2SGFE

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE01
1OWIA 2V3HH 3K2UA 2AS9A 4IN1A 4JK5A 4ABIA 4E05H 1RIWC 4BXSA 4BXWA 5L30H 4HZHA 2GT8A 4YT7H 2QCYA 4MQAA 4BAHB 1DE7H 1AB9B 3BSQA 3ZZAA 1KDQB 4ZHAA 2GCHF 2BD4A 4X2XA 3BEUA 3FP7E 4E7NA 1GDNA 2FOFA 4WJG2 9LPRA 2CJIA 2OQUA 1C1PA 3DFJA 5DP7A 1T8OA 1YLDA 1O2HA 1A1RA 3H7TA 5J4SA 1K9OE 3T27A 4MPXA 3SU3A 2BY6X 2ZFSA 3DA9B 4LOYH 4M7GA 4GHQA 1IQEA 4X2WA 4AGJA 1THRH 3VGCC 1MU6B 4Y8YA 1H9IE 2EC9H 1ARBA 1DX5M 2BVSH 4B71A 4Y0ZE 5FXLA 1E37B 1WAYB 3SNCA 2VIVA 1UVPA 4ZHLU 2FTLE 4ABEA 1OKXA 1V2RT 1CT0E 3EQ0H 1GI5A 3GDSA 4X2YA 4YOJA 2FEQH 3SNDA 1AZZA 2HWLB 1TMBH 2PKAB 1KLTA 1DUEA 3E16B 1EAWA 1SFIA 1F92A 1LPKB 4UFEH 1HGTH 4WH8A 1L4ZA 3IITA 5JBCS 2J2UA 4X8SH 4X1QU 3U69H 1NRPH 1AVXA 1P2IA 1NM6A 1SBWA 2UWOA 3MH5A 3MO6A 1HV7A 2ZFTA 1O33A 1MBQA 4DT7B 3RMNH 2CF8H 2QXGA 3A8AA 5AF9H 1GG6B 1AI8H 1O2JA 3RXHA 7GCHF 1EZUC 4MDSA 2BD3A 3SHAH 2RDLA 1V2NT 2PUXB 1T8NA 3KIDU 4ZXXH 3RLYH 1ZOMA 1M9UA 2SGDE 4FXGH 5DG6A 1YBWA 2FTMA 2VH0A 1LVYA 4CREA 1F5RA 1FY5A 1V2LT 5T6FA 4A1TA 1P09A 1HAYB 1ETTH 3DHKH 3D65E 2OD3B 2VIDA 5K0HA 2EI7A 2BMGB 2XC4A 2ZPSA 1WYKA 2P3TB 1O3NA 3V3MA 1NT1A 1O5EH 1CBWC 1F0UA 1A0JA 1N6XA 4J1YA 1D3DB 1W11U 1SGRE 2R3UA 3RXDA 1ORFA 2NU1E 1V2WT 3LGIA 4FVDA 1RTFB 1TGNA 2PR3A 3A85A 2FS8A 3P17H 2GMTC 1ETRH 1TGCA 1HNEE 2TGDA 1O3MA 4NSYA 4I33A 3T28A 4CHAB 2GKVE 3HGNA 1FONA 2FWWA 1ZPCA 2AIPA 1O3OA 1QNJA 1EP6A 1S82A 1GDQA 1C2IA 1LQEA 2XTTB 2SGQE 2SGAA 1A5HA 2ZZUH 2BDIA 1SG8B 1B0EA 1W2KH 3ZZCA 1G3CA 3S9CA 1YCPK 2FDAA 3TGKE 5GDSH 5C1XA 5A8YA 4TWWA 1JWTA 3I77A 1CGJE 1GBTA 1HXEH 1C2KA 4HFPB 5AVDA 1OWJA 1DY8A 1GHVH 2F83A 1Q2WA 3SUDA 3ZV9A 2JETC 1L0ZA 2R2MB 3MU4A 2SNWA 3MU0A 1N6YA 1G2MA 4Y10E 4Q7ZA 1C5OH 2Z9IA 3LPRA 3RDZA 3WY8A 2ZHWH 1ARCA 1P0SH 1QRXA 1V2ST 2ZGBH 1SGIB 2FZZA 5H4IB 4MPUA 1HUTH 2G4TA 5A8ZA 3KNXA 2Z3CA 3URCA 3MMGA 3SORA 2V0BA 2ZO3H 3TH3H 3RLWH 2AGEX 1FQ3A 2GZ8A 1NRSH 2UUKB 1YF4A 5CHAB 3GY7A 3CS7A 1ACBE 2OP9A 1O2GH 1PPEE 4JZDH 1UTNA 2H9HA 1J16A 3QUMP 1QA7A 1UTMA 3SV8A 3NWUA 3I78A 2G4UA 2QAAA 4IC6A 1LPGB 2C90B 1GBKA 1O5DH 2I6SA 4AZ2B 1AKSB 3RXMA 1S81A 3RXBA 2CMYA 1O2LA 5T6GA 3BTME 1FLEE 1QRWA 4YOGA 1FJSA 1XUIA 1PPHE 1TA6A 1DWCH 2HALA 3A84A 4AB8A 3UUZA 1C1TA 3E0NB 5LH8A 4WWYA 4QT8C 1UVSH 3SU2A 3SO3A 1V2JT 4O3UA 2O8MA 2BY5X 3D49H 2OBQA 2ZU1A 1QTFA 3SV6A 1LQDB 1AWFH 1D4PB 2LNCA 1K1NA 1GHAG 3GCHB 1K28D 2OC1A 3LJJA 1WCZA 4Y8XA 1SLXB 3ENSB 2QGRA 3KQEA 3ZVDA 3SZNA 1BB0B 4MNWA 3UNQA 2BDGA 2ANKH 5C1UA 2O8UA 3BN9A 1ESAA 2AIQA 2YNBA 4KTUA 1SGCA 2W5EA 1BMAA 3RM2H 1HAVB 5GIBA 5E8EH 2BOHB 1MQ5A 3M37A 1TMUH 1VCWA 2JKHA 2ZC9H 2Q1JA 3ZVEA 3VB5A 2FM2A 4NCYA 1IQGA 1K1IA 1U6QA 3BIUH 3KQDA 2KAIA 4CRAA 1O2SA 1MTUA 1MAXA 1UVUH 2UUFB 2DUCA 3M5NA 3SOSA 1O2NA 2G81E 4Q2KA 1QFKH 1GHBF 1Y3UA 4GHTA 1V2KT 2WINI 4FUHA 2BD5A 4K1TA 5EODA 4NIWA 3SI4H 5FPSA 2VIOA 4FU8A 3P8NA 3FANA 2SFAA 5E0HA 3GY3A 1GVZA 1QJ6B 1P3CA 5EGMA 2BY7X 3D62A 1FPCH 3QDZB 2LPRA 1P04A 4CHAC 1Y5AT 5L2ZH 3PV4A 3ZZDA 3AW1A 4O9VA 1ZJKA 2BDAA 3R0FA 1INCA 3RM0H 4K8YA 4AX9H 4CRCA 2XC5A 2CHAB 2VWOA 3RUOA 1MKXH 3MI4A 2UUYA 1YP9A 2QF0A 2ZU4A 4D9RA 4UD9H 1GI8B 4NIXA 3BTFE 3CENA 3ODFA 5C5OA 2J4IA 2P8OB 3SQEE 1BTZA 1PQAA 1HAPH 1HXFH 4Q7XA 1BRAA 1EAUA 1O37A 1C2FA 2VIQA 1TPOA 1BMMH 3GCTF 4AGKA 1KTTB 1DLKB 1SLUB 8ESTE 1UTQA 1XVMA 2FOBA 2PUQH 3L3TA 2H5DA 3ATIA 2C8YB 4X2VA 3NK8A 3ZVFA 4TPIZ 4U01A 3ZYDA 1G32B 2FX6A 3RU4T 2ILNA 2H9TH 1TPAE 4TYDA 4A92A 1O2KA 4CRFA 2O8WA 2ESTE 3LC5A 4Q80A 3ATMA 1ZHMA 3A89A 1KXDA 1W0ZU 2VU8E 1SGFA 1HAZB 4HGCA 2VH6A 1LHDH 2OINA 1D3PB 1ZSJA 1P11E 2BLVA 1YM0A 3F1SB 3A88A 2F91A 2Z9GA 2WYJA 4GUXA 2VVVA 3SJ8A 5J4QA 1GI0A 4UONA 1C1MA 2ZFQH 2RCEA 1BTHH 4FUDA 3TK6A 1NS3A 2OTVA 2ZGCA 1SGYE 4AORA 6GCHF 4D7GA 3HATH 1SLWB 3PMAB 4R8TB 2ZWLH 3A7TA 3G01A 2FXRA 3MWIU 1H4WA 1SB1H 2RA3A 4TY7A 3SU1A 3GCHC 5TCAA 1UO6A 2Z6BD 4E06H 1AWHB 3PTBA 1HAGE 2QXJA 1CGIE 1V3XA 2TGPZ 1FAXA 4MNYA 2C93B 1C2MA 4R0IA 2ODYB 3AAVA 4JZ1A 3ITIA 2ZHDA 4DIHH 2GCTC 2GV6A 2XNIA 4X8TH 5L6NH 1QA0A 5A09A 3A81A 3OX7U 1OWHA 1ZTLA 3CS0A 1CA0B 2ZHFH 2ALVA 2GV7A 2SGPE 1F0TA 4XFQA 3RXTA 3PTNA 1SSXA 3PLBA 2VGCB 3A7XA 3PO1B 3BF6H 3ATLA 3ZVCA 2VWMA 2AMPA 3SJIA 1T8LA 3U1IB 4AB9A 1JOUB 3HK6B 3SNBA 4WY3A 4A1XA 5FCKA 3NXPA 3UR9A 3LH1A 1TNJA 5BPEA 4O3TA 1Y3YA 2A2QH 2R0KA 1AQ7A 4XSKU 1HJAB 1TBZH 2CN0H 4CBOA 4X8VH 1C5YB 2ASUB 2BQWB 1GGDB 1C9PA 4ABDA 4LK4A 1UVTH 1NROH 1ZMLA 4OS7A 1CT2E 1DSUA 1S0RA 1BOQA 3Q77A 1Y3VA 3M3TA 1AMHA 1C4Y2 1EUFA 2ANWA 2WPIS 4ZUHA 1CSOE 1BUIA 2CHAC 1N1LA 1OP2A 2WPJS 2VNTA 1O2YA 3KL6A 2FX4A 1GCTB 2C8ZB 3MU5A 3T2NA 1C5NH 1GHXH 1LCYA 4DOQA 2P59A 5EW2H 1SGTA 1KY9A 5FPYA 1N8OC 2G52A 1TFXA 2GX4A 2PFEA 2BHGA 2P8OC 4WH6A 2EA3A 1C2JA 1BHXB 3OY6U 1E38B 1AUJA 2WPKS 1ZSKA 4BTIB 3UIRA 3MHWU 3RP2A 1SQOA 1J9CH 1PYTD 1BJUA 2G5VA 3T5FH 1C1OA 5EG4A 1O5GH 1DWDH 2Y5HA 2OUAA 3BTKE 4A7IB 1TGTA 1JRSA 5TJXA 4AOQA 1RTKA 6ESTA 1GJBB 4NA9H 1L1JA 2UWPA 2BDYA 3BEFB 1CA8B 1EJMA 2PGBB 3A8CA 4WXIA 1NZQH 1NN6A 4BAKB 1DOJA 4DIIH 2BQ6B 4X6OA 3QK1A 1O36A 1A3EH 1D3TB 