 4TWWA 4OS7A 1DITH 3I77A 3RLYH 1KXDA 3RXBA 1O3JA 2QF3A 1C2HA 1FUJA 1AB9B 1BCUH 1BBRH 1GGDB 4OS5A 2PGBB 1G3EA 3SV7A 4Q2KA 1BBRK 1M9UA 4CH8B 2JH5D 1FQ3A 1VITF 3LT3A 2BD8A 4O3TA 2Z94A 2VIVA 4NA8A 1EOLA 3FANA 1RXPA 3SV9A 5EG4A 2F9NA 3NPSA 5BPEA 5CE1A 1EXFA 1V2NT 3LPRA 3SJ8A 4A1TA 5GCHG 2ZWLH 2ANMH 4D76A 2G5VA 4DCDA 5DK1A 2QY0B 1EAUA 2ZI2H 3ZZDA 2ZTZA 5EODA 3A85A 2ZHWH 1FJSA 2QAAA 3R0FA 1HFDA 1YPGH 2SGDE 5C5NA 1HV7A 1NFXA 5F6MA 5EW1H 3O8BA 5DG6A 3SNCA 5FBIA 2VGCC 2NU0E 1BRBE 2AMQA 1CU1A 5CHAB 1LHEH 3D23A 3UREA 4Y7BA 1O2LA 3LGWA 8GCHG 1ANEA 4AB9A 1GBIA 5ABWA 1QA0A 2XTTB 3SNBA 4IC6A 3A82A 2GV7A 3F6UH 2OC0A 2AIPA 3K6ZA 3GY3A 4B2AA 1ZPBA 3KN2A 3QTOH 2W3KA 1C2DA 4BTIB 2HGTH 5C1XA 3S7KB 1HAVB 3UQVA 4YESB 3BTHE 1FN6A 1GBKA 1EAXA 4JZ1A 1P2JA 3MNCA 1GBEA 1DY8A 4I8LA 4LXBH 4JK6A 4NIXA 1FY3A 1VCPA 1RTKA 1Z1JA 3SV6A 3VPKA 3UY9A 5GIBA 3TGKE 1ETTH 1TABE 2AGIX 3C1KA 3SNAA 4YT7H 2W5EA 2BZ6H 2OBOA 2Y5FA 1QB1A 4IGDA 1T31A 3TNSA 1BTXA 3RU4E 1WCZA 1XX9A 4X1QU 5ESTE 1BMMH 2QXJA 1GHBF 1GWAA 1SGFG 1GMCG 2SGEE 1ANBA 3M5LA 2R3YA 1C5ZB 3MU4A 1V2TT 4GHTA 1DS2E 3RXFA 1U6QA 1DE7H 4GVUA 1KSNA 3CENA 4BANB 2BVRH 4O03A 4AZ2B 3T27A 2WPHS 1W2KH 2Z9JA 1Y59T 1KXCA 4X6MA 5TCAA 1J8AA 2WPKS 2OBQA 2V3OH 5FX6A 1V2MT 3U98H 3BTWE 1EJAA 2GD4B 4X2XA 3SHAH 2DUCA 2Y7XA 3ZZ5A 1GBBA 1TB6H 4A1XA 1O2HA 4WXVA 5L2YH 1MZDA 3F68H 4X2VA 1IOEA 2PHBA 1XKBC 1NRSH 2Y5GA 4UD9H 2ZF0H 1GI9B 1CGIE 2PSYA 1PPEE 1P8VC 1YKTA 1HAOH 1LPGB 1BA8B 4FUDA 2Z9GA 3LC3A 5JBTA 2SGAA 3ZZ6A 2VWLA 3IWMA 1V3XA 1ZR0A 3SZNA 2G5NA 1P3EA 2G8TA 5EGMA 1DPOA 4BNRA 4DJZB 1A3EH 2ULLA 3UWIA 1TX7A 4ISHH 3H5CB 2NWNA 4ABBA 1PPZA 2Y82A 3ZZBA 4GUXA 3DA9B 3K6YA 3MO9A 5IDKA 3RXEA 2FM2A 1QL8A 1BTUA 3T62A 2B0FA 2NU3E 4NGAH 4CBOA 3LGUA 3VXFH 1XUGA 1FXYA 4WVPE 2ZTXA 1CA0C 4NWKA 5FCRA 3SU4A 1ANCA 1DOJA 2HWLB 4B1TA 1ANDA 1ZTLA 4YLQH 2WV5A 5G4BA 4TPIZ 3GISB 1ZHMA 2CV3A 5FPYA 4CRGA 3BEIB 2BY6X 2GZ8A 1O3IA 3SQHE 3RMLH 2P8OB 1TLDA 5C3NA 4J2YB 5HM2A 1VJAU 1OSSA 3B8JA 1TFXA 1EAIA 2WPJS 4Y7AA 1SGCA 2VINA 2F83A 1Q3XA 1B0FA 4JCNA 2UUKB 3IG6B 3QGNB 5EQRA 2GMTB 3OU0A 1ACBE 4X8VH 2WYGA 3GCNA 4NIVA 5DGJA 4FU7A 2FDAA 4Z6AH 2FEQH 4MNYA 1O3CA 3GCTF 3BTQE 2TGTA 1QBNA 1E0FD 8GCHF 1H9HE 5JBBS 2LNCA 3ATLA 1UVPA 5DP6A 1O5EH 3U69H 1GL1A 4Y8XA 2P3UB 3TJUA 3FFGA 2D2DA 3KNXA 2HNTE 4NFFA 3ZVEA 5JB8S 2SGPE 1O33A 3MU0A 1DLEA 1E36B 2P95A 3KQCA 3SN8A 2WPIS 2XCNA 1O2RA 4MVNA 2XBVA 4AFQA 3ODFA 5E0JA 3SU5A 1SGDE 1KLTA 1P09A 3A8CA 5TJXA 2AFQB 1NRQH 3MWIU 1P2MA 1EKBB 3S69A 3T2NA 5DPAA 4F4OC 3DUXH 1C1RA 1JBUH 2RDLA 4XBBA 2F91A 4ZHLU 1BMLA 1GBDA 1YF4A 1O2PA 5EQSA 2Y6TA 3KEEA 1ZHRA 1GHZA 3E3TA 1GI0A 2GCTB 3MO6A 3M3SA 5HYOA 5A8ZA 1PPGE 1QIXB 3QZQA 4Q7XA 5A8XA 2P59A 1O3KA 2PGQB 3SGAE 1UK2A 1GHAG 1C1SA 2A31A 1GMCF
chains in the Genus database with same CATH superfamily
3T26A 2OQUA 5AHGH 1IQFA 3ATWA 2ZCKP 3NUMA 2XCFA 1ZPCA 2BDYA 3A80A 2W6JD 2ZGCA 4X0WU 1LHDH 2QC2A 3FOAA 2UWLA 1P06A 3A7TA 5DSFA 2VH0A 1EAWA 1HB0B 4XRNA 1SLXB 5L6NH 3C27B 1L0ZA 5HXFA 1E35B 2CHAB 3RDZA 4YLUA 1H4WA 1SFQB 3SJOA 3BN9A 2CK3D 4JK5A 3SJIA 1IQNA 1TRMA 2OC1A 3FP6E 2R3UA 1JIMA 1SQAA 1O3DA 3GY8A 4B71A 3FP7E 1QCPA 3F9FA 1V2OT 1ZSJA 2BD5A 3A8BA 1SGQE 1C9TA 4AORA 3E91A 2EQNA 2F9UA 3Q3XA 1F0SA 1SLWB 2B5TB 2FESH 1A4WH 4BAMB 1QBOA 4RSPA 1S6HA 1TGNA 1ZLRA 1O2VA 1ELFA 1WSSH 1CHOG 1LTOA 3VFEA 3Q3KA 3SNDA 4B2BA 3RMNH 1P2KA 1UCYE 3F9HA 2J4IA 1B5GH 3MH4A 2A5IA 4JZFH 1UVTH 3E8LA 