1UTKA

Trypsin specificity as elucidated by lie calculations, x-ray structures and association constant measurements
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
222
structure length
222
Chain Sequence
IVGGYECKPYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKPATLNTYVQPVALPTSCAPAGTMCTVSGWGNTMSSTADSNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMASY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN I
publication title Trypsin Specificity as Elucidated by Lie Calculations, X-Ray Structures, and Association Constant Measurements
pubmed doi rcsb
total genus 51
structure length 222
sequence length 222
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utkA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1utkA02
1XMNB 1ZHRA 2CHAC 2CXVA 4FU8A 5DO4H 1D3DB 1PQ8A 1XXDA 1W7GH 4X2VA 1PPEE 2OBQA 1ZZZA 1P2KA 4E7NA 1LMWB 1A1RA 2BDBA 3SUGA 2QC2A 3PMAB 1P04A 2WYJA 2JH0D 2PSYA 2WPHS 1O5FH 3IITA 2SGAA 4J1YA 4JK5A 3QN7A 4DURA 4O03A 5HM2A 1QL9A 4YT6H 2ZDMA 1PQ7A 1YC0A 1Y5BT 2BY8X 2PKAB 3SU2A 3PWCA 4UE7H 5A09A 5E0HA 1NESE 1RS0A 3SOSA 1HAHH 1RJXB 2Z9JA 4K5ZA 2BB4A 1O5GH 1A0JA 1ELCA 1O31A 1O2MA 1RTFB 2FLBH 3P70B 3MH7A 3BF6H 3RXVA 3URDA 4FUEA 2BD5A 5L30H 1P9UA 3P95A 1HLTH 1QA7A 1ZSKA 4Y8YA 1Z8IB 1GMCF 2TPIZ 3MMGA 2ZDLA 1AFQC 1C5QA 4I8JA 1C1QA 1GBAA 1MZAA 3K6YA 1XUGA 5C5OA 1N1LA 1CA0C 3M7TA 5C3NA 3E0PB 1TYNA 3M5LA 4Y76A 4UEHH 5JBAS 2HRVA 4CR5A 1ORFA 2G5NA 3RXGA 3SJKA 1QJ7B 3ODDA 3NZIA 1ELBA 5F8ZA 3K65B 2GV7A 5T6GA 2B9LA 1HAIH 4E06H 4IC6A 1GJCB 3HK3B 1ESBA 1C5RA 2ANMH 3QLPH 3BSQA 4NSYA 3TK5A 2ZQ2A 1CHOG 1OP0A 4CBNA 2Z6BD 5CMXH 1DX5M 3BTME 1J16A 1Z7KA 1RGQA 4NA7A 6CHAB 2VGCB 3KCGH 4DY7B 3A8AA 1SFIA 1P03A 1EJMA 4NCYA 4UFEH 2ZC9H 1V2JT 2A2QH 2J9NA 1DICA 3NUMA 2HALA 1G3EA 2BDCA 4ZHMU 1N8OC 4B76A 1HGTH 4X0WU 1P12E 3P8GA 1Y3YA 2BLQA 1C1SA 1TNJA 3TU7H 3PMJA 2A7HA 2G81E 1GJ8B 3OTJE 4JYTA 3TK9A 4H6SB 1C2EA 1GL1A 1O3OA 2W7UA 5FHTA 5ETXA 2SGPE 4BXSA 3SNCA 2FOAA 1D3PB 2EI8A 1B5GH 2B0FA 3ZVAA 1C1VH 5LPFA 1NPMA 2I6QA 2IPHA 3A7ZA 2ASUB 3EQ0H 5EPYA 3RXTA 2VH0A 4U30A 2OP9A 4HGCA 2BD4A 2BX4A 3FVFB 4QT8C 2F91A 1A5IA 5EU8A 1FNIA 1GDUA 5JBCS 3MNXA 2AMQA 1GBFA 3BTEE 2J2UA 3PLPA 1DOJA 1NRRH 4K69A 1PPCE 1LVOA 1J8AA 1EAUA 1GJDB 7LPRA 3GY5A 5JYIA 1D3QB 5FBEA 1RTKA 4I32A 3PV4A 1SHHB 2EEKA 1C1OA 2TBSA 1E36B 1EB1H 2FDAA 1QBOA 4ZH8A 1BRAA 1HNEE 1VR1H 4H6TA 1HB0B 1BIOA 1ABIH 3E3TA 2ZTYA 1TA6A 1O3MA 2SFAA 1G30B 2A5AA 5DKMA 2F9OA 4KGAA 5K7RA 4ZXXH 1GBJA 1WU1A 2QAAA 1TPAE 4ZHAA 1LPZB 4JZFH 3F68H 2VWLA 4UFFH 3VB4A 4JYUH 3P17H 4CBOA 3P8FA 1QCPA 3RLYH 1BTPA 4LK4A 3AASA 4DOQA 1QURH 2VVUA 2G00A 1AVGH 5EQRA 1OWKA 2HNTE 7GCHF 1TABE 3A85A 3RXFA 4RN6A 3BEFB 4GHQA 1A5HA 3T25A 1MU6B 1HAXB 1VITG 2QV1A 1BT7A 1GCTC 4MPXA 1Y3XA 3MOCA 1CT2E 1GDNA 1MKXH 1XUKA 1KY9A 1OWDA 4X1PU 5I25A 1BRBE 3MO9A 3UQVA 4AN7A 1BOQA 1F7ZA 1EPTB 3LOXA 1O2ZA 5GWZA 4TPIZ 2HNTF 1V2ST 2ZTXA 3KQEA 3RDZA 5DP6A 1QL8A 4Q2KA 1GJ4H 1CT4E 1C2HA 1DXWA 5HXFA 1HYLA 4ZAEA 2ANWA 1VITH 1DITH 2C4FH 2R2MB 4Q80A 1L1NA 1P3EA 3QGNB 1BBRE 4JCNA 1NROH 1DWDH 5DP5A 1XUFA 1TQ0B 1BMAA 4X6MA 1GBLA 3SZNA 4A1TA 4MNWA 1K28D 4Y71A 1KXCA 5E0GA 3SW2B 1O3NA 1B7XB 2SNVA 1VGCC 2UWOA 4NGAH 2GGVB 2PTCE 3EA8A 4BAMB 2F9BH 2PSXA 1YPKH 1K1IA 1FI8A 2F9VA 2V6NA 2VWMA 4RSPA 5A8XA 1GG6C 1UK2A 3SHCH 2A4GA 3MYWA 4Q7YA 1C2FA 3O8CA 4ESTE 1UTPA 2KAIB 3NKKA 1HDTH 3M5NA 3SGAE 5DP9A 3PO1B 1O2NA 1V2VT 1NZQH 1CQQA 3KQCA 1EXFA 1Z8JB 1BZXE 1AO5A 2P3UB 2ZFQH 1VJ9U 1XUJA 4YLQH 1FDPA 4Y79A 1T7CA 2ZECA 1EZXC 1GI0A 5EPNA 3BTTE 4LXBH 2GCTC 1WTGH 2FM2A 1O2KA 2CF8H 1MTUA 3MTYA 5CHAC 3TVJB 4BAQB 3WY8A 3KQBA 1UTNA 1L2EA 3EE0B 5E0JA 2HPQH 1INCA 3LC3A 2Y6TA 1PYTC 3Q00A 3LGWA 4ASHA 2VNTA 1G3DA 4AGKA 1O39A 3LDXH 1V2WT 2A1DB 2VIWA 4F49A 4DIHH 1QBNA 2ZFPH 5JBBS 3ODFA 2BMGB 2QGRA 2QXGA 1TMUH 5DGJA 2ODPA 1SVPA 1W8BH 1SL3A 4INKA 3T2NA 5JB9S 1GMCG 4CRAA 3SI3H 4DVAU 3TJOA 5EGMA 1QTFA 2XC4A 1MU8B 1O2QA 1CHGA 1C5TA 3MHWU 4Y6DA 1MD8A 5DJ7A 4B71A 1SGYE 4IMQA 4YTAA 4FVBA 2QA9E 1UTKA 4MG3A 1OWEA 1O5EH 1HUTH 2RG3A 2R9PA 5AVDA 3UNQA 2P94A 3BTKE 3OYPA 1F0SA 4K1SA 1THPB 1QQ4A 1N6YA 1F5RA 1HXFH 2W7SA 4Y0YE 1MCTA 4YOIA 1S5SA 2WUBA 1Y3VA 1SGQE 1F2SE 2HNTC 2W5EA 2VH6A 1L4DA 1HAVB 5DG6A 1PPBH 1LHEH 1BMMH 3UR9A 2XW9A 6ESTA 1O3AA 1BJVA 3A7XA 1GMDF 3T5FH 3UOPA 3LJJA 2ZU4A 4B1TA 1O3LA 1O3CA 4FUBA 2ZF0H 3A8DA 1LHGH 2HGTH 4X8SH 1ARBA 1A3BH 1KXFA 2TGAA 1KTTB 5AFYH 1O0DH 5TCAA 1DANH 1O3KA 3LGIA 3GCHC 2GMTC 1Y3UA 2PGBB 4XE4A 1MTNC 1W11U 1YF4A 4K8BA 7KMEH 2BQWB 4X6NA 1O35A 3RM0H 2TGPZ 2ZP0H 2H1UA 1J14A 4ISIH 1T8LA 3BIUH 3QZRA 4R0IA 1KXDA 2XNIA 2FOHA 1C5WB 2FS9A 2A4OA 3PLKA 1BTXA 1OX1A 5TJXA 5J4SA 1CSOE 1SOTA 5G4BA 1D4PB 1V2TT 5LGOA 5ESBA 4IW4E 3ZZ9A 2FODA 3IG6B 1JIMA 3M35A 2FMJA 4X6PA 1S0QA 3CS0A 2A4QA 3FZDA 1V6DA 1KTSB 2FOGA 1S85A 4DCDA 1ANCA 2BY9X 2A5KA 3PMBB 5C20A 5GCHG 2GDDA 1NTPA 2STAE 1EQ9A 1DLEA 4NZLA 1DT2A 4JZDH 1GBHA 1GMHF 3URCA 1QB9A 1DXPA 4JYVH 3RMLH 1UVUH 2GZ9A 1HFDA 1T8NA 2FYQA 2QXHA 3DT0H 3PYHA 1HRTH 2GX4A 4D7FA 3HKJB 2VIVA 2BVXH 3F1SB 1CVWH 1QBVH 2BDIA 3D49H 1NFWA 1PPFE 4Y0ZE 2UUFB 3GCTF 4BNRA 4CRGA 1Y3WA 1SBWA 2ZKSA 