2SGFE

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
b'ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE01
1SC8U 2PSXA 4Y8YA 3TH2H 3PLKA 3P8OA 4DGJA 1TGSZ 2BQ6B 3MI4A 4K69A 3TK5A 3QZRA 4XDEA 4ISHH 3V12A 3SI3H 4YOIA 7GCHF 2ZPSA 1O2IA 1O3EA 3KGPA 2XC5A 4CRBA 1O3OA 4ZUHA 3QLPH 4ISLA 1THPB 1O2QA 2BMGB 1K22H 1GCDA 4DURA 1A3BH 1EJNA 8GCHG 4SGAE 1TPPA 2LPRA 3FP8E 3LGYA 2BYAX 1LQDB 1A46H 2VIWA 1AWFH 1G3BA 1ZSKA 1TWXB 1O35A 3M3SA 2FI5E 2Z9LA 5F03A 2ZPRA 3QWCH 5GCHG 4UDWH 1O3GA 4I8HA 1GBIA 1O3IA 4A5TS 4O03A 1P57B 1Z8GA 3GCNA 2Y82A 1A5GH 1YPJH 5DP5A 2AGGX 2UUJB 1DY8A 4A6LA 1FXYA 1S81A 1XKAC 1J17T 1NU9A 3RXRA 5L2ZH 3SUEA 4X6NA 1EB2A 1NT1A 1QHRB 1DX5M 1NPMA 1YLDA 2ODQA 4IW4E 4LK4A 1B5GH 5EXMA 3HATH 3MNCA 3NKKA 4MPVA 1BRBE 1EUFA 2WPMS 1NRRH 1UTKA 2OXSA 1UVOA 4ZAEA 1C2FA 2Y5FA 2VIQA 3U69H 4K60A 5C1YA 3ZZ6A 3BG4C 1W7XH 3MH7A 1C5XB 1UHBA 1RGQA 3SO3A 1SLVB 3PO1B 2FX6A 2VWNA 2FEQH 2ZCHP 1G37A 1AE5A 4ZHMU 3OU0A 1W13U 3LGUA 1W7GH 1LDTT 1S82A 1AFQB 1ELCA 2H5CA 1O5AB 2ZU2A 4IN2A 1INCA 1XUHA 1AO5A 1VGCB 2FOMB 1O30A 2W26A 1RIWC 3HPTB 1W11U 4BAOB 3S7KB 4I8KA 4IBLH 1OWKA 1CA8B 1TIOA 1VZQH 3MYWA 3DA9B 1BTZA 2QAAA 3S7HB 3BG8A 1GHZA 3PWBA 2VIDA 2ZFRH 3GDUA 3ENSB 3QO6A 2F91A 2JETC 3ATIA 1BCUH 1C1TA 2GP9B 3EA9A 3SUFA 2AEIH 1TNJA 5FPYA 3V0XA 3SI4H 3EDXB 1SGQE 1MBQA 1W3CA 1YF4A 1BBRE 1Y3UA 3K9XB 1C1UH 5DK1A 3ITIA 4JZFH 4YOGA 3SBKA 1C1NA 5ABWA 1VCPA 2BVSH 1L4DA 2R2MB 2Z3DA 1O3MA 1W0YH 1PPHE 1ELDE 3BTTE 4ZMAH 1EP5A 2GTBA 3UFAA 2FOCA 3GOVB 3MTYA 1Y3YA 4E06H 4YTAA 4AN7A 1C9PA 3MOCA 1ZMLA 3UREA 2FDAA 3RU4D 4AFSA 4AFQA 1O2OA 3ZVFA 1FAKH 2FTMA 3HKJB 1P11E 1GI9B 4TYDA 3S9BA 3KCGH 2OP9A 3PM3A 3VFEA 3GYMA 1P2KA 1QL9A 1Z8RA 2Q6DA 2F9OA 1MD8A 2A7JA 5FXLA 2A4OA 3ZZ7A 3S9CA 2HOBA 4J2YB 1CGIE 3GY5A 1RFNA 1NESE 4D9RA 3VB3A 3SU5A 2V3HH 2AIQA 1UK2A 4AG2A 4X6PA 3A8DA 3FVFB 1OS8A 1ELBA 3EAJA 4GCHG 3SU2A 2SNWA 4NGAH 1BBRH 3C27B 1GBJA 3OY5U 1RJXB 5T6GA 4AG1A 3BEFB 2BOKA 5EQQA 4K8YA 2OC8A 2JH0D 1EAWA 1QR3E 3M5OA 5CHAB 2RA0A 3RLWH 1W10U 3GYLB 3K65B 1DM4B 1NY22 2ZCLP 3E90B 1Y8TA 2H6MA 1TPAE 2BD7A 2J94A 2OC1A 4NA7A 3TJUA 1GCTC 5FX6A 1O2WA 2I6QA 2BDGA 1EZXC 2ZHWH 3LGWA 1TONA 2AIPA 4BTUB 2UWOA 3MFJA 1YPEH 3GY4A 3F1SB 5C5OA 2H9TH 1O3LA 3E91A 4AFUA 3SNDA 1K1NA 5HM2A 1ELAA 1GBDA 1CA0C 2PUXB 4MNXA 3URDA 5BRRE 3ZZ9A 1PQAA 1H4WA 1CHGA 1KIGH 1BJVA 2FYRA 1F5LA 1A61H 3A80A 4GHQA 3SNBA 1UO6A 3KQCA 1LVYA 1S84A 3LH1A 2FX4A 5DP3A 2G4UA 4WF8A 4XOJA 4AYYB 3B23B 1S6FA 2ZGXH 4H42U 2PWXA 3PO1C 1TBZH 3A87A 2ULLA 2B7DH 2BD8A 1NFYA 3MNSA 1KDQA 2ZC9H 3SORA 4IMZA 4I32A 1J15A 3HKIB 4FVBA 2HALA 2PGQB 2BXTH 3D49H 1AFQC 2F3CE 2BZ6H 4I8JA 1K1LA 3TH3H 5C67A 1GI2A 1LMWB 1BIOA 3UPEA 3P92A 2HNTF 4X1RU 4WMFA 3D65E 2ZZUH 3M7UA 1VGCC 1FY5A 4TY6A 1PFXC 1A5IA 1SR5C 1Y5AT 4Y76A 3SOSA 5FAHA 1TLDA 1O3FA 1SLUB 3U1JB 4GPGA 1T8OA 3SHCH 1CVWH 5J4QA 3MNXA 3PROA 2W3IA 5JB9S 1GBBA 5JBCS 2NU4E 2OINA 2V0BA 4NFFA 5DP8A 2CN0H 1EAUA 4UD9H 3RC4A 4FUHA 2BDIA 4ZKRU 2I6SA 1ESTA 3MH5A 2F9UA 1HAXB 5EG4A 1HAZB 2XNIA 2AYWA 5ETXA 4K3JA 3MO3A 1PPFE 5L6NH 1CGHA 1IQFA 1MCVA 1QURH 2Y80A 2OQ5A 3R0FA 4E05H 1GMDF 1P3EA 1JRSA 4WVPE 2GCTB 1NRPH 4B2AA 5EQRA 1SB1H 2O8UA 1O2GH 3VXFH 3E1XB 1DXPA 3GICB 4OS1A 5J4SA 1QB9A 3LPRA 1SGFG 1UCYE 2A7HA 5IDKA 3ZYDA 2ZF0H 3F6UH 1IQLA 1OYTH 1ZPCA 4JCNA 2B9LA 2OBQA 1O37A 4ESTE 5A0AE 1MQ5A 2ZEBA 4GUXA 3C1KA 3LT3A 4WWYA 4O3TA 2ZDKA 3TK9A 4DT7B 2IPHA 3SNCA 1C5MD 2XBYA 1QRWA 2VVUA 2BD5A 2BLWA 1GG6B 5GIBA 1AI8H 2G52A 4NFEA 1GJ9B 1HIAB 2CF8H 1AB9B 3E0PB 1ORFA 5TCCA 4GHTA 2UUFB 3RXUA 3TGKE 1ZZZA 2B8OH 2PKSB 4ZH8A 1LHDH 1IOEA 1LVOA 1MKXH 1SHHB 2ZFPH 1GMHG 1K9OE 1Y3WA 2ZU1A 4ABFA 4FVDA 2WPJS 1WYKA 3T29A 1GHBG 1KTSB 3HK3B 5AVDA 4B75A 9LPRA 1KYNA 1DDJA 4K2YA 2P95A 5F8TA 1UCYH 4JK5A 4I8LA 2BLQA 1GI5A 2A5KA 1JIRA 4JZ1A 4XSKU 3SJ9A 2OCVB 2J9NA 1AQ7A 1GBTA 2TGPZ 1F5RA 4HTCH 1V2LT 1V2UT 1P8VC 1O2SA 2ZECA 2ZP0H 1GJ8B 4ZKSU 2HGTH 1YBWA 2VNTA 1QY6A 2TPIZ 3QTVH 4U2WA 2EC9H 1SFQB 1OSSA 3LJOA 1O36A 3A81A 2K1QA 1ZGIA 1TMTH 5AHGH 1Z71A 4X8UH 1O5FH 1FUJA 1SVPA 2A4GA 2ZDAH 5DPAA 5EW2H 2Y7ZA 1KTTB 1JBUH 2XC0A 4BXWA 4AGJA 4DIIH 3NZIA 1LVMA 4RKOB 1QNJA 1JXPA 3M35A 5A8ZA 3VEQB 3SGBE 3VGCC 4MLFB 2VIVA 2H5DA 4IC5A 5TCAA 1BA8B 4JZDH 3RC5A 1K1IA 6CHAB 2G4TA 1BZXE 2BDBA 3PV4A 3RMNH 4ABAA 4D7FA 2P16A 2GCHG 1GMCF 1C1WH 2V35A 3GY8A 7ESTE 2GZ9A 1XKBC 1XUFA 4TPIZ 3SUDA 3SU0A 4F49A 1O3JA 1CQQA 1C4Y2 2FESH 3SJOA 2FMJA 1E37B 1HJ8A 1PPBH 4FUEA 2QXIA 1H8DH 2P3UB 1ETTH 5FPTA 1UHBB 3M36A 1QJ1B 3ATWA 1O2PA 3BTKE 2BY5X 4CBOA 1V2MT 2QN5T 3W94A 2GD4B 3RXLA 2ZU5A 8LPRA 3E8LA 1UTPA 3TU7H 1E0FD 2BY6X 1D3TB 2GCHF 4XE4A 2FOFA 4NSVA 1Q31A 3QDZB 1XVMA 2CGAA 1A7SA 4O97A 1IQKA 3Q3YA 1IQJA 2HPQH 2VJ1A 1YCPH 2LNCA 2ANYA 2ZQ2A 2GCTC 4CRAA 1GHYH 1G2MA 1NRSH 1K1MA 3UIRA 1BMMH 5GWZA 1H8IH 4INLA 1DUEA 3F9EA 2ZO3H 1UMAH 4KTUA 1OP8A 1C5YB 1QQ4A 1AVWA 2D8WA 1DXWA 3RMLH 4NA9H 5DP7A 2ZWLH 2FI3E 1BRAA 1O2UA 3CS7A 2UUKB 1WQSA 4NCYA 4CRCA 1TNGA 3O8BA 1HCGA 5EPYA 1TYNA 5JPMH 1CBWC 1FZZA 2TIOA 3AAUA 1V2VT 2ZDVH 2O8WA 3TGJE 4KKDA 4A1VA 2ZU4A 