1TQ0B 2WV5A 3IWMA 2ZECA 4GVUA 1HB0B 3SNEA 2PKSC 3T25A 1SC8U 4H6SB 1BQYA 2GZ9A 4X8UH 1A4WH 1YPHC 3LONA 2F9PA 3MU8A 1QURH 1NU9A 4WF8A 4YT6H 5C3NA 3QWCH 5A0AE 1E34B 1RTLA 3ZZ5A 1AE8H 1VJ9U 4DY7B 4AFZA 1C5SA 2HOBA 2C3SA 5DJ7A 1SHYA 4DCDA 1VCQA 3ZVBA 1LTOA 1HLTH 1G30B 3TJVA 1MKXK 3LC3A 2Z9KA 1J8AA 2FODA 3BTHE 1LVOA 4VGCC 2AFQB 1C9TA 4CRBA 4Y7AA 3SHCH 1CU1A 3EA9A 3LGYA 1SI5H 1O5CB 3SV9A 4JYUH 3GY4A 2XBVA 4I8KA 2PTCE 5ABWA 3V0XA 4DG4A 1CA0C 1VGCC 4DURA 1P2MA 2V35A 3UQOA 5HM9A 1JBUH 3DD2H 4D9QA 3B23B 5HYOA 4NIVA 2XCFA 5GCHF 1TX6A 4I8GA 1XXFA 2W26A 3DFLA 2J92A 3PO1C 3GDVA 2QV1A 2F9BH 1L1NA 1TMTH 2XC0A 4RN6A 3P8GA 1DICA 1FY8E 3K9XB 4SGAE 5BRRE 1NRNH 1AO5A 4YLUA 1QRZA 4OGXA 3LOXA 1O0DH 3UFAA 2FLBH 1CT4E 1TGSZ 2PSYA 2IOTA 2JH5D 1SGEE 1O2PA 5FBEA 1SLVB 5G4BA 1MKWH 4ABJA 1MD8A 3V7TA 1B7XB 1A5GH 3SGAE 3K6YA 2J94A 1GJ8B 1GL0E 3TJNA 1QBNA 3RMMH 4I8HA 1K1MA 4FUFA 3BTGE 1GWAA 1SPJA 1V2TT 2Y5GA 1GMDG 1QQUA 2ZFRH 1MTNB 1BCUH 1JIRA 2BY9X 2BDCA 3M5LA 1TOCB 3MFJA 1ANEA 1O2ZA 3KCGH 2W7SA 2BLWA 1GI7B 4YTAA 4ISNA 4O97A 2K1QA 1O3DA 2FO9A 1C2EA 3O8CA 1TPSA 1A2CH 1YPGH 3GY2A 2OBOA 3M7TA 4GPGA 4NZQA 3BTEE 1UTLM 3VB3A 2Q6DA 3RXFA 1ZYOA 1DANH 2BD9A 1GMHG 3PMBB 1MMJN 1V2QT 1O30A 1XKBC 3SQHE 3MH7A 1AN1E 1O2VA 1KLIH 1O3KA 1HAVA 1IHTH 1S5SA 4ZKNU 1D3QB 3SJOA 2XBWA 1DWBH 2Y80A 1MTVA 1SGQE 2D1JA 3RXCA 3URDA 1GBHA 4MPVA 4SGBE 5IYTA 1IHSH 4YO9A 3GOVB 1C2HA 3QO6A 1TGBA 4B73A 3SV2H 2ZDVH 3PWCA 1VZQH 4WVPE 1C2DA 1QBOA 1GBEA 4K8BA 3AW0A 2ODPA 3DT0H 4IN2A 2VVCA 4NWKA 2UWLA 1MBMA 1ANCA 4YZUA 3EA8A 3KGPA 3TNTA 4B75A 8LPRA 3M3SA 3O8DA 5I25A 3T26A 1T31A 1IQLA 1CHOF 1MZDA 2BY8X 2A5AA 2TGTA 3MO9A 1AVWA 1C2LA 1DSTA 1G3EA 3EAJA 2OQ5A 1XX9A 2Y6TA 1XUJA 2A0QB 1T4UH 2A5KA 4CBNA 1Q3XA 1G2LA 1Q31A 4ZKOU 4ABBA 2STAE 2FOHA 3M7UA 3STJA 5ESTE 1GVKB 1NTPA 1AB9C 1IQNA 1C1NA 1H1BA 1NFXA 2ZDMA 2Q6FA 1ID5H 3MNBA 1Z8RA 1F5KU 5CE1A 3BTQE 3S9BA 3S69A 1GHWH 2HNTE 1QR3E 1LVMA 1AIXH 1GJ5H 3H5CB 2A4GA 1IAUA 4GCHF 1PPCE 1YPLH 1K1LA 2ZDNA 1KYNA 1TA2A 3P8OA 1B5GH 2ZKSA 1NO9H 1S0QA 3SJKA 4X1NU 2VIWA 4YOIA 8KME2 1FY1A 3KEEA 3ESTA 1Y5BT 3Q76A 2PHBA 1O2UA 1UMAH 3C27B 1H9HE 1UK4A 5EPYA 4X1PU 4BOHA 2JH0D 3UY9A 3T29A 3M5MA 5EQSA 1PPBH 5GPIB 3Q3KA 1WU1A 4F49A 4ABHA 4YESB 4MPWA 3UTUH 1LHEH 2F9VA 3M36A 1O2WA 2H5CA 4D7FA 2G8TA 1QHRB 1TRNA 3SUGA 3C1KA 2HPPH 4UE7H 2M5TA 1C1UH 1GG6C 3UQVA 2BX4A 2C8XB 1F7ZA 2W3KA 1DS2E 1T4VH 3TIUA 3OU0A 2NU4E 1F0RA 3A82A 1C1RA 3BG4B 5JBBS 4Y6DA 2A2XH 2BDBA 3MTYA 3U8OH 1YPMH 4AFQA 2PV9B 2ZPRA 5AFYH 1OSSA 2AYWA 1O32A 1UTPA 3GCOA 3E91A 5EQRA 1PQ8A 1A5IA 1C5UA 3TH4H 2B0FA 1MUEB 3RXIA 2AGIX 2ANYA 1LPZB 3HGPA 4MVNA 1V2UT 1AVGH 2FOMB 3NKKA 4A1VA 3KN2A 1K1OA 2Z3DA 1QBVH 2GD4B 1QJ7B 4INLA 1MKWK 2FOAA 1P01A 2C4FH 2BXTH 2B7DH 4MNVA 1HIAB 2VVUA 1YPJH 1P3EA 2ZP0H 1DXWA 1VITF 2VB0A 2QY0B 4BNRA 1FIWA 1RS0A 3NZIA 4I32A 3VPKA 1K21H 2AGGX 4KKDA 1CHGA 3RXLA 1EOLA 1DUAA 1ZPZA 5JPMH 1MH0A 1V2MT 1X7AC 1FZZA 2J9NA 1ZGVA 3BTTE 4KTCA 1P2JA 1YYY1 2AMQA 1GJ6A 2VWLA 2ZU2A 2TRMA 2ZQ1A 1GBAA 1VR1H 1EAXA 3SBKA 3QZRA 3GY5A 2PW8H 3LDXH 2ZTYA 1GJDB 1FUJA 2ZF0H 3MNXA 3N7OA 1GL1A 3FAOA 2VWNA 5DGJA 5A2MH 1KTSB 3PLPA 4GAWA 1CVWH 2XWAA 1A7SA 1OWKA 3NPSA 4Y76A 5DO4H 1SHHB 4GSOA 4ASHA 3BG8A 6CHAB 2FLRH 1ELVA 2WYGA 4X1SU 5EU8A 4ISOA 2QYIA 2Z3EA 1TE0A 2B5TB 1O35A 4ISLA 3MYWA 1EATA 5CHAC 1S6FA 4FVBA 4X6MA 1ZJDA 1THPB 2G55A 1FAKH 2IPHA 2Z7FE 5JB8S 2BYAX 4H4FA 2RA0A 1DY9A 4KGAA 4NWLA 1GBIA 3B8JA 3A7VA 3P95A 1S83A 1CE5A 2ZDLA 4DW2U 3A87A 5LGOA 1PFXC 3A7YA 1MTSA 4HI3A 3QN7A 2BD7A 1SR5C 3A86A 2Y5FA 3M61U 5C5NA 4INKA 1PPFE 1KIGH 1ZZZA 3ZZ6A 3FP8E 3TITA 1MCTA 1UCYH 5JB9S 4A5TS 1P2NA 5C20A 4LZ4B 1O3PB 1G3DA 3HK3B 1ELDE 1PJPA 1DPOA 4OS5A 2TBSA 1K22H 4H42U 3RXUA 1AGJA 1UVOA 4IW4E 4FUCA 1BDAA 1EASA 1V2OT 3SU5A 1FDPA 1ZHRA 1ZGIA 1BTXA 3LT3A 1HBTH 1BRBE 1QB9A 4KTSA 1Z71A 3RXKA 2VIPA 1HAIH 5C2ZA 1F0SA 3RXJA 1G37A 2Y7XA 1EXFA 1NFYA 4FUEA 5HGGA 2QC2A 1C5ZB 6LPRA 5FX5A 4B2CA 3D23A 2DE9A 2BDHA 4Z6AH 1GMDF 1DITH 1DLEA 1ETSH 2BVXH 3FP6E 4I31A 1O3GA 1O3IA 3F9EA 4AN7A 4U2WA 2XBXA 2Y81A 1C5LH 3IG6B 4TY6A 1LDTT 4UFGH 1J17T 1KDQA 1GPZA 1EB2A 2OC7A 3RU4D 4NSVA 1ZMNA 2KAIB 1RIWB 3ZYEA 1W14U 4CH8B 1P9SA 1BTYA 1GDUA 1YGCH 1OYTH 2Y82A 3S7KB 4ESTE 2A4OA 4Y71A 1V6DA 1KXEA 3UREA 3O8RA 1C5MD 3PROA 4LXBH 3STIA 3M5OA 3E6PH 3GY8A 4ZH8A 3BEIB 1S84A 3T62A 1BHXF 3LH3A 2ZGXH 5DP3A 3PMHB 1IQMA 3UNRA 3LGTA 5DP5A 1GMHF 2THFB 3R3GB 1AD8H 3UWJH 3ZZ7A 1E36B 3EE0B 1TBQH 1ANBA 3M35A 1O2OA 1ZRBA 1RXPA 1C5XB 1WTGH 4OS2A 1UTJA 1BMNH 1GBCA 2ZU3A 3RXGA 3VGCB 2HPQH 1KLJH 1P05A 1ZPBA 3LGUA 1WV7H 4BAMB 2PKAA 4ZXYH 3I29A 1C5QA 2WV4A 2Z9JA 4HTCH 4WXVA 4PROA 1W7XH 6CHAC 2BD8A 1TRYA 4OS4A 4A6LA 1EZQA 1MD7A 2A4RA 1AHTH 2O8LA 3MH4A 4J2YB 2BD2A 1PPGE 1UTOA 1W3CA 3GY6A 4K3JA 1WBGB 2ZHQH 3QX5H 2V6NA 5GXPA 1TOMH 4MG3A 3UOPA 1ZMJA 1NRRH 1VITH 1TRMA 1ELEE 4CR9A 3M7QA 1BTUA 3ELAH 2FI4E 3ZVAA 1O3AA 2ANMH 2AEIH 4I7YH 4FUIA 3FZDA 1LHFH 4F4OC 4GLYA 1ZLRA 4NA7A 5HMAA 2IN2A 1TONA 1ABJH 1L1GA 1XKAC 1C5PA 1E35B 3A7WA 1CQQA 2R2WU 2ZA5A 5FHTA 1AFEH 1C5WB 