2SGFE

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE01
4TY6A 4UD9H 1P57B 2ZTYA 2PLXA 1Y3VA 3ITIA 5IYTA 2NU3E 1FDPA 1H9LB 5LPEA 5DK1A 4FU8A 1ID5H 2JKHA 1DX5M 1MCTA 3A8DA 1Q31A 2VIPA 2CV3A 3U69H 4I8KA 4BXWA 4D76A 3URCA 1N6XA 2ZWLH 3RXTA 1TMBH 5FHTA 1AY6H 2ZHFH 2ZZUH 2VIVA 1TFXA 3AAUA 2ZNKH 1A5HA 3DHKH 3EGKH 1NFYA 1G3BA 1Z71A 4YOIA 2FOCA 1BBRE 1AI8H 1ZTKA 2QV1A 3TJOA 4D9RA 2GT8A 2R0KA 2O8UA 1H8DH 3TU7H 1BITA 3ZZ5A 4ABIA 4FUCA 3ZZAA 1GVKB 2ZO3H 3RM0H 2EI6A 4ISNA 2HGTH 1K22H 1A5IA 3GYMA 5JDUB 5DP4A 1YBWA 3TGIE 5EQQA 3ZZ9A 4FUEA 2FOGA 3ZVCA 1AKSA 1SLUB 1DY8A 4K1TA 4BNRA 1VJAU 1K1IA 4A92A 1NRQH 1GBEA 1GDUA 1GI7B 5IDKA 1O2OA 2ZDLA 2TGAA 1GDQA 2FYQA 1W0ZU 5HM2A 1UK3A 2H9EH 3G01A 2FOHA 1JXPA 1YLDA 3D23A 3LGIA 1LQDB 1TPAE 5DG6A 1A3EH 2SNWA 4A1VA 1RJXB 2SGQE 3A80A 1RRKA 4MTBA 4ASHA 1AZ8A 4Z6AH 2EI8A 1TNGA 1GVZA 1RFNA 1O3DA 1XUIA 1EZSC 1ZR0A 2J9NA 3OY6U 4ZXXH 2BDHA 1LHCH 3LJOA 1O5EH 3SI4H 4KTCA 3GY2A 2NU4E 1GJ8B 1T4VH 3RC6A 1GJAB 2H2ZA 1S84A 1C2FA 3A7YA 3U8TH 2QXHA 3IG6B 1XUFA 2ZP0H 5C5NA 1WQSA 2GT7A 4XDEA 3S69A 5BPEA 1NRRH 4A1XA 4GUXA 3UR9A 1QRWA 2BMGB 4BAOB 4B75A 2THFB 1P10A 1TALA 3PO1B 1O2VA 4AZ2B 1ELVA 1V2TT 1G2MA 3GCHB 2BY8X 2TPIZ 3PROA 3MH4A 3TNTA 3SV8A 3RXQA 1UHBA 2F83A 1GHZA 1IQMA 4TWYA 4IBLH 1QURH 2UUJB 1W14U 2TGPZ 1LVYA 1UVOA 5A0AE 1HDTH 4NZLA 3GY4A 1SQOA 1TX8A 3M7TA 3U9AH 1GMHG 1O5AB 1RXPA 1O31A 1FN6A 2QC2A 2XBYA 2DE8A 1RTFB 1TGSZ 1CA0C 2O8TA 2ZDKA 3HK3B 3KQCA 3GCTF 2GP9B 1P04A 1L4ZA 1XUHA 3MH7A 1NESE 2J4IA 3A7ZA 4K1EA 3F9GA 3TLOA 1P2QA 3MU1A 3BTHE 2FMJA 1QB1A 3SORA 1ZMJA 5GDSH 4HTCH 1AE5A 2F9UA 1TE0A 2OTVA 5ETXA 1BMNH 3CP7A 1J9CH 3E3TA 1HAVB 1O2SA 2ANKH 4WH6A 3SNEA 2ZC9H 3ELAH 1G2LA 1PPBH 1RGQA 4E7RG 3PMAB 4OS6A 5HGGA 2O8LA 1YCPM 1O2MA 5HYOA 1O2GH 4X6NA 1CT2E 3I77A 2P93A 4X8VH 1SGDE 3QTOH 1C1RA 3BIUH 1PPGE 1UJ1A 2Q6GA 4RN6A 2BDCA 1A0HB 2NWNA 1SVPA 1XX9A 2A4OA 2R9PA 3Q76A 3KQDA 2BY6X 2BXUH 1N8OB 2PTCE 1WUNH 2HALA 2VIOA 1N1LA 3QLPH 1GJ9B 3KN2A 1E0FD 3SUFA 1ANBA 1FMGA 3VB4A 1FUJA 1YCPK 2Z9IA 4JZIA 3RXRA 1HJ9A 1TBQH 3E6PH 1HNEE 5JB8S 1TNLA 3GCTG 3NK8A 1GJCB 3BG4B 2JETB 3PB1E 1N8OC 4RSPA 5JB9S 5LPFA 2PWXA 1P05A 1ZHPA 2JH0D 3MTYA 4K8BA 1V2RT 1BTYA 3SUEA 1T8OA 1Y3UA 1BA8B 2G4UA 4DJZB 1PQ7A 1FONA 2GZ9A 1BTWA 2TIOA 1EZUC 3SO3A 4JZEH 3HKIB 3ATIA 1O33A 2ZGHA 5E2OA 2CHAC 2ILNA 2WPKS 3M37A 1LPZB 1NY22 3S9AA 1P06A 5PTPA 2A0QB 4WJG2 1D3DB 4K3JA 1J15A 1GHBG 5K7RA 1P2MA 2C8WB 2P95A 1OP8A 2BZAA 2WPMS 4CR9A 4BXSA 4X1RU 1QR3E 1KIGH 1HJAB 1A4WH 2F9BH 2I6SA 1VCQA 5F03A 2OD3B 4NIYA 1HUTH 4FUJA 3QZRA 5CHAC 5EODA 2ALPA 1DSUA 4AB8A 1HXEH 1O3OA 5L6NH 3SGQE 1AWFH 3RXMA 1AFEH 1CSOE 2VWMA 2BTCE 1OXGA 4DW2U 3RXPA 2QA9E 2P16A 3WY8A 1TGTA 2OLGA 1TNIA 5GCHG 5E0HA 7GCHF 1SQAA 2O8WA 1BMLA 2TGTA 1SPJA 4MPXA 1C2JA 3RMLH 4DURA 2FTLE 1HRTH 4X6PA 2VIDA 4X2VA 4O03A 4AORA 2GKVE 4OS4A 4JCNA 1O3IA 1GWAA 4AYYB 1BZXE 1GBTA 1RTKA 1ZPCA 2ZGXH 2V35A 3ESTA 2HNTC 5LH8A 2ALVA 2SGFE 1D9IA 5EXLA 3L33A 1UTNA 1GBCA 5GJ4B 1DPOA 4IGDA 4RKJB 2G8TA 3S9CA 1MKWH 1UO6A 3A89A 3FANA 1P09A 1Z8IB 1V2WT 2DE9A 3VFEA 4U30A 2PHBA 1ELAA 1QRZA 1P0SH 1C5SA 2XNIA 4LXBH 1V3XA 1FY1A 2VVCA 2FO9A 1O0DH 4AG2A 5JYIA 2ODPA 4D9QA 4AFUA 4CBOA 3MOCA 1F0RA 1GBBA 4YOJA 2UUKB 3BSQA 2Y5FA 4O97A 3ZZCA 3IITA 4LOYH 1A61H 1GHWH 3SU1A 2GMTC 1V2PT 1O2PA 2P8OB 2TRMA 4CRAA 4XFQA 5A09A 1C5NH 2BLQA 2WYGA 2Y6TA 2ZU4A 1DY9A 1PPEE 5GCHF 3S7KB 4CRGA 1DWBH 3LGUA 1E36B 2AH4X 3RXOA 3RU4E 1TOMH 2YOLA 1W2KH 3T27A 1SQTA 2VVUA 3SOSA 1C1MA 1KTTB 3RXSA 1A0JA 4B74A 2BQWB 1OP0A 1HAIH 1XM1A 3GYLB 4AFQA 2ZGJA 4J1YA 3AVZA 3P95A 5DO4H 5C3NA 2YNBA 4DG4A 2ZFTA 1WU1A 1CBWC 4HFPB 3ZV8A 4U32A 1L4DA 2FOAA 1ZOMA 2AMQA 1THSH 2XCNA 3VGCB 2ZTZA 1GI3A 1L1JA 1ELDE 2FDAA 3M7QA 3ZZ8A 1PQAA 1BCUH 1GBAA 1W8BH 3GY6A 3SHCH 5F8ZA 4DIIH 1EJMA 1FAKH 3I29A 4FU9A 1GI2A 4ABBA 2A1DB 1HAGE 2ZFFH 4ISHH 1RD3B 1E38B 4MLFB 3LDXH 1BT7A 4OS2A 4CHAB 4YO9A 3KCGH 4K2YA 1YPKH 1AB9B 1MZAA 3RXKA 3MU0A 4HGCA 1GJ6A 2ZHQH 1TGBA 3SJ8A 2O9QA 1YPHE 3M35A 2XYAA 3A84A 2AEIH 3M7UA 3SU2A 1RS0A 1QB6A 2QCYA 1AVWA 1EASA 3UPEA 2WUBA 1OWJA 3U98H 1C1OA 1MH0A 3PWBA 1C2GA 1SGEE 1QBVH 3E0PB 1RIWB 2ZQ2A 1M9UA 3UQOA 1RTLA 2VVVA 2ZCLP 2QGRA 4FXGH 5A0BA 2UUYA 2C3SA 2KAIA 3H7OA 1BRBE 1TNKA 1GI6A 4INKA 1ACBE 1OWEA 2R0LA 2WV5A 4Y79A 2R3UA 4KTUA 4KP0A 2IN2A 4GHTA 3ZZ4A 1GCDA 1GBLA 1MU8B 1QL7A 1J17T 1EOLA 3ZZ7A 1UVTH 4NGAH 2QXIA 3TPIZ 1WSSH 1O2TA 2A5IA 1TBRH 1GBFA 4I8LA 3BIVH 3NZIA 2XWBI 1SFQB 1P12E 3SU3A 1ABIH 3D62A 4BAKB 5BRRE 2OINA 4YT7H 3M3TA 3OX7U 3T29A 4FUDA 1UTPA 1BBRK 1GI4A 2BOKA 3MNBA 4Y8ZA 1CE5A 4TPIZ 4AN7A 1AZZA 2G00A 1P9SA 1TGNA 5DP9A 1PPZA 2ZQ1A 1CU1A 3KQBA 1AFQC 2ZDMA 4DVAU 1QFKH 4Y0YE 2QF0A 1ESAA 1IQGA 2ZTXA 4AYVB 1F92A 1KLJH 2Y5HA 5J4SA 1O3NA 3Q77A 4DGJA 2K1QA 1HFDA 2VH0A 3MO3A 2ZHDA 2B7DH 1ELBA 4D8NA 5DKMA 3ZZ6A 3MFJA 3SN8A 1HBTH 5EOKA 3RU4D 3LGWA 1NM6A 1KXCA 2FM2A 2BD8A 3RUOA 1T4UH 1O34A 3SUDA 3GY8A 4H42U 3NCLA 3F6UH 3RDZA 2PSXA 1EJAA 1HIAA 3OTJE 5DPAA 3HGPA 1DUEA 5E8EH 1OP2A 4Y11E 1K28D 1G32B 1O5DH 1JBUH 2FLRH 2AS9A 3LH3A 4NCYA 