1UW7A

Nsp9 protein from sars-coronavirus.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
122
structure length
122
Chain Sequence
FLEVLFQGPNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NSP9
publication title The Nsp9 Replicase Protein of Sars-Coronavirus, Structure and Functional Insights
pubmed doi rcsb
source organism Sars coronavirus hku-39849
total genus 20
structure length 122
sequence length 122
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 1uw7A00
2J98A 3EE7A 5HIZA 5C94A 1QZ8A 5HIYA 1UW7A 2J98B 2J97A
chains in the Genus database with same CATH superfamily
1YM0A 3SHCH 1O5DH 3GY4A 1C4V2 2B7DH 3VB5A 4INKA 1HJAC 2VVUA 5IYTA 1EAWA 1F5KU 1Y3UA 3R0FA 1JIMA 1NRRH 1D4PB 2B5TB 3KYGA 1RRKA 5JB9S 2G5NA 4JK6A 1W7XH 1B0EA 2NU3E 3RMMH 1QA7A 2HALA 1FQ3A 2QYIA 3SU1A 1MTWA 4ABAA 1RJXB 4MPUA 5C0UA 3BTME 2STAE 4Y7BA 2L6OA 2Y5FA 3MO9A 2BD8A 4Q80A 5L2ZH 1KSNA 3SJOA 4WJG2 3BTKE 3PMJA 2ZHEH 1GJ6A 4YTAA 1J16A 5DN6D 3TK6A 2W7UA 1FDPA 1OPHB 1CU1A 3D65E 3P8OA 3OEHD 5LPRA 4JYVH 1W2KH 1J9CH 1ABJH 3GY8A 1V2KT 2C8XB 4UONA 1BTZA 1P11E 1DLKB 3PV4A 4A6LA 4YT7H 1GBJA 1JRSA 3MMGA 2RA3A 4BANB 2ZTYA 5DP6A 2WYGA 4INHA 4TY7A 4BAMB 1OWKA 2HLDD 1W10U 2H9HA 3E0NB 1AKSB 2A5KA 2G52A 1LVOA 2TGPZ 1HJAB 2WPIS 3UOUA 2Z3EA 2SGEE 1G3BA 2V0BA 5EXMA 3U98H 1RXPA 3OE7D 3TH3H 5EW2H 3ZZ4A 2BHGA 2C93B 3AAVA 1SFIA 3RLYH 5AF9H 3M5MA 2BXUH 4WMEA 2OCVB 3RP2A 2RDEA 5LGOA 5A09A 1CQQA 3A7VA 1HJ8A 1V2VT 1GHZA 2FX6A 4K69A 1NY22 5GJ4B 2Y5HA 4DT7B 4FUDA 3NWUA 1HAIH 1YPJH 1GJ7B 4MQAA 3F6UH 1O2SA 3AAUA 2BD4A 3GYLB 2BD2A 1WQVH 3TNSA 1SGTA 3SV8A 1EFRD 3RXVA 1F2SE 4HTCH 1AWHB 1ZTJA 1B0FA 4AGKA 3KGPA 1K21H 4XOJA 1CGIE 3P8NA 4I86A 1SGDE 5KGOA 1L1JA 4AOQA 4Y7AA 4WXVA 3ZVGA 2R2MB 5G4BA 2BMGB 1DUAA 4DGJA 1SGCA 5EGMA 3HATH 3DD2H 2ZHQH 