2F9UA 3ZV9A 1C1UH 3CP7A 3MNSA 1QQUA 1XVOA 3UFAA 2B8OH 4H4FA 1WUNH 1LPGB 3DD2H 3SNAA 4AYVB 1O3BA 5JBTA 2THFB 1C2LA 1JOUB 2ZO3H 1YPJH 3L3TA 1BTZA 1EAXA 3PTNA 2DUCA 5E2PA 1BHXB 2FEQH 2C8YB 1DPOA 1AB9B 1O2VA 1YLDA 2ZHEH 1IQHA 4BTUB 1GI5A 2OLGA 3A7TA 2ANKH 3SU0A 4B73A 3MO3A 1UK3A 2NU4E 2CF9H 2ZHQH 3VGCB 2SNWA 3L6PA 1GI2A 3SU1A 2XBWA 2VINA 4GPGA 1C1TA 1U6QA 2VVVA 5DP8A 2ZCKP 1RIWC 4CRDA 3AAVA 2OC8A 4GCHF 1HPGA 4FU7A 4KTSA 4NZQA 1GBIA 2WPIS 1P2IA 2Y80A 3MH6A 4YESB 2ZTZA 1HJAC 1M9UA 5ESTE 3A88A 2A45B 4Q7ZA 2C93B 5A0AE 2BD2A 1SGFA 4YZUA 2VWOA 4E05H 3VB6A 1HAGE 4AG1A 1A3EH 3RU4T 5EODA 3ZZ8A 1ESTA 1WCZA 3LGVA 3RUOA 1C2KA 4UD9H 1WQVH 1XVMA 3P8OA 1O5DH 2W26A 1NS3A 1Q3XA 4AB9A 4PROA 2OTVA 4BAOB 1IAUA 4YOGA 1SG8B 1AD8H 4ABDA 3RU4D 3GY3A 4X1SU 1ELEE 1GVKB 4FUIA 4YLUA 1O3PB 2XYAA 1QR3E 3M3SA 2H9HA 1BTHH 2Y7XA 2ALVA 3ENSB 5H4IB 1GJ7B 1O2HA 1W7XH 1AKSB 2NU0E 4ISHH 3ESTA 3GDUA 1ETRH 1YPGH 1SGIB 1TPOA 2ZDNA 5AFZH 2TGDA 2CMYA 5A0BA 2FOCA 1DWCH 1IQEA 1EP5A 1ELTA 1YPLH 1F5LA 1XKBC 1GGDB 3ZVEA 1HCGA 5GDSH 1EP6A 2PUQH 8GCHF 1OWHA 4X2WA 2XRCA 1P01A 3SV6A 2ODQA 3SI4H 2A31A 2EA3A 4JMYA 2BD7A 2AYWA 3SU6A 5AF9H 2DE9A 2PUXB 1SLUB 1C1NA 1Z8GA 5DP3A 1FN8A 3UREA 2VIOA 4MTBA 1O33A 3GCOA 2BDAA 3P92A 1NC6A 5C2ZA 2AERH 3LJOA 4NG9H 3KL6A 1BDAA 5IDKA 1ANDA 1LHFH 2HLCA 5EOKA 5L2ZH 3TH3H 2FZZA 1JRSA 4IC5A 2ZDAH 1SGTA 5C67A 2HWLB 3U8RH 1C5SA 3IWMA 2K1QA 1SC8U 1ZMNA 2BTCE 1VGCB 2PWXA 2RCEA 3PTBA 1C5NH 5C5NA 2RA0A 1XUHA 1EASA 1W3CA 2OUAA 4MVNA 4B2CA 3DUXH 4D8NA 1S83A 1C5PA 3RMNH 2AIPA 4TYDA 1V2KT 1IQFA 3GY2A 1GMDG 5GIBA 1O3DA 1GG6B 1AIXH 1Z71A 1V2OT 1UK4A 2RA3A 3E8LA 1K1OA 1J15A 1AE5A 1LQDB 3QDZB 2BVSH 1SGFG 3KQDA 3LGYA 3NWUA 5EXMA 1GBBA 3SN8A 1V2PT 2ZQ1A 2P3FH 2Y5HA 1C5MD 2QXJA 1TMBH 1TOMH 3SHAH 4CH2B 4DIIH 1GJ6A 1XXFA 5BPEA 3ATLA 4DG4A 2C8XB 1QFKH 1FY1A 4WF8A 4VGCC 1Z6JH 1O5CB 3SQEE 2SGFE 2OC7A 3JZ1B 5GJ4B 1NU9A 1OP2A 5DK1A 1NRQH 1MCVA 3A80A 1ZHMA 1UTOA 1X7AC 3UUZA 1JXPA 4A7IB 2EC9H 1MTVA 1MKWK 4TWYA 1QB1A 4CREA 4CHAC 3GOVB 1TNKA 1KDQA 3TITA 2QF3A 1Y59T 3ZZ6A 1AVWA 5F8TA 2G51A 2VIDA 1MZDA 2Z9IA 3W95A 1DY8A 3GY6A 2R3UA 3RXDA 4Z0KA 1A0HB 1GMHG 1FY8E 1DUAA 4FUGA 1UHBA 4BTTB 4I33A 3E16B 3G01A 2GCHG 3MO6A 4GVUA 2BD8A 3RMOH 4NA9H 1GBEA 1IQIA 2YNBA 5GCHF 4LZ4B 1UTLM 4MQAA 3ZZ7A 4KTUA 5I46H 4Y7AA 1E38B 1HIAB 1DVAH 4MPUA 1DE7H 1YCPK 2FI5E 3SJIA 3GCTG 1L0ZA 4GHTA 3TNTA 4Y10E 3M61U 3O8BA 3QUMP 1T8OA 1UCYK 1Y8TA 2BDHA 1UVSH 3AVZA 1E35B 3A86A 3TNSA 2Q6DA 4A1VA 2ZDVH 3DFJA 2ZU1A 1E37B 1EJAA 1O5BB 1WBGB 2EI6A 3RXCA 1C2GA 3LH3A 2ZIQH 4BAKB 4M7GA 1GHZA 3BG4B 3RXHA 1QJ6B 3E1XB 4D9RA 5FXLA 2G5VA 1S84A 1O3JA 3KIDU 1OS8A 3MH5A 1EZSC 4MPVA 4A5TS 3V3MA 1C5YB 3GCHB 3MH4A 2FOEA 2QN5T 1T4VH 4ABBA 1J9CH 1GJBB 1MUEB 1ZPCA 3F6UH 4OGYA 4X2XA 3TIUA 4ABIA 4GCHG 3E90B 1O2OA 4WJG2 1KYNA 1O36A 2FS8A 1TONA 3EA7A 3MU0A 2Z9GA 4NFEA 1W2KH 5FCKA 1WTHD 1BITA 2Z3DA 4ZKNU 2FX6A 3GY7A 2ILNA 2FXRA 1AVXA 3TPIZ 4I8GA 1GJ9B 4CRBA 2AS9A 3ZZ3A 4U32A 2ZU2A 2WPKS 1LCYA 1FPHH 3GDSA 1F0TA 1ZJDA 2Z9LA 1E0FD 3BTHE 2HVXA 4AFSA 8LPRA 1A4WH 2JETB 4ZROA 3TGJE 2PKSC 4OS6A 3U98H 1OWIA 1K2I1 3SU4A 4YOJA 1XM1A 2AMPA 2WV5A 5A2MH 1C9PA 5TCCA 2FX4A 1O38A 1PPZA 1MQ5A 3M7QA 3Q3YA 1O2LA 2UUJB 5FCRA 2Z94A 1PQ5A 2BVRH 2QY0B 1MKWH 4MNVA 3TGKE 5LH8A 1SQAA 1MTWA 4IGDA 1O2RA 2BY5X 1CBWB 2ESTE 1O2SA 3M36A 1XX9A 1GI3A 3K9XB 4UONA 1CO7E 3AW1A 4CR9A 2ZHDA 3H7OA 2A7JA 1P06A 1YKTA 1SSXA 1GVZA 1ZOMA 1TOCB 1DUEA 2R2WU 4AFUA 2FESH 1PJPA 8GCHG 1FIZA 1K9OE 3RM2H 1DLKB 1P2MA 2P3TB 1NFUA 2O9QA 2Y82A 2BQ6B 1GBTA 4UDWH 3QX5H 1GJAB 5EXLA 3EA9A 1AWHB 3BEIB 2BDGA 6CHAC 2VGCC 4X1RU 1C4U2 1W13U 1TGBA 1DS2E 1TB6H 1CE5A 1UCYH 4ISOA 3U8TH 1C9TA 1G36A 2VWNA 3MI4A 2Z3EA 1HAZB 1GVLA 1F92A 3V7TA 2XBYA 3BTFE 1K1MA 1WYKA 1W12U 3NXPA 1LVYA 4OS2A 5BRRE 2BHGA 2UWLA 1KXAA 4NWKA 3TJUA 1SR5C 3FP6E 4U01A 1HAPH 1C1PA 5LPRA 2QF0A 3LU9B 5T3HA 4DGJA 9LPRA 2BD9A 1KSNA 2JH6D 2R0KA 2UWPA 2ZFRH 4A92A 4IBLH 1GDQA 4ZKSU 2ZGJA 1S0RA 1VCWA 1ELGA 3ZZ5A 3VB3A 1IQLA 3F9FA 2AGIX 3ZVDA 4JZIA 1ZGVA 1NRPH 1TNGA 1ZYOA 4MPWA 4WXVA 2OD3B 2OC1A 2Z9KA 1AFEH 4THNH 1OKXA 2V3OH 1CGIE 1A2CH 4K1EA 3MWIU 1V2LT 4BAHB 1P0SH 3HKIB 1JIRA 2M5TA 2Y7ZA 1IHSH 1O3EA 2AEIH 2F9PA 2CHAB 5FX6A 3RU4E 1BCUH 4I7YH 1KXEA 1LKAA 1HXEH 1EKBB 1FQ3A 1H4WA 1LQEA 2C8ZB 5EW1H 2JKHA 2GKVE 1TRNA 1NFXA 5AHGH 1CT0E 3RXKA 5PTPA 4AFZA 1BQYA 2WPMS 1P2QA 4SGAE 1A46H 4WVPE 4D76A 1TRMA 1WQSA 2ZGHA 3B9FH 2F83A 1TIOA 1VCQA 2H9TH 1ZTJA 1WV7H 4FU9A 1D9IA 1Z6EA 2PV9B 3RXJA 1NO9H 2G55A 4OS7A 3ZVBA 4B74A 1GBDA 3RXOA 2VIQA 2V3HH 2FI3E 1DSUA 4X8TH 3GYLB 2Q6GA 3EGKH 1OYQA 2NWNA 2P8OC 3M3VA 4ABJA 4NIVA 2XC0A 1Q31A 3OY5U 1EAIA 4A6LA 1F0RA 2BDYA 4O97A 1TPPA 4NSVA 1EPTA 5IYTA 5C1XA 1A0LA 4NIWA 3B23B 1DWEH 3BN9A 1EPTC 4FUHA 1C2JA 3P8NA 1AFQB 1TBQH 5FX5A 1T8MA 5DPAA 3TLOA 1A5GH 1KIGH 4R8TB 4SGBE 1K1NA 2GCHF 4GSOA 1ZJKA 1EATA 1CA0B 3A7WA 1MAXA 3RXSA 3A7YA 3LKWA 3M5MA 1AZZA 3TH2H 1PFXC 5EXNA 3S9AA 1THRH 2FOBA 2EI7A 4D7GA 3ATKA 1MD7A 1GHXH 1AMHA 3SU5A 1MTSA 1O2WA 1P57B 1ZSLA 3SJOA 1O3GA 2D26C 3Q3KA 5A8YA 4AB8A 4JZ1A 2WINI 3Q76A 1BB0B 1TNLA 4Y8ZA 2ZU5A 3S7HB 1JMOH 4IS5A 2NU1E 2ZPRA 1AUJA 3UTUH 