2SGFE

Phe 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recruitment of a Buried K+ Ion to Stabilize the Negative Charge of Ionized P1 in the Hydrophobic Pocket: Crystal Structures of Glu18, Gln18, Asp18 and Asn18 Variants of Turkey Ovomucoid Inhibitor Third Domain Complexed with Streptomyces griseus Protease B at Various pHs
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Streptogrisin B
total genus 48
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 1999-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2sgfE01
1VGCB 2WV4A 4KTSA 1TNLA 8KME2 2FOBA 1KYNA 2H5DA 1GJ8B 3Q3KA 2HPPH 2ANMH 2W26A 3A89A 5C20A 1G3DA 1X7AC 3ZVEA 3K9XB 3A7TA 3Q3YA 2IOTA 1L0ZA 1EOJA 1QJ6B 1UTOA 1LPKB 1GBFA 1AQ7A 1HFDA 2XXLA 1FJSA 1TGBA 4LOYH 4X6PA 1ZPCA 4X2WA 2JETB 5DP8A 3RM2H 4K60A 1YCPK 1ID5H 1PPCE 5DP9A 2F83A 4XBBA 1JWTA 3ATIA 3FZZA 5EPYA 1BIOA 3ELAH 3BIVH 2HNTE 3QTVH 1AN1E 1OWHA 2QXJA 3BN9A 3GY5A 1CVWH 7ESTE 1W8BH 1P2IA 1ZPBA 3A7WA 2HPQH 4J1YA 4A5TS 3TGKE 5B6OA 3EA9A 3RMNH 2Y6TA 1P8VC 5FBEA 5C5NA 3T29A 1T7CA 3SV9A 4NIXA 1BTXA 2BLQA 1O2HA 1GHAG 1KLIH 1ELTA 3HATH 2PW8H 4OS2A 1VJ9U 1DSTA 3GDSA 1GBBA 2OCVB 2V3HH 4NA9H 3TH4H 4B73A 3TK9A 3L33A 3E91A 3ATWA 4ZAEA 5C1XA 2R0KA 2QC2A 4MPUA 2AMQA 2ZFSA 3DHKH 3M5NA 1O2JA 3M3VA 3ZVAA 3UY9A 1F0RA 1EAWA 2STAE 2OC7A 3ZVDA 5JDUB 2ZTYA 5FPSA 3A8AA 3BIUH 1WTGH 1BTUA 2CGAA 4B2AA 1BRBE 1YLDA 2TGTA 3KQEA 1MCTA 1O2LA 3SGBE 3SJ9A 3W95A 1ABIH 1Y8TA 5AF9H 1W12U 1NFXA 1F2SE 4Z6AH 1YPEH 1C2GA 1CGHA 1DY9A 2I6QA 1Y3XA 2ZU4A 1A4WH 1LMWB 3FAOA 1IHSH 2JH5D 1MTNC 1RFNA 1HIAB 1SC8U 1O2XA 1Z8IB 1D3PB 2CHAB 1ZMLA 4DGJA 2FX6A 4AGJA 1C2LA 1SGDE 4UEHH 1PPZA 3RMOH 1O3AA 2VWLA 2BD9A 1NRQH 3BV9B 5C2ZA 5H4IB 4OGXA 2XRCA 2AIQA 1EP5A 4ZKRU 4Y71A 1YPLH 2Q6DA 3S9AA 1BMLA 1HV7A 3RXBA 5K7RA 3SU4A 1GL0E 2YNAA 3RU4E 5A09A 1PPGE 1SGTA 2H5CA 2QF3A 1O2TA 3PM3A 1O5EH 1GHBG 1YF4A 1NRPH 3MMGA 1XUJA 4RSPA 1VJAU 4CRBA 4X8TH 2XWAA 2QXGA 3E16B 3ENSB 2ZKSA 2AMPA 3MH7A 4OS6A 1N8OC 2HGTH 1CSOE 1JIMA 1P01A 1EB1H 2VNTA 3VB3A 5G4BA 2A31A 1K28D 1KXCA 1C5OH 1GJ5H 4LZ4B 1GJ6A 1O2GH 2OTVA 4IMZA 1DUEA 1JIRA 1D9IA 3AAUA 2ANKH 4WXVA 2PKSB 3OSYA 1P02A 1W13U 1C5ZB 2WPIS 3SJ8A 2H2ZA 1EPTC 5DO4H 2OUAA 3TGIE 1TBZH 2ZI2H 3A8CA 1DT2A 1QQUA 2FESH 3MNCA 4Y76A 4FU7A 3T5FH 1XUHA 1QL9A 3SQEE 2AGEX 3PO1B 3B9FH 4B71A 3ZVBA 3RXOA 1A0JA 2XTTB 3MNBA 1O3HA 1MBQA 3HKIB 4CHAC 1H9HE 4MPVA 1A2CH 2GP9B 3P95A 1EZUC 3Q3XA 5BPEA 4BOHA 3FZDA 3SJOA 1F5LA 1AE5A 1D6RA 1FI8A 1EUFA 1O3EA 1G30B 1XX9A 4I8GA 4NA7A 2TBSA 5A0BA 1TYNA 1TGTA 1GHZA 1Y5UT 5EODA 3ZZ5A 1JMOH 1HIAA 4YO9A 1VCPA 3SU1A 5L30H 2XBXA 1UMAH 3UWIA 2ODQA 1O2PA 3GDVA 1W0ZU 5LH8A 4INLA 1ZHRA 3BTFE 2FP7B 2NU2E 1TWXB 1YM0A 3ATKA 3ZYDA 3V12A 4ZROA 1ANCA 2PV9B 4ZMAH 2GTBA 5C1UA 2TIOA 2C3SA 1GI1A 4MNVA 4ABIA 2AMDA 1SOTA 1D3QB 2A2QH 1DWDH 1VCQA 3TNTA 1C5XB 1ZLRA 3A80A 3ITIA 3SNEA 2QV1A 5GXPA 1WQVH 3MWIU 3NKKA 3TJVA 1K21H 1LHCH 2ZA5A 3U8TH 6GCHF 1UTPA 1GCTC 2P8OC 1TBQH 1AZ8A 1P2JA 4DIIH 2IJOB 4AZ2B 5A0AE 2PTCE 2OC1A 3SGQE 3LDXH 1XUIA 1OS8A 1BQYA 1GHYH 1EOLA 2GVFA 1ZGIA 3M7QA 4YLQH 1MD7A 1QHRB 1OXGA 2Z7FE 2ZCHP 1GMDF 2QAAA 2Q6GA 1GI8B 3VEQB 2VIOA 1YKTA 3SUEA 4XBCA 4JK5A 4XBDA 1IQEA 2A2XH 5GDSH 2G8TA 1AUTC 5I25A 1TGSZ 2GV7A 3QGJA 1N8OB 2BDBA 1G2LA 1T32A 4U01A 4TPYA 3EA7A 2WUBA 4MPWA 4MNXA 2BY8X 2C90B 3SJIA 5FAHA 1PQAA 1VGCC 4YM9A 5JBAS 2BDIA 1GWAA 4YOIA 4WF8A 2A5IA 4Y11E 3RXEA 1LVMA 1TBRH 2Z3CA 1BZXE 3KQDA 3ODFA 5C1YA 1RIWC 1CA0B 3LGVA 1DS2E 3OYPA 1AVWA 5DP4A 1GJ7B 5F8ZA 1MBMA 1O36A 3MOCA 4A1VA 1V2OT 2ZFPH 1MAYA 1IQGA 2C8ZB 3S7KB 1PYTC 3BTDE 3RU4T 5LPRA 4FUIA 5TCCA 4UONA 2BB4A 3KL6A 3HGPA 1J17T 1NO9H 1NN6A 4X1SU 1VR1H 2SGEE 1C5LH 1LHEH 3B8JA 1DWBH 5I46H 1YPHE 1A0LA 4KKDA 2GT7A 2OLGA 5TJXA 2JH0D 2VGCB 2ZFRH 4TWWA 3UOPA 5FBIA 4Z0KA 1GJAB 3K6ZA 1DPOA 1CBWB 1FY5A 3MH5A 1TX6A 4IBLH 1HAHH 1BITA 3KGPA 1C4V2 1C2MA 1ZOMA 1CE5A 1JXPA 4K69A 1MKXH 1H4WA 1AMHA 2EI8A 2ZFTA 4ABHA 1GMHF 1BRUP 2FWWA 1P2KA 4NFEA 4YLUA 2B0FA 1IQLA 1XVOA 4R0IA 1SGYE 1WV7H 2J94A 1ETTH 1HDTH 1MAXA 2Q6FA 1AFQB 3HPTB 1MCVA 1LPZB 5E2PA 3LU9B 3FP7E 2ZECA 1QURH 1B0EA 1GBEA 1MUEB 2WPLS 5FX5A 4X0WU 1C1UH 1N1LA 1A46H 1TGCA 2HWLB 1QGFA 2GKVE 2F9PA 1A0HB 1HNEE 1O2MA 1V6DA 2W3IA 4XSKU 3WY8A 2ILNA 1FNIA 1OWJA 1K2I1 2D8WA 3STIA 4FUFA 1O37A 2GV6A 2GDDA 5EPNA 4CRFA 2P93A 5EOKA 1EKBB 1FN6A 1GGDC 1OP2A 1QR3E 3BTME 3GY7A 3BG4C 3DT0H 2VWOA 1C1PA 1TOCB 1O2QA 4OS7A 1C1SA 1GJ9B 4AFQA 2VIQA 1KDQB 4K3JA 2FOAA 1L4ZA 4I8LA 1C1OA 1P11E 1AO5A 1ORFA 1Y5BT 4X1NU 4YT7H 1ELFA 4YTAA 3M7TA 1EX3A 2UWPA 1RTKA 2QF0A 2PWXA 2WV5A 3V13A 1S6HA 2ALVA 2OP9A 1C5PA 1O3OA 1NRSH 3LONA 2JETC 3RXDA 2CV3A 4SGBE 3UIRA 3ESTA 2LPRA 4DVAU 2QYIA 1O5AB 2AEIH 3QK1A 1O5GH 7LPRA 2FX4A 1DUAA 1AI8H 1QB1A 3RXQA 2FYQA 1BHXB 1EJAA 2NWNA 1EPTA 5DP3A 3QTOH 1HAVA 4WY3A 1TRYA 3D62A 3GY8A 1JRSA 3ATLA 2V3OH 4MPXA 4ISLA 3UQOA 4X8VH 4SGAE 3M36A 1L4DA 1DVAH 2AIPA 1GBIA 3FVFB 1MTNB 2FS9A 3PLKA 5CMXH 1TB6H 3BTWE 2ZDMA 3GYMA 2QIQA 3TJOA 1O35A 1D3TB 3ATMA 4ASHA 4RKJB 2ZGJA 2SGQE 1AWFH 3FP6E 3H5CB 3EGKH 4GSOA 6CHAC 2ZEBA 2A5KA 1GHXH 2A1DB 2BY6X 1K1NA 2ZTZA 