4ASHA 2Q6GA 1KDQB 2UWPA 3VEQB 4D8NA 1QRZA 4OS6A 1O2YA 1AZ8A 3U8TH 2PUXB 1TRYA 5EJLA 1HXFH 1O2GH 1EUFA 2B7DH 3RXJA 5A0BA 4YOJA 5FBEA 7GCHG 2BOKA 1HAPH 3M36A 1W0YH 1S0QA 1PPCE 2FOFA 3ZVBA 1UHBB 1E79D 3QGJA 1D3DB 1T8OA 1TPOA 3PV2A 3EE0B 3PYHA 3QX5H 1OWIA 4H4FA 2ZU5A 1BTZA 2KCOA 4X8SH 2KFWA 1VCWA 2WYJA 2CF9H 1AVXA 2A45B 1IQEA 1ELEE 1PYTD 3BIVH 1MTUA 1O2ZA 2AGEX 4ISIH 3RXQA 3EAJA 3L33A 3ZVGA 3NK8A 2W7UA 5FAHA 1O2IA 1O37A 7ESTE 1K9OE 1GI4A 1COWD 1ORFA 2FS9A 1O36A 1ELDE 1MTVA 1ZYOA 4Q80A 1J17T 2EY4C 2FPZA 1LPKB 1YPJH 2VWNA 3QTVH 3RU4T 1W7XH 2FOMB 3TK5A 4DY7B 2ZC9H 4B2CA 1SR5C 2BD4A 5IK2D 4Y0ZE 1MTNB 2ZHQH 1C5TA 4LZ4B 4UDWH 2CGAA 4B76A 3PWBA 1N1LA 3GCOA 1YPKH 3GYLB 4M9FA 3KYGA 1C4Y2 1OS8A 1P05A 1W8BH 4MNWA 4ZKOU 4XDEA 2BDHA 1O3MA 4WMEA 3HGPA 1FAKH 1WBGB 4RN6A 1O2QA 5T6GA 4HI3A 1H8IH 3BTTE 1DX5M 8KME2 3AASA 4A6LA 6GCHG 1C9PA 3SI3H 2P94A 1W7GH 1QL7A 3E0PB 4X1RU 1GI6A 2V7QD 1O5BB 5ETXA 4FU8A 3PV4A 3KQEA 1Z6EA 1IQHA 2GDDA 2JJ1D 2RDEA 2A7JA 4X1NU 5C1YA 1OX1A 2XBWA 2FYQA 3TNTA 2Z9KA 2AMDA 3UIRA 1UTJA 2XC5A 3QDZB 2J34A 1AIXH 3RXKA 1H8ED 2ZDNA 1LVMA 1NRRH 4SGAE 1LVOA 5C0UA 2Y80A 5KGOA 1WAYB 6CHAB 1IHSH 2TGAA 1O3HA 1OP2A 1TYNA 1G2MA 4A1VA 1EJNA 2G51A 1RD3B 4K1SA 5DP3A 1N8OB 1LVBA 3UNQA 3M5NA 2ZQ1A 2XC4A 2ZA5A 2ZFRH 2AMPA 4UFEH 4X1SU 1ZJKA 2YMSB 2XWAA 3B23B 1GJ4H 2ESTE 1GBJA 3Q00A 1P01A 1GJ9B 2ZPQA 5JBAS 1SL3A 1O30A 2FS8A 1P10A 2Q6FA 3RM2H 3N7OA 2PP6A 1X7AC 1O3EA 4KTUA 4ZXYH 1CT2E 3PLBA 3M3TA 2BMGB 1HAHH 1XUKA 9LPRA 3TGJE 1SGYE 1XUJA 4INKA 2HLCA 3WWBA 1S5SA 1EPTA 4FETA 4TY7A 5C5OA 1VKYA 4X6PA 2H6MA 1KXEA 5JB9S 4RKOB 1P2OA 1RS0A 3LGIA 4IN2A 1F5RA 1SHHB 2Z3CA 1QRXA 1GCDA 1UVSH 3ZVDA 1C5MD 1C2LA 2ALVA 2VU8E 3N7DA 4ISLA 5CMXH 1S83A 3DSGA 1BQYA 2ILNA 2W26A 4E05H 1AE5A 1BZXE 1V2JT 1G9IE 2THFB 4GLYA 3A88A 3U1JB 3RXLA 1DUEA 4GSOA 2R0LA 4F49A 1TAWA 5GDSH 8ESTE 2ZGJA 3ZYEA 2A4RA 2QXGA 1TGSZ 2LP6A 5FXLA 1C1UH 1FY8E 1O3AA 4ZKNU 1O2NA 3MHWU 4ASUD 2B8OH 2ZHDA 2PKAB 5HKKD 2BD7A 1W0ZU 3PLKA 3E0NB 3NRLA 2FLBH 1O3PB 1C2GA 3VB3A 1P3CA 2JKHA 1C1VH 2R2WU 3N7EA 3PO1B 3RXRA 2L74A 1QNJA 1SOTA 3M35A 1NRNH 2ZU2A 2FI3E 4DIHH 1ZTKA 1QB6A 2TGPZ 1SBWA 5EXMA 1BT7A 1GG6B 1NS3A 1UJ1A 2F4LA 3KIDU 1C2FA 2GKVE 4GCHG 4MG3A 2GT8A 4AG2A 4KP0A 1Y3YA 2OC8A 2WPLS 4E7NA 1GBLA 1NBMD 3V3MA 1P9SA 2ODYB 1EB2A 3JZ1B 2BY7X 4Z0KA 3UR9A 2DE9A 1YLDA 2A7HA 1LQEA 2WV9A 3DFJA 3LDXH 3OYPA 1TA6A 2TRMA 1SGRE 1Y3WA 1PQ5A 1UHBA 4WMFA 1K1PA 1ABJH 1QQ4A 1H8HD 3LU9B 2WINI 5T6FA 2FOGA 4QT8C 3OSYA 5EOKA 3LGYA 3P8FA 1CHGA 3LGVA 3F2HA 2VWOA 3RXUA 1YGCH 1T8LA 3ZVCA 1AFQC 1ELVA 1TGBA 2ZU1A 1PQ8A 5C2ZA 1TPSA 1TWXB 1YCPH 4TY6A 3P95A 1UTNA 1C5SA 1NPMA 1F92A 4D9RA 1ZOMA 1YCPK 3SUEA 1P0SH 2XBXA 2XXLA 2A32A 2YOLA 5EJ1A 1BBRE 1DWCH 1EASA 1C2IA 3NXPA 2BY9X 4YXWD 2BDBA 2KAIA 3LIWA 1EZUC 2UUFB 5B6OA 6GCHF 1CT0E 2KZ4A 1D3QB 1UTQA 5AFZH 4DURA 1A1RA 2EEKA 2KCYA 1G30B 3A7VA 3GY4A 4ABHA 1AZZA 1H1BA 1C5VA 3SUDA 4ISOA 3ATIA 4FUFA 3RC4A 3ODDA 5DP8A 1FY4A 1O2XA 2FX4A 4HZHA 4DIIH 4Y6DA 2KR7A 2ALPA 1C1OA 2PSXA 2H1UA 3LOXA 2H5DA 2QA9E 2A4GA 1RRKA 4NCYA 1HXEH 3F2FA 4K69A 5EXNA 3ZZCA 1AKSA 3DFLA 1EZQA 1L1JA 4CBNA 3P92A 3BV9B 4A92A 4DGJA 3A87A 1UO6A 3V0XA 2VVVA 1HCGA 3KCGH 2H9TH 4HGCA 1SSXA 1V2UT 3UB0A 2RA0A 4K8YA 1TNJA 3RXOA 2QF4A 3RXDA 2JH0D 1W10U 1ETRH 1MQ6A 2J2UA 2FLRH 1P57B 2M5TA 3UQOA 3FP8E 3SUGA 1EZXC 2V6NA 2ZCLP 4WH8A 4UEHH 3ZVAA 1IQIA 1C5QA 4GHQA 1HAXB 3V12A 4Y79A 1QTFA 4Q7YA 1GDQA 2BX4A 