1ELGA 1Z1JA 2AMPA 3ATLA 4ZHLU 3B8JA 2ZDVH 3NWUA 4MPUA 1Q3XA 2VB0A 3ZZ3A 1EP6A 2BQ7B 1O2UA 5JBAS 5TCCA 2O8MA 1AUJA 2SNVA 3P8OA 2HVXA 1C1VH 2ZECA 1GHBF 2G55A 1LO6A 3LC5A 1WBGB 5HM9A 3BTME 3SV2H 4YM9A 2GDEH 2HOBA 5CE1A 2OUAA 5DJ7A 3FFGA 1IQFA 1EOJA 3RU4T 1A1RA 1NS3A 3UFAA 3SZNA 1HLTH 3ZV9A 2OC0A 4H4FA 1GMCG 2FOFA 1S0RA 1AMHA 2ANWA 1GJ7B 1IQJA 2WINI 1C5QA 4UFDH 3VB7A 3LT3A 1J16A 1TYNA 3GCHC 1NC6A 7KMEH 3K65B 5EXNA 5AF9H 3PO1C 4CRBA 1NFXA 1ELFA 2A31A 2IOTA 2GZ8A 1W0YH 1LCYA 2F91A 1KTSB 3P92A 5E2PA 1ZSLA 2EA3A 1GBJA 1TABE 1HAPH 4Y6DA 1O3HA 1LKAA 3KQEA 2SGPE 4U2WA 1UTKA 3D49H 4NIVA 4X2WA 1KXEA 1ESBA 3DUXH 3EA9A 1ARBA 3TIUA 1LMWB 3V7TA 2HNTF 5SGAE 1TRNA 1AUTC 1UCYK 3RP2A 4ABGA 1DVAH 3SU6A 1DOJA 4B73A 3LU9B 1P2OA 3UNQA 1P3EA 3MWIU 5ESTE 2QXGA 2PKAA 1BRCE 5GXPA 3T25A 3PMHB 1CT4E 4ZXYH 1QBNA 4R8TB 4ABFA 2SGAA 1VJ9U 1JMOH 5AVDA 3MMGA 1TA6A 3FVFB 1ZSKA 2SGEE 3PLBA 1O2YA 4ABAA 3RXJA 2FWWA 4UEHH 3M5OA 1MD7A 1FY8E 2VGCC 3LGVA 1TQ0B 1MAYA 5EGMA 1OKXA 2CMYA 2Q1JA 5TCAA 4O9VA 5DGJA 1ZTJA 2ZHEH 1HJ8A 3B23B 4ZKNU 4CREA 1G3EA 4KTSA 1DM4B 1ZYOA 4DCDA 4GSOA 2H5CA 3EAJA 4OGYA 3C27B 1ABJH 2RCEA 1C5LH 1KXAA 4NIWA 5HMAA 1TPSA 1AWHB 2D1JA 1W13U 1HGTH 1OWIA 3D65E 4WF8A 3GDSA 1KDQA 1Z8RA 1ZJDA 2PKSC 3OSYA 2WPLS 1LHEH 4NA9H 2ZPSA 5FBIA 1P01A 1WV7H 2Z9KA 2BLVA 2OC1A 3A81A 3QDZB 6CHAB 1DLKB 3MHWU 1C4V2 2BD3A 3A7TA 1ZTLA 2ESTE 2FESH 1C2IA 3BTWE 2UWPA 2NU0E 1MUEB 1NROH 4A7IB 4KKDA 2JH5D 2UWOA 1BQYA 1CT0E 1NFWA 1OOKB 1BTPA 2OCVB 3SGBE 2AYWA 1IAUA 4GCHG 1OWHA 3R3GB 4JYVH 3ATWA 1SL3A 1O2QA 3PTBA 1FPCH 2BZ6H 1XXDA 2EC9H 2OQUA 1A7SA 2B8OH 2BDBA 5FPYA 1S82A 3E0NB 1MBQA 1GHVH 3A8AA 3M5MA 2AGGX 1BBRH 1GI8B 3O8DA 1QL9A 2HLCA 2FI4E 1O2IA 1FPHH 1LPKB 5DP6A 2Z6BD 2C4FH 2ZFRH 2ZF0H 5AFYH 4IC6A 5F6MA 1SGCA 1CHOG 1LDTT 3NPSA 3QWCH 1FNIA 3UUZA 3EA8A 1CVWH 2V6NA 4OGXA 1K1NA 4WMDA 3ZZDA 4IMQA 1TMUH 3EA7A 1YC0A 1ZLRA 1F5RA 2W26A 2J94A 2OBQA 3BG8A 3Q00A 1GVLA 3PMJA 2BY7X 4ZUHA 1IHTH 4GHQA 4ABJA 1C9PA 1GJ5H 1F5LA 4BOHA 4DIHH 1ZMLA 1UCYE 1LHDH 3TGJE 2P59A 3V0XA 1SMFE 2R3YA 1LKBA 2VNTA 3M3VA 1IOEA 2ZCKP 1FAXA 5ESBA 4U01A 2CJIA 1HAZB 4X6OA 1LHGH 1DWDH 2P3FH 4BANB 1GMDG 3L6PA 1NN6A 1GBHA 1O2ZA 1V2NT 3T2NA 3LPRA 3ZVFA 1HB0B 1XMNB 1AHTH 3SU4A 4ZMAH 6LPRA 1A0LA 3PV4A 4X8UH 1TRYA 2HPQH 1C1UH 1XKAC 3AW1A 1WOFA 1Y8TA 1C5WB 2HRVA 1SGPE 2A7JA 1AGJA 2XCFA 1IQHA 3ODDA 3QX5H 1QB9A 4UONA 2F9PA 1TA2A 4X1QU 1TOCB 1MQ5A 3HK6B 3VPKA 3QUMP 3T26A 3BTQE 1EATA 2GV6A 3HKJB 1C2LA 3GY3A 1HIAB 2H9TH 3SW2B 2FODA 3RXUA 1SFIA 1WTHD 1UTOA 1Z6JH 1ZPBA 2G5NA 3AASA 1BMAA 4YZUA 2ZFQH 4YLQH 1GJDB 1QIXB 1C2DA 4MPVA 1GL0E 2P8OC 3GOVB 5EQRA 3BTEE 3E16B 3U8OH 1QJ1B 2FI5E 1DDJA 1C1NA 2WPIS 3GICB 3MH5A 6CHAC 1FIZA 4FUHA 1ZHRA 3UOUA 1BRUP 4LK4A 1UTMA 1MCVA 3ZVAA 3S0NA 1MKXK 2ZHWH 4X1NU 2QAAA 1Y3YA 1SLVB 1VITH 4K69A 3P8NA 1BTHH 1A5GH 4MPWA 4XE4A 2FS9A 1B7XB 1KLIH 1L0ZA 4NIXA 3VB3A 1BTZA 1F0TA 1GGDC 4WVPE 1GG6B 3MU4A 5EPYA 1LHFH 2BX4A 3MNSA 2B9LA 4ISOA 1FY3A 5L30H 4Q7XA 1MBMA 4DOQA 4AG1A 3ZVGA 2OP9A 1FV9A 1PPCE 2AMDA 2PTNA 4Q2KA 3QGNB 1YP9A 3HATH 5AHGH 2GCTC 8KME2 3O8RA 4AX9H 2FTMA 1C5RA 1T31A 4Y8XA 2Z3EA 1NZQH 3MYWA 5H4IB 3SJ9A 2BQ6B 1TMTH 1S83A 1O3MA 1UMAH 3SJKA 1E35B 3UWJH 4FU7A 4JMYA 1YPEH 3DFLA 1MKWK 2BYAX 2GCTB 1LTOA 2PUXB 2QIQA 1MTNC 5AFZH 1CGHA 3O8BA 4NWKA 3M61U 5A0CA 1AKSB 1Y5UT 2Z9GA 1JWTA 5FCKA 1IQKA 1O3BA 4XBDA 4CRCA 3STIA 2Z94A 2WPJS 1ELTA 1YGCH 3ZZBA 3RXLA 3PLKA 2GD4B 1S0QA 3RC5A 3RXEA 4X6MA 2HWLB 1MQ6A 1GI0A 1RIWC 2R2MB 1YPHC 2VH6A 1L2EA 3TK9A 1INCA 1B0EA 3FP8E 3QZQA 5DP7A 2F9OA 3MH6A 2Z9LA 3BEFB 4GAWA 4OS7A 1O5GH 1GBDA 3BEUA 1QCPA 8GCHF 1UTLM 1EPTC 2QXJA 5T3HA 1DSTA 5EPNA 1TNJA 4I8GA 5JPMH 4IMZA 1U6QA 1AIXH 1MTWA 3HGNA 5EU8A 3T62A 2VINA 3RXAA 1T8NA 2VWLA 3VXEH 1B0FA 3MO6A 3ZYEA 2VU8E 1IQIA 2GZ7A 4K1SA 1D4PB 1AN1E 2ZU2A 2HPPH 1W10U 4ZHAA 1K1LA 1T8LA 3DA9B 2Y80A 2D26C 1CA0B 1BRAA 1TX6A 4SGAE 1ANEA 2ZIQH 1DITH 1YF4A 2C8YB 4NA7A 4NWLA 4ISLA 4K60A 4UDWH 4X2YA 3SNCA 1K1JA 2J38A 1GCTB 1XUJA 5F8XA 1O38A 1SI5H 1WCZA 3GISB 4FVBA 5FPTA 1O2KA 1P2KA 2VIWA 1YPGH 2TGDA 2ANMH 9LPRA 1OYQA 1C5OH 2C8ZB 4IN2A 4NA8A 4X8SH 5L2YH 4MQAA 1H9IE 1MTVA 5B6OA 2PFEA 3RXDA 1O39A 1QHRB 1SHHB 4AFZA 3UNRA 4UFGH 2XWAA 3SHAH 1O5BB 1ZHMA 2NU1E 2STAE 4H6TA 3LH1A 1V2LT 1T8MA 1Q2WA 3ZVDA 3ATKA 1SGRE 1HAOH 2ASUB 1NFUA 1YPMH 1ZGVA 4CR5A 1ZZZA 2AGEX 3SGAE 4Y7BA 4XBBA 1TGCA 1GPZA 3RXHA 1O2HA 1YM0A 1C2EA 2XW9A 5E0JA 2BDGA 4BTIB 6GCHF 1YPJH 1QA7A 5JBTA 2BLWA 1O3CA 1SGIB 2B0FA 2F9NA 4UFFH 4YLUA 3JZ2B 1ARCA 5LGOA 6ESTA 2AFQB 5FXLA 2WUCA 2FEQH 2FLBH 2PR3A 4RKOB 2ZDNA 5GPIB 1C5PA 2ANYA 4IC5A 1FQ3A 2IPHA 2WV4A 1AVGH 1X7AC 1UCYH 3SJOA 1FN8A 4JYUH 6GCHG 1AFQB 2BD7A 4WMFA 3SNDA 1GDNA 1NU7B 4JZ1A 1BJUA 3MI4A 2J95A 1CGIE 1HCGA 1K9OE 4D7GA 5FX6A 1SGNE 3NXPA 3UNSA 1ETRH 4NG9H 2WPHS 3GCNA 4NSYA 3S9BA 1IQNA 3FP6E 1Y3XA 2QYIA 3PWCA 4JK6A 2OXSA 1EX3A 1P8VC 1T7CA 2CXVA 2A7HA 3IWMA 1GI5A 1O32A 1QGFA 4ABDA 1BOQA 2XBWA 3GY5A 2BOHB 3K2UA 5C20A 1PQ8A 2QF3A 4K8YA 4TWWA 8ESTE 1VZQH 5EG4A 1QL8A 1W12U 4QT8C 4OS5A 1TIOA 4BAHB 2C90B 