2SFAA 4AOQA 1O3NA 5HYOA 3JZ1B 3OY6U 4K5ZA 4FVBA 3FFGA 1AD8H 4CBNA 4ZKSU 1P12E 3TK5A 1FPHH 1BHXF 2OC8A 1P06A 5HM2A 5JBBS 1YPMH 2FOHA 1ARBA 1RTLA 4Y8XA 1O3FA 1ZJDA 2D1JA 3P8OA 3VB4A 3MU4A 3AW0A 1K1MA 4YOGA 1T8MA 1ESAA 1C2HA 3M3TA 4Q7YA 2PFEA 3PLBA 1C5MD 1BA8B 1A7SA 3DFJA 1KDQA 2WINI 4F49A 3MHWU 1K9OE 3DUXH 2SGAA 2GX4A 2PSXA 1VZQH 1KXBA 3BEUA 1K1PA 1W2KH 4TYDA 1WYKA 4OS5A 1HGTH 2AGGX 5F8TA 1OWDA 2BVXH 1LDTT 3F9HA 1DXWA 2B5TB 3M5MA 1WUNH 1HAGE 2WUCA 1BTWA 3ZVFA 4CRGA 2UUFB 3E1XB 7GCHG 1WAYB 3MFJA 4HFPB 1SQOA 2ZIQH 4Y8ZA 1O3PB 2OC0A 4I8HA 3Q00A 1Y59T 5BRRE 4H4FA 5EW2H 3SO3A 3SU3A 4KGAA 1ZYOA 1WQSA 4CH2B 1HAOH 1GBTA 3R3GB 1FLEE 4FUGA 4ABEA 3LGIA 1HB0B 5PTPA 3TIUA 1Z7KA 4JYVH 1H9IE 2WYGA 1C5VA 4Y6DA 4HZHA 3E0NB 1ZTLA 4FUJA 1NFWA 1ELAA 1OWIA 2JKHA 3T25A 2BTCE 4RKOB 1CGJE 5EXLA 2BY7X 3SJKA 3MNXA 1YPJH 1S83A 2EI6A 2BMGB 1ELVA 3NPSA 3KN2A 5A8XA 1GHWH 2YNBA 2ZPRA 1GI4A 2G81E 2Y5FA 5C67A 1O3JA 3E8LA 5EQQA 1O5BB 2ZO3H 1ZSKA 1EZSC 1AY6H 2GCTB 2W3KA 1FXYA 1SGFA 1AHTH 1ESBA 1EP6A 1BBRH 1GBHA 2VWMA 1GMHG 1ZZZA 2A7JA 4YOJA 2ZCLP 2G51A 3O8DA 1LVOA 1SLUB 2R3YA 5A0CA 1GMDG 7KMEH 3GY3A 1PQ7A 3V3MA 1LKAA 3FANA 1E0FD 4U2WA 2H9HA 5FPYA 4K1TA 1AWHB 2XC4A 1O3GA 3LJOA 2RA0A 4K1EA 2XW9A 1O38A 4BXWA 1G3BA 1OKXA 3GY6A 1GDQA 2FO9A 4FUEA 2VWNA 2VGCC 1P05A 4Q7ZA 1NTPA 3AW1A 4AN7A 1FY4A 4ZKOU 6CHAB 3VPKA 2ASUB 1G3CA 1TNIA 1YP9A 4CBOA 2XBWA 1KSNA 2AYWA 1O3MA 2IN2A 1O2ZA 3T28A 1SB1H 2H6MA 4CHAB 2GZ8A 3GY2A 2AS9A 1PPFE 2K1QA 2OBQA 5ABWA 3SU6A 1RJXB 3RXUA 1GI9B 1S82A 1ZRBA 2WPKS 1V2QT 1QY6A 4BNRA 5GIBA 1FY3A 2Y5GA 3HGNA 1TOMH 2XC0A 1PPBH 1C5QA 1GVZA 1GI2A 3K2UA 1QQ4A 3M5OA 2UUKB 1S5SA 3SW2B 3LC3A 1RGQA 1W3CA 4HTCH 4X2VA 1FAKH 2PLXA 3E90B 1YGCH 3URDA 1E36B 1AVGH 1YCPH 2G52A 1OWEA 4AG2A 2VINA 4D9QA 1DWCH 2ANYA 1P2OA 1XM1A 3Q76A 5F6MA 1MQ6A 1S81A 1UTMA 1AB9C 2ZDKA 3SGAE 2UWOA 4B74A 2Y80A 1NESE 3UFAA 1O3CA 3NUMA 2EEKA 1IQMA 1FAXA 2KAIA 2A0QB 8GCHG 3K65B 2JH6D 2A32A 1KLTA 5DPAA 1XKBC 3MU5A 5EGMA 1KXDA 1DSUA 5AFZH 1C4U2 2HNTC 2ZHQH 1GMCG 1TFXA 3LGWA 1BJVA 2HNTF 1QRZA 5FPTA 3ZZBA 3M61U 2J92A 3BG8A 1V2VT 1Y3UA 2O8LA 4U30A 1EASA 1GBKA 1GL1A 1Z6EA 4XE4A 6ESTA 2CF9H 4IW4E 2FTMA 3SNAA 3RXKA 3SU2A 2F9VA 1V2LT 2SGDE 2O8WA 1DLKB 3H7OA 4GHQA 1YPGH 2BDGA 1GHBF 2W7UA 3PMBB 4KTUA 3TITA 2F9NA 1CU1A 1E35B 1BTZA 3U9AH 3A83A 5FCKA 4GCHF 2ZHWH 1QRXA 3U98H 1GCDA 3SHCH 2F9UA 1SLXB 1EJNA 3BTGE 1WOFA 8ESTE 1YC0A 3SBKA 2BY9X 1RIWB 2FOCA 4MVNA 5E0GA 2QGRA 4X2YA 1WU1A 3MI4A 4X8SH 1YYY1 2BXTH 1OP8A 1CT0E 1S0RA 2NU0E 4FXGH 3GCHC 3HKJB 4JZFH 4CH8B 1D3DB 4XDEA 4JMYA 3UR9A 2R0LA 1INCA 2A4OA 4ISIH 3F6UH 1SI5H 1GBDA 3N7OA 1KY9A 1O5CB 3SV7A 1ANEA 4AFUA 1HJ8A 1TPSA 4JYTA 1V2TT 4AFZA 1O3KA 3GDUA 3PV4A 4K8YA 1NRNH 1GGDB 5E2OA 1Y3YA 3BTQE 4DW2U 2BZ6H 1P09A 1E34B 3ZZ7A 3A82A 4M7GA 3T2NA 1FN8A 3S9BA 1P9SA 1FDPA 3O8CA 1NFYA 5EQRA 4JZIA 2SNWA 4WH6A 2G4TA 1Z8RA 1QRWA 3SUFA 5J4QA 4NCYA 2QCYA 2AGIX 3MO3A 1V3XA 4CREA 1MQ5A 2J38A 3SNBA 1UTJA 2GMTC 4MNWA 1Z71A 2YOLA 4B2CA 3LGYA 2QXIA 5LPFA 4NG9H 2XNIA 1XKAC 1K22H 5CE1A 2OQUA 2EC9H 1XVMA 3LIWA 1V2MT 4I8JA 1KIGH 2XWBI 3RC6A 2ZPSA 1HAPH 1SGFG 1MMJN 1BBRE 2OBOA 1AFEH 3RU4D 3ZZCA 1IQNA 1HJAC 1W0YH 1AKSB 3B23B 4VGCC 2GZ9A 1F0SA 2O8UA 4NFFA 4JZDH 1SSXA 1THSH 3CP7A 4GUXA 1EZQA 4AYYB 1H8IH 3LT3A 3ODDA 3EE0B 3RMLH 3E6PH 1XXFA 2Z9JA 1WBGB 4DJZB 5J4SA 1PFXC 1GBJA 1FMGA 1E37B 3GOVB 3PYHA 3U1JB 3S69A 4AB9A 1UVOA 1D6WA 2FI3E 2GCHF 2BLOA 5DGJA 1Z1IA 2G5NA 1M9UA 3MYWA 1EAXA 4VGCB 1SMFE 4O97A 1HJ9A 1MZDA 3OX7U 2ESTE 4WWYA 3A7ZA 3GCTF 1YLCA 5DP6A 1C1VH 4DT7B 2BQWB 2ZCKP 1SFIA 1MKWK 2QN5T 1EJMA 1GI0A 2WPMS 2ZFFH 1HBTH 1GBAA 2OQ5A 2ANWA 1SQAA 2FOFA 1JRTA 2CJIA 5F8XA 3P8NA 1C2JA 4AX9H 2XCNA 5GWZA 1Z8GA 2XC5A 3BTEE 4YESB 2TGAA 3CS0A 2Z9LA 1BDAA 2ZGXH 5AVDA 2FOEA 2GT8A 1MU8B 2G5VA 2OINA 1EATA 1GJ4H 3SQHE 3MH4A 1DFPA 3P70B 4MNYA 2BVSH 1MU6B 1C1MA 3P6ZB 1ELEE 2PGBB 5T6GA 4IMQA 1UK2A 2H1UA 1D4PB 1EQ9A 1ZSJA 3M7UA 4O3UA 4A1XA 1DWEH 1SQTA 1HAYB 2R2WU 5A8YA 2BYAX 3A8BA 5EXMA 3CS7A 1F0UA 5E8EH 1TRNA 2TGPZ 1DOJA 2BD2A 1GJCB 4E7RG 3VB6A 1B0FA 2WYJA 1ZTKA 3RXIA 3RXVA 3OU0A 1EPTB 3ZVGA 2QY0B 2VVUA 2BQ7B 4ESTE 2QA9E 1GVLA 1O3LA 2ZGCA 4K1SA 4UFGH 5T6FA 1NFUA 1UO6A 2BHGA 2FS8A 4Y8YA 2BD7A 3SV8A 2J95A 1CT4E 3W94A 5T6DA 1G2MA 5DKMA 8GCHF 1HYLA 1O39A 1LHDH 4O03A 3SORA 2GZ7A 4Y0YE 2G4UA 2FMJA 1TIOA 5E0JA 2Y81A 3LKWA 3O8BA 1ACBE 1AFQC 1O5FH 2BLVA 4WXIA 3AAVA 4D76A 1FIWA 3LPRA 4J2YB 3SOSA 1QJ7B 2RA3A 2Y5HA 4X6OA 2BDYA 1AZZA 3SUGA 4TPIZ 3NK8A 2Z9IA 2R3UA 1MD8A 4BAHB 4KELA 4E06H 4A92A 2IPHA 4X6MA 5CHAC 4DIHH 1EAIA 1FQ3A 3QWCH 2GCTC 4INKA 4AFSA 3GCTG 3P8FA 3UREA 4IN1A 4Y79A 2HALA 2F9OA 1DY8A 3RXTA 1C5TA 2A5AA 3TNSA 4BAKB 3L3TA 3VB7A 3TLOA 1N6YA 2EA3A 3LJJA 4GPGA 2FPZA 4JZ1A 4NWLA 4A6LA 3GISB 1UVUH 3L6PA 3GCOA 2ZU1A 2VU8E 2F3CE 1PQ5A 4K2YA 1MZAA 4IGDA 3RXMA 1CQQA 1V2JT 5EXNA 1QB9A 1RTFB 1SGRE 2PR3A 3GYLB 3S7HB 4HGCA 2ZDVH 3E0PB 2NU1E 1C1QA 3UTUH 2VVVA 4CR9A 1ELGA 1SGPE 4FU9A 4LK4A 2AH4X 1BB0B 1CA0C 2ZHDA 4WVPE 1C5UA 1P9UA 1OX1A 3PB1E 4AGKA 3TJUA 4XOJA 1B7XB 3EAJA 4GLYA 3DD2H 2BD4A 1HXFH 1DLEA 1O32A 2BD3A 2BOKA 1LVYA 1CA8B 