2BX4A

Crystal structure of sars coronavirus main proteinase (p21212)
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
298
structure length
298
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-LIKE PROTEINASE
publication title Ph-Dependent Conformational Flexibility of the Sars-Cov Main Proteinase (M(Pro)) Dimer: Molecular Dynamics Simulations and Multiple X-Ray Structure Analyses.
pubmed doi rcsb
source organism Sars coronavirus sin2774
molecule tags Hydrolase
total genus 72
structure length 298
sequence length 298
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2bx4A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2bx4A02
1GI7B 1QB9A 5I46H 1T4VH 1ANCA 3ZYEA 1O30A 1BOQA 1S82A 1Y8TA 2ZEBA 1SQAA 4MNYA 2THFB 3ATMA 1O33A 3LJOA 1RD3B 1MH0A 3SN8A 1RTLA 1FQ3A 2W5EA 2ZGCA 2LPRA 3SNDA 1BBRE 1C2DA 3A88A 4B75A 4FUGA 1WTHD 1QHRB 1QGFA 1O2RA 1KXEA 1SFIA 2VIWA 4B76A 1ZYOA 4CH8B 1MTSA 1GCDA 3TVJB 3S69A 1FV9A 2F9PA 2ZFQH 1THPB 3DUXH 1W11U 2WPMS 2V35A 1AO5A 1MTNB 3SJOA 1ANBA 3RXOA 3MWIU 4K1TA 1SGRE 1BZXE 2PLXA 5FCKA 1NY22 1QBVH 1TMUH 2B0FA 1TGTA 1O3BA 2GGVB 3EA9A 3HK6B 1YPEH 2FWWA 4AZ2B 4YT7H 3RMMH 3RXAA 1AVXA 1CA0C 4NIYA 1UTPA 4OS7A 1MKWH 1O2KA 1UVUH 4WMDA 3LONA 1V2MT 1G37A 2UUYA 2GZ9A 1TGCA 1E36B 2CGAA 3MNBA 4JZIA 1DWEH 1O3GA 1WQVH 2O9QA 1Z1IA 1GI2A 2BQWB 2H2ZA 2O8WA 1T32A 2P93A 1DX5M 4NSVA 1O2VA 5PTPA 1SGFG 1SBWA 3RU4D 4BTIB 2BD9A 5C5NA 4AG1A 2FTMA 4X2WA 2ZHDA 3BTFE 4NFEA 3L3TA 1V6DA 1MTVA 3U1JB 8ESTE 1LVOA 3BTQE 1CSOE 3Q3XA 4HGCA 1GMCG 2D8WA 2EEKA 1GBCA 2C93B 4WH6A 1O0DH 3GYMA 3A7VA 1UTOA 2FIRH 1TX8A 3OYPA 4ISHH 2HRVA 1SVPA 1V3XA 1KIGH 1QQUA 2GMTB 2SNVA 4FVDA 2UWLA 5E0HA 2W3IA 3P8GA 2BQ6B 2VU8E 1NN6A 3S7KB 2TBSA 1C9PA 1B0EA 2ANKH 1V2NT 3MHWU 1GJ6A 1N6YA 1ELEE 2Y5GA 2XC5A 1TNKA 3CS0A 2P94A 3SGBE 5EXMA 4I8LA 1GMDF 2RG3A 3QLPH 4DY7B 2A5KA 1SLVB 1MQ5A 5A0CA 3A7TA 4YO9A 2SGQE 2Y5FA 1GI1A 5F8ZA 3P70B 3TNSA 2I6SA 1IQJA 2A1DB 3E90B 4X0WU 1LVYA 4FUBA 2CHAB 4E05H 1UTNA 1SOTA 3M7TA 2PFEA 1SGCA 1LQEA 1ELFA 1ELAA 4LZ1H 1C5QA 2IOTA 2GMTC 2FDAA 4FVBA 3TH3H 2HALA 2RA0A 4GAWA 3RDZA 1C5YB 5C5OA 3LGVA 4Q7YA 2BDHA 3KQDA 4FUIA 1HAVA 4BAHB 1NT1A 1P2QA 1H9HE 1E34B 2GKVE 1IAUA 1A4WH 1GL1A 1C1SA 1Y5UT 5FX6A 2PKSC 2VVCA 4MNVA 1YF4A 5TCAA 3QTOH 1EP6A 1YGCH 2XNIA 4GSOA 5DP9A 1WAYB 1BQYA 1L0ZA 3UY9A 3H5CB 1K1OA 3LGWA 4X2YA 2J4IA 2GV7A 2ZPSA 3LH1A 1K1NA 4KTSA 3VB3A 1YPLH 3Q3KA 2BTCE 1OP0A 1G3DA 1GJ8B 1W10U 3RXDA 4SGBE 2ALPA 3RXPA 4CR5A 1W13U 5EU8A 2J92A 2XBWA 1EX3A 1C1MA 5AHGH 1PPCE 1HNEE 3UPEA 3NKKA 5T6GA 2A0QB 1QIXB 5L30H 2JH0D 1GBTA 1TGSZ 1LO6A 1VCWA 2ZDMA 1YM0A 1P02A 2WPIS 4FUCA 3GY8A 1MU6B 2ASUB 3RP2A 1V2KT 1TMBH 3HGNA 5EQSA 1AB9C 1O3PB 3T62A 4Y8ZA 4AYYB 3O8CA 3E8LA 2D1JA 3SU1A 5T6FA 4A7IB 5JBAS 2QC2A 1T8OA 3RLWH 5FPTA 2HPQH 1PPHE 2AIPA 1BT7A 2BD8A 2ZG0H 4K5ZA 3V12A 1PJPA 4CRBA 3BTWE 3IITA 1A0LA 1TBQH 3FP6E 4AFQA 4CBNA 1GJ5H 3L33A 1BTUA 2H1UA 2ZU3A 1TRYA 4GLYA 1KXFA 1IQKA 5AFZH 1AWHB 1DFPA 5JB9S 3M5MA 4MPUA 1UK2A 1U6QA 3OY5U 1G3BA 1QL9A 4NA9H 2FZZA 2BOKA 3SV2H 4K69A 4MG3A 4ABAA 1DS2E 1GHZA 1ZLRA 3PO1C 1ZMNA 4K1EA 5EPYA 5T6DA 3SU2A 5L2ZH 3FZDA 2PUXB 4GHTA 1KLIH 1DDJA 1SGQE 1AY6H 1FXYA 1UTJA 4XBCA 4IS5A 1HJAB 1GBIA 2HNTC 2KAIA 1JMOH 4JZEH 4ZH8A 1D6WA 1HJ8A 1UJ1A 4OGXA 3ZZ9A 1GVLA 1D3QB 1ZGVA 1ESAA 3T25A 2VWNA 3DFLA 1EB1H 2FESH 2Y81A 4TWWA 4B1TA 1IOEA 1SGTA 2A2QH 2UWPA 4HFPB 5FPSA 2TIOA 4BAMB 4UDWH 4ABEA 3D62A 4I33A 2DE9A 1Z71A 3RXGA 2G00A 2TGAA 1P2OA 4JK6A 1O5EH 5BRRE 2V6NA 3MU5A 1ETRH 1JXPA 2BDGA 1ESTA 5K7RA 5F8TA 4CRAA 1P9SA 1C2JA 3DT0H 4BNRA 2FOHA 2ZQ1A 1C1NA 4E06H 1BHXF 4H6SB 2F91A 1HV7A 3LKWA 1S6FA 1NU9A 3K6YA 3RMNH 1XUKA 3QDZB 1IHTH 1P57B 5JBTA 5TCCA 3QZQA 1OYTH 1GBKA 4WY3A 1CGHA 1MZDA 1ZMLA 3B9FH 3F68H 1EOJA 1J17T 1MBQA 4JZ1A 1FY5A 4YLUA 3SGAE 4X6OA 5LGOA 2BDCA 1RIWC 3P92A 3SJ8A 3H7TA 1UTKA 4MQAA 1DLEA 1VITH 2A32A 3LDXH 1SR5C 3NUMA 1HPGA 3TJNA 3KNXA 4NA7A 4VGCC 4A5TS 1A3BH 3ZVAA 2SFAA 3TU7H 2BX4A 2AEIH 3MU0A 3LGTA 6LPRA 4X6PA 1A5IA 1V2PT 2VGCB 3SZNA 1EASA 1SI5H 3A84A 5GCHF 1PPGE 1G9IE 1MCTA 4U30A 3MYWA 1ELCA 3W95A 3EYDA 1L1GA 2UUFB 3P95A 4XBBA 1SHYA 2P8OB 3TH4H 1GJBB 3D49H 1CVWH 1GJDB 4I32A 3SV9A 3NCLA 1XKBC 4TY7A 2BY6X 1TA2A 1WYKA 1XMNB 3SNEA 5JDUB 2SGPE 2TGTA 3QGNB 1DSTA 1H8DH 2YNBA 4X8VH 1ESBA 2H5DA 1CO7E 1GVKB 2NWNA 2ZFRH 3ZVEA 5DP5A 1H1BA 5ESBA 1DT2A 2XXLA 2OC7A 4JCNA 1CBWB 1BA8B 2RDLA 4JZDH 2O8UA 3BTME 2VIDA 5K0HA 1P12E 1HAYB 1L1JA 2H9TH 1FY3A 1ARCA 1C5LH 4LOYH 1DSUA 1FJSA 3GY6A 1GHVH 1UVOA 4OS4A 5DG6A 3BN9A 3T29A 3S9CA 1OOKB 4UD9H 3M36A 1NU7B 4Y8YA 1IQEA 3A85A 2FO9A 1E35B 4D7FA 1G30B 2VGCC 3F9GA 3BF6H 1GCTB 3QZRA 3UQVA 2XCFA 4FUJA 1B7XB 2P3TB 3V13A 4ESTE 3DD2H 1AFQB 4RN6A 2P8OC 1Y5BT 1AVGH 1C9TA 1C5OH 1SFQB 4NWLA 1HDTH 3KQBA 2XYAA 3BSQA 1S81A 3VB4A 1JBUH 3I77A 4B71A 3Q76A 4DJZB 1KSNA 1IQLA 1P10A 2CJIA 5F6MA 2O8TA 4I7YH 2C90B 2PTCE 4GVUA 2EA3A 2CF8H 1NFWA 1ORFA 3LJJA 1P09A 4IN1A 2HLCA 1CBWC 4DCDA 4AFUA 1VCPA 1TQ7B 2BD4A 2OC1A 2RCEA 2BYAX 1O3DA 3IG6B 1EXFA 1JRSA 1XVOA 3TITA 1GBDA 2PKAB 1KLJH 2QIQA 2ZU5A 1J16A 3ZV8A 2BDIA 3H7OA 4YZUA 1MAXA 1TX6A 1V2RT 