4MLFB 3T29A 3DFLA 2A5IA 1NT1A 1TFXA 3QK1A 5JB8S 4LZ1H 3RXIA 2ZZUH 2WPJS 4OGXA 1SLVB 2GT7A 3SNDA 2A0QB 1N8OB 2WPLS 4TY7A 4X2YA 4KTCA 3M5OA 2QIQA 4GAWA 3PO1C 5F03A 3A7VA 5FAHA 4A1XA 4AX9H 1ZMJA 3STIA 3SU3A 1E34B 1HJ9A 2CJIA 3PB1E 3RXUA 3GY8A 1CGHA 1EZQA 1ZHPA 4Y11E 1L1GA 3TJNA 2Y5FA 2QXIA 1Z8RA 3LC5A 1FV9A 1C4Y2 4XBCA 2G8TA 1L4ZA 1NY22 1LVMA 3V13A 2LPRA 1PPHE 3EDXB 3OY6U 5DP7A 3SGBE 1AE8H 1SFQB 3BG8A 3ZZDA 4YO9A 3S0NA 1GI8B 1J17T 3DA9B 1T4UH 1TAWA 2VJ1A 3U9AH 2P16A 3S69A 3V12A 2FP7B 3Q77A 4Y7BA 2ZEBA 1F5KU 1CU1A 3AAUA 1TWXB 2FO9A 3BTQE 1D3TB 3RXPA 1P3CA 2OQ5A 1O3HA 1DSTA 1MAYA 3OSYA 1O2YA 5E8EH 3U8OH 1ABJH 4OS1A 3BTWE 1G2MA 1C5UA 1LDTT 3RC5A 2FTLE 2ZHFH 1BHXF 2O8LA 2ZPQA 4ABAA 5B6OA 1FIWA 3HPTB 3TGIE 3FP8E 1QIXB 1PPGE 3LPRA 1OWJA 1UMAH 3ATMA 2A32A 3T26A 4ABHA 1YGCH 4J2YB 3RXQA 1UCYE 3SQHE 1SQOA 3SNBA 2CV3A 1W0YH 1UVPA 1HAVA 4INHA 3KF2A 3U1JB 3E6PH 4FUDA 2FYRA 1K1LA 2Q6FA 1H8IH 1GHVH 2IOTA 3SJ8A 1GCTB 1AGJA 1GHBG 1V2MT 1VZQH 4CH8B 5EQQA 2B5TB 3BIVH 4FXGH 4UFGH 1BRCE 5FBIA 5DP4A 1TBRH 2J4IA 2ZFSA 2QYIA 1O2IA 3TH4H 4TWWA 3VFEA 4YT7H 2FIRH 1ZGIA 1RXPA 1TPSA 5EQSA 3GDVA 4KP0A 3D23A 5HMAA 2BXUH 2TGTA 2UUKB 3A83A 4INLA 4ZUHA 1NM6A 3KHVA 4BXWA 1C5XB 3ATWA 1TX7A 2XWBI 2ZGBH 3SV8A 1O2GH 3GCNA 2ZFFH 1FUJA 5HYOA 1GWAA 5C1YA 4WH6A 1EB2A 1O37A 3PWBA 1FXYA 2XXLA 1ETTH 4WMDA 2Q1JA 2ZDKA 3VPKA 4X8VH 1BTUA 1GBCA 1BJUA 1JBUH 5A0CA 1GI6A 2XWAA 3ELAH 3EAJA 3MNBA 1ZSJA 3QZQA 2PKSB 3K6ZA 3LH1A 1AU8A 5FPTA 1K1PA 1T32A 4X6OA 1C2IA 3MU5A 1SGRE 1ZTLA 1AHTH 1SQTA 1O2TA 1EZUC 4KKDA 4OS5A 1IHTH 3B8JA 4K2YA 3F9HA 1BA8B 1KLTA 1QJ1B 1ZLRA 3GY4A 1V2RT 1FAXA 2ZCLP 5ABWA 3PM3A 1D6WA 4O9VA 1GBKA 4HTCH 1HJ8A 2AH4X 1GI7B 1P8VC 1MKXK 3H5CB 4AFQA 8KME2 1LTOA 4FVDA 5GPIB 2STBE 3H7TA 5CE1A 2YNAA 2I6SA 1QB6A 1ELVA 2ALPA 4XDEA 1YCPM 6GCHF 2B7DH 1OPHB 4H42U 2GTBA 1UTQA 4Z6AH 1UVTH 2ZGXH 1TALA 2GCTB 5F8XA 3KEEA 1SLWB 1AZ8A 2C8WB 4ZKOU 4AOQA 2OCVB 3C1KA 5CHAB 1UTMA 1DY9A 1C5ZB 4D9QA 2OXSA 5L2YH 1EX3A 1G32B 4BANB 1GJ5H 1G2LA 1C5OH 3GYMA 3SBKA 4ABGA 3I29A 5F6MA 3SUEA 1AB9C 3A89A 1NRNH 1ZR0A 5GXPA 1AY6H 2V35A 1FMGA 4MNXA 2G4TA 3UWJH 5JDUB 4TPYA 2VVCA 4B75A 2ZHWH 2ZWLH 3VGCC 1SMFE 2BY6X 5C1UA 1P9SA 4KELA 1SGPE 3SNEA 8ESTE 3VB5A 5LPEA 3MU1A 3TJVA 3D65E 2FTMA 1G3BA 2J34A 3D62A 1WSSH 1GHWH 3VB7A 2HPPH 4IN2A 6LPRA 4DT7B 2G52A 1RTLA 4ABEA 3A81A 2AFQB 3KN2A 2ANYA 2CN0H 2BOHB 1ETSH 1QRWA 1ANBA 1H1BA 3RXAA 5HM9A 2O8UA 4BTIB 2C90B 1CGJE 4BOHA 2TIOA 1KLJH 9ESTA 1QRZA 1YPMH 2SGEE 3ZVFA 1EUFA 5K0HA 1SGDE 2GZ7A 1FN6A 1C5VA 3A84A 3FAOA 3PLBA 1SHYA 2OC0A 4MDSA 4I31A 3UPEA 1AKSA 1A7SA 2GMTB 3UOUA 3FP7E 1MTNB 1W0ZU 3RC4A 1SLXB 4CRCA 3JZ2B 4F4OC 2FI4E 2ZA5A 1EJNA 1SGEE 5E2OA 3RXLA 3A82A 4TY6A 2YOLA 1BMLA 4ZHLU 1C2MA 1D6RA 2R3YA 2Y5GA 2P8OB 1Y5UT 3RXBA 3STJA 1GGDC 1HAYB 3HGPA 1GI9B 1TGNA 1G3CA 1Y5AT 3T62A 2PKAA 1TGCA 3BTDE 1NFYA 2C3SA 1BRUP 3FFGA 5A8ZA 1AN1E 1ZPBA 4WMEA 3KGPA 4IMZA 1W14U 2H6MA 1B0EA 1P09A 4AG2A 1LO6A 1Q2WA 2D2DA 3OU0A 1ZRBA 1FY5A 3ZV8A 2AGEX 3R0FA 3C27B 1OYTH 3U1IB 3O8DA 5JPMH 1LVBA 1V2QT 1ANEA 3VEQB 1GI1A 2BXTH 4OS4A 3ZVCA 2ZFTA 1DM4B 2PLXA 2ZG0H 1ESAA 1VCPA 3O8RA 2D1JA 2AMDA 1MBMA 2OINA 4ABFA 5SGAE 4NFFA 1O2PA 3SV9A 4WXIA 1JWTA 1S6HA 1S82A 3AW0A 2GP9B 1MMJN 1ZRKA 1O30A 1OSSA 3TK6A 1C2DA 1YP9A 3KNXA 3P6ZB 7ESTE 1P05A 2D8WA 1RRKA 2BOKA 2BD3A 1ELFA 2BLVA 1G9IE 4I8HA 1UJ1A 2PW8H 2P93A 2G4UA 2J92A 2GVFA 3ITIA 4K1TA 1HAOH 3A8CA 1GHAF 4HI3A 2PGQB 4AGJA 1ZTKA 1Z1JA 2Z3CA 2FWWA 4ZXYH 3RMMH 2RDLA 1IQGA 4X8UH 1O3FA 3PMHB 3HATH 3W94A 1S81A 3L33A 1GHBF 4NWLA 2W3IA 1OP8A 3OX7U 1HV7A 1A61H 1RIWB 3E91A 1FAKH 4O3UA 1YCPH 1C4V2 2GZ8A 1TX8A 4RKJB 4ZMAH 2JH5D 2XBVA 1ELDE 3K2UA 4WWYA 2XC5A 2ODYB 1BTYA 2IJOB 2H9EH 1HJAB 1NN6A 5J4QA 3F9GA 1AUTC 3QWCH 1RFNA 1GCDA 4WY3A 1S6FA 3QO6A 1CA8B 1DFPA 3SO3A 2F3CE 2Y81A 1ID5H 3UIRA 1PYTD 3LONA 1FY4A 2XTTB 1V2NT 1C5LH 1O2JA 2O8WA 1UO6A 1GL0E 1ZMLA 1N6XA 1TA2A 2ZGCA 1TNHA 1K21H 4FUJA 3V0XA 2BX3A 2BY7X 1G37A 1O5AB 2NU3E 5EG4A 2XBXA 1SB1H 3LIWA 1BTWA 2BQ7B 1H9LB 1PQAA 4ISNA 3LT3A 1TLDA 2A4RA 2GDEH 2AGGX 3UR6A 1JRTA 2A7CA 3S9BA 1C1RA 3ATIA 1O3IA 1HIAA 2WV4A 3UQOA 6GCHG 3ZVGA 1XKAC 4LOYH 1EOJA 3VXFH 3ZZ4A 5HGGA 2FOFA 4MNYA 3QGJA 2VIPA 1LHCH 1SI5H 3M3TA 2NU2E 2SGQE 1ARCA 4FUCA 1O34A 3A8BA 4ISLA 2P59A 4NA8A 2AIQA 4U2WA 1YPHE 3I77A 3RXMA 1UVOA 4NIYA 3RXEA 2WYGA 1AQ7A 1MQ6A 3DHKH 4WMFA 1C1MA 4I8LA 2ZI2H 1AWFH 1DWBH 1W10U 1O2UA 2UUYA 2BYAX 2BZAA 1YPEH 3ZYDA 1EAWA 1ELAA 4ZKRU 1CHOF 2F9NA 1QA0A 2PR3A 5L6NH 4GUXA 4IN1A 1TGTA 3UWIA 3BG4C 1KLIH 1NU7B 1YYY1 1QNJA 1B0FA 2IN2A 2VU8E 1TQ7B 3A87A 2HOBA 3UNRA 1GHYH 1RD3B 2GD4B 3Q3XA 4O3TA 4WH8A 1WOFA 1QY6A 1Z1IA 3QTVH 1OXGA 1BBRK 1IQMA 3HK6B 3M37A 5FPYA 4JZEH 2TRMA 1IQJA 3R3GB 2W3KA 2R0LA 1WAYB 3NK8A 1YM0A 3RP2A 1SPJA 4AZ2B 1ZPZA 1P2JA 2O8MA 4GLYA 4JK6A 4Y8XA 1H8DH 2J38A 1QRXA 2LNCA 2OBOA 3LGUA 2BM2A 4FUFA 1VJAU 3SORA 2OQUA 2P95A 1YBWA 3E0NB 3GISB 4Q7XA 1LHDH 2JETC 3ZZCA 1FZZA 4RKOB 2GT8A 2PTNA 2ZCHP 3NCLA 5FPSA 2ZPSA 2BLOA 4XSKU 3PROA 3BTGE 2PHBA 2VB0A 3VXEH 2H5CA 3GICB 4HFPB 4AORA 5T6FA 1FPCH 4XFQA 3RLWH 4AYYB 4UFDH 3MNCA 1FY3A 2WUCA 1P10A 3EYDA 1HBTH 2XCNA 3I78A 