1FY8E 4BTTB 1V2WT 3RXFA 2P3TB 2FLBH 3MU1A 3A8DA 1QBNA 2ALPA 4X6NA 4NSVA 4NA8A 1BOQA 4ABAA 3SNDA 2W7SA 2BZAA 2UUYA 3IWMA 1DANH 3TH3H 4NZQA 4BXSA 1TPPA 1A61H 1GVKB 1QFKH 2KAIB 5DG6A 1JBUH 2O8TA 3A88A 1W7XH 3JZ2B 5EG4A 1K1OA 2M5TA 1TMUH 4DCDA 1O2KA 3A7XA 4X1QU 4BANB 2J2UA 3PWBA 1QTFA 4NGAH 3NZIA 1TRMA 4JK6A 3U8OH 3M3SA 1GI5A 4WMEA 2TGDA 4B2BA 1H8DH 2A7CA 3UNRA 1TAWA 1ELCA 3LH3A 1NPMA 1QA7A 1P03A 4ZHMU 1C2IA 1BBRK 2ZU5A 2O8MA 1P04A 2XCFA 5LGOA 1TONA 1C4Y2 3RXLA 1BMAA 4BAQB 1SFQB 4D7GA 1ETRH 1RS0A 4ABGA 5DK1A 1TMBH 1HUTH 1CHOG 2FI4E 1F5KU 1HAIH 3M5LA 4FUCA 1FUJA 1G32B 3P8GA 4DURA 1UTKA 4D7FA 1TALA 2ZQ2A 2F9BH 4LXBH 5EW1H 1ZPZA 1O2VA 3PLPA 5C5OA 1T31A 1P0SH 2XBVA 3A85A 5E0HA 1HAXB 3MU8A 4OGYA 2J34A 3OY5U 3BEIB 3S9CA 4ZXXH 1GMCF 1VITG 1P10A 3RXSA 3MO9A 1SLVB 1HPGA 4TY6A 3DA9B 2ZHEH 1T4UH 2DE8A 4Q2KA 3VGCB 1XUKA 3UWJH 2CN0H 3HK3B 4INHA 2BOHB 3T62A 1VCWA 1IHTH 3URCA 1GJDB 5FCRA 1GI3A 3QN7A 1DE7H 1UCYK 3P92A 3PWCA 5GCHG 4AYVB 4ZHLU 3NWUA 1PJPA 2G55A 3RUOA 1UTNA 4I8KA 3FP8E 2PSYA 3SU0A 2ZU2A 4Q7XA 4IC6A 6GCHG 2CF8H 4MTBA 1ZTJA 5DP5A 1A5HA 4WMFA 3STJA 1CHOF 2A4QA 1O30A 1P2NA 3F9GA 1LTOA 1J16A 5AFYH 3A81A 1MTSA 1Q31A 1LKBA 3ZZ3A 2XBYA 1SR5C 1NM6A 1UJ1A 3C27B 2BXUH 3MU0A 1AIXH 2ZFQH 5K0HA 2ZDLA 5LPEA 1W14U 2I6SA 3MH6A 1BTHH 2CXVA 3RP2A 4MLFB 3SI3H 2FM2A 1ESTA 2Z9GA 1TQ7B 1L2EA 4ISNA 2STBE 3KNXA 1V2ST 1OYTH 4ABDA 2ZC9H 1TA2A 3ZV9A 2NU3E 5HGGA 1SGIB 1O5DH 3AVZA 4UE7H 1FONA 1O3DA 4K8BA 4B1TA 1PQ8A 1C9PA 1SG8B 2DE9A 3LGTA 4ISHH 1FIZA 1LHFH 2TPIZ 1A3BH 1RRKA 3DFLA 1Y3VA 3V7TA 1IAUA 4GVUA 2VVCA 4CR5A 1ZHPA 1QL7A 1S85A 3KF2A 4D9RA 4ISOA 1V2UT 1YPKH 1UK3A 4IN2A 3LGUA 4PROA 3ZV8A 1CT2E 5A2MH 1O2WA 3HK6B 2J9NA 3RMMH 1BTYA 1ANBA 3GICB 1QBVH 5HMAA 4BAMB 1UVSH 2PKAB 4Y10E 3VXEH 3LH1A 5DJ7A 2BDCA 4DOQA 1Y3WA 2GDEH 1P2QA 2C8WB 2BDHA 5GJ4B 4WMDA 4I33A 1PPEE 5C3NA 1GBMA 3UNQA 3TH2H 3T27A 3PTBA 1BRAA 3A7YA 2ZTXA 3IITA 4OS4A 1AE8H 1C2EA 1O34A 3R0FA 1H9LB 3RXJA 1QCPA 1Q3XA 3IG6B 3TU7H 1C5SA 1ZSLA 2R2MB 1UTQA 2FOMB 3K6YA 3SNCA 3UNSA 1B5GH 4BTUB 3BF6H 4X2XA 2BQ6B 4ABFA 4Q80A 3QX5H 4AB8A 2H9TH 4TY7A 1CHGA 1MTUA 1W7GH 2Y7ZA 5HM9A 4B76A 5DP7A 1GHAF 2FXRA 1XXDA 2A4RA 3UUZA 2PKSC 1KXFA 3Q77A 2H9EH 1P3EA 5GPIB 1WSSH 5AHGH 3PMJA 1NU9A 1PYTD 1KTSB 1THPB 3MO6A 2FDAA 1MTVA 1GBCA 1AVXA 3PO1C 2RCEA 1KTTB 3ZZDA 4KTCA 3RLYH 2RDLA 3QDZB 3EDXB 4I31A 1T8LA 5FX6A 1O2SA 1OOKB 1BTPA 3UPEA 1DXPA 1QBOA 3U69H 4NIYA 2VIWA 1HXEH 2ULLA 5T3HA 1ELDE 9LPRA 3BG4B 4D8NA 2NU4E 3F68H 1TPOA 2BD8A 1SHHB 1GCTB 4THNH 1ELBA 2ZG0H 4E05H 1QNJA 1O2OA 3QZRA 1L1JA 1UTLM 1QJ1B 2OXSA 1AKSA 2ZPQA 1GDUA 1S0QA 3P17H 3M35A 1GHVH 3A87A 1C5NH 1GG6C 2ZU3A 3SV6A 1Z8JB 3EA8A 3BTKE 2LNCA 1OPHB 1BRCE 2PTNA 2VJ1A 5HXFA 2V6NA 1QL8A 4I7YH 1G37A 5ETXA 1HRTH 2A45B 1TMTH 4JYUH 1P2MA 1P3CA 3KCGH 2FLRH 4UFEH 5FXLA 1E38B 5JYIA 2G00A 4WJG2 2O9QA 4RN6A 1V2NT 4HI3A 1ARCA 1O0DH 1OSSA 1XMNB 3QUMP 3NCLA 1O2YA 3KQCA 2C93B 4GAWA 2BD5A 1C5RA 2ZZUH 1TGNA 3QZQA 1MKWH 3TGJE 4WH8A 1O2UA 5L6NH 3MNSA 1BJUA 3I29A 3UR6A 1AUJA 3TJNA 1UCYH 4Y0ZE 2WPHS 3BTTE 1O33A 2SNVA 1OYQA 2F91A 1O2IA 4FUHA 4Y7AA 2GGVB 1DDJA 1NC6A 3GY4A 2FYRA 3RC5A 1VITH 5SGAE 1TQ0B 3LOXA 1DITH 1V2PT 9ESTA 4O9VA 2D26C 4CRAA 3PTNA 2PHBA 1IQKA 3M37A 4ZXYH 1CBWC 2BLWA 1HAVB 2VH6A 1AB9B 2Y82A 3SI4H 1C1NA 5JPMH 1UVTH 2FI5E 1J14A 1WCZA 5FHTA 1F5RA 5EQSA 1HLTH 1AGJA 2UUJB 4FVDA 3T26A 3AASA 1P57B 2THFB 5F03A 1FY1A 1LQDB 1IQJA 4DY7B 1NRRH 2Y7XA 1G3EA 2BY5X 2HRVA 3OTJE 2P3FH 1UHBB 1Y5AT 4NWKA 1A3EH 2WPJS 1K1LA 5JBCS 3U1IB 4X8UH 3SZNA 4MG3A 1UK4A 2OD3B 4ABJA 1IOEA 4FUBA 2BDAA 4AORA 1IQHA 1O3BA 1SBWA 4NIVA 1EZXC 2PUXB 3A84A 5TCAA 3A7VA 1ZMNA 4FUDA 2HOBA 4I32A 4UD9H 1F92A 3ZZ8A 2Z9KA 1SGCA 1UHBA 4H6SB 1NU7B 4B75A 3SV2H 2R9PA 1S84A 3D23A 2GMTB 3ZZ4A 3RXPA 1IQFA 2VB0A 4UFDH 3VFEA 3SN8A 2PUQH 1W11U 1A1RA 2SGFE 4H42U 1GG6B 3RC4A 1O31A 1DICA 5L2ZH 2CHAC 3A86A 2P3UB 1ZRKA 2B8OH 3F1SB 4BTIB 1C9TA 4YZUA 2GCHG 1TNKA 3C1KA 2W5EA 1NS3A 1L1GA 3G01A 2P8OB 1OWKA 3VB5A 3F9FA 1V2KT 3QO6A 2Q1JA 1BT7A 1LCYA 1SGQE 2Z3EA 1G9IE 1GBLA 2P59A 3SUDA 2PGQB 1GDNA 2P94A 2CMYA 2ZNKH 4E7NA 1TNGA 2ZGBH 1OP0A 1C5YB 1O2RA 2AFQB 5IYTA 1CO7E 1KXAA 3VGCC 1SVPA 4NSYA 4LZ1H 1T8NA 1W10U 3PMHB 4JCNA 2ZDAH 4KP0A 1TE0A 3NXPA 1RXPA 4GCHG 3RXAA 2FZZA 3UQVA 5ESBA 1K1JA 1O2NA 1EB2A 1YPHC 2C8XB 2J4IA 4YT6H 4ZH8A 4OS1A 3S0NA 1ABJH 1FV9A 4NIWA 2ODYB 1KXEA 5JBTA 1DX5M 1DM4B 3E3TA 2ZHFH 2ZP0H 1C5WB 2P95A 2FEQH 3KHVA 2ZF0H 1A5IA 1JOUB 4CRDA 2Z6BD 1C2KA 4IC5A 1SPJA 1V2RT 1UVPA 1T4VH 3RXHA 4NZLA 1C1WH 3PMAB 1GPZA 4JZEH 2C8YB 3GCNA 1NROH 1J8AA 4ABBA 1BUIA 3U8RH 3BSQA 3TVJB 2FIRH 1ZMJA 3ZZ6A 1C2FA 3F9EA 4ZHAA 5CHAB 4A7IB 2BVRH 1TNHA 4BAOB 4CRCA 3PROA 2Z94A 1A5GH 2A4GA 1TLDA 1XUFA 3I77A 8LPRA 6LPRA 2ZWLH 1GI7B 2ZDNA 3EYDA 3BTHE 4IS5A 1NT1A 3VXFH 1LHGH 4X1PU 1FPCH 1T8OA 1ANDA 1SGNE 1SL3A 3ZYEA 1QB6A 5JB8S 2HVXA 1QA0A 3GCHB 1HJAB 1LO6A 2DUCA 1SLWB 3RXRA 4DG4A 2V0BA 1MH0A 1L1NA 3CENA 2PKAA 1J9CH 1S6FA 1VITF 3BEFB 5GCHF 3UOUA 1H1BA 2TRMA 3ZZAA 3MTYA 1TPAE 4XFQA 3RDZA 1N6XA 2ZGHA 3V0XA 3RXGA 1CGIE 1FZZA 1BMMH 1SHYA 3SHAH 2BM2A 2HLCA 1YBWA 2V35A 1K1IA 