4ZHAA 1IQMA 3KEEA 2AMDA 1BDAA 4NZQA 2UWOA 2ZGXH 4TPIZ 4RKJB 2G55A 3C1KA 1DXWA 4WWYA 3GDSA 2OD3B 1VZQH 5A8XA 3T27A 3ZZ4A 5EQRA 5DK1A 4BAOB 1GBLA 3NK8A 3TIUA 2WV4A 1W0YH 2P95A 5EPNA 1DITH 1P03A 3RXFA 5FXLA 2VH0A 1Z6EA 5EOKA 5G4BA 2PHBA 4BTTB 1BTPA 2GD4B 4ZROA 3VGCB 4UFEH 3ZVCA 4UFFH 3BIUH 1BJVA 2C3SA 2A7HA 3MU1A 4X1SU 2R9PA 2VIVA 1QRWA 1W0ZU 3TJVA 3E1XB 1O2IA 4ABDA 4BANB 1JIRA 4K8BA 1SGNE 2QXHA 2R2MB 3RXIA 2SGFE 1MMJN 1ZSKA 3RC6A 2B8OH 5B6OA 2VIPA 1V2TT 1W2KH 3KL6A 1O3KA 3B23B 3D65E 5LPRA 5HM2A 4FUDA 4GPGA 3F9FA 1EOLA 2SNWA 1QJ1B 1P2KA 1K28D 1YPHE 1NESE 5C2ZA 2HOBA 3KHVA 2HGTH 4X2VA 1LPGB 2GZ8A 4ABIA 1LVMA 3E16B 3UWJH 3MH6A 1OP2A 2V3OH 5EXLA 2W26A 3BEIB 1P0SH 2ZI2H 1J14A 1HRTH 3S9BA 2V0BA 1Y3UA 1AI8H 3EGKH 2HVXA 2G4TA 1TPPA 3BEFB 1JWTA 2A45B 1P8VC 1FIZA 1GHYH 1OS8A 1EPTB 2C8WB 1GJ4H 1O2JA 4O3UA 1C5PA 4FUHA 2ZTXA 3SO3A 3K2UA 1GJCB 5FCRA 2TRMA 4I8KA 3SW2B 3GYLB 1YLDA 1VJ9U 4INKA 1QJ7B 3URCA 3FANA 2ANYA 3EBNA 4AX9H 1GBHA 1O3NA 3DA9B 3RXCA 4YOJA 1TMTH 3VFEA 1VITG 3CS7A 5FBEA 4CHAB 1NM6A 2ODQA 1EATA 5ABWA 1ABJH 3F9EA 1K9OE 2OP9A 1RXPA 4A1XA 5C1XA 2VVUA 5LH8A 4WMFA 2P16A 1KDQB 3QX5H 3T28A 2FOMB 2TPIZ 2PR3A 1AE5A 1O5CB 1TB6H 2ANMH 5DGJA 1ELVA 3A8CA 3SU0A 4UEHH 1IHSH 2GP9B 2XBXA 5C20A 2ZPQA 4D7GA 1KLTA 3UWIA 1NFUA 1W3CA 2WINI 1QJ6B 2BOHB 1MD8A 1AN1E 3VEQB 2ZNKH 6ESTA 3Q00A 1F7ZA 1K2I1 4SGAE 1MCVA 1Z6JH 4FU9A 2PGBB 3BTDE 3A7ZA 1YKTA 3GY7A 4GHQA 1MTNC 1IQNA 2BY7X 1SL3A 1TIOA 2A7JA 3A80A 1V2QT 3BTGE 3SORA 2H9HA 4D8NA 2ESTE 1O38A 1GI6A 2ZO3H 3BTEE 5L2YH 1AFEH 3KQEA 3SHCH 5BPEA 4YM9A 1T8MA 2GCHF 4ISOA 1VJAU 3ZZ8A 1YCPK 1S6HA 5JBBS 5DP7A 2UUJB 1C5VA 4WMEA 1G2MA 4I8HA 4WJG2 2FXRA 2XC0A 1GGDB 2W7SA 5C3NA 1EAIA 3SOSA 1FDPA 1BMLA 3HPTB 4TYDA 1HBTH 1G36A 2JKHA 2FMJA 1MTUA 1TQ0B 1O3MA 1INCA 1YP9A 1CT0E 1GDQA 3ATWA 3MMGA 1TNJA 3ZV9A 5A09A 5SGAE 8KME2 3SV7A 2XBVA 3QWCH 1ZPCA 5JBCS 2DUCA 3TGJE 2WPHS 5J4SA 1FNIA 2TGPZ 1UCYK 3GY4A 1P3CA 1HCGA 1HXFH 1MKXK 2CV3A 7KMEH 3MOCA 1O5AB 4NZLA 3ODDA 3M61U 2H5CA 4HI3A 1H9IE 1NFXA 2LNCA 3SI4H 1Z8GA 2ZFTA 1TAWA 1QA7A 1XUFA 1OWIA 3MNSA 2J9NA 1LQDB 1SGIB 4JYVH 3ZZBA 1S5SA 4TPYA 1ARBA 2F3CE 1A1RA 1KTSB 4B2AA 2BZAA 1AU8A 3GCTF 2W7UA 4WXVA 4MTBA 3SJKA 7GCHF 4MPVA 1FLEE 3A87A 3MU4A 1TBZH 2FM2A 1GJAB 4INHA 1MTWA 1A46H 1DVAH 2Z3DA 4F49A 3Q77A 1O2LA 3T26A 2ZCHP 2FI5E 3RXKA 4TWYA 2OCVB 3SV8A 1EAWA 3AW0A 1BJUA 3BG4B 3AW1A 1WU1A 3PLPA 1O2YA 1GBJA 1A0JA 1C2MA 1HAIH 3TK9A 1NRRH 2VWMA 2ZTYA 2WUBA 2BY8X 2CHAC 2BMGB 1GI8B 1FY4A 1O32A 4IN2A 3QTVH 4F4OC 1GG6B 1C5NH 2F9BH 1G3EA 2BY5X 1OSSA 4X6NA 1WQSA 2BY9X 1EAXA 2V3HH 2WPKS 4AGKA 1LHCH 1P2MA 1G2LA 1BBRK 3TK5A 3C27B 2R3UA 1GBFA 1UTLM 4I31A 4ISIH 4AFSA 1NRQH 2Q6DA 2JH5D 1F5LA 1C2LA 3OY6U 1OYQA 4JK5A 3SV6A 4H4FA 2Z6BD 1FONA 2J95A 3MTYA 1TRNA 3HK3B 4K2YA 1CQQA 1NTPA 3GY3A 3UREA 1Y5AT 1FAKH 3K6ZA 1C5TA 3LH3A 4NG9H 1EAUA 3STIA 5DPAA 1BRBE 4MNWA 1GMHG 1D9IA 3F6UH 2D2DA 3PMAB 3UOPA 4KTCA 1BB0B 1BITA 4H42U 3RMLH 1OWDA 2VH6A 4Q80A 1C1TA 1C4V2 2QXGA 2ZF0H 1C4Y2 2WYJA 2GCHG 1W8BH 5AFYH 1T4UH 2FTLE 1O3CA 2GCTB 1IQIA 4DT7B 2IJOB 3ZVBA 1SHHB 2AYWA 1VGCB 2BDAA 3M7UA 4WH8A 1EZQA 4CRDA 5E0JA 2O8MA 4HZHA 1O34A 1W7GH 1LKBA 1WV7H 3P17H 1DE7H 1UTQA 5E2PA 2NU0E 2F9NA 4FXGH 1K1LA 1UVSH 4DOQA 3TLOA 3SNBA 1WTGH 4K3JA 4X8UH 3ITIA 2ZHQH 1P2JA 5GIBA 1TOMH 3TPIZ 3AAVA 4XOJA 4WF8A 1F2SE 1Z7KA 1L4ZA 4BAKB 1O3FA 2ANWA 9LPRA 3VB7A 3U9AH 2Y5HA 2HNTE 1BRCE 4DVAU 3VPKA 4GCHG 3KGPA 5CHAB 5JYIA 2AS9A 1ZHPA 1T7CA 2QF3A 2ZU4A 3UR6A 3TJOA 1ELDE 2ZU2A 2STBE 2H9EH 3ZZ3A 1BHXB 1KTTB 1UVTH 4JYTA 1ETTH 3GCTG 3EQ0H 3PM3A 3Q3YA 7GCHG 5IDKA 2PW8H 1B0FA 3LOXA 5A8YA 1CT2E 4Y11E 1DPOA 1FY1A 5T3HA 1AZZA 4MNXA 5DP6A 3KIDU 1C5SA 1KY9A 3M3TA 3N7OA 3V3MA 1OWHA 1TGBA 4Y7AA 2IPHA 4X2XA 4UONA 1NS3A 2G4UA 1HJAC 3RM2H 1YCPH 2QYIA 4LZ4B 3HGPA 1GHBF 1QRXA 4ISLA 3RU4E 2FS8A 1L2EA 1V2WT 1RTFB 5DP4A 3TH2H 2QCYA 4ZKOU 4KGAA 3CENA 2GDEH 2G52A 1KDQA 4ZMAH 3UR9A 1BTHH 1AHTH 1ZSLA 2G51A 3O8RA 1H4WA 2JETB 2W3KA 4IGDA 1TNIA 1YPGH 2YOLA 2B7DH 3RXBA 3ZZ7A 2BD2A 2I6QA 4Q2KA 4D76A 5A8ZA 1TNLA 1IQFA 2XTTB 1BTXA 4MLFB 3NWUA 1ACBE 1UCYH 1C2IA 2AFQB 1MKXH 1PQ5A 1IQHA 2ZDVH 2ZPRA 3QK1A 2ZTZA 4XE4A 3U8TH 4FUFA 2VB0A 3EAJA 1BCUH 1C2KA 2GDDA 1V2JT 3PLKA 1EZUC 2WPJS 4AOQA 3AASA 1FN6A 2FOBA 3K65B 3ENSB 3RUOA 2FS9A 3GCOA 1XXFA 1D3DB 3M3VA 5C1UA 1MKWK 5EGMA 1C1UH 1AKSB 3GCHB 1C5ZB 2ZECA 4OS6A 3TK6A 1ZTJA 2ZGHA 5HMAA 3RXMA 1QNJA 2XBYA 1AE8H 1HGTH 1QR3E 2BLOA 8GCHF 4YLQH 2SGAA 1ZJKA 2VINA 2QXJA 2FOAA 1CU1A 1ID5H 4A6LA 2IN2A 3ATLA 2JETC 3P8NA 2QF0A 1T31A 1B5GH 2R0KA 2C8YB 1RS0A 4U32A 4X1QU 1XM1A 3BTHE 3ELAH 2Y82A 1THRH 1PYTD 1PPFE 4MPWA 2QGRA 2GTBA 2JH6D 3TGKE 1O5DH 4LK4A 1AZ8A 1YC0A 1W14U 2VWLA 2AGGX 2Q1JA 5A2MH 4MDSA 1O2WA 5C1YA 5TJXA 1NRSH 5IYTA 4LXBH 1O37A 3O8BA 1BBRH 4M7GA 9ESTA 1O3HA 5F03A 1HYLA 1TRMA 1DUAA 1N8OB 3U8OH 1O36A 4ISNA 2WPLS 1EJNA 1TWXB 3SGQE 1HB0B 3UIRA 1GL0E 3NXPA 2FLBH 1VITF 1GBMA 1UVPA 4CRCA 6CHAB 1FY8E 4ASHA 1QBOA 3B8JA 2WUCA 2B5TB 2FI4E 2Y7XA 4YOIA 1MUEB 1JIMA 1YYY1 4X6MA 3SUFA 1C1WH 1MQ6A 4Y76A 1C5RA 1O3IA 4NGAH 3K9XB 4DIIH 1ELTA 2F83A 2ZU1A 3A82A 1GWAA 3PMBB 2ZHEH 3L6PA 