2YNAA 2A7HA 1RFNA 1ZTJA 3FFGA 3LGVA 4AG2A 2GP9B 3LU9B 4K2YA 1BBRH 1O31A 1UK3A 1GI3A 1HJ9A 1QCPA 1H8DH 3U8RH 1BBRE 3Q3XA 3RXQA 2NU3E 1GMCG 1IQIA 1UHBB 1WQSA 9ESTA 1FXYA 1BT7A 4Y7BA 1A61H 1AZ8A 1RRKA 1J15A 4ZAEA 1CBWB 1S6HA 2XXLA 3GCTG 4IMQA 1HCGA 5DP8A 5C1YA 2WUBA 3KHVA 5F8ZA 1UJ1A 4E7RG 4FUJA 5AFZH 2B8OH 2XCNA 4ZHMU 3UR6A 1RD3B 4BANB 3Q00A 1BA8B 2GMTB 1Y3XA 4THNH 1O5AB 1O3HA 1Y8TA 4RKJB 2VGCC 4ABFA 4Y79A 2I6QA 2PTNA 1O3LA 1XVOA 1SMFE 4KP0A 4NFEA 5F03A 1GBLA 1AFQB 4ZKSU 1Z8JB 3SNAA 1TX8A 1BTWA 1DFPA 3CP7A 1DT2A 1YLCA 5FPTA 3KQBA 1HDTH 1HJAC 3LJOA 1Z8GA 3SUEA 1C1SA 1GHAF 1EB1H 2JETB 1AUTC 4DVAU 1GGDC 3GICB 5EXMA 1TAWA 6GCHG 3NUMA 1O38A 1FPHH 1TLDA 4AFSA 2G51A 4JYTA 1W7GH 2GDEH 4XE4A 3TJUA 2AH4X 1DM4B 2HGTH 4XOJA 1UCYK 1O2IA 1GCTC 2BM2A 1O3JA 1FIZA 1O5FH 1T7CA 1HPGA 1EZSC 1AKSA 3BV9B 2QXHA 1LMWB 5EXNA 3AAUA 1UTKA 5C67A 2BOKA 1NESE 2TIOA 1XUHA 1FV9A 2ZI2H 3E1XB 2A32A 1P02A 3S9AA 1D6WA 4WMFA 2FESH 4NG9H 5T6DA 4K69A 1WTHD 2J38A 3W95A 4Q7YA 2GVFA 4AFUA 4OS6A 1AY6H 2FOCA 1KXCA 3ZZ9A 3OSYA 1O2XA 3L33A 4JCNA 1QL8A 1TX7A 2STBE 3B9FH 3TK5A 1SGPE 1V2VT 3DUXH 3ZZ8A 3E3TA 2XW9A 1GI2A 5FX6A 4JZFH 3RXSA 3P92A 2OC8A 1KXAA 1IQHA 1GI6A 1BRCE 1SGDE 4K1EA 3MNCA 4X6PA 3QLPH 1D6RA 2D2DA 2UUJB 1FY4A 3PWBA 5DP4A 3TGIE 4UFFH 1IOEA 3TU7H 1SOTA 1GHYH 1A0HB 4ZKRU 3UWIA 3OY5U 5JBTA 3ODDA 1P03A 2QF3A 1OWDA 1GI1A 1P9UA 1ESBA 3SU0A 1XUFA 1YPEH 5T3HA 1YKTA 1SGFG 1OWEA 2WPHS 4FU9A 2A7CA 3GYMA 1SGNE 1HIAA 1EPTB 2H9EH 3LIWA 1O34A 5GJ4B 3BIVH 1HAOH 5FAHA 1C1QA 4RKOB 2HLCA 1FMGA 1DDJA 5ETXA 2WUCA 3U9AH 1ANDA 1LHGH 3EYDA 1ELBA 4K5ZA 1BZXE 1GJAB 4XBBA 2ZHEH 2XWBI 1GVLA 2DE8A 1GBJA 4XDEA 1G9IE 3O8BA 4WMEA 1MU8B 8GCHG 1PQ7A 3A8DA 2ZEBA 2HNTC 5GWZA 1QY6A 3ATKA 2NU2E 3U8TH 3E0PB 3RXVA 4Z0KA 5DP9A 3LKWA 1ZRKA 1FNIA 3ATWA 2R0LA 3A7ZA 2WPLS 5CMXH 5EPNA 1Y5UT 2Q6GA 1AFQC 1O3CA 1RJXB 3TPIZ 5DK1A 5E0GA 1NPMA 5F6MA 4IC5A 3E8LA 1TNKA 3P6ZB 2IJOB 1GBMA 2FIRH 3K65B 1ZR0A 3QTOH 4BAOB 2GDDA 1BBRK 4BAQB 3Q3YA 1NC6A 3GYLB 5ESBA 2ULLA 1SVPA 3MH6A 3BTDE 1MTNC 1C1WH 1CO7E 2FYRA 3RC6A 2OLGA 2PGQB 4CR5A 1OP0A 3RC5A 1QJ1B 1LVBA 1ELCA 3F9HA 2SGFE 2AERH 2BLOA 1D9IA 2F9OA 2ZCLP 1RGQA 5LPFA 1TPPA 3GDUA 3F9GA 1GJ9B 4BTTB 4IGDA 1EZXC 2FOGA 1OP8A 2SNVA 5L2YH 5GCHG 1UK2A 3V13A 5EXLA 2GCHG 1G36A 2HVXA 2VINA 4NA8A 3SJ9A 3GCNA 2QA9E 2QIQA 4UDWH 3EDXB 1BTPA 3HKJB 4NGAH 1P10A 1C4U2 3PM3A 1T8MA 3PB1E 5HM2A 5TCCA 3RXRA 1W10U 2ZCKP 4BTUB 3FZZA 1GJ7B 1YC0A 2GZ7A 2BLQA 3V12A 1O2TA 2PWXA 4XBCA 3KQCA 4ABGA 2ZDAH 3F6UH 4X0WU 5E0JA 2A31A 1OS8A 1C1VH 2A7JA 2ZFPH 2CXVA 3JZ1B 3AVZA 3P8FA 2GCTB 4FUGA 1KXFA 2BQ7B 2O8TA 2F9UA 2YOLA 5F8XA 3MNSA 1GJ4H 3F68H 5JYIA 1GBDA 2ZU5A 3UPEA 3A83A 5E2OA 2ZCHP 3PMJA 2ZGJA 1EPTC 2ZQ2A 2EEKA 3RC4A 4JK6A 1ELGA 2QN5T 2ZNKH 5PTPA 1OXGA 4OS1A 2CV3A 1NFWA 1TBRH 4FUBA 1SFQB 1MZAA 5FBIA 1IQJA 2AMDA 2GGVB 1LKAA 3UOUA 2P3UB 3A8BA 2WPMS 2FYQA 1TB6H 3VB6A 1MTWA 3RXEA 7KMEH 7GCHG 2G5NA 1T32A 1HAHH 1ELAA 1LHCH 4TWYA 1P06A 3VFEA 1EP5A 1NRQH 4AYYB 1BITA 1JIMA 3M3VA 4WMDA 2ALPA 1BJVA 1A0LA 3JZ2B 3TGJE 5LPRA 2FI5E 1DVAH 1K1JA 1GJCB 1O2MA 3ZVGA 3HPTB 1EQ9A 4D8NA 5AHGH 1TYNA 1ZTKA 2BZ6H 4K60A 4ZROA 1GMCF 5HXFA 3GISB 1N8OB 3EGKH 3S7HB 1VJAU 5A8XA 5DP6A 1DXPA 1TALA 1XUKA 2ZFFH 3TH2H 2FS9A 4OGYA 7ESTE 2BTCE 1P57B 3LGWA 2XRCA 3RXAA 1QB6A 3H7OA 2A5IA 2W3IA 4MNXA 1P8VC 2P3FH 4TPYA 4YLQH 5DPAA 2ZTXA 3RMOH 4Y8ZA 3FVFB 3SU6A 1QGFA 4CH2B 3ZV8A 1CHOG 1EOJA 2OXSA 3PYHA 1C5VA 1QIXB 1XUGA 1VCPA 1C5TA 1HYLA 2P93A 4RSPA 1FY3A 4UEHH 1KXBA 5A0BA 3QGNB 3PLKA 3QZQA 5K7RA 3OTJE 2BX3A 1GCDA 3SU4A 1UCYE 1FN8A 1OYQA 1GHZA 3TLOA 1P12E 1EJAA 2PKSB 5E2PA 1O39A 2H6MA 2JH6D 3ZZ4A 4DJZB 1FN6A 1Y59T 1KSNA 1UHBA 4XBDA 1W13U 3BG4C 1WUNH 5EQQA 1H9LB 1J14A 1EKBB 2CGAA 1TNHA 1YCPM 2P95A 1F5LA 2FI3E 3VB7A 4B1TA 3S0NA 1Z1IA 1BIOA 1WQVH 4GCHG 4B2BA 1ZHPA 1AU8A 5IDKA 5EOKA 1YPKH 2D8WA 3RMLH 3TNSA 1L2EA 4VGCB 1BMLA 2ZTZA 3L6PA 1PPZA 3EA7A 4B76A 1ABIH 1EAIA 3NCLA 1C5RA 1QL9A 3F9FA 4IBLH 1TABE 3SGQE 4ZMAH 2GTBA 2ZGHA 1WOFA 1TNGA 1C2GA 1V2PT 3HKIB 2ZIQH 2EI8A 1ZSLA 1EX3A 2BVRH 1ELTA 1VGCB 4IS5A 1NY22 4B74A 3TK9A 5LPEA 4H6TA 1O2RA 4D76A 4Y11E 3MU1A 3MO3A 1PQ5A 2CF9H 3TJOA 3VXEH 1HAXB 2BB4A 1NU7B 2J34A 1F2SE 2XYAA 4K1SA 4JZEH 3W94A 1HRTH 4NIYA 1CGHA 1HJ8A 4U30A 5I46H 3K6ZA 2A45B 1GI4A 1SL3A 1LKBA 4I8JA 1Y3WA 2EI6A 1O2QA 2OC0A 2TGAA 3BTWE 4UFDH 3P70B 3RXPA 1O3FA 1EJNA 2GT7A 2Z94A 3QGJA 1G3BA 5JDUB 4YM9A 1E0FD 1ESTA 1SQAA 2XBYA 4NZLA 2O9QA 3QTVH 4O03A 2P94A 3U98H 3KF2A 1XM1A 1JXPA 2TPIZ 2Z9LA 2SGEE 2G00A 5EW1H 2V3OH 4AG1A 4B2AA 2H1UA 3SI3H 3SUFA 7LPRA 4IMZA 1C4V2 3VB4A 3RU4E 3SW2B 2OCVB 5SGAE 4LZ1H 2ODQA 3MOCA 1LO6A 2VJ1A 1P2KA 4MLFB 3SV7A 1MAYA 1L4DA 1TIOA 4KELA 2RG3A 1GHBG 4I8LA 4ABAA 3U1JB 4NFFA 1O3BA 1H8IH 2R3YA 1ELFA 1W12U 1HFDA 1TWXB 1WSSH 1A3BH 1YCPH 1P2OA 1MCVA 1THSH 1Z6EA 3ZZBA 2B9LA 1VITG 1OPHB 4JZIA 3OYPA 1AE5A 1Z1JA 4ISHH 3UNSA 4X6NA 2HRVA 1GBFA 3SGBE 5B6OA 1GI9B 3VEQB 8GCHF 2FPZA 4AYVB 3AASA 1O5BB 2Y7ZA 3SN8A 2A4QA 2W7UA 1FI8A 1IQFA 1PYTC 2FMJA 2PLXA 2J95A 1QB1A 2D26C 2QXIA 5FCRA 2BZAA 4JMYA 2F3CE 4U32A 1OOKB 2HNTF 4CRGA 1SQTA 1S85A 1Z7KA 2ZDKA 1DWEH 1O3EA 2FP7B 1EPTA 1B0FA 1W8BH 2F9NA 3E90B 4FU7A 1Z8IB 5JBAS 5A0CA 4ISIH 1OX1A 2BXUH 2NU0E 1A46H 3TVJB 3RXOA 2ZG0H 1XMNB 2P16A 2FOEA 1TNLA 2C8WB 1K1PA 2R9PA 4JYVH 4MTBA 1YPHE 1QQ4A 3ZZ3A 1BRUP 1JMOH 5DKMA 1JRTA 3VXFH 3A80A 1MQ6A 1TQ7B 2H2ZA 1IQKA 1P2QA 2ZPQA 4CRDA 1NFUA 1QL7A 4X1RU 1GBBA 4Y0YE 4INHA 2A1DB 2NWNA 1K2I1 1Z6JH 1W0YH 2PSXA 1SOZA 1XXDA 5F8TA 4DGJA 1TNIA