4H6TA 4R8TB 4FU8A 2BX4A 3QGNB 1F7ZA 1NY22 2ODPA 3H7TA 2A7HA 2C4FH 3RXCA 2BX3A 2P16A 3TPIZ 4ZKNU 1SOZA 2B7DH 1ZJKA 3D65E 1XUGA 1TA6A 1AU8A 1MTWA 2VIVA 1LPGB 7GCHF 3QLPH 1ZR0A 2FODA 5L2YH 1Z1JA 1SGEE 1MKXK 4MDSA 2VIPA 1F0TA 2QXHA 1THRH 1RD3B 2FOGA 1HAZB 3EQ0H 1BMNH 3KQBA 1TABE 1EAUA 2VIDA 3KEEA 3TK6A 2SGPE 4F4OC 4UDWH 2ZQ1A 3I78A 1ZGVA 1J15A 1GJBB 1TX8A 1GI6A 1LVBA 1NZQH 1Q2WA 1C2DA 2VH0A 1Z6JH 2Z3DA 1TX7A 1LQEA 4MQAA 1BCUH 1KLJH 2RG3A 1G36A 2GD4B 1IQIA 1UCYE 1C1RA 1YCPM 3RLWH 3O8RA 2UWLA 1ZHMA 4TWYA 4QT8C 5ESTE 2D2DA 1EXFA 2B9LA 4UFFH 2EI7A 1C1TA 4X1RU 1QIXB 1U6QA 1ETSH 5IDKA 4O3TA 4ZUHA 5JB9S 4A1TA 3ZVCA 4AG1A 5EU8A 3RM0H 3D49H 4U32A 4GHTA 3LC5A 3SU5A 3KIDU 2AERH 1TNJA 1PPHE 4Y7BA 2FTLE 1O3IA 2XYAA 1WTHD 5A8ZA 3ZZ9A 1HCGA
chains in the Genus database with same CATH superfamily
1VGCB 3F2HA 2WV4A 4KTSA 1YLNA 1TNLA 8KME2 2FOBA 1KYNA 2H5DA 4F55A 1GJ8B 3Q3KA 2HPPH 2ANMH 2W26A 3A89A 5C20A 1G3DA 1X7AC 3ZVEA 3K9XB 3A7TA 3Q3YA 2IOTA 1L0ZA 1EOJA 3WWBA 1QJ6B 1UTOA 1LPKB 1GBFA 1AQ7A 1HFDA 2XXLA 1FJSA 1TGBA 4LOYH 4X6PA 1ZPCA 4X2WA 2JETB 5DP8A 3RM2H 1WXRA 4K60A 1YCPK 1ID5H 1PPCE 5DP9A 2F83A 4XBBA 1JWTA 3ATIA 3FZZA 5EPYA 1BIOA 3ELAH 3BIVH 2HNTE 3QTVH 1AN1E 1OWHA 2QXJA 3BN9A 3GY5A 1CVWH 7ESTE 1W8BH 1P2IA 1ZPBA 3A7WA 2HPQH 4J1YA 4A5TS 3TGKE 5B6OA 3EA9A 3RMNH 2Y6TA 1P8VC 5FBEA 5C5NA 3T29A 1T7CA 3SV9A 4NIXA 1BTXA 5CDFE 2HVYB 2BLQA 1O2HA 1GHAG 1KLIH 1ELTA 3HATH 2PW8H 4OS2A 1VJ9U 1DSTA 3GDSA 1GBBA 2OCVB 2V3HH 4NA9H 3TH4H 4B73A 3TK9A 3L33A 3E91A 3ATWA 3UAIC 2XNDD 4ZAEA 5C1XA 2R0KA 4P00A 2QC2A 4MPUA 2KCPA 3ZIAD 2AMQA 2ZFSA 3DHKH 3M5NA 1O2JA 3M3VA 3ZVAA 3UY9A 1F0RA 1EAWA 2STAE 2OC7A 3ZVDA 5JDUB 1WDIA 2ZTYA 5FPSA 3A8AA 3BIUH 1WTGH 1BTUA 2CGAA 4B2AA 1BRBE 1YLDA 2TGTA 3KQEA 1MCTA 1O2LA 4Q63A 3SGBE 3SJ9A 3W95A 1ABIH 1Y8TA 5AF9H 1W12U 1NFXA 1F2SE 4Z6AH 1YPEH 1C2GA 1CGHA 1DY9A 2I6QA 1Y3XA 2ZU4A 1A4WH 1LMWB 3FAOA 1IHSH 2JH5D 1MTNC 1RFNA 1HIAB 3WW7A 1SC8U 1O2XA 1Z8IB 1D3PB 2CHAB 1ZMLA 4DGJA 2FX6A 4AGJA 1C2LA 1SGDE 4UEHH 1PPZA 3RMOH 4TSFD 1O3AA 2VWLA 2BD9A 1NRQH 3BV9B 5C2ZA 5H4IB 4OGXA 2XRCA 2AIQA 1EP5A 4ZKRU 4Y71A 1YPLH 2Q6DA 3S9AA 1BMLA 1HV7A 3F2FA 3RXBA 5K7RA 3SU4A 1GL0E 2YNAA 3RU4E 5A09A 1PPGE 1SGTA 2H5CA 2JJ2D 2QF3A 1O2TA 3PM3A 1O5EH 1GHBG 1YF4A 1NRPH 3MMGA 1XUJA 4RSPA 1VJAU 4CRBA 4X8TH 2L6OA 2XWAA 2QXGA 3E16B 3ENSB 2ZKSA 2AMPA 3MH7A 4OS6A 1N8OC 2HGTH 1CSOE 1JIMA 1P01A 1EB1H 2VNTA 5C0UA 3VB3A 5G4BA 2A31A 1K28D 1KXCA 1C5OH 1GJ5H 4LZ4B 1GJ6A 1O2GH 2OTVA 4IMZA 1DUEA 1JIRA 1D9IA 3AAUA 2ANKH 4WXVA 2PKSB 3OSYA 1P02A 1W13U 1C5ZB 2WPIS 3SJ8A 2H2ZA 1EPTC 5DO4H 2OUAA 3TGIE 1TBZH 2ZI2H 3A8CA 1DT2A 1QQUA 2FESH 3MNCA 4Y76A 4FU7A 3T5FH 1XUHA 1QL9A 3SQEE 2AGEX 3PO1B 3B9FH 4B71A 3ZVBA 3RXOA 1A0JA 2XTTB 3MNBA 1K0HA 1O3HA 1MBQA 3HKIB 4CHAC 1H9HE 2YMSC 4MPVA 1A2CH 2GP9B 3P95A 1EZUC 3Q3XA 5BPEA 4BOHA 3FZDA 3SJOA 1F5LA 1AE5A 1D6RA 1FI8A 2JJ1D 1EUFA 1O3EA 1G30B 1XX9A 2AHME 4I8GA 4NA7A 2TBSA 5A0BA 1TYNA 1TGTA 1GHZA 1Y5UT 5EODA 3ZZ5A 1JMOH 1HIAA 4YO9A 1VCPA 5GNDA 3SU1A 5L30H 2XBXA 1UMAH 3UWIA 2ODQA 1O2PA 3GDVA 1W0ZU 1YWUA 4INLA 5LH8A 1ZHRA 3BTFE 2FP7B 2NU2E 1TWXB 1YM0A 3ATKA 3ZYDA 3V12A 4ZROA 1ANCA 2PV9B 4ZMAH 1QZ8A 2GTBA 5C1UA 2TIOA 2C3SA 1GI1A 4MNVA 4ABIA 2AMDA 1SOTA 1D3QB 2A2QH 1DWDH 1VCQA 3W1EA 3TNTA 1C5XB 1ZLRA 3A80A 3ITIA 3SNEA 2QV1A 5GXPA 1WQVH 3MWIU 3NKKA 3TJVA 1K21H 1LHCH 3FN8A 2ZA5A 3U8TH 6GCHF 1UTPA 1GCTC 2P8OC 1TBQH 1AZ8A 1P2JA 4DIIH 2IJOB 4AZ2B 5A0AE 2PTCE 2OC1A 3SGQE 3LDXH 1XUIA 1OS8A 1BQYA 1GHYH 1EOLA 2GVFA 1ZGIA 3M7QA 4YLQH 1MD7A 1QHRB 3DSOA 1OXGA 2Z7FE 2ZCHP 1GMDF 2QAAA 2Q6GA 1GI8B 3FOAA 3VEQB 2VIOA 1YKTA 3SUEA 4XBCA 4F48B 4JK5A 4XBDA 1IQEA 4I86A 2A2XH 2IPQX 5GDSH 2G8TA 3F0PA 1AUTC 5I25A 1TGSZ 2GV7A 3QGJA 1N8OB 1E1RD 2BDBA 1G2LA 1T32A 4U01A 4TPYA 3EA7A 2WUBA 4MPWA 4MNXA 2BY8X 2C90B 3SJIA 5FAHA 1PQAA 1VGCC 4YM9A 5JBAS 2BDIA 1GWAA 4YOIA 4WF8A 2A5IA 4Y11E 3RXEA 1LVMA 1TBRH 2Z3CA 1BZXE 3KQDA 3ODFA 5C1YA 1RIWC 3N7DA 1CA0B 3LGVA 1DS2E 3OYPA 1AVWA 5DP4A 4ZCNA 1GJ7B 5F8ZA 1MBMA 1O36A 3MOCA 4A1VA 5T1VA 1V2OT 2ZFPH 1MAYA 1IQGA 2C8ZB 3S7KB 1PYTC 3BTDE 3RU4T 5LPRA 4FUIA 5TCCA 4UONA 4DT4A 2BB4A 3KL6A 3HGPA 1J17T 1NO9H 1NN6A 4X1SU 1VR1H 2SGEE 1C5LH 1LHEH 3B8JA 1DWBH 5I46H 1YPHE 1A0LA 2WHXA 4KKDA 2GT7A 2OLGA 5TJXA 2JH0D 2VGCB 2ZFRH 4TWWA 3UOPA 5FBIA 4Z0KA 1GJAB 3K6ZA 1DPOA 1CBWB 1FY5A 3MH5A 1TX6A 4IBLH 1HAHH 1BITA 3KGPA 1C4V2 1C2MA 1ZOMA 1CE5A 1JXPA 4K69A 1MKXH 1H4WA 1AMHA 2EI8A 2ZFTA 4ABHA 1GMHF 3N7EA 1BRUP 2FWWA 1P2KA 4NFEA 4YLUA 2B0FA 1YY3A 1IQLA 1XVOA 4R0IA 1SGYE 2OK5A 1WV7H 2J94A 1ETTH 1HDTH 1MAXA 2Q6FA 1AFQB 3HPTB 1MCVA 1LPZB 5E2PA 3LU9B 3FP7E 2ZECA 1QURH 1B0EA 1GBEA 1MUEB 2WPLS 5FX5A 4X0WU 1C1UH 1N1LA 1A46H 1TGCA 2HWLB 1QGFA 2GKVE 2F9PA 3MQKC 1A0HB 1HNEE 1O2MA 1V6DA 2W3IA 4XSKU 3WY8A 2ILNA 1FNIA 1OWJA 1S6LA 1K2I1 2D8WA 3STIA 2WV9A 4FUFA 1O37A 2GV6A 2GDDA 5EPNA 4CRFA 2P93A 5EOKA 1EKBB 1FN6A 1GGDC 1OP2A 1QR3E 3BTME 3GY7A 3BG4C 3DT0H 2VWOA 1C1PA 1TOCB 1O2QA 4OS7A 1C1SA 1GJ9B 4AFQA 2VIQA 1KDQB 4K3JA 2FOAA 3NRLA 1L4ZA 4I8LA 1C1OA 1P11E 1AO5A 1ORFA 1Y5BT 5EJLA 4X1NU 4YT7H 1ELFA 4YTAA 