1EZSC 3QO6A 1GCTC 2GZ7A 1EQ9A 1P04A 3ODFA 1GHBG 4NIXA 1AQ7A 1AFQC 1EUFA 3RXVA 1P01A 1FPHH 2B9LA 1DLKB 5JB8S 1AVWA 3SU3A 1DOJA 4O3TA 5FAHA 2A4OA 2Z9KA 1NROH 1GI9B 1DUEA 2A4RA 5J4QA 1LMWB 1FMGA 4FU8A 1Y3VA 1SPJA 4ABJA 2XC4A 4B2CA 1Q3XA 5C67A 4O97A 4Y79A 4X1PU 1RGQA 4KELA 1L4DA 1ZJDA 2QY0B 1GBAA 3A89A 6CHAC 5HM9A 3MI4A 2P3FH 5LPFA 3GY2A 2ZIQH 1O31A 2PSYA 3BV9B 1FIWA 1ABIH 1OKXA 3M35A 1S0QA 3FVFB 1SGEE 1C1OA 5DJ7A 3JZ1B 1OWEA 1AWFH 1C1RA 1PPBH 3HKJB 2BXTH 2AIQA 2G5VA 3MH5A 2PTNA 3MH4A 5GJ4B 4CREA 4BTUB 4RKOB 1LDTT 3VXFH 2D26C 3BG8A 2Y80A 1S84A 3G01A 4CBOA 4YOGA 8GCHG 1K1MA 1KXAA 3RM0H 4PROA 4AGJA 1K21H 4IBLH 5FPYA 1UK3A 1ZTKA 4ABGA 1QY6A 2Z94A 1G32B 3KF2A 1ZRBA 2R3YA 3QN7A 1BMMH 2FOCA 1OWJA 3LGYA 3EA8A 2VIOA 4MVNA 1DM4B 3SJIA 1QBNA 1S83A 2Z7FE 3VGCC 4BXSA 3GOVB 5AF9H 1PQ8A 1Z8JB 2ULLA 1JRTA 2A4QA 1A7SA 4X8TH 4I8GA 3U98H 2A7CA 3SUGA 4AG2A 3M3SA 1WCZA 4DURA 3E0PB 2Y7ZA 2PWXA 4ZKNU 1SGYE 1LVBA 2OC8A 2FI3E 2GT8A 3MO6A 2ZDNA 5I25A 2A5AA 1RFNA 1ANEA 1HAHH 2WYGA 1Q2WA 3F9HA 4ZUHA 5GWZA 1ZPZA 5FHTA 2FOGA 2VVVA 1SSXA 3UFAA 5GXPA 3RU4T 1XUIA 3LU9B 4R0IA 3MO3A 1HIAB 1O2XA 3PROA 2OBQA 4Y71A 3SQHE 1O2PA 2CXVA 1K1IA 1V2UT 3GICB 1W7XH 1O3JA 1TONA 2AGIX 1C2GA 2ZHWH 1C2EA 1QFKH 3BEUA 1D6RA 5HXFA 1KYNA 1CGIE 4B73A 1FI8A 2M5TA 4Q7XA 4CR9A 1Y3YA 5EODA 1UO6A 2ZDAH 3ZVGA 3KN2A 1O2GH 2DE8A 1UTMA 1EPTC 1ZHRA 2ZGJA 4AB8A 4CRGA 2TGDA 1CHGA 1V2OT 4KP0A 1BRAA 3UNRA 1L1NA 3UOUA 1P2IA 1GMHF 1SGPE 2BD7A 1AGJA 1SB1H 2FX4A 1TNGA 2ZFPH 3A83A 3E6PH 4YESB 1MBMA 1EP5A 2PGQB 1TNHA 1F5KU 2GV6A 4CHAC 1ZGIA 3F1SB 1GDUA 2AGEX 3E91A 4ZKSU 1LHEH 1A5HA 2J94A 3HKIB 4O03A 4ZXXH 1F0TA 4ZHLU 4KTUA 4UE7H 3M5OA 1QL8A 3MFJA 2BZ6H 1CGJE 5F8XA 1O5BB 1ZR0A 4Y10E 1K1JA 4K1SA 3HATH 3M5NA 4R8TB 1E37B 1GDNA 3PTNA 3P8OA 4NWKA 1N6XA 1UHBB 1PYTC 3A8AA 2PKSB 2Z9GA 1KXDA 1UK4A 3CP7A 1WSSH 2ZZUH 1AKSA 1D3PB 1GHXH 4DW2U 3R3GB 2ZP0H 1J9CH 2STAE 2P59A 2XWAA 8LPRA 1PQAA 2ODPA 2BD5A 3A7WA 1Z8IB 1O3AA 5DO4H 1LHDH 2Y6TA 1E38B 1TFXA 2BHGA 2F9UA 2AMQA 5EW1H 3R0FA 4CRFA 1GHWH 2C8ZB 3RXEA 1OWKA 4UFGH 4GCHF 1C2FA 1VR1H 3MU8A 1P2NA 2QN5T 4Y0ZE 3ZZ5A 5FBIA 1LTOA 1O3OA 2AMPA 4D9QA 4THNH 2FYQA 1KXBA 1TOCB 4Y7BA 1TABE 2K1QA 1OPHB 1GGDC 4AFZA 3LT3A 1X7AC 1F0UA 1C1VH 1LCYA 4Y6DA 1GI3A 1AB9B 4XSKU 1FZZA 1TBRH 1AD8H 1SLXB 4ZXYH 2GX4A 5AVDA 1HJ9A 2ILNA 1ELGA 1K1PA 2ZFSA 4B2BA 1PFXC 4IMQA 3BTKE 1J8AA 2EI6A 1BRUP 1C1QA 1F5RA 1BUIA 5E0GA 2QXIA 3MO9A 2ZQ2A 3RXQA 1SQTA 2OINA 3SI3H 2VNTA 1GI0A 4MPXA 3EDXB 2NU2E 1SGFA 3SNAA 1NRNH 1TYNA 3NZIA 4DIHH 1GI5A 2ZC9H 2XWBI 4CH2B 3OU0A 5GDSH 4D9RA 2SGDE 2PKAA 2OC0A 1O39A 1CA8B 1XVMA 1O2HA 3BIVH 3GISB 1H8IH 3UNQA 1MU8B 2BXUH 2VIQA 1A3EH 4XDEA 4I8JA 4YTAA 2RA3A 3SU4A 3KQCA 2CF9H 2ZKSA 2LIZA 3PO1B 5EQQA 5H4IB 3RLYH 4OS5A 2UUKB 1HAZB 3I29A 1DY8A 3PV4A 2VJ1A 1NZQH 1F0RA 1EZXC 2ZCKP 3RC4A 3UTUH 1IQGA 4Z6AH 1ZHMA 1T8LA 2OUAA 2H6MA 3TNTA 1O5GH 3BG4C 1P3EA 1UMAH 1EJMA 1RRKA 2WV5A 1MAYA 3PB1E 3A81A 3RC5A 3ZZCA 1LHGH 1YPKH 3TJUA 4NCYA 2Z9LA 2BLVA 1DWCH 2F9OA 4BXWA 4NIWA 1DWBH 3OTJE 2BDBA 2HNTF 3WY8A 2ZGBH 4UFDH 1YPMH 1TALA 1HUTH 4YT6H 1LKAA 1GG6C 6GCHF 1YBWA 3KCGH 1CT4E 4NA8A 3S0NA 1S0RA 2BLWA 4KKDA 2BD3A 4IMZA 4ABBA 2EI8A 4BAQB 5A0AE 1ZPBA 1GMDG 3I78A 4Q7ZA 1SMFE 3RXLA 2ZA5A 4JMYA 1ZTLA 1C5XB 3E3TA 1ZSJA 3A8BA 3TGIE 1OP8A 1C2HA 1O2QA 4FUEA 1GJ9B 4H6TA 2NU4E 1YCPM 1EKBB 3AVZA 3A86A 4J2YB 2BM2A 3S9AA 1TX7A 1D3TB 4JZFH 1RIWB 2FOFA 2GCTC 3VXEH 3JZ2B 2PSXA 4NIVA 1Y3XA 1EPTA 1PQ7A 1Q31A 1FUJA 1SLUB 4VGCB 4U2WA 4B74A 7LPRA 1VGCC 3SNCA 1FPCH 3U69H 3ZZDA 3RXRA 3LGIA 1NC6A 4IW4E 2QAAA 2R0LA 2K7XA 5FX5A 3W94A 1F92A 1MZAA 5E8EH 4ZKRU 1GHAF 1OXGA 1QB1A 2P3UB 2NU3E 1O3EA 3LC5A 3M5LA 4ABFA 1GJ7B 3SUDA 5DKMA 1A0HB 3RMOH 4OGYA 5CMXH 3MH7A 2OQUA 1O2UA 3T5FH 1CHOF 1SG8B 1HIAA 1ELBA 1O2NA 4Y0YE 1TPOA 5DP3A 1QL7A 7ESTE 3ZVFA 3ZVDA 3U1IB 2OQ5A 1DANH 1ZRKA 2OLGA 1V2ST 2QV1A 1O5FH 2A5IA 4J1YA 3SUEA 3UQOA 4ABHA 5CE1A 5JPMH 3RXTA 1AUTC 3PLBA 1P9UA 4TY6A 1T8NA 1HAXB 2OBOA 4AORA 2XRCA 4U01A 5CHAC 4Y8XA 3VB6A 1YPJH 3ZZAA 3P6ZB 5GPIB 3V0XA 1QCPA 1MD7A 2G5NA 4QT8C 3M7QA 2Z9JA 2EC9H 4Z0KA 5ESTE 1Z8RA 1QRZA 1TE0A 4OS1A 4AN7A 3RXHA 1M9UA 1KXCA 4HTCH 1ETSH 3RXUA 3PMJA 3EA7A 3A8DA 3UNSA 1NPMA 4JYUH 2BQ7B 3AAUA 1RJXB 1C5MD 1J15A 1HXEH 1K22H 3E0NB 1DY9A 1O2SA 3SHAH 4IC5A 3U8RH 1G3CA 2J34A 2BDYA 1QTFA 3EE0B 2J38A 2XCNA 2FP7B 1BMAA 5L6NH 2GT7A 2FEQH 4A92A 1AMHA 5ETXA 2CN0H 3QGJA 1P06A 1QB6A 4X8SH 5EW2H 1GBEA 1Y59T 4K8YA 6GCHG 3LIWA 1SOZA 1N1LA 4RSPA 1A2CH 1PPZA 1O2OA 2QA9E 3VB5A 1GVZA 1WBGB 2A2XH 2FX6A 1VCQA 1DWDH 1C1PA 2BB4A 1HAGE 1QURH 3PWBA 1YLCA 3A7XA 5DP8A 1UHBA 3DFJA 3O8DA 1A5GH 1SQOA 3RXJA 3T2NA 1TLDA 1ZMJA 3MNCA 1NFYA 2J2UA 1HAOH 1RTKA 4WVPE 1WOFA 1XUGA 4ZHMU 1P11E 3SU6A 2F9VA 1ZZZA 2C8XB 3GDVA 1O35A 1HAVB 3SU5A 1S85A 1SGDE 3STJA 1WUNH 1XKAC 1XXDA 1TA6A 1LHFH 4FU7A 3MNXA 4DGJA 2FPZA 1TGNA 3SQEE 3GCHC 1Z1JA 2Q6FA 3NPSA 1V2VT 5E2OA 3IWMA 1EJAA 1FAXA 2PV9B 2O8LA 3A7YA 3FP7E 4INLA 3FAOA 4BOHA 3FFGA 2C4FH 2R2WU 3V7TA 2Q6GA 1ANDA 2ZWLH 3SBKA 4ZAEA 1AIXH 1W12U 4NFFA 4O9VA 3OX7U 2VWOA 1F0SA 1SC8U 1XUJA 1BTYA 2YNAA 3DHKH 5HYOA 3LGUA 1O2TA 4X1RU 4A1TA 