4X1NU 1GBMA 1SGNE 3F9EA 4YM9A 1TX6A 3NPSA 1AI8H 4K60A 1K1JA 4I8KA 3UNSA 4NIXA 2KAIA 4VGCB 3N7OA 3T28A 2J94A 1CBWC 2ZU3A 3ZZBA 2ZNKH 3RC6A 3CS7A 5T6DA 4B2BA 7GCHG 3QTOH 3S9CA 1BMNH 2ULLA 1GPZA 4CHAB 2BLWA 1P02A 1TBZH 3HGNA 1T31A 3MU4A 4XBDA 2PFEA 1V2UT 4CRFA 1C1WH 1KXBA 2O8TA 1KDQB 1THSH 2SGDE 1MH0A 1BUIA 3UY9A 3ZZAA 3BV9B 1H9HE 3LGTA 1OOKB 1VITF 3MFJA 1F0UA 1NRSH 3FANA 1TE0A 3SUFA 1QHRB 2J95A 1MBQA 2Z7FE 2FLRH 4HZHA 3SGQE 1UHBB 1V3XA 3U69H 2BZ6H 3T27A 3SV2H 2DE8A 1IQNA 4K8YA 1FONA 1DDJA 5EW2H 1UTJA 1FJSA 1XUIA 4E7RG 1H9IE 3SV7A 3ZYEA 4DW2U 3S7KB 4B2AA 1P2NA 1YPHC 2CGAA 1GI4A 4X1QU 1TNIA 2QCYA 2A2XH 3FZZA 2H5DA 1SOZA 1K22H 4DJZB 1TGSZ 1P11E 1P2OA 1YLCA 3RXRA 2H2ZA 1LKBA 2GV6A 3SUDA 1IOEA 1IQKA 1QL7A 1O2XA 1GHAG 1EOLA 3M7UA 1TMTH 2V0BA 1O32A 4K3JA 3BEUA 3SJ9A 1SGCA 3CENA 1BBRH 2XCFA 1LPKB 2FOMB 4XOJA 1TRYA 3MU8A 4XBBA 1FLEE 1L1JA 1QGFA 1ACBE 2FPZA
chains in the Genus database with same CATH superfamily
1XMNB 1ZHRA 2CHAC 2CXVA 4FU8A 5DO4H 1D3DB 1PQ8A 1XXDA 1W7GH 4X2VA 1WXRA 1PPEE 2OBQA 1ZZZA 1P2KA 4E7NA 1LMWB 1A1RA 2BDBA 3SUGA 2QC2A 3PMAB 1P04A 2WYJA 2JH0D 2PSYA 2WPHS 1O5FH 3IITA 2SGAA 4J1YA 4JK5A 3QN7A 4DURA 4O03A 5HM2A 1QL9A 4YT6H 2ZDMA 1PQ7A 1YC0A 1Y5BT 2BY8X 2PKAB 3SU2A 3PWCA 4UE7H 5A09A 5E0HA 1NESE 1RS0A 3SOSA 1HAHH 1RJXB 2Z9JA 4K5ZA 2BB4A 1O5GH 1A0JA 1ELCA 1O31A 1O2MA 1RTFB 2FLBH 3P70B 3MH7A 3BF6H 3RXVA 3SZEA 3URDA 4FUEA 2BD5A 5L30H 1P9UA 3P95A 1HLTH 1QA7A 1ZSKA 4Y8YA 1Z8IB 1GMCF 2TPIZ 1FX0B 3MMGA 4TT3D 2ZDLA 1AFQC 1C5QA 4I8JA 1C1QA 4P00A 1GBAA 4F48B 1MZAA 3K6YA 1XUGA 5C5OA 1S6LA 1N1LA 3KYFA 1CA0C 3M7TA 5C3NA 3E0PB 1TYNA 3M5LA 4Y76A 4UEHH 5JBAS 2HRVA 4CR5A 1ORFA 2G5NA 3RXGA 3SJKA 1QJ7B 3ODDA 3NZIA 1ELBA 2J98B 5F8ZA 3K65B 5IK2D 2GV7A 5T6GA 2B9LA 1HAIH 4E06H 4IC6A 1GJCB 3HK3B 1ESBA 1C5RA 2ANMH 3QLPH 3BSQA 4NSYA 1E1QD 3TK5A 2ZQ2A 1CHOG 1OP0A 4CBNA 2Z6BD 5CMXH 1DX5M 3BTME 1J16A 1Z7KA 1RGQA 4NA7A 6CHAB 2VGCB 3KCGH 4DY7B 3A8AA 1SFIA 1P03A 1EJMA 4NCYA 4UFEH 2ZC9H 1V2JT 2A2QH 3ZIAD 2J9NA 1DICA 3NUMA 2HALA 1G3EA 2BDCA 4ZHMU 1N8OC 4B76A 1HGTH 4X0WU 1P12E 3P8GA 1Y3YA 2BLQA 1C1SA 1TNJA 3TU7H 3PMJA 2A7HA 2G81E 1GJ8B 3OTJE 4JYTA 3TK9A 3AK5A 4H6SB 1C2EA 1GL1A 1O3OA 2WZQA 2W7UA 5FHTA 5ETXA 5EJZA 2SGPE 4BXSA 3SNCA 4YXWD 2FOAA 1D3PB 2EI8A 1B5GH 2B0FA 3ZVAA 1C1VH 5LPFA 1NPMA 2I6QA 2IPHA 3A7ZA 2ASUB 3EQ0H 5EPYA 3RXTA 2VH0A 4U30A 2OP9A 4HGCA 2BD4A 2BX4A 3FVFB 1MABB 2F91A 1A5IA 4QT8C 5EU8A 1FNIA 1GDUA 5JBCS 3MNXA 2AMQA 1GBFA 3BTEE 2J2UA 3PLPA 1DOJA 1NRRH 4K69A 1PPCE 1LVOA 1J8AA 1EAUA 1GJDB 7LPRA 3GY5A 5JYIA 1D3QB 5FBEA 1RTKA 4I32A 3PV4A 1SHHB 2EEKA 1C1OA 2TBSA 1E36B 1EB1H 2FDAA 1QBOA 4ZH8A 1BRAA 1HNEE 1VR1H 4H6TA 1HB0B 4FOUC 1BIOA 1ABIH 3E3TA 2ZTYA 1TA6A 1O3MA 2SFAA 1G30B 2A5AA 5DKMA 2F9OA 4KGAA 5K7RA 4ZXXH 1GBJA 1WU1A 2QAAA 1TPAE 4ZHAA 2QF5A 1LPZB 4JZFH 3F68H 2VWLA 4UFFH 3VB4A 4JYUH 3P17H 4CBOA 3P8FA 1QCPA 3RLYH 1BTPA 4LK4A 3AASA 4DOQA 1QURH 2VVUA 1H8ED 1AVGH 2G00A 5EQRA 1OWKA 2HNTE 7GCHF 1TABE 3A85A 3RXFA 4RN6A 3BEFB 4GHQA 1A5HA 3T25A 1MU6B 1HAXB 1VITG 2QV1A 1BT7A 1GCTC 4ASUD 4MPXA 1Y3XA 3MOCA 1CT2E 1GDNA 3GS9A 1MKXH 1XUKA 1KY9A 1OWDA 4X1PU 4DT4A 5I25A 2JJ1D 1BRBE 3MO9A 3UQVA 4AN7A 1BOQA 1F7ZA 1EPTB 3LOXA 1O2ZA 5GWZA 4TPIZ 2HNTF 1V2ST 2ZTXA 3KQEA 3RDZA 5DP6A 1QL8A 4Q2KA 1GJ4H 1CT4E 1C2HA 1DXWA 3H09A 1H8HD 5HXFA 1HYLA 4ZAEA 2ANWA 1VITH 1DITH 2C4FH 2R2MB 4Q80A 1L1NA 1P3EA 3QGNB 1BBRE 4JCNA 1NROH 1DWDH 5DP5A 1XUFA 1TQ0B 1BMAA 4X6MA 1GBLA 3SZNA 4A1TA 4MNWA 1K28D 4Y71A 1KXCA 5E0GA 3SW2B 1O3NA 1B7XB 2SNVA 1VGCC 2UWOA 4NGAH 2GGVB 2PTCE 3EA8A 4BAMB 2F9BH 2PSXA 1YPKH 1K1IA 1FI8A 2F9VA 2V6NA 2VWMA 4RSPA 5A8XA 1GG6C 1UK2A 3SHCH 2A4GA 3MYWA 4Q7YA 1C2FA 3O8CA 4ESTE 1UTPA 2KAIB 3NKKA 1HDTH 3M5NA 4AC9A 3SGAE 5DP9A 5KECA 3KYGA 3PO1B 1O2NA 1V2VT 1NZQH 1CQQA 2IJD1 3KQCA 1EXFA 1Z8JB 1BZXE 1AO5A 2P3UB 2ZFQH 1VJ9U 1XUJA 4YLQH 1FDPA 4Y79A 1T7CA 2ZECA 1EZXC 1GI0A 5EPNA 3BTTE 4LXBH 2GCTC 1WTGH 2FM2A 1O2KA 5F53A 2CF8H 1MTUA 3MTYA 5CHAC 3TVJB 4BAQB 3WY8A 3KQBA 1UTNA 1L2EA 3EE0B 5E0JA 2HPQH 1INCA 3LC3A 2Y6TA 1PYTC 3Q00A 3LGWA 4ASHA 2VNTA 1G3DA 4AGKA 1O39A 3LDXH 1V2WT 4RT0A 2A1DB 2WHXA 4FETA 2VIWA 4F49A 4DIHH 1QBNA 2ZFPH 2CK3D 5JBBS 3ODFA 2BMGB 2VBCA 2QGRA 2QXGA 1TMUH 5DGJA 2ODPA 1SVPA 1W8BH 1SL3A 2K0QA 4INKA 3T2NA 1GMCG 5JB9S 4CRAA 3SI3H 4DVAU 3TJOA 5EGMA 1QTFA 2XC4A 1MU8B 1O2QA 1CHGA 1C5TA 3MHWU 4Y6DA 1MD8A 5DJ7A 4B71A 1SGYE 4IMQA 4YTAA 4FVBA 2F4LA 2QA9E 1UTKA 2OK5A 4MG3A 1OWEA 1O5EH 1HUTH 2RG3A 2R9PA 5DSFA 5AVDA 3UNQA 2P94A 3BTKE 3OYPA 1SQRA 1F0SA 4K1SA 1THPB 1QQ4A 1N6YA 1F5RA 1HXFH 2W7SA 4Y0YE 1MCTA 4YOIA 1S5SA 2WUBA 1Y3VA 2GJGA 1SGQE 1F2SE 2HNTC 2W5EA 2VH6A 1L4DA 1HAVB 5DG6A 3WWFA 4TSFD 1PPBH 1LHEH 1BMMH 3UR9A 1KMHB 2XW9A 6ESTA 1O3AA 1BJVA 3A7XA 1GMDF 3T5FH 3UOPA 3LJJA 2ZU4A 4B1TA 1O3LA 2YMSC 1O3CA 4FUBA 2ZF0H 1YLNA 3A8DA 1LHGH 2HGTH 4X8SH 1ARBA 1A3BH 1KXFA 2TGAA 1KTTB 5AFYH 1O0DH 5TCAA 1DANH 1O3KA 3LGIA 3GCHC 2GMTC 1Y3UA 2PGBB 4XE4A 1MTNC 1W11U 1YF4A 4K8BA 7KMEH 2BQWB 2XOKD 4X6NA 1O35A 3RM0H 2TGPZ 2ZP0H 2H1UA 1J14A 4ISIH 1T8LA 3BIUH 3QZRA 4R0IA 1KXDA 2XNIA 2FOHA 1C5WB 2FS9A 2A4OA 3PLKA 1BTXA 1OX1A 