2SGFE

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE01
1GJ6A 3TNTA 4FVBA 1O2OA 3MH6A 2F9BH 5FBIA 4AG1A 2VINA 1TA6A 3ITIA 3MH7A 1HUTH 1QQUA 5EQQA 3UNRA 3L33A 2PHBA 2Y81A 1DWDH 1EB1H 3NZIA 3M36A 5EXMA 4AX9H 3SZNA 3SHAH 2TGPZ 4KKDA 1JRSA 2F9VA 3GOVB 6GCHG 1CBWB 3TH4H 1SGCA 1AB9C 1QBVH 3MO6A 4BNRA 3SU2A 4AGKA 1ELFA 1MTNC 2B9LA 1AWFH 1OWKA 1XUKA 1AVXA 4YT7H 1VJAU 1CO7E 4NGAH 2DE8A 2I6QA 3MNSA 2CJIA 3L3TA 1GI3A 1CQQA 2FIRH 4XBBA 4BXWA 2EI6A 3RC6A 1AZZA 3UFAA 1C2GA 1MCVA 1D9IA 1OX1A 1ZHRA 3RXIA 3P8OA 1D6WA 4H42U 2ZFRH 4JYVH 1LVMA 2TBSA 1K1LA 2HNTC 2TRMA 3RXMA 5FCRA 4Y0ZE 1TPPA 3A7TA 1BA8B 1GDUA 3F9FA 3RDZA 3UPEA 1PPCE 2W3IA 5EPYA 3ZZ3A 4D8NA 3W95A 1JMOH 1GBBA 5GCHG 2BXTH 4HGCA 3E8LA 2B8OH 4BAHB 4GHQA 2VGCB 5C20A 5J4QA 3GY3A 3GY7A 1PQ8A 7GCHF 1CT4E 3M5MA 2ULLA 4ABHA 2AFQB 1DUAA 4RSPA 2VH6A 3M3TA 5JPMH 1H8DH 2R9PA 3L6PA 4ZKSU 1GDQA 3GY8A 4NIYA 5IYTA 1RTLA 1Y59T 3BEIB 1C1OA 4WWYA 4VGCB 1ZGVA 2BD8A 2H1UA 2O8MA 3ELAH 2ODYB 2P8OB 2FYQA 1B7XB 1GJCB 3SV9A 1O39A 3PTNA 1RGQA 1GJ4H 4Y8XA 3RM2H 4INHA 4WXVA 4NA9H 2HRVA 4FUJA 4NA8A 5A8XA 1RTKA 5HM9A 3LGVA 3MFJA 3LPRA 4NSVA 1YP9A 1SGFA 1FONA 3U98H 3FZZA 1QA7A 3VB6A 1ELGA 3M7UA 3HATH 3VEQB 2D8WA 4WXIA 4IMQA 1THRH 4BTUB 3SUGA 3HK3B 1NROH 3SI4H 1IQHA 1O2ZA 2H9EH 2ZQ2A 3FP7E 3UNQA 3RU4D 2BQWB 2CGAA 4X6PA 2R2MB 2Q6GA 1C5QA 1ARBA 1E34B 5FX5A 1OYTH 3GY6A 3MU5A 1TNHA 3EYDA 1NU9A 2XC5A 1AFQB 1YLDA 1A5IA 1GHAF 3QTOH 3VXFH 3GDVA 2ZTYA 4KP0A 1FZZA 1WTHD 1HJAB 1FN6A 4JZ1A 1FY5A 2G8TA 1D3TB 3OYPA 3KQDA 5LGOA 2FWWA 3ZVDA 2OUAA 4O97A 3PLBA 1UMAH 1M9UA 4LXBH 1D3DB 4FXGH 5E0HA 3KQBA 5BPEA 3QDZB 2ZU4A 1UJ1A 1BHXB 1MU8B 5HM2A 3ZV8A 3I29A 1NO9H 2Y5GA 3F1SB 3QGNB 1XKBC 4X2XA 2P59A 4SGAE 3QUMP 3QZQA 1UCYK 4R0IA 2CF9H 1O3JA 3AW1A 5DK1A 1MAYA 4OS5A 4WH8A 1PQ7A 1GPZA 2VIVA 1CA0C 4U32A 1P06A 1HNEE 4XOJA 1YPGH 1TYNA 1SB1H 2Y7ZA 3RXPA 1QURH 4M7GA 1XM1A 2F3CE 1QQ4A 4CRBA 1ZZZA 2ZGHA 4U2WA 4BANB 3OY5U 3OX7U 2WUBA 1V2QT 1FY8E 3QZRA 3VGCC 2BLQA 3LONA 4WVPE 3MNBA 3RXTA 1O31A 3ODDA 4X2WA 3GCNA 2C8YB 1NC6A 5C67A 4CHAC 3K9XB 1DY8A 3MOCA 1YC0A 3FANA 1F0UA 2FPZA 4QT8C 3ODFA 3SN8A 4F4OC 1SOZA 1KXDA 2BB4A 1HRTH 3LJOA 1VITH 1P3CA 1Y5UT 2ZTXA 1HAHH 3CENA 3PMJA 1SBWA 1ORFA 4SGBE 1N8OC 2J38A 1HXFH 3G01A 4K69A 3SV2H 1DWEH 2A1DB 5G4BA 3SU4A 1IQEA 4DCDA 1TWXB 1OWDA 1GI0A 4ZKRU 3KNXA 1GBFA 1P11E 2VIOA 1H8IH 1FNIA 3MU4A 1DPOA 2Y82A 2H5DA 1U6QA 3ZV9A 2BLWA 3ESTA 4D7GA 2CMYA 1YM0A 4WMDA 2FI4E 3A7YA 3DFJA 1EZXC 5JBAS 1GL1A 4A1TA 1CE5A 1CHOG 1LKAA 4BXSA 1NM6A 4NZQA 1F0TA 1W7XH 1WBGB 2VVVA 1ANEA 1AKSA 3SGBE 1O2GH 1O3MA 2SGAA 4X1QU 3D65E 1LHEH 5T3HA 1EXFA 1PPGE 3IITA 3Q3XA 3A81A 1BJUA 1O5CB 2PFEA 5LPFA 4WJG2 1YKTA 3BTHE 4XFQA 5SGAE 3SW2B 3PMBB 1GDNA 2GV6A 6CHAC 1HIAB 3V0XA 2BZ6H 1KXBA 1PYTD 4CH8B 1AB9B 1IHTH 1ZMLA 3KQEA 5I25A 3MU1A 3TH3H 1TFXA 2THFB 1L4ZA 3U8RH 2ZU3A 1O0DH 4MTBA 1LPZB 4YTAA 4YLUA 3ATWA 2BX3A 2ZU1A 3EQ0H 1HAGE 3OTJE 3RMMH 3RXDA 3RXVA 3ZVGA 1MCTA 1GCTB 5F6MA 3UUZA 1BRAA 2ZECA 1C1QA 3A89A 5ESBA 3AAVA 5CMXH 1LHDH 4YM9A 4WF8A 1LHCH 1V2JT 3M3SA 3SNDA 1LPKB 1GJ9B 1A0JA 1OSSA 3T26A 1J15A 2HGTH 2GKVE 1FPCH 2FYRA 4DJZB 3AW0A 1GVLA 1G3DA 1UVTH 1BTHH 1S5SA 3NCLA 2ESTE 2F9NA 2VWOA 4B73A 3U1JB 5A2MH 1EOJA 3EA7A 4A1XA 4DGJA 3ZZBA 4ABBA 1V2WT 4X1SU 2SGQE 1FLEE 2OQ5A 8GCHF 4CR5A 3LGWA 1O2MA 4E06H 2AEIH 1C2EA 1A5GH 1G3EA 1QBOA 3MO9A 3NWUA 3TK9A 1C4Y2 4Q7ZA 1LVYA 2P3UB 4E7NA 2BMGB 3SV8A 1P2JA 2ZWLH 4GUXA 2EC9H 2LPRA 2PGBB 3VFEA 3M5OA 1THPB 2FX6A 2ZDLA 5L6NH 2P3FH 3A8AA 3T29A 5K7RA 5F8ZA 1JBUH 3K6ZA 2GZ8A 1GGDB 3URDA 3TVJB 2PUQH 1LPGB 1VCWA 4K5ZA 4ZAEA 1AZ8A 3RLYH 2G51A 1C5OH 1QCPA 1TE0A 4MG3A 3TH2H 2FDAA 3A8BA 2TGTA 4FU8A 2FOGA 1DSUA 3VB5A 2J94A 1CHGA 1O2KA 3OY6U 3SOSA 1GG6C 2FOHA 3BTME 1SSXA 1W11U 3LGIA 4Y10E 1MTWA 1O3HA 5DG6A 2XXLA 1Z7KA 5F8XA 1OKXA 2QXHA 1DVAH 1MAXA 3TIUA 5EODA 5FPTA 4FUIA 1ZPZA 3STIA 1IOEA 1FAKH 4JZIA 3TJUA 1AGJA 2VWNA 1P01A 1THSH 2O8UA 1ID5H 1PYTC 2VJ1A 1TOMH 1PQ5A 2HNTF 1T4UH 2PV9B 3I78A 1AY6H 1GJ7B 2ANMH 2ZGBH 3MH4A 3ZZDA 4AZ2B 2JH6D 3EE0B 2F9UA 3SU5A 4AYYB 1O2SA 2VNTA 1SGDE 1C5ZB 1PPHE 1GHBF 2FOFA 3BIVH 4I32A 5HGGA 1HFDA 3ZVEA 1HAVA 2ANKH 1MKXH 1DXPA 3P8GA 3F9HA 1K21H 3BEUA 6GCHF 3K2UA 2XWBI 4HI3A 2BY9X 1EQ9A 2JETB 4JYUH 2HWLB 3QX5H 4TWWA 2P95A 1IQNA 1WV7H 4ABJA 2A7JA 1S85A 3HKIB 4DIHH 2ZHQH 1H9HE 1TQ0B 3M5LA 3Q77A 1PJPA 1E36B 2Y80A 2WPIS 3D23A 4UFFH 1YPHC 3MHWU 4CREA 1G2LA 1DLEA 1AQ7A 4FUGA 2HPPH 1EZUC 3GCHC 2O8LA 3PO1C 2GZ9A 1RRKA 4AB9A 2G52A 4OS1A 5GCHF 1QB9A 3RXHA 2A45B 2XCNA 3KGPA 2BD7A 1O2LA 2XBVA 1FY1A 2WINI 3FP8E 4ZKNU 2FXRA 1O2YA 2FTLE 1FJSA 1JIMA 1C9TA 4ASHA 3UR6A 4ISOA 3JZ2B 4IN1A 3SORA 1MMJN 5E8EH 5AFYH 1K2I1 1V2OT 1EJNA 4Y0YE 3UR9A 1Z71A 2F91A 4I8GA 4DURA 1C2DA 1AWHB 2VH0A 1AN1E 3TK6A 4I8LA 4Q7YA 1WAYB 1TNJA 4YESB 3TGKE 4UFEH 3LC3A 3UOUA 1NRRH 1TPSA 1ZYOA 2GMTB 1MTUA 3M5NA 2IN2A 4Y8ZA 1TMUH 4K1SA 1GI4A 2BD3A 2XCFA 1WSSH 1BRCE 2PKSB 5EU8A 5C5NA 4U30A 2HOBA 3KEEA 4B2AA 2ZIQH 2Z9GA 4K8BA 2TPIZ 1AKSB 3EA8A 2PUXB 2G4TA 1K9OE 1OWJA 1DITH 4D9RA 1Q3XA 2FZZA 1LKBA 