1GHAG 1FN8A 2OXSA 4DG4A 5A0BA 1C5WB 1O2ZA 1NRPH 2BLQA 1XX9A 2FLRH 1A61H 2CMYA 2Z3CA 1CE5A 1AUJA 1CHOG 4A1VA 1HLTH 1O3LA 1LPZB 1E0FD 3PMHB 3GCNA 2ODYB 1JOUB 3FP8E 2SGEE 1P05A 2AH4X 4X1NU 2BX3A 2ZCLP 4GUXA 1QA0A 2A31A 2HWLB 3M37A 2GVFA 3RXSA 1N8OC 1LPKB 1V2LT 1HAPH 3D23A 2FYRA 3LC3A 1XUHA 1HFDA 2OTVA 2ZFFH 3ATKA 3OSYA 1GMCF 2ZDKA 3ESTA 5LPEA 3ZYDA 3QUMP 5EG4A 3P8FA 1THSH 2FOEA 1PPEE 1OX1A 2BVSH 2HPPH 4K60A 1GBBA 1BIOA 1UCYE 2PUQH 1H9LB 1QQ4A 2Z9IA 4NSYA 4WXIA 2AERH 2BVRH 4OS2A 4XBDA 2A4GA 1NO9H 2FODA 3S7HB 1SLWB 1GPZA 5GCHG 3PWCA 3SJ9A 1GI4A 1DXPA 1BTZA 1Y3WA 2G8TA 1BMNH 3LPRA 1DICA 3ATIA 3FZZA 3PYHA 2ZHFH 3GDUA 4XFQA 5EXNA 3ZZ6A 1C4U2 2BVXH 1YPHC 2ALVA 4E7NA 2XW9A 2Z3EA 2EI7A 4E7RG 2G81E 3GY5A 5HGGA 1BTWA 3URDA 1O2MA 3BTTE 1TPSA 1TPAE 4AYVB 1C5UA 1CA0B 1D4PB 2KAIB 3PTBA 1EB2A 1ZOMA 2ZDLA 4IC6A 3UUZA 4AB9A 2NU1E
chains in the Genus database with same CATH superfamily
1GI7B 1QB9A 5I46H 1T4VH 1ANCA 3ZYEA 1O30A 3PRDA 1BOQA 1S82A 1Y8TA 2ZEBA 4F55A 1SQAA 4MNYA 2THFB 3ATMA 1O33A 3LJOA 1RD3B 1MH0A 3SN8A 1RTLA 1FQ3A 2W5EA 2ZGCA 2LPRA 3SNDA 1BBRE 1C2DA 3A88A 4B75A 4FUGA 1WTHD 1QHRB 1QGFA 1O2RA 1KXEA 1SFIA 2VIWA 4B76A 1ZYOA 4CH8B 4P02A 1MTSA 1GCDA 3TVJB 3S69A 1FV9A 2F9PA 1UW7A 2ZFQH 1THPB 3DUXH 1W11U 3F2HA 2WPMS 2V35A 1AO5A 1MTNB 3SJOA 1ANBA 3RXOA 3MWIU 4K1TA 4YXWD 1SGRE 1BZXE 2PLXA 5FCKA 1NY22 1QBVH 1TMUH 2B0FA 1TGTA 1O3BA 2GGVB 3EA9A 3HK6B 1YPEH 2HVYB 2FWWA 4AZ2B 4YT7H 3RMMH 3RXAA 1AVXA 2YMSD 1CA0C 4NIYA 1UTPA 4OS7A 1MKWH 1E1QD 1O2KA 5F53A 1UVUH 4WMDA 3LONA 1V2MT 1G37A 2UUYA 2GZ9A 1TGCA 1E36B 2CGAA 3MNBA 4JZIA 1DWEH 1O3GA 1WQVH 2O9QA 1Z1IA 1GI2A 2BQWB 2H2ZA 2O8WA 1T32A 2P93A 2XOKD 1DX5M 4NSVA 1O2VA 5PTPA 1SGFG 1SBWA 3RU4D 1YWUA 4BTIB 2BD9A 5C5NA 3FKSD 4AG1A 2FTMA 4X2WA 2ZHDA 3BTFE 4NFEA 2J98A 3L3TA 1V6DA 1MTVA 3U1JB 8ESTE 1LVOA 3BTQE 1CSOE 3Q3XA 4HGCA 1GMCG 2D8WA 2EEKA 1GBCA 2C93B 4WH6A 1O0DH 3GYMA 3A7VA 3N7EA 1UTOA 2FIRH 1TX8A 3OYPA 4ISHH 2HRVA 1SVPA 1V3XA 1KIGH 1QQUA 2GMTB 2SNVA 4FVDA 2UWLA 5E0HA 2W3IA 3P8GA 2BQ6B 2VU8E 1NN6A 3S7KB 2TBSA 1C9PA 1B0EA 2ANKH 1V2NT 3MHWU 1GJ6A 1N6YA 1ELEE 2Y5GA 2XC5A 1TNKA 3CS0A 2P94A 3SGBE 5EXMA 4I8LA 1GMDF 2RG3A 3QLPH 4DY7B 2J97A 2A5KA 1SLVB 1MQ5A 5A0CA 3A7TA 4YO9A 2SGQE 2Y5FA 1GI1A 5F8ZA 3P70B 3TNSA 2I6SA 1IQJA 2A1DB 3E90B 4X0WU 1LVYA 2QE7D 4FUBA 2CHAB 4E05H 1UTNA 1SOTA 3M7TA 2PFEA 1SGCA 1LQEA 1ELFA 1ELAA 4LZ1H 1C5QA 2IOTA 2GMTC 2FDAA 4FVBA 3TH3H 2HALA 2RA0A 4GAWA 3RDZA 1C5YB 5C5OA 3LGVA 4Q7YA 2BDHA 3KQDA 1OHHD 4FUIA 1HAVA 4BAHB 1NT1A 2F4LA 1P2QA 1H9HE 2PP6A 1E34B 2GKVE 1IAUA 1A4WH 1GL1A 2WPDD 4ACAA 1C1SA 1Y5UT 5FX6A 2PKSC 2VVCA 4MNVA 1YF4A 5TCAA 3QTOH 1EP6A 1YGCH 2XNIA 4GSOA 5DP9A 1WAYB 1BQYA 1L0ZA 3UY9A 3H5CB 1K1OA 3LGWA 4X2YA 2J4IA 5C17A 2GV7A 2ZPSA 3LH1A 1K1NA 4KTSA 3VB3A 1YPLH 3Q3KA 2BTCE 1OP0A 1G3DA 1GJ8B 1W10U 3RXDA 4SGBE 2ALPA 3RXPA 4CR5A 1W13U 5EU8A 2J92A 2XBWA 1EX3A 1C1MA 5AHGH 1PPCE 1HNEE 3UPEA 3NKKA 2XNDD 5T6GA 2A0QB 1QIXB 5L30H 2JH0D 1GBTA 1TGSZ 1LO6A 1VCWA 2ZDMA 1YM0A 1P02A 2WPIS 4FUCA 3GY8A 1MU6B 2ASUB 3RP2A 1V2KT 1TMBH 3HGNA 5EQSA 1AB9C 1O3PB 3T62A 4Y8ZA 4AYYB 3O8CA 3E8LA 2D1JA 3SU1A 5T6FA 4A7IB 5JBAS 2QC2A 1T8OA 3RLWH 5FPTA 2HPQH 1PPHE 2AIPA 1BT7A 2BD8A 2ZG0H 4K5ZA 3V12A 1PJPA 4CRBA 3BTWE 3IITA 1A0LA 1TBQH 3FP6E 4AFQA 4CBNA 1GJ5H 3L33A 2W6ID 1BTUA 2H1UA 2ZU3A 1TRYA 4GLYA 4AC9A 1KXFA 1IQKA 5AFZH 1AWHB 1DFPA 5JB9S 3M5MA 4MPUA 1UK2A 1U6QA 3OY5U 1G3BA 1QL9A 4NA9H 2FZZA 3F0PA 2BOKA 3SV2H 4K69A 4MG3A 4ABAA 1DS2E 1GHZA 1ZLRA 2KCPA 3PO1C 3WW7A 1ZMNA 4K1EA 4P00A 5EPYA 5T6DA 3SU2A 5L2ZH 3FZDA 2PUXB 4GHTA 1KLIH 1DDJA 1SGQE 1AY6H 4ACBA 1FXYA 1UTJA 4XBCA 4IS5A 1HJAB 1GBIA 2HNTC 2KAIA 1JMOH 4JZEH 4ZH8A 1D6WA 1HJ8A 1UJ1A 4OGXA 3ZZ9A 1GVLA 1D3QB 1ZGVA 1ESAA 1NBME 3T25A 2VWNA 3DFLA 1EB1H 2FESH 2Y81A 4TWWA 4B1TA 1IOEA 1SGTA 2A2QH 2UWPA 4HFPB 5FPSA 5KEDA 2TIOA 4BAMB 4UDWH 4ABEA 3D62A 4I33A 2DE9A 1Z71A 2YMSC 3RXGA 2G00A 2TGAA 1P2OA 4JK6A 1O5EH 3WWBA 5BRRE 2V6NA 3MU5A 1ETRH 1JXPA 2BDGA 1ESTA 5K7RA 5F8TA 4CRAA 1P9SA 1C2JA 3DT0H 4BNRA 2FOHA 2ZQ1A 1C1NA 4E06H 1BHXF 4H6SB 2F91A 1HV7A 3LKWA 1S6FA 1NU9A 3K6YA 2KM0A 3RMNH 1XUKA 3QDZB 1IHTH 1P57B 5JBTA 5TCCA 3QZQA 1OYTH 1GBKA 4WY3A 1CGHA 1MZDA 1ZMLA 3B9FH 3F68H 1EOJA 1J17T 1MBQA 4JZ1A 1FY5A 4YLUA 3SGAE 4X6OA 5LGOA 2BDCA 1RIWC 3P92A 3SJ8A 3H7TA 1UTKA 4MQAA 1DLEA 1VITH 2A32A 3LDXH 1SR5C 3NUMA 1HPGA 3TJNA 3KNXA 4NA7A 4VGCC 4A5TS 1A3BH 3ZVAA 2SFAA 3TU7H 2BX4A 2AEIH 3MU0A 3LGTA 6LPRA 4X6PA 1A5IA 1V2PT 2VGCB 3SZNA 1EASA 1SI5H 3A84A 4XRNA 1PPGE 1G9IE 5GCHF 1MCTA 4U30A 3MYWA 1ELCA 3W95A 3EYDA 1L1GA 2UUFB 3P95A 4XBBA 1SHYA 2P8OB 3TH4H 1GJBB 3D49H 1CVWH 1GJDB 4I32A 3SV9A 3NCLA 1XKBC 4TY7A 2BY6X 1TA2A 1WYKA 1XMNB 3SNEA 5JDUB 2SGPE 2TGTA 3QGNB 2JIZD 1DSTA 1EFRD 1H8DH 2YNBA 4X8VH 1ESBA 2H5DA 1CO7E 1GVKB 2NWNA 2ZFRH 2KFWA 3ZVEA 5DP5A 1H1BA 5ESBA 1DT2A 2XXLA 5KECA 2OC7A 4JCNA 1CBWB 1BA8B 2RDLA 4JZDH 2O8UA 3BTME 2VIDA 3GS9A 5K0HA 1P12E 1HAYB 1L1JA 2H9TH 1FY3A 1ARCA 1C5LH 4LOYH 1DSUA 1FJSA 3GY6A 1GHVH 1UVOA 4OS4A 5DG6A 3BN9A 3T29A 3S9CA 1OOKB 4UD9H 3M36A 1NU7B 4Y8YA 1IQEA 3A85A 2FO9A 1E35B 4D7FA 1G30B 