5TJXA 5J4SA 1CSOE 1SOTA 5G4BA 1D4PB 1V2TT 5LGOA 5ESBA 4IW4E 3ZZ9A 2FODA 3IG6B 1JIMA 3M35A 2FMJA 4X6PA 1S0QA 3CS0A 2A4QA 3FZDA 1V6DA 1KTSB 2FOGA 1S85A 4DCDA 1ANCA 1BMFD 2A5KA 2BY9X 3PMBB 5C20A 5GCHG 2GDDA 1NTPA 2STAE 1EQ9A 1DLEA 4NZLA 1DT2A 4JZDH 1GBHA 1GMHF 3URCA 1QB9A 1DXPA 4JYVH 3RMLH 1UVUH 2GZ9A 1HFDA 1T8NA 2FYQA 2QXHA 3DT0H 3PYHA 1HRTH 2GX4A 4D7FA 3HKJB 2VIVA 2BVXH 3F1SB 2J5UA 1CVWH 1QBVH 2BDIA 3D49H 1NFWA 1PPFE 4Y0ZE 2UUFB 3GCTF 4BNRA 4CRGA 1Y3WA 1SBWA 2ZKSA 2F9UA 3ZV9A 1C1UH 3CP7A 3MNSA 3SYJA 1QQUA 1XVOA 3UFAA 2B8OH 4H4FA 1WUNH 5CHBA 1LPGB 3DD2H 3SNAA 4AYVB 3F2FA 1O3BA 5JBTA 2THFB 1C2LA 1JOUB 2ZO3H 1YPJH 3L3TA 1BTZA 1EAXA 3PTNA 2DUCA 5E2PA 1BHXB 2FEQH 2C8YB 1DPOA 1AB9B 1O2VA 1YLDA 2ZHEH 1IQHA 4BTUB 1GI5A 2OLGA 3A7TA 2ANKH 3SU0A 2V3MA 4B73A 3MO3A 1UK3A 2NU4E 2CF9H 2ZHQH 3VGCB 2SNWA 3L6PA 5KEDA 4RT1A 1GI2A 3SU1A 2XBWA 2VINA 4GPGA 1C1TA 1U6QA 2VVVA 5DP8A 2ZCKP 1RIWC 4CRDA 3AAVA 2OC8A 4GCHF 1HPGA 4FU7A 4KTSA 4NZQA 1GBIA 2WPIS 2W6ID 1P2IA 2Y80A 3MH6A 4YESB 2ZTZA 1HJAC 1M9UA 5ESTE 3A88A 2A45B 4Q7ZA 2C93B 5A0AE 2BD2A 1SGFA 4YZUA 2EQNA 2VWOA 4E05H 3VB6A 1HAGE 4AG1A 1A3EH 3RU4T 5EODA 3ZZ8A 1ESTA 1WCZA 3LGVA 3RUOA 2PP6A 1C2KA 3OFND 4UD9H 1WQVH 1XVMA 3P8OA 1O5DH 2W26A 1NS3A 1Q3XA 4AB9A 4PROA 2OTVA 4BAOB 1IAUA 4YOGA 1SG8B 1AD8H 4ABDA 3RU4D 3GY3A 4X1SU 1ELEE 1GVKB 2JJ2D 4FUIA 4YLUA 1O3PB 2XYAA 1QR3E 4RI0A 3M3SA 2H9HA 1BTHH 2Y7XA 2ALVA 3ENSB 5H4IB 1GJ7B 1O2HA 1W7XH 1AKSB 2NU0E 4ISHH 3ESTA 3GDUA 2L74A 1ETRH 1YPGH 1SGIB 1TPOA 2ZDNA 5AFZH 2TGDA 2CMYA 5A0BA 2FOCA 1DWCH 1IQEA 1EP5A 1ELTA 1YPLH 3F2GA 1F5LA 1XKBC 1GGDB 3ZVEA 1HCGA 5GDSH 1EP6A 2PUQH 8GCHF 1OWHA 4X2WA 2XRCA 1E1RD 1P01A 3SV6A 2ODQA 3SI4H 2A31A 2EA3A 4JMYA 2BD7A 2AYWA 3SU6A 5AF9H 2DE9A 2PUXB 1SLUB 1C1NA 1Z8GA 5DP3A 1FN8A 3UREA 2VIOA 3OEHD 4MTBA 1O33A 3GCOA 2BDAA 3P92A 1W0KD 1NC6A 5C2ZA 2AERH 2JIZD 3LJOA 4NG9H 3KL6A 1BDAA 5IDKA 1ANDA 1LHFH 1WDIA 2HLCA 5EOKA 5L2ZH 3TH3H 2FZZA 1JRSA 4IC5A 2ZDAH 1SGTA 5C67A 2HWLB 3U8RH 1C5SA 3IWMA 2K1QA 1SC8U 1ZMNA 2BTCE 1VGCB 2PWXA 2RCEA 3PTBA 1C5NH 5C5NA 1YWUA 2RA0A 5EJ1A 1XUHA 1EASA 1W3CA 2OUAA 4MVNA 4B2CA 3DUXH 4D8NA 1S83A 1C5PA 3RMNH 2AIPA 3W1EA 4TYDA 1V2KT 1IQFA 3GY2A 1GMDG 5GIBA 1O3DA 4Q63A 1GG6B 1YY3A 1AIXH 1Z71A 1V2OT 1UK4A 2RA3A 3E8LA 1K1OA 1J15A 1AE5A 1LQDB 1NBME 3QDZB 2BVSH 4OM9A 1SGFG 3KQDA 3LGYA 3NWUA 5EXMA 1GBBA 3SN8A 1V2PT 2ZQ1A 2P3FH 2Y5HA 2AHME 1C5MD 2QXJA 1TMBH 1TOMH 3SHAH 4CH2B 1E79D 1GJ6A 4DIIH 1XXFA 5BPEA 3ATLA 4DG4A 2C8XB 1QFKH 1FY1A 4WF8A 4VGCC 1Z6JH 1O5CB 3SQEE 3VG8A 2SGFE 2OC7A 3JZ1B 5GJ4B 1NU9A 1OP2A 5DK1A 1NRQH 1MCVA 3A80A 1ZHMA 1UTOA 1X7AC 3UUZA 1JXPA 4A7IB 2EC9H 1MTVA 1MKWK 4TWYA 1QB1A 4CREA 4CHAC 3GOVB 1TNKA 1KDQA 3TITA 2QF3A 1Y59T 3ZZ6A 1AVWA 5F8TA 2G51A 2VIDA 1MZDA 2Z9IA 3W95A 1DY8A 3GY6A 2R3UA 3RXDA 4Z0KA 1A0HB 1GMHG 1FY8E 1DUAA 4FUGA 1UHBA 4BTTB 4I33A 3E16B 3G01A 2GCHG 3MO6A 4GVUA 2BD8A 3RMOH 4NA9H 1GBEA 1IQIA 2YNBA 5GCHF 4LZ4B 1UTLM 4MQAA 3ZZ7A 4KTUA 5I46H 4Y7AA 1E38B 1HIAB 1DVAH 4MPUA 1DE7H 5T1VA 1YCPK 2FI5E 3SJIA 3GCTG 1L0ZA 4GHTA 3TNTA 4Y10E 3M61U 3O8BA 3QUMP 3OTPA 1T8OA 1UCYK 1Y8TA 2BDHA 1UVSH 2F43B 3AVZA 3U28C 1E35B 3A86A 3TNSA 2Q6DA 4A1VA 2ZDVH 3DFJA 2ZU1A 1E37B 1EJAA 1O5BB 1WBGB 2EI6A 3RXCA 1C2GA 3LH3A 2ZIQH 4BAKB 4M7GA 1GHZA 3BG4B 3RXHA 1QJ6B 3E1XB 4D9RA 5FXLA 2KCAA 2G5VA 1S84A 1O3JA 3KIDU 1OS8A 3MH5A 1EZSC 2V7QD 3KQ5A 4MPVA 3EE7A 4A5TS 2WV9A 3V3MA 1C5YB 3GCHB 3MH4A 2FOEA 2QN5T 1T4VH 4ABBA 1J9CH 1GJBB 1MUEB 1ZPCA 3F6UH 4OGYA 4X2XA 3TIUA 4ABIA 4GCHG 3E90B 1O2OA 4WJG2 1KYNA 1O36A 2FS8A 1UW7A 1TONA 3EA7A 3MU0A 2Z9GA 4NFEA 1W2KH 5FCKA 1WTHD 1BITA 2Z3DA 4ZKNU 2FX6A 3GY7A 3DCLA 2ILNA 2FXRA 1AVXA 3TPIZ 4I8GA 1GJ9B 4CRBA 2AS9A 3FO8D 3ZZ3A 4U32A 2ZU2A 2WPKS 2HVYB 2KCPA 1LCYA 1FPHH 3UB0A 3GDSA 1F0TA 1ZJDA 2Z9LA 1E0FD 3BTHE 2HVXA 4AFSA 8LPRA 1A4WH 2JETB 4ZROA 3TGJE 2KCYA 2PKSC 4OS6A 3U98H 1OWIA 1K2I1 3SU4A 4YOJA 1XM1A 2AMPA 2WV5A 5A2MH 1C9PA 5TCCA 2FX4A 1O38A 1PPZA 1MQ5A 3M7QA 3Q3YA 1O2LA 2UUJB 5FCRA 2Z94A 1PQ5A 2BVRH 2QY0B 1MKWH 4MNVA 3PRBA 3TGKE 5LH8A 1SQAA 1MTWA 4IGDA 1O2RA 2BY5X 1CBWB 2ESTE 1O2SA 3M36A 1XX9A 1GI3A 3K9XB 4UONA 1CO7E 3AW1A 4CR9A 2ZHDA 3H7OA 2A7JA 1P06A 1YKTA 1SSXA 4B6EA 1GVZA 1ZOMA 1TOCB 2J98A 1DUEA 2R2WU 4AFUA 2FESH 1PJPA 8GCHG 1FIZA 1K9OE 3RM2H 1DLKB 1P2MA 2P3TB 1NFUA 2O9QA 2Y82A 2BQ6B 1GBTA 4UDWH 3QX5H 1GJAB 5EXLA 5FL7D 3EA9A 1AWHB 3BEIB 2BDGA 3OE7D 6CHAC 2VGCC 4X1RU 1C4U2 1W13U 2QE7D 1TGBA 1DS2E 1TB6H 1CE5A 1UCYH 4ISOA 3U8TH 1C9TA 1G36A 2VWNA 3MI4A 2Z3EA 1HAZB 1GVLA 1F92A 3V7TA 2XBYA 3BTFE 1K1MA 1WYKA 1W12U 3NXPA 1LVYA 4OS2A 5BRRE 2BHGA 2UWLA 1KXAA 4NWKA 3TJUA 1SR5C 3FP6E 4U01A 1HAPH 1C1PA 5LPRA 2QF0A 3LU9B 5T3HA 4DGJA 9LPRA 2BD9A 1KSNA 2JH6D 2R0KA 2UWPA 2ZFRH 4A92A 2LP6A 2XNDD 4IBLH 1GDQA 4ZKSU 4B6FA 2ZGJA 1S0RA 1VCWA 1ELGA 3ZZ5A 3VB3A 1IQLA 3F9FA 2AGIX 3ZVDA 4JZIA 1ZGVA 1NRPH 1TNGA 1ZYOA 4MPWA 4WXVA 2OD3B 2OC1A 2Z9KA 1AFEH 4THNH 1OKXA 2V3OH 1CGIE 1A2CH 4K1EA 3MWIU 1V2LT 4BAHB 1EFRD 1P0SH 3HKIB 1JIRA 2M5TA 2Y7ZA 1IHSH 1O3EA 2AEIH 2F9PA 2CHAB 5FX6A 3RU4E 4ZCNA 1BCUH 4I7YH 1KXEA 1LKAA 1HXEH 1EKBB 1FQ3A 1H4WA 1LQEA 2C8ZB 5EW1H 