3M7TA 1EX3A 2UWPA 1RTKA 4AC9A 2QF0A 2PWXA 2WV5A 3V13A 1MABB 1S6HA 1E1QD 2ALVA 2OP9A 1C5PA 1O3OA 3PV2A 1NRSH 3LONA 2JETC 3RXDA 2CV3A 4SGBE 3UIRA 3ESTA 2LPRA 4DVAU 2QYIA 1O5AB 2AEIH 3QK1A 1O5GH 7LPRA 2FX4A 1DUAA 1AI8H 1QB1A 3RXQA 2FYQA 1BHXB 1EJAA 2NWNA 1EPTA 5DP3A 3QTOH 1HAVA 4WY3A 1TRYA 3D62A 3GY8A 3AK5A 1JRSA 3ATLA 2V3OH 4MPXA 4ISLA 3UQOA 4X8VH 4SGAE 3M36A 1L4DA 1DVAH 2AIPA 2VBCA 1GBIA 3FVFB 1MTNB 2QF5A 2FS9A 3PLKA 3GS9A 5CMXH 1TB6H 3BTWE 2ZDMA 3GYMA 2QIQA 3TJOA 1O35A 1D3TB 3ATMA 4ASHA 4RKJB 2ZGJA 2SGQE 1AWFH 3FP6E 3H5CB 3EGKH 4GSOA 6CHAC 2ZEBA 2A5KA 1GHXH 2A1DB 2BY6X 1K1NA 2ZTZA 2SFAA 4AOQA 1O3NA 5HYOA 3JZ1B 3OY6U 4K5ZA 4FVBA 3FFGA 1AD8H 4CBNA 4ZKSU 1P12E 2KZ4A 3TK5A 1FPHH 1BHXF 5C17A 2OC8A 1P06A 5HM2A 5JBBS 1YPMH 2FOHA 1ARBA 1RTLA 4Y8XA 1O3FA 1ZJDA 2D1JA 3P8OA 3VB4A 3MU4A 3AW0A 1K1MA 4YOGA 1T8MA 1ESAA 1C2HA 3M3TA 4Q7YA 2PFEA 3PLBA 1C5MD 1BA8B 1A7SA 3DFJA 1KDQA 2WINI 4F49A 3MHWU 1K9OE 3DUXH 2SGAA 2GX4A 2PSXA 1VZQH 1KXBA 3BEUA 1K1PA 1W2KH 4TYDA 1WYKA 4OS5A 1HGTH 3PRDA 2AGGX 5F8TA 1OWDA 2BVXH 1LDTT 3F9HA 1DXWA 2B5TB 3M5MA 1WUNH 1HAGE 2WUCA 1BTWA 3ZVFA 4CRGA 2UUFB 3E1XB 2EQNA 7GCHG 1WAYB 3MFJA 4HFPB 1SQOA 2ZIQH 4Y8ZA 1O3PB 2OC0A 4I8HA 3Q00A 1Y59T 2HLDD 4H4FA 3DSGA 5BRRE 5IK2D 5EW2H 3SO3A 3SU3A 4KGAA 1ZYOA 1WQSA 4CH2B 1HAOH 1GBTA 3R3GB 1FLEE 4FUGA 4ABEA 3LGIA 1HB0B 5PTPA 3TIUA 1Z7KA 4JYVH 1H9IE 2WYGA 1C5VA 4Y6DA 1FX0B 4HZHA 3E0NB 1ZTLA 3H09A 3U28C 4FUJA 1NFWA 1ELAA 1OWIA 2JKHA 3T25A 2BTCE 4RKOB 1CGJE 5EXLA 2BY7X 3SJKA 3MNXA 1YPJH 1S83A 2EI6A 2BMGB 1ELVA 3NPSA 3KN2A 5A8XA 1GHWH 2YNBA 2ZPRA 1GI4A 2G81E 2Y5FA 5C67A 1O3JA 3E8LA 5EQQA 1O5BB 2ZO3H 1ZSKA 1EZSC 1AY6H 2GCTB 2W3KA 1FXYA 1SGFA 1AHTH 1ESBA 1EP6A 1BBRH 4ACAA 1GBHA 2VWMA 1GMHG 1ZZZA 2A7JA 4YOJA 2ZCLP 2G51A 3O8DA 1LVOA 1SLUB 1SKYE 2R3YA 5A0CA 1GMDG 7KMEH 3GY3A 1PQ7A 3V3MA 1LKAA 3FANA 1E0FD 4U2WA 2H9HA 5FPYA 4K1TA 1AWHB 2XC4A 1O3GA 3LJOA 2RA0A 4K1EA 2XW9A 1O38A 4BXWA 1G3BA 1OKXA 3GY6A 1GDQA 2FO9A 4FUEA 2VWNA 2VGCC 4B6FA 1P05A 4Q7ZA 1NTPA 3AW1A 4AN7A 1COWD 1FY4A 4ZKOU 6CHAB 3VPKA 2ASUB 1G3CA 1TNIA 1YP9A 4CBOA 2XBWA 1KSNA 2AYWA 1O3MA 2IN2A 1O2ZA 3T28A 1SB1H 2H6MA 4CHAB 2GZ8A 3GY2A 2AS9A 1PPFE 2K1QA 2OBQA 5ABWA 3SU6A 1RJXB 3RXUA 1GI9B 1S82A 1ZRBA 2WPKS 1V2QT 1QY6A 4BNRA 5GIBA 1FY3A 1H8ED 2Y5GA 3HGNA 5KGOA 1TOMH 2XC0A 1PPBH 1C5QA 1GVZA 1GI2A 3K2UA 1QQ4A 3M5OA 2UUKB 1S5SA 3SW2B 3LC3A 1RGQA 5F53A 1W3CA 4HTCH 4X2VA 1FAKH 2PLXA 3E90B 1YGCH 3URDA 1E36B 1AVGH 1YCPH 2G52A 1OWEA 4OM9A 4AG2A 2VINA 4D9QA 1DWCH 2ANYA 1P2OA 1XM1A 3Q76A 5F6MA 2CK3D 1MQ6A 1S81A 1UTMA 1AB9C 2ZDKA 3SGAE 2UWOA 4B74A 2Y80A 1NESE 2YMSD 3UFAA 1O3CA 3NUMA 2EEKA 1IQMA 1FAXA 2KAIA 3VG8A 2A0QB 8GCHG 3K65B 2JH6D 2A32A 1KLTA 2WZQA 5DPAA 1XKBC 3MU5A 2KCAA 5EGMA 1KXDA 1DSUA 5AFZH 1C4U2 2HNTC 2ZHQH 1GMCG 1TFXA 3LGWA 1BJVA 2HNTF 3OEHD 1QRZA 5FPTA 3ZZBA 3M61U 2J92A 3BG8A 4YXWD 1V2VT 1Y3UA 2O8LA 4U30A 1EASA 1GBKA 1GL1A 1Z6EA 4XE4A 6ESTA 2CF9H 4IW4E 2FTMA 3SNAA 3RXKA 3SU2A 2F9VA 1V2LT 2SGDE 2O8WA 1DLKB 3H7OA 4GHQA 1YPGH 2BDGA 1GHBF 2W7UA 3PMBB 4KTUA 3TITA 2F9NA 5C94A 1CU1A 1E35B 1BTZA 3U9AH 3A83A 5FCKA 3EE7A 4GCHF 2ZHWH 1QRXA 3U98H 1GCDA 3SHCH 2F9UA 1SLXB 1EJNA 3BTGE 1WOFA 8ESTE 1YC0A 3SBKA 2BY9X 5DN6D 1RIWB 2KX4A 2FOCA 4MVNA 5E0GA 2QGRA 4X2YA 1WU1A 3MI4A 4X8SH 1YYY1 2BXTH 1OP8A 1CT0E 1S0RA 2NU0E 4FXGH 3GCHC 3HKJB 4JZFH 4CH8B 1D3DB 4XDEA 4JMYA 3UR9A 2R0LA 3FKSD 1INCA 2A4OA 4ISIH 3F6UH 1SI5H 1GBDA 3N7OA 1KY9A 1O5CB 3SV7A 1ANEA 4AFUA 1HJ8A 1TPSA 4JYTA 1V2TT 4AFZA 5CHBA 1O3KA 3GDUA 3PV4A 4K8YA 1NRNH 1GGDB 5E2OA 1Y3YA 3BTQE 4DW2U 2BZ6H 1P09A 1E34B 3ZZ7A 3A82A 4M7GA 3T2NA 1FN8A 3S9BA 1P9SA 2K0QA 1FDPA 3O8CA 1NFYA 5EQRA 4JZIA 2SNWA 4WH6A 2G4TA 1Z8RA 1QRWA 3SUFA 5J4QA 4NCYA 2QCYA 2AGIX 3MO3A 1V3XA 4CREA 1MQ5A 2J38A 3SNBA 1UTJA 2GMTC 4MNWA 1Z71A 2YOLA 4B2CA 3LGYA 2QXIA 5LPFA 4NG9H 2XNIA 1XKAC 1K22H 5CE1A 2OQUA 2EC9H 1XVMA 3LIWA 1V2MT 4I8JA 1KIGH 2XWBI 3RC6A 2ZPSA 1HAPH 1SGFG 1MMJN 1BBRE 2OBOA 1AFEH 3RU4D 3ZZCA 1IQNA 1HJAC 1W0YH 1AKSB 3B23B 4VGCC 2GZ9A 1F0SA 2O8UA 4NFFA 4JZDH 3PV5A 1SSXA 1THSH 3CP7A 4GUXA 1EZQA 4AYYB 1H8IH 2KCOA 2V7QD 3LT3A 3ODDA 3EE0B 3RMLH 3E6PH 1XXFA 2Z9JA 1WBGB 4DJZB 5J4SA 1PFXC 1GBJA 5B6LA 1FMGA 1E37B 1NBME 3GOVB 3PYHA 3U1JB 3S69A 4AB9A 1UVOA 1D6WA 1OHHD 2F4LA 2FI3E 2GCHF 2BLOA 5DGJA 1Z1IA 2G5NA 5DSFA 1M9UA 3MYWA 1EAXA 4VGCB 1SMFE 4O97A 1HJ9A 1MZDA 3OX7U 2ESTE 4WWYA 3A7ZA 3GCTF 1YLCA 5DP6A 1C1VH 4DT7B 2BQWB 2ZCKP 1SFIA 1MKWK 2QN5T 1EJMA 1GI0A 2WPMS 2ZFFH 1HBTH 1GBAA 2OQ5A 2ANWA 1SQAA 2FOFA 1JRTA 2CJIA 5F8XA 3P8NA 1C2JA 4AX9H 2XCNA 5GWZA 1Z8GA 2XC5A 3BTEE 4YESB 2TGAA 3CS0A 2Z9LA 1BDAA 2ZGXH 5AVDA 2FOEA 2GT8A 1MU8B 2GJGA 2G5VA 2OINA 1EATA 1GJ4H 3SQHE 3MH4A 1DFPA 3P70B 4MNYA 2BVSH 1MU6B 1C1MA 3P6ZB 1ELEE 2PGBB 5T6GA 4IMQA 1UK2A 2H1UA 1D4PB 1EQ9A 1ZSJA 3M7UA 4O3UA 4A1XA 1DWEH 1SQTA 1HAYB 2R2WU 5A8YA 2BYAX 3A8BA 5EXMA 3CS7A 1F0UA 5E8EH 1TRNA 2TGPZ 1DOJA 2BD2A 1GJCB 4E7RG 3VB6A 1B0FA 2WYJA 1ZTKA 3RXIA 3RXVA 3OU0A 1EPTB 3ZVGA 2QY0B 2VVUA 2BQ7B 4ESTE 2QA9E 1GVLA 1O3LA 2ZGCA 4K1SA 4UFGH 5T6FA 1NFUA 4ASUD 1UO6A 2BHGA 2FS8A 2WPDD 