2VGCC 3F9GA 3BF6H 1GCTB 3QZRA 3UQVA 2XCFA 4FUJA 1B7XB 2P3TB 3V13A 4ESTE 3DD2H 1AFQB 4RN6A 2P8OC 1Y5BT 1AVGH 1C9TA 1C5OH 1SFQB 4NWLA 1HDTH 3KQBA 2XYAA 3BSQA 1S81A 3VB4A 1JBUH 3I77A 4B71A 3Q76A 4DJZB 1KSNA 1IQLA 1P10A 2CJIA 5F6MA 2O8TA 3F3BA 2C90B 2PTCE 4I7YH 4GVUA 2EA3A 2CF8H 1NFWA 1ORFA 4HG6A 3LJJA 1P09A 4IN1A 2HLCA 1CBWC 4DCDA 4AFUA 1VCPA 1TQ7B 2BD4A 2OC1A 2RCEA 2QF5A 2BYAX 1O3DA 3IG6B 1EXFA 1JRSA 1XVOA 3TITA 1GBDA 2PKAB 1KLJH 2QIQA 2ZU5A 1J16A 3ZV8A 2BDIA 3H7OA 4YZUA 1MAXA 1TX6A 1V2RT 4ZHAA 1IQMA 3KEEA 2AMDA 1BDAA 4NZQA 2UWOA 2ZGXH 4TPIZ 4RKJB 3N99A 2G55A 3C1KA 1DXWA 4WWYA 3GDSA 2OD3B 1VZQH 5A8XA 3T27A 3ZZ4A 5EQRA 5DK1A 4BAOB 1GBLA 3NK8A 3TIUA 2WV4A 1W0YH 2P95A 5EPNA 1DITH 1P03A 2V3MA 3RXFA 5FXLA 2VH0A 1Z6EA 5EOKA 5G4BA 2PHBA 4BTTB 1BTPA 2GD4B 4ZROA 3VGCB 4UFEH 3ZVCA 4UFFH 3BIUH 1BJVA 4ASUD 3FN8A 2C3SA 2A7HA 3MU1A 4X1SU 2R9PA 2VIVA 1QRWA 1W0ZU 3TJVA 3E1XB 1O2IA 4ABDA 4BANB 1JIRA 4K8BA 1SGNE 2QXHA 2R2MB 3RXIA 2SGFE 1MMJN 3OFND 3PV5A 1ZSKA 3RC6A 2B8OH 5B6OA 3F2FA 2VIPA 1V2TT 2RDEA 1W2KH 3KL6A 1O3KA 3B23B 3D65E 5LPRA 5HM2A 4FUDA 4GPGA 3F9FA 1EOLA 2SNWA 4RT0A 1QJ1B 1P2KA 1K28D 1YPHE 1NESE 5C2ZA 2HOBA 3KHVA 2HGTH 4X2VA 1LPGB 2GZ8A 4ABIA 1MABB 1LVMA 3E16B 3UWJH 3MH6A 1OP2A 2V3OH 5EXLA 2W26A 3BEIB 1P0SH 2ZI2H 1J14A 1HRTH 3S9BA 4TSFD 2V0BA 1Y3UA 3OTPA 1AI8H 3EGKH 2HVXA 2G4TA 1TPPA 3BEFB 3ZIAD 1JWTA 2A45B 1P8VC 1FIZA 1GHYH 1OS8A 1EPTB 2C8WB 1GJ4H 1O2JA 4O3UA 1C5PA 4FUHA 2ZTXA 3U28C 2JJ1D 3SO3A 3K2UA 1GJCB 5FCRA 2TRMA 3MQKC 4I8KA 3SW2B 5EJLA 3GYLB 1YLDA 1VJ9U 4INKA 1QJ7B 3URCA 2V7QD 3FANA 2ANYA 3EBNA 4AX9H 1GBHA 1O3NA 3DA9B 4RI0A 3RXCA 4YOJA 1TMTH 3VFEA 1VITG 3CS7A 5FBEA 4CHAB 1NM6A 2ODQA 4B6EA 1EATA 5ABWA 1ABJH 3F9EA 1K9OE 2OP9A 1RXPA 4A1XA 5C1XA 2VVUA 5LH8A 4WMFA 2P16A 1KDQB 3QX5H 3T28A 2FOMB 2TPIZ 2PR3A 1AE5A 1O5CB 1TB6H 2ANMH 5DGJA 1ELVA 3A8CA 3SU0A 4UEHH 1IHSH 2GP9B 3DSOA 2XBXA 5C20A 2ZPQA 3WWFA 4D7GA 1KLTA 3UWIA 1NFUA 1W3CA 2WINI 1QJ6B 2BOHB 1MD8A 1AN1E 3VEQB 2ZNKH 6ESTA 3Q00A 1F7ZA 1K2I1 4SGAE 1MCVA 1Z6JH 4FU9A 2PGBB 3BTDE 3A7ZA 1YKTA 3GY7A 4GHQA 1MTNC 1IQNA 2BY7X 1SL3A 1TIOA 2A7JA 3A80A 1V2QT 3BTGE 3SORA 2H9HA 4D8NA 2ESTE 1O38A 1GI6A 2ZO3H 3BTEE 5L2YH 1AFEH 3KQEA 3SHCH 5BPEA 4YM9A 1T8MA 2GCHF 5HKKD 4ISOA 1VJAU 3ZZ8A 1YCPK 1S6HA 2LP6A 5JBBS 5DP7A 2UUJB 1C5VA 4WMEA 1G2MA 3OE7D 4I8HA 2FXRA 4WJG2 2XC0A 1GGDB 2W7SA 5C3NA 1EAIA 3SOSA 1FDPA 1BMLA 3HPTB 4TYDA 1HBTH 1G36A 2JKHA 2FMJA 1MTUA 1TQ0B 1O3MA 1INCA 3F0OA 1YP9A 1CT0E 1GDQA 3ATWA 3MMGA 1TNJA 3ZV9A 5A09A 5SGAE 8KME2 3SV7A 2XBVA 3QWCH 1ZPCA 5JBCS 2DUCA 3TGJE 2WPHS 5J4SA 1FNIA 2TGPZ 1UCYK 3GY4A 1P3CA 1HCGA 1HXFH 1MKXK 2CV3A 7KMEH 3MOCA 1O5AB 4NZLA 3ODDA 3M61U 2H5CA 4HI3A 1E79D 1H9IE 1NFXA 2LNCA 3SI4H 2WZQA 3DSPA 1Z8GA 2ZFTA 1TAWA 1QA7A 1XUFA 1OWIA 3MNSA 1BMFD 2GJGA 2J9NA 1LQDB 1SGIB 4JYVH 3ZZBA 1S5SA 4TPYA 1ARBA 2F3CE 1A1RA 1KTSB 4B2AA 2BZAA 1AU8A 3GCTF 2W7UA 4WXVA 4MTBA 3SJKA 7GCHF 4MPVA 1FLEE 3A87A 3MU4A 1TBZH 2FM2A 1GJAB 4INHA 1MTWA 1A46H 3UAIC 1DVAH 2Z3DA 4F49A 3Q77A 1O2LA 3T26A 2ZCHP 2FI5E 3RXKA 4TWYA 2OCVB 3SV8A 1EAWA 3AW0A 1BJUA 3BG4B 3AW1A 1WU1A 3PLPA 1O2YA 1GBJA 1A0JA 1C2MA 1HAIH 3TK9A 3OAAD 1NRRH 2VWMA 2ZTYA 3DCLA 2WUBA 2BY8X 2CHAC 2KZ4A 2BMGB 1GI8B 1FY4A 1O32A 4IN2A 3QTVH 4F4OC 1GG6B 1C5NH 2F9BH 1G3EA 2BY5X 1OSSA 4X6NA 1WQSA 2BY9X 1EAXA 2V3HH 2WPKS 4AGKA 1LHCH 1W0JD 1P2MA 1G2LA 1BBRK 3TK5A 3C27B 2R3UA 1GBFA 1UTLM 4I31A 4ISIH 4AFSA 1NRQH 2Q6DA 2JH5D 1F5LA 1C2LA 3OY6U 1OYQA 4JK5A 4DT4A 3SV6A 4H4FA 2Z6BD 1FONA 2HLDD 2J95A 3MTYA 1TRNA 3HK3B 4K2YA 1CQQA 1NTPA 3GY3A 3UREA 1Y5AT 1FAKH 3K6ZA 1C5TA 3LH3A 4NG9H 1EAUA 1YY3A 3STIA 3NRLA 5DPAA 1BRBE 4MNWA 1GMHG 1D9IA 3F6UH 2D2DA 3PMAB 3H09A 4KTCA 3UOPA 1BB0B 1BITA 4H42U 3RMLH 1OWDA 3N7DA 2VH6A 4Q80A 1C1TA 1C4V2 5HIZA 2QXGA 2ZF0H 1C4Y2 2WYJA 1W8BH 2GCHG 5AFYH 1T4UH 4XD7D 2FTLE 1O3CA 2GCTB 1IQIA 1H8ED 2IJOB 4DT7B 3ZVBA 1SHHB 3PRBA 2AYWA 3EE7A 3VG8A 1VGCB 2BDAA 3M7UA 4WH8A 1EZQA 4CRDA 5E0JA 2O8MA 4HZHA 1O34A 1W7GH 1LKBA 1WV7H 3P17H 3FOAA 1DE7H 1UTQA 5E2PA 2NU0E 2F9NA 5CDFE 4FXGH 1K1LA 1UVSH 4DOQA 3TLOA 3SNBA 2WSSD 1WTGH 4K3JA 4X8UH 3ITIA 2ZHQH 1P2JA 5GIBA 1TOMH 3TPIZ 3AAVA 4XOJA 4WF8A 1F2SE 1Z7KA 1L4ZA 4BAKB 1O3FA 2ANWA 9LPRA 3VB7A 3U9AH 2Y5HA 2HNTE 1BRCE 4DVAU 3VPKA 4GCHG 3KGPA 5CHAB 5JYIA 2AS9A 1ZHPA 1T7CA 2QF3A 2ZU4A 3UR6A 3TJOA 1ELDE 2ZU2A 2STBE 2H9EH 3ZZ3A 1BHXB 1KTTB 1UVTH 4JYTA 1ETTH 3GCTG 3EQ0H 3PM3A 3Q3YA 7GCHG 5IDKA 2PW8H 1B0FA 3LOXA 5A8YA 1CT2E 4Y11E 1DPOA 1FY1A 5T3HA 1AZZA 4MNXA 5DP6A 3KIDU 1C5SA 1KY9A 3M3TA 3N7OA 3V3MA 1OWHA 1TGBA 4Y7AA 2IPHA 4X2XA 4UONA 1NS3A 2G4UA 1HJAC 3RM2H 1YCPH 2QYIA 4LZ4B 3HGPA 1GHBF 1QRXA 4ISLA 3RU4E 2FS8A 1L2EA 1V2WT 3OEED 1RTFB 5DP4A 3TH2H 2QCYA 4ZKOU 4KGAA 3CENA 2GDEH 2G52A 1KDQA 4ZMAH 3UR9A 1BTHH 1AHTH 1ZSLA 2G51A 3O8RA 1H4WA 2JETB 2W3KA 5EJ1A 5C0TA 4IGDA 1TNIA 1YPGH 2YOLA 2B7DH 3RXBA 3ZZ7A 2BD2A 2I6QA 4Q2KA 4D76A 5A8ZA 1TNLA 1IQFA 2XTTB 3AK5A 1BTXA 4MLFB 3NWUA 1ACBE 1UCYH 1C2IA 2AFQB 1MKXH 1PQ5A 1IQHA 2ZDVH 2L74A 2ZPRA 3QK1A 2ZTZA 4XE4A 3U8TH 4FUFA 2VB0A 3EAJA 1BCUH 1C2KA 2GDDA 1V2JT 3PLKA 1EZUC 2WPJS 4AOQA 3AASA 