1GG6C 4X8TH 1C5VA 3BIVH 3QX5H 5E0GA 1S5SA 3S69A 3K6YA 4B71A 7GCHG 1DPOA 3OY6U 1SGDE 5BPEA 3V13A 2PKSC 1EJAA 1TBQH 2Q1JA 1ETRH 4TPYA 1IQGA 1HB0B 1FPCH 4Q7ZA 1TNLA 3SZNA 1D3QB 1H1BA 4HI3A 2C93B 4AYVB 3SQEE 3EYDA 2SGAA 1SBWA 1HAPH 3AVZA 4Q7YA 3UUZA 3FAOA 3M3VA 2VU8E 2ZPQA 1ZRKA 1BBRK 1YPGH 3O8RA 3M3TA 3QZQA 4RN6A 4AB8A 1NS3A 4JK6A 2AMDA 3SV2H 4K1TA 4NZQA 1IAUA 1AWHB 1ZJKA 1GJ5H 2XTTB 2ZHEH 2C90B 1GBAA 3TNTA 4Y8ZA 3L33A 1O3BA 2XWAA 3UNSA 2GT7A 1MTVA 5C1UA 1GHAF 1HUTH 1O2ZA 3M61U 1P2OA 2J95A 3L6PA 1GCTB 4ABBA 4B73A 1UTMA 2ZTZA 1RTFB 2ZGJA 1KY9A 4A7IB 2IN2A 3EA8A 3SU6A 3BTME 1V2RT 1PJPA 4Z0KA 1ARBA 2XCNA 1Y59T 1PQ8A 3TIUA 1ZMNA 1CA0B 5A2MH 2CHAC 1NM6A 1ABJH 2J38A 1DWEH 2XBVA 1DITH 2PSYA 1L2EA 6CHAC 3SUGA 1UTJA 2Y5GA 2PHBA 1YGCH 4ABEA 3U9AH 4Q2KA 4DIHH 2PFEA 4JYTA 2BD2A 1NC6A 5TJXA 2ZKSA 1TPSA 5DP6A 1MMJN 4DY7B 1YLCA 1HRTH 1PYTC 2H9HA 2BDYA 1A2CH 2UWPA 1M9UA 1P2QA 2ZIQH 1CO7E 1O34A 1QJ6B 2CV3A 4UFEH 1PPGE 5JBAS 4MNYA 1T8LA 3RXAA 3KHVA 1GHWH 3QK1A 2ZTXA 1YC0A 1T8NA 1KXEA 3PTNA 6ESTA 1C5TA 1FAXA 1S83A 2OLGA 1QTFA 2BVRH 1DFPA 2BDHA 1GJ4H 1KDQB 3TVJB 3MHWU 4OS5A 1HXFH 1NROH 1DWBH 1GDUA 1TRNA 2EA3A 4AORA 4DG4A 4PROA 3QTOH 4Y11E 1VITF 4AZ2B 1J16A 4B2CA 1BTXA 4BTTB 2CMYA 2Z9KA 3UWJH 1JOUB 3DFLA 1O38A 2VWLA 3MO9A 2P3FH 1AMHA 1CHOF 2GT8A 1OOKB 2WPKS 1O3AA 4GLYA 4IS5A 2HPPH 4UFFH 4YOJA 1SLWB 1OWJA 4XFQA 1BTUA 4MG3A 4MNWA 1P2MA 2ZTYA 3DUXH 1P04A 3NK8A 3RMMH 5EW1H 3T28A 4BANB 4DW2U 4JZIA 3SV7A 3ZZBA 1F5KU 1FV9A 3H5CB 1CU1A 3KIDU 4QT8C 2FO9A 1S6HA 4X8SH 5JBTA 1LHEH 1ZLRA 2PLXA 4WMDA 2WYJA 3BTGE 4X2VA 2UWLA 3M37A 3SV9A 2D2DA 1KLTA 1GBEA 4R0IA 1KXAA 2CXVA 2XC4A 3LDXH 1ELGA 2ZGHA 1BTPA 3L3TA 2P93A 3T27A 5AF9H 1TA6A 4WMEA 2BX3A 1ZYOA 1IQEA 4FUDA 1Z8JB 2BDAA 1MTUA 1BB0B 1GJBB 3A7XA 3BTWE 3P8FA 1V2PT 3UQOA 2WUCA 5JBBS 1V3XA 4H4FA 4UE7H 3F9FA 2HNTC 5G4BA 1ELEE 4I8GA 1BJUA 1LPKB 1EOLA 1FY3A 1A5HA 1K1JA 1SOZA 3ATKA 1TGCA 1WTHD 4LZ4B 1O2RA 3A8AA 1IHTH 1TA2A 2A1DB 2ZDNA 1E34B 1ZHMA 3ZZ5A 4FUJA 1C2EA 2QYIA 2PV9B 2ANKH 1UTOA 3PMHB 3B9FH 2Z3EA 3U8OH 1C1PA 2ZHFH 1SLXB 4OS6A 1FIZA 3A8CA 1V2NT 4UFDH 1QCPA 1C5RA 3GCTG 1SGEE 4IGDA 3PMJA 1LHGH 1S0RA 3A85A 1Z8IB 3BN9A 3MU8A 3ODDA 1U6QA 3PLPA 3RLYH 2W7UA 2FS8A 3A82A 5DG6A 1SHYA 1DS2E 4XBBA 1CGJE 1XX9A 4NG9H 5EOKA 2VINA 2AGIX 3RXHA 2FIRH 2FS9A 3IWMA 1DSUA 1DE7H 3RXOA 3GCTF 3KQEA 3A7ZA 1C1RA 1MH0A 1FN8A 3KNXA 3LU9B 4J1YA 5LPFA 4D7GA 3NCLA 1GVZA 1SGRE 3ZVEA 1CT0E 3PB1E 1GHXH 1EAIA 5T3HA 1HXEH 1LO6A 4INKA 1GBHA 3VGCB 4WJG2 4ASHA 5B6OA 2STBE 1GI3A 4TWYA 2A4RA 1GHVH 1NFWA 1AU8A 4WH6A 2ZGBH 4LXBH 1C5UA 2HLCA 1D6WA 1B0EA 1ELFA 3K2UA 4YM9A 1G32B 3AAVA 3ZZCA 3E3TA 5E0HA 1SFIA 1V2JT 1A0LA 2ODPA 1GMDG 1Z6JH 3UTUH 1TOCB 3KF2A 4U01A 1UTQA 4B74A 1VR1H 2PTCE 2R9PA 2FPZA 2FP7B 3M7TA 1BDAA 2Y81A 2ANWA 3QN7A 2SGDE 1LHFH 4BAQB 2J4IA 1HAOH 1TNKA 1ZTLA 2YNAA 5C20A 3LC5A 1AZZA 1O5CB 2GV7A 5A8XA 1PQ7A 3KQBA 2XW9A 3A7TA 4FU7A 2XWBI 1P03A 1ANCA 2FZZA 4NIVA 5E2PA 2EI8A 4KELA 2BD4A 1WU1A 3O8DA 5EPNA 1GDNA 1QQUA 1C2HA 1QA7A 2XBXA 4H6TA 2BLOA 1K1OA 1TOMH 1ABIH 2FXRA 2W3KA 4BAHB 2SGFE 3A88A 1P05A 4WXVA 5E8EH 4AGKA 1ARCA 1CSOE 3IITA 3I77A 2VIOA 3UOPA 1HLTH 2IJOB 3MU0A 3RDZA 1CBWB 1TALA 1C5LH 1ETSH 1Y3VA 1ZJDA 2G5VA 4XBDA 1Q2WA 3BTFE 1BMNH 1C1QA 2ZG0H 3FP7E 3K6ZA 3RXIA 1AVGH 1ZTJA 5DKMA 3PLBA 1P9SA 1F0RA 4VGCC 4HGCA 2HRVA 4ZHLU 1FDPA 3ZVCA 1UVTH 1SGIB 1WTGH 3BIUH 3H7OA 5FBIA 4ABJA 1TRYA 2STAE 1G36A 1DSTA 1H9LB 2RA3A 4DCDA 1EPTB 1MZAA 1XUJA 2ESTE 4K8BA 3LH3A 1HAHH 1V6DA 2JKHA 2C8WB 1QGFA 4OS7A 1J9CH 3F68H 4FUIA 1SQOA 1F0TA 3AW0A 3B8JA 3GY7A 1EXFA 3EE0B 2GMTB 2QXGA 4GAWA 3WY8A 1IHSH 3LC3A 1RS0A 3RXBA 1O5GH 3TJVA 1PQ5A 1QA0A 4U30A 4CRGA 3F9GA 1GBMA 1TGTA 2BHGA 1MQ6A 1GMCG 1E35B 1Z7KA 3V3MA 1T31A 4Y7AA 4TWWA 3RXPA 1UVSH 1SOTA 3ZYEA 4NA8A 1O39A 5FCRA 4OS2A 1SQTA 3ZV9A 2ZFTA 4I7YH 2A2XH 3QUMP 5DGJA 1QJ7B 1WCZA 1AKSA 1C2DA 1GVKB 1FY1A 1TGBA 1K1PA 3MWIU 3T25A 2CF9H 2CHAB 1WSSH 1BMLA 3IG6B 4BTIB 1AGJA 1F2SE 1KXDA 2C3SA 1GBKA 1MTNB 1WV7H 1ZSLA 2EI6A 2VIPA 1G3DA 3SHAH 2FI4E 1TMUH 1IQNA 2QC2A 4KTCA 5DJ7A 1HDTH 2GV6A 3MU5A 1UVPA 1GL0E 1FJSA 1HFDA 2Z9JA 1LCYA 1L1GA 3BEIB 1ZMJA 2ZFFH 1HAYB 2ZNKH 5ESBA 2BQWB 1QB6A 5JB8S 2BQ7B 1EZQA 1MD7A 2GKVE 3ODFA 1V2TT 3GY2A 2Z9IA 1QRZA 2J92A 1THSH 3H7TA 1F92A 1QFKH 4ABHA 8ESTE 1LVBA 1AIXH 2TBSA 3LGVA 3ZZ3A 1P10A 2R3UA 5LGOA 2PKAA 1HBTH 1A1RA 1F7ZA 4ZXYH 3M7QA 4F4OC 3P8NA 3TK6A 1EQ9A 1MKWH 2ZDMA 1AVXA 2Y5HA 1ZHRA 2C4FH 2VH0A 1J14A 2VGCB 1EKBB 4M7GA 3LOXA 5K7RA 1C4U2 3UR9A 3ATLA 4B2BA 1OP0A 3P70B 3VB6A 1D6RA 1UVUH 1YPMH 5L2YH 2BY9X 4X0WU 4FU9A 1ACBE 1C5PA 3MH6A 5A0CA 3KQDA 1DANH 1MUEB 2PTNA 2GDEH 1NTPA 1DUAA 3STIA 3O8CA 1ANBA 2M5TA 1C5QA 1JMOH 1K2I1 1VITH 4MPUA 1GI4A 1BHXF 1BTHH 1C9TA 1O5BB 3GISB 1BOQA 4X1SU 1ZGVA 2G8TA 5JYIA 1BRCE 1T8MA 1HYLA 1V2WT 3TJOA 4NIXA 2HWLB 1EPTA 1BMAA 2A0QB 3ELAH 1EP6A 2XXLA 2KAIA 3T26A 2G55A 4D76A 2A5IA 4ISNA 1AD8H 4IC6A 1HAVA 3BV9B 1GJ6A 1O31A 2GDDA 1GHAG 3BTDE 1F0UA 1KXBA 1AZ8A 1GI6A 1EPTC 1Z1JA 4LOYH 2H2ZA 3NWUA 1CE5A 3JZ1B 4X2WA 3SJIA 1ZOMA 2SNVA 1BTYA 