1FN8A 4A5TS 3OU0A 1BMAA 5EW1H 1OS8A 3RM0H 2BDCA 2GCTB 1B5GH 2ANYA 1G3BA 3F6UH 1EAIA 1GI1A 1KXAA 1UVOA 3P8NA 3V7TA 1S84A 1NTPA 4B75A 1D4PB 1GMHF 2FX4A 1SVPA 1BBRK 1YPKH 3RXBA 2D2DA 5C2ZA 4KTUA 1MZAA 1SLXB 1XUIA 4I31A 2ZU5A 1VGCB 4K3JA 4Y79A 2AGIX 1C2JA 4CRGA 1TONA 2WPHS 2BM2A 1SLVB 2ZU2A 4X6OA 1C5SA 1PPEE 4DT7B 1Y8TA 2AMQA 3UQVA 1GI6A 1Y3WA 4JZDH 1O36A 1TABE 1EZSC 1S0QA 3AASA 1O2UA 2ZP0H 4MDSA 5CHAC 3K6YA 1IQMA 5TCCA 3RMOH 1LQDB 1L1JA 1TLDA 2OBQA 2ZDKA 2G4UA 2BLOA 2VIDA 1K22H 5EGMA 1Y5BT 3SNEA 1TX7A 1HAPH 3RU4T 1ETTH 1OWHA 1Z8JB 5ETXA 4AG2A 1RXPA 1C2MA 4NWLA 3E90B 1KLTA 1D6RA 4PROA 2CXVA 3ZVFA 1S83A 1GVKB 5AVDA 4ABGA 5L2ZH 1XVOA 3ZZ5A 1MTSA 1UCYE 5HYOA 2FESH 1XUHA 2AMDA 3LGUA 1BQYA 1C5YB 2NU1E 2Q6DA 3MWIU 1O2IA 5HMAA 1DOJA 1GHZA 2XRCA 1WQSA 1EJMA 1XUJA 1O2VA 2WV4A 2BDAA 2ASUB 1CU1A 3UQOA 3T62A 5EW2H 4WY3A 5DGJA 2GX4A 3B23B 4XBCA 5E0GA 1E38B 2Q6FA 1V2MT 4X1PU 2ZPRA 3P8FA 2XWAA 1W12U 2O8WA 3A87A 2JH5D 3GY2A 1BTYA 1A3EH 1LVBA 1P12E 4ZUHA 2ZKSA 2ZF0H 5EXNA 2H5CA 1O35A 1Z8IB 2B5TB 2W7UA 1P02A 2BDHA 2QAAA 1GI5A 4TPIZ 3E0PB 3NKKA 1X7AC 1EPTB 2F9OA 4GPGA 4LK4A 1UK3A 3UWJH 1O3FA 3PMHB 1OYQA 3SJKA 2CHAB 4GCHG 2NWNA 4UDWH 3RP2A 2IPHA 5EQRA 2Z3CA 1A5HA 2A7HA 4CRDA 2GCHF 3BF6H 5FHTA 4K1TA 3EGKH 1BITA 1V2ST 3MNXA 1TMBH 1Q31A 2BVXH 2XC4A 4RKOB 4MPXA 4R8TB 3S9CA 2ZCHP 1T32A 3SU1A 1ZTKA 4ISNA 4Q80A 1K1OA 1CHOF 4IS5A 3VB4A 2PSXA 1IHSH 1GI7B 1O2NA 3SBKA 2OD3B 3B8JA 4X8SH 4ZXYH 1RIWC 3NXPA 4O3TA 2GTBA 3C27B 5FPYA 3M37A 3ZVAA 2AIQA 3RXRA 4I8KA 3T27A 3O8BA 3SI3H 5C1XA 2Y6TA 2GDEH 2J9NA 2A5AA 1TGTA 1HAVB 2A2QH 2OQUA 3PTBA 5E2PA 1TNLA 3EAJA 1UHBA 1C2KA 1RJXB 1QR3E 4YOJA 2R0LA 3O8CA 1O5BB 2WV5A 1V2KT 1C5LH 2A5KA 5AFZH 2ZPSA 1G2MA 1C2LA 2VB0A 3LKWA 3U8TH 3U8OH 4ISHH 4I8JA 1GI8B 1MKXK 4KELA 3EA9A 3QO6A 3LOXA 2UUKB 2SGFE 2XBYA 4NWKA 1KXCA 2RDLA 4MLFB 2ZC9H 3RXSA 4AFQA 2ILNA 2A7CA 1Z8RA 4INKA 1LQEA 3ENSB 4XSKU 3E91A 3MU0A 1BUIA 5C1UA 2ZI2H 3A88A 4AB8A 2EA3A 2PKAA 4ABEA 7GCHG 5C3NA 1W8BH 2TGDA 1O2PA 1TBZH 2M5TA 4FU9A 1C5MD 1UVPA 2BD4A 2J4IA 5GPIB 1QGFA 2HVXA 3BG4C 5JBTA 1T4VH 5T6GA 1TRMA 2SGPE 1GHYH 2FI3E 1O3PB 4FVDA 4MNVA 1BDAA 2V0BA 1CGHA 3GDUA 5K0HA 2JH0D 1JRTA 4MQAA 4HTCH 2FO9A 2Z3DA 5H4IB 2GGVB 3SU6A 4XDEA 4GHTA 1UTNA 4GAWA 3TITA 1MKWK 1ZTLA 3TJVA 3A82A 1DICA 1YCPM 3ZZAA 1ESAA 1BJVA 8LPRA 1PQAA 1T8NA 1F5LA 1PPZA 3DFLA 1CGJE 2BY6X 1H9LB 5F8TA 5DP9A 2QV1A 3KL6A 2IOTA 2AMPA 4X2YA 1W14U 3ZVBA 1H9IE 1ELBA 3SGAE 3LC5A 4ABFA 3SU0A 2AIPA 2V35A 1A1RA 1GHVH 3M61U 3TK5A 2A4GA 1GBLA 1GHAG 2RG3A 2UUJB 1ARCA 1BBRH 1DS2E 1HXEH 1P09A 4CBOA 4IC6A 1K1MA 2OC1A 1ZR0A 4ZHLU 2BD5A 2GV7A 3A85A 2G5NA 1ZRBA 1QRZA 1MQ5A 1E35B 1O3NA 2VIPA 1MTNB 3PROA 1QFKH 1G3CA 1LCYA 1O3EA 3RXUA 2BQ7B 3H7OA 2ZPQA 3HK6B 4O3UA 5GXPA 3AVZA 3MYWA 4IN2A 1GBHA 1GVZA 2NU3E 2OP9A 1IQKA 2R3UA 3LGYA 3RXCA 1KTTB 2FOCA 1BZXE 4DG4A 3P95A 2PTNA 3BN9A 2FTMA 4K60A 1OP8A 2CV3A 2HNTE 1F0RA 2B7DH 1ZTJA 1GBDA 2CN0H 3S9BA 5A8ZA 2CF8H 1TNGA 1KXEA 1Y3YA 4I33A 1G37A 1KY9A 1P2QA 1ZPCA 4NFEA 2UWPA 5AHGH 4DOQA 2ZGCA 1CBWC 3ZZ9A 4OS2A 4TPYA 1HCGA 2LNCA 1LTOA 3MNCA 1QBNA 4AFZA 5DP8A 1ZJKA 1SOTA 4Y8YA 1V2TT 1EZQA 1ZJDA 1MUEB 1QJ6B 2VWMA 1HGTH 1P05A 4ZROA 4FUFA 5I46H 4YLQH 1QJ1B 3KHVA 1WQVH 2VIWA 3DT0H 1P03A 2KAIA 2ZHWH 3A7VA 1P0SH 5A09A 1ANCA 1NRQH 1Z1IA 4NCYA 2AH4X 3F9GA 1J9CH 4IGDA 1DT2A 2PGQB 2C8WB 6LPRA 1TBQH 3C1KA 2RCEA 2C93B 4WMEA 4AFSA 1IQLA 3QK1A 3LT3A 1ZSKA 1BCUH 1IQIA 3SJ8A 1AVWA 1C4U2 3S9AA 2JKHA 2ZDNA 3WY8A 4FUEA 4A6LA 2VWLA 1PPFE 3GYLB 1S6HA 1NFYA 5A0AE 1HJ9A 4NIVA 1TBRH 3KN2A 1T8LA 2D1JA 3A7ZA 4VGCC 5A8YA 1ABIH 2P8OC 1ZGIA 1NRSH 2W26A 3M7QA 4AGJA 3MI4A 1OWIA 1WCZA 1GBKA 4RN6A 1AUTC 1FI8A 4IBLH 3A80A 3TNSA 1C1VH 1YCPK 1GI2A 1J8AA 1F7ZA 2GP9B 3FVFB 4IC5A 4X8VH 4CRFA 1O30A 2ZCLP 2ODPA 1NT1A 3P70B 1AE5A 3SQHE 2OC8A 3RC5A 5FX6A 3UIRA 1ZMNA 4A1VA 1C5UA 4ZXXH 3QLPH 5DJ7A 2VU8E 3D49H 1BT7A 4BTIB 1F2SE 1GBJA 1BMNH 2P16A 1KDQA 1DM4B 1EP5A 1P2MA 1C5WB 1C1SA 3LJJA 1UTKA 1L4DA 3AAUA 2HLCA 4NSYA 1JWTA 1YPLH 3GCTG 1CA0B 2Z9KA 5E0JA 4Q2KA 1Y5AT 1HJAC 2QXGA 1DSTA 1KTSB 4AORA 3KQCA 4KGAA 2Z9JA 4X1RU 3M7TA 1SQTA 3HPTB 1KLIH 3FAOA 4MVNA 3H7TA 4DW2U 2Z9LA 4Y71A 2UWOA 3VGCB 1C1WH 3TJNA 1AIXH 1V2NT 2O8TA 2FP7B 1JOUB 1O3BA 5JBCS 1ELDE 1S6FA 1XMNB 4H6TA 3BEFB 1MBMA 1DANH 4CHAB 2A4RA 2V3HH 1F5RA 1E37B 2EI7A 2PKAB 1SQAA 2K1QA 3V3MA 4TY7A 3GDSA 3PMAB 3QWCH 1MD8A 3TU7H 1NFXA 1MQ6A 1G32B 3BG4B 2QN5T 1SHHB 2AERH 2FOMB 1BB0B 1MZDA 1XUGA 4FU7A 1ZPBA 3E16B 1N8OB 3RXJA 3BTWE 3TJOA 3OSYA 3ATLA 1ZMJA 5DO4H 3RUOA 2Y5FA 2BD2A 2BVRH 1MKWH 2WPMS 1UTQA 1W13U 2FS9A 2QC2A 3RLWH 1GBEA 1P04A 5JBBS 1EAWA 1O34A 1GHWH 1DX5M 3Q3KA 3ATKA 2BQ6B 5C5OA 3TGJE 1SGNE 1J16A 3RU4E 1GL0E 5GJ4B 2BZAA 1P2NA 1F5KU 5JB9S 4J2YB 1SFIA 4D7FA 1V6DA 2AGGX 2O9QA 1QL9A 4XE4A 1EOLA 1C1NA 3LH3A 4JCNA 3URCA 1TIOA 2QXIA 1O3CA 3F9EA 1GMDG 4OGXA 1AU8A 1SG8B 4OS4A 4FUCA 3U69H 1AD8H 2GVFA 1CGIE 1ESTA 1SFQB 2FLRH 1AI8H 3O8DA 2YNBA 1ETSH 1SGYE 1A0LA 4NIWA 1XXFA 1HDTH 3TLOA 3SUDA 3BTGE 4BAQB 5GWZA 1O3KA 3F68H 4Y7BA 3V12A 3PB1E 6CHAB 2A4OA 