1FN6A 2FOBA 3K65B 3ENSB 3RUOA 2FS9A 3GCOA 1XXFA 1D3DB 3M3VA 5C1UA 1MKWK 5EGMA 1C1UH 1AKSB 3GCHB 1C5ZB 2ZECA 4OS6A 3TK6A 1ZTJA 2ZGHA 5HMAA 3RXMA 1QNJA 2XBYA 1AE8H 1HGTH 1QR3E 2BLOA 4Z1MD 4YLQH 8GCHF 2SGAA 1ZJKA 2VINA 2QXJA 2FOAA 1CU1A 1ID5H 4A6LA 2IN2A 3ATLA 2JETC 3P8NA 2QF0A 2K0QA 1T31A 1B5GH 2R0KA 2C8YB 1RS0A 4U32A 4X1QU 1XM1A 3BTHE 3ELAH 2Y82A 1THRH 1PYTD 1PPFE 4MPWA 2QGRA 2GTBA 2JH6D 3TGKE 1O5DH 4LK4A 1AZ8A 1YC0A 1W14U 2VWLA 2AGGX 2Q1JA 5A2MH 4MDSA 1O2WA 5C1YA 5TJXA 1NRSH 5IYTA 4LXBH 1O37A 3O8BA 1BBRH 4M7GA 9ESTA 1O3HA 5F03A 1HYLA 1TRMA 5B6LA 1DUAA 1N8OB 3U8OH 1O36A 4ISNA 2WPLS 4ZCNA 1EJNA 1TWXB 3SGQE 4RT1A 1HB0B 3UIRA 1GL0E 3NXPA 2FLBH 1VITF 1GBMA 1S6LA 1UVPA 4CRCA 6CHAB 1FY8E 4ASHA 1QBOA 3B8JA 2WUCA 2B5TB 2FI4E 2Y7XA 4YOIA 1MUEB 1JIMA 1YYY1 4X6MA 3SUFA 1C1WH 1MQ6A 4Y76A 1C5RA 1O3IA 4NGAH 3K9XB 4DIIH 1ELTA 2F83A 2ZU1A 3A82A 5HIYA 1GWAA 3PMBB 1SQRA 2ZHEH 3L6PA 4Q4LA 1EZSC 3QO6A 1GCTC 2GZ7A 1EQ9A 2K8IA 1P04A 3ODFA 1GHBG 4NIXA 1AQ7A 1AFQC 1EUFA 3RXVA 1P01A 1FPHH 2B9LA 1DLKB 5JB8S 1AVWA 3SU3A 1DOJA 4O3TA 5FAHA 2A4OA 2Z9KA 1NROH 1GI9B 1DUEA 2A4RA 5J4QA 1LMWB 1FMGA 4FU8A 1Y3VA 1SPJA 4ABJA 2XC4A 4TT3D 1Q3XA 4B2CA 5C67A 4O97A 4Y79A 4X1PU 1RGQA 4KELA 1L4DA 1ZJDA 2QY0B 1GBAA 3A89A 6CHAC 5HM9A 3MI4A 2P3FH 5LPFA 3GY2A 2ZIQH 1O31A 2PSYA 3BV9B 1FIWA 1ABIH 1OKXA 3M35A 1S0QA 3FVFB 1SGEE 1C1OA 5DJ7A 3JZ1B 1OWEA 1AWFH 1C1RA 1PPBH 3HKJB 2BXTH 2AIQA 2G5VA 3MH5A 2PTNA 3MH4A 5GJ4B 4CREA 4BTUB 4RKOB 1LDTT 3VXFH 2D26C 3BG8A 2Y80A 1S84A 3G01A 4CBOA 4YOGA 8GCHG 1K1MA 1KXAA 3RM0H 4PROA 4AGJA 1K21H 4IBLH 5FPYA 1UK3A 1ZTKA 4ABGA 1QY6A 2Z94A 1G32B 3KF2A 1ZRBA 2R3YA 3QN7A 1BMMH 2FOCA 1OWJA 3LGYA 3EA8A 2VIOA 4MVNA 1DM4B 3SJIA 1QBNA 1S83A 2Z7FE 3VGCC 4BXSA 3GOVB 5AF9H 2VBCA 1PQ8A 1Z8JB 2ULLA 1JRTA 2A4QA 1A7SA 1QZ8A 4X8TH 4I8GA 3U98H 2A7CA 3SUGA 4AG2A 1NBMD 3M3SA 1WCZA 1SKYE 4DURA 3E0PB 2Y7ZA 2PWXA 4ZKNU 1SGYE 1LVBA 2OC8A 5FL7D 2FI3E 2GT8A 3MO6A 2ZDNA 5I25A 2A5AA 1RFNA 1ANEA 1HAHH 2WYGA 1Q2WA 3F9HA 4ZUHA 5GWZA 1ZPZA 5FHTA 2FOGA 2VVVA 1SSXA 3UFAA 5GXPA 3RU4T 1XUIA 3LU9B 4R0IA 3MO3A 1COWD 1HIAB 1O2XA 3PV2A 2JJ2D 2OBQA 3PROA 4I86A 4Y71A 3SQHE 2QF4A 1O2PA 2CXVA 1K1IA 1V2UT 2WHXA 3GICB 1W7XH 1O3JA 1TONA 2AGIX 1C2GA 2ZHWH 1C2EA 1QFKH 3BEUA 1D6RA 2AHME 5HXFA 1KYNA 1CGIE 4B73A 1FI8A 2M5TA 4Q7XA 4CR9A 1Y3YA 5EODA 1UO6A 2ZDAH 3ZVGA 3KN2A 5DSFA 1O2GH 2DE8A 1UTMA 1EPTC 1ZHRA 2ZGJA 4AB8A 4CRGA 2TGDA 1CHGA 1V2OT 4KP0A 1BRAA 3UNRA 1L1NA 2KX4A 3UOUA 1P2IA 1GMHF 1SGPE 2BD7A 1AGJA 1SB1H 2FX4A 1TNGA 2ZFPH 3A83A 3E6PH 4YESB 1MBMA 1EP5A 2PGQB 1TNHA 1F5KU 2GV6A 4CHAC 1ZGIA 3F1SB 1GDUA 2AGEX 3E91A 4ZKSU 1LHEH 1A5HA 2J94A 3HKIB 4O03A 4ZXXH 1F0TA 4ZHLU 4KTUA 4UE7H 3M5OA 1QL8A 3MFJA 2BZ6H 1CGJE 2L6OA 5F8XA 1O5BB 1ZR0A 1YLNA 2W6JD 4Y10E 1K1JA 4K1SA 3HATH 3M5NA 4R8TB 1E37B 1GDNA 3PTNA 3P8OA 4NWKA 1N6XA 1UHBB 1PYTC 3A8AA 2PKSB 2Z9GA 1KXDA 1UK4A 3CP7A 1WSSH 2ZZUH 1AKSA 1D3PB 1GHXH 4DW2U 3R3GB 2ZP0H 1J9CH 2STAE 2P59A 2XWAA 8LPRA 1PQAA 2ODPA 2BD5A 3A7WA 1Z8IB 1O3AA 3FO8D 1LHDH 2Y6TA 1E38B 5DO4H 1TFXA 2BHGA 2F9UA 2AMQA 5EW1H 3R0FA 4CRFA 1GHWH 2C8ZB 3RXEA 1OWKA 4UFGH 4GCHF 1C2FA 1VR1H 3MU8A 1P2NA 2QN5T 4Y0ZE 3ZZ5A 5FBIA 3UB0A 1LTOA 1O3OA 2AMPA 4D9QA 4THNH 5GNDA 5KGOA 2FYQA 1KXBA 1TOCB 4Y7BA 1TABE 2K1QA 1OPHB 1GGDC 4AFZA 3LT3A 1X7AC 1F0UA 1C1VH 4F48B 1LCYA 4Y6DA 1GI3A 1AB9B 4XSKU 1FZZA 1TBRH 1AD8H 1SLXB 4Q63A 4ZXYH 2GX4A 5AVDA 1HJ9A 2ILNA 1ELGA 1K1PA 2ZFSA 4B2BA 1PFXC 4FETA 4IMQA 3BTKE 1J8AA 2EI6A 1BRUP 1C1QA 1F5RA 1BUIA 5E0GA 2QXIA 3MO9A 3SYJA 2ZQ2A 3RXQA 1SQTA 2OINA 3SI3H 2VNTA 1GI0A 4MPXA 3EDXB 2NU2E 1SGFA 3SNAA 1NRNH 1TYNA 3NZIA 4DIHH 1GI5A 2ZC9H 2KCYA 2XWBI 4CH2B 3OU0A 5GDSH 4D9RA 2SGDE 2PKAA 2M2AA 2OC0A 1O39A 1CA8B 1XVMA 1O2HA 3BIVH 1K0HA 3GISB 1H8IH 3UNQA 1MU8B 2BXUH 2VIQA 1A3EH 4XDEA 4I8JA 4YTAA 2RA3A 3SU4A 3KQCA 2CF9H 2ZKSA 2LIZA 3PO1B 5EQQA 5H4IB 3RLYH 4OS5A 2UUKB 1HAZB 3I29A 1DY8A 3PV4A 2VJ1A 1NZQH 1F0RA 1EZXC 2ZCKP 2WV9A 3RC4A 3UTUH 1IQGA 4Z6AH 1ZHMA 1T8LA 2OUAA 2H6MA 3TNTA 1O5GH 3BG4C 2RFKC 1P3EA 1UMAH 1EJMA 1RRKA 2WV5A 1MAYA 3PB1E 3A81A 3RC5A 3ZZCA 1LHGH 1YPKH 3TJUA 4NCYA 2Z9LA 2BLVA 1DWCH 2F9OA 4BXWA 4NIWA 1DWBH 3OTJE 2BDBA 2HNTF 3WY8A 1W0KD 2ZGBH 4UFDH 1YPMH 1TALA 1HUTH 4YT6H 1LKAA 1GG6C 6GCHF 1YBWA 4OM9A 3KCGH 1CT4E 4NA8A 1E1RD 2J5UA 3S0NA 1S0RA 2BLWA 2YMSB 4KKDA 2BD3A 4IMZA 4ABBA 2EI8A 4BAQB 5A0AE 1ZPBA 1GMDG 3I78A 4Q7ZA 1SMFE 3RXLA 2ZA5A 4JMYA 1ZTLA 1C5XB 3E3TA 1ZSJA 3A8BA 3TGIE 1OP8A 1C2HA 2KCOA 3CNRA 1O2QA 4FUEA 1GJ9B 4H6TA 2NU4E 1YCPM 1EKBB 3AVZA 3A86A 4J2YB 2BM2A 3S9AA 4M9FA 1TX7A 1D3TB 4JZFH 1RIWB 2FOFA 2GCTC 3VXEH 3JZ2B 2PSXA 4NIVA 1Y3XA 1EPTA 1PQ7A 1Q31A 1FUJA 1SLUB 4VGCB 4U2WA 4B74A 7LPRA 1VGCC 3SNCA 1FPCH 3U69H 3ZZDA 3KYFA 3RXRA 3LGIA 1NC6A 4IW4E 2QAAA 2R0LA 2JDID 2K7XA 5FX5A 3W94A 1F92A 1MZAA 5E8EH 4ZKRU 1GHAF 1OXGA 1QB1A 2P3UB 2NU3E 1O3EA 3LC5A 3M5LA 2EQNA 4ABFA 1GJ7B 3SUDA 5DKMA 1A0HB 3RMOH 4OGYA 5CMXH 3MH7A 2OQUA 1O2UA 3T5FH 1CHOF 1SG8B 1HIAA 1ELBA 1O2NA 4Y0YE 1TPOA 5DP3A 3OEHD 1QL7A 7ESTE 3ZVFA 3ZVDA 3U1IB 2OQ5A 1DANH 1ZRKA 2OLGA 1V2ST 2QV1A 1O5FH 5DN6D 2A5IA 4J1YA 3SUEA 3UQOA 