1V2JT 5C2ZA 1SBWA 1QA0A 3NKKA 4Y7AA 2BDAA 1TONA 1C5MD 1H1BA 1ETSH 1HAHH 3LONA 1KDQB 4BTUB 1C1WH 2D8WA 2CF8H 1NU9A 4B2AA 1WAYB 1D3PB 1DS2E 1GMHF 2V0BA 1ELCA 1SR5C 2FOMB 2J34A 2M5TA 4I8JA 4D7FA 3SQHE 1C5VA 1YYY1 1BJVA 4GLYA 2QN5T 2VGCB 1O3GA 3STJA 2BX3A 4AOQA 3CS7A 1MTSA 2FP7B 1MAXA 3KL6A 3SV9A 1LVBA 1ETTH 1UK2A 3LJJA 4X1SU 2PV9B 1J8AA 1W3CA 1GL1A 1THRH 4B76A 2A5KA 3F1SB 1K1PA 4I32A 3KEEA 2GGVB 4B2BA 5DP5A 3DD2H 3RLYH 2VWNA 1ANCA 2BXTH 3TGKE 3QTVH 1P02A 1XXFA 3BTFE 4F4OC 2Y5GA 4R0IA 2A5AA 3SQEE 2BY5X 1V2KT 2BD2A 3PM3A 2ZCHP 1OWDA 1BUIA 1Z8JB 4DY7B 2FX4A 5DP3A 1QJ7B 2PGBB 3A88A 1D6RA 1C5YB 3V12A 2OC7A 3BTKE 4TYDA 3A86A 1O5CB 2J92A 1YPLH 4INHA 1SGTA 2AERH 3A8CA 4LZ4B 1EAUA 1NRSH 1GGDB 2BLOA 2PGQB 7ESTE 1C2KA 2PKSB 2ZPQA 1DT2A 1K1OA 4GCHF 2FI3E 3E91A 2G51A 5FX5A 1V2ST 3A87A 1C5XB 1S85A 1GJBB 3LKWA 2G4TA 3U8RH 3ZYDA 3E90B 1XUGA 2BHGA 1GHAG 4CBNA 1EZQA 4VGCB 2W5EA 3Q3YA 1G9IE 4MG3A 1HJAC 3TJNA 3VGCC 5K0HA 3RXVA 5LPRA 1JIMA 2Y7XA 2XBVA 1TWXB 1O2NA 5A8ZA 1O3JA 1SGQE 3I78A 1SSXA 3AW0A 1VR1H 1DUAA 3SJIA 1QNJA 2ZU3A 3F68H 3UREA 1GBKA 1XUKA 2BY9X 1ZRBA 3A7WA 4A6LA 2UUFB 1Y3WA 3QO6A 3K6ZA 1K2I1 3UWIA 4ISIH 1W7XH 3BTDE 1WYKA 1OWKA 4TY7A 1VITG 5FAHA 4KGAA 5EW2H 3GCOA 1YKTA 2C8XB 4B1TA 3FP7E 2ZG0H 1EAWA 1P2IA 1OX1A 5F8TA 2Q6DA 1Y5BT 5C1UA 2BVSH 3P6ZB 4NSVA 2FOEA 1P2JA 4I7YH 4WH8A 7LPRA 2NU2E 2ODQA 1IHSH 2ZU1A 3DT0H 2BDIA 8LPRA 1O2LA 1FI8A 3PTNA 3E1XB 3RLWH 1E34B 3MNXA 3PLPA 3FAOA 3RXCA 7GCHG 1ZMNA 2CGAA 2G52A 3P8GA 1FIWA 1HAYB 2CHAB 1OSSA 3F9EA 2RG3A 1EJNA 3U1IB 2W3IA 1VCWA 2G5VA 4ESTE 1A3BH 2ZEBA 3UY9A 4WY3A 1EB1H 1LVMA 1MTUA 3VEQB 1QY6A 5DP8A 1TRMA 3LOXA 2C93B 1V6DA 1WQVH 4Q80A 4E7NA 2EEKA 3S7HB 4Q7ZA 3MNCA 4I33A 1IQEA 4SGBE 3FZZA 1S5SA 3TH3H 2BD5A 2Y81A 2BVRH 3UIRA 1FJSA 3CENA 3DFJA 4I31A 4YESB 3EYDA 5C5OA 2A4RA 1W11U 1UTQA 4IS5A 1EUFA 2WYJA 2Q6FA 2A45B 3TNSA 1YCPH 1K21H 1KY9A 1ZGIA 2RA0A 1HV7A 3OYPA 2FYRA 2VIQA 3UTUH 1AE8H 1F5KU 4M7GA 1CO7E 1MZDA 1XKBC 2F3CE 2XC4A 3A7VA 3ZVBA 3L3TA 5EXMA 2I6QA 1PJPA 1SOTA 4MNVA 1L1NA 3SV7A 1ZRKA 4MVNA 5FBEA 1CGJE 2LNCA 2PSYA 3QK1A 3RXFA 3BG4C 4X0WU 4J2YB 1VITF 3LGYA 1HYLA 2CN0H 2V3OH 1BMMH 4WXVA 3M36A 4CRDA 3NUMA 1UTJA 4ZAEA 2BM2A 3O8CA 1K1MA 4VGCC 3QN7A 3SUGA 4ZH8A 4NZQA 1GMDF 1F7ZA 2A32A 5GWZA 4XOJA 2LPRA 3RXGA 1GJ4H 2H6MA 4Y10E 1O37A 1PPHE 1P03A 1PYTC 3P8FA 2PKAB 1THPB 2GX4A 3GDUA 1F0UA 2F9VA 5L2ZH 1ZPZA 4NFFA 5I25A 1T32A 1FZZA 1O3KA 2JH6D 1SLWB 3SI3H 1EZXC 3KIDU 3ZVEA 1KXBA 3EQ0H 1KXDA 3R0FA 4TPYA 1MTNB 1SG8B 5T6DA 1BIOA 1O35A 3LC3A 1C2HA 1KLTA 2GV7A 1CHOF 2FIRH 1DWEH 2CF9H 5JBCS 4PROA 1OPHB 1N6YA 3C1KA 3TJVA 3K6YA 1G3CA 2ZU5A 1C1QA 1F2SE 2XC5A 2A2QH 1O2JA 3MO9A 1GI9B 2ZI2H 3AAVA 1IQLA 1HAXB 5C67A 1BHXB 3V13A 5A8YA 3A83A 3PYHA 2GTBA 3TJUA 4AGJA 4UE7H 1C5ZB 2FX6A 2RDLA 3VB6A 1JRSA 1BTUA 3N7OA 4Q7YA 4Y8YA 1NTPA 1EXFA 2ZPRA 3M5LA 3UR6A 4IW4E 1FLEE 4Y71A 2XXLA 1V2QT 2A4GA 4X1PU 2BD9A 4UFEH 5FCRA 3BTTE 1F0SA 1TB6H 1DXWA 1W7GH 2ODYB 1TX7A 2EI7A 1SC8U 3A7XA 5A8XA 1NT1A 4CHAC 1O2XA 1VCPA 1BHXF 5FPSA 4B71A 1ORFA 3BF6H 3FZDA 1Z6EA 4YT6H 1OYTH 1TAWA 1A46H 1AB9C 1WTGH 1O3EA 1GHYH 1C4U2 1O5FH 1C2MA 1BB0B 3KF2A 1H8IH 3KHVA 1H9HE 1UVSH 1SOZA 1TQ7B 5J4QA 3P17H 1O3AA 2AGIX 1DANH 2BDYA 4MNXA 1LPGB 3F9FA 3K9XB 1E37B 1QTFA 1O3FA 1FY5A 4ABHA 3H7TA 1C4Y2 1MKXH 4X2XA 4FUBA 2OQ5A 1V2MT 1DE7H 4JYTA 5CMXH 1AVXA 4FVDA 1EAXA 1EQ9A 3LIWA 1AD8H 1G3DA 2GVFA 1HAVA 2P94A 2W3KA 5TJXA 3OU0A 5EQSA 1NPMA 3UQVA 3TVJB 1BTXA 3RXIA 1UVPA 3A8BA 1Z8GA 2ULLA 2ZA5A 3M3SA 4ZKOU 4KELA 1O3PB 4DT7B 2P3TB 5EW1H 3HPTB 5JBBS 2FOBA 4MDSA 1EPTB 3F9HA 3Q3XA 2A2XH 8GCHG 1FXYA 3MU5A 1XVOA 4FUFA 1PFXC 3TK6A 1JIRA 4F49A 2BB4A 1GI1A 4E05H 1P3CA 4AFSA 2ZFPH 1V2UT 4A1TA 3SNBA 2J2UA 3A82A 1TLDA 4H6SB 2IJOB 1BDAA 3SU5A 4JK5A 1G30B 1P9UA 2G81E 2GDDA 1C5UA 2Y7ZA 3Q3KA 5I46H 1NRPH 1KXFA 1B5GH 1Z7KA 1DWCH 4BAQB 4HI3A 4LZ1H 2GMTB 4HZHA 4YOGA 1G37A 3W94A 1MMJN 3EDXB 1SB1H 1H4WA 1KYNA 4ZKRU 3TK5A 1MU6B 1GCTC 4BAMB 1C1TA 1GHAF 2W7UA 1GBIA 5C1XA 1HXFH 2FS8A 4GPGA 2P3UB 1SGFG 1KSNA 2OC8A 4FUIA 4FUGA 2Z7FE 1S6FA 3JZ1B 4OS1A 2AIPA 3BN9A 9ESTA 2FZZA 1S6HA 2STBE 1EB2A 1CQQA 1QRXA 3RC4A 2ZFSA 1V2OT 2SGDE 1AO5A 2RA3A 3RMMH 3LGTA 1C9TA 1EKBB 3BEIB 1ANDA 2JETC 1TPOA 4X8TH 1VGCC 4O3UA 4ZROA 3OY5U 1A2CH 2A4QA 3MU8A 1SHYA 4XBCA 1PPFE 3SBKA 1O2WA 1UHBB 4A5TS 2XRCA 4I8HA 2ZKSA 1GMCF 2XBXA 3SU0A 2VJ1A 1QBOA 3TH2H 1VGCB 3RM2H 4JZDH 3V3MA 2ZDAH 1EAIA 1UVUH 1V2VT 1JOUB 4XSKU 2VWOA 1O30A 1YLCA 1DLEA 1S81A 5C1YA 2KAIB 1CHGA 4THNH 3H5CB 1EP5A 4IN1A 2ZGBH 1MD8A 3TITA 4CH2B 1NO9H 5A2MH 2H5DA 1ZJKA 2D2DA 3ENSB 1D3QB 1DICA 3TH4H 1QQUA 3QGJA 4WWYA 3SV6A 3GY7A 3PMBB 1SLXB 1P11E 1XVMA 5T6FA 1LQEA 1ZSJA 2W7SA 3RMOH 1J14A 1HPGA 3UOPA 4ZHMU 5ABWA 1LVOA 3CS0A 2XC0A 4AB9A 2FPZA 1PYTD 1C1SA 3KNXA 2QY0B 1O2RA 3ODFA 1TPPA 2H1UA 1EPTA 3E8LA 1CBWB 4JZFH 1O36A 3B9FH 1JRTA 3P70B 4Z0KA 1DXPA 2PW8H 1Y59T 3VB5A 2SFAA 4E06H 3VXFH 1QQ4A 2FXRA 1ELEE 2GCHG 1ESTA 1SGYE 2BD4A 3SNAA 2OBOA 1P2NA 3RXBA 2R2WU 4GVUA 2Z9JA 1SGFA 3W95A 3ATMA 3BTGE 1GG6C 1GBMA 5T6GA 2ZGCA 1FY4A 3T28A 3KGPA 3T5FH 2PUQH 2GCHF 2YNAA 1C5TA 4Y76A 3RMNH 2Y82A 1AQ7A 3URDA 1Z1IA 4WXIA 4WMEA 4YTAA 2A7CA 5G4BA 4CRFA 2UWLA 2Z3CA 2AIQA 1Y5AT 1UK4A 1AU8A 2BVXH 4CH8B 1O3LA 2HNTE 4BTTB 4B2CA 5HXFA 1TBZH 1CA8B 4MNYA 2XTTB 3M5NA 4K5ZA 5CHAB 1D3TB 2Z3DA 1DFPA 4MNWA 1OS8A 3EE0B 1GHXH 4ZKSU 4ABEA 3U1JB 3BV9B 1D6WA 1G36A 1TNHA 2H9HA 4O3TA 1PQ5A 1C1PA 3GDVA 5GIBA 1L1GA 2V3HH 3A85A 2TBSA 5E0GA 1QJ6B 4AGKA 1NRNH 2B5TB 4NFEA 2DUCA 4INLA 4Y0ZE