2W7SA 4B1TA 4GCHF 1LMWB 1UTMA 3GY4A 5DP6A 2HALA 2BDBA 3T25A 3HGPA 5CE1A 2BOKA 4WMFA 2P94A 2EI8A 2Z3EA 3I77A 4H4FA 3TGIE 1IQGA 2BY7X 5LPEA 1TGCA 2D26C 2WPLS 2BTCE 1LVOA 5TJXA 3SNBA 1WOFA 2R3YA 1ZSLA 5T6FA 1UVSH 4HZHA 4DY7B 1V2RT 1O37A 1QY6A 3PV4A 4NG9H 6ESTA 1SGEE 2V6NA 1C1TA 1G30B 1K28D 1XUFA 3UWIA 4B2CA 3U9AH 2VIQA 3STJA 2Q1JA 1GHBG 1BMLA 1F0SA 2ALPA 2ZTZA 4NIXA 1TX6A 4NA7A 2SNVA 1EKBB 1P9SA 1FIZA 2ZDAH 3M3VA 1HIAA 2ZNKH 1QL7A 1SMFE 4HFPB 2VVCA 1K1NA 2UWLA 1EATA 1C4V2 3FZDA 1FMGA 2I6SA 4U01A 2P3TB 1O2XA 3M35A 3RXKA 1DE7H 3S7HB 1P2KA 3SO3A 1FPHH 3P92A 1Y3VA 2PLXA 2Y7XA 2BHGA 1C5TA 4O03A 1PPBH 1OP2A 2BVSH 2QYIA 2Z9IA 1B0EA 1C5VA 4ZHMU 2ZDMA 4XBDA 3VPKA 1AUJA 1D3QB 1GCTC 2FLBH 3A8DA 2GT7A 3SJOA 1G9IE 4MPVA 1ZLRA 2H2ZA 5GIBA 2KAIB 4MPUA 3ZYDA 1QA0A 1SGFG 2BX4A 4CRCA 1LDTT 1Z6EA 2OINA 2XBXA 1ELAA 1WUNH 2OLGA 1F92A 5BRRE 1VJ9U 1O2HA 4TY6A 1TNKA 1ZHPA 2ANWA 2SGEE 1YLCA 1O2QA 1A3BH 1UVUH 2FM2A 2QA9E 1O33A 5A0CA 4X2VA 4A7IB 4ZKOU 1QTFA 1O3LA 2J92A 4KTCA 1O3DA 1SC8U 1SR5C 4RKJB 5FAHA 1SGRE 4B71A 1V2UT 4BAMB 3RC4A 2BY5X 1TQ7B 4CRAA 4OGYA 1E0FD 4FUDA 3ATMA 5DPAA 2GDDA 1GBMA 1GMCG 1ANBA 1FY4A 1FXYA 2BLVA 1TA2A 2GZ7A 2BDGA 1O3GA 2ZCKP 1FV9A 5DP3A 1C1MA 1GG6B 1VITG 1UTLM 2GD4B 1FIWA 2C8ZB 1P9UA 4ZHAA 1J17T 2YNAA 3DUXH 1T7CA 4GVUA 1W3CA 3H5CB 1BTUA 3EDXB 4JMYA 1TGNA 1YCPH 2TGAA 3RXQA 1O5GH 1DWBH 2OTVA 1AE8H 9ESTA 1PFXC 1O5EH 1O5AB 1T8MA 1ZOMA 1ELVA 1TALA 2G5VA 2P93A 4K1EA 1S81A 2FMJA 1H1BA 1A46H 1GGDC 1QB1A 2J2UA 1P3EA 5AF9H 3RMNH 3NUMA 3SV7A 4LOYH 1NY22 1KYNA 1SGPE 2A5IA 4MNXA 2WPKS 4H6SB 4MPWA 4KTSA 1KDQB 3E1XB 1L1NA 1AVGH 3MU8A 2BD9A 1MH0A 1D3PB 3E0NB 2ZHDA 1GMHG 1TGSZ 2TIOA 1TPAE 3D62A 2AGEX 4FUHA 2QCYA 3RMLH 4AOQA 1CSOE 3Q3YA 5GDSH 1OXGA 8KME2 3HKJB 3A7XA 1HLTH 1BTWA 1P57B 1G36A 2HPQH 4ZH8A 2WYGA 2ZG0H 1ESBA 1GJDB 3MTYA 1ELCA 4Z6AH 1NFWA 2NU4E 2ZDVH 2ZHEH 5FBEA 3ZZ6A 4YZUA 2W5EA 1GJAB 3T2NA 3KF2A 8ESTE 5PTPA 2ZO3H 1GJBB 1DUEA 1JXPA 1TOCB 1HB0B 5TCAA 1YPHE 2OC0A 2FOBA 3PM3A 1EX3A 3PWBA 2FOAA 3QN7A 3SJIA 2PSYA 1K1JA 4D9QA 3GCHB 3UTUH 1C5RA 1UK4A 3PO1B 3SUEA 1L2EA 2GT8A 3Q00A 1TPOA 1A7SA 3LIWA 4B74A 3A7WA 1MU6B 4ISLA 1W0ZU 3PWCA 2G55A 5EG4A 2AS9A 4X6NA 1TX8A 2JETC 3JZ1B 1Y3XA 1KXFA 1QRWA 4D76A 1W2KH 1DWCH 4I7YH 5B6OA 2BXUH 3BG8A 1QB6A 2PW8H 1AHTH 5DP4A 2A2XH 5DP7A 3SQEE 4UD9H 4ABDA 1GHXH 2BDIA 1DLKB 4ESTE 1NPMA 1QJ7B 1NESE 5L30H 4JK5A 3DHKH 2UUYA 2ZA5A 4X6MA 1Z8GA 1NRPH 4TWYA 1MTVA 1O2JA 2SGDE 5F03A 2J34A 2BDYA 1V2LT 1TGBA 2B0FA 3PLPA 2Y5HA 4NFFA 2ZHFH 1XVMA 1K1PA 4F49A 1UTJA 2STAE 3HGNA 3BV9B 1B0FA 4YOGA 3BIUH 2ALVA 3GY5A 4Z0KA 1LO6A 4WH6A 2GCHG 1ZRKA 3KCGH 2SFAA 1BOQA 2Z6BD 1EASA 3SNCA 5JYIA 3S0NA 3FP6E 1LHFH 1C1RA 3BTTE 3CS7A 4JK6A 2OCVB 2GMTC 3R0FA 3LU9B 5JDUB 1RFNA 2XNIA 1FY3A 2PKSC 1C5NH 1O5FH 1T8OA 1NU7B 1HBTH 1BMMH 4OS7A 5DKMA 5IDKA 1BHXF 1SGTA 3W94A 1V2VT 4ABIA 2XC0A 2G81E 4Y11E 1VCPA 3MMGA 4E05H 1ANDA 1UO6A 1HAOH 1A2CH 1JIRA 5CHAB 3MO3A 4OS6A 1GJ5H 2GCTC 1XKAC 2V3OH 3A86A 5ABWA 1OPHB 4IW4E 1C9PA 4X8TH 3TPIZ 2QF0A 1C2HA 1TNIA 3DD2H 3T28A 2H9HA 1BTXA 3ZZ7A 2C8XB 2WUCA 3GCTF 1QRXA 1V3XA 2XYAA 3VB7A 1O2RA 2C4FH 5EXLA 1HJ8A 3UREA 5A0BA 1N6YA 1GBAA 1VGCC 1C2FA 2H6MA 2C3SA 2ZZUH 1GJ8B 9LPRA 2OBOA 4X1NU 1IQJA 4I8HA 1GBIA 1EJAA 5HXFA 4UFDH 2BYAX 2STBE 5JB8S 1O3IA 2Z7FE 4BTTB 1DFPA 3Q76A 1S0RA 4UFGH 1FDPA 3BSQA 1L0ZA 4Y7AA 1C2IA 7KMEH 1C1PA 7LPRA 1ABJH 1ETRH 5LPRA 4E7RG 3RXOA 1A61H 1Z6JH 1GWAA 1HAYB 1EAUA 3RXFA 3QGJA 3VB3A 1AMHA 1EUFA 3RXEA 1QL8A 1DY9A 4K2YA 4ISIH 1RTFB 3LDXH 3ZYEA 2WPJS 3FFGA 1EP6A 4GSOA 2OC7A 1DXWA 2VGCC 1T31A 3SJ9A 2A32A 4JZFH 2NU2E 1Y3UA 3IG6B 3A8CA 3V13A 3P17H 1HAZB 1NS3A 1VZQH 1EB2A 3DA9B 4JYTA 2UUFB 3NPSA 4BAKB 1UK2A 5EPNA 4YOIA 1BRBE 1L1GA 2ZFTA 2BOHB 3A83A 2IJOB 2SNWA 4B76A 2XTTB 2ZEBA 4UE7H 3SU3A 1GCDA 2QF3A 1ELTA 1KLJH 1WTGH 1RS0A 1XX9A 5FPSA 4UEHH 4CBNA 2ZFQH 1GI9B 3LGTA 1UTPA 1Z1JA 1A0HB 3BTDE 3ZZ4A 4MNWA 4LZ1H 1SI5H 2Z94A 2A31A 1MD7A 1GMDF 1SGQE 4J1YA 1C5XB 3S7KB 2F83A 1O3OA 1LHGH 3RXAA 1RIWB 4CR9A 2NU0E 1ACBE 1TMTH 3BTKE 1VR1H 2XBWA 4ZMAH 1SL3A 1EPTA 2ZFPH 2RA0A 7ESTE 1YPMH 2RA3A 1EPTC 5L2YH 3RXGA 1ZSJA 5T6DA 1Q2WA 1C5PA 1HYLA 1HAIH 2CHAC 1NFUA 1IQFA 3CS0A 1AO5A 1OP0A 3QTVH 2EEKA 1KIGH 3BTFE 3NK8A 3SV6A 3P6ZB 5J4SA 2ZGJA 1UHBB 3O8RA 1INCA 2J95A 1AFQC 3UOPA 5DP5A 1K1IA 1TRYA 3U1IB 4JZEH 1SLUB 1H4WA 1YF4A 4AYVB 3GYMA 5C1YA 5ESTE 3ZZCA 1IAUA 1TAWA 1YPJH 3ZVCA 1SQOA 4A92A 2AYWA 2OXSA 5LH8A 1UCYH 3PLKA 2WYJA 1FUJA 1P8VC 2F9PA 1BTPA 4UONA 1O2TA 3BTQE 4CH2B 3E3TA 1W7GH 2ZFFH 4GLYA 1W0YH 3ATIA 3UNSA 1J14A 2R2WU 5E2OA 1OOKB 1XXDA 1SPJA 1GBTA 3S69A 1P2OA 3UY9A 1BBRE 4MNYA 4AN7A 2ZFSA 1ELEE 1HV7A 4DIIH 4FUBA 3PYHA 4INLA 2W3KA 3MH5A 1O38A 1AFEH 1WYKA 2FI5E 1NZQH 4K8YA 1HAXB 1CVWH 8GCHG 2G00A 3GICB 4BAOB 4NZLA 2FOEA 1FQ3A 4Q7XA 5EQSA 1WU1A 3T5FH 1S82A 1MBQA 1BRUP 2QIQA 4Y76A 1GBCA 1V2PT 2VVUA 3LH1A 2XW9A 1OWEA 1O5DH 4Y6DA 4AFUA 1NRNH 4TYDA 2C90B 1BIOA 4B2BA 4IMZA 3IWMA 1DDJA 1QNJA 4YT6H 3VXEH 1P10A 2DUCA 3ZZ8A 3R3GB 3SNAA 4YO9A 3GISB 3E6PH 1VCQA 5FCKA 4THNH 1YGCH 1O32A 2YOLA 2QXJA 1HPGA 4O9VA 3RXLA 1W10U 3N7OA 1CA8B 1EAXA 3KIDU 2H9TH 2QY0B 4BOHA 3A84A 1A4WH 3SHCH 1ZHMA 1BTZA 2FODA 1CT2E 1P2IA 1SGIB 1YYY1 1GMCF 2A4QA 2PTCE 3K65B 2FEQH 2ODQA 2PR3A 2QGRA 1KSNA 1CT0E 3CP7A 1YPEH 1VITF 2A0QB 3SGQE 4X8UH 1UTOA 5FXLA 3SUFA 1NN6A 4LZ4B 3GCOA 4ABAA 1YBWA 3BTEE 1QHRB 4X0WU 2DE9A 1O2WA 1C1UH 2BY8X 1SLWB 1N6XA 3B9FH 1N1LA 1TB6H 5EOKA 2PWXA 1SHYA 2FS8A 2R0KA 2ZQ1A 2ZGXH 1O3AA 1QIXB 4DVAU 1TRNA 1FAXA 1RD3B