4Y8YA 2BD7A 3SV8A 2RDEA 2J95A 1CT4E 3W94A 5T6DA 1G2MA 5DKMA 8GCHF 1HYLA 1O39A 1LHDH 4O03A 3SORA 2GZ7A 4Y0YE 2G4UA 2FMJA 1TIOA 5E0JA 2Y81A 3LKWA 3O8BA 1ACBE 1AFQC 1O5FH 2BLVA 4WXIA 3AAVA 4FOUC 4D76A 1FIWA 3LPRA 4J2YB 3CNRA 3SOSA 1QJ7B 3OFND 2RA3A 2Y5HA 5HIZA 4X6OA 2BDYA 1AZZA 3SUGA 4TPIZ 3NK8A 2Z9IA 2R3UA 2V3MA 4RT1A 1MD8A 4BAHB 4KELA 4E06H 4A92A 2IPHA 4X6MA 5CHAC 4DIHH 1EAIA 1FQ3A 3QWCH 2GCTC 4INKA 4AFSA 3GCTG 3P8FA 3UREA 4IN1A 2W6JD 4Y79A 2HALA 2F9OA 1DY8A 3RXTA 1C5TA 2A5AA 3TNSA 4BAKB 3L3TA 4RT0A 3VB7A 3TLOA 1N6YA 2EA3A 3LJJA 4GPGA 2FPZA 4JZ1A 4NWLA 4A6LA 3GISB 3SYJA 1UVUH 3L6PA 3GCOA 2ZU1A 2VU8E 2F3CE 1PQ5A 4K2YA 1MZAA 4IGDA 3RXMA 1CQQA 1V2JT 5EXNA 1QB9A 1RTFB 1SGRE 2PR3A 3GYLB 3S7HB 4HGCA 2ZDVH 3E0PB 2NU1E 1C1QA 3UTUH 2VVVA 4TT3D 4CR9A 1ELGA 1SGPE 4FU9A 4LK4A 2AH4X 1BB0B 1CA0C 2ZHDA 4WVPE 1C5UA 1P9UA 1OX1A 3PB1E 4AGKA 3TJUA 4XOJA 1B7XB 2L74A 3SZEA 2KCYA 3EAJA 4GLYA 3DD2H 2BD4A 1HXFH 1DLEA 1O32A 2BD3A 2BOKA 1LVYA 1CA8B 1FY8E 4BTTB 1V2WT 3RXFA 2P3TB 2FLBH 3MU1A 3A8DA 1QBNA 2ALPA 4X6NA 4NSVA 4NA8A 1BOQA 4ABAA 3SNDA 2W7SA 2BZAA 2UUYA 4XD7D 3IWMA 1DANH 3TH3H 4NZQA 4BXSA 1TPPA 1A61H 1GVKB 1QFKH 2KAIB 2XOKD 5DG6A 1JBUH 2O8TA 3A88A 1W7XH 3JZ2B 5EG4A 1K1OA 2M5TA 1TMUH 4DCDA 1O2KA 3A7XA 4X1QU 2LP6A 4BANB 2J2UA 3PWBA 1QTFA 4NGAH 3NZIA 1TRMA 4JK6A 3U8OH 3M3SA 1GI5A 4WMEA 2TGDA 4B2BA 1H8DH 2A7CA 1EFRD 1TAWA 3UNRA 1ELCA 3LH3A 1NPMA 1QA7A 1P03A 4ZHMU 1C2IA 1BBRK 2ZU5A 2O8MA 1P04A 5KECA 2XCFA 5LGOA 5FL7D 1TONA 1C4Y2 3RXLA 1BMAA 4BAQB 1SFQB 4D7GA 1ETRH 1RS0A 4ABGA 5DK1A 1TMBH 1HUTH 1CHOG 2FI4E 1F5KU 1HAIH 3M5LA 4FUCA 3OAAD 1FUJA 1G32B 3P8GA 4DURA 1UTKA 4D7FA 3F2GA 1TALA 2ZQ2A 2F9BH 4LXBH 5EW1H 1ZPZA 1O2VA 3PLPA 5C5OA 1T31A 1P0SH 5C0TA 2XBVA 3A85A 5E0HA 1HAXB 3MU8A 4OGYA 2J34A 3OY5U 3BEIB 3S9CA 4ZXXH 1GMCF 1VITG 1P10A 3RXSA 3MO9A 1SLVB 1HPGA 4TY6A 3DA9B 2ZHEH 1T4UH 2DE8A 4Q2KA 1W0JD 3VGCB 1XUKA 3UWJH 2CN0H 3HK3B 4INHA 2BOHB 3T62A 1VCWA 1IHTH 3URCA 1GJDB 5FCRA 1GI3A 3QN7A 1DE7H 1UCYK 3P92A 3PWCA 5GCHG 4AYVB 4ZHLU 3NWUA 1PJPA 2G55A 3RUOA 1UTNA 4I8KA 3FP8E 2PSYA 3SU0A 2ZU2A 4Q7XA 4IC6A 6GCHG 2CF8H 4MTBA 1ZTJA 3PRBA 5DP5A 1A5HA 4WMFA 3STJA 1CHOF 2A4QA 1O30A 1P2NA 4FETA 3F9GA 1LTOA 1J16A 5AFYH 3A81A 1MTSA 1Q31A 1LKBA 3ZZ3A 2XBYA 1SR5C 1NM6A 1UJ1A 3C27B 2BXUH 3MU0A 1AIXH 2ZFQH 5K0HA 2ZDLA 5LPEA 1W14U 2I6SA 3MH6A 1BTHH 2CXVA 3RP2A 4MLFB 3SI3H 1SQRA 2FM2A 1ESTA 2Z9GA 1TQ7B 1L2EA 4ISNA 2STBE 3KNXA 1V2ST 1OYTH 4ABDA 2ZC9H 1TA2A 3ZV9A 2NU3E 5HGGA 1SGIB 1O5DH 3WWFA 3DSPA 3AVZA 4UE7H 1FONA 1O3DA 4K8BA 1NBMD 4B1TA 1PQ8A 1C9PA 1SG8B 2DE9A 3LGTA 4ISHH 1FIZA 1LHFH 2TPIZ 1A3BH 1RRKA 3DFLA 1Y3VA 2WSSD 1IAUA 4GVUA 3V7TA 2VVCA 4CR5A 1ZHPA 1QL7A 1S85A 3KF2A 4D9RA 4ISOA 1V2UT 1YPKH 1UK3A 4IN2A 3LGUA 4PROA 3ZV8A 1CT2E 5A2MH 1O2WA 3HK6B 2J9NA 3RMMH 1BTYA 3DCLA 1ANBA 2JDID 1QBVH 3GICB 5HMAA 4BAMB 1UVSH 2PKAB 4Y10E 3VXEH 3LH1A 5DJ7A 2BDCA 4DOQA 1Y3WA 1VKYA 2GDEH 1P2QA 2C8WB 2BDHA 5GJ4B 4WMDA 4I33A 1PPEE 5C3NA 1GBMA 3UNQA 3TH2H 3T27A 3PTBA 1BRAA 3A7YA 2ZTXA 3IITA 4OS4A 1AE8H 1C2EA 1O34A 3R0FA 1H9LB 3RXJA 1QCPA 1Q3XA 3IG6B 3TU7H 1C5SA 1ZSLA 2R2MB 1UTQA 2FOMB 3K6YA 3SNCA 3UNSA 1B5GH 4BTUB 3BF6H 2RFKC 4X2XA 2BQ6B 4ABFA 4Q80A 3QX5H 4AB8A 2H9TH 4TY7A 1CHGA 1MTUA 1W7GH 2Y7ZA 5HM9A 4B76A 5DP7A 2QF4A 1GHAF 2FXRA 1XXDA 2A4RA 3UUZA 2PKSC 1KXFA 3Q77A 2H9EH 1P3EA 5GPIB 1WSSH 5AHGH 3N99A 3PMJA 1NU9A 1PYTD 1KTSB 1THPB 3MO6A 2FDAA 4ACBA 1MTVA 1GBCA 1AVXA 3PO1C 2RCEA 1KTTB 3ZZDA 4KTCA 3RLYH 2RDLA 3QDZB 2F43B 3EDXB 4I31A 1T8LA 5FX6A 1O2SA 1OOKB 1BTPA 3UPEA 1DXPA 1QBOA 3U69H 4NIYA 2VIWA 1HXEH 2QE7D 2ULLA 5T3HA 1ELDE 9LPRA 3BG4B 4D8NA 2NU4E 3F68H 1TPOA 2BD8A 2M2AA 1SHHB 1GCTB 4THNH 1ELBA 2ZG0H 5EJ1A 4E05H 1QNJA 1O2OA 3QZRA 1L1JA 1UTLM 1QJ1B 1W0KD 2OXSA 1AKSA 2ZPQA 1GDUA 1S0QA 3P17H 3M35A 1GHVH 2PP6A 3A87A 4Z1MD 1C5NH 1GG6C 2ZU3A 3SV6A 1Z8JB 3EA8A 3BTKE 2LNCA 1OPHB 1BRCE 2PTNA 2VJ1A 5HXFA 2V6NA 1QL8A 4I7YH 1G37A 5ETXA 1HRTH 2A45B 1TMTH 4JYUH 1P2MA 1P3CA 3KCGH 2FLRH 4UFEH 5FXLA 1E38B 2JIZD 5JYIA 2G00A 4WJG2 2O9QA 4RN6A 1V2NT 4HI3A 1ARCA 1O0DH 1OSSA 1XMNB 3QUMP 3NCLA 1O2YA 3KQCA 2C93B 4GAWA 2BD5A 1C5RA 2ZZUH 1TGNA 3QZQA 1MKWH 3TGJE 4WH8A 1O2UA 5L6NH 3MNSA 1BJUA 3I29A 3UR6A 1AUJA 3TJNA 1UCYH 4Y0ZE 5EJZA 2WPHS 3BTTE 1O33A 2SNVA 1OYQA 2F91A 1O2IA 4FUHA 4Y7AA 2GGVB 1DDJA 1NC6A 3GY4A 2FYRA 3RC5A 1VITH 5SGAE 1TQ0B 3LOXA 2KM0A 1DITH 1V2PT 9ESTA 4O9VA 2D26C 4CRAA 3FO8D 3PTNA 2PHBA 1IQKA 3M37A 4ZXYH 5HKKD 1CBWC 2BLWA 1HAVB 3KQ5A 2VH6A 1AB9B 2Y82A 2K8IA 3SI4H 4P02A 1C1NA 5JPMH 1UVTH 2FI5E 1J14A 1WCZA 5FHTA 1F5RA 3OEED 3UB0A 5EQSA 1HLTH 1AGJA 3OE7D 2UUJB 4FVDA 3T26A 3AASA 1P57B 2THFB 5F03A 1FY1A 1LQDB 1IQJA 4DY7B 1NRRH 2Y7XA 1G3EA 2BY5X 2HRVA 3OTJE 2P3FH 1UHBB 1Y5AT 4NWKA 1A3EH 2WPJS 1K1LA 5JBCS 3U1IB 4X8UH 3SZNA 4MG3A 1UK4A 2OD3B 4ABJA 1IOEA 4FUBA 2BDAA 4AORA 1IQHA 1O3BA 1SBWA 4NIVA 1EZXC 2PUXB 3A84A 5TCAA 3A7VA 1ZMNA 3KYFA 4FUDA 2HOBA 4I32A 4UD9H 1F92A 3ZZ8A 2Z9KA 1SGCA 1UHBA 4H6SB 1NU7B 2KR7A 4B75A 3SV2H 2R9PA 2J5UA 1S84A 3D23A 2GMTB 3ZZ4A 3RXPA 1IQFA 2VB0A 4UFDH 3VFEA 3SN8A 2PUQH 1W11U 1A1RA 2J98B 2SGFE 