chains in the Genus database with same CATH superfamily
1OWIA 2V3HH 3K2UA 2AS9A 4IN1A 4JK5A 4ABIA 4E05H 1RIWC 4BXSA 4BXWA 5L30H 4HZHA 2GT8A 4YT7H 2QCYA 4MQAA 4BAHB 1DE7H 1AB9B 3BSQA 3ZZAA 1KDQB 4ZHAA 2GCHF 2BD4A 4X2XA 3BEUA 3FP7E 4E7NA 1GDNA 2FOFA 4WJG2 9LPRA 2CJIA 3MQKC 2OQUA 5DSFA 1C1PA 3DFJA 5DP7A 1T8OA 1YLDA 1O2HA 1A1RA 3H7TA 5J4SA 1K9OE 3T27A 4MPXA 3SU3A 4ACBA 2BY6X 2ZFSA 3DA9B 4LOYH 4M7GA 4GHQA 1IQEA 4X2WA 4AGJA 1THRH 3VGCC 1MU6B 4Y8YA 1H9IE 2EC9H 1ARBA 1DX5M 2BVSH 4B71A 4Y0ZE 5FXLA 1E37B 1WAYB 3SNCA 2VIVA 1UVPA 4ZHLU 2FTLE 3VG8A 4ABEA 1OKXA 1V2RT 1CT0E 3EQ0H 1GI5A 3GDSA 4X2YA 4YOJA 2FEQH 3SNDA 2KZ4A 1AZZA 2HWLB 1TMBH 2PKAB 1KLTA 1DUEA 3E16B 1EAWA 1SFIA 1F92A 1LPKB 4UFEH 1HGTH 4WH8A 1L4ZA 3IITA 5JBCS 2J2UA 4X8SH 4X1QU 3U69H 1NRPH 1AVXA 1P2IA 1NM6A 1SBWA 2UWOA 3MH5A 3MO6A 1HV7A 2ZFTA 1O33A 1MBQA 4DT7B 3RMNH 2QF4A 2CF8H 2QXGA 3A8AA 5AF9H 1GG6B 1AI8H 3FOAA 1O2JA 3RXHA 7GCHF 1EZUC 4MDSA 3UAIC 2BD3A 3SHAH 2RDLA 1V2NT 2PUXB 1T8NA 3KIDU 4ZXXH 3RLYH 1ZOMA 1M9UA 2SGDE 4FXGH 5DG6A 1YBWA 2EY4C 2FTMA 2VH0A 1LVYA 4CREA 1F5RA 1FY5A 1V2LT 5T6FA 4A1TA 1P09A 1HAYB 1ETTH 3DHKH 3D65E 2OD3B 2VIDA 3F2GA 5K0HA 2EI7A 2BMGB 2XC4A 2ZPSA 1WYKA 2P3TB 1O3NA 3V3MA 1NT1A 1O5EH 1CBWC 1F0UA 1A0JA 1N6XA 4J1YA 1D3DB 1SQRA 1W11U 1SGRE 2R3UA 3RXDA 1ORFA 2NU1E 1V2WT 3LGIA 4FVDA 1RTFB 1TGNA 2PR3A 3A85A 2FS8A 3P17H 2GMTC 1ETRH 1TGCA 1HNEE 2TGDA 1O3MA 4NSYA 4I33A 3T28A 4CHAB 2GKVE 3HGNA 1FONA 2FWWA 1ZPCA 2AIPA 1O3OA 1QNJA 1EP6A 1S82A 1GDQA 1C2IA 1LQEA 2XTTB 2WSSD 2SGQE 2SGAA 1A5HA 2ZZUH 2BDIA 2RFKC 1SG8B 1B0EA 1W2KH 3ZZCA 1G3CA 3S9CA 1YCPK 1OHHD 2FDAA 3TGKE 5GDSH 5C1XA 5A8YA 4TWWA 1JWTA 3I77A 1CGJE 1GBTA 1HXEH 1C2KA 4HFPB 5AVDA 1OWJA 1DY8A 1GHVH 2F83A 1Q2WA 3SUDA 3ZV9A 2JETC 1L0ZA 2R2MB 3MU4A 2SNWA 3MU0A 1N6YA 1G2MA 4Y10E 4Q7ZA 2J97A 1C5OH 2Z9IA 3LPRA 3RDZA 3WY8A 2ZHWH 1ARCA 1P0SH 1QRXA 1V2ST 2ZGBH 1SGIB 2FZZA 5H4IB 1WXRA 4MPUA 1HUTH 2G4TA 5A8ZA 3KNXA 2Z3CA 3URCA 3FO8D 3MMGA 3SORA 2LELA 2V0BA 2ZO3H 4B6EA 3TH3H 3RLWH 2AGEX 1FQ3A 2GZ8A 1NRSH 2UUKB 1YF4A 5CHAB 3GY7A 3CS7A 1ACBE 2OP9A 1O2GH 1PPEE 4JZDH 1UTNA 2H9HA 1J16A 2WPDD 1W0KD 1QA7A 3QUMP 1UTMA 3SV8A 3NWUA 3I78A 2QF5A 2G4UA 2QAAA 4IC6A 1LPGB 2C90B 1GBKA 1O5DH 2I6SA 4AZ2B 1AKSB 3RXMA 1S81A 3RXBA 2CMYA 1O2LA 5T6GA 3BTME 1FLEE 1QRWA 4YOGA 1FJSA 1XUIA 1PPHE 1TA6A 4TT3D 1DWCH 2HALA 3A84A 4AB8A 3UUZA 1C1TA 3E0NB 5LH8A 4WWYA 4QT8C 1UVSH 3SU2A 3SO3A 1V2JT 4O3UA 5C94A 2O8MA 1NBME 2BY5X 3D49H 2KR7A 2OBQA 2ZU1A 1QTFA 3SV6A 1LQDB 1AWFH 1D4PB 2LNCA 1K1NA 1GHAG 3GCHB 1K28D 2OC1A 3LJJA 3OEED 1WCZA 4Y8XA 1SLXB 3ENSB 2QGRA 3KQEA 3ZVDA 3SZNA 1BB0B 4MNWA 3UNQA 2BDGA 2ANKH 5C1UA 2O8UA 3N99A 3BN9A 1ESAA 2AIQA 2YNBA 4KTUA 1H8HD 1SGCA 1BMAA 2W5EA 2XNDD 3RM2H 1HAVB 5GIBA 5E8EH 2BOHB 1MQ5A 3M37A 1TMUH 1VCWA 2JKHA 2L74A 2ZC9H 2Q1JA 3ZVEA 3N7EA 3VB5A 2FM2A 4NCYA 1IQGA 1K1IA 1U6QA 3BIUH 3KQDA 2KAIA 2KCYA 1O2SA 4CRAA 1MTUA 1MAXA 1UVUH 2UUFB 2DUCA 3M5NA 3SOSA 1O2NA 2G81E 4Q2KA 1QFKH 1GHBF 1Y3UA 4GHTA 1V2KT 2WINI 4FUHA 2BD5A 4K1TA 5EODA 4NIWA 3SI4H 5FPSA 4RT1A 2VIOA 4FU8A 3P8NA 3FANA 2SFAA 5E0HA 3GY3A 1GVZA 1QJ6B 1P3CA 5EGMA 2BY7X 3D62A 1FPCH 3QDZB 2LPRA 1P04A 4CHAC 4XD7D 1Y5AT 5L2ZH 3PV4A 3ZZDA 3AW1A 4O9VA 1ZJKA 3N7DA 2BDAA 3R0FA 1INCA 3RM0H 4K8YA 4AX9H 4CRCA 2XC5A 2CHAB 2VWOA 2KCOA 3RUOA 1MKXH 3MI4A 2UUYA 1YP9A 2QF0A 2ZU4A 4D9RA 4UD9H 1GI8B 4NIXA 3BTFE 3CENA 5B6LA 3ODFA 5C5OA 3KYFA 2J4IA 2P8OB 3SQEE 1BTZA 1PQAA 1HAPH 1HXFH 4Q7XA 1BRAA 1EAUA 1O37A 1C2FA 2VIQA 1TPOA 1BMMH 3GCTF 4AGKA 1KTTB 1DLKB 1SLUB 3PRBA 8ESTE 1UTQA 1XVMA 2FOBA 2PUQH 3L3TA 2H5DA 3ATIA 2C8YB 4X2VA 3NK8A 3ZVFA 5EJZA 4TPIZ 4U01A 1YWUA 3ZYDA 1G32B 2FX6A 3RU4T 2ILNA 2H9TH 1TPAE 4TYDA 4A92A 1O2KA 4CRFA 3OAAD 2JJ2D 2O8WA 2ESTE 3LC5A 4Q80A 3ATMA 1ZHMA 3A89A 1KXDA 1W0ZU 3OEHD 2VU8E 1SGFA 1HAZB 4HGCA 2VH6A 1LHDH 2OINA 1D3PB 1ZSJA 1P11E 2BLVA 1YM0A 3F1SB 3A88A 2F91A 2Z9GA 2WYJA 4GUXA 2VVVA 3SJ8A 5J4QA 1GI0A 3SYJA 4UONA 1C1MA 2ZFQH 2RCEA 2WV9A 1BTHH 4FUDA 3TK6A 1NS3A 2OTVA 5EJ1A 2ZGCA 1SGYE 4AORA 6GCHF 4D7GA 3HATH 1SLWB 3PMAB 4R8TB 2ZWLH 3A7TA 3G01A 1UW7A 2FXRA 3MWIU 1H4WA 1SB1H 2RA3A 4TY7A 3SU1A 4FOUC 3GCHC 5TCAA 1UO6A 3FN8A 2Z6BD 4E06H 1AWHB 4HG6A 3PTBA 1HAGE 2QXJA 1CGIE 1V3XA 2TGPZ 1FAXA 3CNRA 4MNYA 2C93B 1C2MA 4R0IA 2ODYB 3AAVA 4JZ1A 3ITIA 2ZHDA 4DIHH 2GCTC 2GV6A 2XNIA 4X8TH 5L6NH 1QA0A 5A09A 3A81A 3OX7U 1OWHA 1ZTLA 3CS0A 1CA0B 2ZHFH 2ALVA 2GV7A 2SGPE 1F0TA 4XFQA 3RXTA 3PTNA 1SSXA 3F0PA 3PLBA 2VGCB 3A7XA 3PO1B 3BF6H 3ATLA 3ZVCA 2VWMA 2AMPA 3SJIA 1T8LA 3U1IB 4AB9A 1JOUB 3HK6B 3SNBA 4WY3A 4A1XA 5FCKA 