4ABHA 5CE1A 5JPMH 3RXTA 1AUTC 3PLBA 1P9UA 4TY6A 2J98B 1T8NA 1HAXB 2OBOA 4AORA 2XRCA 4U01A 5CHAC 4Y8XA 3VB6A 1YPJH 3ZZAA 3P6ZB 5GPIB 3V0XA 1QCPA 1MD7A 2G5NA 4QT8C 3M7QA 2Z9JA 2EC9H 4Z0KA 5ESTE 2KR7A 1Z8RA 1QRZA 1TE0A 4OS1A 4AN7A 3RXHA 1M9UA 1KXCA 4HTCH 1ETSH 3RXUA 3PMJA 3EA7A 3A8DA 3UNSA 1FX0B 1NPMA 4JYUH 2BQ7B 3AAUA 1RJXB 5CHBA 1C5MD 1J15A 1HXEH 1K22H 3E0NB 5T1VA 1DY9A 1O2SA 3SHAH 4IC5A 3U8RH 1G3CA 2J34A 2BDYA 1QTFA 3EE0B 2J38A 2XCNA 2FP7B 1BMAA 5L6NH 2GT7A 2FEQH 4A92A 1AMHA 5ETXA 2CN0H 3QGJA 1P06A 1QB6A 4X8SH 5EW2H 1GBEA 1Y59T 4K8YA 6GCHG 3LIWA 1SOZA 1N1LA 4RSPA 1A2CH 1PPZA 1O2OA 2CK3D 3VB5A 2QA9E 1GVZA 1WBGB 2KCAA 2A2XH 2FX6A 1VCQA 1DWDH 1C1PA 2BB4A 1HAGE 1QURH 3PWBA 2IJD1 1YLCA 3A7XA 5DP8A 1UHBA 3DFJA 3O8DA 1A5GH 1SQOA 3RXJA 3T2NA 1TLDA 1ZMJA 3MNCA 1NFYA 2J2UA 1HAOH 1RTKA 4WVPE 1WOFA 1XUGA 5EJZA 3KYGA 4ZHMU 1P11E 3SU6A 2F9VA 1ZZZA 2C8XB 3GDVA 1O35A 1HAVB 3SU5A 1WDIA 1S85A 1SGDE 3STJA 1WUNH 1XKAC 2OK5A 1XXDA 1TA6A 1LHFH 4FU7A 3MNXA 4DGJA 2FPZA 2LELA 1TGNA 3SQEE 5C94A 3GCHC 1Z1JA 2Q6FA 3SZEA 3NPSA 1V2VT 5E2OA 3IWMA 1EJAA 1FAXA 2PV9B 2O8LA 3A7YA 3FP7E 4INLA 3FAOA 4BOHA 3FFGA 2C4FH 2R2WU 3V7TA 2Q6GA 1ANDA 2ZWLH 3SBKA 4ZAEA 1AIXH 1W12U 2IPQX 4NFFA 4O9VA 3OX7U 2VWOA 1F0SA 1SC8U 1XUJA 1BTYA 2YNAA 3DHKH 5HYOA 3F2GA 1O2TA 3LGUA 4X1RU 4A1TA 1GHAG 1WXRA 1FN8A 2OXSA 4DG4A 3W1EA 3KQ5A 5IK2D 5A0BA 1C5WB 1O2ZA 1NRPH 2BLQA 1XX9A 2FLRH 1A61H 2CMYA 2Z3CA 1CE5A 1AUJA 1CHOG 1VKYA 4A1VA 1HLTH 1KMHB 1O3LA 1LPZB 1E0FD 3PMHB 3GCNA 2ODYB 1JOUB 3FP8E 2SGEE 1P05A 2AH4X 4X1NU 2BX3A 4B6FA 2ZCLP 4GUXA 1QA0A 2A31A 2HWLB 3M37A 2GVFA 3RXSA 1N8OC 1LPKB 1V2LT 1HAPH 3D23A 2FYRA 3LC3A 1XUHA 1HFDA 2OTVA 2ZFFH 3ATKA 3OSYA 1GMCF 5C0UA 2ZDKA 3ESTA 5LPEA 3ZYDA 3QUMP 2F43B 3P8FA 5EG4A 1THSH 2FOEA 1PPEE 1OX1A 2BVSH 2HPPH 4K60A 1GBBA 1BIOA 1UCYE 2PUQH 1H9LB 1QQ4A 2Z9IA 4NSYA 4WXIA 2AERH 2BVRH 4OS2A 4XBDA 2A4GA 1NO9H 2FODA 3S7HB 1SLWB 1GPZA 5GCHG 5EIYA 3PWCA 2EY4C 3SJ9A 1GI4A 1DXPA 1H8HD 1BTZA 1Y3WA 2G8TA 1BMNH 3LPRA 1DICA 3ATIA 3FZZA 3PYHA 2ZHFH 3GDUA 4XFQA 5EXNA 4FOUC 3ZZ6A 1C4U2 2BVXH 1YPHC 2ALVA 4E7NA 2XW9A 2Z3EA 2EI7A 4E7RG 2G81E 3GY5A 5HGGA 1BTWA 3URDA 1O2MA 3BTTE 1TPSA 1TPAE 4AYVB 1C5UA 1CA0B 1D4PB 2KAIB 3PTBA 1EB2A 1ZOMA 2ZDLA 3DSGA 4IC6A 3UUZA 4AB9A 2NU1E
chains in the Genus database with same CATH topology
1GI7B 1QB9A 5I46H 1T4VH 1ANCA 3ZYEA 1O30A 1BOQA 1S82A 1Y8TA 2ZEBA 1SQAA 4MNYA 2THFB 3ATMA 1O33A 3LJOA 1RD3B 1MH0A 3SN8A 1RTLA 1FQ3A 2W5EA 2ZGCA 2LPRA 3SNDA 1BBRE 1C2DA 3A88A 4B75A 4FUGA 1WTHD 1QHRB 1QGFA 1O2RA 1KXEA 1SFIA 2VIWA 4B76A 1ZYOA 4CH8B 1MTSA 1GCDA 3TVJB 3S69A 1FV9A 2F9PA 2ZFQH 1THPB 3DUXH 1W11U 2WPMS 2V35A 1AO5A 1MTNB 3SJOA 1ANBA 3RXOA 3MWIU 4K1TA 1SGRE 1BZXE 2PLXA 5FCKA 1NY22 1QBVH 1TMUH 2B0FA 1TGTA 1O3BA 2GGVB 3EA9A 3HK6B 1YPEH 2FWWA 4AZ2B 4YT7H 3RMMH 3RXAA 1AVXA 1CA0C 4NIYA 1UTPA 4OS7A 1MKWH 1O2KA 1UVUH 4WMDA 3LONA 1V2MT 1G37A 2UUYA 2GZ9A 1TGCA 1E36B 2CGAA 3MNBA 4JZIA 1DWEH 1O3GA 1WQVH 2O9QA 1Z1IA 1GI2A 2BQWB 2H2ZA 2O8WA 1T32A 2P93A 1DX5M 4NSVA 1O2VA 5PTPA 1SGFG 1SBWA 3RU4D 4BTIB 2BD9A 5C5NA 4AG1A 2FTMA 4X2WA 2ZHDA 3BTFE 4NFEA 3L3TA 1V6DA 1MTVA 3U1JB 8ESTE 1LVOA 3BTQE 1CSOE 3Q3XA 4HGCA 1GMCG 2D8WA 2EEKA 1GBCA 2C93B 4WH6A 1O0DH 3GYMA 3A7VA 1UTOA 2FIRH 1TX8A 3OYPA 4ISHH 2HRVA 1SVPA 1V3XA 1KIGH 1QQUA 2GMTB 2SNVA 4FVDA 2UWLA 5E0HA 2W3IA 3P8GA 2BQ6B 2VU8E 1NN6A 3S7KB 2TBSA 1C9PA 1B0EA 2ANKH 1V2NT 3MHWU 1GJ6A 1N6YA 1ELEE 2Y5GA 2XC5A 1TNKA 3CS0A 2P94A 3SGBE 5EXMA 4I8LA 1GMDF 2RG3A 3QLPH 4DY7B 2A5KA 1SLVB 1MQ5A 5A0CA 3A7TA 4YO9A 2SGQE 2Y5FA 1GI1A 5F8ZA 3P70B 3TNSA 2I6SA 1IQJA 2A1DB 3E90B 4X0WU 1LVYA 4FUBA 2CHAB 4E05H 1UTNA 1SOTA 3M7TA 2PFEA 1SGCA 1LQEA 1ELFA 1ELAA 4LZ1H 1C5QA 2IOTA 2GMTC 2FDAA 4FVBA 3TH3H 2HALA 2RA0A 4GAWA 3RDZA 1C5YB 5C5OA 3LGVA 4Q7YA 2BDHA 3KQDA 4FUIA 1HAVA 4BAHB 1NT1A 1P2QA 1H9HE 1E34B 2GKVE 1IAUA 1A4WH 1GL1A 1C1SA 1Y5UT 5FX6A 2PKSC 2VVCA 4MNVA 1YF4A 5TCAA 3QTOH 1EP6A 1YGCH 2XNIA 4GSOA 5DP9A 1WAYB 1BQYA 1L0ZA 3UY9A 3H5CB 1K1OA 3LGWA 4X2YA 2J4IA 2GV7A 2ZPSA 3LH1A 1K1NA 4KTSA 3VB3A 1YPLH 3Q3KA 2BTCE 1OP0A 1G3DA 1GJ8B 1W10U 3RXDA 4SGBE 2ALPA 3RXPA 4CR5A 1W13U 5EU8A 2J92A 2XBWA 1EX3A 1C1MA 5AHGH 1PPCE 1HNEE 3UPEA 3NKKA 5T6GA 2A0QB 1QIXB 5L30H 2JH0D 1GBTA 1TGSZ 1LO6A 1VCWA 2ZDMA 1YM0A 1P02A 2WPIS 4FUCA 3GY8A 1MU6B 2ASUB 3RP2A 1V2KT 1TMBH 3HGNA 5EQSA 1AB9C 1O3PB 3T62A 4Y8ZA 4AYYB 3O8CA 3E8LA 2D1JA 3SU1A 5T6FA 4A7IB 5JBAS 2QC2A 1T8OA 3RLWH 5FPTA 2HPQH 1PPHE 2AIPA 1BT7A 2BD8A 2ZG0H 4K5ZA 3V12A 1PJPA 4CRBA 3BTWE 3IITA 1A0LA 1TBQH 3FP6E 4AFQA 4CBNA 1GJ5H 3L33A 1BTUA 2H1UA 2ZU3A 1TRYA 4GLYA 1KXFA 1IQKA 5AFZH 1AWHB 1DFPA 5JB9S 3M5MA 4MPUA 1UK2A 1U6QA 3OY5U 1G3BA 1QL9A 4NA9H 2FZZA 2BOKA 3SV2H 4K69A 4MG3A 4ABAA 1DS2E 1GHZA 1ZLRA 3PO1C 1ZMNA 4K1EA 5EPYA 5T6DA 3SU2A 5L2ZH 3FZDA 2PUXB 4GHTA 1KLIH 1DDJA 1SGQE 1AY6H 1FXYA 1UTJA 4XBCA 4IS5A 1HJAB 1GBIA 2HNTC 2KAIA 1JMOH 4JZEH 4ZH8A 1D6WA 1HJ8A 1UJ1A 4OGXA 3ZZ9A 1GVLA 1D3QB 1ZGVA 1ESAA 3T25A 2VWNA 3DFLA 1EB1H 2FESH 2Y81A 4TWWA 4B1TA 1IOEA 1SGTA 2A2QH 2UWPA 4HFPB 5FPSA 2TIOA 4BAMB 4UDWH 4ABEA 3D62A 4I33A 2DE9A 1Z71A 3RXGA 