1TPPA 5C0TA 4Y8ZA 5GPIB 4AOQA 4CREA 2A2QH 1TMBH 5A2MH 1PQ7A 1K1JA 3SNEA 2ZEBA 2TPIZ 3O8CA 1HRTH 2BTCE 4DT7B 1UTPA 3QO6A 3SU3A 1WTGH 3SU1A 1MKWH 1OHHD 1YBWA 3RXVA 1JIRA 1CA0B 1TNIA 3BTGE 1MKWK 3RC5A 5JPMH 2ZHFH 4K8BA 1C1TA 1UTOA 1BMAA 3MI4A 1OP0A 2XWBI 2ZDKA 1GI7B 4WWYA 2V3HH 2AERH 1OWEA 4JYVH 5L2ZH 1O2TA 1SQOA 3EBNA 3DSOA 1C2KA 4ZCNA 1TPAE 1JMOH 2JJ2D 3K9XB 1O5GH 1C5UA 3RXSA 4GAWA 2C3SA 4WY3A 2ZNKH 1CBWB 4KTCA 1F0TA 2F3CE 1NU9A 3S9BA 2L6OA 1AQ7A 5H4IB 3RLWH 4WMDA 1HIAB 1Y3XA 1D9IA 1F0UA 1P2NA 5DO4H 2P16A 1TALA 2BQ7B 1E34B 2FWWA 3NWUA 1LKAA 1CQQA 3CS7A 2D8WA 2IJD1 1K22H 4Q7ZA 3M7TA 4BAOB 4YOIA 3GY2A 1B7XB 4THNH 2BXTH 5A0CA 2CMYA 2GCHG 2NU1E 3HKIB 3LKWA 1L4DA 3GDSA 3KQBA 2VIPA 3N99A 4O3UA 1K1IA 5GCHF 4FVDA 2FODA 2GDEH 1DVAH 2ANWA 1O5DH 1SKYE 1GI5A 2J38A 1K1MA 5JBCS 4Y10E 1YPEH 2UUYA 1SQRA 2C8YB 1TMTH 5DN6D 1GMHG 4XE4A 3LJJA 4O97A 3CNRA 4R8TB 1RFNA 1TGTA 1T8NA 3PLPA 1V2ST 3B9FH 3PTBA 3SQEE 3OY5U 1ZTJA 3U8RH 1C5RA 1KMHB 1NU7B 5K0HA 1MU6B 4Q4LA 1Y8TA 1LCYA 4NIWA 4K3JA 1TA2A 4JZIA 5E0GA 5T3HA 1MZAA 2H9HA 1RTFB 4XBCA 3GDVA 1A5GH 1L2EA 2F9PA 2JETC 5A0AE 1LKBA 5AVDA 3UUZA 4XFQA 2QF0A 3T5FH 3D49H 4SGBE 2BD9A 1IQLA 1AO5A 1Z6JH 3A84A 3MU1A 3QK1A 3PMJA 1FPCH 2BM2A 1DWBH 3BTFE 1V2WT 1EFRD 2C93B 4OS4A 2Z3DA 2R9PA 1DXWA 1LHGH 4FUHA 1UTMA 3SHCH 1BITA 3D62A 1NZQH 2VNTA 2ZCHP 2VWMA 3LH1A 1SGEE 4DW2U 1SPJA 1YYY1 1MTWA 1QBVH 2UUJB 2ZQ2A 3UFAA 3V13A 5F03A 3ZZAA 4YZUA 1OWDA 1TX8A 1C2JA 2AIQA 1SQTA 1CE5A 1HAVA 1Z71A 5A8YA 2ZHEH 4LOYH 1MCVA 4A5TS 1TX6A 1A0JA 1S6FA 3SV8A 3UTUH 2F9BH 2GJGA 1F5LA 1YC0A 1AHTH 1O0DH 2BLVA 3FZDA 1GHVH 3BSQA 2J94A 1V2QT 1FY5A 2D1JA 3KHVA 1FAXA 4FUCA 1O32A 2K7XA 3KQ5A 2QXHA 4I8GA 2YNAA 3STJA 2VIOA 3TH2H 1TBQH 4HFPB 3PRBA 1O2JA 1Z8IB 2O8WA 3TH4H 2ZECA 2ZO3H 1BB0B 1HAIH 3LJOA 1FY1A 4IMZA 4UFGH 3BG8A 1GMDG 4I8JA 1TMUH 4DG4A 1DWDH 3GY6A 1C2MA 2BDCA 1MCTA 1OWKA 5F8ZA 4KGAA 5DP5A 5C1UA 3H09A 2ASUB 1G3BA 4BAQB 1L1NA 4Y76A 4AGJA 1UK4A 2QXIA 3TK6A 2BDAA 2G81E 3RMMH 2WUCA 1VITH 3GY5A 1C5LH 3UOUA 2ZZUH 1S6LA 1O3FA 4FU9A 1GCTC 1TRNA 1WDIA 1DFPA 3K2UA 3SJKA 4E7RG 1FX0B 1NY22 2H2ZA 1P2QA 3HK6B 3VGCC 3BG4C 1IHTH 5I46H 4LZ1H 2VJ1A 3F9GA 4ABGA 1A5HA 2QN5T 3ITIA 1LVYA 1Z1IA 3VB5A 1EATA 1BJVA 2C8XB 3T28A 1G36A 1ZZZA 2Z6BD 3A7ZA 1QHRB 3DCLA 3DT0H 3PMHB 3W94A 1ZMJA 2A2XH 3ZZ8A 4BTTB 3TGIE 3EYDA 2SGFE 1ZSKA 1GHWH 1HYLA 3PRDA 4Y8YA 2GGVB 2PR3A 3SOSA 3PM3A 3NZIA 4IC5A 1GI8B 1QJ6B 1KIGH 1B0EA 2PW8H 3NCLA 5DP4A 3O8DA 1EPTC 2IPHA 4ACBA 1GJDB 2FP7B 2VIQA 1Z8JB 4U01A 5SGAE 1DSUA 1NFUA 1O2KA 1CVWH 1RIWC 2G4TA 3PROA 1BOQA 4X6NA 3I29A 4AFZA 1AE8H 2PTNA 1GBAA 1H9LB 3SYJA 1THSH 1ARCA 3SORA 2BLQA 2ANKH 3SU2A 3UR6A 2GP9B 5L30H 1T4VH 4JMYA 2ZTYA 3TIUA 5E0HA 3AK5A 2AHME 2ZIQH 3ESTA 3URCA 5J4SA 1YCPM 2A4QA 3MFJA 2WPDD 4CHAC 1AUTC 3OAAD 2G55A 2ZDMA 1H8DH 1K1LA 2A4OA 2EI7A 5T1VA 3F9EA 3DD2H 1ABIH 3MYWA 3A86A 5LPRA 2F43B 3MNXA 3ZZ7A 3IITA 1QRWA 1VITG 1J15A 3CP7A 2QF5A 4NSYA 2FOBA 2GZ9A 1YLCA 3S9AA 4IBLH 2AEIH 1QA7A 4ZMAH 1EJMA 2C8WB 5EW2H 1EB1H 2SFAA 2A0QB 3RXIA 3QUMP 1YLNA 2XNDD 1O5FH 1V2KT 1JWTA 1QQUA 2NU2E 1Z8GA 2JH6D 1T7CA 3UAIC 4CRDA 1AY6H 3OEED 1EQ9A 1ESBA 2J97A 4KELA 1A0LA 1OWJA 3MH7A 1PPHE 4CH2B 3F0OA 1O2SA 1KXFA 3EGKH 1GBCA 1FONA 2STBE 4FUJA 1BJUA 3TH3H 2H5CA 5E2OA 2Y7ZA 2LPRA 1GDUA 3WY8A 4IMQA 1XUIA 1O39A 1SI5H 1Y5BT 1THRH 2HNTF 2O8MA 2R2MB 2FTLE 3MU8A 3MTYA 2WSSD 4I33A 4UE7H 4DT4A 1BTPA 1GBTA 1VGCC 1OXGA 3FZZA 3A81A 