4H42U 1GG6B 3RC4A 1O31A 1DICA 5L2ZH 2CHAC 2EY4C 3A86A 2P3UB 1ZRKA 2B8OH 3F1SB 4BTIB 1C9TA 4YZUA 2GCHG 1TNKA 3C1KA 2W5EA 1NS3A 3F3BA 1L1GA 4XRNA 4M9FA 3G01A 4RI0A 2P8OB 1OWKA 3VB5A 3F9FA 1V2KT 3QO6A 2Q1JA 1BT7A 1LCYA 2LELA 1SGQE 2Z3EA 1G9IE 1GBLA 2P59A 3SUDA 2PGQB 1GDNA 2P94A 2CMYA 2ZNKH 4E7NA 1TNGA 2ZGBH 1OP0A 1C5YB 1O2RA 2AFQB 5IYTA 1CO7E 1KXAA 3VGCC 1SVPA 4NSYA 4LZ1H 1T8NA 1W10U 3PMHB 4JCNA 2ZDAH 4KP0A 1TE0A 3NXPA 1RXPA 4GCHG 3RXAA 2FZZA 3UQVA 5ESBA 1K1JA 1O2NA 1EB2A 1YPHC 2C8XB 2J4IA 4YT6H 4ZH8A 4OS1A 3S0NA 1ABJH 1FV9A 4NIWA 2ODYB 1KXEA 5JBTA 3F0OA 1DX5M 1DM4B 3E3TA 2ZHFH 2ZP0H 1C5WB 2P95A 2FEQH 3KHVA 2ZF0H 1A5IA 1JOUB 2YMSB 4CRDA 4B6EA 2Z6BD 1C2KA 4IC5A 1SPJA 1V2RT 3OTPA 1UVPA 1T4VH 3RXHA 4NZLA 1C1WH 3PMAB 1GPZA 4JZEH 2C8YB 3GCNA 1NROH 1J8AA 4ABBA 4HG6A 5HIYA 1BUIA 3U8RH 3BSQA 3TVJB 2FIRH 1ZMJA 3ZZ6A 1C2FA 3F9EA 4ZHAA 5CHAB 4A7IB 2BVRH 1TNHA 2W6ID 4BAOB 4CRCA 3PROA 2Z94A 1A5GH 2A4GA 1TLDA 1XUFA 3I77A 8LPRA 2KFWA 6LPRA 2J98A 2ZWLH 1GI7B 2ZDNA 3EYDA 3BTHE 4IS5A 1NT1A 3VXFH 1LHGH 4X1PU 1FPCH 1T8OA 1ANDA 1SGNE 1SL3A 3ZYEA 1QB6A 5JB8S 2HVXA 1QA0A 3GCHB 1HJAB 1LO6A 2DUCA 1SLWB 3RXRA 4DG4A 2V0BA 1MH0A 1L1NA 3CENA 2PKAA 1J9CH 1S6FA 1VITF 3BEFB 5GCHF 3UOUA 1H1BA 2TRMA 3ZZAA 3MTYA 1TPAE 1H8HD 4XFQA 1E79D 1UW7A 3RDZA 1N6XA 2ZGHA 3V0XA 3RXGA 1CGIE 2J97A 1FZZA 1BMMH 1SHYA 3SHAH 2BM2A 2HLCA 1YBWA 2IJD1 2V35A 1K1IA 4H6TA 4R8TB 4FU8A 2BX4A 3QGNB 1F7ZA 1NY22 2ODPA 3H7TA 2A7HA 2C4FH 3RXCA 2BX3A 2P16A 3TPIZ 4ZKNU 1SOZA 2B7DH 1ZJKA 1BMFD 3D65E 1XUGA 1TA6A 1AU8A 1MTWA 2VIVA 1LPGB 7GCHF 3QLPH 1ZR0A 2FODA 5L2YH 3KYGA 1Z1JA 1SGEE 1MKXK 4MDSA 2VIPA 4Q4LA 1F0TA 2QXHA 1THRH 1RD3B 2FOGA 1HAZB 1KMHB 3EQ0H 1BMNH 3KQBA 1TABE 1EAUA 2VIDA 3KEEA 3TK6A 2SGPE 4F4OC 4UDWH 2ZQ1A 3I78A 1ZGVA 1J15A 1GJBB 1TX8A 1GI6A 1LVBA 1NZQH 1Q2WA 1C2DA 2VH0A 1Z6JH 2Z3DA 1TX7A 1LQEA 4MQAA 1BCUH 1KLJH 2RG3A 1G36A 2GD4B 1IQIA 1UCYE 1C1RA 1YCPM 3RLWH 3O8RA 2UWLA 1ZHMA 4TWYA 4QT8C 5ESTE 2D2DA 1EXFA 2B9LA 4UFFH 2EI7A 1C1TA 4X1RU 1QIXB 1U6QA 1ETSH 5IDKA 4O3TA 4ZUHA 5EIYA 5JB9S 4A1TA 3ZVCA 5KEDA 4AG1A 5EU8A 3RM0H 3D49H 4U32A 4GHTA 3LC5A 3SU5A 3KIDU 2AERH 1TNJA 1PPHE 4Y7BA 2FTLE 1O3IA 2XYAA 1WTHD 5A8ZA 3ZZ9A 1HCGA
chains in the Genus database with same CATH topology
1VGCB 2WV4A 4KTSA 1TNLA 8KME2 2FOBA 1KYNA 2H5DA 1GJ8B 3Q3KA 2HPPH 2ANMH 2W26A 3A89A 5C20A 1G3DA 1X7AC 3ZVEA 3K9XB 3A7TA 3Q3YA 2IOTA 1L0ZA 1EOJA 1QJ6B 1UTOA 1LPKB 1GBFA 1AQ7A 1HFDA 2XXLA 1FJSA 1TGBA 4LOYH 4X6PA 1ZPCA 4X2WA 2JETB 5DP8A 3RM2H 4K60A 1YCPK 1ID5H 1PPCE 5DP9A 2F83A 4XBBA 1JWTA 3ATIA 3FZZA 5EPYA 1BIOA 3ELAH 3BIVH 2HNTE 3QTVH 1AN1E 1OWHA 2QXJA 3BN9A 3GY5A 1CVWH 7ESTE 1W8BH 1P2IA 1ZPBA 3A7WA 2HPQH 4J1YA 4A5TS 3TGKE 5B6OA 3EA9A 3RMNH 2Y6TA 1P8VC 5FBEA 5C5NA 3T29A 1T7CA 3SV9A 4NIXA 1BTXA 2BLQA 1O2HA 1GHAG 1KLIH 1ELTA 3HATH 2PW8H 4OS2A 1VJ9U 1DSTA 3GDSA 1GBBA 2OCVB 2V3HH 4NA9H 3TH4H 4B73A 3TK9A 3L33A 3E91A 3ATWA 4ZAEA 5C1XA 2R0KA 2QC2A 4MPUA 2AMQA 2ZFSA 3DHKH 3M5NA 1O2JA 3M3VA 3ZVAA 3UY9A 1F0RA 1EAWA 2STAE 2OC7A 3ZVDA 5JDUB 2ZTYA 5FPSA 3A8AA 3BIUH 1WTGH 1BTUA 2CGAA 4B2AA 1BRBE 1YLDA 2TGTA 3KQEA 1MCTA 1O2LA 3SGBE 3SJ9A 3W95A 1ABIH 1Y8TA 5AF9H 1W12U 1NFXA 1F2SE 4Z6AH 1YPEH 1C2GA 1CGHA 1DY9A 2I6QA 1Y3XA 2ZU4A 1A4WH 1LMWB 3FAOA 1IHSH 2JH5D 1MTNC 1RFNA 1HIAB 1SC8U 1O2XA 1Z8IB 1D3PB 2CHAB 1ZMLA 4DGJA 2FX6A 4AGJA 1C2LA 1SGDE 4UEHH 1PPZA 3RMOH 1O3AA 2VWLA 2BD9A 1NRQH 3BV9B 5C2ZA 5H4IB 4OGXA 2XRCA 2AIQA 1EP5A 4ZKRU 4Y71A 1YPLH 2Q6DA 3S9AA 1BMLA 1HV7A 3RXBA 5K7RA 3SU4A 1GL0E 2YNAA 3RU4E 5A09A 1PPGE 1SGTA 2H5CA 2QF3A 1O2TA 3PM3A 1O5EH 1GHBG 1YF4A 1NRPH 3MMGA 1XUJA 4RSPA 1VJAU 4CRBA 4X8TH 2XWAA 2QXGA 3E16B 3ENSB 2ZKSA 2AMPA 3MH7A 4OS6A 1N8OC 2HGTH 1CSOE 1JIMA 1P01A 1EB1H 2VNTA 3VB3A 5G4BA 2A31A 1K28D 1KXCA 1C5OH 1GJ5H 4LZ4B 1GJ6A 1O2GH 2OTVA 4IMZA 1DUEA 1JIRA 1D9IA 3AAUA 2ANKH 4WXVA 2PKSB 3OSYA 1P02A 1W13U 1C5ZB 2WPIS 3SJ8A 2H2ZA 1EPTC 5DO4H 2OUAA 3TGIE 1TBZH 2ZI2H 3A8CA 1DT2A 1QQUA 2FESH 3MNCA 4Y76A 4FU7A 3T5FH 1XUHA 1QL9A 3SQEE 2AGEX 3PO1B 3B9FH 4B71A 3ZVBA 3RXOA 1A0JA 2XTTB 3MNBA 1O3HA 1MBQA 3HKIB 4CHAC 1H9HE 4MPVA 1A2CH 2GP9B 3P95A 1EZUC 3Q3XA 5BPEA 4BOHA 3FZDA 3SJOA 1F5LA 1AE5A 1D6RA 1FI8A 1EUFA 1O3EA 1G30B 1XX9A 4I8GA 4NA7A 2TBSA 5A0BA 1TYNA 1TGTA 1GHZA 1Y5UT 5EODA 3ZZ5A 1JMOH 1HIAA 4YO9A 1VCPA 3SU1A 5L30H 2XBXA 1UMAH 3UWIA 2ODQA 1O2PA 3GDVA 1W0ZU 5LH8A 4INLA 1ZHRA 3BTFE 2FP7B 2NU2E 1TWXB 1YM0A 3ATKA 3ZYDA 3V12A 4ZROA 1ANCA 2PV9B 4ZMAH 2GTBA 5C1UA 2TIOA 2C3SA 1GI1A 4MNVA 4ABIA 2AMDA 1SOTA 1D3QB 2A2QH 1DWDH 1VCQA 3TNTA 1C5XB 1ZLRA 3A80A 3ITIA 3SNEA 2QV1A 5GXPA 1WQVH 3MWIU 3NKKA 3TJVA 1K21H 1LHCH 2ZA5A 3U8TH 6GCHF 1UTPA 1GCTC 2P8OC 1TBQH 1AZ8A 1P2JA 4DIIH 2IJOB 4AZ2B 5A0AE 2PTCE 2OC1A 3SGQE 3LDXH 1XUIA 1OS8A 1BQYA 1GHYH 1EOLA 2GVFA 1ZGIA 3M7QA 4YLQH 1MD7A 1QHRB 1OXGA 2Z7FE 2ZCHP 1GMDF 2QAAA 2Q6GA 1GI8B 3VEQB 2VIOA 1YKTA 3SUEA 4XBCA 4JK5A 4XBDA 1IQEA 2A2XH 5GDSH 2G8TA 1AUTC 5I25A 1TGSZ 2GV7A 3QGJA 1N8OB 2BDBA 1G2LA 1T32A 4U01A 4TPYA 3EA7A 2WUBA 4MPWA 4MNXA 2BY8X 2C90B 3SJIA 5FAHA 1PQAA 1VGCC 4YM9A 5JBAS 2BDIA 1GWAA 4YOIA 4WF8A 2A5IA 