3NXPA 3UR9A 3LH1A 1TNJA 5BPEA 4O3TA 1Y3YA 2A2QH 2R0KA 1AQ7A 4XSKU 2KM0A 1HJAB 1TBZH 2CN0H 4CBOA 4X8VH 1C5YB 2ASUB 2BQWB 1GGDB 1C9PA 4ABDA 4LK4A 1UVTH 1NROH 1ZMLA 4OS7A 1CT2E 1DSUA 1S0RA 1BOQA 3Q77A 1Y3VA 3M3TA 1AMHA 1C4Y2 1EUFA 2ANWA 2WPIS 4ZUHA 1CSOE 4XRNA 1BUIA 2CHAC 1N1LA 1OP2A 2WPJS 2VNTA 1O2YA 3KL6A 2FX4A 1GCTB 2C8ZB 3MU5A 3PV2A 3T2NA 1C5NH 1GHXH 1LCYA 4DOQA 2P59A 5EW2H 2V3MA 1SGTA 4ACAA 1KY9A 2WHXA 5FPYA 2J98A 1N8OC 2G52A 1TFXA 2GX4A 2PFEA 2BHGA 2P8OC 4WH6A 4B6FA 2EA3A 1C2JA 1BHXB 3OY6U 3UB0A 1E38B 1AUJA 2WPKS 1ZSKA 4BTIB 1E1RD 3UIRA 3MHWU 3RP2A 1SQOA 1J9CH 1PYTD 3F2HA 3U28C 1BJUA 2G5VA 3T5FH 1C1OA 5EG4A 1O5GH 1DWDH 2Y5HA 2OUAA 3BTKE 4A7IB 1TGTA 1JRSA 5TJXA 4AOQA 1RTKA 6ESTA 1GJBB 4NA9H 1L1JA 2UWPA 2BDYA 3BEFB 1CA8B 1EJMA 2PGBB 3A8CA 4WXIA 1NZQH 1NN6A 4BAKB 1DOJA 4DIIH 2BQ6B 4X6OA 3QK1A 1O36A 1A3EH 1D3TB 1TQ0B 2WV5A 3IWMA 2RDEA 2ZECA 4GVUA 1HB0B 3SNEA 2PKSC 3T25A 1SC8U 3WW7A 4H6SB 1BQYA 2GZ9A 4X8UH 1A4WH 1YPHC 2LP6A 3LONA 2F9PA 3MU8A 1QURH 1NU9A 4WF8A 4YT6H 5C3NA 3QWCH 5A0AE 1E34B 1RTLA 3ZZ5A 1AE8H 1VJ9U 4DY7B 4AFZA 1C5SA 2HOBA 2C3SA 5DJ7A 1SHYA 4DCDA 1VCQA 3ZVBA 1LTOA 1HLTH 1G30B 3TJVA 1MKXK 1S6LA 3LC3A 2Z9KA 1J8AA 2FODA 3BTHE 1LVOA 4VGCC 2AFQB 2F43B 1C9TA 4CRBA 4Y7AA 3SHCH 1CU1A 3EA9A 3LGYA 1SI5H 1O5CB 3SV9A 4JYUH 3GY4A 2XBVA 4I8KA 2PTCE 5ABWA 3V0XA 4DG4A 1CA0C 1VGCC 4DURA 1P2MA 2V35A 3UQOA 5HM9A 1JBUH 2F4LA 3DD2H 4D9QA 3B23B 5HYOA 4NIVA 2KX4A 2XCFA 5GCHF 1TX6A 4I8GA 1XXFA 2W26A 3DFLA 2J92A 3PO1C 5C0UA 3GDVA 2QV1A 2F9BH 1L1NA 1TMTH 2XC0A 3NRLA 4RN6A 3P8GA 1DICA 4DT4A 1FY8E 3K9XB 4SGAE 5BRRE 1NRNH 1AO5A 4YLUA 1QRZA 4OGXA 3LOXA 1O0DH 3UFAA 4ZCNA 2FLBH 1CT4E 1TGSZ 1W0JD 2PSYA 2IOTA 3EE7A 2JH5D 1SGEE 1O2PA 5FBEA 1SLVB 5G4BA 1MKWH 4ABJA 1MD8A 3V7TA 1B7XB 1A5GH 3SGAE 3K6YA 2J94A 1GJ8B 1GL0E 3TJNA 1QBNA 3RMMH 4I8HA 1K1MA 4FUFA 3BTGE 1GWAA 1SPJA 1V2TT 2Y5GA 1GMDG 1QQUA 2ZFRH 1MTNB 4ASUD 1BCUH 1JIRA 2BY9X 2IPQX 2BDCA 3M5LA 1TOCB 3MFJA 1ANEA 1O2ZA 3KCGH 2W7SA 2BLWA 2L6OA 1GI7B 4YTAA 4ISNA 4O97A 2K1QA 1O3DA 2FO9A 1C2EA 3O8CA 1TPSA 1A2CH 1YPGH 3GY2A 2OBOA 3M7TA 4GPGA 4NZQA 3BTEE 1UTLM 3VB3A 2Q6DA 3RXFA 1ZYOA 1DANH 2BD9A 1GMHG 3PMBB 1MMJN 1V2QT 1O30A 1XKBC 3SQHE 3MH7A 1AN1E 1O2VA 1KLIH 1O3KA 1HAVA 1IHTH 1S5SA 4ZKNU 1D3QB 3SJOA 2XBWA 1DWBH 2Y80A 4P00A 1MTVA 1SGQE 2D1JA 3RXCA 3URDA 1GBHA 4MPVA 4SGBE 5IYTA 1IHSH 4YO9A 3GOVB 1C2HA 3QO6A 1TGBA 4B73A 3SV2H 2ZDVH 3PWCA 1VZQH 4WVPE 1C2DA 1QBOA 1GBEA 2JJ1D 4K8BA 3AW0A 2ODPA 3DT0H 4IN2A 2VVCA 3OTPA 4NWKA 2UWLA 1MBMA 1ANCA 4YZUA 3EA8A 3KGPA 3TNTA 4B75A 3WWBA 8LPRA 3M3SA 3O8DA 5I25A 3T26A 1T31A 1IQLA 1CHOF 1MZDA 2BY8X 2A5AA 2TGTA 3MO9A 1E1QD 1AVWA 1C2LA 1DSTA 1G3EA 3EAJA 2OQ5A 1XX9A 2Y6TA 1XUJA 2A0QB 1T4UH 2A5KA 4CBNA 1Q3XA 1G2LA 1Q31A 4ZKOU 4ABBA 2STAE 2FOHA 3M7UA 3STJA 5ESTE 1GVKB 1NTPA 1AB9C 1IQNA 1C1NA 1H1BA 1NFXA 2ZDMA 2XOKD 2Q6FA 1ID5H 3MNBA 3DSGA 1Z8RA 1F5KU 5CE1A 3BTQE 3S9BA 3S69A 1GHWH 2HNTE 1QR3E 1LVMA 1AIXH 1GJ5H 3H5CB 2A4GA 1IAUA 4GCHF 1PPCE 1YPLH 1K1LA 2ZDNA 1KYNA 1TA2A 3P8OA 1B5GH 2ZKSA 1NO9H 1S0QA 3SJKA 4X1NU 2VIWA 2OK5A 1NBMD 3AK5A 4YOIA 8KME2 1FY1A 3KEEA 3ESTA 1Y5BT 3Q76A 2PHBA 1O2UA 1UMAH 3C27B 1H9HE 1UK4A 5EPYA 4X1PU 4BOHA 2JH0D 3UY9A 3T29A 3FKSD 3M5MA 5EQSA 1PPBH 5GPIB 3Q3KA 4AC9A 1WU1A 4F49A 4ABHA 4YESB 4MPWA 3UTUH 1LHEH 2F9VA 5C0TA 3M36A 5HKKD 1O2WA 2H5CA 4D7FA 2G8TA 1QHRB 1TRNA 3SUGA 3C1KA 2HPPH 4UE7H 2M5TA 1C1UH 1GG6C 1VKYA 3UQVA 2BX4A 2C8XB 1F7ZA 2W3KA 1DS2E 1T4VH 3TIUA 3OU0A 2NU4E 1F0RA 3A82A 1C1RA 3BG4B 5JBBS 4Y6DA 2A2XH 2BDBA 2V7QD 3MTYA 3U8OH 1YPMH 4AFQA 3ZIAD 2PV9B 2ZPRA 5AFYH 1OSSA 2AYWA 1O32A 1UTPA 3GCOA 3E91A 5EQRA 4F55A 1PQ8A 1A5IA 1C5UA 3TH4H 2B0FA 1MUEB 3W1EA 3RXIA 2AGIX 2ANYA 1LPZB 3HGPA 4MVNA 1V2UT 5HIYA 1AVGH 2FOMB 3NKKA 4A1VA 3KN2A 1K1OA 2Z3DA 1QBVH 2GD4B 1QJ7B 4INLA 1MKWK 2FOAA 1P01A 2C4FH 2BXTH 2B7DH 4MNVA 1HIAB 2VVUA 1YPJH 1P3EA 2ZP0H 1DXWA 1VITF 2VB0A 2QY0B 4BNRA 1FIWA 1RS0A 3NZIA 4I32A 3VPKA 1K21H 2AGGX 4KKDA 1CHGA 1QZ8A 3RXLA 1EOLA 1DUAA 1ZPZA 5JPMH 1MH0A 1V2MT 1X7AC 2KCAA 1FZZA 2J9NA 1ZGVA 3BTTE 4KTCA 1P2JA 1YYY1 2AMQA 2AHME 1GJ6A 2VWLA 2ZU2A 2TRMA 2ZQ1A 1GBAA 1VR1H 1EAXA 3SBKA 3QZRA 3GY5A 2PW8H 3DCLA 3LDXH 2ZTYA 1GJDB 1FUJA 2ZF0H 3PRDA 3MNXA 3N7OA 1GL1A 3FAOA 2VWNA 5DGJA 5A2MH 1KTSB 2VBCA 3PLPA 2JDID 1CVWH 2XWAA 1A7SA 4GAWA 1OWKA 3NPSA 4Y76A 5DO4H 1SHHB 4GSOA 4ASHA 3BG8A 6CHAB 2FLRH 1ELVA 1FX0B 2WYGA 4FETA 4X1SU 5EU8A 4ISOA 2QYIA 2K0QA 1TE0A 2B5TB 2Z3EA 1O35A 4ISLA 3MYWA 1EATA 5CHAC 1S6FA 4FVBA 4X6MA 1ZJDA 1THPB 2G55A 1FAKH 2IPHA 2Z7FE 5JB8S 2BYAX 4H4FA 2RA0A 1DY9A 4KGAA 4NWLA 1GBIA 3B8JA 3A7VA 3P95A 1S83A 1CE5A 2ZDLA 4DW2U 3A87A 5LGOA 1PFXC 3A7YA 1MTSA 4HI3A 3QN7A 2BD7A 1SR5C 3A86A 2Y5FA 3M61U 5C5NA 4INKA 1PPFE 1KIGH 1ZZZA 3ZZ6A 3FP8E 3TITA 1MCTA 1UCYH 5JB9S 4A5TS 1P2NA 5C20A 4LZ4B 1O3PB 1G3DA 2YMSB 3HK3B 1ELDE 1PJPA 1DPOA 4M9FA 4OS5A 2TBSA 1K22H 4H42U 3RXUA 3SZEA 1AGJA 1UVOA 4IW4E 4FUCA 1BDAA 1EASA 1V2OT 3SU5A 1FDPA 1ZHRA 3F0OA 1ZGIA 1BTXA 3LT3A 1HBTH 1BRBE 1QB9A 4KTSA 1Z71A 3RXKA 2VIPA 1HAIH 