2FWWA 1G3CA 1ZR0A 3RXCA 2AMQA 2SFAA 2QY0B 4AOQA 4E7NA 1ELVA 1O2NA 3D23A 1RXPA 4YZUA 1GGDB 4XBCA 5I46H 2ZA5A 2GMTC 4TY7A 1HJAB 1EOJA 1FONA 1YPLH 3A86A 1G2LA 3ZVGA 2THFB 3ZZAA 1S0QA 2C8XB 3BEUA 2SGQE 1SGTA 3Q3KA 4AX9H 1GI8B 1AUTC 5A09A 3A83A 2ALPA 1T7CA 4B1TA 1DT2A 4BAMB 4MQAA 1GBFA 3BTEE 4I33A 1A3EH 1FY8E 1PYTD 1Z1IA 2PUQH 4BNRA 1E36B 1MU8B 4O9VA 3E6PH 3UQVA 5E2OA 2OC7A 1UJ1A 4NWLA 1KXCA 1EASA 4D9QA 2F9VA 1O2MA 2GX4A 1YYY1 1OWEA 4OGXA 4UFGH 1DLEA 2BY7X 1OKXA 1N6YA 5PTPA 3NUMA 3UOUA 2VH6A 2P3TB 3SNEA 1MTNC 1VJAU 2XRCA 5F6MA 4K1SA 3DD2H 2B5TB 1P01A 3TPIZ 4A92A 4CRDA 2NU1E 1UK4A 3FZZA 3HK6B 3SU4A 4X8VH 2A4QA 5IYTA 6LPRA 4MVNA 1VITG 4ZROA 4CHAB 1W8BH 1ZTKA 4NZLA 2ZFSA 2HNTE 1HAGE 3Q00A 5E0JA 5L30H 1TRMA 4YESB 5ESTE 2SGPE 3S9AA 5FBEA 4YLUA 1CHOG 2BOHB 1P2NA 4X1NU 3STJA 8GCHF 4LZ1H 3ZVDA 4KP0A 2GVFA 1LKBA 2AMPA 3FFGA 2ODYB 4ABIA 4NIYA 1YKTA 1CT4E 1DY9A 5F8XA 2FOAA 3SU1A 1NO9H 4AB9A 1W2KH 1FIWA 1O3PB 2CJIA 1SL3A 4INHA 3RM2H 5DP9A 3UNQA 5GCHF 1YPHC 3RXSA 1RTLA 1Y3XA 2ZQ1A 1G30B 4U32A 1P3CA 1Y5BT 3RU4E 4FUCA 3ZVAA 5DO4H 1PPEE 1SGNE 2VB0A 5T6DA 2Z6BD 1O3HA 2BVXH 1XUKA 2OUAA 4X6OA 4FUBA 1OYQA 3ATMA 3MMGA 3VB7A 4ABDA 2QIQA 4B76A 1GPZA 1L1NA 3SV8A 1ANDA 1DOJA 1C2MA 2Y6TA 4ISIH 1N8OB 1YP9A 2A31A 1KLIH 1F0SA 4GVUA 1S85A 2R2WU 2VGCC 1L1JA 3U98H 3E0NB 3GCHB 3HGNA 1WUNH 3DT0H 1ANEA 2JH5D 3SJKA 1D4PB 2ZHQH 3SV6A 1OWDA 1O3NA 1HV7A 1P06A 1FLEE 2WV5A 1O5DH 1ZSJA 1DLKB 3MU1A 1NFUA 1TNIA 1XXFA 3RP2A 3GCOA 2PR3A 1GJCB 3I29A 1BITA 1SG8B 1QRXA 3M5LA 3RM0H 1GVLA 1GJAB 2TGTA 3MNBA 3EA7A 3V7TA 4IMQA 2FOEA 3SQHE 1OX1A 2Z3CA 3QGJA 2XYAA 2ZU3A 2Z7FE 4X2YA 1GJ7B 2DE9A 3A7WA 2HVXA 1K21H 3TLOA 1MTWA 2BY8X 4DOQA 3BTQE 4MPWA 1EAXA 2AERH 2EI7A 1KSNA 2PGBB 2A5AA 5SGAE 1TQ7B 1XMNB 4FUFA 1O3CA 2IOTA 1C1VH 1GBLA 2RDLA 4KTSA 5LPEA 4UONA 2P59A 3AASA 1FQ3A 2W5EA 4KGAA 3UY9A 1GGDC 4ZKNU 2A32A 4ZKOU 4VGCB 1VCWA 1XUGA 2QXHA 1HJAC 3P8GA 3DFJA 1JIMA 1N1LA 1QL7A 1MKXK 1TQ0B 3U8TH 3GY6A 3Q76A 1UTLM 1QB1A 2FODA 2D26C 1NRNH 3A84A 1C1OA 1O2JA 1MCTA 1UCYK 3SU3A 1DICA 1DWCH 1OXGA 2P8OB 2Q6FA 3RXQA 2ZGCA 3RXTA 1AN1E 2JH6D 1MZDA 4SGBE 1LPZB 1MBMA 1B7XB 3AW1A 7KMEH 2ANMH 1GL1A 5H4IB 1ESBA 1C5OH 2C8YB 5T6FA 1G3EA 3UWIA 1RTKA 1UK3A 4FUGA 3MH4A 1EATA 1J8AA 2YOLA 4RKJB 1TMBH 1XUIA 3LJJA 4X1PU 1LHCH 1QBNA 4GCHF 3JZ2B 3RC6A 3TGIE 1OWIA 1O2LA 3EGKH 4R8TB 1UTNA 3R3GB 2F9NA 1ZPZA 2F83A 3ZZ4A 4DJZB 4CHAC 1P2JA 1DWDH 3TITA 2O9QA 2BB4A 1EZUC 2AFQB 1TE0A 2BD9A 1TNHA 4Y79A 2OD3B 2AH4X 1XVOA 2VWMA 1X7AC 3VPKA 1D9IA 2R3YA 3G01A 1FN6A 2FTLE 1LPGB 3PTBA 4Q7XA 4Y6DA 1SI5H 2WPLS 1SGCA 1AFEH 1AKSB 2OBOA 3RMOH 2G81E 1P12E 4YLQH 1LQEA 2FLBH 1O5EH 5EU8A 2TGDA 3KEEA 1BHXB 3CS0A 1O32A 1P0SH 1DVAH 2QA9E 5AFZH 5GPIB 1O2VA 1PPCE 1JWTA 2ZCKP 1NFXA 3SJ8A 1GI7B 1MTSA 1TX6A 4MNVA 4ABGA 1IQIA 2UUYA 3BSQA 4CREA 1C5WB 1GI0A 3I78A 1ZRBA 1SGFA 1N8OC 3UNRA 1SSXA 2O8TA 4Q80A 1IQMA 5FPSA 2BDCA 2AGEX 1AHTH 1C5ZB 3GCHC 3T62A 1N6XA 3CENA 1O0DH 4Y0YE 2RG3A 4NWKA 1Y5UT 4JMYA 3RXVA 5EXNA 3OTJE 4FXGH 3MU4A 4YT6H 2VWOA 3A7VA 3PMAB 1YCPK 4ZXXH 5C3NA 1KLJH 5FHTA 2Z9GA 1TBRH 3E16B 3RXDA 2WV4A 1A0HB 1MKWK 1C2LA 1ELTA 1E38B 1K28D 1QBOA 3SN8A 3NXPA 5FX5A 2PKAB 4MTBA 1C2GA 1TABE 3SGAE 1QL8A 1T4UH 3FANA 3TNSA 1WQVH 5A8YA 5C1XA 2WINI 3RXGA 2SGEE 3OSYA 3OYPA 3RXKA 4CBNA 3N7OA 3BTHE 3A7YA 1L0ZA 1AUJA 1EZSC 5EXLA 3URCA 2VVVA 3ZZ8A 3HGPA 3VB4A 1LTOA 2FOGA 2R0LA 1BUIA 4Y8XA 2WUBA 1NN6A 1OWHA 1C1MA 1TGNA 2XCFA 2D1JA 2DE8A 1IQHA 2Q6GA 1YPKH 1ESAA 2O8MA 2BZAA 3RXJA 3GDVA 5GDSH 3CP7A 2WPHS 2FM2A 2NU0E 4HZHA 3GY3A 1C1SA 1SMFE 3LKWA 1FPHH 1QIXB 3RU4T 2G5NA 1C2JA 3FP6E 2ZFQH 1T32A 1W14U 2AS9A 1FMGA 1A4WH 1SQAA 4MPXA 5GJ4B 3KN2A 4X2XA 2BLVA 1SGYE 3RXFA 2ALVA 2KAIB 1D3PB 1FNIA 1XXDA 6GCHG 1HPGA 3A8BA 2ASUB 1O2HA 3PWCA 5CHAC 1V2KT 4WY3A 2P8OC 1HAVB 3D62A 5FCKA 2J34A 1P02A 2H9EH 3S0NA 1GI1A 1LKAA 1AY6H 2ZI2H 1V2QT 1SPJA 2A7CA 2PW8H 1EB1H 2FLRH 3SW2B 9ESTA 1W12U 4Y71A 2OQUA 4X6MA 4Y10E 1TB6H 1RD3B 2QGRA 5DP4A 4BAKB 1EX3A 1SGPE 4ZHAA 4OGYA 1NRQH 3U8RH 2OTVA 2BTCE 3LGIA 4IN1A 1W0ZU 5HXFA 1BRUP 2V3OH 2QF0A 6GCHF 3VXEH 2C8ZB 5CMXH 1PPZA 2W7SA 2GZ7A 1C2IA 4K5ZA 1NU7B 1P9UA 1TX8A 3RXMA 3BF6H 1A0JA 1GMHF 5GXPA 4I31A 1MAXA 3PYHA 2OC0A 1ZPBA 1HAIH 1O2YA 1AE8H 1O2XA 3Q77A 4BXSA 3F9HA 4K1EA 1GHBF 2TRMA 2ILNA 2ZDLA 2QV1A 1BQYA 1WAYB 1QBVH 2NU2E 1C5NH 5C5NA 4X1QU 5HYOA 1VJ9U 3W95A 5I25A 4OS4A 1KXFA 3SNAA 2F9PA 4BOHA 2BXUH 2XBWA 1D3DB 2FOBA 2G51A 5HM9A 4GSOA 2VVCA 4A1XA 1FI8A 3FZDA 4NIWA 2G00A 1TPOA 5AFYH 3SGQE 2FOHA 4YO9A 3RXEA 1O33A 2TGAA 5HMAA 7LPRA 1GBCA 4WXIA 4A1TA 2GGVB 3T2NA 2RCEA 2DUCA 1HGTH 1GWAA 4AFZA 1C5SA 2QXJA 3BG4B 3GDSA 2NWNA 1YM0A 3LIWA 1C4V2 2WYGA 1NZQH 5JDUB 2Z94A 4Z6AH 2QF3A 5HGGA 1FY4A 1YCPM 1THRH 5C2ZA 4CRFA 2NU3E 4ISOA 1O2KA 1H9IE 2O8LA 1O2TA 3LGTA 3OX7U 1HNEE 1O3KA 2WPIS 3TJNA 3ZZDA 2A2QH 3ZV8A 1RIWB 3LONA 1VCQA 3Q3XA 3KL6A 4JYUH 5LH8A 2P94A 1CT2E 1GDQA 1GJDB 1Q3XA 3P6ZB 5F8ZA 3U1IB 4CH2B 4CH8B 4D8NA 1ZHPA 4JYVH 2A45B 4DVAU 1TAWA 3MO6A 5LPRA 4E7RG 2EEKA 2JETB 1WBGB 1BTWA 2FYQA 3P17H 3TH4H 1Z6EA 5CE1A 4Y0ZE 2QCYA 5EGMA 4CR9A 3A89A 4O3UA 1O3DA 3P95A 1P2IA 2B0FA 1MU6B 3QGNB 2Y7XA 3ZVBA 2BM2A 2YNBA 3VB5A 1B0FA 4HFPB 1BT7A 1ID5H 5EQSA 1P09A 1HIAA 1YPHE 4MDSA 1HJ9A 3PMBB 4Y7BA 1T4VH 1RRKA 3DHKH 2H1UA 3EQ0H 4FU8A 1OPHB 1EJMA 3RUOA 2R0KA 4CR5A 4THNH 3NPSA 1H9HE 1V2ST 1C2KA 1G9IE 4UEHH 4H6SB 1AB9C 8KME2 5EODA 1L4ZA 1TX7A 1TFXA 3T5FH 5A0BA 2F9BH 2GZ8A 1OP2A 4RSPA 3UR6A 2ZHDA 1MAYA 2BX4A 1V2OT 4YT7H 3ESTA 4NSYA 5K0HA 3M5MA 2BD3A 4JZEH 2J2UA 1WOFA 2V6NA 4WH8A 1XM1A 1JRTA 3M5NA