4Y11E 3RXEA 1LVMA 1TBRH 2Z3CA 1BZXE 3KQDA 3ODFA 5C1YA 1RIWC 1CA0B 3LGVA 1DS2E 3OYPA 1AVWA 5DP4A 1GJ7B 5F8ZA 1MBMA 1O36A 3MOCA 4A1VA 1V2OT 2ZFPH 1MAYA 1IQGA 2C8ZB 3S7KB 1PYTC 3BTDE 3RU4T 5LPRA 4FUIA 5TCCA 4UONA 2BB4A 3KL6A 3HGPA 1J17T 1NO9H 1NN6A 4X1SU 1VR1H 2SGEE 1C5LH 1LHEH 3B8JA 1DWBH 5I46H 1YPHE 1A0LA 4KKDA 2GT7A 2OLGA 5TJXA 2JH0D 2VGCB 2ZFRH 4TWWA 3UOPA 5FBIA 4Z0KA 1GJAB 3K6ZA 1DPOA 1CBWB 1FY5A 3MH5A 1TX6A 4IBLH 1HAHH 1BITA 3KGPA 1C4V2 1C2MA 1ZOMA 1CE5A 1JXPA 4K69A 1MKXH 1H4WA 1AMHA 2EI8A 2ZFTA 4ABHA 1GMHF 1BRUP 2FWWA 1P2KA 4NFEA 4YLUA 2B0FA 1IQLA 1XVOA 4R0IA 1SGYE 1WV7H 2J94A 1ETTH 1HDTH 1MAXA 2Q6FA 1AFQB 3HPTB 1MCVA 1LPZB 5E2PA 3LU9B 3FP7E 2ZECA 1QURH 1B0EA 1GBEA 1MUEB 2WPLS 5FX5A 4X0WU 1C1UH 1N1LA 1A46H 1TGCA 2HWLB 1QGFA 2GKVE 2F9PA 1A0HB 1HNEE 1O2MA 1V6DA 2W3IA 4XSKU 3WY8A 2ILNA 1FNIA 1OWJA 1K2I1 2D8WA 3STIA 4FUFA 1O37A 2GV6A 2GDDA 5EPNA 4CRFA 2P93A 5EOKA 1EKBB 1FN6A 1GGDC 1OP2A 1QR3E 3BTME 3GY7A 3BG4C 3DT0H 2VWOA 1C1PA 1TOCB 1O2QA 4OS7A 1C1SA 1GJ9B 4AFQA 2VIQA 1KDQB 4K3JA 2FOAA 1L4ZA 4I8LA 1C1OA 1P11E 1AO5A 1ORFA 1Y5BT 4X1NU 4YT7H 1ELFA 4YTAA 3M7TA 1EX3A 2UWPA 1RTKA 2QF0A 2PWXA 2WV5A 3V13A 1S6HA 2ALVA 2OP9A 1C5PA 1O3OA 1NRSH 3LONA 2JETC 3RXDA 2CV3A 4SGBE 3UIRA 3ESTA 2LPRA 4DVAU 2QYIA 1O5AB 2AEIH 3QK1A 1O5GH 7LPRA 2FX4A 1DUAA 1AI8H 1QB1A 3RXQA 2FYQA 1BHXB 1EJAA 2NWNA 1EPTA 5DP3A 3QTOH 1HAVA 4WY3A 1TRYA 3D62A 3GY8A 1JRSA 3ATLA 2V3OH 4MPXA 4ISLA 3UQOA 4X8VH 4SGAE 3M36A 1L4DA 1DVAH 2AIPA 1GBIA 3FVFB 1MTNB 2FS9A 3PLKA 5CMXH 1TB6H 3BTWE 2ZDMA 3GYMA 2QIQA 3TJOA 1O35A 1D3TB 3ATMA 4ASHA 4RKJB 2ZGJA 2SGQE 1AWFH 3FP6E 3H5CB 3EGKH 4GSOA 6CHAC 2ZEBA 2A5KA 1GHXH 2A1DB 2BY6X 1K1NA 2ZTZA 2SFAA 4AOQA 1O3NA 5HYOA 3JZ1B 3OY6U 4K5ZA 4FVBA 3FFGA 1AD8H 4CBNA 4ZKSU 1P12E 3TK5A 1FPHH 1BHXF 2OC8A 1P06A 5HM2A 5JBBS 1YPMH 2FOHA 1ARBA 1RTLA 4Y8XA 1O3FA 1ZJDA 2D1JA 3P8OA 3VB4A 3MU4A 3AW0A 1K1MA 4YOGA 1T8MA 1ESAA 1C2HA 3M3TA 4Q7YA 2PFEA 3PLBA 1C5MD 1BA8B 1A7SA 3DFJA 1KDQA 2WINI 4F49A 3MHWU 1K9OE 3DUXH 2SGAA 2GX4A 2PSXA 1VZQH 1KXBA 3BEUA 1K1PA 1W2KH 4TYDA 1WYKA 4OS5A 1HGTH 2AGGX 5F8TA 1OWDA 2BVXH 1LDTT 3F9HA 1DXWA 2B5TB 3M5MA 1WUNH 1HAGE 2WUCA 1BTWA 3ZVFA 4CRGA 2UUFB 3E1XB 7GCHG 1WAYB 3MFJA 4HFPB 1SQOA 2ZIQH 4Y8ZA 1O3PB 2OC0A 4I8HA 3Q00A 1Y59T 5BRRE 4H4FA 5EW2H 3SO3A 3SU3A 4KGAA 1ZYOA 1WQSA 4CH2B 1HAOH 1GBTA 3R3GB 1FLEE 4FUGA 4ABEA 3LGIA 1HB0B 5PTPA 3TIUA 1Z7KA 4JYVH 1H9IE 2WYGA 1C5VA 4Y6DA 4HZHA 3E0NB 1ZTLA 4FUJA 1NFWA 1ELAA 1OWIA 2JKHA 3T25A 2BTCE 4RKOB 1CGJE 5EXLA 2BY7X 3SJKA 3MNXA 1YPJH 1S83A 2EI6A 2BMGB 1ELVA 3NPSA 3KN2A 5A8XA 1GHWH 2YNBA 2ZPRA 1GI4A 2G81E 2Y5FA 5C67A 1O3JA 3E8LA 5EQQA 1O5BB 2ZO3H 1ZSKA 1EZSC 1AY6H 2GCTB 2W3KA 1FXYA 1SGFA 1AHTH 1ESBA 1EP6A 1BBRH 1GBHA 2VWMA 1GMHG 1ZZZA 2A7JA 4YOJA 2ZCLP 2G51A 3O8DA 1LVOA 1SLUB 2R3YA 5A0CA 1GMDG 7KMEH 3GY3A 1PQ7A 3V3MA 1LKAA 3FANA 1E0FD 4U2WA 2H9HA 5FPYA 4K1TA 1AWHB 2XC4A 1O3GA 3LJOA 2RA0A 4K1EA 2XW9A 1O38A 4BXWA 1G3BA 1OKXA 3GY6A 1GDQA 2FO9A 4FUEA 2VWNA 2VGCC 1P05A 4Q7ZA 1NTPA 3AW1A 4AN7A 1FY4A 4ZKOU 6CHAB 3VPKA 2ASUB 1G3CA 1TNIA 1YP9A 4CBOA 2XBWA 1KSNA 2AYWA 1O3MA 2IN2A 1O2ZA 3T28A 1SB1H 2H6MA 4CHAB 2GZ8A 3GY2A 2AS9A 1PPFE 2K1QA 2OBQA 5ABWA 3SU6A 1RJXB 3RXUA 1GI9B 1S82A 1ZRBA 2WPKS 1V2QT 1QY6A 4BNRA 5GIBA 1FY3A 2Y5GA 3HGNA 1TOMH 2XC0A 1PPBH 1C5QA 1GVZA 1GI2A 3K2UA 1QQ4A 3M5OA 2UUKB 1S5SA 3SW2B 3LC3A 1RGQA 1W3CA 4HTCH 4X2VA 1FAKH 2PLXA 3E90B 1YGCH 3URDA 1E36B 1AVGH 1YCPH 2G52A 1OWEA 4AG2A 2VINA 4D9QA 1DWCH 2ANYA 1P2OA 1XM1A 3Q76A 5F6MA 1MQ6A 1S81A 1UTMA 1AB9C 2ZDKA 3SGAE 2UWOA 4B74A 2Y80A 1NESE 3UFAA 1O3CA 3NUMA 2EEKA 1IQMA 1FAXA 2KAIA 2A0QB 8GCHG 3K65B 2JH6D 2A32A 1KLTA 5DPAA 1XKBC 3MU5A 5EGMA 1KXDA 1DSUA 5AFZH 1C4U2 2HNTC 2ZHQH 1GMCG 1TFXA 3LGWA 1BJVA 2HNTF 1QRZA 5FPTA 3ZZBA 3M61U 2J92A 3BG8A 1V2VT 1Y3UA 2O8LA 4U30A 1EASA 1GBKA 1GL1A 1Z6EA 4XE4A 6ESTA 2CF9H 4IW4E 2FTMA 3SNAA 3RXKA 3SU2A 2F9VA 1V2LT 2SGDE 2O8WA 1DLKB 3H7OA 4GHQA 1YPGH 2BDGA 1GHBF 2W7UA 3PMBB 4KTUA 3TITA 2F9NA 1CU1A 1E35B 1BTZA 3U9AH 3A83A 5FCKA 4GCHF 2ZHWH 1QRXA 3U98H 1GCDA 3SHCH 2F9UA 1SLXB 1EJNA 3BTGE 1WOFA 8ESTE 1YC0A 3SBKA 2BY9X 1RIWB 2FOCA 4MVNA 5E0GA 2QGRA 4X2YA 1WU1A 3MI4A 4X8SH 1YYY1 2BXTH 1OP8A 1CT0E 1S0RA 2NU0E 4FXGH 3GCHC 3HKJB 4JZFH 4CH8B 1D3DB 4XDEA 4JMYA 3UR9A 2R0LA 1INCA 2A4OA 4ISIH 3F6UH 1SI5H 1GBDA 3N7OA 1KY9A 1O5CB 3SV7A 1ANEA 4AFUA 1HJ8A 1TPSA 4JYTA 1V2TT 4AFZA 1O3KA 3GDUA 3PV4A 4K8YA 1NRNH 1GGDB 5E2OA 1Y3YA 3BTQE 4DW2U 2BZ6H 1P09A 1E34B 3ZZ7A 3A82A 4M7GA 3T2NA 1FN8A 3S9BA 1P9SA 1FDPA 3O8CA 1NFYA 5EQRA 4JZIA 2SNWA 4WH6A 2G4TA 1Z8RA 1QRWA 3SUFA 5J4QA 4NCYA 2QCYA 2AGIX 3MO3A 1V3XA 4CREA 1MQ5A 2J38A 3SNBA 1UTJA 2GMTC 4MNWA 1Z71A 2YOLA 4B2CA 3LGYA 2QXIA 5LPFA 4NG9H 2XNIA 1XKAC 1K22H 5CE1A 2OQUA 2EC9H 1XVMA 3LIWA 1V2MT 4I8JA 1KIGH 2XWBI 3RC6A 2ZPSA 1HAPH 1SGFG 1MMJN 1BBRE 2OBOA 1AFEH 3RU4D 3ZZCA 1IQNA 1HJAC 1W0YH 1AKSB 3B23B 4VGCC 2GZ9A 1F0SA 2O8UA 4NFFA 4JZDH 1SSXA 1THSH 3CP7A 4GUXA 1EZQA 4AYYB 1H8IH 3LT3A 3ODDA 3EE0B 3RMLH 3E6PH 1XXFA 2Z9JA 1WBGB 4DJZB 5J4SA 1PFXC 1GBJA 1FMGA 1E37B 3GOVB 3PYHA 3U1JB 3S69A 4AB9A 1UVOA