chains in the Genus database with same CATH superfamily
1GJ6A 3TNTA 4FVBA 1O2OA 3MH6A 3N7DA 2F9BH 5FBIA 4AG1A 2VINA 1TA6A 3ITIA 3MH7A 4P00A 1HUTH 1QQUA 5EQQA 3UNRA 3L33A 2PHBA 2Y81A 1DWDH 1EB1H 3NZIA 3M36A 5EXMA 4AX9H 3SZNA 3SHAH 2TGPZ 4KKDA 1JRSA 2F9VA 3GOVB 6GCHG 1CBWB 3TH4H 1SGCA 1AB9C 1QBVH 3MO6A 4BNRA 3SU2A 4AGKA 1ELFA 1MTNC 2B9LA 1AWFH 1OWKA 1XUKA 1AVXA 4YT7H 1VJAU 1CO7E 4NGAH 2DE8A 2I6QA 3MNSA 2CJIA 3L3TA 1GI3A 1CQQA 2FIRH 4XBBA 2J97A 4BXWA 2EI6A 3RC6A 1AZZA 3UFAA 1C2GA 1MCVA 1D9IA 1OX1A 1ZHRA 3RXIA 3P8OA 1D6WA 4H42U 2ZFRH 4JYVH 1LVMA 2TBSA 1K1LA 2HNTC 2TRMA 3RXMA 5FCRA 4Y0ZE 1TPPA 3A7TA 1BA8B 1GDUA 3F9FA 3RDZA 3UPEA 1PPCE 2W3IA 5EPYA 3ZZ3A 4D8NA 3W95A 1JMOH 1GBBA 5GCHG 2BXTH 4HGCA 3E8LA 2B8OH 4BAHB 4GHQA 2VGCB 5C20A 5J4QA 3GY3A 3GY7A 1PQ8A 7GCHF 1CT4E 3M5MA 2ULLA 4ABHA 2AFQB 1DUAA 4RSPA 2VH6A 5DN6D 3M3TA 5JPMH 1H8DH 2R9PA 3L6PA 4ZKSU 1GDQA 3GY8A 4NIYA 5IYTA 1RTLA 1Y59T 3BEIB 1C1OA 4WWYA 4VGCB 1ZGVA 2BD8A 2H1UA 2O8MA 2AHME 3ELAH 2ODYB 2P8OB 2FYQA 1B7XB 1GJCB 3SV9A 1O39A 3PV5A 3PTNA 1RGQA 1GJ4H 4Y8XA 3RM2H 4INHA 4WXVA 4NA9H 2HRVA 4FUJA 4NA8A 5A8XA 1RTKA 5HM9A 3LGVA 3MFJA 3LPRA 4NSVA 1YP9A 1SGFA 1FONA 3U98H 3FZZA 1QA7A 3VB6A 1ELGA 3M7UA 3HATH 3VEQB 2D8WA 4WXIA 2VBCA 4IMQA 1THRH 4BTUB 3SUGA 3HK3B 1NROH 3SI4H 1IQHA 1O2ZA 2H9EH 2ZQ2A 3FP7E 3UNQA 3RU4D 2BQWB 2CGAA 4X6PA 2R2MB 2Q6GA 1C5QA 1ARBA 1E34B 5FX5A 1OYTH 3GY6A 3MU5A 1TNHA 3EYDA 1NU9A 2XC5A 1AFQB 1YLDA 1A5IA 1GHAF 3QTOH 3VXFH 3GDVA 2ZTYA 4KP0A 1FZZA 1WTHD 1HJAB 1FN6A 4JZ1A 1FY5A 2G8TA 1D3TB 3OYPA 3KQDA 5LGOA 2FWWA 3ZVDA 2OUAA 4O97A 3PLBA 1UMAH 1M9UA 4LXBH 1D3DB 4FXGH 5E0HA 3KQBA 5BPEA 3QDZB 2ZU4A 1UJ1A 1BHXB 1MU8B 5HM2A 3ZV8A 3I29A 1NO9H 2Y5GA 3F1SB 3QGNB 1XKBC 4X2XA 2P59A 4SGAE 1KMHB 3QUMP 3QZQA 1UCYK 4R0IA 2CF9H 1O3JA 2WV9A 3AW1A 5DK1A 1MAYA 4OS5A 4WH8A 1PQ7A 1GPZA 2VIVA 1CA0C 4U32A 1P06A 1HNEE 4XOJA 1YPGH 1TYNA 1SB1H 2Y7ZA 3RXPA 1QURH 4M7GA 1XM1A 2F3CE 1QQ4A 4CRBA 1ZZZA 2ZGHA 4U2WA 4BANB 3OY5U 3OX7U 2WUBA 1V2QT 1FY8E 3QZRA 3VGCC 2QE7D 5F53A 2BLQA 3LONA 4WVPE 3MNBA 3RXTA 1O31A 3ODDA 4X2WA 3GCNA 2C8YB 2XNDD 1NC6A 5C67A 4CHAC 3K9XB 1DY8A 3MOCA 3UB0A 1YC0A 3FANA 1F0UA 2FPZA 4QT8C 3ODFA 3SN8A 4F4OC 1SOZA 2F4LA 1KXDA 1K0HA 2BB4A 1HRTH 3LJOA 1VITH 1P3CA 1Y5UT 2ZTXA 1HAHH 3CENA 3PMJA 1SBWA 1ORFA 4SGBE 1N8OC 2J38A 1HXFH 3FO8D 3G01A 4K69A 3SV2H 4M9FA 1DWEH 2A1DB 5G4BA 3SU4A 1IQEA 4DCDA 1TWXB 1OWDA 1GI0A 4ZKRU 3KNXA 5KECA 1GBFA 1P11E 2VIOA 1H8HD 1H8IH 1FNIA 4Q4LA 3MU4A 1DPOA 2Y82A 5FL7D 2H5DA 1U6QA 3ZV9A 2BLWA 3ESTA 4D7GA 2CMYA 1YM0A 5C0TA 4WMDA 2FI4E 3A7YA 3DFJA 1EZXC 3GS9A 3SYJA 5JBAS 1GL1A 4A1TA 1CE5A 1CHOG 1LKAA 4BXSA 1NM6A 4NZQA 4RT0A 1F0TA 1W7XH 1WBGB 2VVVA 1ANEA 1AKSA 3SGBE 1O2GH 1O3MA 2SGAA 4X1QU 3D65E 1LHEH 5T3HA 1EXFA 1PPGE 3IITA 3Q3XA 3A81A 1BJUA 1O5CB 2PFEA 5LPFA 4WJG2 1YKTA 3BTHE 4XFQA 5SGAE 3SW2B 3PMBB 1GDNA 2GV6A 6CHAC 1HIAB 3V0XA 2BZ6H 1KXBA 1PYTD 4CH8B 1AB9B 1IHTH 1ZMLA 2QF5A 3KQEA 1VKYA 5I25A 3MU1A 3TH3H 1TFXA 2THFB 1L4ZA 3U8RH 2ZU3A 1O0DH 4MTBA 1LPZB 4YTAA 4YLUA 3ATWA 2BX3A 2ZU1A 3EQ0H 1HAGE 3OTJE 3RMMH 3RXDA 3RXVA 3ZVGA 1MCTA 1GCTB 1OHHD 5F6MA 3UUZA 2IPQX 1BRAA 2ZECA 1C1QA 3A89A 5ESBA 3AAVA 5CMXH 1W0JD 1LHDH 4YM9A 4WF8A 1LHCH 2LELA 1V2JT 3M3SA 3SNDA 1LPKB 1GJ9B 1NBME 1A0JA 1OSSA 3T26A 1J15A 5T1VA 2HGTH 2GKVE 1FPCH 2FYRA 4DJZB 3AW0A 1GVLA 1G3DA 1COWD 1UVTH 1BTHH 1S5SA 3NCLA 2ESTE 2F9NA 2VWOA 4Q63A 4B73A 3U1JB 5A2MH 1EOJA 3EA7A 4A1XA 4DGJA 3ZZBA 4ABBA 1V2WT 4X1SU 2SGQE 1FLEE 2OQ5A 8GCHF 4CR5A 3LGWA 1O2MA 4E06H 2AEIH 1C2EA 1A5GH 1H8ED 1G3EA 1QBOA 3MO9A 3NWUA 3TK9A 1C4Y2 4Q7ZA 1LVYA 3OTPA 2P3UB 4E7NA 2BMGB 3SV8A 1P2JA 2ZWLH 4GUXA 2EC9H 3KYFA 2LPRA 2PGBB 3OEED 3VFEA 3M5OA 1THPB 2FX6A 2ZDLA 5L6NH 2P3FH 3A8AA 1SKYE 3T29A 5K7RA 5F8ZA 1JBUH 3K6ZA 2GZ8A 1GGDB 3URDA 3TVJB 2PUQH 3KYGA 1LPGB 1VCWA 4K5ZA 4ZAEA 1AZ8A 3RLYH 2G51A 1C5OH 3DCLA 1QCPA 1TE0A 4MG3A 3DSPA 3TH2H 2FDAA 3A8BA 2TGTA 4FU8A 2FOGA 1DSUA 3VB5A 2J94A 1CHGA 1O2KA 3OY6U 3SOSA 1GG6C 2FOHA 3BTME 1SSXA 1W11U 3LGIA 4Y10E 1MTWA 1O3HA 5DG6A 2XXLA 1Z7KA 5F8XA 1OKXA 2PP6A 2QXHA 1DVAH 1MAXA 3TIUA 5EODA 5FPTA 4FUIA 1ZPZA 4XD7D 3STIA 1IOEA 1FAKH 4JZIA 3TJUA 1AGJA 2VWNA 1P01A 1THSH 2RDEA 2V7QD 2O8UA 1ID5H 3W1EA 1PYTC 2VJ1A 1TOMH 1PQ5A 2HNTF 1T4UH 2PV9B 3I78A 1AY6H 1GJ7B 2ANMH 2ZGBH 3MH4A 4RT1A 3ZZDA 4AZ2B 2JH6D 3EE0B 2F9UA 3SU5A 4AYYB 1O2SA 2VNTA 1SGDE 1C5ZB 1PPHE 1GHBF 2FOFA 3F0PA 3BIVH 4I32A 5HGGA 1HFDA 3OAAD 3ZVEA 1HAVA 2ANKH 1MKXH 1DXPA 3P8GA 4Z1MD 3F9HA 1K21H 3BEUA 6GCHF 3K2UA 5KEDA 2XWBI 4HI3A 2BY9X 1EQ9A 2JETB 4JYUH 2HWLB 3QX5H 1E1QD 