chains in the Genus database with same CATH superfamily
4TY6A 4UD9H 1P57B 2ZTYA 2PLXA 1Y3VA 3ITIA 5IYTA 2NU3E 1FDPA 1MABB 1H9LB 5LPEA 5DK1A 4FU8A 1ID5H 2JKHA 1DX5M 1MCTA 3A8DA 1Q31A 2VIPA 2CV3A 3U69H 4I8KA 4BXWA 4D76A 3URCA 1N6XA 2ZWLH 3RXTA 1TMBH 2L6OA 5FHTA 1AY6H 2ZHFH 2ZZUH 2VIVA 1TFXA 3AAUA 2ZNKH 1A5HA 3DHKH 2K0QA 3EGKH 1NFYA 1G3BA 1Z71A 4YOIA 2FOCA 1BBRE 1AI8H 1ZTKA 3KQ5A 2QV1A 3TJOA 2VBCA 4D9RA 2GT8A 2R0KA 2O8UA 1H8DH 3TU7H 1BITA 3ZZ5A 4ABIA 4FUCA 3ZZAA 1GVKB 2ZO3H 3RM0H 2EI6A 3FN8A 4ISNA 2HGTH 1K22H 4DT4A 1A5IA 3GYMA 5JDUB 5DP4A 1YBWA 3TGIE 5EQQA 3ZZ9A 4FUEA 2FOGA 3ZVCA 1AKSA 1SLUB 1DY8A 4K1TA 4BNRA 1VJAU 1K1IA 4A92A 1NRQH 1GBEA 1GDUA 1GI7B 5IDKA 1O2OA 2ZDLA 2TGAA 1GDQA 2FYQA 1W0ZU 5HM2A 1UK3A 2H9EH 3G01A 2FOHA 1JXPA 1YLDA 3D23A 1S6LA 3LGIA 1LQDB 1TPAE 5DG6A 1A3EH 2SNWA 4A1VA 2LP6A 1RJXB 2SGQE 3A80A 1RRKA 4MTBA 4ASHA 1AZ8A 4Z6AH 2EI8A 1TNGA 1GVZA 1RFNA 1O3DA 1XUIA 1EZSC 1ZR0A 2J9NA 3OY6U 4ZXXH 2BDHA 1LHCH 3LJOA 1O5EH 3SI4H 4KTCA 3GY2A 2NU4E 1GJ8B 1T4VH 3RC6A 1NBME 1GJAB 2H2ZA 1S84A 1C2FA 3A7YA 3U8TH 2QXHA 3IG6B 1XUFA 2ZP0H 5C5NA 1WQSA 2GT7A 4XDEA 3S69A 5BPEA 1NRRH 4A1XA 4GUXA 3UR9A 1QRWA 2K8IA 2BMGB 4BAOB 4B75A 2THFB 1P10A 1TALA 3PO1B 1O2VA 4AZ2B 1ELVA 1V2TT 1G2MA 3GCHB 2BY8X 2TPIZ 3PROA 3MH4A 5HKKD 3TNTA 3SV8A 3RXQA 1UHBA 2F83A 1GHZA 4AC9A 1IQMA 2JIZD 4TWYA 4IBLH 1QURH 2UUJB 1W14U 1YY3A 2TGPZ 2KCAA 1LVYA 1UVOA 5A0AE 1HDTH 5DSFA 4NZLA 3GY4A 1SQOA 1TX8A 3M7TA 3OEED 3U9AH 1GMHG 1O5AB 1RXPA 1O31A 1FN6A 2QC2A 2XBYA 2DE8A 1RTFB 1TGSZ 1CA0C 2O8TA 2ZDKA 5F53A 3HK3B 3KQCA 3GCTF 2GP9B 1P04A 1L4ZA 1XUHA 3MH7A 4F55A 1NESE 2J4IA 3A7ZA 4K1EA 3F9GA 1EFRD 3TLOA 1P2QA 3MU1A 3BTHE 4FOUC 2FMJA 1QB1A 3SORA 1ZMJA 5GDSH 4HTCH 1AE5A 1NBMD 2F9UA 1TE0A 2OTVA 2WZQA 5ETXA 1BMNH 3PV5A 3CP7A 1J9CH 3E3TA 1HAVB 1O2SA 2ANKH 4WH6A 3SNEA 2ZC9H 3ELAH 1G2LA 1PPBH 1RGQA 3NRLA 4E7RG 3PMAB 4OS6A 5HGGA 2O8LA 1YCPM 1O2MA 5HYOA 1O2GH 4P02A 4X6NA 1CT2E 3I77A 2P93A 4X8VH 1SGDE 3QTOH 1C1RA 3BIUH 1PPGE 1UJ1A 2Q6GA 4RN6A 2BDCA 1A0HB 2NWNA 1SVPA 1XX9A 2A4OA 2R9PA 3Q76A 3KQDA 2BY6X 2BXUH 1N8OB 2PTCE 1WUNH 2HALA 2VIOA 1N1LA 3QLPH 1GJ9B 3KN2A 1E0FD 3SUFA 1ANBA 1FMGA 3VB4A 1FUJA 1YCPK 2Z9IA 4JZIA 3RXRA 1HJ9A 1TBQH 3E6PH 1HNEE 5JB8S 1TNLA 3GCTG 3NK8A 1GJCB 3BG4B 2JETB 3PB1E 1N8OC 4RSPA 5JB9S 5LPFA 2PWXA 1P05A 1ZHPA 2JH0D 3MTYA 4K8BA 1V2RT 3GS9A 1BTYA 3SUEA 1T8OA 1Y3UA 1BA8B 2G4UA 4DJZB 1PQ7A 1FONA 2GZ9A 1BTWA 2TIOA 1EZUC 3SO3A 4JZEH 3HKIB 3ATIA 1O33A 2ZGHA 5E2OA 2CHAC 2ILNA 2WPKS 3M37A 1LPZB 1NY22 3S9AA 1P06A 2J98B 5PTPA 2A0QB 4WJG2 1D3DB 4K3JA 1J15A 1GHBG 5K7RA 1P2MA 2C8WB 2P95A 1OP8A 2BZAA 2WPMS 4CR9A 4BXSA 4X1RU 1QR3E 1KIGH 1HJAB 1A4WH 2F9BH 2I6SA 1VCQA 5F03A 2OD3B 4NIYA 1HUTH 4FUJA 3QZRA 5CHAC 5EODA 2ALPA 1DSUA 4AB8A 1HXEH 1O3OA 5L6NH 3SGQE 1AWFH 3RXMA 1AFEH 1CSOE 5EIYA 2VWMA 2BTCE 1OXGA 4DW2U 3RXPA 2QA9E 2P16A 3WY8A 1TGTA 2OLGA 1TNIA 5GCHG 5E0HA 7GCHF 1SQAA 2O8WA 1BMLA 2TGTA 1SPJA 4MPXA 1C2JA 3RMLH 4DURA 2FTLE 1HRTH 4X6PA 2VIDA 4X2VA 4O03A 3DSOA 4AORA 2GKVE 4OS4A 4JCNA 1O3IA 1GWAA 4AYYB 1BZXE 1GBTA 1RTKA 1ZPCA 2ZGXH 2V35A 3ESTA 2HNTC 5LH8A 2ALVA 2SGFE 2J97A 1D9IA 5EXLA 3L33A 1UTNA 1GBCA 5GJ4B 1DPOA 4IGDA 4RKJB 2G8TA 3S9CA 1MKWH 1UO6A 3A89A 3FANA 1P09A 1Z8IB 1V2WT 2DE9A 3VFEA 4U30A 2PHBA 1ELAA 1QRZA 1P0SH 1C5SA 2XNIA 4LXBH 1V3XA 1FY1A 2VVCA 2FO9A 1O0DH 4AG2A 5JYIA 2ODPA 1FX0B 4D9QA 4AFUA 4CBOA 3MOCA 1F0RA 1GBBA 4OM9A 4YOJA 2UUKB 3BSQA 2Y5FA 4O97A 3ZZCA 3IITA 4LOYH 1A61H 3OAAD 1GHWH 3SU1A 2GMTC 1V2PT 3U28C 1O2PA 2P8OB 2TRMA 4CRAA 4XFQA 5A09A 1C5NH 3FKSD 2BLQA 2WYGA 2Y6TA 2ZU4A 1DY9A 1PPEE 5GCHF 3S7KB 4CRGA 1DWBH 3LGUA 1E36B 2AH4X 2YMSB 3RXOA 3RU4E 1TOMH 2YOLA 1W2KH 3T27A 5C94A 1SQTA 2VVUA 3SOSA 1C1MA 1KTTB 3RXSA 1A0JA 4B74A 2BQWB 1OP0A 1HAIH 1XM1A 3GYLB 4AFQA 2ZGJA 4J1YA 3AVZA 3P95A 1H8ED 5DO4H 5C3NA 2YNBA 4DG4A 1COWD 2ZFTA 1WU1A 1CBWC 5C17A 2QE7D 4HFPB 3ZV8A 4U32A 1L4DA 2FOAA 1ZOMA 2AMQA 1THSH 2XCNA 3VGCB 2ZTZA 1GI3A 1L1JA 1ELDE 2FDAA 3M7QA 3ZZ8A 1PQAA 1BCUH 1GBAA 1W8BH 3GY6A 3SHCH 5F8ZA 4P00A 4DIIH 1EJMA 1FAKH 3I29A 2EY4C 4FU9A 1GI2A 4ABBA 2A1DB 1HAGE 2ZFFH 4ISHH 1RD3B 1E38B 4MLFB 3LDXH 1BT7A 4OS2A 4CHAB 4YO9A 3KCGH 4K2YA 1YPKH 1AB9B 1MZAA 3RXKA 3MU0A 4HGCA 1GJ6A 2ZHQH 1TGBA 3SJ8A 2O9QA 1YPHE 3M35A 2XYAA 3A84A 3OE7D 1E1QD 2QF4A 3OFND 3N7EA 2AEIH 3M7UA 3SU2A 1RS0A 1QB6A 2QCYA 1AVWA 1EASA 3UPEA 2WUBA 1OWJA 3U98H 1C1OA 3UB0A 1MH0A 3PWBA 1C2GA 1SGEE 1QBVH 3E0PB 1RIWB 2ZQ2A 1M9UA 3UQOA 1RTLA 2VVVA 2ZCLP 2QGRA 4FXGH 5A0BA 4FETA 2UUYA 2C3SA 2KAIA 3H7OA 1BRBE 1TNKA 1GI6A 2XNDD 4INKA 1ACBE 1OWEA 