chains in the Genus database with same CATH superfamily
1SC8U 2PSXA 4Y8YA 3TH2H 3PLKA 3P8OA 4DGJA 1TGSZ 2BQ6B 3MI4A 4K69A 3TK5A 3QZRA 4XDEA 4ISHH 3V12A 3SI3H 4YOIA 7GCHF 3DSOA 2ZPSA 1O2IA 1O3EA 3KGPA 2XC5A 3KQ5A 4CRBA 1O3OA 4ZUHA 3QLPH 4ISLA 1THPB 4OM9A 1O2QA 2BMGB 3EE7A 3W1EA 1K22H 1GCDA 4DURA 3ZIAD 1A3BH 1EJNA 8GCHG 4SGAE 1TPPA 2LPRA 3FP8E 3LGYA 2BYAX 1LQDB 1A46H 2VIWA 1AWFH 1G3BA 1ZSKA 1TWXB 1O35A 1YY3A 2FI5E 3M3SA 2Z9LA 5F03A 2ZPRA 3QWCH 5GCHG 4UDWH 4RT1A 1O3GA 4I8HA 1GBIA 1O3IA 4A5TS 4O03A 1P57B 1Z8GA 2YMSC 2Y82A 1A5GH 3GCNA 1YPJH 5DP5A 2AGGX 2UUJB 1DY8A 4A6LA 1FXYA 1S81A 1XKAC 1J17T 1NU9A 1WDIA 3RXRA 5L2ZH 3SUEA 4X6NA 1EB2A 1NT1A 1QHRB 1DX5M 1NPMA 1YLDA 2ODQA 4IW4E 4LK4A 1B5GH 5EXMA 3HATH 3MNCA 3NKKA 4MPVA 1BRBE 1EUFA 2WPMS 1NRRH 1UTKA 2OXSA 1UVOA 4ZAEA 1C2FA 2Y5FA 2J98A 2VIQA 3U69H 5C0UA 4K60A 5C1YA 4HG6A 3ZZ6A 3BG4C 1W7XH 3MH7A 1C5XB 1UHBA 1RGQA 3SO3A 1SLVB 3PO1B 2FX6A 2VWNA 2FEQH 2ZCHP 1G37A 1AE5A 4ZHMU 3OU0A 1W13U 3LGUA 1W7GH 1LDTT 1S82A 1UW7A 1AFQB 1ELCA 2H5CA 1O5AB 2WZQA 2ZU2A 4IN2A 1INCA 3U28C 1XUHA 1AO5A 1VGCB 2FOMB 1O30A 2W26A 1RIWC 3HPTB 1W11U 4BAOB 3S7KB 4I8KA 4IBLH 1OWKA 1CA8B 1TIOA 1VZQH 3MYWA 3DA9B 1BTZA 2QAAA 3S7HB 3BG8A 1GHZA 3PWBA 2VIDA 2ZFRH 3GDUA 3ENSB 3QO6A 2F91A 2JETC 3ATIA 1BCUH 1C1TA 2GP9B 3SZEA 3EA9A 4ASUD 3SUFA 2AEIH 1TNJA 5FPYA 3V0XA 3SI4H 3EDXB 1SGQE 1MBQA 1W3CA 1YF4A 1BBRE 1Y3UA 3K9XB 1C1UH 5DK1A 3ITIA 4JZFH 4YOGA 3SBKA 1C1NA 5ABWA 1VCPA 2BVSH 1L4DA 2R2MB 2Z3DA 1O3MA 1W0YH 1PPHE 1ELDE 3BTTE 4ZMAH 1EP5A 2GTBA 3UFAA 2FOCA 3GOVB 3MTYA 1Y3YA 4E06H 4YTAA 4AN7A 1C9PA 3MOCA 1ZMLA 3UREA 2FDAA 3RU4D 4AFSA 4AFQA 1O2OA 3ZVFA 1FAKH 1OHHD 2FTMA 3HKJB 1P11E 1GI9B 4TYDA 3S9BA 5C17A 3KCGH 2OP9A 3PM3A 3VFEA 3GYMA 1P2KA 1QL9A 1Z8RA 2Q6DA 2F9OA 1MD8A 2A7JA 5FXLA 2A4OA 3ZZ7A 3S9CA 2HOBA 4J2YB 1CGIE 3GY5A 1RFNA 1NESE 4D9RA 3VB3A 3SU5A 2V3HH 2AIQA 1UK2A 4AG2A 4X6PA 3A8DA 3FVFB 1OS8A 1ELBA 3EAJA 4GCHG 3SU2A 2SNWA 4NGAH 1BBRH 3C27B 1GBJA 3OY5U 1RJXB 5T6GA 4AG1A 3BEFB 2BOKA 5EQQA 4K8YA 2OC8A 2JH0D 1EAWA 1QR3E 3M5OA 5CHAB 2WPDD 2RA0A 3RLWH 1W10U 3GYLB 3K65B 1DM4B 1NY22 2ZCLP 3E90B 1Y8TA 2H6MA 1TPAE 2BD7A 2J94A 2OC1A 4NA7A 3TJUA 1GCTC 5FX6A 1O2WA 2I6QA 2BDGA 4AC9A 1EZXC 2ZHWH 3LGWA 1TONA 2AIPA 4BTUB 2UWOA 3MFJA 1YPEH 3GY4A 3F1SB 5C5OA 2H9TH 1O3LA 3E91A 4AFUA 3SNDA 1K1NA 5HM2A 1ELAA 1GBDA 1CA0C 2PUXB 4MNXA 3URDA 5BRRE 3ZZ9A 1PQAA 1H4WA 1CHGA 1KIGH 5GNDA 2KFWA 1BJVA 2FYRA 1F5LA 1A61H 3A80A 4GHQA 3SNBA 2XOKD 1UO6A 3KQCA 1LVYA 1S84A 3LH1A 2FX4A 5DP3A 2G4UA 4WF8A 4XOJA 4AYYB 3B23B 1S6FA 2ZGXH 4H42U 2PWXA 3PO1C 1TBZH 3A87A 2ULLA 2B7DH 2BD8A 1NFYA 3MNSA 1KDQA 3KYFA 2ZC9H 3SORA 4IMZA 4I32A 1J15A 3HKIB 4FVBA 2HALA 2BXTH 2PGQB 3D49H 1AFQC 2F3CE 2BZ6H 4I8JA 1K1LA 3TH3H 5C67A 1GI2A 1LMWB 1BIOA 3UPEA 3P92A 2HNTF 4X1RU 4WMFA 3D65E 2ZZUH 2WSSD 3M7UA 1VGCC 1FY5A 4TY6A 1PFXC 4B6FA 1A5IA 1SR5C 1Y5AT 4Y76A 3SOSA 5FAHA 1TLDA 1O3FA 1SLUB 3U1JB 4GPGA 1T8OA 3SHCH 1CVWH 5J4QA 3MNXA 3PROA 2W3IA 3VG8A 5JB9S 1GBBA 5JBCS 2NU4E 2OINA 2V0BA 4NFFA 5DP8A 2CN0H 1EAUA 4UD9H 3RC4A 4FUHA 2BDIA 4ZKRU 2I6SA 1ESTA 3MH5A 2F9UA 1HAXB 5EG4A 1HAZB 2XNIA 2AYWA 5ETXA 4K3JA 3MO3A 1PPFE 5L6NH 1CGHA 1IQFA 1MCVA 1QURH 2Y80A 2OQ5A 3R0FA 4E05H 3FO8D 1GMDF 1P3EA 1JRSA 4WVPE 2GCTB 1NRPH 4B2AA 5EQRA 1SB1H 2O8UA 1O2GH 3NRLA 3VXFH 3E1XB 1DXPA 3GICB 4OS1A 5J4SA 1QB9A 3LPRA 4Z1MD 1SGFG 1UCYE 2A7HA 5IDKA 3ZYDA 2ZF0H 3F6UH 1IQLA 1OYTH 1ZPCA 4JCNA 2B9LA 2OBQA 1O37A 4ESTE 5A0AE 1MQ5A 2ZEBA 4ACAA 4GUXA 3C1KA 3LT3A 4WWYA 4O3TA 2ZDKA 3TK9A 4DT7B 2IPHA 3SNCA 1C5MD 2XBYA 1QRWA 2VVUA 2BD5A 2BLWA 3WW7A 1GG6B 5GIBA 1AI8H 2G52A 4NFEA 1GJ9B 1HIAB 2IJD1 2CF8H 1AB9B 3E0PB 1ORFA 5TCCA 4GHTA 2UUFB 2KZ4A 3RXUA 3TGKE 1ZZZA 2B8OH 2PKSB 4ZH8A 1LHDH 1IOEA 1LVOA 1MKXH 1SHHB 2HLDD 1GMHG 2ZFPH 1K9OE 1Y3WA 2ZU1A 4ABFA 4FVDA 2WPJS 1WYKA 3T29A 1GHBG 1KTSB 3HK3B 5AVDA 4B75A 9LPRA 1KYNA 1DDJA 4K2YA 2P95A 5F8TA 1UCYH 4JK5A 4I8LA 2BLQA 1GI5A 2A5KA 1JIRA 4JZ1A 4XSKU 3SJ9A 2OCVB 1S6LA 2J9NA 1AQ7A 1GBTA 2TGPZ 1F5RA 4HTCH 1V2LT 1V2UT 1P8VC 1O2SA 2ZECA 2ZP0H 1GJ8B 4ZKSU 2HGTH 1YBWA 4P00A 3H09A 5KGOA 2VNTA 1QY6A 2TPIZ 3QTVH 4U2WA 2EC9H 1SFQB 1OSSA 3LJOA 1O36A 3A81A 2K1QA 1ZGIA 1TMTH 5AHGH 1Z71A 4X8UH 1O5FH 1FUJA 1SVPA 2A4GA 2ZDAH 5DPAA 5EW2H 2Y7ZA 1KTTB 1JBUH 2XC0A 4BXWA 4AGJA 4DIIH 3NZIA 1LVMA 4RKOB 1QNJA 1JXPA 3M35A 5A8ZA 5DN6D 3VEQB 3SGBE 3VGCC 4MLFB 2VIVA 2H5DA 4IC5A 5TCAA 1BA8B 4JZDH 3RC5A 1K1IA 6CHAB 2G4TA 1BZXE 2BDBA 3PV4A 3UB0A 3RMNH 4ABAA 4D7FA 2P16A 2GCHG 1GMCF 1C1WH 2V35A 3GY8A 7ESTE 2GZ9A 1XKBC 1XUFA 