5C2ZA 1F0SA 3RXJA 1G37A 2Y7XA 1EXFA 1NFYA 4FUEA 5HGGA 2QC2A 1C5ZB 6LPRA 5FX5A 4B2CA 3D23A 2DE9A 2BDHA 4Z6AH 1GMDF 1DITH 1DLEA 1ETSH 2BVXH 2GJGA 3FP6E 1O3GA 1O3IA 3F9EA 4I31A 4AN7A 4U2WA 2XBXA 2Y81A 1C5LH 3IG6B 4TY6A 1LDTT 4UFGH 1J17T 1KDQA 1GPZA 1EB2A 2OC7A 3RU4D 4NSVA 1ZMNA 2KAIB 1RIWB 3ZYEA 1W14U 4CH8B 1P9SA 1BTYA 1GDUA 1YGCH 1OYTH 2Y82A 3S7KB 4ESTE 2A4OA 2CK3D 1V6DA 2W6JD 4Y71A 1KXEA 3UREA 3O8RA 1C5MD 3PROA 4LXBH 3STIA 3M5OA 3E6PH 3GY8A 4ZH8A 3BEIB 1S84A 3T62A 1BHXF 3LH3A 2ZGXH 5DP3A 1YY3A 3PMHB 3WWFA 1IQMA 3UNRA 1MABB 3LGTA 5DP5A 1GMHF 2THFB 3R3GB 1AD8H 3UWJH 3ZZ7A 1E36B 3EE0B 1TBQH 1ANBA 3M35A 1O2OA 1ZRBA 1RXPA 1C5XB 1WTGH 4OS2A 1UTJA 1BMNH 1GBCA 2ZU3A 3RXGA 2HVYB 3VGCB 2HPQH 1KLJH 1P05A 1ZPBA 3LGUA 1WV7H 4BAMB 2PKAA 4ZXYH 3I29A 1C5QA 2WV4A 2Z9JA 4HTCH 4WXVA 4PROA 1W7XH 5EIYA 6CHAC 2BD8A 1TRYA 4OS4A 4A6LA 1EZQA 2J5UA 1MD7A 2A4RA 1AHTH 2O8LA 3MH4A 4J2YB 2BD2A 1PPGE 1UTOA 1W3CA 3GY6A 4K3JA 1WBGB 2ZHQH 3QX5H 2V6NA 5GXPA 4RI0A 1TOMH 4MG3A 3UOPA 1ZMJA 1NRRH 1VITH 1E79D 1TRMA 1ELEE 4Q4LA 4CR9A 2M2AA 3M7QA 1BTUA 3ELAH 2FI4E 3ZVAA 1O3AA 2ANMH 2AEIH 4I7YH 4FUIA 3FZDA 1LHFH 4F4OC 4GLYA 1ZLRA 4NA7A 5T1VA 5HMAA 2IN2A 1TONA 1ABJH 1L1GA 5F53A 1XKAC 1C5PA 1E35B 3A7WA 1CQQA 2R2WU 2ZA5A 5FHTA 1AFEH 1C5WB 2YNAA 2A7HA 1RFNA 1ZTJA 3FFGA 3LGVA 4AG2A 2GP9B 3LU9B 4K2YA 1BBRH 1O31A 1UK3A 1GI3A 1HJ9A 1K0HA 1QCPA 1H8DH 2YMSC 3U8RH 1BBRE 3Q3XA 3RXQA 2NU3E 1GMCG 1IQIA 1UHBB 1WQSA 9ESTA 1FXYA 1BT7A 4Y7BA 1A61H 1AZ8A 1RRKA 1J15A 4ZAEA 1CBWB 1S6HA 2XXLA 3GCTG 4IMQA 1HCGA 5DP8A 5C1YA 2WUBA 3KHVA 5F8ZA 1UJ1A 4E7RG 1H8ED 4FUJA 5AFZH 2B8OH 2XCNA 4ZHMU 3UR6A 1RD3B 4BANB 3Q00A 3KYGA 1BA8B 2GMTB 1Y3XA 4THNH 1O5AB 1O3HA 1Y8TA 4RKJB 2VGCC 4ABFA 4Y79A 5C17A 2I6QA 2PTNA 1O3LA 1XVOA 1SMFE 4KP0A 4NFEA 5F03A 1GBLA 1AFQB 4ZKSU 1Z8JB 3SNAA 1TX8A 1BTWA 1DFPA 3CP7A 1DT2A 1YLCA 5FPTA 3KQBA 1HDTH 1HJAC 3LJOA 1Z8GA 3SUEA 1C1SA 1GHAF 1EB1H 2JETB 1AUTC 4DVAU 1GGDC 5KECA 3GICB 5EXMA 1TAWA 6GCHG 3NUMA 1O38A 1FPHH 1TLDA 4AFSA 2G51A 4JYTA 1W7GH 2GDEH 4XE4A 3TJUA 2AH4X 1DM4B 2HGTH 4XOJA 1UCYK 4I86A 1O2IA 1GCTC 2BM2A 1O3JA 1FIZA 1O5FH 1T7CA 1HPGA 1EZSC 1AKSA 3BV9B 2QXHA 1LMWB 5EXNA 3AAUA 1UTKA 5C67A 2BOKA 1NESE 3DSPA 2TIOA 1XUHA 1FV9A 2ZI2H 3E1XB 2A32A 1P02A 3S9AA 1D6WA 4WMFA 2FESH 4NG9H 5T6DA 4K69A 1WTHD 2J38A 2J98B 3W95A 3KQ5A 4Q7YA 2GVFA 4AFUA 4OS6A 1AY6H 2FOCA 1KXCA 3ZZ9A 3OSYA 1O2XA 3L33A 4JCNA 1QL8A 1TX7A 2STBE 3B9FH 3TK5A 4TSFD 1SGPE 1V2VT 3DUXH 3ZZ8A 3E3TA 2XW9A 1GI2A 5FX6A 4JZFH 3RXSA 3P92A 2OC8A 1KXAA 1IQHA 1GI6A 1BRCE 1SGDE 4K1EA 3MNCA 4X6PA 3QLPH 1D6RA 2D2DA 2UUJB 1FY4A 3PWBA 4P02A 5DP4A 3TGIE 4UFFH 1IOEA 3TU7H 1SOTA 4Z1MD 1GHYH 1A0HB 4ZKRU 3UWIA 3OY5U 5JBTA 3ODDA 1P03A 4YXWD 2QF3A 2W6ID 1OWDA 1GI1A 1P9UA 1ESBA 3SU0A 1XUFA 1YPEH 5T3HA 1YKTA 1SGFG 1OWEA 2WPHS 4FU9A 2A7CA 3GYMA 1SGNE 1HIAA 1EPTB 2H9EH 3LIWA 1O34A 2JIZD 3BIVH 5GJ4B 1HAOH 5FAHA 1C1QA 4RKOB 2HLCA 1FMGA 1DDJA 5ETXA 2WUCA 3U9AH 1ANDA 1LHGH 3EYDA 1ELBA 4K5ZA 1BZXE 1GJAB 4XBBA 2ZHEH 2XWBI 1GVLA 2DE8A 1GBJA 4XDEA 3PV5A 1G9IE 3O8BA 4WMEA 1MU8B 8GCHG 1PQ7A 3A8DA 2ZEBA 2HNTC 4RT0A 1QY6A 5GWZA 3ATKA 2NU2E 3U8TH 3E0PB 3RXVA 4Z0KA 5DP9A 3LKWA 1ZRKA 1FNIA 3ATWA 5IK2D 2R0LA 3A7ZA 2WPLS 5CMXH 5EPNA 1Y5UT 2Q6GA 1AFQC 1O3CA 1WDIA 1RJXB 3TPIZ 5DK1A 5E0GA 1NPMA 5F6MA 4IC5A 3E8LA 1TNKA 3P6ZB 2IJOB 1GBMA 2FIRH 3K65B 2K8IA 1ZR0A 3QTOH 4BAOB 2GDDA 1BBRK 4BAQB 3Q3YA 1NC6A 3GYLB 5ESBA 2ULLA 1SVPA 3MH6A 3BTDE 1MTNC 1C1WH 1CO7E 2FYRA 3RC6A 2OLGA 2PGQB 4CR5A 1OP0A 3RC5A 1QJ1B 1LVBA 1ELCA 3F9HA 2SGFE 2AERH 2BLOA 1D9IA 2F9OA 2KFWA 1RGQA 2ZCLP 5LPFA 1TPPA 3GDUA 3F9GA 1GJ9B 4BTTB 4IGDA 1EZXC 2FOGA 2HLDD 5FL7D 1OP8A 2SNVA 5L2YH 5GCHG 1UK2A 3V13A 5EXLA 2GCHG 1G36A 2HVXA 2VINA 4NA8A 3SJ9A 3GCNA 2QA9E 2QIQA 4UDWH 3EDXB 1BTPA 3HKJB 4NGAH 1P10A 1C4U2 3PM3A 1T8MA 3PB1E 5HM2A 5TCCA 3RXRA 5KGOA 1W10U 2ZCKP 4BTUB 3FZZA 1GJ7B 1YC0A 2GZ7A 2BLQA 3V12A 1O2TA 2PWXA 4XBCA 3KQCA 4ABGA 2ZDAH 3F6UH 4X0WU 5E0JA 2A31A 1OS8A 1C1VH 2A7JA 2ZFPH 2CXVA 3JZ1B 3OE7D 5CHBA 3AVZA 3P8FA 2GCTB 4FUGA 1KXFA 2BQ7B 2O8TA 2F9UA 2YOLA 5F8XA 3MNSA 1GJ4H 3F68H 5JYIA 1GBDA 2ZU5A 3UPEA 3A83A 5E2OA 2ZCHP 3PMJA 4F48B 3OFND 2PP6A 2ZGJA 1EPTC 2ZQ2A 2EEKA 2QE7D 3RC4A 4JK6A 1ELGA 2QN5T 2ZNKH 5PTPA 1OXGA 4OS1A 2CV3A 1NFWA 1TBRH 4FUBA 1SFQB 1MZAA 5FBIA 1IQJA 2AMDA 2GGVB 1LKAA 3UOUA 2P3UB 3A8BA 2WPMS 2FYQA 1TB6H 3VB6A 1MTWA 3RXEA 7KMEH 7GCHG 2G5NA 1T32A 1HAHH 1ELAA 1LHCH 4TWYA 1P06A 3VFEA 1EP5A 1NRQH 4AYYB 1BITA 1JIMA 3M3VA 4WMDA 2ALPA 1BJVA 1A0LA 3JZ2B 1SKYE 3TGJE 5LPRA 2FI5E 1DVAH 1K1JA 1GJCB 1O2MA 3ZVGA 3HPTB 1EQ9A 4D8NA 3F2FA 5AHGH 1TYNA 1ZTKA 2BZ6H 5EJLA 4K60A 4ZROA 1GMCF 5HXFA 3GISB 1N8OB 3EGKH 3S7HB 1VJAU 5A8XA 5DP6A 1DXPA 1TALA 1XUKA 2ZFFH 3TH2H 2FS9A 4OGYA 7ESTE 2BTCE 1P57B 3LGWA 2XRCA 3RXAA 1QB6A 3H7OA 2A5IA 2W3IA 4MNXA 1P8VC 2P3FH 4TPYA 4YLQH 5DPAA 2ZTXA 3RMOH 4Y8ZA 3FVFB 3SU6A 1QGFA 4CH2B 3ZV8A 1CHOG 1EOJA 2OXSA 3PYHA 1C5VA 1QIXB 1XUGA 1VCPA 1C5TA 1HYLA 2P93A 4RSPA 1FY3A 4UEHH 1KXBA 5A0BA 5DN6D 3QGNB 3PLKA 3QZQA 5K7RA 3OTJE 