2R0LA 2WV5A 4Y79A 2R3UA 4KTUA 4KP0A 2IN2A 4GHTA 3ZZ4A 1GCDA 4ZCNA 1GBLA 1MU8B 1QL7A 1J17T 1EOLA 3ZZ7A 2EQNA 1UVTH 4NGAH 2QXIA 3TPIZ 1WSSH 1O2TA 2A5IA 5FL7D 1TBRH 1GBFA 4I8LA 3BIVH 3NZIA 2XWBI 1SFQB 1P12E 3SU3A 1ABIH 3D62A 4BAKB 5BRRE 1BMFD 2L74A 2OINA 4YT7H 3M3TA 2W6JD 3OX7U 3T29A 4FUDA 1UTPA 2WV9A 2KR7A 1BBRK 1GI4A 2BOKA 3MNBA 4Y8ZA 1CE5A 4TPIZ 4AN7A 1AZZA 2G00A 1P9SA 1TGNA 5DP9A 1PPZA 2ZQ1A 1CU1A 2M2AA 3KQBA 1AFQC 2ZDMA 4DVAU 1QFKH 4Y0YE 2QF0A 1ESAA 1IQGA 2ZTXA 4AYVB 1F92A 1KLJH 2Y5HA 5J4SA 1O3NA 3Q77A 4DGJA 2K1QA 1HFDA 2VH0A 3MO3A 2ZHDA 2B7DH 4ACAA 1ELBA 4D8NA 5DKMA 3ZZ6A 3MFJA 3SN8A 1HBTH 5EOKA 3RU4D 3LGWA 1NM6A 1KXCA 2FM2A 2BD8A 3RUOA 5CHBA 1T4UH 1O34A 3SUDA 3GY8A 4H42U 3NCLA 3F6UH 3RDZA 2PSXA 1EJAA 1HIAA 3OTJE 5DPAA 3HGPA 1DUEA 5E8EH 1OP2A 4Y11E 1K28D 1G32B 1O5DH 1JBUH 2FLRH 2AS9A 3LH3A 3F3BA 4NCYA 1ELGA 1Z1JA 2AMPA 3ATLA 4ZHLU 3B8JA 2ZDVH 3NWUA 4MPUA 1Q3XA 2VB0A 3ZZ3A 1EP6A 2BQ7B 5B6LA 1O2UA 5JBAS 1W0JD 5TCCA 5KECA 2O8MA 1AUJA 2SNVA 3P8OA 2HVXA 1C1VH 2ZECA 1GHBF 2G55A 1LO6A 3LC5A 1WBGB 5HM9A 3BTME 3SV2H 4YM9A 2GDEH 4TSFD 2HOBA 5CE1A 3FOAA 2OUAA 5DJ7A 3FFGA 1IQFA 3WWBA 1EOJA 3RU4T 1A1RA 1NS3A 3UFAA 3SZNA 1HLTH 3ZV9A 2OC0A 4H4FA 1GMCG 2FOFA 1S0RA 1AMHA 2ANWA 2W6ID 2JDID 1GJ7B 1IQJA 2WINI 2KM0A 1C5QA 1SQRA 4UFDH 3VB7A 3LT3A 1J16A 1TYNA 3GCHC 4XRNA 1NC6A 7KMEH 3K65B 5EXNA 5AF9H 3PO1C 4CRBA 1NFXA 1YWUA 1ELFA 2A31A 2IOTA 2GZ8A 1W0YH 1LCYA 2F91A 1KTSB 3P92A 5E2PA 1ZSLA 2EA3A 1GBJA 1TABE 1HAPH 4Y6DA 1O3HA 1LKAA 3KQEA 2SGPE 4U2WA 1UTKA 3D49H 4NIVA 4X2WA 1KXEA 1ESBA 3DUXH 3EA9A 1ARBA 3TIUA 1LMWB 3V7TA 2HNTF 5SGAE 2JJ1D 1TRNA 1AUTC 1UCYK 3RP2A 4TT3D 1DVAH 3SU6A 1DOJA 4ABGA 4B73A 3LU9B 1P2OA 3UNQA 1P3EA 3MWIU 5ESTE 2QXGA 2PKAA 1BRCE 5GXPA 3T25A 3PMHB 3ZIAD 1CT4E 4ZXYH 1QBNA 4R8TB 4ABFA 2SGAA 1VJ9U 1JMOH 2KCOA 5AVDA 3MMGA 4YXWD 1TA6A 3FVFB 1ZSKA 2SGEE 2OK5A 3PLBA 1O2YA 4ABAA 3RXJA 5C0UA 2FWWA 4UEHH 3M5OA 1MD7A 1FY8E 2VGCC 3LGVA 1TQ0B 1MAYA 5EGMA 1OKXA 2CMYA 2Q1JA 5TCAA 3CNRA 4O9VA 5DGJA 1ZTJA 2ZHEH 1HJ8A 3B23B 3SZEA 4ZKNU 4CREA 1G3EA 4KTSA 1DM4B 1ZYOA 4DCDA 4GSOA 2H5CA 3EAJA 4OGYA 3C27B 2V7QD 1ABJH 2RCEA 1C5LH 1KXAA 4NIWA 5HMAA 1TPSA 1AWHB 2D1JA 1W13U 1HGTH 1OWIA 3D65E 4WF8A 3GDSA 1KDQA 1Z8RA 1ZJDA 2PKSC 3OSYA 2WPLS 1LHEH 4NA9H 2ZPSA 5FBIA 1P01A 1WV7H 4ACBA 2Z9KA 2BLVA 2OC1A 3A81A 3QDZB 6CHAB 1DLKB 3MHWU 1C4V2 2BD3A 3A7TA 1ZTLA 2ESTE 2FESH 1C2IA 3BTWE 2UWPA 2NU0E 2QF5A 4F48B 1MUEB 1NROH 4A7IB 4KKDA 2JH5D 2UWOA 1BQYA 1CT0E 1NFWA 1OOKB 1BTPA 2OCVB 2IJD1 3SGBE 2AYWA 1IAUA 4GCHG 1OWHA 3R3GB 4JYVH 3ATWA 1SL3A 1O2QA 3PTBA 1FPCH 2BZ6H 1XXDA 2EC9H 2OQUA 1A7SA 2B8OH 2BDBA 5FPYA 1S82A 3E0NB 1MBQA 1GHVH 3A8AA 3M5MA 2AGGX 1BBRH 1GI8B 3O8DA 1QL9A 2HLCA 2FI4E 1O2IA 1FPHH 1LPKB 5DP6A 2Z6BD 2C4FH 2ZFRH 2ZF0H 5AFYH 4IC6A 5F6MA 1SGCA 1CHOG 1LDTT 3NPSA 3QWCH 1FNIA 3UUZA 3EA8A 1CVWH 2V6NA 4OGXA 1K1NA 4WMDA 3ZZDA 4IMQA 1TMUH 3EA7A 1YC0A 1ZLRA 1F5RA 2W26A 2J94A 2OBQA 3BG8A 2LELA 3Q00A 1GVLA 3PMJA 2BY7X 4ZUHA 1IHTH 4GHQA 4ABJA 1C9PA 1GJ5H 1F5LA 4BOHA 4DIHH 1K0HA 1W0KD 1ZMLA 1UCYE 2KFWA 1LHDH 3TGJE 2P59A 3V0XA 1SMFE 2KCPA 2R3YA 1LKBA 2VNTA 3M3VA 1IOEA 2ZCKP 1FAXA 5ESBA 4U01A 2CJIA 1HAZB 4X6OA 1LHGH 1DWDH 2P3FH 4BANB 1GMDG 3L6PA 1NN6A 1GBHA 1O2ZA 1V2NT 3T2NA 3LPRA 3ZVFA 1HB0B 1XMNB 1AHTH 3KYFA 3SU4A 4ZMAH 6LPRA 1A0LA 3PV4A 4X8UH 1TRYA 2HPQH 1C1UH 1XKAC 3AW1A 5HIZA 1WOFA 1Y8TA 1C5WB 2HRVA 1SGPE 2A7JA 1AGJA 2XCFA 1IQHA 3ODDA 3QX5H 1QB9A 4UONA 2F9PA 1TA2A 4X1QU 1TOCB 1MQ5A 3HK6B 3VPKA 3QUMP 3T26A 3PRDA 3BTQE 1EATA 2GV6A 3HKJB 1C2LA 3GY3A 1HIAB 2H9TH 1WXRA 3SW2B 2FODA 3RXUA 2KZ4A 1SFIA 1WTHD 1UTOA 1Z6JH 1ZPBA 2G5NA 3AASA 1BMAA 4YZUA 2ZFQH 4YLQH 1GJDB 1QIXB 1C2DA 4MPVA 1GL0E 2P8OC 3GOVB 5EQRA 3BTEE 3E16B 3U8OH 2RDEA 2FI5E 1QJ1B 1DDJA 1C1NA 2WPIS 1QZ8A 3GICB 3MH5A 6CHAC 1E1RD 1FIZA 4FUHA 1ZHRA 3UOUA 1BRUP 4LK4A 1UTMA 1MCVA 3ZVAA 3S0NA 1MKXK 2ZHWH 4X1NU 2QAAA 1Y3YA 1SLVB 1VITH 4K69A 3P8NA 1BTHH 1A5GH 4MPWA 4XE4A 2FS9A 1B7XB 1KLIH 1L0ZA 4NIXA 3VB3A 1BTZA 1F0TA 1GGDC 4WVPE 1GG6B 3MU4A 5EPYA 1LHFH 2BX4A 3MNSA 2B9LA 4ISOA 1FY3A 5L30H 4Q7XA 1MBMA 2IPQX 4DOQA 3WWFA 4AG1A 3ZVGA 2OP9A 1FV9A 1PPCE 2AMDA 2PTNA 4Q2KA 3QGNB 1YP9A 3HATH 5AHGH 2GCTC 8KME2 5C0TA 3O8RA 4AX9H 2FTMA 1C5RA 1T31A 3FO8D 4Y8XA 2Z3EA 1NZQH 3MYWA 4M9FA 5H4IB 2BQ6B 3SJ9A 1TMTH 1S83A 1O3MA 2JJ2D 1UMAH 3SJKA 1E35B 3UWJH 4FU7A 4JMYA 1YPEH 3DFLA 4Z1MD 1MKWK 2BYAX 2GCTB 1LTOA 2PUXB 2QIQA 1MTNC 5AFZH 1CGHA 3O8BA 4NWKA 3M61U 5A0CA 1AKSB 1Y5UT 2Z9GA 1JWTA 2F4LA 5FCKA 1IQKA 1O3BA 4XBDA 4CRCA 3STIA 2Z94A 2WPJS 1ELTA 1YLNA 1YGCH 3ZZBA 3H09A 3RXLA 3PLKA 2GD4B 3DSPA 1S0QA 3RC5A 3RXEA 4X6MA 2HWLB 1MQ6A 5EJLA 1GI0A 1RIWC 2R2MB 1YPHC 2VH6A 1L2EA 3TK9A 1INCA 1B0EA 3FP8E 3QZQA 5DP7A 2F9OA 3MH6A 2Z9LA 3BEFB 4GAWA 4OS7A 1O5GH 1GBDA 3BEUA 1QCPA 8GCHF 1UTLM 1EPTC 2QXJA 5T3HA 1DSTA 5EPNA 1TNJA 4I8GA 5JPMH 4IMZA 1U6QA 1AIXH 1MTWA 3HGNA 5EU8A 3T62A 2VINA 3RXAA 1T8NA 2VWLA 3VXEH 1B0FA 3MO6A 3ZYEA 2VU8E 1IQIA 2GZ7A 4K1SA 1D4PB 1AN1E 2ZU2A 2HPPH 1W10U 4ZHAA 1K1LA 1T8LA 3DA9B 2Y80A 