2JKHA 2GKVE 1TRNA 1NFXA 5AHGH 1CT0E 3RXKA 5PTPA 4AFZA 1BQYA 2WPMS 1P2QA 4SGAE 1A46H 4WVPE 4D76A 1TRMA 1WQSA 2ZGHA 3B9FH 2F83A 1TIOA 1VCQA 2H9TH 1ZTJA 1WV7H 4FU9A 1D9IA 1Z6EA 2PV9B 3RXJA 1NO9H 2G55A 4OS7A 3ZVBA 4B74A 1GBDA 3RXOA 2VIQA 2V3HH 2FI3E 1DSUA 4X8TH 3GYLB 2Q6GA 3EGKH 1OYQA 3FN8A 3PRDA 2NWNA 2P8OC 3M3VA 4ABJA 4NIVA 2XC0A 1Q31A 3OY5U 1EAIA 4A6LA 2JDID 1F0RA 2BDYA 4O97A 1TPPA 4NSVA 1EPTA 5IYTA 5C1XA 1A0LA 4NIWA 3F2HA 3B23B 1DWEH 3BN9A 1EPTC 4FUHA 3FKSD 1C2JA 3P8NA 1AFQB 1TBQH 5FX5A 1T8MA 5DPAA 3TLOA 1A5GH 1KIGH 4R8TB 4SGBE 1K1NA 2GCHF 4GSOA 1ZJKA 1EATA 1CA0B 3A7WA 1MAXA 3RXSA 3A7YA 3LKWA 3M5MA 1AZZA 3TH2H 1PFXC 5EXNA 3S9AA 1THRH 2FOBA 2EI7A 4D7GA 3F0PA 3ATKA 1MD7A 1GHXH 1AMHA 3SU5A 1MTSA 1O2WA 1P57B 1ZSLA 3SJOA 1O3GA 2D26C 3Q3KA 5A8YA 4AB8A 4JZ1A 2WINI 5HKKD 5C0TA 3Q76A 1BB0B 1TNLA 4Y8ZA 2ZU5A 3S7HB 1JMOH 2KFWA 1VKYA 4IS5A 2NU1E 2ZPRA 1AUJA 5GNDA 4MLFB 3UTUH 3T29A 3DFLA 2A5IA 1NT1A 1TFXA 3QK1A 5JB8S 4LZ1H 3RXIA 4XRNA 2ZZUH 2WPJS 4OGXA 1SLVB 2GT7A 3SNDA 2A0QB 1N8OB 2WPLS 4TY7A 4X2YA 4KTCA 3M5OA 2QIQA 4GAWA 3PO1C 5F03A 3A7VA 5FAHA 4A1XA 4AX9H 1ZMJA 3STIA 3SU3A 1E34B 1HJ9A 2CJIA 3PB1E 3RXUA 3GY8A 1CGHA 1EZQA 1ZHPA 4Y11E 1L1GA 3TJNA 2Y5FA 2QXIA 1Z8RA 3LC5A 4Z1MD 1FV9A 1C4Y2 4XBCA 2G8TA 1L4ZA 1NY22 1LVMA 3V13A 2LPRA 1PPHE 3PV2A 3EDXB 3OY6U 5DP7A 3SGBE 1AE8H 1SFQB 3BG8A 3ZZDA 4YO9A 3S0NA 1GI8B 1J17T 3DA9B 1T4UH 1TAWA 2VJ1A 3U9AH 2P16A 3S69A 3V12A 3N99A 2FP7B 3Q77A 4Y7BA 2ZEBA 1F5KU 1CU1A 3AAUA 1TWXB 2FO9A 3BTQE 1D3TB 3RXPA 4ACBA 1P3CA 2OQ5A 1O3HA 1DSTA 2J97A 1MAYA 3OSYA 1O2YA 5E8EH 3U8OH 1ABJH 4OS1A 3BTWE 1G2MA 1C5UA 1LDTT 3RC5A 2FTLE 3OAAD 2ZHFH 2LELA 2KM0A 1BHXF 2O8LA 2ZPQA 4ABAA 5B6OA 1FIWA 3HPTB 3TGIE 3FP8E 1QIXB 1PPGE 3LPRA 1OWJA 1UMAH 3ATMA 2A32A 3T26A 4ABHA 1YGCH 4J2YB 3RXQA 1UCYE 3SQHE 1SQOA 3SNBA 2CV3A 1W0YH 1UVPA 1HAVA 4INHA 3KF2A 3U1JB 3E6PH 4FUDA 2FYRA 1K1LA 2Q6FA 1H8IH 1GHVH 2IOTA 3SJ8A 1GCTB 1AGJA 1GHBG 3F3BA 1V2MT 1VZQH 4CH8B 5EQQA 2B5TB 3BIVH 1QZ8A 4FXGH 1BRCE 3DSPA 4UFGH 5FBIA 5DP4A 1TBRH 2J4IA 2HLDD 2ZFSA 2QYIA 1O2IA 3TH4H 4TWWA 3VFEA 4YT7H 2FIRH 1COWD 1ZGIA 2KCOA 1RXPA 1TPSA 5EQSA 3GDVA 4KP0A 3D23A 5HMAA 2BXUH 2TGTA 3UAIC 2UUKB 3A83A 4INLA 4ZUHA 1NM6A 3KHVA 4BXWA 1C5XB 3ATWA 1TX7A 2XWBI 3DSOA 2ZGBH 3WWBA 3SV8A 1O2GH 3GCNA 2ZFFH 1FUJA 5HYOA 1GWAA 5C1YA 4WH6A 1EB2A 1O37A 3PWBA 1FXYA 2XXLA 1ETTH 4WMDA 2Q1JA 2ZDKA 3VPKA 4X8VH 1BTUA 1GBCA 1BJUA 1JBUH 5A0CA 1GI6A 2XWAA 3ELAH 3EAJA 3MNBA 1ZSJA 3QZQA 2PKSB 3K6ZA 3LH1A 1AU8A 5FPTA 1K1PA 1T32A 4X6OA 1C2IA 3MU5A 1SGRE 1ZTLA 1AHTH 1SQTA 1O2TA 1EZUC 4KKDA 4OS5A 1IHTH 3B8JA 4K2YA 3F9HA 1BA8B 1KLTA 1QJ1B 1ZLRA 3GY4A 1V2RT 1FAXA 2ZCLP 5ABWA 3PM3A 1D6WA 4O9VA 1GBKA 4HTCH 1HJ8A 2AH4X 1GI7B 1P8VC 1MKXK 3H5CB 4AFQA 8KME2 1LTOA 4FVDA 5GPIB 2STBE 3H7TA 5CE1A 2YNAA 2I6SA 1QB6A 1ELVA 2ALPA 4XDEA 1YCPM 6GCHF 3DSGA 2B7DH 1OPHB 4H42U 2GTBA 1UTQA 4XD7D 4Z6AH 1UVTH 2ZGXH 1TALA 2GCTB 5F8XA 3KEEA 1SLWB 1AZ8A 2C8WB 4ZKOU 4AOQA 2OCVB 3C1KA 5CHAB 1UTMA 1DY9A 1C5ZB 4D9QA 2OXSA 5L2YH 1EX3A 1G32B 3MQKC 4BANB 1GJ5H 1G2LA 2IPQX 1C5OH 3GYMA 3SBKA 4ABGA 3I29A 5F6MA 3SUEA 1AB9C 3A89A 1NRNH 1ZR0A 5GXPA 5KGOA 1AY6H 2V35A 1FMGA 4MNXA 2G4TA 3UWJH 5JDUB 4TPYA 2VVCA 4B75A 2ZHWH 2ZWLH 3VGCC 1SMFE 2BY6X 5C1UA 1P9SA 5C0UA 4KELA 3OEED 1SGPE 3SNEA 8ESTE 3VB5A 5LPEA 3MU1A 3TJVA 3D65E 2FTMA 1G3BA 2KX4A 2J34A 3D62A 3NRLA 1WSSH 4I86A 1GHWH 3VB7A 2HPPH 4IN2A 5B6LA 6LPRA 4DT7B 4M9FA 2G52A 1RTLA 4ABEA 3A81A 2AFQB 3KN2A 2ANYA 2CN0H 2BOHB 1ETSH 1QRWA 1ANBA 1H1BA 3RXAA 5HM9A 2O8UA 4BTIB 2C90B 1CGJE 4BOHA 2TIOA 1KLJH 9ESTA 1QRZA 2YMSB 1YPMH 2SGEE 3ZVFA 1EUFA 5K0HA 1SGDE 3CNRA 2GZ7A 1FN6A 1C5VA 3A84A 3FAOA 3PLBA 1SHYA 2OC0A 4MDSA 4I31A 2W6JD 3UPEA 1AKSA 1A7SA 2GMTB 3UOUA 3FP7E 1MTNB 1W0ZU 3RC4A 1SLXB 4CRCA 3JZ2B 4F4OC 2FI4E 2ZA5A 1EJNA 1SGEE 5E2OA 3RXLA 3A82A 4TY6A 2YOLA 1BMLA 4ZHLU 1C2MA 1D6RA 2R3YA 2Y5GA 2P8OB 2WPDD 1Y5UT 3N7EA 3RXBA 3STJA 1GGDC 1HAYB 3HGPA 1GI9B 1TGNA 1G3CA 1Y5AT 3T62A 2PKAA 1TGCA 3BTDE 1NFYA 2C3SA 1BRUP 3FFGA 5A8ZA 1AN1E 1ZPBA 4WMEA 3KGPA 4IMZA 3WW7A 1W14U 2H6MA 1B0EA 1P09A 4AG2A 1LO6A 1Q2WA 2D2DA 3OU0A 1ZRBA 1FY5A 3ZV8A 2AGEX 3R0FA 3C27B 1OYTH 3U1IB 3O8DA 5JPMH 1W0JD 1LVBA 1V2QT 1ANEA 3VEQB 1GI1A 2BXTH 4OS4A 3ZVCA 2ZFTA 1DM4B 2PLXA 2ZG0H 1ESAA 1VCPA 3O8RA 2D1JA 2AMDA 1MBMA 2OINA 3FOAA 4ABFA 5SGAE 4NFFA 1O2PA 4HG6A 3SV9A 4WXIA 1JWTA 1S6HA 1S82A 3AW0A 2GP9B 1MMJN 1ZRKA 1O30A 1OSSA 3TK6A 1C2DA 1YP9A 3KNXA 3P6ZB 7ESTE 1P05A 2D8WA 1RRKA 2BOKA 2BD3A 1ELFA 2BLVA 1G9IE 4I8HA 1UJ1A 2PW8H 1NBMD 2P93A 2G4UA 2J92A 2GVFA 3ITIA 4K1TA 1HAOH 2KZ4A 3A8CA 2WSSD 1GHAF 4HI3A 2PGQB 3PV5A 4AGJA 1ZTKA 1Z1JA 2Z3CA 2FWWA 4ZXYH 3RMMH 2RDLA 1IQGA 4X8UH 1O3FA 3PMHB 3HATH 3W94A 1S81A 3L33A 1GHBF 4NWLA 2W3IA 1OP8A 3OX7U 1HV7A 1A61H 1RIWB 3E91A 1FAKH 4O3UA 1YCPH 1C4V2 2GZ8A 1TX8A 2RDEA 4RKJB 4ZMAH 2JH5D 2XBVA 1ELDE 3K2UA 2RFKC 4WWYA 2XC5A 2ODYB 1BTYA 2IJOB 2H9EH 1HJAB 1NN6A 5J4QA 3F9GA 1AUTC 3QWCH 1RFNA 1GCDA 4WY3A 1S6FA 2L6OA 3QO6A 1CA8B 1DFPA 3SO3A 2F3CE 2Y81A 1ID5H 3UIRA 1PYTD 3LONA 1FY4A 2XTTB 1V2NT 1C5LH 1O2JA 2O8WA 1UO6A 1GL0E 1ZMLA 1N6XA 1TA2A 2QF4A 2ZGCA 