2V35A 1GI2A 1MAXA 7KMEH 2IOTA 1D3PB 2BDGA 3KYFA 5C20A 1P04A 2BD3A 1MBQA 9ESTA 2Z3EA 4MNXA 4U2WA 4WJG2 1Y3VA 1GHAF 1SC8U 1YPLH 1RTLA 1GJ5H 3FN8A 2Q6DA 1W0KD 1GBHA 1QR3E 4TT3D 2FX6A 4VGCC 4WF8A 1GL0E 1MTNC 1D6WA 3MO3A 1SGTA 2XC0A 4X1PU 2OQ5A 3HK3B 5IYTA 1BRAA 1OYTH 1D4PB 1YY3A 1Y5UT 3U9AH 3UWJH 1GMDF 2PWXA 1BHXB 4K1TA 1NBME 1BTWA 2GX4A 1YM0A 3LC5A 3LGTA 3PV5A 4KKDA 4X2YA 4H6SB 1FIWA 5GJ4B 1OOKB 4R0IA 4GPGA 4ZROA 2RA3A 1GHBG 2ZDLA 3OX7U 4BOHA 1L1GA 1UVUH 1KXBA 4X2WA 4FVBA 2ZGHA 2DE8A 4Y71A 1SMFE 3BTEE 1SFIA 1HJ9A 5J4QA 4CR5A 1CHOF 3EA8A 4MLFB 2ZFQH 3MNBA 4I7YH 1P03A 2QE7D 4ZHAA 1AN1E 3A7XA 5DP7A 1FDPA 4AFSA 1PFXC 4I32A 5TCCA 4BTUB 1AUJA 4U32A 4X8UH 4AX9H 1HNEE 1HPGA 1IQMA 5LPFA 1ZRKA 4JYTA 2IN2A 5HIZA 5E2PA 2OTVA 2CF8H 1C5XB 3EDXB 3Q3YA 2FOEA 2G00A 3GOVB 3VXEH 4D7GA 2PFEA 3R3GB 3GCHC 2O9QA 4ZKSU 7GCHF 2ZFTA 3WW7A 1AFQB 2VGCB 4O9VA 2ODPA 1G37A 2OUAA 1CO7E 1GJ7B 1WYKA 1ZMNA 3A7YA 5A09A 5GXPA 1KDQA 2SNVA 2FMJA 2PV9B 1SGFA 1LDTT 4FOUC 3GY7A 1JOUB 2A7CA 3ENSB 3EA9A 2XOKD 1SGPE 3AAUA 7LPRA 1O5AB 1MD7A 1OP8A 4B74A 2HLDD 1EX3A 3ATKA 2Y5HA 1GI3A 3M5OA 2HNTC 1NFYA 4ABFA 1HJAC 4ZKRU 1SVPA 1CSOE 4JYUH 2WUBA 3A83A 2OK5A 1AWHB 1XVOA 2OCVB 2ZP0H 1KXAA 2A5KA 3ZZ9A 5F53A 2GTBA 1AWFH 4AG1A 1DY9A 1S0RA 1Q31A 4BAHB 4U30A 4ABIA 3DHKH 5JYIA 3P6ZB 3HKJB 1ZMLA 3U28C 2PKSC 4I8HA 1FPHH 1G32B 3SBKA 1SHYA 2NU4E 5AFYH 1SOZA 1ZSLA 3ZV8A 1O31A 3PO1C 2ZFSA 4FUBA 1IQKA 1BUIA 1AB9C 1GGDC 1IQGA 1SLUB 2OC7A 4K2YA 3PWCA 1GG6C 1TBRH 1F5KU 2HALA 2JDID 2R0KA 3UOPA 1KYNA 2PUQH 3GCTG 2PTCE 3ZZ4A 3BEFB 4NSVA 4IN1A 1XUFA 1CGHA 1S84A 1WV7H 3BTKE 1NT1A 2J98B 1W12U 2HOBA 1XXDA 3M37A 3OTPA 4CRAA 3OE7D 3A8AA 2AH4X 4AC9A 2I6QA 4ZUHA 1YPMH 1SGIB 3MH5A 2KM0A 1DWEH 3P8GA 1PYTC 1ARBA 1A5IA 1LPZB 2P93A 1KTSB 2PLXA 5FPSA 3HGNA 4AYVB 2G52A 4BXSA 2STAE 1FMGA 1O2MA 1YPHE 2TGDA 1GJ8B 2AGGX 4H6TA 1BDAA 2Z9LA 1DLKB 4D7FA 1TQ7B 2VIWA 3GICB 3RXAA 4MPXA 1MQ5A 1NO9H 3SJ9A 1W13U 5CHAC 3EA7A 1PPBH 1MUEB 1V2LT 1SB1H 1ESAA 1K28D 1HAZB 2QIQA 1DDJA 4FUIA 1J14A 4ISNA 3QLPH 1K0HA 4X6OA 1WUNH 3ELAH 1FI8A 1OYQA 1AI8H 1BMNH 3QZRA 4I8KA 4YOGA 1WQVH 1S85A 2LIZA 2FO9A 1ZGVA 1D3TB 3NKKA 1HBTH 4FXGH 4D9QA 1TNHA 4ABDA 2C90B 1NTPA 2JIZD 4B73A 4RT0A 1T32A 2BVXH 4INHA 4OS1A 3BTDE 1WTHD 5I25A 2P3TB 1A3BH 1ZRBA 2QGRA 3BIUH 3FVFB 1CA8B 1GVLA 3TJOA 1O3NA 4JZEH 1BRUP 2ANYA 2BY8X 1O35A 2BQWB 2VIDA 4H42U 5EPYA 1TIOA 3VB7A 1GBMA 2ZGBH 1VR1H 4XOJA 4PROA 2C4FH 3A89A 2GT7A 1XVMA 1T4UH 3JZ2B 4YO9A 4Y0YE 1W11U 1UTLM 2A1DB 4MTBA 4XBDA 5C67A 2XW9A 4AYYB 4GCHF 3FAOA 1DT2A 2BHGA 2PKAA 1MMJN 1VJ9U 2JETB 1C4V2 3OTJE 1A2CH 4HTCH 5C94A 3RU4D 1LQDB 2VH6A 2V0BA 1GHYH 4MPWA 1TGCA 5EQQA 3ZVFA 4XSKU 1G3DA 2EC9H 5DP9A 5T6DA 3SV2H 1CT4E 1H9IE 1LHCH 2ZDVH 3UNRA 1TNKA 3RP2A 1ESTA 5B6LA 3H7OA 4ZXXH 2GZ7A 4FUEA 2HVXA 1D6RA 3MNSA 1QJ7B 3E16B 1QB9A 3O8RA 3W1EA 4MNVA 2QV1A 1FLEE 5F8XA 4Y11E 1GVKB 5EXLA 1ZPZA 1O3GA 3P8OA 3OY6U 1K21H 4NWLA 4NZQA 1EP6A 1NFWA 5F8TA 1AU8A 4NG9H 3TLOA 1CBWC 1MKXH 3VB4A 4K5ZA 1TQ0B 3ATMA 1MKXK 3RC6A 2ZG0H 1GJCB 2BX3A 2OXSA 1JRTA 2VVUA 2H9EH 4MPVA 1LHFH 1DSTA 1E1QD 1G3CA 1P02A 1TONA 2BYAX 4IW4E 4MDSA 2FYRA 2WHXA 2FOCA 1N6YA 3VB6A 1S81A 3MU5A 1UTKA 1AD8H 6ESTA 2ZFFH 3MH6A 1GHXH 1K1OA 2RCEA 3S7HB 3OFND 5FL7D 2EI6A 4IS5A 5EPNA 1MBMA 2XRCA 1O34A 2BQ6B 4B6FA 3Q76A 1WOFA 3TU7H 4WH6A 1THPB 2OINA 2P8OC 5AF9H 2ZU4A 1A46H 2D26C 2BLOA 4RI0A 1GCTB 4NFEA 1V2VT 4WXIA 4B75A 3UNSA 2XNIA 2FOAA 1KLJH 