2G00A 2TGAA 1P2OA 4JK6A 1O5EH 5BRRE 2V6NA 3MU5A 1ETRH 1JXPA 2BDGA 1ESTA 5K7RA 5F8TA 4CRAA 1P9SA 1C2JA 3DT0H 4BNRA 2FOHA 2ZQ1A 1C1NA 4E06H 1BHXF 4H6SB 2F91A 1HV7A 3LKWA 1S6FA 1NU9A 3K6YA 3RMNH 1XUKA 3QDZB 1IHTH 1P57B 5JBTA 5TCCA 3QZQA 1OYTH 1GBKA 4WY3A 1CGHA 1MZDA 1ZMLA 3B9FH 3F68H 1EOJA 1J17T 1MBQA 4JZ1A 1FY5A 4YLUA 3SGAE 4X6OA 5LGOA 2BDCA 1RIWC 3P92A 3SJ8A 3H7TA 1UTKA 4MQAA 1DLEA 1VITH 2A32A 3LDXH 1SR5C 3NUMA 1HPGA 3TJNA 3KNXA 4NA7A 4VGCC 4A5TS 1A3BH 3ZVAA 2SFAA 3TU7H 2BX4A 2AEIH 3MU0A 3LGTA 6LPRA 4X6PA 1A5IA 1V2PT 2VGCB 3SZNA 1EASA 1SI5H 3A84A 5GCHF 1PPGE 1G9IE 1MCTA 4U30A 3MYWA 1ELCA 3W95A 3EYDA 1L1GA 2UUFB 3P95A 4XBBA 1SHYA 2P8OB 3TH4H 1GJBB 3D49H 1CVWH 1GJDB 4I32A 3SV9A 3NCLA 1XKBC 4TY7A 2BY6X 1TA2A 1WYKA 1XMNB 3SNEA 5JDUB 2SGPE 2TGTA 3QGNB 1DSTA 1H8DH 2YNBA 4X8VH 1ESBA 2H5DA 1CO7E 1GVKB 2NWNA 2ZFRH 3ZVEA 5DP5A 1H1BA 5ESBA 1DT2A 2XXLA 2OC7A 4JCNA 1CBWB 1BA8B 2RDLA 4JZDH 2O8UA 3BTME 2VIDA 5K0HA 1P12E 1HAYB 1L1JA 2H9TH 1FY3A 1ARCA 1C5LH 4LOYH 1DSUA 1FJSA 3GY6A 1GHVH 1UVOA 4OS4A 5DG6A 3BN9A 3T29A 3S9CA 1OOKB 4UD9H 3M36A 1NU7B 4Y8YA 1IQEA 3A85A 2FO9A 1E35B 4D7FA 1G30B 2VGCC 3F9GA 3BF6H 1GCTB 3QZRA 3UQVA 2XCFA 4FUJA 1B7XB 2P3TB 3V13A 4ESTE 3DD2H 1AFQB 4RN6A 2P8OC 1Y5BT 1AVGH 1C9TA 1C5OH 1SFQB 4NWLA 1HDTH 3KQBA 2XYAA 3BSQA 1S81A 3VB4A 1JBUH 3I77A 4B71A 3Q76A 4DJZB 1KSNA 1IQLA 1P10A 2CJIA 5F6MA 2O8TA 4I7YH 2C90B 2PTCE 4GVUA 2EA3A 2CF8H 1NFWA 1ORFA 3LJJA 1P09A 4IN1A 2HLCA 1CBWC 4DCDA 4AFUA 1VCPA 1TQ7B 2BD4A 2OC1A 2RCEA 2BYAX 1O3DA 3IG6B 1EXFA 1JRSA 1XVOA 3TITA 1GBDA 2PKAB 1KLJH 2QIQA 2ZU5A 1J16A 3ZV8A 2BDIA 3H7OA 4YZUA 1MAXA 1TX6A 1V2RT 4ZHAA 1IQMA 3KEEA 2AMDA 1BDAA 4NZQA 2UWOA 2ZGXH 4TPIZ 4RKJB 2G55A 3C1KA 1DXWA 4WWYA 3GDSA 2OD3B 1VZQH 5A8XA 3T27A 3ZZ4A 5EQRA 5DK1A 4BAOB 1GBLA 3NK8A 3TIUA 2WV4A 1W0YH 2P95A 5EPNA 1DITH 1P03A 3RXFA 5FXLA 2VH0A 1Z6EA 5EOKA 5G4BA 2PHBA 4BTTB 1BTPA 2GD4B 4ZROA 3VGCB 4UFEH 3ZVCA 4UFFH 3BIUH 1BJVA 2C3SA 2A7HA 3MU1A 4X1SU 2R9PA 2VIVA 1QRWA 1W0ZU 3TJVA 3E1XB 1O2IA 4ABDA 4BANB 1JIRA 4K8BA 1SGNE 2QXHA 2R2MB 3RXIA 2SGFE 1MMJN 1ZSKA 3RC6A 2B8OH 5B6OA 2VIPA 1V2TT 1W2KH 3KL6A 1O3KA 3B23B 3D65E 5LPRA 5HM2A 4FUDA 4GPGA 3F9FA 1EOLA 2SNWA 1QJ1B 1P2KA 1K28D 1YPHE 1NESE 5C2ZA 2HOBA 3KHVA 2HGTH 4X2VA 1LPGB 2GZ8A 4ABIA 1LVMA 3E16B 3UWJH 3MH6A 1OP2A 2V3OH 5EXLA 2W26A 3BEIB 1P0SH 2ZI2H 1J14A 1HRTH 3S9BA 2V0BA 1Y3UA 1AI8H 3EGKH 2HVXA 2G4TA 1TPPA 3BEFB 1JWTA 2A45B 1P8VC 1FIZA 1GHYH 1OS8A 1EPTB 2C8WB 1GJ4H 1O2JA 4O3UA 1C5PA 4FUHA 2ZTXA 3SO3A 3K2UA 1GJCB 5FCRA 2TRMA 4I8KA 3SW2B 3GYLB 1YLDA 1VJ9U 4INKA 1QJ7B 3URCA 3FANA 2ANYA 3EBNA 4AX9H 1GBHA 1O3NA 3DA9B 3RXCA 4YOJA 1TMTH 3VFEA 1VITG 3CS7A 5FBEA 4CHAB 1NM6A 2ODQA 1EATA 5ABWA 1ABJH 3F9EA 1K9OE 2OP9A 1RXPA 4A1XA 5C1XA 2VVUA 5LH8A 4WMFA 2P16A 1KDQB 3QX5H 3T28A 2FOMB 2TPIZ 2PR3A 1AE5A 1O5CB 1TB6H 2ANMH 5DGJA 1ELVA 3A8CA 3SU0A 4UEHH 1IHSH 2GP9B 2XBXA 5C20A 2ZPQA 4D7GA 1KLTA 3UWIA 1NFUA 1W3CA 2WINI 1QJ6B 2BOHB 1MD8A 1AN1E 3VEQB 2ZNKH 6ESTA 3Q00A 1F7ZA 1K2I1 4SGAE 1MCVA 1Z6JH 4FU9A 2PGBB 3BTDE 3A7ZA 1YKTA 3GY7A 4GHQA 1MTNC 1IQNA 2BY7X 1SL3A 1TIOA 2A7JA 3A80A 1V2QT 3BTGE 3SORA 2H9HA 4D8NA 2ESTE 1O38A 1GI6A 2ZO3H 3BTEE 5L2YH 1AFEH 3KQEA 3SHCH 5BPEA 4YM9A 1T8MA 2GCHF 4ISOA 1VJAU 3ZZ8A 1YCPK 1S6HA 5JBBS 5DP7A 2UUJB 1C5VA 4WMEA 1G2MA 4I8HA 4WJG2 2FXRA 2XC0A 1GGDB 2W7SA 5C3NA 1EAIA 3SOSA 1FDPA 1BMLA 3HPTB 4TYDA 1HBTH 1G36A 2JKHA 2FMJA 1MTUA 1TQ0B 1O3MA 1INCA 1YP9A 1CT0E 1GDQA 3ATWA 3MMGA 1TNJA 3ZV9A 5A09A 5SGAE 8KME2 3SV7A 2XBVA 3QWCH 1ZPCA 5JBCS 2DUCA 3TGJE 2WPHS 5J4SA 1FNIA 2TGPZ 1UCYK 3GY4A 1P3CA 1HCGA 1HXFH 1MKXK 2CV3A 7KMEH 3MOCA 1O5AB 4NZLA 3ODDA 3M61U 2H5CA 4HI3A 1H9IE 1NFXA 2LNCA 3SI4H 1Z8GA 2ZFTA 1TAWA 1QA7A 1XUFA 1OWIA 3MNSA 2J9NA 1LQDB 1SGIB 4JYVH 3ZZBA 1S5SA 4TPYA 1ARBA 2F3CE 1A1RA 1KTSB 4B2AA 2BZAA 1AU8A 3GCTF 2W7UA 4WXVA 4MTBA 3SJKA 7GCHF 4MPVA 1FLEE 3A87A 3MU4A 1TBZH 2FM2A 1GJAB 4INHA 1MTWA 1A46H 1DVAH 2Z3DA 4F49A 3Q77A 1O2LA 3T26A 2ZCHP 2FI5E 3RXKA 4TWYA 2OCVB 3SV8A 1EAWA 3AW0A 1BJUA 3BG4B 3AW1A 1WU1A 3PLPA 1O2YA 1GBJA 1A0JA 1C2MA 1HAIH 3TK9A 1NRRH 2VWMA 2ZTYA 2WUBA 2BY8X 2CHAC 2BMGB 1GI8B 1FY4A 1O32A 4IN2A 3QTVH 4F4OC 1GG6B 1C5NH 2F9BH 1G3EA 2BY5X 1OSSA 4X6NA 1WQSA 2BY9X 1EAXA 2V3HH 2WPKS 4AGKA 1LHCH 1P2MA 1G2LA 1BBRK 3TK5A 3C27B 2R3UA 1GBFA 1UTLM 4I31A 4ISIH 4AFSA 1NRQH 2Q6DA 2JH5D 1F5LA 1C2LA 3OY6U 1OYQA 4JK5A 3SV6A 4H4FA 2Z6BD 1FONA 2J95A 3MTYA 1TRNA 3HK3B 4K2YA 1CQQA 1NTPA 3GY3A 3UREA 1Y5AT 1FAKH 3K6ZA 1C5TA 3LH3A 4NG9H 1EAUA 3STIA 5DPAA 1BRBE 4MNWA 1GMHG 1D9IA 3F6UH 2D2DA 3PMAB 3UOPA 4KTCA 1BB0B 1BITA 4H42U 3RMLH 1OWDA 2VH6A 4Q80A 1C1TA 1C4V2 2QXGA 2ZF0H 1C4Y2 2WYJA 2GCHG 1W8BH 5AFYH 1T4UH 2FTLE 1O3CA 2GCTB 1IQIA 4DT7B 2IJOB 3ZVBA 1SHHB 2AYWA 1VGCB 2BDAA 3M7UA 4WH8A 1EZQA 4CRDA 5E0JA 2O8MA 4HZHA 1O34A 1W7GH 1LKBA 1WV7H 3P17H 1DE7H 1UTQA 5E2PA 2NU0E 2F9NA 4FXGH 1K1LA 1UVSH 4DOQA 3TLOA 3SNBA 1WTGH 4K3JA 4X8UH 3ITIA 2ZHQH 1P2JA 5GIBA 1TOMH 3TPIZ 3AAVA 4XOJA 4WF8A 1F2SE 1Z7KA 1L4ZA 4BAKB 1O3FA 2ANWA 9LPRA 3VB7A 3U9AH 2Y5HA 2HNTE 1BRCE 4DVAU 3VPKA 4GCHG 3KGPA 5CHAB 5JYIA 2AS9A 1ZHPA 1T7CA