2P95A 4TWWA 3SZEA 1IQNA 1WV7H 4ABJA 2A7JA 1S85A 3HKIB 4DIHH 2ZHQH 1H9HE 1TQ0B 3M5LA 3Q77A 1PJPA 1E36B 2Y80A 2EY4C 2WPIS 3D23A 4UFFH 1YPHC 3MHWU 4CREA 1G2LA 1DLEA 1AQ7A 4FUGA 2HPPH 1EZUC 3GCHC 2O8LA 3PO1C 2GZ9A 1RRKA 4AB9A 2G52A 1SQRA 4OS1A 5GCHF 1QB9A 3RXHA 2A45B 2XCNA 5C94A 3KGPA 2BD7A 1O2LA 2XBVA 1FY1A 2WINI 3FP8E 4ZKNU 2FXRA 1O2YA 2FTLE 1FJSA 1JIMA 1C9TA 4ASHA 3UR6A 4ISOA 5EJ1A 3JZ2B 4IN1A 3SORA 1MMJN 5E8EH 5AFYH 1K2I1 1V2OT 1EJNA 4Y0YE 3UR9A 1Z71A 2F91A 4I8GA 4DURA 1C2DA 1AWHB 5C0UA 2VH0A 1AN1E 3TK6A 1BMFD 4I8LA 4Q7YA 1WAYB 1TNJA 4YESB 3TGKE 4UFEH 3LC3A 3UOUA 1NRRH 1TPSA 1ZYOA 2GMTB 1MTUA 3M5NA 2IN2A 4Y8ZA 1TMUH 4K1SA 1GI4A 2BD3A 2XCFA 1WSSH 4AC9A 1BRCE 2PKSB 5EU8A 5C5NA 4U30A 2HOBA 3KEEA 4B2AA 2ZIQH 2Z9GA 4K8BA 2TPIZ 1E1RD 1AKSB 3EA8A 2PUXB 2G4TA 1K9OE 1OWJA 1DITH 4D9RA 1Q3XA 3FKSD 2FZZA 1LKBA 1FN8A 4A5TS 3OU0A 1BMAA 5EW1H 1OS8A 3RM0H 2BDCA 2GCTB 1B5GH 2ANYA 1G3BA 3F6UH 1EAIA 1GI1A 1KXAA 1UVOA 3P8NA 3V7TA 1S84A 1NTPA 4B75A 1D4PB 1GMHF 2FX4A 1SVPA 1BBRK 1YPKH 3RXBA 2D2DA 5C2ZA 4KTUA 1MZAA 1SLXB 1XUIA 4I31A 2ZU5A 2J98B 1VGCB 4K3JA 4Y79A 2AGIX 1C2JA 4CRGA 1TONA 2YMSC 2WPHS 2BM2A 1SLVB 2ZU2A 4X6OA 1C5SA 1PPEE 2JIZD 4DT7B 1Y8TA 2AMQA 3UQVA 1GI6A 1Y3WA 4B6EA 1W0KD 4JZDH 1O36A 5HKKD 1TABE 1EZSC 1S0QA 3AASA 1O2UA 2ZP0H 4MDSA 5CHAC 3K6YA 1IQMA 5TCCA 3RMOH 1LQDB 1L1JA 1TLDA 2OBQA 4TT3D 2ZDKA 2G4UA 2BLOA 2VIDA 1K22H 5EGMA 1Y5BT 3SNEA 1TX7A 1HAPH 3RU4T 1ETTH 1OWHA 1Z8JB 5ETXA 4AG2A 1RXPA 1C2MA 4NWLA 3E90B 1KLTA 1D6RA 4PROA 3KQ5A 2CXVA 3ZVFA 1S83A 1GVKB 5AVDA 4ABGA 5L2ZH 1XVOA 3ZZ5A 1MTSA 1UCYE 5HYOA 2EQNA 2FESH 1XUHA 2AMDA 3LGUA 1BQYA 1C5YB 2NU1E 2Q6DA 3MWIU 1O2IA 5HMAA 1DOJA 1GHZA 2XRCA 1WQSA 1EJMA 3OFND 1XUJA 3F2GA 1O2VA 2WV4A 2BDAA 2KCYA 2ASUB 1CU1A 3UQOA 3T62A 5EW2H 4WY3A 5DGJA 2GX4A 3B23B 4XBCA 5E0GA 1E38B 2Q6FA 3F2HA 1V2MT 4X1PU 2ZPRA 3P8FA 2XWAA 1W12U 2O8WA 3A87A 2JH5D 3GY2A 1BTYA 1A3EH 1LVBA 1P12E 4ZUHA 2ZKSA 2ZF0H 5EXNA 2H5CA 1O35A 1Z8IB 2B5TB 2W7UA 1P02A 5GNDA 2BDHA 2QAAA 1GI5A 4TPIZ 3E0PB 3NKKA 1X7AC 1EPTB 2F9OA 1MABB 4GPGA 4LK4A 2K0QA 1UK3A 3UWJH 1O3FA 3PMHB 1OYQA 3SJKA 2CHAB 2HVYB 4GCHG 2NWNA 4UDWH 3RP2A 3WWBA 2IPHA 5EQRA 2Z3CA 1A5HA 2A7HA 4CRDA 2GCHF 1S6LA 3BF6H 5FHTA 4K1TA 3EGKH 1BITA 1V2ST 3MNXA 1TMBH 1Q31A 2BVXH 2XC4A 4RKOB 4MPXA 4R8TB 3S9CA 2ZCHP 1T32A 3SU1A 1ZTKA 4ISNA 4Q80A 1K1OA 1CHOF 4IS5A 3VB4A 2PSXA 1IHSH 1GI7B 1O2NA 3SBKA 2OD3B 3B8JA 4X8SH 4ZXYH 1RIWC 3NXPA 4O3TA 2GTBA 3C27B 5FPYA 3M37A 3ZVAA 2AIQA 3RXRA 4I8KA 3T27A 3O8BA 3SI3H 5C1XA 2Y6TA 2GDEH 2J9NA 2A5AA 3WWFA 1TGTA 1HAVB 2A2QH 2OQUA 3PTBA 5E2PA 1TNLA 3EAJA 1UHBA 1C2KA 1RJXB 1QR3E 4YOJA 2R0LA 3O8CA 1O5BB 2WV5A 1V2KT 1C5LH 2A5KA 5AFZH 2ZPSA 1G2MA 1C2LA 2VB0A 3LKWA 3U8TH 3U8OH 4ISHH 4I8JA 1GI8B 1MKXK 4KELA 3EA9A 3QO6A 3LOXA 4FETA 2UUKB 2SGFE 2XBYA 4NWKA 1KXCA 2RDLA 4MLFB 2ZC9H 3RXSA 4AFQA 2ILNA 2A7CA 1Z8RA 4INKA 1LQEA 3ENSB 4XSKU 3E91A 3MU0A 1BUIA 5C1UA 2ZI2H 3A88A 4AB8A 2EA3A 2PKAA 4ABEA 7GCHG 5C3NA 1W8BH 2TGDA 1O2PA 1TBZH 2M5TA 4FU9A 1C5MD 1UVPA 2BD4A 2J4IA 5GPIB 1QGFA 2HVXA 3BG4C 5JBTA 1T4VH 5T6GA 1TRMA 2SGPE 1GHYH 2FI3E 1O3PB 4FVDA 4MNVA 1BDAA 2V0BA 1CGHA 3GDUA 5K0HA 2JH0D 1JRTA 2W6ID 4MQAA 4HTCH 2FO9A 2Z3DA 5H4IB 2GGVB 3SU6A 4XDEA 4GHTA 1UTNA 3DSGA 2L6OA 4GAWA 3TITA 1MKWK 1ZTLA 3TJVA 3A82A 1DICA 1YCPM 2V3MA 2KCOA 3ZZAA 1ESAA 1BJVA 8LPRA 1PQAA 1T8NA 1F5LA 1PPZA 3DFLA 1CGJE 2BY6X 1H9LB 5F8TA 5DP9A 2QV1A 3KL6A 2IOTA 2AMPA 4X2YA 1W14U 4I86A 3ZVBA 1H9IE 1ELBA 3SGAE 3LC5A 4ABFA 3SU0A 2AIPA 2V35A 1A1RA 1GHVH 3M61U 1WDIA 3TK5A 2A4GA 1GBLA 1GHAG 2RG3A 2UUJB 1ARCA 1BBRH 1DS2E 1HXEH 1P09A 4CBOA 4IC6A 1K1MA 2OC1A 1ZR0A 4ZHLU 2BD5A 2GV7A 3A85A 2G5NA 1ZRBA 1QRZA 1MQ5A 1E35B 1O3NA 2VIPA 1MTNB 3PROA 1QFKH 1G3CA 1LCYA 1O3EA 3RXUA 2BQ7B 3H7OA 2ZPQA 3HK6B 4O3UA 5GXPA 3AVZA 2QF4A 3MYWA 1GBHA 1GVZA 2NU3E 4IN2A 2OP9A 1IQKA 2R3UA 3LGYA 3RXCA 1KTTB 1YLNA 2FOCA 1BZXE 4DG4A 3N7EA 3P95A 2PTNA 3BN9A 2FTMA 4K60A 1OP8A 2CV3A 2HNTE 1F0RA 2IJD1 2B7DH 1ZTJA 5B6LA 1GBDA 2CN0H 3S9BA 5A8ZA 2CF8H 1TNGA 1KXEA 1Y3YA 4YXWD 4I33A 1G37A 1KY9A 1P2QA 1ZPCA 3F3BA 4NFEA 2UWPA 5AHGH 4DOQA 2ZGCA 1CBWC 3ZZ9A 4OS2A 4ASUD 4TPYA 1HCGA 2LNCA 1LTOA 3MNCA 1QBNA 4AFZA 5DP8A 1ZJKA 1SOTA 4Y8YA 1V2TT 1EZQA 1ZJDA 1MUEB 1QJ6B 2VWMA 1HGTH 1P05A 4ZROA 4FUFA 5I46H 4YLQH 1QJ1B 3FN8A 3KHVA 1WQVH 2VIWA 3DT0H 1P03A 4F55A 2KAIA 5HIYA 2OK5A 2ZHWH 3A7VA 3OE7D 5C17A 1P0SH 5A09A 1ANCA 1NRQH 1Z1IA 5EJZA 4NCYA 2AH4X 3PRDA 3F9GA 1J9CH 4IGDA 1DT2A 2PGQB 2C8WB 3F2FA 6LPRA 1TBQH 3C1KA 2RCEA 2C93B 4WMEA 4AFSA 1IQLA 3QK1A 3LT3A 1ZSKA 1BCUH 1IQIA 3SJ8A 1AVWA 1C4U2 3S9AA 2JKHA 2ZDNA 3WY8A 4FUEA 4A6LA 2VWLA 1PPFE 3GYLB 1S6HA 1NFYA 5A0AE 1HJ9A 4NIVA 1TBRH 3KN2A 3PRBA 1T8LA 2D1JA 3A7ZA 4VGCC 5CHBA 5A8YA 1ABIH 2P8OC 2GJGA 1ZGIA 1NRSH 2W26A 3M7QA 3DSOA 3MI4A 4AGJA 1OWIA 1WCZA 2KZ4A 1GBKA 4RN6A 1AUTC 1FI8A 4IBLH 3A80A 3TNSA 1C1VH 1YCPK 1GI2A 1J8AA 1F7ZA 2GP9B 3FVFB 4IC5A 4X8VH 3WW7A 4CRFA 1O30A 4DT4A 2ZCLP 2ODPA 1NT1A 3P70B 1AE5A 2KCAA 3SQHE 2OC8A 3RC5A 5FX6A 3UIRA 1ZMNA 4A1VA 1C5UA 4ZXXH 