1RGQA 4DVAU 3A7WA 2BD2A 4JZDH 1ETSH 3VGCB 3BG4B 2GMTC 1S82A 3URDA 3RM0H 1F0RA 1Z7KA 1SLVB 4UFDH 2HRVA 2ZKSA 2GVFA 4E06H 4OGXA 1J16A 3RXPA 4TSFD 4ZHMU 5PTPA 1O5CB 2BVSH 3TJNA 3LH3A 1E37B 2W3IA 1C5OH 3AAVA 2BZAA 2WZQA 2J9NA 3M7QA 1UCYH 1Y5AT 4NA7A 5HM9A 1GJ6A 1UCYK 3S0NA 3KGPA 1DUAA 1F2SE 1OKXA 4ESTE 1RJXB 1EPTB 2B9LA 3BTME 3QN7A 1O3OA 1DICA 4CRBA 3H7TA 1KY9A 1OPHB 1V6DA 1W0JD 2V3MA 3RXHA 3P8NA 1ZJDA 1DXPA 3A8DA 2VB0A 1MH0A 1RIWB 3TK9A 1NROH 1OWHA 1ELAA 3DSPA 1HAYB 4UONA 3E1XB 1ZHPA 2WV4A 1C5NH 1NRPH 3M3VA 5FCKA 1HJ8A 3TJVA 1C1MA 1QFKH 1C1WH 2EI8A 1ELBA 1MABB 1SGNE 3G01A 1BIOA 4X8TH 1TBZH 1W3CA 1A61H 1QL9A 1AMHA 3L6PA 1MD8A 4CHAB 3RMOH 2VBCA 1ELCA 1NM6A 2HPQH 3SO3A 4TYDA 3LONA 3SI4H 4MPUA 2F9OA 3ZZ3A 2YNBA 2GCTC 1GJAB 1TOMH 4AFUA 2BOHB 4NIYA 2FOHA 3RXCA 2ZPSA 2SGQE 3AVZA 1GPZA 3TVJB 5ESBA 2ODQA 2Z7FE 1XMNB 3AW1A 3T25A 2SNWA 3KF2A 2CXVA 1GJBB 5LPEA 2Q1JA 4A7IB 2RG3A 1C2EA 2GCHF 2I6SA 2FZZA 5K7RA 1P12E 1O38A 1AFEH 1HLTH 1T8MA 1BRCE 8LPRA 1CGJE 2BLWA 2CHAC 4ACAA 2BB4A 4I31A 1J9CH 4F55A 1HIAA 4OS2A 1O2OA 3K65B 2C8ZB 2A5AA 3TPIZ 1QJ1B 2FI5E 3L3TA 4INLA 1BTYA 3SU6A 1QURH 4ABAA 2BXUH 5GNDA 3KL6A 3STIA 4ZAEA 3PTNA 5LGOA 5BRRE 2HPPH 1GMHF 4ZH8A 1EP5A 1V2PT 2ZDAH 1A7SA 3FO8D 3U1IB 4TPYA 1GI1A 3E90B 5HMAA 1VGCB 1WQSA 1IAUA 3S9CA 3I78A 4LK4A 1L4ZA 1HGTH 1QGFA 1KLIH 1O3BA 4KTSA 3SUFA 2O8UA 1MAYA 2ZFPH 1WU1A 1E38B 2P3FH 2F9VA 3PMAB 3QWCH 1O3LA 1P11E 2QCYA 4AGKA 2AS9A 2KAIB 1GDNA 3P17H 5LH8A 1PPFE 1BHXF 1F7ZA 2GV6A 3EQ0H 1A0HB 1N6XA 2O8TA 4K60A 4VGCB 1V2RT 1BTHH 3KQDA 1C1PA 3GYMA 1YPHC 1QZ8A 3GS9A 1FV9A 1UMAH 1JXPA 1C1QA 3V7TA 1TNLA 3ZYDA 3ZV9A 2XYAA 1EZSC 3P70B 2XBYA 3RXMA 4YM9A 1NN6A 2FIRH 1K2I1 4YT6H 3W95A 2Z9IA 5HGGA 1TOCB 1LO6A 1Q2WA 5FHTA 3M61U 1QY6A 3RXGA 2VVCA 2UWOA 1TNGA 2AYWA 3F2GA 2LELA 3MOCA 5GWZA 3BEUA 1C1NA 1SG8B 3TITA 3SU0A 1AKSB 1C4U2 3BF6H 1JRSA 3HPTB 3SW2B 3D65E 2CJIA 1C5PA 2FI4E 2O8LA 1XM1A 1VCQA 1MU8B 2TIOA 1K1NA 4Q63A 5FX5A 1PJPA 3SGBE 1HAGE 1NESE 1W14U 3E6PH 4MQAA 4RKJB 1GBFA 3T29A 4NZLA 6LPRA 2WPMS 1HUTH 2IJOB 4AN7A 1AGJA 4CR9A 4TWYA 2G4UA 4BXWA 3GDUA 4M7GA 4NA9H 1INCA 2K1QA 5DKMA 3PB1E 2OD3B 1G2LA 3GCHB 1P9UA 1Y3UA 3RXTA 1AVGH 2ZPRA 3M7UA 1EOJA 3MMGA 4J1YA 1KTTB 2KX4A 3M5MA 2M2AA 2OP9A 2BDIA 3Q77A 5FPTA 3F3BA 3WWFA 1XKAC 3AW0A 3UPEA 4K1EA 4ABEA 2ZGXH 2QYIA 4CRCA 4UFFH 1DM4B 5JDUB 5DJ7A 1TE0A 1P2IA 4FUGA 3PMBB 1XUHA 4DOQA 1IQJA 1ELGA 1O2UA 2EA3A 1O2WA 1AVWA 2FXRA 1FIZA 5KEDA 1YP9A 3SGQE 1HJAB 1FZZA 2Y81A 5EU8A 6CHAC 4ABJA 2TBSA 1GVZA 1ID5H 3RUOA 1UVOA 1DANH 2ZU3A 4CRFA 4BAKB 2OLGA 1N8OC 2BY5X 3HATH 1XXFA 3U8OH 1YWUA 5E8EH 2J92A 3CS0A 2YMSC 2CN0H 4YTAA 2FTMA 5HIYA 1UK3A 4OGYA 2IPQX 5KECA 2W7SA 1LMWB 2KCAA 1NC6A 4AB8A 1VZQH 1ELTA 2PKSB 1C5YB 1FN8A 1PQAA 1HDTH 1FNIA 1ZGIA 2J95A 1MTSA 3F1SB 1C5WB 1Z8RA 4TWWA 4OS7A 1DITH 3I77A 3RLYH 1KXDA 3RXBA 1O3JA 2QF3A 1C2HA 1FUJA 4F48B 1AB9B 1BCUH 1BBRH 1GGDB 4OS5A 3OEHD 2PGBB 1G3EA 3SV7A 4Q2KA 1BBRK 1M9UA 4CH8B 2JH5D 1FQ3A 1VITF 3LT3A 2BD8A 4O3TA 2Z94A 2VIVA 4NA8A 1EOLA 3FANA 1RXPA 3SV9A 5EG4A 2F9NA 3NPSA 5BPEA 5CE1A 1EXFA 1V2NT 3LPRA 3SJ8A 4A1TA 5GCHG 2ZWLH 2ANMH 4D76A 2G5VA 4DCDA 5DK1A 4OM9A 2QY0B 1EAUA 2ZI2H 3ZZDA 2ZTZA 5C17A 5EODA 3A85A 2ZHWH 1FJSA 2QAAA 3R0FA 1HFDA 1YPGH 2SGDE 5C5NA 1HV7A 1NFXA 5F6MA 5EW1H 3O8BA 5DG6A 3SNCA 5FBIA 2VGCC 2NU0E 1BRBE 2AMQA 1CU1A 5CHAB 2K8IA 1LHEH 3D23A 3UREA 1WXRA 4Y7BA 1O2LA 3LGWA 8GCHG 1ANEA 4AB9A 1GBIA 5CHBA 