4TPIZ 3SUDA 3SU0A 4F49A 1O3JA 1CQQA 1C4Y2 2FESH 3SJOA 2FMJA 1E37B 1HJ8A 1PPBH 4FUEA 2QXIA 5KEDA 4F48B 1H8DH 2P3UB 1ETTH 5FPTA 1UHBB 3M36A 1QJ1B 3ATWA 1O2PA 3BTKE 2BY5X 4CBOA 1V2MT 2QN5T 3W94A 2GD4B 3RXLA 2ZU5A 8LPRA 2EQNA 3E8LA 1UTPA 3TU7H 1E0FD 2BY6X 1D3TB 2GCHF 4XE4A 2FOFA 4NSVA 1Q31A 3QDZB 1XVMA 3OFND 2CK3D 3CNRA 2CGAA 1A7SA 4O97A 1EFRD 1IQKA 1IQJA 2HPQH 2VJ1A 3Q3YA 1YCPH 2LNCA 2ANYA 2ZQ2A 2GCTC 4CRAA 1GHYH 1G2MA 2VBCA 1NRSH 1K1MA 3UIRA 1BMMH 5GWZA 1H8IH 4INLA 1DUEA 3F9EA 2ZO3H 1UMAH 4KTUA 1OP8A 1C5YB 1QQ4A 1AVWA 2D8WA 1DXWA 3RMLH 4NA9H 5DP7A 2ZWLH 2FI3E 1BRAA 1MABB 1O2UA 3CS7A 2UUKB 1WQSA 4NCYA 4CRCA 1TNGA 3O8BA 1HCGA 3OE7D 1TYNA 5EPYA 5JPMH 3FN8A 1CBWC 1FZZA 2TIOA 3AAUA 1V2VT 2ZDVH 2O8WA 3TGJE 4KKDA 4A1VA 3MQKC 2ZU4A 1GG6C 4X8TH 1C5VA 3BIVH 3QX5H 5E0GA 1S5SA 3S69A 3K6YA 4B71A 7GCHG 1DPOA 3OY6U 5DSFA 1SGDE 5BPEA 3V13A 2PKSC 1EJAA 1TBQH 2Q1JA 1ETRH 4TPYA 1IQGA 1HB0B 1FPCH 4Q7ZA 1SQRA 1TNLA 3SZNA 1D3QB 1H1BA 4HI3A 2C93B 4AYVB 3SQEE 3EYDA 2SGAA 1SBWA 1HAPH 3AVZA 4Q7YA 3UUZA 3FAOA 3M3VA 2VU8E 2ZPQA 1ZRKA 1BBRK 1YPGH 3O8RA 3M3TA 3QZQA 4RN6A 4AB8A 1NS3A 4JK6A 2AMDA 3SV2H 4K1TA 4NZQA 1IAUA 1AWHB 1ZJKA 1GJ5H 2XTTB 2ZHEH 2L74A 2C90B 1GBAA 3TNTA 4Y8ZA 3L33A 1O3BA 2XWAA 3UNSA 2GT7A 1MTVA 5C1UA 1GHAF 1HUTH 1O2ZA 3M61U 1P2OA 2J95A 3L6PA 1GCTB 5EJZA 4ABBA 4B73A 1UTMA 2ZTZA 1RTFB 2ZGJA 1KY9A 3PRDA 4A7IB 2IN2A 3EA8A 3SU6A 3F2HA 3BTME 1V2RT 1PJPA 4Z0KA 1ARBA 2XCNA 1Y59T 1PQ8A 3TIUA 1ZMNA 1E1RD 1CA0B 5A2MH 2CHAC 4P02A 1NM6A 3PRBA 1ABJH 2J38A 1DWEH 2XBVA 1DITH 2PSYA 1L2EA 6CHAC 3SUGA 1UTJA 2Y5GA 2PHBA 1YGCH 4ABEA 3U9AH 4Q2KA 4DIHH 3F0PA 2PFEA 4JYTA 2BD2A 1NC6A 5TJXA 2ZKSA 1TPSA 5DP6A 1MMJN 4DY7B 1YLCA 1HRTH 1PYTC 2H9HA 2BDYA 1A2CH 2UWPA 1M9UA 1P2QA 2ZIQH 1CO7E 1O34A 1QJ6B 2CV3A 4UFEH 1PPGE 5JBAS 4MNYA 1T8LA 3RXAA 3KHVA 1GHWH 3QK1A 2ZTXA 1YC0A 1T8NA 1KXEA 3PTNA 6ESTA 1C5TA 1FAXA 1COWD 1S83A 2OLGA 1QTFA 2BVRH 1DFPA 2BDHA 1GJ4H 1KDQB 3TVJB 3MHWU 4OS5A 1HXFH 1NROH 1DWBH 1GDUA 1TRNA 2EA3A 4AORA 4DG4A 4PROA 3QTOH 4Y11E 1VITF 4AZ2B 1J16A 4B2CA 1BTXA 4BTTB 2CMYA 2Z9KA 3UWJH 1JOUB 3DFLA 1O38A 2VWLA 3MO9A 2P3FH 1AMHA 1CHOF 2GT8A 1OOKB 2WPKS 1O3AA 4GLYA 3WWFA 4IS5A 2HPPH 3FKSD 4UFFH 4YOJA 1SLWB 1OWJA 4XFQA 1BTUA 4MG3A 4MNWA 1P2MA 2ZTYA 4B6EA 3DUXH 3OAAD 1P04A 1H8ED 3NK8A 3RMMH 5EW1H 3T28A 4BANB 4DW2U 4JZIA 3SV7A 3ZZBA 1F5KU 2QE7D 1FV9A 3H5CB 1CU1A 3KIDU 4QT8C 2FO9A 1S6HA 4X8SH 5JBTA 1LHEH 1ZLRA 2PLXA 4WMDA 2WYJA 3BTGE 4X2VA 2UWLA 3M37A 3SV9A 2D2DA 5CHBA 1KLTA 1GBEA 4R0IA 1KXAA 2CXVA 2XC4A 3LDXH 1ELGA 2ZGHA 1BTPA 3L3TA 2P93A 3T27A 5AF9H 1TA6A 4WMEA 2BX3A 1ZYOA 1IQEA 4FUDA 1Z8JB 2J5UA 2BDAA 1MTUA 1BB0B 1GJBB 3A7XA 4Q63A 3BTWE 3N7DA 3P8FA 1V2PT 2W6ID 3UQOA 2WUCA 5JBBS 1V3XA 4H4FA 4UE7H 3F9FA 2HNTC 5G4BA 1ELEE 4I8GA 1BJUA 1LPKB 1EOLA 1FY3A 1A5HA 1K1JA 1SOZA 3ATKA 1TGCA 1WTHD 4LZ4B 1O2RA 3A8AA 1IHTH 1TA2A 2A1DB 2ZDNA 1E34B 1ZHMA 3ZZ5A 4FUJA 1C2EA 2QYIA 2PV9B 2ANKH 1UTOA 2KM0A 3PMHB 3B9FH 2Z3EA 3U8OH 1C1PA 2ZHFH 1SLXB 4OS6A 1FIZA 3A8CA 1V2NT 4UFDH 1QCPA 1C5RA 3GCTG 1SGEE 4IGDA 3PMJA 1LHGH 1S0RA 3A85A 1Z8IB 3BN9A 2LELA 3MU8A 3ODDA 1U6QA 3PLPA 3RLYH 2W7UA 5EIYA 2FS8A 3A82A 5DG6A 1BMFD 2K0QA 3DCLA 1SHYA 1DS2E 4XBBA 1CGJE 1XX9A 4NG9H 5EOKA 2VINA 2AGIX 3RXHA 2FIRH 3SYJA 2FS9A 3IWMA 1DSUA 1DE7H 3RXOA 3GCTF 3KQEA 3A7ZA 1C1RA 1MH0A 1FN8A 3KNXA 3LU9B 4J1YA 5LPFA 4D7GA 3NCLA 1GVZA 1SGRE 3ZVEA 1CT0E 3PB1E 1GHXH 1EAIA 5T3HA 1HXEH 1LO6A 4INKA 1GBHA 3VGCB 4WJG2 4ASHA 5B6OA 2STBE 1GI3A 4TWYA 2A4RA 1GHVH 1NFWA 1AU8A 4WH6A 2ZGBH 4LXBH 1C5UA 2HLCA 1D6WA 1B0EA 1ELFA 3K2UA 4YM9A 1G32B 3AAVA 2WV9A 3ZZCA 3E3TA 5E0HA 1SFIA 1V2JT 1YLNA 1A0LA 2ODPA 1GMDG 1Z6JH 3UTUH 2LP6A 1TOCB 3KF2A 4U01A 1UTQA 4B74A 1VR1H 2PTCE 2R9PA 2FPZA 2FP7B 3M7TA 3PV5A 1BDAA 2Y81A 2ANWA 3QN7A 2SGDE 1LHFH 4BAQB 1KMHB 2J4IA 1HAOH 1TNKA 1ZTLA 2YNAA 5C20A 2WHXA 3LC5A 1AZZA 1E1QD 1O5CB 2GV7A 5A8XA 1PQ7A 3KQBA 2XW9A 3A7TA 4FU7A 2XWBI 1P03A 1ANCA 2FZZA 3OEHD 2XNDD 4NIVA 4TSFD 5E2PA 2EI8A 4KELA 2BD4A 1YWUA 1WU1A 3O8DA 5EPNA 1GDNA 1QQUA 1C2HA 1QA7A 2XBXA 4H6TA 2BLOA 1K1OA 1TOMH 1ABIH 2FXRA 2W3KA 4BAHB 2SGFE 3A88A 1P05A 4M9FA 4WXVA 5E8EH 4AGKA 1ARCA 1CSOE 3N99A 5C94A 3IITA 2QF5A 3I77A 2VIOA 3UOPA 4RT0A 1HLTH 2IJOB 3MU0A 3RDZA 1CBWB 1TALA 1C5LH 1ETSH 1Y3VA 1ZJDA 2G5VA 4XBDA 1Q2WA 3BTFE 1BMNH 1C1QA 2ZG0H 3FP7E 3K6ZA 3RXIA 1AVGH 1ZTJA 5DKMA 3PLBA 1P9SA 1F0RA 4VGCC 4HGCA 2HRVA 3GS9A 4ZHLU 1FDPA 3ZVCA 1UVTH 1SGIB 1WTGH 3BIUH 3H7OA 5FBIA 4ABJA 1TRYA 2STAE 5CDFE 1G36A 1DSTA 1H9LB 2RA3A 4DCDA 1EPTB 1MZAA 1XUJA 2ESTE 4K8BA 3LH3A 1HAHH 1V6DA 2JKHA 2C8WB 1QGFA 4OS7A 2OK5A 1J9CH 3F68H 4FUIA 1SQOA 1F0TA 2EY4C 3AW0A 3B8JA 3GY7A 1EXFA 3EE0B 2GMTB 3KYGA 2QXGA 4GAWA 3WY8A 2JJ1D 1IHSH 3LC3A 1RS0A 3RXBA 1O5GH 3TJVA 1PQ5A 1QA0A 4U30A 4CRGA 3F9GA 1GBMA 1TGTA 2BHGA 1MQ6A 1GMCG 1E35B 1Z7KA 3V3MA 1T31A 4Y7AA 4TWWA 1H8HD 2J97A 3RXPA 1UVSH 1SOTA 3ZYEA 4NA8A 1O39A 3F0OA 5FCRA 4OS2A 1SQTA 3ZV9A 2ZFTA 3WWBA 4I7YH 2A2XH 3DSGA 3QUMP 5DGJA 1QJ7B 1WCZA 1AKSA 1C2DA 1GVKB 1FY1A 2PP6A 5HIZA 1TGBA 1K1PA 3MWIU 