1TNHA 1K21H 5HIYA 4FUJA 3V0XA 2BX3A 2BY7X 1G37A 1O5AB 2NU3E 5EG4A 5HIZA 2XBXA 1SB1H 3LIWA 1BTWA 2BQ7B 1H9LB 1PQAA 4ISNA 3LT3A 1TLDA 2A4RA 2GDEH 2AGGX 3UR6A 1JRTA 2A7CA 3S9BA 1C1RA 1SKYE 3ATIA 1O3IA 1HIAA 2WV4A 4ACAA 3UQOA 6GCHG 3ZVGA 1XKAC 4LOYH 1EOJA 3VXFH 3ZZ4A 5HGGA 2FOFA 4MNYA 3QGJA 2VIPA 1LHCH 1SI5H 3M3TA 2NU2E 2SGQE 1ARCA 4FUCA 1O34A 3A8BA 4ISLA 2P59A 4NA8A 2AIQA 4U2WA 1YPHE 3I77A 3RXMA 1UVOA 4NIYA 3RXEA 2WYGA 1AQ7A 1MQ6A 3DHKH 4WMFA 1C1MA 4I8LA 2ZI2H 1AWFH 1DWBH 4F55A 1W10U 1O2UA 2UUYA 2BYAX 5CDFE 2BZAA 1YPEH 3F0OA 3ZYDA 1EAWA 1ELAA 4ZKRU 1CHOF 2F9NA 1QA0A 2PR3A 5L6NH 4GUXA 4IN1A 1TGTA 3UWIA 3BG4C 1KLIH 1NU7B 1YYY1 2YMSD 1QNJA 1B0FA 2IN2A 2M2AA 2VU8E 1TQ7B 3A87A 2HOBA 3N7DA 3UNRA 1GHYH 1RD3B 2GD4B 3Q3XA 4O3TA 4WH8A 1WOFA 1QY6A 1Z1IA 3QTVH 1OXGA 1BBRK 1IQMA 3HK6B 3M37A 5FPYA 4JZEH 2TRMA 1IQJA 3R3GB 2W3KA 2R0LA 1WAYB 3NK8A 1YM0A 3RP2A 1SPJA 4AZ2B 1ZPZA 1OHHD 5DN6D 1P2JA 2O8MA 4GLYA 4JK6A 4Y8XA 1H8DH 2J38A 1QRXA 2LNCA 2OBOA 3LGUA 2BM2A 4FUFA 1VJAU 3SORA 2OQUA 2P95A 1YBWA 3E0NB 3GISB 4Q7XA 1LHDH 2JETC 2EY4C 3ZZCA 1FZZA 4RKOB 2GT8A 2PTNA 2ZCHP 3NCLA 5FPSA 2ZPSA 2BLOA 4XSKU 3PROA 3BTGE 2PHBA 2VB0A 3VXEH 2H5CA 3GICB 4HFPB 4AORA 5T6FA 1FPCH 4XFQA 3RLWH 4AYYB 4UFDH 2KR7A 3MNCA 1FY3A 2WUCA 1P10A 3EYDA 1HBTH 2XCNA 3I78A 4X1NU 1GBMA 1SGNE 3F9EA 4YM9A 1TX6A 3NPSA 1AI8H 4K60A 1K1JA 4I8KA 3UNSA 4NIXA 2KAIA 4VGCB 3N7OA 3T28A 2J94A 1CBWC 2ZU3A 3ZZBA 2ZNKH 3RC6A 3CS7A 5T6DA 4B2BA 7GCHG 3QTOH 3S9CA 1BMNH 2ULLA 1K0HA 1GPZA 4CHAB 2BLWA 1P02A 1TBZH 3HGNA 1T31A 3MU4A 4XBDA 2PFEA 1V2UT 4CRFA 1C1WH 1KXBA 1KDQB 1THSH 2O8TA 2SGDE 1MH0A 1BUIA 2K8IA 3UY9A 3ZZAA 3BV9B 1H9HE 3LGTA 1OOKB 1VITF 3MFJA 1F0UA 1NRSH 3FANA 1TE0A 3SUFA 1QHRB 2J95A 1MBQA 5C94A 2Z7FE 2FLRH 4HZHA 3SGQE 1UHBB 1V3XA 3U69H 2BZ6H 3T27A 3SV2H 2DE8A 1IQNA 4K8YA 5EJLA 1FONA 1DDJA 5EW2H 1UTJA 1FJSA 4Q4LA 1XUIA 4E7RG 1H9IE 3SV7A 3ZYEA 4DW2U 3S7KB 4B2AA 1P2NA 1YPHC 2CGAA 1GI4A 5C17A 4X1QU 1TNIA 2QCYA 2A2XH 3FZZA 2H5DA 1SOZA 1K22H 4DJZB 1TGSZ 1P11E 1P2OA 1YLCA 3RXRA 2H2ZA 1LKBA 2GV6A 3SUDA 1IOEA 1IQKA 1QL7A 1O2XA 4P02A 1GHAG 1EOLA 3M7UA 1TMTH 2V0BA 1O32A 4K3JA 3BEUA 5EIYA 3SJ9A 1SGCA 3CENA 1BBRH 2XCFA 1LPKB 2FOMB 4XOJA 1TRYA 3MU8A 4XBBA 1FLEE 1L1JA 1QGFA 1ACBE 2FPZA
chains in the Genus database with same CATH topology
1XMNB 1ZHRA 2CHAC 2CXVA 4FU8A 5DO4H 1D3DB 1PQ8A 1XXDA 1W7GH 4X2VA 1PPEE 2OBQA 1ZZZA 1P2KA 4E7NA 1LMWB 1A1RA 2BDBA 3SUGA 2QC2A 3PMAB 1P04A 2WYJA 2JH0D 2PSYA 2WPHS 1O5FH 3IITA 2SGAA 4J1YA 4JK5A 3QN7A 4DURA 4O03A 5HM2A 1QL9A 4YT6H 2ZDMA 1PQ7A 1YC0A 1Y5BT 2BY8X 2PKAB 3SU2A 3PWCA 4UE7H 5A09A 5E0HA 1NESE 1RS0A 3SOSA 1HAHH 1RJXB 2Z9JA 4K5ZA 2BB4A 1O5GH 1A0JA 1ELCA 1O31A 1O2MA 1RTFB 2FLBH 3P70B 3MH7A 3BF6H 3RXVA 3URDA 4FUEA 2BD5A 5L30H 1P9UA 3P95A 1HLTH 1QA7A 1ZSKA 4Y8YA 1Z8IB 1GMCF 2TPIZ 3MMGA 2ZDLA 1AFQC 1C5QA 4I8JA 1C1QA 1GBAA 1MZAA 3K6YA 1XUGA 5C5OA 1N1LA 1CA0C 3M7TA 5C3NA 3E0PB 1TYNA 3M5LA 4Y76A 4UEHH 5JBAS 2HRVA 4CR5A 1ORFA 2G5NA 3RXGA 3SJKA 1QJ7B 3ODDA 3NZIA 1ELBA 5F8ZA 3K65B 2GV7A 5T6GA 2B9LA 1HAIH 4E06H 4IC6A 1GJCB 3HK3B 1ESBA 1C5RA 2ANMH 3QLPH 3BSQA 4NSYA 3TK5A 2ZQ2A 1CHOG 1OP0A 4CBNA 2Z6BD 5CMXH 1DX5M 3BTME 1J16A 1Z7KA 1RGQA 4NA7A 6CHAB 2VGCB 3KCGH 4DY7B 3A8AA 1SFIA 1P03A 1EJMA 4NCYA 4UFEH 2ZC9H 1V2JT 2A2QH 2J9NA 1DICA 3NUMA 2HALA 1G3EA 2BDCA 4ZHMU 1N8OC 4B76A 1HGTH 4X0WU 1P12E 3P8GA 1Y3YA 2BLQA 1C1SA 1TNJA 3TU7H 3PMJA 2A7HA 2G81E 1GJ8B 3OTJE 4JYTA 3TK9A 4H6SB 1C2EA 1GL1A 1O3OA 2W7UA 5FHTA 5ETXA 2SGPE 4BXSA 3SNCA 2FOAA 1D3PB 2EI8A 1B5GH 2B0FA 3ZVAA 1C1VH 5LPFA 1NPMA 2I6QA 2IPHA 3A7ZA 2ASUB 3EQ0H 5EPYA 3RXTA 2VH0A 4U30A 2OP9A 4HGCA 2BD4A 2BX4A 3FVFB 4QT8C 2F91A 1A5IA 5EU8A 1FNIA 1GDUA 5JBCS 3MNXA 2AMQA 1GBFA 3BTEE 2J2UA 3PLPA 1DOJA 1NRRH 4K69A 1PPCE 1LVOA 1J8AA 1EAUA 1GJDB 7LPRA 3GY5A 5JYIA 1D3QB 5FBEA 1RTKA 4I32A 3PV4A 1SHHB 2EEKA 1C1OA 2TBSA 1E36B 1EB1H 2FDAA 1QBOA 4ZH8A 1BRAA 1HNEE 1VR1H 4H6TA 1HB0B 1BIOA 1ABIH 3E3TA 2ZTYA 1TA6A 1O3MA 2SFAA 1G30B 2A5AA 5DKMA 2F9OA 4KGAA 5K7RA 4ZXXH 1GBJA 1WU1A 2QAAA 1TPAE 4ZHAA 1LPZB 4JZFH 3F68H 2VWLA 4UFFH 3VB4A 4JYUH 3P17H 4CBOA 3P8FA 1QCPA 3RLYH 1BTPA 4LK4A 3AASA 4DOQA 1QURH 2VVUA 2G00A 1AVGH 5EQRA 1OWKA 2HNTE 7GCHF 1TABE 3A85A 3RXFA 4RN6A 3BEFB 4GHQA 1A5HA 3T25A 1MU6B 1HAXB 1VITG 2QV1A 1BT7A 1GCTC 4MPXA 1Y3XA 3MOCA 1CT2E 1GDNA 1MKXH 1XUKA 1KY9A 1OWDA 4X1PU 5I25A 1BRBE 3MO9A 3UQVA 4AN7A 1BOQA 1F7ZA 1EPTB 3LOXA 1O2ZA 5GWZA 4TPIZ 2HNTF 1V2ST 2ZTXA 3KQEA 3RDZA 5DP6A 1QL8A 4Q2KA 1GJ4H 1CT4E 1C2HA 1DXWA 5HXFA 1HYLA 4ZAEA 2ANWA 1VITH 1DITH 2C4FH 2R2MB 4Q80A 1L1NA 1P3EA 3QGNB 1BBRE 4JCNA 1NROH 1DWDH 5DP5A 1XUFA 1TQ0B 1BMAA 4X6MA 1GBLA 3SZNA 4A1TA 4MNWA 1K28D 4Y71A 1KXCA 5E0GA 3SW2B 1O3NA 1B7XB 2SNVA 1VGCC 2UWOA 4NGAH 2GGVB 2PTCE 3EA8A 4BAMB 2F9BH 2PSXA 1YPKH 1K1IA 1FI8A 2F9VA 2V6NA 2VWMA 4RSPA 5A8XA 1GG6C 1UK2A 3SHCH 2A4GA 3MYWA 4Q7YA 1C2FA 3O8CA 4ESTE 1UTPA 2KAIB 3NKKA 1HDTH 3M5NA 3SGAE 5DP9A 3PO1B 1O2NA 1V2VT 1NZQH 1CQQA 3KQCA 1EXFA 1Z8JB 1BZXE 1AO5A 2P3UB 2ZFQH 1VJ9U 1XUJA 4YLQH 1FDPA 4Y79A 1T7CA 2ZECA 1EZXC 1GI0A 5EPNA 3BTTE 4LXBH 2GCTC 1WTGH 2FM2A 1O2KA 2CF8H 1MTUA 3MTYA 