5GNDA 2D26C 1CA0B 1BRAA 1TX6A 4SGAE 1ANEA 2ZIQH 1DITH 1YF4A 2C8YB 4NA7A 4NWLA 4ISLA 4K60A 4UDWH 4X2YA 3SNCA 1K1JA 2J38A 1GCTB 1XUJA 5F8XA 1O38A 1SI5H 1WCZA 3GISB 4FVBA 5FPTA 1O2KA 1P2KA 2VIWA 1YPGH 2TGDA 2ANMH 9LPRA 1OYQA 1C5OH 2C8ZB 4IN2A 4NA8A 4X8SH 5L2YH 4MQAA 1H9IE 1MTVA 5B6OA 2PFEA 3RXDA 1O39A 1QHRB 1SHHB 1UW7A 4AFZA 3UNRA 1OHHD 4UFGH 2XWAA 3SHAH 1O5BB 1ZHMA 2NU1E 2STAE 4H6TA 3LH1A 1V2LT 1T8MA 1Q2WA 3ZVDA 3ATKA 1SGRE 1HAOH 2ASUB 1NFUA 1YPMH 1ZGVA 4CR5A 5EJ1A 1ZZZA 2AGEX 3SGAE 4Y7BA 4XBBA 1TGCA 1GPZA 3RXHA 1O2HA 1YM0A 1C2EA 2XW9A 5E0JA 2BDGA 4BTIB 6GCHF 1YPJH 1QA7A 5JBTA 2HVYB 2BLWA 1O3CA 1SGIB 2B0FA 2F9NA 4UFFH 4YLUA 3JZ2B 1ARCA 5LGOA 6ESTA 2AFQB 5FXLA 2WUCA 2FEQH 2FLBH 2PR3A 4RKOB 2ZDNA 2F43B 5GPIB 3W1EA 1C5PA 2ANYA 4IC5A 1FQ3A 2IPHA 2WV4A 1AVGH 1X7AC 1UCYH 3SJOA 1FN8A 4JYUH 4I86A 6GCHG 1AFQB 2BD7A 4WMFA 3SNDA 1GDNA 1NU7B 4JZ1A 1BJUA 3MI4A 2J95A 1CGIE 1HCGA 1K9OE 4D7GA 5FX6A 1SGNE 3NXPA 3UNSA 1ETRH 4NG9H 4B6EA 2WPHS 3GCNA 4NSYA 3S9BA 1IQNA 3FP6E 1Y3XA 2QYIA 3PWCA 4JK6A 2OXSA 1EX3A 1P8VC 1T7CA 2CXVA 2A7HA 3IWMA 1GI5A 1SKYE 1O32A 1QGFA 5EJZA 4ABDA 1BOQA 2XBWA 3GY5A 2BOHB 3K2UA 5C20A 1PQ8A 2QF3A 4K8YA 4TWWA 8ESTE 5KEDA 1VZQH 5EG4A 1QL8A 1W12U 4QT8C 4OS5A 1TIOA 4BAHB 2C90B 1V2JT 5C2ZA 1SBWA 1QA0A 3NKKA 4Y7AA 2BDAA 1TONA 1C5MD 1H1BA 1ETSH 1HAHH 3LONA 1KDQB 4BTUB 1C1WH 2D8WA 2CF8H 1NU9A 2WPDD 4B2AA 1WAYB 1D3PB 1DS2E 1GMHF 2V0BA 1ELCA 1SR5C 2FOMB 2J34A 2M5TA 4I8JA 4D7FA 3SQHE 1C5VA 1YYY1 1BJVA 4GLYA 2QN5T 2VGCB 1O3GA 3STJA 2BX3A 4AOQA 3CS7A 1MTSA 2FP7B 1MAXA 3KL6A 3SV9A 1LVBA 1ETTH 1UK2A 3LJJA 4X1SU 2PV9B 1J8AA 1W3CA 1GL1A 1THRH 4B76A 3DCLA 2A5KA 5CDFE 3F1SB 3AK5A 5HIYA 1K1PA 4I32A 3KEEA 2GGVB 4B2BA 5DP5A 3DD2H 1H8HD 3RLYH 2VWNA 3SYJA 1ANCA 2BXTH 3TGKE 3QTVH 1P02A 1XXFA 3BTFE 4F4OC 2Y5GA 4R0IA 2A5AA 3SQEE 2BY5X 1V2KT 2BD2A 3PM3A 2ZCHP 1OWDA 1BUIA 1Z8JB 3UAIC 4DY7B 2FX4A 5DP3A 1QJ7B 2PGBB 3A88A 1D6RA 1C5YB 3V12A 2OC7A 3BTKE 4TYDA 3A86A 1O5CB 2J92A 1YPLH 4INHA 1SGTA 2AERH 3A8CA 4LZ4B 1EAUA 1NRSH 1GGDB 2BLOA 2PGQB 7ESTE 1C2KA 2PKSB 2ZPQA 4XD7D 5DN6D 1DT2A 1K1OA 4GCHF 2FI3E 3E91A 2G51A 5FX5A 1V2ST 3A87A 1C5XB 1S85A 1GJBB 3LKWA 2G4TA 3U8RH 3ZYDA 3E90B 1XUGA 2BHGA 1GHAG 4CBNA 1EZQA 4VGCB 2W5EA 3Q3YA 1G9IE 4MG3A 1HJAC 3TJNA 3VGCC 3F2HA 5K0HA 3RXVA 5LPRA 1JIMA 2Y7XA 2XBVA 1TWXB 1O2NA 5A8ZA 1O3JA 1SGQE 3I78A 1SSXA 3AW0A 1VR1H 1DUAA 2CK3D 1E79D 3SJIA 1QNJA 2ZU3A 3F68H 3UREA 1GBKA 1XUKA 2BY9X 3PV2A 1ZRBA 3A7WA 4A6LA 2UUFB 1Y3WA 3QO6A 3K6ZA 1K2I1 3UWIA 4ISIH 1W7XH 3BTDE 1KMHB 1WYKA 1OWKA 4TY7A 1VITG 5FAHA 4KGAA 5EW2H 3GCOA 1YKTA 2C8XB 4B1TA 3FP7E 2ZG0H 1EAWA 1P2IA 1OX1A 5F8TA 2Q6DA 1Y5BT 5C1UA 2BVSH 3P6ZB 4NSVA 2FOEA 1P2JA 4I7YH 4WH8A 7LPRA 2NU2E 2ODQA 1IHSH 2ZU1A 3DT0H 2BDIA 8LPRA 1O2LA 2WHXA 1FI8A 3PTNA 3E1XB 3RLWH 1E34B 3MNXA 3PLPA 3PRBA 4RT0A 3FAOA 3RXCA 7GCHG 4RT1A 1ZMNA 2CGAA 2J5UA 2G52A 3P8GA 4RI0A 1FIWA 1HAYB 2CHAB 1OSSA 3F9EA 2RG3A 1EJNA 3U1IB 2W3IA 1VCWA 2G5VA 4ESTE 1A3BH 2ZEBA 3UY9A 4WY3A 1EB1H 3OTPA 1LVMA 1MTUA 3VEQB 1QY6A 5DP8A 1TRMA 3LOXA 4ASUD 2C93B 1V6DA 1VKYA 1WQVH 4Q80A 4E7NA 2EEKA 3S7HB 4Q7ZA 3MNCA 4I33A 1IQEA 4SGBE 3FZZA 1S5SA 3TH3H 2BD5A 2Y81A 2BVRH 3UIRA 1FJSA 3CENA 3DFJA 4I31A 4YESB 3EYDA 5C5OA 2A4RA 1W11U 1UTQA 4IS5A 1EUFA 2WYJA 2Q6FA 2A45B 3TNSA 1YCPH 5KGOA 1K21H 1KY9A 1ZGIA 2RA0A 1HV7A 3OYPA 2FYRA 2VIQA 3UTUH 1AE8H 1F5KU 4M7GA 3F0OA 1CO7E 1MZDA 1XKBC 2F3CE 2V3MA 2XC4A 3A7VA 3L3TA 3ZVBA 5EXMA 2I6QA 1PJPA 1SOTA 4MNVA 1L1NA 3SV7A 1ZRKA 4MVNA 5FBEA 1CGJE 2LNCA 2PSYA 3QK1A 3RXFA 3BG4C 4X0WU 4J2YB 1VITF 3LGYA 1HYLA 2CN0H 2V3OH 1BMMH 4WXVA 3M36A 4CRDA 3NUMA 1UTJA 4ZAEA 2BM2A 3O8CA 1K1MA 4VGCC 3QN7A 3SUGA 4ZH8A 4NZQA 1GMDF 1F7ZA 2A32A 5GWZA 4XOJA 2LPRA 3RXGA 1GJ4H 2H6MA 4Y10E 1O37A 1PPHE 1P03A 1PYTC 3P8FA 2PKAB 2KX4A 1THPB 2GX4A 3GDUA 1F0UA 3N99A 2F9VA 5L2ZH 1ZPZA 4NFFA 5I25A 1T32A 1FZZA 1O3KA 2JH6D 1SLWB 3SI3H 1EZXC 3KIDU 3ZVEA 1KXBA 3EQ0H 1KXDA 3R0FA 4TPYA 1MTNB 1SG8B 5T6DA 1BIOA 1O35A 3LC3A 1C2HA 1KLTA 2GV7A 1CHOF 2FIRH 3VG8A 1DWEH 2CF9H 5JBCS 4PROA 1OPHB 1N6YA 3C1KA 3TJVA 3K6YA 1G3CA 2ZU5A 1C1QA 1F2SE 5T1VA 2XC5A 2A2QH 1O2JA 3MO9A 1GI9B 2ZI2H 3AAVA 1IQLA 1HAXB 5C67A 1BHXB 3V13A 5A8YA 3A83A 3PYHA 2GTBA 3TJUA 4AGJA 4UE7H 2RDLA 1C5ZB 2FX6A 3VB6A 1JRSA 3F2FA 1BTUA 3N7OA 4Q7YA 4Y8YA 1NTPA 1EXFA 2ZPRA 3M5LA 3UR6A 4IW4E 1FLEE 4Y71A 2XXLA 1V2QT 2A4GA 2XOKD 4X1PU 2BD9A 4UFEH 5FCRA 3BTTE 1F0SA 1TB6H 1DXWA 1W7GH 2ODYB 1TX7A 2EI7A 1SC8U 3A7XA 5A8XA 1NT1A 4CHAC 1O2XA 1VCPA 1BHXF 5FPSA 4B71A 1ORFA 3BF6H 3FZDA 4Q4LA 1Z6EA 3MQKC 4YT6H 1OYTH 1TAWA 1A46H 1AB9C 1WTGH 1O3EA 1GHYH 1C4U2 1O5FH 1C2MA 1BB0B 3KF2A 1H8IH 3KHVA 1H9HE 3EE7A 1UVSH 1SOZA 1TQ7B 5J4QA 3P17H 1O3AA 2AGIX 3OEHD 1DANH 2BDYA 4MNXA 1LPGB 3F9FA 3K9XB 4HG6A 1E37B 1QTFA 1O3FA 1FY5A 4ABHA 3H7TA 1C4Y2 1MKXH 4X2XA 4FUBA 2OQ5A 1V2MT 1DE7H 4JYTA 5CMXH 1AVXA 4FVDA 1EAXA 1EQ9A 3LIWA 1AD8H 1G3DA 2GVFA 1HAVA 2P94A 2W3KA 5TJXA 3OU0A 5EQSA 1NPMA 3UQVA 2RFKC 3TVJB 1BTXA 3RXIA 1UVPA 3A8BA 1Z8GA 2ULLA 2ZA5A 3M3SA 4ZKOU 4KELA 1O3PB 4DT7B 