3T25A 2CF9H 2CHAB 1VKYA 1WSSH 1BMLA 3IG6B 4BTIB 1AGJA 1F2SE 1KXDA 2C3SA 1GBKA 1MTNB 1WV7H 1ZSLA 2EI6A 5EJ1A 2VIPA 1G3DA 3SHAH 2FI4E 1TMUH 1IQNA 1E79D 2QC2A 4KTCA 5DJ7A 1HDTH 2GV6A 3MU5A 1UVPA 1GL0E 1FJSA 1HFDA 2Z9JA 1LCYA 1L1GA 3BEIB 1ZMJA 2ZFFH 1HAYB 2ZNKH 5ESBA 2BQWB 1QB6A 5JB8S 4F55A 2BQ7B 1EZQA 1MD7A 2GKVE 3ODFA 1V2TT 3GY2A 2Z9IA 1QRZA 2J92A 1THSH 3H7TA 1F92A 1QFKH 4ABHA 8ESTE 1LVBA 1AIXH 2TBSA 3LGVA 3ZZ3A 1P10A 2R3UA 5LGOA 2PKAA 1HBTH 1A1RA 1F7ZA 4ZXYH 3M7QA 4F4OC 3P8NA 3TK6A 1EQ9A 1MKWH 2ZDMA 1AVXA 2Y5HA 1ZHRA 2C4FH 2VH0A 1J14A 2VGCB 1EKBB 4FETA 4M7GA 3LOXA 5K7RA 1C4U2 3UR9A 3ATLA 4B2BA 5B6LA 1OP0A 3P70B 3VB6A 1D6RA 1UVUH 1YPMH 5L2YH 4YXWD 2BY9X 4X0WU 4FU9A 1ACBE 1C5PA 3MH6A 2HVYB 5A0CA 3KQDA 1DANH 1MUEB 2PTNA 2GDEH 1NTPA 1DUAA 3STIA 3O8CA 1ANBA 2M5TA 1C5QA 1JMOH 1K2I1 4ACBA 1VITH 4MPUA 1GI4A 1BHXF 1BTHH 1C9TA 1O5BB 3GISB 1BOQA 2F43B 4X1SU 1ZGVA 2G8TA 5JYIA 5KECA 1BRCE 1T8MA 1HYLA 1V2WT 3TJOA 4NIXA 2HWLB 1EPTA 1BMAA 2A0QB 3ELAH 1EP6A 2XXLA 2KAIA 3T26A 2G55A 4D76A 2A5IA 4ISNA 1AD8H 4IC6A 1HAVA 3BV9B 1GJ6A 1O31A 2GDDA 1GHAG 2AHME 1F0UA 1KXBA 3BTDE 1AZ8A 1GI6A 1EPTC 1Z1JA 4DT4A 4LOYH 2H2ZA 3NWUA 1CE5A 3JZ1B 4X2WA 3SJIA 1ZOMA 2SNVA 1BTYA 2FWWA 1G3CA 1ZR0A 3RXCA 2AMQA 2SFAA 2YMSD 2QY0B 4AOQA 4E7NA 1ELVA 1O2NA 3D23A 1RXPA 4YZUA 1GGDB 4XBCA 1WXRA 5I46H 2ZA5A 2GMTC 4TY7A 1HJAB 1EOJA 1FONA 1YPLH 3A86A 1G2LA 3ZVGA 2THFB 3ZZAA 2KCOA 1S0QA 2C8XB 2JDID 3BEUA 2SGQE 1SGTA 3Q3KA 4AX9H 1GI8B 1AUTC 5A09A 3A83A 2ALPA 1T7CA 2V3MA 1DT2A 4B1TA 4BAMB 4MQAA 1GBFA 3BTEE 4I33A 1A3EH 1FY8E 1PYTD 1Z1IA 4I86A 2PUQH 4BNRA 1E36B 1MU8B 4O9VA 3E6PH 3UQVA 5E2OA 2OC7A 3OEED 1UJ1A 4NWLA 1KXCA 1EASA 4D9QA 2F9VA 1O2MA 2GX4A 1W0JD 1YYY1 1OWEA 4OGXA 4UFGH 1DLEA 2BY7X 1OKXA 1N6YA 5PTPA 3NUMA 3UOUA 2VH6A 2P3TB 3SNEA 2V7QD 1MTNC 1VJAU 2XRCA 5F6MA 4K1SA 3DD2H 2B5TB 1P01A 3F2GA 3TPIZ 4A92A 2NU1E 4CRDA 1UK4A 3FZZA 3HK6B 3SU4A 4X8VH 2A4QA 5IYTA 6LPRA 4MVNA 1VITG 4ZROA 4CHAB 1W8BH 1ZTKA 2JJ2D 2ZFSA 2HNTE 3DSPA 4NZLA 1HAGE 3Q00A 5E0JA 5L30H 1TRMA 4YESB 5ESTE 2SGPE 3S9AA 5FBEA 4YLUA 1CHOG 2BOHB 1P2NA 4X1NU 3STJA 8GCHF 4LZ1H 3ZVDA 4KP0A 2GVFA 1LKBA 2AMPA 3FFGA 2ODYB 4ABIA 4NIYA 1YKTA 1CT4E 1DY9A 5F8XA 2FOAA 3SU1A 1NO9H 4AB9A 1W2KH 1FIWA 1O3PB 2CJIA 1SL3A 4INHA 3RM2H 5DP9A 3UNQA 5GCHF 1YPHC 3RXSA 1RTLA 1Y3XA 2ZQ1A 1G30B 4U32A 1P3CA 1Y5BT 3RU4E 4FUCA 3ZVAA 5DO4H 3FOAA 1PPEE 1SGNE 2VB0A 5T6DA 2Z6BD 5IK2D 1O3HA 2BVXH 1XUKA 2OUAA 4X6OA 4FUBA 5T1VA 1OYQA 3ATMA 3MMGA 3VB7A 4ABDA 2QIQA 4B76A 1GPZA 1L1NA 3SV8A 1ANDA 1DOJA 1C2MA 2Y6TA 4ISIH 1N8OB 1YP9A 2A31A 1KLIH 1F0SA 4GVUA 1S85A 2R2WU 2VGCC 1L1JA 2JIZD 3E0NB 3GCHB 3HGNA 3U98H 1WUNH 3DT0H 1ANEA 2JH5D 3SJKA 1D4PB 2ZHQH 3SV6A 1OWDA 1O3NA 1HV7A 1P06A 1FLEE 2WV5A 3OTPA 1O5DH 1ZSJA 1DLKB 3MU1A 1NFUA 1TNIA 1XXFA 3RP2A 3UAIC 3GCOA 5FL7D 2PR3A 1GJCB 4Q4LA 3I29A 1BITA 1SG8B 1QRXA 3M5LA 3RM0H 1GVLA 1GJAB 2TGTA 3MNBA 3EA7A 3V7TA 4IMQA 2FOEA 3SQHE 1OX1A 2Z3CA 3QGJA 2XYAA 2ZU3A 2Z7FE 4X2YA 1GJ7B 2DE9A 3A7WA 2HVXA 1K21H 3TLOA 1MTWA 2BY8X 4DOQA 3BTQE 4MPWA 1EAXA 2AERH 2EI7A 1KSNA 2PGBB 2A5AA 5SGAE 1TQ7B 1XMNB 4FUFA 1O3CA 2IOTA 1C1VH 1GBLA 2RDLA 4KTSA 5LPEA 4UONA 2P59A 3AASA 1FQ3A 2W5EA 4KGAA 3UY9A 1GGDC 4ZKNU 2A32A 4ZKOU 4VGCB 2KCYA 1VCWA 1XUGA 2QXHA 1HJAC 3P8GA 3DFJA 1JIMA 1N1LA 1QL7A 1MKXK 1TQ0B 3U8TH 3GY6A 2IPQX 3Q76A 1UTLM 1QB1A 2FODA 2D26C 1NRNH 3A84A 1C1OA 1O2JA 1MCTA 1UCYK 3SU3A 1DICA 1DWCH 1OXGA 2P8OB 2Q6FA 3RXQA 2ZGCA 3RXTA 1AN1E 2JH6D 1MZDA 4SGBE 1LPZB 1MBMA 1B7XB 3AW1A 7KMEH 2ANMH 1GL1A 5H4IB 1ESBA 1C5OH 2C8YB 5T6FA 1G3EA 3UWIA 1RTKA 1UK3A 4FUGA 3F3BA 3MH4A 1EATA 1J8AA 4TT3D 2YOLA 4RKJB 1TMBH 1XUIA 3LJJA 4X1PU 1LHCH 1QBNA 5HKKD 4GCHF 3JZ2B 3RC6A 3TGIE 1OWIA 1O2LA 3EGKH 4R8TB 1UTNA 3R3GB 2F9NA 1ZPZA 2F83A 3ZZ4A 4DJZB 4CHAC 1P2JA 1DWDH 3TITA 2O9QA 2BB4A 1EZUC 2AFQB 1TE0A 2BD9A 1TNHA 4Y79A 2OD3B 2AH4X 1XVOA 2VWMA 1X7AC 3VPKA 1D9IA 2R3YA 3G01A 1FN6A 5F53A 2FTLE 1LPGB 3PTBA 4Q7XA 4Y6DA 1SI5H 2KCAA 2WPLS 1SGCA 1AFEH 1AKSB 2OBOA 3RMOH 2G81E 1P12E 4YLQH 1LQEA 2FLBH 1O5EH 2M2AA 3PV2A 5EU8A 2TGDA 3KEEA 1BHXB 3CS0A 1O32A 1P0SH 1DVAH 2QA9E 5AFZH 4FOUC 5GPIB 1O2VA 1PPCE 1JWTA 2ZCKP 1NFXA 3SJ8A 1GI7B 1MTSA 1W0KD 1TX6A 4MNVA 4ABGA 1IQIA 2UUYA 3BSQA 4CREA 1C5WB 1GI0A 3I78A 1ZRBA 2RFKC 1SGFA 1N8OC 3UNRA 1SSXA 2O8TA 4Q80A 1IQMA 5FPSA 2BDCA 2AGEX 1AHTH 1C5ZB 3GCHC 3T62A 1N6XA 3AK5A 3CENA 1O0DH 4Y0YE 2RG3A 4NWKA 1Y5UT 4JMYA 3RXVA 5EXNA 3OTJE 4FXGH 4ZCNA 2L6OA 4RI0A 3MU4A 4YT6H 2VWOA 3A7VA 3PMAB 1YCPK 4ZXXH 5C3NA 1KLJH 5FHTA 2Z9GA 1TBRH 3E16B 3RXDA 2WV4A 1A0HB 1MKWK 4XRNA 1C2LA 1ELTA 1E38B 1K28D 1QBOA 3SN8A 3NXPA 5FX5A 2PKAB 4MTBA 1C2GA 1TABE 3SGAE 1QL8A 1T4UH 3FANA 3TNSA 1WQVH 5A8YA 5C1XA 2WINI 3RXGA 2SGEE 3OSYA 3OYPA 3RXKA 4CBNA 3N7OA 3BTHE 3A7YA 1L0ZA 1AUJA 1EZSC 5EXLA 3URCA 2VVVA 5HIYA 3ZZ8A 3HGPA 3VB4A 1LTOA 2FOGA 2R0LA 1BUIA 4Y8XA 2WUBA 1NN6A 1OWHA 1C1MA 1TGNA 2XCFA 2D1JA 2DE8A 2GJGA 1IQHA 1K0HA 2Q6GA 1YPKH 1ESAA 2O8MA 2BZAA 3RXJA 3GDVA 5GDSH 3CP7A 2WPHS 2FM2A 2NU0E 4HZHA 3GY3A 1C1SA 1SMFE 3LKWA 1FPHH 