3QLPH 5DJ7A 2VU8E 3D49H 1BT7A 4BTIB 1F2SE 1GBJA 1BMNH 2P16A 1KDQA 1DM4B 1EP5A 2K8IA 1P2MA 1C5WB 1C1SA 2LP6A 3LJJA 1UTKA 1L4DA 3AAUA 2YMSD 2HLCA 4NSYA 1JWTA 1YPLH 3GCTG 4XRNA 1CA0B 2Z9KA 5E0JA 4Q2KA 1Y5AT 1HJAC 2QXGA 1DSTA 1KTSB 4AORA 3KQCA 4KGAA 2Z9JA 4X1RU 3M7TA 1SQTA 3HPTB 1KLIH 3FAOA 4MVNA 3H7TA 4DW2U 2Z9LA 4Y71A 2UWOA 3VGCB 1C1WH 3TJNA 1AIXH 1V2NT 2O8TA 2FP7B 1JOUB 1O3BA 4TSFD 5JBCS 1ELDE 1S6FA 1XMNB 4H6TA 3BEFB 1MBMA 2RFKC 1DANH 1YWUA 4CHAB 2WZQA 2A4RA 2V3HH 1F5RA 1E37B 2EI7A 2PKAB 1SQAA 2K1QA 3V3MA 4TY7A 3GDSA 3PMAB 3QWCH 1MD8A 3TU7H 1NFXA 1MQ6A 1G32B 2JJ1D 3BG4B 2QN5T 1SHHB 2AERH 2FOMB 1BB0B 1MZDA 1XUGA 4FU7A 1ZPBA 3E16B 1N8OB 3RXJA 3BTWE 3TJOA 3OSYA 3ATLA 1ZMJA 5DO4H 1FX0B 3RUOA 2Y5FA 2BD2A 2BVRH 1MKWH 2WPMS 1UTQA 1W13U 2FS9A 3U28C 2QC2A 3RLWH 1GBEA 1P04A 4ACBA 5JBBS 1EAWA 1O34A 1GHWH 1DX5M 3Q3KA 3ATKA 2BQ6B 5C5OA 3TGJE 1SGNE 1J16A 3RU4E 1GL0E 5GJ4B 2BZAA 1P2NA 1F5KU 5JB9S 4J2YB 1SFIA 4D7FA 1V6DA 2AGGX 2O9QA 1QL9A 4XE4A 1EOLA 1C1NA 3LH3A 4JCNA 3URCA 1TIOA 2QXIA 1O3CA 3F9EA 1GMDG 4OGXA 1AU8A 1SG8B 4OS4A 4FUCA 3U69H 1AD8H 2GVFA 1CGIE 1ESTA 1SFQB 2FLRH 1AI8H 3O8DA 2YNBA 1ETSH 1SGYE 1A0LA 4NIWA 1XXFA 1HDTH 3TLOA 3SUDA 3BTGE 4BAQB 5GWZA 1O3KA 3F68H 4Y7BA 3V12A 3PB1E 6CHAB 2A4OA 2KFWA 2W7SA 4B1TA 4GCHF 1LMWB 4HG6A 1UTMA 3GY4A 5DP6A 2HALA 2BDBA 3T25A 3HGPA 5CE1A 2BOKA 4WMFA 3AK5A 2P94A 2EI8A 2Z3EA 3I77A 4H4FA 3TGIE 1IQGA 2BY7X 5LPEA 1TGCA 2D26C 2WPLS 4ACAA 2BTCE 1UW7A 1LVOA 5TJXA 3SNBA 1WOFA 2R3YA 1ZSLA 5T6FA 1UVSH 4HZHA 4DY7B 4ZCNA 1V2RT 1O37A 1QY6A 3PV4A 4NG9H 6ESTA 1SGEE 2V6NA 1C1TA 1G30B 1K28D 1XUFA 3UWIA 4B2CA 3U9AH 2VIQA 3STJA 2Q1JA 1GHBG 1BMLA 1F0SA 2ALPA 1WXRA 2ZTZA 4NIXA 1TX6A 4NA7A 2SNVA 1EKBB 1P9SA 1FIZA 2ZDAH 3M3VA 1HIAA 2ZNKH 4RI0A 1QL7A 1SMFE 4HFPB 2VVCA 1K1NA 2UWLA 1EATA 1C4V2 3FZDA 1FMGA 2I6SA 4U01A 2P3TB 1O2XA 3M35A 3RXKA 1DE7H 3S7HB 1P2KA 3SO3A 5DSFA 1FPHH 3P92A 1Y3VA 2PLXA 2Y7XA 2BHGA 1C5TA 4O03A 1PPBH 1OP2A 2BVSH 2QYIA 2Z9IA 1B0EA 1C5VA 4ZHMU 2WSSD 2ZDMA 4XBDA 3VPKA 1AUJA 1D3QB 1GCTC 2FLBH 3A8DA 2GT7A 3SJOA 1G9IE 4MPVA 1ZLRA 2H2ZA 5GIBA 2KAIB 4MPUA 3ZYDA 1QA0A 1SGFG 5CDFE 2BX4A 5EIYA 4CRCA 1LDTT 1Z6EA 2OINA 2XBXA 1ELAA 5KGOA 1WUNH 2OLGA 1F92A 5BRRE 1VJ9U 1O2HA 4TY6A 1TNKA 1ZHPA 2ANWA 2SGEE 1YLCA 1O2QA 1A3BH 1UVUH 2FM2A 2QA9E 1O33A 5A0CA 4X2VA 4A7IB 4ZKOU 1QTFA 1O3LA 2J92A 4KTCA 1O3DA 1SC8U 1SR5C 4RKJB 5FAHA 1SGRE 4B71A 1V2UT 4BAMB 3RC4A 2BY5X 1TQ7B 4CRAA 4OGYA 1E0FD 4FUDA 2L74A 3ATMA 5DPAA 2GDDA 1GBMA 1GMCG 1ANBA 1FY4A 1FXYA 2BLVA 1TA2A 2GZ7A 2BDGA 1O3GA 2ZCKP 1FV9A 5DP3A 1C1MA 1GG6B 1VITG 1UTLM 2GD4B 1FIWA 4P02A 2C8ZB 1P9UA 4ZHAA 1J17T 2YNAA 3DUXH 1T7CA 4GVUA 1W3CA 3H5CB 1BTUA 3EDXB 4JMYA 1TGNA 1YCPH 2TGAA 3RXQA 1O5GH 1DWBH 2OTVA 1AE8H 9ESTA 1PFXC 1O5EH 4B6FA 1O5AB 1T8MA 1ZOMA 1ELVA 1TALA 2G5VA 2P93A 4K1EA 1S81A 2FMJA 1H1BA 1A46H 3UAIC 1GGDC 1QB1A 2J2UA 1P3EA 4OM9A 5AF9H 3RMNH 3NUMA 3SV7A 4LOYH 1NY22 1KYNA 1SGPE 2A5IA 4MNXA 2WPKS 4H6SB 2KM0A 4MPWA 4KTSA 3EE7A 1KDQB 3E1XB 1L1NA 1AVGH 3MU8A 2BD9A 1MH0A 1D3PB 3E0NB 2ZHDA 1GMHG 1TGSZ 2TIOA 1TPAE 3D62A 2AGEX 4FUHA 2QCYA 3RMLH 4AOQA 1CSOE 3Q3YA 5GDSH 1OXGA 8KME2 3HKJB 3A7XA 1HLTH 1BTWA 1P57B 1G36A 2HPQH 4ZH8A 2WYGA 2ZG0H 1ESBA 1GJDB 3MTYA 1ELCA 4Z6AH 1NFWA 2NU4E 2ZDVH 2ZHEH 5FBEA 3ZZ6A 4YZUA 2W5EA 1GJAB 3T2NA 3KF2A 8ESTE 5PTPA 2ZO3H 1GJBB 1DUEA 1JXPA 1TOCB 1HB0B 5TCAA 1YPHE 2OC0A 2FOBA 3PM3A 1EX3A 3PWBA 2FOAA 3QN7A 3SJIA 2PSYA 1K1JA 4D9QA 3GCHB 3UTUH 1C5RA 1UK4A 3PO1B 3SUEA 1L2EA 2JJ2D 2GT8A 3Q00A 1TPOA 1A7SA 3LIWA 4B74A 3A7WA 3VG8A 1MU6B 3FOAA 4ISLA 1W0ZU 3PWCA 2G55A 5EG4A 2AS9A 4X6NA 1TX8A 2JETC 3JZ1B 1Y3XA 1KXFA 1QRWA 4D76A 2KR7A 1W2KH 1DWCH 4I7YH 5B6OA 2BXUH 3BG8A 1QB6A 2PW8H 1AHTH 5DP4A 2A2XH 5DP7A 3SQEE 4UD9H 4ABDA 1GHXH 2BDIA 1DLKB 4ESTE 1NPMA 1QJ7B 1NESE 5L30H 4JK5A 3DHKH 2UUYA 2ZA5A 4X6MA 1Z8GA 1NRPH 4TWYA 1MTVA 1O2JA 2SGDE 5F03A 2J34A 2BDYA 1V2LT 1TGBA 2B0FA 3PLPA 2Y5HA 4NFFA 2ZHFH 1XVMA 1K1PA 4F49A 1UTJA 2STAE 3HGNA 3BV9B 5HIZA 1B0FA 4YOGA 3BIUH 2ALVA 3GY5A 4Z0KA 1LO6A 4WH6A 2GCHG 1ZRKA 3KCGH 2SFAA 1BOQA 2Z6BD 1EASA 3SNCA 5JYIA 3S0NA 3MQKC 3FP6E 1LHFH 1C1RA 3BTTE 3CS7A 4JK6A 2OCVB 2GMTC 2KX4A 3R0FA 3LU9B 5JDUB 2WHXA 1RFNA 2XNIA 2YMSB 1FY3A 2PKSC 1C5NH 1O5FH 1T8OA 1NU7B 1HBTH 1BMMH 4OS7A 5DKMA 5IDKA 1BHXF 1SGTA 3W94A 1V2VT 4ABIA 2XC0A 2G81E 4Y11E 1VCPA 3MMGA 4E05H 1ANDA 1UO6A 1HAOH 1A2CH 1JIRA 5CHAB 3MO3A 4OS6A 1GJ5H 2GCTC 1XKAC 2V3OH 3A86A 5ABWA 1OPHB 4IW4E 3N99A 1C9PA 4X8TH 3TPIZ 2QF0A 1C2HA 1TNIA 3DD2H 3T28A 2H9HA 1BTXA 3ZZ7A 2C8XB 2WUCA 3GCTF 1QRXA 1V3XA 2XYAA 3VB7A 1O2RA 2C4FH 2J98A 5EXLA 1HJ8A 3UREA 5A0BA 1N6YA 1GBAA 1VGCC 1C2FA 2H6MA 2C3SA 2ZZUH 1GJ8B 9LPRA 2OBOA 4X1NU 1IQJA 4I8HA 1GBIA 1EJAA 5HXFA 4UFDH 2BYAX 2STBE 5JB8S 1O3IA 2Z7FE 4BTTB 4F48B 1DFPA 3Q76A 1S0RA 4UFGH 1FDPA 3BSQA 1L0ZA 4Y7AA 1C2IA 7KMEH 1C1PA 2KCPA 7LPRA 1ABJH 1ETRH 5LPRA 4E7RG 3RXOA 1A61H 1Z6JH 1GWAA 1HAYB 1EAUA 3RXFA 3QGJA 3VB3A 1AMHA 1EUFA 3RXEA 1QL8A 1DY9A 4K2YA 4ISIH 1RTFB 3LDXH 3ZYEA 2WPJS 3FFGA 1EP6A 4GSOA 2OC7A 1DXWA 