5ABWA 1QA0A 2XTTB 3SNBA 4IC6A 3A82A 2GV7A 3F6UH 2OC0A 2AIPA 3K6ZA 3GY3A 4B2AA 1ZPBA 3KN2A 3QTOH 2W3KA 1C2DA 4BTIB 2HGTH 5C1XA 3S7KB 1HAVB 5EJZA 3F0PA 3UQVA 4YESB 3BTHE 1FN6A 1GBKA 1EAXA 4JZ1A 1P2JA 3MNCA 4B6EA 1GBEA 1DY8A 4I8LA 4LXBH 4JK6A 4NIXA 1FY3A 1VCPA 1RTKA 1Z1JA 3SV6A 3VPKA 3UY9A 5GIBA 2W6ID 3TGKE 1ETTH 1TABE 2AGIX 3C1KA 3SNAA 2KCPA 4YT7H 2W5EA 2BZ6H 2OBOA 2Y5FA 1QB1A 4IGDA 1T31A 3TNSA 1BTXA 3RU4E 1WCZA 1XX9A 4X1QU 5ESTE 1BMMH 2QXJA 1GHBF 1GWAA 1SGFG 1GMCG 3EE7A 2SGEE 4XD7D 1ANBA 3M5LA 2R3YA 1C5ZB 3MU4A 1V2TT 4GHTA 1DS2E 3RXFA 1U6QA 1BMFD 1DE7H 4HG6A 4GVUA 1KSNA 3CENA 4BANB 2BVRH 4O03A 4AZ2B 3T27A 2WPHS 1W2KH 2Z9JA 1Y59T 1KXCA 4X6MA 5TCAA 1J8AA 2WPKS 2OBQA 2V3OH 5FX6A 1V2MT 3U98H 3BTWE 1EJAA 2GD4B 4X2XA 3SHAH 2DUCA 2Y7XA 3ZZ5A 1GBBA 1TB6H 4A1XA 1O2HA 4WXVA 5L2YH 5CDFE 1MZDA 3F68H 2HVYB 4X2VA 1IOEA 2PHBA 1XKBC 1NRSH 2Y5GA 4UD9H 2ZF0H 1GI9B 1CGIE 2PSYA 1PPEE 1P8VC 1YKTA 1HAOH 1LPGB 1BA8B 4FUDA 2Z9GA 3LC3A 5JBTA 2SGAA 3ZZ6A 2VWLA 3IWMA 3VG8A 1V3XA 1ZR0A 3SZNA 2K0QA 2G5NA 1P3EA 2G8TA 5EGMA 1DPOA 4BNRA 4DJZB 1A3EH 2ULLA 3UWIA 1TX7A 4ISHH 2J5UA 3H5CB 2NWNA 4ABBA 1PPZA 2Y82A 3ZZBA 4GUXA 3DA9B 3K6YA 3MO9A 5IDKA 3RXEA 2FM2A 1QL8A 1BTUA 3T62A 2B0FA 2NU3E 4NGAH 4CBOA 3LGUA 3VXFH 1XUGA 1FXYA 3SZEA 4WVPE 2ZTXA 1CA0C 4NWKA 5FCRA 3SU4A 4I86A 1ANCA 1DOJA 2HWLB 4B1TA 1ANDA 1ZTLA 4YLQH 2WV5A 4RT1A 5G4BA 4TPIZ 3GISB 1ZHMA 2CV3A 5FPYA 4CRGA 3BEIB 4P02A 2BY6X 2GZ8A 1O3IA 3SQHE 3RMLH 2P8OB 1TLDA 4P00A 5C3NA 3FKSD 4J2YB 5HM2A 1VJAU 1OSSA 3B8JA 1TFXA 1EAIA 2WPJS 4Y7AA 1SGCA 2VINA 2F83A 1Q3XA 1B0FA 1UW7A 4JCNA 2UUKB 3IG6B 3QGNB 5EQRA 2GMTB 3OU0A 1ACBE 4X8VH 2WYGA 3GCNA 4NIVA 5DGJA 4FU7A 2FDAA 3ZIAD 4Z6AH 2FEQH 4MNYA 1O3CA 3GCTF 3BTQE 2TGTA 5EIYA 1QBNA 3MQKC 1E0FD 8GCHF 1H9HE 5JBBS 2LNCA 3ATLA 1UVPA 5DP6A 1O5EH 3U69H 1GL1A 4Y8XA 2P3UB 3TJUA 3FFGA 2D2DA 3KNXA 4Z1MD 2HNTE 4NFFA 3ZVEA 5JB8S 2SGPE 1O33A 3MU0A 1DLEA 1E36B 2P95A 3KQCA 3SN8A 2WPIS 2XCNA 1O2RA 4MVNA 2XBVA 1E1RD 4AFQA 3ODFA 2J98A 5E0JA 1SGDE 3SU5A 1KLTA 1P09A 3A8CA 5TJXA 2AFQB 1NRQH 3MWIU 1P2MA 1EKBB 3S69A 3T2NA 5DPAA 4F4OC 3DUXH 1C1RA 1JBUH 2RDLA 4XBBA 2F91A 4ZHLU 1BMLA 1GBDA 1YF4A 2RFKC 1O2PA 5EQSA 2Y6TA 3KEEA 1ZHRA 1GHZA 3E3TA 1GI0A 2GCTB 3MO6A 3M3SA 5HYOA 2YMSD 5A8ZA 1PPGE 1QIXB 3QZQA 4Q7XA 5A8XA 2P59A 1O3KA 2PGQB 3SGAE 1UK2A 1GHAG 1C1SA 2A31A 1GMCF
chains in the Genus database with same CATH topology
3T26A 2OQUA 5AHGH 1IQFA 3ATWA 2ZCKP 3NUMA 2XCFA 1ZPCA 2BDYA 3A80A 2ZGCA 4X0WU 1LHDH 2QC2A 2UWLA 1P06A 3A7TA 2VH0A 1EAWA 1HB0B 1SLXB 5L6NH 3C27B 1L0ZA 5HXFA 1E35B 2CHAB 3RDZA 4YLUA 1H4WA 1SFQB 3SJOA 3BN9A 4JK5A 3SJIA 1IQNA 1TRMA 2OC1A 3FP6E 2R3UA 1JIMA 1SQAA 1O3DA 3GY8A 4B71A 3FP7E 1QCPA 3F9FA 1V2OT 1ZSJA 2BD5A 3A8BA 1SGQE 1C9TA 4AORA 3E91A 2F9UA 3Q3XA 1F0SA 1SLWB 2B5TB 2FESH 1A4WH 4BAMB 1QBOA 4RSPA 1S6HA 1TGNA 1ZLRA 1O2VA 1ELFA 1WSSH 1CHOG 1LTOA 3VFEA 3Q3KA 3SNDA 4B2BA 3RMNH 1P2KA 1UCYE 3F9HA 2J4IA 1B5GH 3MH4A 2A5IA 4JZFH 1UVTH 3E8LA 4ASHA 2Q6GA 1KDQB 2UWPA 3VEQB 4D8NA 1QRZA 4OS6A 1O2YA 1AZ8A 3U8TH 2PUXB 1TRYA 1HXFH 1O2GH 1EUFA 2B7DH 3RXJA 5A0BA 4YOJA 5FBEA 7GCHG 2BOKA 1HAPH 3M36A 1W0YH 1S0QA 1PPCE 2FOFA 3ZVBA 1UHBB 3QGJA 1D3DB 1T8OA 1TPOA 3QX5H 3EE0B 3PYHA 1OWIA 4H4FA 2ZU5A 1BTZA 4X8SH 1VCWA 2WYJA 2CF9H 1AVXA 2A45B 1IQEA 1ELEE 1PYTD 3BIVH 1MTUA 1O2ZA 2AGEX 4ISIH 3RXQA 3EAJA 3L33A 3ZVGA 3NK8A 2W7UA 5FAHA 1O2IA 1O37A 7ESTE 1K9OE 1GI4A 1ORFA 2FS9A 1O36A 