1QIXB 3RU4T 2G5NA 1C2JA 3FP6E 2ZFQH 1T32A 1W14U 2AS9A 1FMGA 1A4WH 1SQAA 4MPXA 5GJ4B 3KN2A 4X2XA 2BLVA 1SGYE 3RXFA 2ALVA 2KAIB 1D3PB 1FNIA 1XXDA 6GCHG 1SKYE 1HPGA 3A8BA 2ASUB 1O2HA 3PWCA 5CHAC 1V2KT 4WY3A 2P8OC 1HAVB 3D62A 5FCKA 2J34A 1P02A 2H9EH 3S0NA 1GI1A 1LKAA 1AY6H 2ZI2H 1V2QT 1SPJA 2A7CA 2PW8H 1EB1H 2FLRH 3SW2B 9ESTA 1W12U 3F2FA 4Y71A 2OQUA 4X6MA 4Y10E 1TB6H 1RD3B 2QGRA 5DP4A 4BAKB 1EX3A 1SGPE 4ZHAA 4OGYA 1NRQH 3U8RH 2OTVA 2BTCE 3LGIA 4IN1A 1W0ZU 5HXFA 1BRUP 2V3OH 5C0TA 2QF0A 6GCHF 3VXEH 2C8ZB 5CMXH 1PPZA 2QF4A 2W7SA 2GZ7A 1C2IA 4K5ZA 1NU7B 1P9UA 1TX8A 3RXMA 3BF6H 1A0JA 1GMHF 5GXPA 4I31A 1MAXA 3PYHA 2OC0A 1ZPBA 1HAIH 1O2YA 1AE8H 1O2XA 3Q77A 4BXSA 3F9HA 4K1EA 1GHBF 2TRMA 2ILNA 2ZDLA 2KCPA 2QV1A 1BQYA 1WAYB 1QBVH 2NU2E 1C5NH 5C5NA 4X1QU 5HYOA 1VJ9U 3W95A 5I25A 4XD7D 4OS4A 1KXFA 3SNAA 2YMSB 2F9PA 4BOHA 2BXUH 2KR7A 2XBWA 1D3DB 2FOBA 2G51A 5HM9A 4GSOA 2VVCA 4A1XA 1FI8A 3FZDA 4NIWA 2F4LA 2G00A 1TPOA 2KX4A 5AFYH 3SGQE 2FOHA 4YO9A 3RXEA 1O33A 2TGAA 5HMAA 7LPRA 1GBCA 2K8IA 4WXIA 4A1TA 2GGVB 3T2NA 2RCEA 1NBME 2DUCA 1HGTH 1GWAA 4AFZA 1C5SA 2QXJA 3BG4B 3GDSA 2NWNA 1YM0A 3LIWA 1C4V2 2WYGA 1NZQH 5JDUB 2Z94A 4Z6AH 2QF3A 5HGGA 1FY4A 1YCPM 1THRH 2J98B 5C2ZA 4CRFA 2NU3E 4ISOA 1O2KA 1H9IE 2O8LA 1O2TA 3LGTA 3OX7U 1HNEE 1O3KA 2WPIS 3TJNA 3ZZDA 2A2QH 3ZV8A 1RIWB 3LONA 1VCQA 3Q3XA 3KL6A 4JYUH 5LH8A 2P94A 1CT2E 1GDQA 1GJDB 1Q3XA 3P6ZB 5F8ZA 3U1IB 4CH2B 4CH8B 4D8NA 1ZHPA 1FX0B 4JYVH 2A45B 2W6JD 4DVAU 1TAWA 3MO6A 5LPRA 4E7RG 2EEKA 2JETB 1WBGB 1BTWA 1QZ8A 2FYQA 3P17H 3TH4H 1Z6EA 5CE1A 4Y0ZE 2QCYA 5EGMA 4CR9A 3A89A 4O3UA 1O3DA 3P95A 1P2IA 2B0FA 1MU6B 3QGNB 2Y7XA 3ZVBA 2BM2A 2YNBA 3VB5A 1B0FA 4HFPB 1BT7A 1ID5H 5EQSA 1P09A 1HIAA 1YPHE 4MDSA 1HJ9A 1NBMD 3PMBB 1T4VH 4Y7BA 1RRKA 3DHKH 2H1UA 3EQ0H 4FU8A 1OPHB 1EJMA 3RUOA 2R0KA 4CR5A 4THNH 3NPSA 1H9HE 1V2ST 1C2KA 1G9IE 4UEHH 4H6SB 1AB9C 8KME2 5EODA 3N7EA 1L4ZA 1TX7A 1TFXA 3T5FH 5EJLA 2RDEA 5A0BA 2F9BH 2GZ8A 1OP2A 4RSPA 3UR6A 2ZHDA 1MAYA 2BX4A 1V2OT 4YT7H 3ESTA 4NSYA 5K0HA 3M5MA 2BD3A 4JZEH 2J2UA 1WOFA 2V6NA 4WH8A 1XM1A 1JRTA 3M5NA
chains in the Genus database with same CATH topology
1SC8U 2PSXA 4Y8YA 3TH2H 3PLKA 3P8OA 4DGJA 1TGSZ 2BQ6B 3MI4A 4K69A 3TK5A 3QZRA 4XDEA 4ISHH 3V12A 3SI3H 4YOIA 7GCHF 2ZPSA 1O2IA 1O3EA 3KGPA 2XC5A 4CRBA 1O3OA 4ZUHA 3QLPH 4ISLA 1THPB 1O2QA 2BMGB 1K22H 1GCDA 4DURA 1A3BH 1EJNA 8GCHG 4SGAE 1TPPA 2LPRA 3FP8E 3LGYA 2BYAX 1LQDB 1A46H 2VIWA 1AWFH 1G3BA 1ZSKA 1TWXB 1O35A 3M3SA 2FI5E 2Z9LA 5F03A 2ZPRA 3QWCH 5GCHG 4UDWH 1O3GA 4I8HA 1GBIA 1O3IA 4A5TS 4O03A 1P57B 1Z8GA 3GCNA 2Y82A 1A5GH 1YPJH 5DP5A 2AGGX 2UUJB 1DY8A 4A6LA 1FXYA 1S81A 1XKAC 1J17T 1NU9A 3RXRA 5L2ZH 3SUEA 4X6NA 1EB2A 1NT1A 1QHRB 1DX5M 1NPMA 1YLDA 2ODQA 4IW4E 4LK4A 1B5GH 5EXMA 3HATH 3MNCA 3NKKA 4MPVA 1BRBE 1EUFA 2WPMS 1NRRH 1UTKA 2OXSA 1UVOA 4ZAEA 1C2FA 2Y5FA 2VIQA 3U69H 4K60A 5C1YA 3ZZ6A 3BG4C 1W7XH 3MH7A 1C5XB 1UHBA 1RGQA 3SO3A 1SLVB 3PO1B 2FX6A 2VWNA 2FEQH 2ZCHP 1G37A 1AE5A 4ZHMU 3OU0A 1W13U 3LGUA 1W7GH 1LDTT 1S82A 1AFQB 1ELCA 2H5CA 1O5AB 2ZU2A 4IN2A 1INCA 1XUHA 1AO5A 1VGCB 2FOMB 1O30A 2W26A 1RIWC 3HPTB 1W11U 4BAOB 3S7KB 4I8KA 4IBLH 1OWKA 1CA8B 1TIOA 1VZQH 3MYWA 3DA9B 1BTZA 2QAAA 3S7HB 3BG8A 1GHZA 3PWBA 2VIDA 2ZFRH 3GDUA 3ENSB 3QO6A 2F91A 2JETC 3ATIA 1BCUH 1C1TA 2GP9B 3EA9A 3SUFA 2AEIH 1TNJA 5FPYA 3V0XA 3SI4H 3EDXB 1SGQE 1MBQA 1W3CA 1YF4A 1BBRE 1Y3UA 3K9XB 1C1UH 5DK1A 3ITIA 4JZFH 4YOGA 3SBKA 1C1NA 5ABWA 1VCPA 2BVSH 1L4DA 2R2MB 2Z3DA 1O3MA 1W0YH 1PPHE 1ELDE 3BTTE 4ZMAH 1EP5A 2GTBA 3UFAA 2FOCA 3GOVB 3MTYA 1Y3YA 4E06H 4YTAA 4AN7A 1C9PA 3MOCA 1ZMLA 3UREA 2FDAA 3RU4D 4AFSA 4AFQA 1O2OA 3ZVFA 1FAKH 2FTMA 3HKJB 1P11E 1GI9B 4TYDA 3S9BA 3KCGH 2OP9A 3PM3A 3VFEA 3GYMA 1P2KA 1QL9A 1Z8RA 2Q6DA 2F9OA 1MD8A 2A7JA 5FXLA 2A4OA 3ZZ7A 3S9CA 2HOBA 4J2YB 1CGIE 3GY5A 1RFNA 1NESE 4D9RA 3VB3A 3SU5A 2V3HH 2AIQA 1UK2A 4AG2A 4X6PA 3A8DA 3FVFB 1OS8A 1ELBA 3EAJA 4GCHG 3SU2A 2SNWA 4NGAH 1BBRH 3C27B 1GBJA 3OY5U 1RJXB 5T6GA 4AG1A 3BEFB 2BOKA 5EQQA 4K8YA 2OC8A 2JH0D 1EAWA 1QR3E 3M5OA 5CHAB 2RA0A 3RLWH 1W10U 3GYLB 3K65B 1DM4B 1NY22 2ZCLP 3E90B 1Y8TA 2H6MA 1TPAE 2BD7A 2J94A 2OC1A 4NA7A 3TJUA 1GCTC 5FX6A 1O2WA 2I6QA 2BDGA 1EZXC 2ZHWH 3LGWA 1TONA 2AIPA 4BTUB 2UWOA 3MFJA 1YPEH 3GY4A 3F1SB 5C5OA 2H9TH 1O3LA 3E91A 4AFUA 3SNDA 1K1NA 5HM2A 1ELAA 1GBDA 1CA0C 2PUXB 4MNXA 3URDA 5BRRE 3ZZ9A 1PQAA 1H4WA 1CHGA 1KIGH 1BJVA 2FYRA 1F5LA 1A61H 3A80A 4GHQA 3SNBA 1UO6A 3KQCA 1LVYA 1S84A 3LH1A 2FX4A 5DP3A 2G4UA 4WF8A 4XOJA 4AYYB 3B23B 1S6FA 2ZGXH 4H42U 2PWXA 3PO1C 1TBZH 3A87A 2ULLA 2B7DH 2BD8A 1NFYA 3MNSA 1KDQA 2ZC9H 3SORA 4IMZA 4I32A 1J15A 3HKIB 4FVBA 2HALA 2PGQB 2BXTH 3D49H 1AFQC 2F3CE 2BZ6H 4I8JA 1K1LA 3TH3H 5C67A 1GI2A 1LMWB 1BIOA 3UPEA 3P92A 2HNTF 4X1RU 4WMFA 3D65E 2ZZUH 3M7UA 1VGCC 1FY5A 4TY6A 1PFXC 1A5IA 1SR5C 1Y5AT 4Y76A 3SOSA 5FAHA 1TLDA 1O3FA 1SLUB 3U1JB 4GPGA 1T8OA 3SHCH 1CVWH 5J4QA 3MNXA 3PROA 2W3IA 5JB9S 1GBBA 5JBCS 2NU4E 2OINA 2V0BA 4NFFA 5DP8A 2CN0H 1EAUA 4UD9H 3RC4A 4FUHA 2BDIA 4ZKRU 2I6SA 1ESTA 3MH5A 2F9UA 1HAXB 5EG4A 