1BDAA 3LJJA 2YOLA 2VGCC 1IHSH 1L1GA 1P06A 1C1WH 3AW1A 1N8OC 5C3NA 3SUFA 1OS8A 3E90B 1UTJA 2TGAA 3LT3A 3WWFA 5HMAA 1BIOA 3ZVEA 1HAVA 2YMSD 2UUKB 3STIA 1OHHD 1P2KA 2BX3A 1C5YB 1O3IA 2ZGHA 3M3VA 5EPYA 1BMFD 1O31A 1AMHA 1G9IE 4X1PU 4YLQH 1LVYA 3LOXA 2GJGA 1TB6H 3Q77A 7KMEH 1LCYA 1HFDA 1VZQH 4HZHA 4BXWA 1GJ9B 4UD9H 1GMHF 3PYHA 1TOMH 1GJBB 1GBDA 5A2MH 1EZSC 3PRDA 1Y3XA 2BD3A 3PV5A 3DFJA 4RN6A 4CH2B 1CVWH 2BQ7B 4O9VA 2SGDE 4WMDA 2ZCLP 5AHGH 4MNWA 1GVKB 1HDTH 1B7XB 1XXDA 3N99A 2GD4B 3UR9A 1NU7B 1O3PB 3ESTA 3UFAA 1BRUP 3SGQE 1IQGA 4M9FA 1W8BH 3BEIB 1EAUA 1SHHB 3PB1E 2CF9H 1FIZA 2FDAA 4IMQA 1LDTT 2BDCA 3CNRA 2Z6BD 1C5PA 5EXLA 1SKYE 2J2UA 2BZAA 4JZIA 3I77A 2VIOA 1QBNA 4CRFA 5F6MA 2A31A 1ELDE 1BOQA 2STBE 3RMLH 2BDHA 1C1SA 2AIPA 4K8BA 1SGIB 1JRTA 2GT8A 2R0LA 5GCHF 1AUJA 1WTHD 4TSFD 1ETRH 1S5SA 1O3KA 3OTPA 1TAWA 3U8TH 4FUEA 2A5IA 1MCVA 1GCDA 1IQFA 3KN2A 3UY9A 1QHRB 1O33A 1SI5H 3RXLA 1MKWK 1C5QA 1Z1IA 5GWZA 3QN7A 4TWYA 3M5LA 3ZZ5A 1W13U 3SGBE 1EZUC 2V3HH 4Q63A 3O8DA 3SNAA 3OFND 1WV7H 8ESTE 1LKAA 1NO9H 1TGSZ 3W1EA 1VJAU 3V0XA 4R0IA 2JETB 1MBMA 1QQUA 3F3BA 3QO6A 1KTSB 3ATMA 2OD3B 5AFZH 3WW7A 4JCNA 3ZV8A 1GBAA 1TX8A 8GCHF 2QXGA 1HAXB 1K1OA 4MNVA 3SNDA 4ZCNA 1AI8H 1DY9A 2CV3A 3A87A 1UTQA 1UJ1A 1SVPA 4GCHG 2WZQA 6ESTA 2ODYB 1DT2A 2GMTB 1ZMJA 3QTOH 4X2VA 3MNXA 1S0QA 4ISHH 1K28D 4FUBA 1DDJA 2V3OH 4IS5A 1ZJDA 1D6RA 1GGDC 4YXWD 1DXWA 1LPZB 1YCPM 4B2AA 8KME2 2ODQA 3UNQA 3D23A 2PW8H 3GCTF 1FPHH 1C1OA 1ANBA 4YZUA 3VB7A 5JBTA 1GHXH 3BEFB 5GXPA 1GDUA 3BTDE 3URDA 3FZZA 1A4WH 1XMNB 2FESH 3HKIB 1THRH 4KTSA 4DG4A 1GI8B 3KL6A 1SLVB 2JH0D 2BB4A 2AHME 4E05H 1E1RD 2VB0A 1V2PT 1EX3A 3HGPA 1ANEA 1QIXB 2GGVB 2WPKS 1G30B 3PRBA 1GBTA 1OWIA 1MTNC 1T4UH 1EAXA 4JYTA 4NSYA 2FIRH 2W3KA 1NRNH 4SGAE 1MMJN 2G4TA 2A7HA 2FYQA 2HWLB 