1ELDE 1MTVA 1ZYOA 4Q80A 1J17T 2FPZA 1LPKB 1YPJH 2VWNA 3QTVH 3RU4T 1W7XH 2FOMB 3TK5A 4DY7B 2ZC9H 4B2CA 1SR5C 2BD4A 4Y0ZE 1MTNB 2ZHQH 1C5TA 4LZ4B 4UDWH 2CGAA 4B76A 3PWBA 1N1LA 3GCOA 1YPKH 3GYLB 1C4Y2 1OS8A 1P05A 1W8BH 4MNWA 4ZKOU 4XDEA 2BDHA 1O3MA 4WMEA 3HGPA 1FAKH 1WBGB 4RN6A 1O2QA 5T6GA 4HI3A 1H8IH 3BTTE 1DX5M 8KME2 3AASA 4A6LA 6GCHG 1C9PA 3SI3H 2P94A 1W7GH 1QL7A 3E0PB 4X1RU 1GI6A 1O5BB 5ETXA 4FU8A 3PV4A 3KQEA 1Z6EA 1IQHA 2GDDA 2A7JA 4X1NU 5C1YA 1OX1A 2XBWA 2FYQA 3TNTA 2Z9KA 2AMDA 3UIRA 1UTJA 2XC5A 3QDZB 2J34A 1AIXH 3RXKA 2ZDNA 1LVMA 1NRRH 4SGAE 1LVOA 2Y80A 1WAYB 6CHAB 1IHSH 2TGAA 1O3HA 1OP2A 1TYNA 1G2MA 4A1VA 1EJNA 2G51A 1RD3B 4K1SA 5DP3A 1N8OB 1LVBA 3UNQA 3M5NA 2ZQ1A 2XC4A 2ZA5A 2ZFRH 2AMPA 4UFEH 4X1SU 1ZJKA 2XWAA 3B23B 1GJ4H 2ESTE 1GBJA 3Q00A 1P01A 1GJ9B 2ZPQA 5JBAS 1SL3A 1O30A 2FS8A 1P10A 2Q6FA 3RM2H 3N7OA 1X7AC 1O3EA 4KTUA 4ZXYH 1CT2E 3PLBA 3M3TA 2BMGB 1HAHH 1XUKA 9LPRA 3TGJE 1SGYE 1XUJA 4INKA 2HLCA 1S5SA 1EPTA 4TY7A 5C5OA 4X6PA 2H6MA 1KXEA 5JB9S 4RKOB 1P2OA 1RS0A 3LGIA 4IN2A 1F5RA 1SHHB 2Z3CA 1QRXA 1GCDA 1UVSH 3ZVDA 1C5MD 1C2LA 2ALVA 2VU8E 4ISLA 5CMXH 1S83A 1BQYA 2ILNA 2W26A 4E05H 1AE5A 1BZXE 1V2JT 1G9IE 2THFB 4GLYA 3A88A 3U1JB 3RXLA 1DUEA 4GSOA 2R0LA 4F49A 1TAWA 5GDSH 8ESTE 2ZGJA 3ZYEA 2A4RA 2QXGA 1TGSZ 5FXLA 1C1UH 1FY8E 1O3AA 4ZKNU 1O2NA 3MHWU 2B8OH 2ZHDA 2PKAB 2BD7A 1W0ZU 3PLKA 3E0NB 2FLBH 1O3PB 1C2GA 3VB3A 1P3CA 2JKHA 1C1VH 2R2WU 3PO1B 3RXRA 1QNJA 1SOTA 3M35A 1NRNH 2ZU2A 2FI3E 4DIHH 1ZTKA 1QB6A 2TGPZ 1SBWA 5EXMA 1BT7A 1GG6B 1NS3A 1UJ1A 3KIDU 1C2FA 2GKVE 4GCHG 4MG3A 2GT8A 4AG2A 4KP0A 1Y3YA 2OC8A 2WPLS 4E7NA 1GBLA 2ODYB 3V3MA 1P9SA 4Z0KA 1EB2A 3JZ1B 2BY7X 3UR9A 2DE9A 1YLDA 2A7HA 1LQEA 3DFJA 3LDXH 3OYPA 1TA6A 2TRMA 1SGRE 1Y3WA 1PQ5A 1UHBA 4WMFA 1K1PA 1ABJH 1QQ4A 3LU9B 2WINI 5T6FA 2FOGA 4QT8C 3OSYA 5EOKA 3LGYA 3P8FA 1CHGA 3LGVA 3RXUA 2VWOA 1YGCH 1T8LA 3ZVCA 1AFQC 1ELVA 1TGBA 2ZU1A 1PQ8A 5C2ZA 1TPSA 1TWXB 1YCPH 4TY6A 3P95A 1UTNA 1C5SA 1NPMA 1F92A 4D9RA 1ZOMA 1YCPK 3SUEA 1P0SH 2XBXA 2XXLA 2A32A 2YOLA 1BBRE 1DWCH 1EASA 1C2IA 3NXPA 2BY9X 2BDBA 2KAIA 3LIWA 1EZUC 2UUFB 5B6OA 6GCHF 1CT0E 1D3QB 1UTQA 5AFZH 4DURA 1A1RA 2EEKA 3A7VA 1G30B 3GY4A 4ABHA 1AZZA 1H1BA 1C5VA 3SUDA 4ISOA 3ATIA 4FUFA 3RC4A 3ODDA 5DP8A 1FY4A 1O2XA 2FX4A 4HZHA 4DIIH 4Y6DA 2ALPA 1C1OA 2PSXA 2H1UA 3LOXA 2H5DA 2QA9E 2A4GA 1RRKA 4NCYA 1HXEH 5EXNA 4K69A 3ZZCA 1AKSA 3DFLA 1EZQA 1L1JA 4CBNA 3P92A 3BV9B 4A92A 4DGJA 3A87A 1UO6A 3V0XA 2VVVA 1HCGA 3KCGH 2H9TH 4HGCA 1SSXA 1V2UT 2RA0A 4K8YA 1TNJA 3RXOA 3RXDA 2JH0D 1W10U 1ETRH 1MQ6A 2J2UA 2FLRH 1P57B 2M5TA 3UQOA 3FP8E 3SUGA 1EZXC 2V6NA 2ZCLP 4WH8A 4UEHH 3ZVAA 1IQIA 1C5QA 4GHQA 1HAXB 3V12A 4Y79A 1QTFA 4Q7YA 1GDQA 2BX4A 1TPPA 4Y8ZA 5GPIB 4AOQA 4CREA 2A2QH 1TMBH 5A2MH 1PQ7A 1K1JA 3SNEA 2ZEBA 2TPIZ 3O8CA 1HRTH 2BTCE 4DT7B 1UTPA 3QO6A 3SU3A 1WTGH 3SU1A 1MKWH 1YBWA 3RXVA 1JIRA 1CA0B 1TNIA 3BTGE 1MKWK 3RC5A 5JPMH 2ZHFH 4K8BA 1C1TA 1UTOA 1BMAA 3MI4A 1OP0A 2XWBI 2ZDKA 1GI7B 4WWYA 2V3HH 2AERH 1OWEA 4JYVH 5L2ZH 1O2TA 1SQOA 3EBNA 1C2KA 1TPAE 1JMOH 3K9XB 1O5GH 1C5UA 3RXSA 4GAWA 2C3SA 4WY3A 2ZNKH 1CBWB 4KTCA 1F0TA 2F3CE 1NU9A 3S9BA 1AQ7A 5H4IB 3RLWH 4WMDA 1HIAB 1Y3XA 1D9IA 1F0UA 1P2NA 5DO4H 2P16A 1TALA 2BQ7B 1E34B 2FWWA 3NWUA 1LKAA 1CQQA 3CS7A 2D8WA 1K22H 4Q7ZA 3M7TA 4BAOB 4YOIA 3GY2A 1B7XB 4THNH 2BXTH 5A0CA 2CMYA 2GCHG 2NU1E 3HKIB 3LKWA 1L4DA 3GDSA 3KQBA 2VIPA 4O3UA 1K1IA 5GCHF 4FVDA 2FODA 2GDEH 