5CHAC 3TVJB 4BAQB 3WY8A 3KQBA 1UTNA 1L2EA 3EE0B 5E0JA 2HPQH 1INCA 3LC3A 2Y6TA 1PYTC 3Q00A 3LGWA 4ASHA 2VNTA 1G3DA 4AGKA 1O39A 3LDXH 1V2WT 2A1DB 2VIWA 4F49A 4DIHH 1QBNA 2ZFPH 5JBBS 3ODFA 2BMGB 2QGRA 2QXGA 1TMUH 5DGJA 2ODPA 1SVPA 1W8BH 1SL3A 4INKA 3T2NA 5JB9S 1GMCG 4CRAA 3SI3H 4DVAU 3TJOA 5EGMA 1QTFA 2XC4A 1MU8B 1O2QA 1CHGA 1C5TA 3MHWU 4Y6DA 1MD8A 5DJ7A 4B71A 1SGYE 4IMQA 4YTAA 4FVBA 2QA9E 1UTKA 4MG3A 1OWEA 1O5EH 1HUTH 2RG3A 2R9PA 5AVDA 3UNQA 2P94A 3BTKE 3OYPA 1F0SA 4K1SA 1THPB 1QQ4A 1N6YA 1F5RA 1HXFH 2W7SA 4Y0YE 1MCTA 4YOIA 1S5SA 2WUBA 1Y3VA 1SGQE 1F2SE 2HNTC 2W5EA 2VH6A 1L4DA 1HAVB 5DG6A 1PPBH 1LHEH 1BMMH 3UR9A 2XW9A 6ESTA 1O3AA 1BJVA 3A7XA 1GMDF 3T5FH 3UOPA 3LJJA 2ZU4A 4B1TA 1O3LA 1O3CA 4FUBA 2ZF0H 3A8DA 1LHGH 2HGTH 4X8SH 1ARBA 1A3BH 1KXFA 2TGAA 1KTTB 5AFYH 1O0DH 5TCAA 1DANH 1O3KA 3LGIA 3GCHC 2GMTC 1Y3UA 2PGBB 4XE4A 1MTNC 1W11U 1YF4A 4K8BA 7KMEH 2BQWB 4X6NA 1O35A 3RM0H 2TGPZ 2ZP0H 2H1UA 1J14A 4ISIH 1T8LA 3BIUH 3QZRA 4R0IA 1KXDA 2XNIA 2FOHA 1C5WB 2FS9A 2A4OA 3PLKA 1BTXA 1OX1A 5TJXA 5J4SA 1CSOE 1SOTA 5G4BA 1D4PB 1V2TT 5LGOA 5ESBA 4IW4E 3ZZ9A 2FODA 3IG6B 1JIMA 3M35A 2FMJA 4X6PA 1S0QA 3CS0A 2A4QA 3FZDA 1V6DA 1KTSB 2FOGA 1S85A 4DCDA 1ANCA 2BY9X 2A5KA 3PMBB 5C20A 5GCHG 2GDDA 1NTPA 2STAE 1EQ9A 1DLEA 4NZLA 1DT2A 4JZDH 1GBHA 1GMHF 3URCA 1QB9A 1DXPA 4JYVH 3RMLH 1UVUH 2GZ9A 1HFDA 1T8NA 2FYQA 2QXHA 3DT0H 3PYHA 1HRTH 2GX4A 4D7FA 3HKJB 2VIVA 2BVXH 3F1SB 1CVWH 1QBVH 2BDIA 3D49H 1NFWA 1PPFE 4Y0ZE 2UUFB 3GCTF 4BNRA 4CRGA 1Y3WA 1SBWA 2ZKSA 2F9UA 3ZV9A 1C1UH 3CP7A 3MNSA 1QQUA 1XVOA 3UFAA 2B8OH 4H4FA 1WUNH 1LPGB 3DD2H 3SNAA 4AYVB 1O3BA 5JBTA 2THFB 1C2LA 1JOUB 2ZO3H 1YPJH 3L3TA 1BTZA 1EAXA 3PTNA 2DUCA 5E2PA 1BHXB 2FEQH 2C8YB 1DPOA 1AB9B 1O2VA 1YLDA 2ZHEH 1IQHA 4BTUB 1GI5A 2OLGA 3A7TA 2ANKH 3SU0A 4B73A 3MO3A 1UK3A 2NU4E 2CF9H 2ZHQH 3VGCB 2SNWA 3L6PA 1GI2A 3SU1A 2XBWA 2VINA 4GPGA 1C1TA 1U6QA 2VVVA 5DP8A 2ZCKP 1RIWC 4CRDA 3AAVA 2OC8A 4GCHF 1HPGA 4FU7A 4KTSA 4NZQA 1GBIA 2WPIS 1P2IA 2Y80A 3MH6A 4YESB 2ZTZA 1HJAC 1M9UA 5ESTE 3A88A 2A45B 4Q7ZA 2C93B 5A0AE 2BD2A 1SGFA 4YZUA 2VWOA 4E05H 3VB6A 1HAGE 4AG1A 1A3EH 3RU4T 5EODA 3ZZ8A 1ESTA 1WCZA 3LGVA 3RUOA 1C2KA 4UD9H 1WQVH 1XVMA 3P8OA 1O5DH 2W26A 1NS3A 1Q3XA 4AB9A 4PROA 2OTVA 4BAOB 1IAUA 4YOGA 1SG8B 1AD8H 4ABDA 3RU4D 3GY3A 4X1SU 1ELEE 1GVKB 4FUIA 4YLUA 1O3PB 2XYAA 1QR3E 3M3SA 2H9HA 1BTHH 2Y7XA 2ALVA 3ENSB 5H4IB 1GJ7B 1O2HA 1W7XH 1AKSB 2NU0E 4ISHH 3ESTA 3GDUA 1ETRH 1YPGH 1SGIB 1TPOA 2ZDNA 5AFZH 2TGDA 2CMYA 5A0BA 2FOCA 1DWCH 1IQEA 1EP5A 1ELTA 1YPLH 1F5LA 1XKBC 1GGDB 3ZVEA 1HCGA 5GDSH 1EP6A 2PUQH 8GCHF 1OWHA 4X2WA 2XRCA 1P01A 3SV6A 2ODQA 3SI4H 2A31A 2EA3A 4JMYA 2BD7A 2AYWA 3SU6A 5AF9H 2DE9A 2PUXB 1SLUB 1C1NA 1Z8GA 5DP3A 1FN8A 3UREA 2VIOA 4MTBA 1O33A 3GCOA 2BDAA 3P92A 1NC6A 5C2ZA 2AERH 3LJOA 4NG9H 3KL6A 1BDAA 5IDKA 1ANDA 1LHFH 2HLCA 5EOKA 5L2ZH 3TH3H 2FZZA 1JRSA 4IC5A 2ZDAH 1SGTA 5C67A 2HWLB 3U8RH 1C5SA 3IWMA 2K1QA 1SC8U 1ZMNA 2BTCE 1VGCB 2PWXA 2RCEA 3PTBA 1C5NH 5C5NA 2RA0A 1XUHA 1EASA 1W3CA 2OUAA 4MVNA 4B2CA 3DUXH 4D8NA 1S83A 1C5PA 3RMNH 2AIPA 4TYDA 1V2KT 1IQFA 3GY2A 1GMDG 5GIBA 1O3DA 1GG6B 1AIXH 1Z71A 1V2OT 1UK4A 2RA3A 3E8LA 1K1OA 1J15A 1AE5A 1LQDB 3QDZB 2BVSH 1SGFG 3KQDA 3LGYA 3NWUA 5EXMA 1GBBA 3SN8A 1V2PT 2ZQ1A 2P3FH 2Y5HA 1C5MD 2QXJA 1TMBH 1TOMH 3SHAH 4CH2B 4DIIH 1GJ6A 1XXFA 5BPEA 3ATLA 4DG4A 2C8XB 1QFKH 1FY1A 4WF8A 4VGCC 1Z6JH 1O5CB 3SQEE 2SGFE 2OC7A 3JZ1B 5GJ4B 1NU9A 1OP2A 5DK1A 1NRQH 1MCVA 3A80A 1ZHMA 1UTOA 1X7AC 3UUZA 1JXPA 4A7IB 2EC9H 1MTVA 1MKWK 4TWYA 1QB1A 4CREA 4CHAC 3GOVB 1TNKA 1KDQA 3TITA 2QF3A 1Y59T 3ZZ6A 1AVWA 5F8TA 2G51A 2VIDA 1MZDA 2Z9IA 3W95A 1DY8A 3GY6A 2R3UA 3RXDA 4Z0KA 1A0HB 1GMHG 1FY8E 1DUAA 4FUGA 1UHBA 4BTTB 4I33A 3E16B 3G01A 2GCHG 3MO6A 4GVUA 2BD8A 3RMOH 4NA9H 1GBEA 1IQIA 2YNBA 5GCHF 4LZ4B 1UTLM 4MQAA 3ZZ7A 4KTUA 5I46H 4Y7AA 1E38B 1HIAB 1DVAH 4MPUA 1DE7H 1YCPK 2FI5E 3SJIA 3GCTG 1L0ZA 4GHTA 3TNTA 4Y10E 3M61U 3O8BA 3QUMP 1T8OA 1UCYK 1Y8TA 2BDHA 1UVSH 3AVZA 1E35B 3A86A 3TNSA 2Q6DA 4A1VA 2ZDVH 3DFJA 2ZU1A 1E37B 1EJAA 1O5BB 1WBGB 2EI6A 3RXCA 1C2GA 3LH3A 2ZIQH 4BAKB 4M7GA 1GHZA 3BG4B 3RXHA 1QJ6B 3E1XB 4D9RA 5FXLA 2G5VA 1S84A 1O3JA 3KIDU 1OS8A 3MH5A 1EZSC 4MPVA 4A5TS 3V3MA 1C5YB 3GCHB 3MH4A 2FOEA 2QN5T 1T4VH 4ABBA 1J9CH 1GJBB 1MUEB 1ZPCA 3F6UH 4OGYA 4X2XA 3TIUA 4ABIA 4GCHG 3E90B 1O2OA 4WJG2 1KYNA 1O36A 2FS8A 1TONA 3EA7A 3MU0A 2Z9GA 4NFEA 1W2KH 5FCKA 1WTHD 1BITA 2Z3DA 4ZKNU 2FX6A 3GY7A 2ILNA 2FXRA 1AVXA 3TPIZ 4I8GA 1GJ9B 4CRBA 2AS9A 3ZZ3A 4U32A 2ZU2A 2WPKS 1LCYA 1FPHH 3GDSA 1F0TA 1ZJDA 2Z9LA 1E0FD 3BTHE 2HVXA 4AFSA 8LPRA 1A4WH 2JETB 4ZROA 3TGJE 2PKSC 4OS6A 3U98H 1OWIA 1K2I1 3SU4A 4YOJA 1XM1A 2AMPA 2WV5A 5A2MH 1C9PA 5TCCA 2FX4A 1O38A 1PPZA 1MQ5A 3M7QA 3Q3YA 1O2LA 2UUJB 5FCRA 2Z94A 1PQ5A 2BVRH 2QY0B 1MKWH 4MNVA 3TGKE 5LH8A 1SQAA 1MTWA 4IGDA 1O2RA 2BY5X 1CBWB 2ESTE 1O2SA 3M36A 1XX9A 1GI3A 3K9XB 4UONA 1CO7E 3AW1A 4CR9A 2ZHDA 3H7OA 2A7JA 1P06A 1YKTA 1SSXA 1GVZA 1ZOMA 1TOCB 1DUEA 2R2WU 4AFUA 2FESH 1PJPA 8GCHG 1FIZA 1K9OE 3RM2H 1DLKB 1P2MA 2P3TB 1NFUA 2O9QA 2Y82A 2BQ6B 1GBTA 4UDWH 3QX5H 1GJAB 5EXLA 3EA9A 1AWHB 3BEIB 2BDGA 6CHAC 2VGCC