2BX3A 1GCDA 3SU4A 1UCYE 1FN8A 1OYQA 3H09A 4Q63A 1GHZA 3TLOA 1P12E 1EJAA 2PKSB 5E2PA 1O39A 2H6MA 2JH6D 3ZZ4A 4DJZB 1FN6A 1YLNA 1Y59T 1KSNA 1UHBA 4XBDA 1W13U 3BG4C 1WUNH 5EQQA 1H9LB 1J14A 1EKBB 2CGAA 1TNHA 1YCPM 2P95A 1F5LA 2FI3E 3VB7A 4B1TA 3S0NA 1Z1IA 1BIOA 1WQVH 4GCHG 4B2BA 1ZHPA 1AU8A 5IDKA 5EOKA 1YPKH 2D8WA 3RMLH 3TNSA 1L2EA 4VGCB 1BMLA 2ZTZA 1BMFD 3L6PA 1PPZA 2EQNA 3EA7A 4B76A 1ABIH 1EAIA 3NCLA 1C5RA 1QL9A 3F9FA 4IBLH 1TABE 3SGQE 4ZMAH 2GTBA 2ZGHA 1WOFA 1TNGA 1C2GA 1V2PT 3HKIB 2ZIQH 2EI8A 1ZSLA 1EX3A 2BVRH 1ELTA 1VGCB 4IS5A 1NY22 4B74A 3TK9A 5LPEA 4H6TA 1O2RA 4D76A 4Y11E 3MU1A 3MO3A 1PQ5A 2CF9H 2WZQA 3TJOA 3VXEH 1HAXB 2BB4A 1NU7B 2J34A 1F2SE 2XYAA 4K1SA 3DSOA 4JZEH 3W94A 1HRTH 4NIYA 1CGHA 1HJ8A 2KCPA 4U30A 5I46H 3K6ZA 2A45B 1GI4A 1SL3A 1LKBA 1KMHB 4I8JA 3F3BA 5GNDA 1Y3WA 2EI6A 1O2QA 2OC0A 2TGAA 3BTWE 4UFDH 3P70B 3RXPA 1O3FA 1EJNA 2GT7A 2Z94A 3QGJA 1G3BA 5JDUB 5CDFE 4YM9A 1E0FD 1ESTA 1SQAA 2XBYA 4NZLA 2O9QA 3QTVH 4O03A 2P94A 3U98H 3KF2A 1XM1A 1JXPA 2TPIZ 2Z9LA 2SGEE 2G00A 5EW1H 2V3OH 4AG1A 4B2AA 2H1UA 3SI3H 3SUFA 7LPRA 4IMZA 1C4V2 3VB4A 1EFRD 3RU4E 3SW2B 2OCVB 5SGAE 4LZ1H 2ODQA 3MOCA 1LO6A 2VJ1A 1P2KA 4MLFB 3SV7A 1MAYA 1L4DA 1TIOA 4KELA 2RG3A 1GHBG 4I8LA 4ABAA 3U1JB 4NFFA 1O3BA 1H8IH 2R3YA 1ELFA 1W12U 1HFDA 1TWXB 1WSSH 1A3BH 5KEDA 1YCPH 1P2OA 2IJD1 1MCVA 1THSH 1Z6EA 3ZZBA 2B9LA 1VITG 1OPHB 4JZIA 3OYPA 1AE5A 1Z1JA 4ISHH 3UNSA 4X6NA 2HRVA 2YMSD 1GBFA 3SGBE 5B6OA 1GI9B 3VEQB 8GCHF 2FPZA 4AYVB 3AASA 1O5BB 2Y7ZA 3GS9A 3SN8A 2A4QA 2W7UA 1FI8A 1IQFA 1PYTC 2FMJA 2PLXA 2J95A 1QB1A 2D26C 2QXIA 5FCRA 2BZAA 4JMYA 2F3CE 4U32A 1OOKB 2HNTF 4CRGA 1SQTA 1S85A 1Z7KA 2ZDKA 1DWEH 1O3EA 2FP7B 1EPTA 1B0FA 4OM9A 1W8BH 2F9NA 3E90B 4FU7A 1Z8IB 5JBAS 5A0CA 4ISIH 1OX1A 2BXUH 1A46H 2NU0E 3TVJB 3RXOA 2ZG0H 1XMNB 2P16A 2FOEA 1TNLA 2C8WB 1K1PA 2R9PA 4JYVH 4MTBA 1YPHE 1QQ4A 3ZZ3A 1BRUP 1JMOH 5DKMA 1JRTA 3VXFH 3A80A 1MQ6A 1TQ7B 2H2ZA 1IQKA 1P2QA 2ZPQA 4CRDA 1NFUA 1QL7A 4X1RU 1GBBA 4Y0YE 4INHA 2A1DB 2NWNA 1K2I1 1Z6JH 5HIZA 1W0YH 2PSXA 1SOZA 1XXDA 5F8TA 4DGJA 1TNIA 1COWD
chains in the Genus database with same CATH topology
1OWIA 2V3HH 3K2UA 2AS9A 4IN1A 4JK5A 4ABIA 4E05H 1RIWC 4BXSA 4BXWA 5L30H 4HZHA 2GT8A 4YT7H 2QCYA 4MQAA 4BAHB 1DE7H 1AB9B 3BSQA 3ZZAA 1KDQB 4ZHAA 2GCHF 2BD4A 4X2XA 3BEUA 3FP7E 4E7NA 1GDNA 2FOFA 4WJG2 9LPRA 2CJIA 2OQUA 1C1PA 3DFJA 5DP7A 1T8OA 1YLDA 1O2HA 1A1RA 3H7TA 5J4SA 1K9OE 3T27A 4MPXA 3SU3A 2BY6X 2ZFSA 3DA9B 4LOYH 4M7GA 4GHQA 1IQEA 4X2WA 4AGJA 1THRH 3VGCC 1MU6B 4Y8YA 1H9IE 2EC9H 1ARBA 1DX5M 2BVSH 4B71A 4Y0ZE 5FXLA 1E37B 1WAYB 3SNCA 2VIVA 1UVPA 4ZHLU 2FTLE 4ABEA 1OKXA 1V2RT 1CT0E 3EQ0H 1GI5A 3GDSA 4X2YA 4YOJA 2FEQH 3SNDA 1AZZA 2HWLB 1TMBH 2PKAB 1KLTA 1DUEA 3E16B 1EAWA 1SFIA 1F92A 1LPKB 4UFEH 1HGTH 4WH8A 1L4ZA 3IITA 5JBCS 2J2UA 4X8SH 4X1QU 3U69H 1NRPH 1AVXA 1P2IA 1NM6A 1SBWA 2UWOA 3MH5A 3MO6A 1HV7A 2ZFTA 1O33A 1MBQA 4DT7B 3RMNH 2CF8H 2QXGA 3A8AA 5AF9H 1GG6B 1AI8H 1O2JA 3RXHA 7GCHF 1EZUC 4MDSA 2BD3A 3SHAH 2RDLA 1V2NT 2PUXB 1T8NA 3KIDU 4ZXXH 3RLYH 1ZOMA 1M9UA 2SGDE 4FXGH 5DG6A 1YBWA 2FTMA 2VH0A 1LVYA 4CREA 1F5RA 1FY5A 1V2LT 5T6FA 4A1TA 1P09A 1HAYB 1ETTH 3DHKH 3D65E 2OD3B 2VIDA 5K0HA 2EI7A 2BMGB 2XC4A 2ZPSA 1WYKA 2P3TB 1O3NA 3V3MA 1NT1A 1O5EH 1CBWC 1F0UA 1A0JA 1N6XA 4J1YA 1D3DB 1W11U 1SGRE 2R3UA 3RXDA 1ORFA 2NU1E 1V2WT 3LGIA 4FVDA 1RTFB 1TGNA 2PR3A 3A85A 2FS8A 3P17H 2GMTC 1ETRH 1TGCA 1HNEE 2TGDA 1O3MA 4NSYA 4I33A 3T28A 4CHAB 2GKVE 3HGNA 1FONA 2FWWA 1ZPCA 2AIPA 1O3OA 1QNJA 1EP6A 1S82A 1GDQA 1C2IA 1LQEA 2XTTB 2SGQE 2SGAA 1A5HA 2ZZUH 2BDIA 1SG8B 1B0EA 1W2KH 3ZZCA 1G3CA 3S9CA 1YCPK 2FDAA 3TGKE 5GDSH 5C1XA 5A8YA 4TWWA 1JWTA 3I77A 1CGJE 1GBTA 1HXEH 1C2KA 4HFPB 5AVDA 1OWJA 1DY8A 1GHVH 2F83A 1Q2WA 3SUDA 3ZV9A 2JETC 1L0ZA 2R2MB 3MU4A 2SNWA 3MU0A 1N6YA 1G2MA 4Y10E 4Q7ZA 1C5OH 2Z9IA 3LPRA 3RDZA 3WY8A 2ZHWH 1ARCA 1P0SH 1QRXA 1V2ST 2ZGBH 1SGIB 2FZZA 5H4IB 4MPUA 1HUTH 2G4TA 5A8ZA 3KNXA 2Z3CA 3URCA 3MMGA 3SORA 2V0BA 2ZO3H 3TH3H 3RLWH 2AGEX 1FQ3A 2GZ8A 1NRSH 2UUKB 1YF4A 5CHAB 3GY7A 3CS7A 1ACBE 2OP9A 1O2GH 1PPEE 4JZDH 1UTNA 2H9HA 1J16A 3QUMP 1QA7A 1UTMA 3SV8A 3NWUA 3I78A 2G4UA 2QAAA 4IC6A 1LPGB 2C90B 1GBKA 1O5DH 2I6SA 4AZ2B 1AKSB 3RXMA 1S81A 3RXBA 2CMYA 1O2LA 5T6GA 3BTME 1FLEE 1QRWA 4YOGA 1FJSA 1XUIA 1PPHE 1TA6A 1DWCH 2HALA 3A84A 4AB8A 3UUZA 1C1TA 3E0NB 5LH8A 4WWYA 4QT8C 1UVSH 3SU2A 3SO3A 1V2JT 4O3UA 2O8MA 2BY5X 3D49H 2OBQA 2ZU1A 1QTFA 3SV6A 1LQDB 1AWFH 1D4PB 2LNCA 1K1NA 1GHAG 3GCHB 1K28D 2OC1A 3LJJA 1WCZA 4Y8XA 1SLXB 3ENSB 2QGRA 3KQEA 3ZVDA 3SZNA 1BB0B 4MNWA 3UNQA 2BDGA 2ANKH 5C1UA 2O8UA 3BN9A 1ESAA 2AIQA 2YNBA 4KTUA 1SGCA 2W5EA 1BMAA 3RM2H 1HAVB 5GIBA 5E8EH 2BOHB 1MQ5A 3M37A 1TMUH 1VCWA 2JKHA 2ZC9H 2Q1JA 3ZVEA 3VB5A 2FM2A 4NCYA 1IQGA 1K1IA 1U6QA 3BIUH 3KQDA 2KAIA 4CRAA 1O2SA 1MTUA 1MAXA 1UVUH 2UUFB 2DUCA 3M5NA 3SOSA 1O2NA 2G81E 4Q2KA 1QFKH 1GHBF 1Y3UA 4GHTA 1V2KT 2WINI 4FUHA 2BD5A 4K1TA 5EODA 4NIWA 3SI4H 5FPSA 2VIOA 4FU8A 3P8NA 3FANA 2SFAA 5E0HA 3GY3A 1GVZA 1QJ6B 1P3CA 5EGMA 2BY7X 3D62A 1FPCH 3QDZB 2LPRA 