1DVAH 2ANWA 1O5DH 1GI5A 2J38A 1K1MA 5JBCS 4Y10E 1YPEH 2UUYA 2C8YB 1TMTH 1GMHG 4XE4A 3LJJA 4O97A 4R8TB 1RFNA 1TGTA 1T8NA 3PLPA 1V2ST 3B9FH 3PTBA 3SQEE 3OY5U 1ZTJA 3U8RH 1C5RA 1NU7B 5K0HA 1MU6B 1Y8TA 1LCYA 4NIWA 4K3JA 1TA2A 4JZIA 5E0GA 5T3HA 1MZAA 2H9HA 1RTFB 4XBCA 3GDVA 1A5GH 1L2EA 2F9PA 2JETC 5A0AE 1LKBA 5AVDA 3UUZA 4XFQA 2QF0A 3T5FH 3D49H 4SGBE 2BD9A 1IQLA 1AO5A 1Z6JH 3A84A 3MU1A 3QK1A 3PMJA 1FPCH 2BM2A 1DWBH 3BTFE 1V2WT 2C93B 4OS4A 2Z3DA 2R9PA 1DXWA 1LHGH 4FUHA 1UTMA 3SHCH 1BITA 3D62A 1NZQH 2VNTA 2ZCHP 2VWMA 3LH1A 1SGEE 4DW2U 1SPJA 1YYY1 1MTWA 1QBVH 2UUJB 2ZQ2A 3UFAA 3V13A 5F03A 3ZZAA 4YZUA 1OWDA 1TX8A 1C2JA 2AIQA 1SQTA 1CE5A 1HAVA 1Z71A 5A8YA 2ZHEH 4LOYH 1MCVA 4A5TS 1TX6A 1A0JA 1S6FA 3SV8A 3UTUH 2F9BH 1F5LA 1YC0A 1AHTH 1O0DH 2BLVA 3FZDA 1GHVH 3BSQA 2J94A 1V2QT 1FY5A 2D1JA 3KHVA 1FAXA 4FUCA 1O32A 2K7XA 2QXHA 4I8GA 2YNAA 3STJA 2VIOA 3TH2H 1TBQH 4HFPB 1O2JA 1Z8IB 2O8WA 3TH4H 2ZECA 2ZO3H 1BB0B 1HAIH 3LJOA 1FY1A 4IMZA 4UFGH 3BG8A 1GMDG 4I8JA 1TMUH 4DG4A 1DWDH 3GY6A 1C2MA 2BDCA 1MCTA 1OWKA 5F8ZA 4KGAA 5DP5A 5C1UA 2ASUB 1G3BA 4BAQB 1L1NA 4Y76A 4AGJA 1UK4A 2QXIA 3TK6A 2BDAA 2G81E 3RMMH 2WUCA 1VITH 3GY5A 1C5LH 3UOUA 2ZZUH 1O3FA 4FU9A 1GCTC 1TRNA 1DFPA 3K2UA 3SJKA 4E7RG 1NY22 2H2ZA 1P2QA 3HK6B 3VGCC 3BG4C 1IHTH 5I46H 4LZ1H 2VJ1A 3F9GA 4ABGA 1A5HA 2QN5T 3ITIA 1LVYA 1Z1IA 3VB5A 1EATA 1BJVA 2C8XB 3T28A 1G36A 1ZZZA 2Z6BD 3A7ZA 1QHRB 3DT0H 3PMHB 3W94A 1ZMJA 2A2XH 3ZZ8A 4BTTB 3TGIE 3EYDA 2SGFE 1ZSKA 1GHWH 1HYLA 4Y8YA 2GGVB 2PR3A 3SOSA 3PM3A 3NZIA 4IC5A 1GI8B 1QJ6B 1KIGH 1B0EA 2PW8H 3NCLA 5DP4A 3O8DA 1EPTC 2IPHA 1GJDB 2FP7B 2VIQA 1Z8JB 4U01A 5SGAE 1DSUA 1NFUA 1O2KA 1CVWH 1RIWC 2G4TA 3PROA 1BOQA 4X6NA 3I29A 4AFZA 1AE8H 2PTNA 1GBAA 1H9LB 1THSH 1ARCA 3SORA 2BLQA 2ANKH 3SU2A 3UR6A 2GP9B 5L30H 1T4VH 4JMYA 2ZTYA 3TIUA 5E0HA 2ZIQH 3ESTA 3URCA 5J4SA 1YCPM 2A4QA 3MFJA 4CHAC 1AUTC 2G55A 2ZDMA 1H8DH 1K1LA 2A4OA 2EI7A 3F9EA 3DD2H 1ABIH 3MYWA 3A86A 5LPRA 3MNXA 3ZZ7A 3IITA 1QRWA 1VITG 1J15A 3CP7A 4NSYA 2FOBA 2GZ9A 1YLCA 3S9AA 4IBLH 2AEIH 1QA7A 4ZMAH 1EJMA 2C8WB 5EW2H 1EB1H 2SFAA 2A0QB 3RXIA 3QUMP 1O5FH 1V2KT 1JWTA 1QQUA 2NU2E 1Z8GA 2JH6D 1T7CA 4CRDA 1AY6H 1EQ9A 1ESBA 4KELA 1A0LA 1OWJA 3MH7A 1PPHE 4CH2B 1O2SA 1KXFA 3EGKH 1GBCA 1FONA 2STBE 4FUJA 1BJUA 3TH3H 2H5CA 5E2OA 2Y7ZA 2LPRA 1GDUA 3WY8A 4IMQA 1XUIA 1O39A 1SI5H 1Y5BT 1THRH 2HNTF 2O8MA 2R2MB 2FTLE 3MU8A 3MTYA 4I33A 4UE7H 1BTPA 1GBTA 1VGCC 1OXGA 3FZZA 3A81A 2V35A 1GI2A 1MAXA 7KMEH 2IOTA 1D3PB 2BDGA 5C20A 1P04A 2BD3A 1MBQA 9ESTA 2Z3EA 4MNXA 4U2WA 4WJG2 1Y3VA 1GHAF 1SC8U 1YPLH 1RTLA 1GJ5H 2Q6DA 1GBHA 1QR3E 2FX6A 4VGCC 4WF8A 1GL0E 1MTNC 1D6WA 3MO3A 1SGTA 2XC0A 4X1PU 2OQ5A 3HK3B 5IYTA 1BRAA 1OYTH 1D4PB 1Y5UT 3U9AH 3UWJH 1GMDF 2PWXA 1BHXB 4K1TA 1BTWA 2GX4A 1YM0A 3LC5A 3LGTA 4KKDA 4X2YA 4H6SB 1FIWA 5GJ4B 1OOKB 4R0IA 4GPGA 4ZROA 2RA3A 1GHBG 2ZDLA 3OX7U 4BOHA 1L1GA 1UVUH 1KXBA 4X2WA 4FVBA 2ZGHA 2DE8A 4Y71A 1SMFE 3BTEE 1SFIA 1HJ9A 5J4QA 4CR5A 1CHOF 3EA8A 4MLFB 2ZFQH 3MNBA 4I7YH 1P03A 4ZHAA 1AN1E 3A7XA 5DP7A 1FDPA 4AFSA 1PFXC 4I32A 5TCCA 4BTUB 1AUJA 4U32A 4X8UH 4AX9H 1HNEE 1HPGA 1IQMA 5LPFA 1ZRKA 4JYTA 2IN2A 5E2PA 2OTVA 2CF8H 1C5XB 3EDXB 3Q3YA 2FOEA 2G00A 3GOVB 3VXEH 4D7GA 2PFEA 3R3GB 3GCHC 2O9QA 4ZKSU 7GCHF 2ZFTA 1AFQB 2VGCB 4O9VA 2ODPA 1G37A 2OUAA 1CO7E 1GJ7B 1WYKA 1ZMNA 3A7YA 5A09A 5GXPA 1KDQA 2SNVA 2FMJA 2PV9B 1SGFA 1LDTT 3GY7A 1JOUB 2A7CA 3ENSB 3EA9A 1SGPE 3AAUA 7LPR