2VGCC 1T31A 3SJ9A 2A32A 4JZFH 2NU2E 1Y3UA 2J5UA 3IG6B 3A8CA 3V13A 3P17H 1HAZB 1NS3A 1VZQH 1EB2A 3DA9B 4JYTA 2UUFB 3NPSA 4BAKB 1UK2A 5EPNA 4YOIA 1BRBE 1L1GA 2ZFTA 2BOHB 3A83A 2IJOB 2SNWA 4B76A 2XTTB 2ZEBA 3NRLA 4UE7H 3SU3A 1GCDA 2QF3A 1ELTA 2CK3D 1KLJH 1WTGH 1RS0A 1XX9A 5FPSA 4UEHH 4CBNA 2ZFQH 1GI9B 3LGTA 1UTPA 1Z1JA 1A0HB 3BTDE 3ZZ4A 4MNWA 4LZ1H 1SI5H 2Z94A 2A31A 1MD7A 1GMDF 1SGQE 4J1YA 1C5XB 3S7KB 1YY3A 2F83A 1O3OA 1LHGH 3RXAA 1RIWB 4CR9A 2NU0E 1ACBE 1TMTH 3BTKE 4FOUC 1VR1H 2XBWA 4ZMAH 1SL3A 1EPTA 2ZFPH 2RA0A 7ESTE 1YPMH 1EFRD 2RA3A 1EPTC 5L2YH 3RXGA 1ZSJA 5T6DA 1Q2WA 1C5PA 1HYLA 3CNRA 1HAIH 2CHAC 1NFUA 1IQFA 3CS0A 1AO5A 1OP0A 3QTVH 2EEKA 5IK2D 1KIGH 3BTFE 3NK8A 3SV6A 3P6ZB 5J4SA 2ZGJA 1UHBB 3O8RA 1INCA 3F0OA 2J95A 1AFQC 3UOPA 5DP5A 1K1IA 1TRYA 2JDID 4JZEH 2WPDD 1SLUB 1H4WA 1YF4A 3U1IB 4AYVB 3GYMA 5EJLA 5C1YA 3ZIAD 5ESTE 3ZZCA 1IAUA 1TAWA 1YPJH 3ZVCA 1SQOA 4A92A 2AYWA 2OXSA 5LH8A 1UCYH 3PLKA 2WYJA 1FUJA 1P8VC 2F9PA 1BTPA 4UONA 1O2TA 3BTQE 4CH2B 3E3TA 1W7GH 2ZFFH 4GLYA 1W0YH 3ATIA 3UNSA 1J14A 2R2WU 5E2OA 1OOKB 1XXDA 1SPJA 1GBTA 3S69A 1P2OA 3UY9A 1BBRE 4MNYA 4AN7A 2ZFSA 1ELEE 1HV7A 4DIIH 4FUBA 3PYHA 4INLA 2W3KA 3MH5A 1O38A 1AFEH 1WYKA 2FI5E 1NZQH 4K8YA 1HAXB 1CVWH 8GCHG 2G00A 2XOKD 3GICB 4BAOB 4NZLA 2FOEA 1FQ3A 1NBMD 4Q7XA 5EQSA 1WU1A 3T5FH 2W6JD 1S82A 1MBQA 1BRUP 2QIQA 4Y76A 1GBCA 1V2PT 2VVUA 3LH1A 2XW9A 1E79D 1OWEA 1O5DH 4Y6DA 4AFUA 1NRNH 4TYDA 2C90B 1BIOA 4B2BA 4IMZA 3IWMA 1DDJA 1QNJA 4YT6H 3VXEH 1P10A 2DUCA 3ZZ8A 3R3GB 3SNAA 4YO9A 3GISB 3E6PH 1VCQA 5FCKA 4THNH 1YGCH 1O32A 2YOLA 3PV2A 1QZ8A 2QXJA 1HPGA 3OEHD 4O9VA 3RXLA 1W10U 3N7OA 1CA8B 1EAXA 3KIDU 2H9TH 2QY0B 4BOHA 3A84A 1A4WH 3SHCH 1ZHMA 1BTZA 2FODA 2HLDD 1CT2E 1P2IA 1SGIB 1YYY1 1GMCF 2A4QA 2PTCE 3K65B 2FEQH 2ODQA 2PR3A 2QGRA 1KSNA 1CT0E 3CP7A 1YPEH 1VITF 2A0QB 3SGQE 4X8UH 1UTOA 5FXLA 3SUFA 3H09A 1NN6A 4LZ4B 3GCOA 4ABAA 1YBWA 3BTEE 1QHRB 4X0WU 2DE9A 1O2WA 1C1UH 2BY8X 1SLWB 1N6XA 3B9FH 1N1LA 1TB6H 5EOKA 2F43B 2PWXA 1SHYA 2FS8A 2R0KA 2M2AA 2ZQ1A 2ZGXH 1O3AA 1QIXB 4DVAU 1TRNA 1FAXA 1RD3B
chains in the Genus database with same CATH topology
1GJ6A 3TNTA 4FVBA 1O2OA 3MH6A 2F9BH 5FBIA 4AG1A 2VINA 1TA6A 3ITIA 3MH7A 1HUTH 1QQUA 5EQQA 3UNRA 3L33A 2PHBA 2Y81A 1DWDH 1EB1H 3NZIA 3M36A 5EXMA 4AX9H 3SZNA 3SHAH 2TGPZ 4KKDA 1JRSA 2F9VA 3GOVB 6GCHG 1CBWB 3TH4H 1SGCA 1AB9C 1QBVH 3MO6A 4BNRA 3SU2A 4AGKA 1ELFA 1MTNC 2B9LA 1AWFH 1OWKA 1XUKA 1AVXA 4YT7H 1VJAU 1CO7E 4NGAH 2DE8A 2I6QA 3MNSA 2CJIA 3L3TA 1GI3A 1CQQA 2FIRH 4XBBA 4BXWA 2EI6A 3RC6A 1AZZA 3UFAA 1C2GA 1MCVA 1D9IA 1OX1A 1ZHRA 3RXIA 3P8OA 1D6WA 4H42U 2ZFRH 4JYVH 1LVMA 2TBSA 1K1LA 2HNTC 2TRMA 3RXMA 5FCRA 4Y0ZE 1TPPA 3A7TA 1BA8B 1GDUA 3F9FA 3RDZA 3UPEA 1PPCE 2W3IA 5EPYA 3ZZ3A 4D8NA 3W95A 1JMOH 1GBBA 5GCHG 2BXTH 4HGCA 3E8LA 2B8OH 4BAHB 4GHQA 2VGCB 5C20A 5J4QA 3GY3A 3GY7A 1PQ8A 7GCHF 1CT4E 3M5MA 2ULLA 4ABHA 2AFQB 1DUAA 4RSPA 2VH6A 3M3TA 5JPMH 1H8DH 2R9PA 3L6PA 4ZKSU 1GDQA 3GY8A 4NIYA 5IYTA 1RTLA 1Y59T 3BEIB 1C1OA 4WWYA 4VGCB 1ZGVA 2BD8A 2H1UA 2O8MA 3ELAH 2ODYB 2P8OB 2FYQA 1B7XB 1GJCB 3SV9A 1O39A 3PTNA 1RGQA 1GJ4H 4Y8XA 3RM2H 4INHA 4WXVA 4NA9H 2HRVA 4FUJA 4NA8A 5A8XA 1RTKA 5HM9A 3LGVA 3MFJA 3LPRA 4NSVA 1YP9A 1SGFA 1FONA 3U98H 3FZZA 1QA7A 3VB6A 1ELGA 3M7UA 3HATH 3VEQB 2D8WA 4WXIA 4IMQA 1THRH 4BTUB 3SUGA 3HK3B 1NROH 3SI4H 1IQHA 1O2ZA 2H9EH 2ZQ2A 3FP7E 3UNQA 3RU4D 2BQWB 2CGAA 4X6PA 2R2MB 2Q6GA 1C5QA 1ARBA 1E34B 5FX5A 1OYTH 3GY6A 3MU5A 1TNHA 3EYDA 1NU9A 2XC5A 1AFQB 1YLDA 1A5IA 1GHAF 3QTOH 3VXFH 3GDVA 2ZTYA 4KP0A 1FZZA 1WTHD 1HJAB 1FN6A 4JZ1A 1FY5A 2G8TA 1D3TB 3OYPA 3KQDA 5LGOA 2FWWA 3ZVDA 2OUAA 4O97A 3PLBA 1UMAH 1M9UA 4LXBH 1D3DB 4FXGH 5E0HA 3KQBA 5BPEA 3QDZB 2ZU4A 1UJ1A 1BHXB 1MU8B 5HM2A 3ZV8A 3I29A 1NO9H 2Y5GA 3F1SB 3QGNB 1XKBC 4X2XA 2P59A 4SGAE 3QUMP 3QZQA 1UCYK 4R0IA 2CF9H 1O3JA 3AW1A 5DK1A 1MAYA 4OS5A 4WH8A 1PQ7A 1GPZA 2VIVA 1CA0C 4U32A 1P06A 1HNEE 4XOJA 1YPGH 1TYNA 1SB1H 2Y7ZA 3RXPA 1QURH 4M7GA 1XM1A 2F3CE 1QQ4A 4CRBA 1ZZZA 2ZGHA 4U2WA 4BANB 3OY5U 3OX7U 2WUBA 1V2QT 1FY8E 3QZRA 3VGCC 2BLQA 3LONA 4WVPE 3MNBA 3RXTA 1O31A 3ODDA 4X2WA 3GCNA 2C8YB 1NC6A 5C67A 4CHAC 3K9XB 1DY8A 3MOCA 1YC0A 3FANA 1F0UA 2FPZA 4QT8C 3ODFA 3SN8A 4F4OC 1SOZA 1KXDA 2BB4A 1HRTH 3LJOA 1VITH 1P3CA 1Y5UT 2ZTXA 1HAHH 3CENA 3PMJA 1SBWA 1ORFA 4SGBE 1N8OC 2J38A 1HXFH 3G01A 4K69A 3SV2H 1DWEH 2A1DB 5G4BA 3SU4A 1IQEA 4DCDA 1TWXB 1OWDA 1GI0A 4ZKRU 3KNXA 1GBFA 1P11E 2VIOA 1H8IH 1FNIA 3MU4A 1DPOA 2Y82A 2H5DA 1U6QA 3ZV9A 2BLWA 3ESTA 4D7GA 2CMYA 1YM0A 4WMDA 2FI4E 3A7YA 3DFJA 1EZXC 5JBAS 1GL1A 4A1TA 1CE5A 1CHOG 1LKAA 4BXSA 1NM6A 4NZQA 1F0TA 1W7XH 1WBGB 2VVVA 1ANEA 1AKSA 3SGBE 1O2GH 1O3MA 2SGAA 4X1QU 3D65E 1LHEH 5T3HA 1EXFA 1PPGE 3IITA 3Q3XA 3A81A 1BJUA 1O5CB 2PFEA 5LPFA 4WJG2 1YKTA 3BTHE 4XFQA 5SGAE 3SW2B 3PMBB 1GDNA 2GV6A 6CHAC 1HIAB 3V0XA 2BZ6H 1KXBA 1PYTD 4CH8B 1AB9B 1IHTH 1ZMLA 3KQEA 5I25A 3MU1A 3TH3H 1TFXA 2THFB 1L4ZA 3U8RH 2ZU3A 1O0DH 4MTBA 1LPZB 4YTAA 4YLUA 3ATWA 2BX3A 2ZU1A 3EQ0H 1HAGE 3OTJE 3RMMH 3RXDA 3RXVA 3ZVGA 1MCTA 1GCTB 