1P04A 4CHAC 1Y5AT 5L2ZH 3PV4A 3ZZDA 3AW1A 4O9VA 1ZJKA 2BDAA 3R0FA 1INCA 3RM0H 4K8YA 4AX9H 4CRCA 2XC5A 2CHAB 2VWOA 3RUOA 1MKXH 3MI4A 2UUYA 1YP9A 2QF0A 2ZU4A 4D9RA 4UD9H 1GI8B 4NIXA 3BTFE 3CENA 3ODFA 5C5OA 2J4IA 2P8OB 3SQEE 1BTZA 1PQAA 1HAPH 1HXFH 4Q7XA 1BRAA 1EAUA 1O37A 1C2FA 2VIQA 1TPOA 1BMMH 3GCTF 4AGKA 1KTTB 1DLKB 1SLUB 8ESTE 1UTQA 1XVMA 2FOBA 2PUQH 3L3TA 2H5DA 3ATIA 2C8YB 4X2VA 3NK8A 3ZVFA 4TPIZ 4U01A 3ZYDA 1G32B 2FX6A 3RU4T 2ILNA 2H9TH 1TPAE 4TYDA 4A92A 1O2KA 4CRFA 2O8WA 2ESTE 3LC5A 4Q80A 3ATMA 1ZHMA 3A89A 1KXDA 1W0ZU 2VU8E 1SGFA 1HAZB 4HGCA 2VH6A 1LHDH 2OINA 1D3PB 1ZSJA 1P11E 2BLVA 1YM0A 3F1SB 3A88A 2F91A 2Z9GA 2WYJA 4GUXA 2VVVA 3SJ8A 5J4QA 1GI0A 4UONA 1C1MA 2ZFQH 2RCEA 1BTHH 4FUDA 3TK6A 1NS3A 2OTVA 2ZGCA 1SGYE 4AORA 6GCHF 4D7GA 3HATH 1SLWB 3PMAB 4R8TB 2ZWLH 3A7TA 3G01A 2FXRA 3MWIU 1H4WA 1SB1H 2RA3A 4TY7A 3SU1A 3GCHC 5TCAA 1UO6A 2Z6BD 4E06H 1AWHB 3PTBA 1HAGE 2QXJA 1CGIE 1V3XA 2TGPZ 1FAXA 4MNYA 2C93B 1C2MA 4R0IA 2ODYB 3AAVA 4JZ1A 3ITIA 2ZHDA 4DIHH 2GCTC 2GV6A 2XNIA 4X8TH 5L6NH 1QA0A 5A09A 3A81A 3OX7U 1OWHA 1ZTLA 3CS0A 1CA0B 2ZHFH 2ALVA 2GV7A 2SGPE 1F0TA 4XFQA 3RXTA 3PTNA 1SSXA 3PLBA 2VGCB 3A7XA 3PO1B 3BF6H 3ATLA 3ZVCA 2VWMA 2AMPA 3SJIA 1T8LA 3U1IB 4AB9A 1JOUB 3HK6B 3SNBA 4WY3A 4A1XA 5FCKA 3NXPA 3UR9A 3LH1A 1TNJA 5BPEA 4O3TA 1Y3YA 2A2QH 2R0KA 1AQ7A 4XSKU 1HJAB 1TBZH 2CN0H 4CBOA 4X8VH 1C5YB 2ASUB 2BQWB 1GGDB 1C9PA 4ABDA 4LK4A 1UVTH 1NROH 1ZMLA 4OS7A 1CT2E 1DSUA 1S0RA 1BOQA 3Q77A 1Y3VA 3M3TA 1AMHA 1C4Y2 1EUFA 2ANWA 2WPIS 4ZUHA 1CSOE 1BUIA 2CHAC 1N1LA 1OP2A 2WPJS 2VNTA 1O2YA 3KL6A 2FX4A 1GCTB 2C8ZB 3MU5A 3T2NA 1C5NH 1GHXH 1LCYA 4DOQA 2P59A 5EW2H 1SGTA 1KY9A 5FPYA 1N8OC 2G52A 1TFXA 2GX4A 2PFEA 2BHGA 2P8OC 4WH6A 2EA3A 1C2JA 1BHXB 3OY6U 1E38B 1AUJA 2WPKS 1ZSKA 4BTIB 3UIRA 3MHWU 3RP2A 1SQOA 1J9CH 1PYTD 1BJUA 2G5VA 3T5FH 1C1OA 5EG4A 1O5GH 1DWDH 2Y5HA 2OUAA 3BTKE 4A7IB 1TGTA 1JRSA 5TJXA 4AOQA 1RTKA 6ESTA 1GJBB 4NA9H 1L1JA 2UWPA 2BDYA 3BEFB 1CA8B 1EJMA 2PGBB 3A8CA 4WXIA 1NZQH 1NN6A 4BAKB 1DOJA 4DIIH 2BQ6B 4X6OA 3QK1A 1O36A 1A3EH 1D3TB 1TQ0B 2WV5A 3IWMA 2ZECA 4GVUA 1HB0B 3SNEA 2PKSC 3T25A 1SC8U 4H6SB 1BQYA 2GZ9A 4X8UH 1A4WH 1YPHC 3LONA 2F9PA 3MU8A 1QURH 1NU9A 4WF8A 4YT6H 5C3NA 3QWCH 5A0AE 1E34B 1RTLA 3ZZ5A 1AE8H 1VJ9U 4DY7B 4AFZA 1C5SA 2HOBA 2C3SA 5DJ7A 1SHYA 4DCDA 1VCQA 3ZVBA 1LTOA 1HLTH 1G30B 3TJVA 1MKXK 3LC3A 2Z9KA 1J8AA 2FODA 3BTHE 1LVOA 4VGCC 2AFQB 1C9TA 4CRBA 4Y7AA 3SHCH 1CU1A 3EA9A 3LGYA 1SI5H 1O5CB 3SV9A 4JYUH 3GY4A 2XBVA 4I8KA 2PTCE 5ABWA 3V0XA 4DG4A 1CA0C 1VGCC 4DURA 1P2MA 2V35A 3UQOA 5HM9A 1JBUH 3DD2H 4D9QA 3B23B 5HYOA 4NIVA 2XCFA 5GCHF 1TX6A 4I8GA 1XXFA 2W26A 3DFLA 2J92A 3PO1C 3GDVA 2QV1A 2F9BH 1L1NA 1TMTH 2XC0A 4RN6A 3P8GA 1DICA 1FY8E 3K9XB 4SGAE 5BRRE 1NRNH 1AO5A 4YLUA 1QRZA 4OGXA 3LOXA 1O0DH 3UFAA 2FLBH 1CT4E 1TGSZ 2PSYA 2IOTA 2JH5D 1SGEE 1O2PA 5FBEA 1SLVB 5G4BA 1MKWH 4ABJA 1MD8A 3V7TA 1B7XB 1A5GH 3SGAE 3K6YA 2J94A 1GJ8B 1GL0E 3TJNA 1QBNA 3RMMH 4I8HA 1K1MA 4FUFA 3BTGE 1GWAA 1SPJA 1V2TT 2Y5GA 1GMDG 1QQUA 2ZFRH 1MTNB 1BCUH 1JIRA 2BY9X 2BDCA 3M5LA 1TOCB 3MFJA 1ANEA 1O2ZA 3KCGH 2W7SA 2BLWA 1GI7B 4YTAA 4ISNA 4O97A 2K1QA 1O3DA 2FO9A 1C2EA 3O8CA 1TPSA 1A2CH 1YPGH 3GY2A 2OBOA 3M7TA 4GPGA 4NZQA 3BTEE 1UTLM 3VB3A 2Q6DA 3RXFA 1ZYOA 1DANH 2BD9A 1GMHG 3PMBB 1MMJN 1V2QT 1O30A 1XKBC 3SQHE 3MH7A 1AN1E 1O2VA 1KLIH 1O3KA 1HAVA 1IHTH 1S5SA 4ZKNU 1D3QB 3SJOA 2XBWA 1DWBH 2Y80A 1MTVA 1SGQE 2D1JA 3RXCA 3URDA 1GBHA 4MPVA 4SGBE 5IYTA 1IHSH 4YO9A 3GOVB 1C2HA 3QO6A 1TGBA 4B73A 3SV2H 2ZDVH 3PWCA 1VZQH 4WVPE 1C2DA 1QBOA 1GBEA 4K8BA 3AW0A 2ODPA 3DT0H 4IN2A 2VVCA 4NWKA 2UWLA 1MBMA 1ANCA 4YZUA 3EA8A 3KGPA 3TNTA 4B75A 8LPRA 3M3SA 3O8DA 5I25A 3T26A 1T31A 1IQLA 1CHOF 1MZDA 2BY8X 2A5AA 2TGTA 3MO9A 1AVWA 1C2LA 1DSTA 1G3EA 3EAJA 2OQ5A 1XX9A 2Y6TA 1XUJA 2A0QB 1T4UH 2A5KA 4CBNA 1Q3XA 1G2LA 1Q31A 4ZKOU 4ABBA 2STAE 2FOHA 3M7UA 3STJA 5ESTE 1GVKB 1NTPA 1AB9C 1IQNA 1C1NA 1H1BA 1NFXA 2ZDMA 2Q6FA 1ID5H 3MNBA 1Z8RA 1F5KU 5CE1A 3BTQE 3S9BA 3S69A 1GHWH 2HNTE 1QR3E 1LVMA 1AIXH 1GJ5H 3H5CB 2A4GA 1IAUA 4GCHF 1PPCE 1YPLH 1K1LA 2ZDNA 1KYNA 1TA2A 3P8OA 1B5GH 2ZKSA 1NO9H 1S0QA 3SJKA 4X1NU 2VIWA 4YOIA 8KME2 1FY1A 3KEEA 3ESTA 1Y5BT 3Q76A 2PHBA 1O2UA 1UMAH 3C27B 1H9HE 1UK4A 5EPYA 4X1PU 4BOHA 2JH0D 3UY9A 3T29A 3M5MA 5EQSA 1PPBH 5GPIB 3Q3KA 1WU1A 4F49A 4ABHA 4YESB 4MPWA 3UTUH 1LHEH 2F9VA 3M36A 1O2WA 2H5CA 4D7FA 2G8TA 1QHRB 1TRNA 3SUGA 3C1KA 2HPPH 4UE7H 2M5TA 1C1UH 1GG6C 3UQVA 2BX4A 2C8XB 1F7ZA 2W3KA 1DS2E 1T4VH 3TIUA 3OU0A 2NU4E 1F0RA 3A82A 1C1RA 3BG4B 5JBBS 4Y6DA 2A2XH 2BDBA 3MTYA 3U8OH 1YPMH 4AFQA 2PV9B 2ZPRA 5AFYH 1OSSA 2AYWA 1O32A 1UTPA 3GCOA 3E91A 5EQRA 1PQ8A 1A5IA 1C5UA 3TH4H 2B0FA 1MUEB 3RXIA 2AGIX 2ANYA 1LPZB 3HGPA 4MVNA 1V2UT 1AVGH 2FOMB 3NKKA 4A1VA 3KN2A 1K1OA 2Z3DA 1QBVH 2GD4B 1QJ7B 4INLA 1MKWK 2FOAA 1P01A 2C4FH 2BXTH 2B7DH 4MNVA 1HIAB 2VVUA 1YPJH 1P3EA 2ZP0H 1DXWA 1VITF 2VB0A 2QY0B 4BNRA 1FIWA 1RS0A 3NZIA 4I32A 3VPKA 1K21H 2AGGX 4KKDA 1CHGA 3RXLA 1EOLA 1DUAA 1ZPZA 5JPMH 1MH0A 1V2MT 1X7AC 1FZZA 2J9NA 1ZGVA 3BTTE 4KTCA