1HAZB 2XNIA 2AYWA 5ETXA 4K3JA 3MO3A 1PPFE 5L6NH 1CGHA 1IQFA 1MCVA 1QURH 2Y80A 2OQ5A 3R0FA 4E05H 1GMDF 1P3EA 1JRSA 4WVPE 2GCTB 1NRPH 4B2AA 5EQRA 1SB1H 2O8UA 1O2GH 3VXFH 3E1XB 1DXPA 3GICB 4OS1A 5J4SA 1QB9A 3LPRA 1SGFG 1UCYE 2A7HA 5IDKA 3ZYDA 2ZF0H 3F6UH 1IQLA 1OYTH 1ZPCA 4JCNA 2B9LA 2OBQA 1O37A 4ESTE 5A0AE 1MQ5A 2ZEBA 4GUXA 3C1KA 3LT3A 4WWYA 4O3TA 2ZDKA 3TK9A 4DT7B 2IPHA 3SNCA 1C5MD 2XBYA 1QRWA 2VVUA 2BD5A 2BLWA 1GG6B 5GIBA 1AI8H 2G52A 4NFEA 1GJ9B 1HIAB 2CF8H 1AB9B 3E0PB 1ORFA 5TCCA 4GHTA 2UUFB 3RXUA 3TGKE 1ZZZA 2B8OH 2PKSB 4ZH8A 1LHDH 1IOEA 1LVOA 1MKXH 1SHHB 2ZFPH 1GMHG 1K9OE 1Y3WA 2ZU1A 4ABFA 4FVDA 2WPJS 1WYKA 3T29A 1GHBG 1KTSB 3HK3B 5AVDA 4B75A 9LPRA 1KYNA 1DDJA 4K2YA 2P95A 5F8TA 1UCYH 4JK5A 4I8LA 2BLQA 1GI5A 2A5KA 1JIRA 4JZ1A 4XSKU 3SJ9A 2OCVB 2J9NA 1AQ7A 1GBTA 2TGPZ 1F5RA 4HTCH 1V2LT 1V2UT 1P8VC 1O2SA 2ZECA 2ZP0H 1GJ8B 4ZKSU 2HGTH 1YBWA 2VNTA 1QY6A 2TPIZ 3QTVH 4U2WA 2EC9H 1SFQB 1OSSA 3LJOA 1O36A 3A81A 2K1QA 1ZGIA 1TMTH 5AHGH 1Z71A 4X8UH 1O5FH 1FUJA 1SVPA 2A4GA 2ZDAH 5DPAA 5EW2H 2Y7ZA 1KTTB 1JBUH 2XC0A 4BXWA 4AGJA 4DIIH 3NZIA 1LVMA 4RKOB 1QNJA 1JXPA 3M35A 5A8ZA 3VEQB 3SGBE 3VGCC 4MLFB 2VIVA 2H5DA 4IC5A 5TCAA 1BA8B 4JZDH 3RC5A 1K1IA 6CHAB 2G4TA 1BZXE 2BDBA 3PV4A 3RMNH 4ABAA 4D7FA 2P16A 2GCHG 1GMCF 1C1WH 2V35A 3GY8A 7ESTE 2GZ9A 1XKBC 1XUFA 4TPIZ 3SUDA 3SU0A 4F49A 1O3JA 1CQQA 1C4Y2 2FESH 3SJOA 2FMJA 1E37B 1HJ8A 1PPBH 4FUEA 2QXIA 1H8DH 2P3UB 1ETTH 5FPTA 1UHBB 3M36A 1QJ1B 3ATWA 1O2PA 3BTKE 2BY5X 4CBOA 1V2MT 2QN5T 3W94A 2GD4B 3RXLA 2ZU5A 8LPRA 3E8LA 1UTPA 3TU7H 1E0FD 2BY6X 1D3TB 2GCHF 4XE4A 2FOFA 4NSVA 1Q31A 3QDZB 1XVMA 2CGAA 1A7SA 4O97A 1IQKA 3Q3YA 1IQJA 2HPQH 2VJ1A 1YCPH 2LNCA 2ANYA 2ZQ2A 2GCTC 4CRAA 1GHYH 1G2MA 1NRSH 1K1MA 3UIRA 1BMMH 5GWZA 1H8IH 4INLA 1DUEA 3F9EA 2ZO3H 1UMAH 4KTUA 1OP8A 1C5YB 1QQ4A 1AVWA 2D8WA 1DXWA 3RMLH 4NA9H 5DP7A 2ZWLH 2FI3E 1BRAA 1O2UA 3CS7A 2UUKB 1WQSA 4NCYA 4CRCA 1TNGA 3O8BA 1HCGA 5EPYA 1TYNA 5JPMH 1CBWC 1FZZA 2TIOA 3AAUA 1V2VT 2ZDVH 2O8WA 3TGJE 4KKDA 4A1VA 2ZU4A 1GG6C 4X8TH 1C5VA 3BIVH 3QX5H 5E0GA 1S5SA 3S69A 3K6YA 4B71A 7GCHG 1DPOA 3OY6U 1SGDE 5BPEA 3V13A 2PKSC 1EJAA 1TBQH 2Q1JA 1ETRH 4TPYA 1IQGA 1HB0B 1FPCH 4Q7ZA 1TNLA 3SZNA 1D3QB 1H1BA 4HI3A 2C93B 4AYVB 3SQEE 3EYDA 2SGAA 1SBWA 1HAPH 3AVZA 4Q7YA 3UUZA 3FAOA 3M3VA 2VU8E 2ZPQA 1ZRKA 1BBRK 1YPGH 3O8RA 3M3TA 3QZQA 4RN6A 4AB8A 1NS3A 4JK6A 2AMDA 3SV2H 4K1TA 4NZQA 1IAUA 1AWHB 1ZJKA 1GJ5H 2XTTB 2ZHEH 2C90B 1GBAA 3TNTA 4Y8ZA 3L33A 1O3BA 2XWAA 3UNSA 2GT7A 1MTVA 5C1UA 1GHAF 1HUTH 1O2ZA 3M61U 1P2OA 2J95A 3L6PA 1GCTB 4ABBA 4B73A 1UTMA 2ZTZA 1RTFB 2ZGJA 1KY9A 4A7IB 2IN2A 3EA8A 3SU6A 3BTME 1V2RT 1PJPA 4Z0KA 1ARBA 2XCNA 1Y59T 1PQ8A 3TIUA 1ZMNA 1CA0B 5A2MH 2CHAC 1NM6A 1ABJH 2J38A 1DWEH 2XBVA 1DITH 2PSYA 1L2EA 6CHAC 3SUGA 1UTJA 2Y5GA 2PHBA 1YGCH 4ABEA 3U9AH 4Q2KA 4DIHH 2PFEA 4JYTA 2BD2A 1NC6A 5TJXA 2ZKSA 1TPSA 5DP6A 1MMJN 4DY7B 1YLCA 1HRTH 1PYTC 2H9HA 2BDYA 1A2CH 2UWPA 1M9UA 1P2QA 2ZIQH 1CO7E 1O34A 1QJ6B 2CV3A 4UFEH 1PPGE 5JBAS 4MNYA 1T8LA 3RXAA 3KHVA 1GHWH 3QK1A 2ZTXA 1YC0A 1T8NA 1KXEA 3PTNA 6ESTA 1C5TA 1FAXA 1S83A 2OLGA 1QTFA 2BVRH 1DFPA 2BDHA 1GJ4H 1KDQB 3TVJB 3MHWU 4OS5A 1HXFH 1NROH 1DWBH 1GDUA 1TRNA 2EA3A 4AORA 4DG4A 4PROA 3QTOH 4Y11E 1VITF 4AZ2B 1J16A 4B2CA 1BTXA 4BTTB 2CMYA 2Z9KA 3UWJH 1JOUB 3DFLA 1O38A 2VWLA 3MO9A 2P3FH 1AMHA 1CHOF 2GT8A 1OOKB 2WPKS 1O3AA 4GLYA 4IS5A 2HPPH 4UFFH 4YOJA 1SLWB 1OWJA 4XFQA 1BTUA 4MG3A 4MNWA 1P2MA 2ZTYA 3DUXH 1P04A 3NK8A 3RMMH 5EW1H 3T28A 4BANB 4DW2U 4JZIA 3SV7A 3ZZBA 1F5KU 1FV9A 3H5CB 1CU1A 3KIDU 4QT8C 2FO9A 1S6HA 4X8SH 5JBTA 1LHEH 1ZLRA 2PLXA 4WMDA 2WYJA 3BTGE 4X2VA 2UWLA 3M37A 3SV9A 2D2DA 1KLTA 1GBEA 4R0IA 1KXAA 2CXVA 2XC4A 3LDXH 1ELGA 2ZGHA 1BTPA 3L3TA 2P93A 3T27A 5AF9H 1TA6A 4WMEA 2BX3A 1ZYOA 1IQEA 4FUDA 1Z8JB 2BDAA 1MTUA 1BB0B 1GJBB 3A7XA 3BTWE 3P8FA 1V2PT 3UQOA 2WUCA 5JBBS 1V3XA 4H4FA 4UE7H 3F9FA 2HNTC 5G4BA 1ELEE 4I8GA 1BJUA 1LPKB 1EOLA 1FY3A 1A5HA 1K1JA 1SOZA 3ATKA 1TGCA 1WTHD 4LZ4B 1O2RA 3A8AA 1IHTH 1TA2A 2A1DB 2ZDNA 1E34B 1ZHMA 3ZZ5A 4FUJA 1C2EA 2QYIA 2PV9B 2ANKH 1UTOA 3PMHB 3B9FH 2Z3EA 3U8OH 1C1PA 2ZHFH 1SLXB 4OS6A 1FIZA 3A8CA 1V2NT 4UFDH 1QCPA 1C5RA 3GCTG 1SGEE 4IGDA 3PMJA 1LHGH 1S0RA 3A85A 1Z8IB 3BN9A 3MU8A 3ODDA 1U6QA 3PLPA 3RLYH 2W7UA 2FS8A 3A82A 5DG6A 1SHYA 1DS2E 4XBBA 1CGJE 1XX9A 4NG9H 5EOKA 2VINA 2AGIX 3RXHA 2FIRH 2FS9A 3IWMA 1DSUA 1DE7H 3RXOA 3GCTF 3KQEA 3A7ZA 1C1RA 1MH0A 1FN8A 3KNXA 3LU9B 4J1YA 5LPFA 4D7GA 3NCLA 1GVZA 1SGRE 3ZVEA 1CT0E 3PB1E 1GHXH 1EAIA 5T3HA 1HXEH 1LO6A 4INKA 1GBHA 3VGCB 4WJG2 4ASHA 5B6OA 2STBE 1GI3A 4TWYA 2A4RA 1GHVH 1NFWA 1AU8A 4WH6A 2ZGBH 4LXBH 1C5UA 2HLCA 1D6WA 1B0EA 1ELFA 3K2UA 4YM9A 1G32B 3AAVA 3ZZCA 3E3TA 5E0HA 1SFIA 1V2JT 1A0LA 2ODPA 1GMDG 1Z6JH 3UTUH 1TOCB 3KF2A 4U01A 1UTQA 4B74A 1VR1H 2PTCE 2R9PA 2FPZA 2FP7B 3M7TA 1BDAA 2Y81A 2ANWA 3QN7A 2SGDE 1LHFH 4BAQB 2J4IA 1HAOH 1TNKA 1ZTLA 2YNAA 5C20A 3LC5A 1AZZA 1O5CB 2GV7A 5A8XA 1PQ7A 3KQBA 2XW9A 3A7TA 4FU7A 2XWBI 1P03A 1ANCA 2FZZA 4NIVA 5E2PA 2EI8A 4KELA 2BD4A 1WU1A 3O8DA 5EPNA 1GDNA 1QQUA 1C2HA