5F6MA 3UUZA 1BRAA 2ZECA 1C1QA 3A89A 5ESBA 3AAVA 5CMXH 1LHDH 4YM9A 4WF8A 1LHCH 1V2JT 3M3SA 3SNDA 1LPKB 1GJ9B 1A0JA 1OSSA 3T26A 1J15A 2HGTH 2GKVE 1FPCH 2FYRA 4DJZB 3AW0A 1GVLA 1G3DA 1UVTH 1BTHH 1S5SA 3NCLA 2ESTE 2F9NA 2VWOA 4B73A 3U1JB 5A2MH 1EOJA 3EA7A 4A1XA 4DGJA 3ZZBA 4ABBA 1V2WT 4X1SU 2SGQE 1FLEE 2OQ5A 8GCHF 4CR5A 3LGWA 1O2MA 4E06H 2AEIH 1C2EA 1A5GH 1G3EA 1QBOA 3MO9A 3NWUA 3TK9A 1C4Y2 4Q7ZA 1LVYA 2P3UB 4E7NA 2BMGB 3SV8A 1P2JA 2ZWLH 4GUXA 2EC9H 2LPRA 2PGBB 3VFEA 3M5OA 1THPB 2FX6A 2ZDLA 5L6NH 2P3FH 3A8AA 3T29A 5K7RA 5F8ZA 1JBUH 3K6ZA 2GZ8A 1GGDB 3URDA 3TVJB 2PUQH 1LPGB 1VCWA 4K5ZA 4ZAEA 1AZ8A 3RLYH 2G51A 1C5OH 1QCPA 1TE0A 4MG3A 3TH2H 2FDAA 3A8BA 2TGTA 4FU8A 2FOGA 1DSUA 3VB5A 2J94A 1CHGA 1O2KA 3OY6U 3SOSA 1GG6C 2FOHA 3BTME 1SSXA 1W11U 3LGIA 4Y10E 1MTWA 1O3HA 5DG6A 2XXLA 1Z7KA 5F8XA 1OKXA 2QXHA 1DVAH 1MAXA 3TIUA 5EODA 5FPTA 4FUIA 1ZPZA 3STIA 1IOEA 1FAKH 4JZIA 3TJUA 1AGJA 2VWNA 1P01A 1THSH 2O8UA 1ID5H 1PYTC 2VJ1A 1TOMH 1PQ5A 2HNTF 1T4UH 2PV9B 3I78A 1AY6H 1GJ7B 2ANMH 2ZGBH 3MH4A 3ZZDA 4AZ2B 2JH6D 3EE0B 2F9UA 3SU5A 4AYYB 1O2SA 2VNTA 1SGDE 1C5ZB 1PPHE 1GHBF 2FOFA 3BIVH 4I32A 5HGGA 1HFDA 3ZVEA 1HAVA 2ANKH 1MKXH 1DXPA 3P8GA 3F9HA 1K21H 3BEUA 6GCHF 3K2UA 2XWBI 4HI3A 2BY9X 1EQ9A 2JETB 4JYUH 2HWLB 3QX5H 4TWWA 2P95A 1IQNA 1WV7H 4ABJA 2A7JA 1S85A 3HKIB 4DIHH 2ZHQH 1H9HE 1TQ0B 3M5LA 3Q77A 1PJPA 1E36B 2Y80A 2WPIS 3D23A 4UFFH 1YPHC 3MHWU 4CREA 1G2LA 1DLEA 1AQ7A 4FUGA 2HPPH 1EZUC 3GCHC 2O8LA 3PO1C 2GZ9A 1RRKA 4AB9A 2G52A 4OS1A 5GCHF 1QB9A 3RXHA 2A45B 2XCNA 3KGPA 2BD7A 1O2LA 2XBVA 1FY1A 2WINI 3FP8E 4ZKNU 2FXRA 1O2YA 2FTLE 1FJSA 1JIMA 1C9TA 4ASHA 3UR6A 4ISOA 3JZ2B 4IN1A 3SORA 1MMJN 5E8EH 5AFYH 1K2I1 1V2OT 1EJNA 4Y0YE 3UR9A 1Z71A 2F91A 4I8GA 4DURA 1C2DA 1AWHB 2VH0A 1AN1E 3TK6A 4I8LA 4Q7YA 1WAYB 1TNJA 4YESB 3TGKE 4UFEH 3LC3A 3UOUA 1NRRH 1TPSA 1ZYOA 2GMTB 1MTUA 3M5NA 2IN2A 4Y8ZA 1TMUH 4K1SA 1GI4A 2BD3A 2XCFA 1WSSH 1BRCE 2PKSB 5EU8A 5C5NA 4U30A 2HOBA 3KEEA 4B2AA 2ZIQH 2Z9GA 4K8BA 2TPIZ 1AKSB 3EA8A 2PUXB 2G4TA 1K9OE 1OWJA 1DITH 4D9RA 1Q3XA 2FZZA 1LKBA 1FN8A 4A5TS 3OU0A 1BMAA 5EW1H 1OS8A 3RM0H 2BDCA 2GCTB 1B5GH 2ANYA 1G3BA 3F6UH 1EAIA 1GI1A 1KXAA 1UVOA 3P8NA 3V7TA 1S84A 1NTPA 4B75A 1D4PB 1GMHF 2FX4A 1SVPA 1BBRK 1YPKH 3RXBA 2D2DA 5C2ZA 4KTUA 1MZAA 1SLXB 1XUIA 4I31A 2ZU5A 1VGCB 4K3JA 4Y79A 2AGIX 1C2JA 4CRGA 1TONA 2WPHS 2BM2A 1SLVB 2ZU2A 4X6OA 1C5SA 1PPEE 4DT7B 1Y8TA 2AMQA 3UQVA 1GI6A 1Y3WA 4JZDH 1O36A 1TABE 1EZSC 1S0QA 3AASA 1O2UA 2ZP0H 4MDSA 5CHAC 3K6YA 1IQMA 5TCCA 3RMOH 1LQDB 1L1JA 1TLDA 2OBQA 2ZDKA 2G4UA 2BLOA 2VIDA 1K22H 5EGMA 1Y5BT 3SNEA 1TX7A 1HAPH 3RU4T 1ETTH 1OWHA 1Z8JB 5ETXA 4AG2A 1RXPA 1C2MA 4NWLA 3E90B 1KLTA 1D6RA 4PROA 2CXVA 3ZVFA 1S83A 1GVKB 5AVDA 4ABGA 5L2ZH 1XVOA 3ZZ5A 1MTSA 1UCYE 5HYOA 2FESH 1XUHA 2AMDA 3LGUA 1BQYA 1C5YB 2NU1E 2Q6DA 3MWIU 1O2IA 5HMAA 1DOJA 1GHZA 2XRCA 1WQSA 1EJMA 1XUJA 1O2VA 2WV4A 2BDAA 2ASUB 1CU1A 3UQOA 3T62A 5EW2H 4WY3A 5DGJA 2GX4A 3B23B 4XBCA 5E0GA 1E38B 2Q6FA 1V2MT 4X1PU 2ZPRA 3P8FA 2XWAA 1W12U 2O8WA 3A87A 2JH5D 3GY2A 1BTYA 1A3EH 1LVBA 1P12E 4ZUHA 2ZKSA 2ZF0H 5EXNA 2H5CA 1O35A 1Z8IB 2B5TB 2W7UA 1P02A 2BDHA 2QAAA 1GI5A 4TPIZ 3E0PB 3NKKA 1X7AC 1EPTB 2F9OA 4GPGA 4LK4A 1UK3A 3UWJH 1O3FA 3PMHB 1OYQA 3SJKA 2CHAB 4GCHG 2NWNA 4UDWH 3RP2A 2IPHA 5EQRA 2Z3CA 1A5HA 2A7HA 4CRDA 2GCHF 3BF6H 5FHTA 4K1TA 3EGKH 1BITA 1V2ST 3MNXA 1TMBH 1Q31A 2BVXH 2XC4A 4RKOB 4MPXA 4R8TB 3S9CA 2ZCHP 1T32A 3SU1A 1ZTKA 4ISNA 4Q80A 1K1OA 1CHOF 4IS5A 3VB4A 2PSXA 1IHSH 1GI7B 1O2NA 3SBKA 2OD3B 3B8JA 4X8SH 4ZXYH 1RIWC 3NXPA 4O3TA 2GTBA 3C27B 5FPYA 3M37A 3ZVAA 2AIQA 3RXRA 4I8KA 3T27A 3O8BA 3SI3H 5C1XA 2Y6TA 2GDEH 2J9NA 2A5AA 1TGTA 1HAVB 2A2QH 2OQUA 3PTBA 5E2PA 1TNLA 3EAJA 1UHBA 1C2KA 1RJXB 1QR3E 4YOJA 2R0LA 3O8CA 1O5BB 2WV5A 1V2KT 1C5LH 2A5KA 5AFZH 2ZPSA 1G2MA 1C2LA 2VB0A 3LKWA 3U8TH 3U8OH 4ISHH 4I8JA 1GI8B 1MKXK 4KELA 3EA9A 3QO6A 3LOXA 2UUKB 2SGFE 2XBYA 4NWKA 1KXCA 2RDLA 4MLFB 2ZC9H 3RXSA 4AFQA 2ILNA 2A7CA 1Z8RA 4INKA 1LQEA 3ENSB 4XSKU 3E91A 3MU0A 1BUIA 5C1UA 2ZI2H 3A88A 4AB8A 2EA3A 2PKAA 4ABEA 7GCHG 5C3NA 1W8BH 2TGDA 1O2PA 1TBZH 2M5TA 4FU9A 1C5MD 1UVPA 2BD4A 2J4IA 5GPIB 1QGFA 2HVXA 3BG4C 5JBTA 1T4VH 5T6GA 1TRMA 2SGPE 1GHYH 2FI3E 1O3PB 4FVDA 4MNVA 1BDAA 2V0BA 1CGHA 3GDUA 5K0HA 2JH0D 1JRTA 4MQAA 4HTCH 2FO9A 2Z3DA 5H4IB 2GGVB 3SU6A 4XDEA 4GHTA 1UTNA 4GAWA 3TITA 1MKWK 1ZTLA 3TJVA 3A82A 1DICA 1YCPM 3ZZAA 1ESAA 1BJVA 8LPRA 1PQAA 1T8NA 1F5LA 1PPZA 3DFLA 1CGJE 2BY6X 1H9LB 5F8TA 5DP9A 2QV1A 3KL6A 2IOTA 2AMPA 4X2YA 1W14U 3ZVBA 1H9IE 1ELBA 3SGAE 3LC5A 4ABFA 3SU0A 2AIPA 2V35A 1A1RA 1GHVH 3M61U 3TK5A 2A4GA 1GBLA 1GHAG 2RG3A 2UUJB 1ARCA 1BBRH 1DS2E 1HXEH 1P09A 4CBOA 4IC6A 1K1MA 2OC1A 1ZR0A 4ZHLU 2BD5A 2GV7A 3A85A 2G5NA 1ZRBA 1QRZA 1MQ5A 1E35B 1O3NA 2VIPA 1MTNB 3PROA 1QFKH 1G3CA 1LCYA 1O3EA 3RXUA 2BQ7B 3H7OA 2ZPQA 3HK6B 4O3UA 5GXPA 3AVZA 3MYWA 4IN2A 1GBHA 1GVZA 2NU3E 2OP9A 1IQKA 2R3UA 3LGYA 3RXCA 1KTTB 2FOCA 1BZXE 4DG4A 3P95A 2PTNA 3BN9A 2FTMA 4K60A 1OP8A 2CV3A 2HNTE 1F0RA 2B7DH 1ZTJA 1GBDA 2CN0H 3S9BA 5A8ZA 2CF8H 1TNGA