2P3TB 5EW1H 3HPTB 3DSGA 3N7DA 5JBBS 2FOBA 4MDSA 1EPTB 3F9HA 3Q3XA 2A2XH 8GCHG 1FXYA 3MU5A 1XVOA 4FUFA 1PFXC 3TK6A 1JIRA 4F49A 2BB4A 1GI1A 4E05H 1P3CA 1WDIA 4AFSA 2ZFPH 1V2UT 4A1TA 3SNBA 2J2UA 3A82A 1TLDA 4H6SB 2IJOB 1BDAA 3SU5A 4JK5A 1G30B 1P9UA 2G81E 2GDDA 1C5UA 2Y7ZA 3Q3KA 5I46H 3F0PA 1NRPH 1KXFA 2WSSD 1B5GH 1Z7KA 1DWCH 4BAQB 4HI3A 4LZ1H 2GMTB 4HZHA 4YOGA 3WW7A 1G37A 3W94A 1MMJN 3EDXB 1SB1H 1H4WA 1KYNA 4ZKRU 3TK5A 1MU6B 1GCTC 4BAMB 1C1TA 1GHAF 2W7UA 2YMSC 1GBIA 5C1XA 1HXFH 2J98A 2FS8A 4GPGA 2P3UB 1SGFG 1KSNA 2OC8A 4FUIA 4FUGA 2Z7FE 1S6FA 3JZ1B 4OS1A 2AIPA 3BN9A 9ESTA 2FZZA 1S6HA 4B6FA 2STBE 1EB2A 1CQQA 1QRXA 3RC4A 2ZFSA 1V2OT 2SGDE 2YMSD 1AO5A 2RA3A 3RMMH 3LGTA 1C9TA 1EKBB 2PP6A 3BEIB 1ANDA 2JETC 5IK2D 1TPOA 4X8TH 1VGCC 4O3UA 4ZROA 3OY5U 1A2CH 2A4QA 3MU8A 1SHYA 4XBCA 1PPFE 3SBKA 1O2WA 4Q63A 1UHBB 4A5TS 2XRCA 4I8HA 2ZKSA 1GMCF 2XBXA 3SU0A 2VJ1A 1QBOA 3TH2H 1VGCB 3RM2H 4JZDH 3V3MA 2ZDAH 1EAIA 1UVUH 1V2VT 1JOUB 4XSKU 2VWOA 1O30A 1YLCA 1DLEA 1S81A 5C1YA 2KAIB 1CHGA 4THNH 3H5CB 1EP5A 4IN1A 2ZGBH 1MD8A 3TITA 4CH2B 1NO9H 5A2MH 2H5DA 1ZJKA 2D2DA 3ENSB 1D3QB 1DICA 3TH4H 1QQUA 3QGJA 4WWYA 3F2GA 3SV6A 3GY7A 3PMBB 1SLXB 1P11E 1XVMA 5T6FA 1LQEA 1ZSJA 2W7SA 3RMOH 1J14A 1HPGA 3UOPA 4ZHMU 5ABWA 1LVOA 3CS0A 2XC0A 4AB9A 3KYGA 2FPZA 1PYTD 1C1SA 3KNXA 2QY0B 1O2RA 3ODFA 1TPPA 2H1UA 1EPTA 3E8LA 1CBWB 4JZFH 1O36A 3B9FH 1JRTA 2KCYA 3P70B 4Z0KA 1DXPA 2PW8H 1Y59T 3VB5A 2SFAA 4E06H 3VXFH 1QQ4A 2FXRA 1ELEE 2GCHG 1ESTA 1SGYE 2BD4A 3SNAA 2OBOA 1P2NA 3RXBA 2R2WU 4GVUA 2Z9JA 1SGFA 3W95A 3ATMA 3BTGE 1GG6C 1GBMA 5T6GA 2ZGCA 1FY4A 3T28A 3KGPA 2AHME 3T5FH 2PUQH 2GCHF 2YNAA 1C5TA 4Y76A 3RMNH 2Y82A 1AQ7A 2HLDD 1Z1IA 3URDA 4WXIA 4WMEA 4YTAA 2A7CA 5G4BA 4CRFA 2UWLA 2Z3CA 2AIQA 1Y5AT 1UK4A 1AU8A 2BVXH 4CH8B 1O3LA 2HNTE 4BTTB 4B2CA 5HXFA 1TBZH 1CA8B 4MNYA 2XTTB 3M5NA 4K5ZA 5CHAB 2GJGA 1D3TB 2Z3DA 1DFPA 4MNWA 1OS8A 3EE0B 1GHXH 4ZKSU 4ABEA 3U1JB 3BV9B 1D6WA 1G36A 1TNHA 2H9HA 4O3TA 1PQ5A 1C1PA 3GDVA 5GIBA 1L1GA 2V3HH 3A85A 2TBSA 5E0GA 1QJ6B 4AGKA 1NRNH 2B5TB 4NFEA 2DUCA 4INLA 4Y0ZE
chains in the Genus database with same CATH topology
4TY6A 4UD9H 1P57B 2ZTYA 2PLXA 1Y3VA 3ITIA 5IYTA 2NU3E 1FDPA 1H9LB 5LPEA 5DK1A 4FU8A 1ID5H 2JKHA 1DX5M 1MCTA 3A8DA 1Q31A 2VIPA 2CV3A 3U69H 4I8KA 4BXWA 4D76A 3URCA 1N6XA 2ZWLH 3RXTA 1TMBH 5FHTA 1AY6H 2ZHFH 2ZZUH 2VIVA 1TFXA 3AAUA 2ZNKH 1A5HA 3DHKH 3EGKH 1NFYA 1G3BA 1Z71A 4YOIA 2FOCA 1BBRE 1AI8H 1ZTKA 2QV1A 3TJOA 4D9RA 2GT8A 2R0KA 2O8UA 1H8DH 3TU7H 1BITA 3ZZ5A 4ABIA 4FUCA 3ZZAA 1GVKB 2ZO3H 3RM0H 2EI6A 4ISNA 2HGTH 1K22H 1A5IA 3GYMA 5JDUB 5DP4A 1YBWA 3TGIE 5EQQA 3ZZ9A 4FUEA 2FOGA 3ZVCA 1AKSA 1SLUB 1DY8A 4K1TA 4BNRA 1VJAU 1K1IA 4A92A 1NRQH 1GBEA 1GDUA 1GI7B 5IDKA 1O2OA 2ZDLA 2TGAA 1GDQA 2FYQA 1W0ZU 5HM2A 1UK3A 2H9EH 3G01A 2FOHA 1JXPA 1YLDA 3D23A 3LGIA 1LQDB 1TPAE 5DG6A 1A3EH 2SNWA 4A1VA 1RJXB 2SGQE 3A80A 1RRKA 4MTBA 4ASHA 1AZ8A 4Z6AH 2EI8A 1TNGA 1GVZA 1RFNA 1O3DA 1XUIA 1EZSC 1ZR0A 2J9NA 3OY6U 4ZXXH 2BDHA 1LHCH 3LJOA 1O5EH 3SI4H 4KTCA 3GY2A 2NU4E 1GJ8B 1T4VH 3RC6A 1GJAB 2H2ZA 1S84A 1C2FA 3A7YA 3U8TH 2QXHA 3IG6B 1XUFA 2ZP0H 5C5NA 1WQSA 2GT7A 4XDEA 3S69A 5BPEA 1NRRH 4A1XA 4GUXA 3UR9A 1QRWA 2BMGB 4BAOB 4B75A 2THFB 1P10A 1TALA 3PO1B 1O2VA 4AZ2B 1ELVA 1V2TT 1G2MA 3GCHB 2BY8X 2TPIZ 3PROA 3MH4A 3TNTA 3SV8A 3RXQA 1UHBA 2F83A 1GHZA 1IQMA 4TWYA 4IBLH 1QURH 2UUJB 1W14U 2TGPZ 1LVYA 1UVOA 5A0AE 1HDTH 4NZLA 3GY4A 1SQOA 1TX8A 3M7TA 3U9AH 1GMHG 1O5AB 1RXPA 1O31A 1FN6A 2QC2A 2XBYA 2DE8A 1RTFB 1TGSZ 1CA0C 2O8TA 2ZDKA 3HK3B 3KQCA 3GCTF 2GP9B 1P04A 1L4ZA 1XUHA 3MH7A 1NESE 2J4IA 3A7ZA 4K1EA 3F9GA 3TLOA 1P2QA 3MU1A 3BTHE 2FMJA 1QB1A 3SORA 1ZMJA 5GDSH 4HTCH 1AE5A 2F9UA 1TE0A 2OTVA 5ETXA 1BMNH 3CP7A 1J9CH 3E3TA 1HAVB 1O2SA 2ANKH 4WH6A 3SNEA 2ZC9H 3ELAH 1G2LA 1PPBH 1RGQA 4E7RG 3PMAB 4OS6A 5HGGA 2O8LA 1YCPM 1O2MA 5HYOA 1O2GH 4X6NA 1CT2E 3I77A 2P93A 4X8VH 1SGDE 3QTOH 1C1RA 3BIUH 1PPGE 1UJ1A 2Q6GA 4RN6A 2BDCA 1A0HB 2NWNA 1SVPA 1XX9A 2A4OA 2R9PA 3Q76A 3KQDA 2BY6X 2BXUH 1N8OB 2PTCE 1WUNH 2HALA 2VIOA 1N1LA 3QLPH 1GJ9B 3KN2A 1E0FD 3SUFA 1ANBA 1FMGA 3VB4A 1FUJA 1YCPK 2Z9IA 4JZIA 3RXRA 1HJ9A 1TBQH 3E6PH 1HNEE 5JB8S 1TNLA 3GCTG 3NK8A 1GJCB 3BG4B 2JETB 3PB1E 1N8OC 4RSPA 5JB9S 5LPFA 2PWXA 1P05A 1ZHPA 2JH0D 3MTYA 4K8BA 1V2RT 1BTYA 3SUEA 1T8OA 1Y3UA 1BA8B 2G4UA 4DJZB 1PQ7A 1FONA 2GZ9A 1BTWA 2TIOA 1EZUC 3SO3A 4JZEH 3HKIB 3ATIA 1O33A 2ZGHA 5E2OA 2CHAC 2ILNA 2WPKS 3M37A 1LPZB 1NY22 3S9AA 1P06A 5PTPA 2A0QB 4WJG2 1D3DB 4K3JA 1J15A 1GHBG 5K7RA 1P2MA 2C8WB 2P95A 1OP8A 2BZAA 2WPMS 4CR9A 4BXSA 4X1RU 1QR3E 1KIGH 1HJAB 1A4WH 2F9BH 2I6SA 1VCQA 5F03A 2OD3B 4NIYA 1HUTH 4FUJA 3QZRA 5CHAC 5EODA 2ALPA 1DSUA 4AB8A 1HXEH 1O3OA 5L6NH 3SGQE 1AWFH 3RXMA 1AFEH 1CSOE 2VWMA 2BTCE 1OXGA 4DW2U 3RXPA 2QA9E 2P16A 3WY8A 1TGTA 2OLGA 1TNIA 5GCHG 5E0HA 7GCHF 1SQAA 2O8WA 1BMLA 2TGTA 1SPJA 4MPXA 1C2JA 3RMLH 4DURA 2FTLE 1HRTH 4X6PA 2VIDA 4X2VA 4O03A 4AORA 2GKVE 4OS4A 4JCNA 1O3IA 1GWAA 4AYYB 1BZXE 1GBTA 1RTKA 1ZPCA 2ZGXH 2V35A 3ESTA 2HNTC 5LH8A 2ALVA 2SGFE 1D9IA 5EXLA 3L33A 1UTNA 1GBCA 5GJ4B 1DPOA 4IGDA 4RKJB 2G8TA 3S9CA 1MKWH 1UO6A 3A89A 3FANA 1P09A 1Z8IB 1V2WT 2DE9A 3VFEA 4U30A 2PHBA 1ELAA 1QRZA 1P0SH 1C5SA 2XNIA 4LXBH 1V3XA 1FY1A 2VVCA 2FO9A 1O0DH 4AG2A 5JYIA 2ODPA 4D9QA 4AFUA 4CBOA 3MOCA 1F0RA 1GBBA 4YOJA 2UUKB 3BSQA 2Y5FA 4O97A 3ZZCA 3IITA 4LOYH 1A61H 1GHWH 3SU1A 2GMTC 1V2PT 1O2PA 2P8OB 2TRMA 4CRAA 4XFQA 5A09A 1C5NH 2BLQA 2WYGA 2Y6TA 2ZU4A 1DY9A 1PPEE 5GCHF 3S7KB 4CRGA 1DWBH 3LGUA 1E36B 2AH4X 3RXOA 3RU4E 1TOMH 2YOLA 1W2KH 3T27A 1SQTA 2VVUA 3SOSA 1C1MA 1KTTB 3RXSA 1A0JA 4B74A 2BQWB 1OP0A 1HAIH 1XM1A 3GYLB 4AFQA 2ZGJA 4J1YA 3AVZA 3P95A 5DO4H 5C3NA 2YNBA 4DG4A 2ZFTA 1WU1A 1CBWC 4HFPB 3ZV8A 4U32A 1L4DA 2FOAA 1ZOMA 2AMQA 1THSH 2XCNA 3VGCB 2ZTZA 1GI3A 1L1JA 1ELDE 2FDAA 3M7QA 3ZZ8A 1PQAA 1BCUH 1GBAA 1W8BH 3GY6A 3SHCH 5F8ZA 4DIIH 1EJMA 1FAKH 3I29A 4FU9A 1GI2A 4ABBA 2A1DB 1HAGE 2ZFFH 4ISHH 1RD3B 1E38B 4MLFB 3LDXH 1BT7A 4OS2A 4CHAB 4YO9A 3KCGH 4K2YA 1YPKH 1AB9B 1MZAA 3RXKA 3MU0A 4HGCA 1GJ6A 2ZHQH 1TGBA 3SJ8A 2O9QA 1YPHE 3M35A 2XYAA 3A84A 2AEIH 3M7UA 3SU2A 1RS0A 1QB6A 2QCYA 1AVWA 1EASA 3UPEA 2WUBA 1OWJA 3U98H 1C1OA 1MH0A 3PWBA 1C2GA 1SGEE 1QBVH 3E0PB 1RIWB 2ZQ2A 1M9UA 3UQOA 1RTLA 2VVVA 2ZCLP 2QGRA 4FXGH 5A0BA 2UUYA 2C3SA 2KAIA 3H7OA 1BRBE 1TNKA 1GI6A 4INKA 1ACBE 1OWEA 2R0LA 2WV5A 4Y79A 2R3UA 4KTUA 4KP0A 2IN2A 4GHTA 3ZZ4A 1GCDA 1GBLA 1MU8B 1QL7A 1J17T 1EOLA 3ZZ7A 1UVTH 4NGAH 2QXIA 3TPIZ 1WSSH 1O2TA 2A5IA 1TBRH 1GBFA 4I8LA 3BIVH 3NZIA 2XWBI 1SFQB 1P12E 3SU3A 1ABIH 3D62A 4BAKB 5BRRE 2OINA 4YT7H 3M3TA 3OX7U 3T29A 4FUDA 1UTPA 1BBRK 1GI4A 2BOKA 3MNBA 4Y8ZA 1CE5A 4TPIZ 4AN7A 1AZZA 2G00A 1P9SA 1TGNA 5DP9A 1PPZA 2ZQ1A 1CU1A 3KQBA 1AFQC 2ZDMA 4DVAU 1QFKH 4Y0YE 2QF0A 1ESAA 1IQGA 2ZTXA 4AYVB 1F92A 1KLJH 2Y5HA 5J4SA 1O3NA 3Q77A 4DGJA 2K1QA 1HFDA 2VH0A 3MO3A 2ZHDA 2B7DH 1ELBA 4D8NA 5DKMA 3ZZ6A 3MFJA 3SN8A 1HBTH 5EOKA 3RU4D 3LGWA 1NM6A 1KXCA 2FM2A 2BD8A 3RUOA 1T4UH 1O34A 3SUDA 3GY8A 4H42U 3NCLA 3F6UH 3RDZA 2PSXA 1EJAA 1HIAA 3OTJE 5DPAA 3HGPA 1DUEA 5E8EH 1OP2A 4Y11E 1K28D 1G32B 1O5DH 1JBUH 2FLRH 2AS9A 3LH3A 4NCYA 1ELGA 1Z1JA 2AMPA 3ATLA 4ZHLU 3B8JA 2ZDVH 3NWUA 4MPUA 1Q3XA 2VB0A 3ZZ3A 1EP6A 2BQ7B 1O2UA 5JBAS 5TCCA 2O8MA 1AUJA 2SNVA 3P8OA 2HVXA 1C1VH 2ZECA 1GHBF 2G55A 1LO6A 3LC5A 1WBGB 5HM9A 3BTME 3SV2H 4YM9A 2GDEH 2HOBA 5CE1A 2OUAA 5DJ7A 3FFGA 1IQFA 1EOJA 3RU4T 1A1RA 1NS3A 3UFAA 3SZNA 1HLTH 3ZV9A 2OC0A 4H4FA 1GMCG 2FOFA 1S0RA 1AMHA 2ANWA 1GJ7B 1IQJA 2WINI 1C5QA 4UFDH 3VB7A 3LT3A 1J16A 1TYNA 3GCHC 1NC6A 7KMEH 3K65B 5EXNA 5AF9H 3PO1C 4CRBA 1NFXA 1ELFA 2A31A 2IOTA 2GZ8A 1W0YH 1LCYA 2F91A 1KTSB 3P92A 5E2PA 1ZSLA 2EA3A 1GBJA 1TABE 1HAPH 4Y6DA 1O3HA 1LKAA 3KQEA 2SGPE 4U2WA 1UTKA 3D49H 4NIVA 4X2WA 1KXEA 1ESBA 3DUXH 3EA9A 1ARBA 3TIUA 1LMWB 3V7TA 2HNTF 5SGAE 1TRNA 1AUTC 1UCYK 3RP2A 4ABGA 1DVAH 3SU6A 1DOJA 4B73A 3LU9B 1P2OA 3UNQA 1P3EA 3MWIU 5ESTE 2QXGA 2PKAA 1BRCE 5GXPA 3T25A 3PMHB 1CT4E 4ZXYH 1QBNA 4R8TB 4ABFA 2SGAA 1VJ9U 1JMOH 5AVDA 3MMGA 1TA6A 3FVFB 1ZSKA 2SGEE 3PLBA 1O2YA 4ABAA 3RXJA 2FWWA 4UEHH 3M5OA 1MD7A 1FY8E 2VGCC 3LGVA 1TQ0B 1MAYA 5EGMA 1OKXA 2CMYA 2Q1JA 5TCAA 4O9VA 5DGJA 1ZTJA 2ZHEH 1HJ8A 3B23B 4ZKNU 4CREA 1G3EA 4KTSA 1DM4B 1ZYOA 4DCDA 4GSOA 2H5CA 3EAJA 4OGYA 3C27B 1ABJH 2RCEA 1C5LH 1KXAA 4NIWA 5HMAA 1TPSA 1AWHB 2D1JA 1W13U 1HGTH 1OWIA 3D65E 4WF8A 3GDSA 1KDQA 1Z8RA 1ZJDA 2PKSC 3OSYA 2WPLS 1LHEH 4NA9H 2ZPSA 5FBIA 1P01A 1WV7H 2Z9KA 2BLVA 2OC1A 3A81A 3QDZB 6CHAB 1DLKB 3MHWU 1C4V2 2BD3A 3A7TA 1ZTLA 2ESTE 2FESH 1C2IA 3BTWE 2UWPA 2NU0E 1MUEB 1NROH 4A7IB 4KKDA 2JH5D 2UWOA 1BQYA 1CT0E 1NFWA 1OOKB 1BTPA 2OCVB 3SGBE 2AYWA 1IAUA 4GCHG 1OWHA 3R3GB 4JYVH 3ATWA 1SL3A 1O2QA 3PTBA 1FPCH 2BZ6H 1XXDA 2EC9H 2OQUA 1A7SA 2B8OH 2BDBA 5FPYA 1S82A 3E0NB 1MBQA 1GHVH 3A8AA 3M5MA 2AGGX 1BBRH 1GI8B 3O8DA 1QL9A 2HLCA 2FI4E 1O2IA 1FPHH 1LPKB 5DP6A 2Z6BD 2C4FH 2ZFRH 2ZF0H 5AFYH 4IC6A 5F6MA 1SGCA 1CHOG 1LDTT 3NPSA 3QWCH 1FNIA 3UUZA 3EA8A 1CVWH 2V6NA 4OGXA 1K1NA 4WMDA 3ZZDA 4IMQA 1TMUH 3EA7A 1YC0A 1ZLRA 1F5RA 2W26A 2J94A 2OBQA 3BG8A 3Q00A 1GVLA 3PMJA 2BY7X 4ZUHA 1IHTH 4GHQA 4ABJA 1C9PA 1GJ5H 1F5LA 4BOHA 4DIHH 1ZMLA 1UCYE 1LHDH 3TGJE 2P59A 3V0XA 1SMFE 2R3YA 1LKBA 2VNTA 3M3VA 1IOEA 2ZCKP 1FAXA 5ESBA 4U01A 2CJIA 1HAZB 4X6OA 1LHGH 1DWDH 2P3FH 4BANB 1GMDG 3L6PA 1NN6A 1GBHA 1O2ZA 1V2NT 3T2NA 3LPRA 3ZVFA 1HB0B 1XMNB 1AHTH 3SU4A 4ZMAH 6LPRA 1A0LA 3PV4A 4X8UH 1TRYA 2HPQH 1C1UH 1XKAC 3AW1A 1WOFA 1Y8TA 1C5WB 2HRVA 1SGPE 2A7JA 1AGJA 2XCFA 1IQHA 3ODDA 3QX5H 1QB9A 4UONA 2F9PA 1TA2A 4X1QU 1TOCB 1MQ5A 3HK6B 3VPKA 3QUMP 3T26A 3BTQE 1EATA 2GV6A 3HKJB 1C2LA 3GY3A 1HIAB 2H9TH 3SW2B 2FODA 3RXUA 1SFIA 1WTHD 1UTOA 1Z6JH 1ZPBA 2G5NA 3AASA 1BMAA 4YZUA 2ZFQH 4YLQH 1GJDB 1QIXB 1C2DA 4MPVA 1GL0E 2P8OC 3GOVB 5EQRA 3BTEE 3E16B 3U8OH 1QJ1B 2FI5E 1DDJA 1C1NA 2WPIS 3GICB 3MH5A 6CHAC 1FIZA 4FUHA 1ZHRA 3UOUA 1BRUP 4LK4A 1UTMA 1MCVA 3ZVAA 3S0NA 1MKXK 2ZHWH 4X1NU 2QAAA 1Y3YA 1SLVB 1VITH 4K69A 3P8NA 1BTHH 1A5GH 4MPWA 4XE4A 2FS9A 1B7XB 1KLIH 1L0ZA 4NIXA 3VB3A 1BTZA 1F0TA 1GGDC 4WVPE 1GG6B 3MU4A 5EPYA 1LHFH 2BX4A 3MNSA 2B9LA 4ISOA