3M3SA 1TABE 4NG9H 2ZQ2A 2J97A 1O32A 3ATWA 4GLYA 2BY9X 1AZ8A 4IGDA 5DP9A 2ZU2A 4UFDH 1GHBG 1QJ1B 3PO1B 3F9FA 3PMBB 1Z8IB 5DP3A 2BDIA 2SGPE 1QRWA 3Q3YA 1V2UT 2A2XH 1AU8A 1P12E 1MKXH 4ACAA 1H1BA 5I46H 4NIVA 1AE8H 2O8WA 2V3MA 1AGJA 1NRPH 5EJZA 1GI1A 1GJ4H 1P0SH 1S6HA 1MD8A 5CHAC 1ESBA 2D8WA 4X6PA 5AVDA 3BF6H 3HK6B 4Y10E 1C9TA 1VITH 4UE7H 3RUOA 1LQEA 3DFLA 1RIWB 4Q7YA 3T62A 3RMNH 1CA8B 1A7SA 3P70B 1GMCG 1GI6A 1P10A 5KEDA 1KDQA 3KEEA 5EG4A 2ASUB 4XBCA 2AS9A 2ZF0H 1SQOA 2F9UA 3QWCH 1O2OA 1MTNB 1O2GH 3ZZAA 1ID5H 3B8JA 2AYWA 2FMJA 3SU4A 2C8YB 3RXOA 1TA6A 4JZDH 1W14U 2J95A 1OXGA 3F1SB 4ZHLU 2B9LA 3RXGA 2ALVA 2PFEA 4M7GA 2K0QA 3MWIU 3F2HA 3DT0H 3LGWA 4OS4A 1LQDB 1C1TA 1YGCH 3A7TA 1LO6A 4RKJB 2A2QH 4FUFA 1DXPA 3UIRA 4JZFH 2FZZA 1TGNA 4YESB 2GTBA 1C5NH 2D2DA 2AH4X 1HAVB 1ANCA 4PROA 7LPRA 3SW2B 3NXPA 5DP7A 4ZHAA 4I7YH 1RTFB 2W7SA 3UR6A 1HNEE 2F4LA 2W6JD 4FU9A 1O5EH 1H8DH 1G3EA 1GI3A 2WPLS 4YOJA 4Y0YE 2J9NA 1AB9C 2IJOB 1TYNA 4ABHA 5L2YH 1DOJA 1YCPK 4X6OA 1SGFA 3SUDA 3V12A 4ABJA 3P17H 2C8WB 3U1IB 2I6SA 2FOCA 1WSSH 3T29A 3U8OH 2QF3A 1CA0C 1T4VH 3S9AA 1Z7KA 2WYJA 3RXHA 3TH4H 3VG8A 3N7EA 2XCFA 1BRBE 1E34B 3ZYEA 1TNGA 1P9UA 2AFQB 3OTJE 1F0UA 2ZECA 3ODDA 1J15A 3GS9A 2CHAB 3OSYA 4P02A 1GMDF 1NT1A 4GHQA 2SGAA 3RXCA 5FXLA 1C1NA 1SSXA 2A4OA 4UFEH 1ZR0A 2PR3A 2BDAA 5DO4H 4INLA 3P6ZB 1ZMNA 1XM1A 2ZGJA 1IQLA 2FOHA 1A0LA 4ZKNU 5T6DA 3BN9A 4KTCA 4Q2KA 2BLQA 1HAZB 1KYNA 4ZROA 4XFQA 1ZOMA 4AG1A 1FNIA 1WTGH 4O97A 2TIOA 2VVVA 4YOGA 4VGCC 1AB9B 3VFEA 1DSTA 2KFWA 2ZDKA 1QB1A 2FM2A 2QCYA 3QLPH 2WV4A 4NA9H 2ZFQH 1TGTA 3DHKH 1QJ7B 1ZJKA 2IN2A 2M5TA 1V3XA 4MNYA 1OWHA 1CA0B 1COWD 3RXIA 1SHYA 1JIRA 3Q76A 4F4OC 1NN6A 1UTPA 4K5ZA 3O8CA 1A3EH 2FO9A 1V6DA 3BIUH 3LGVA 1P05A 1JXPA 1ZHMA 3A8CA 4IC5A 3KNXA 2VH0A 2P3FH 2D1JA 1BJUA 1O2WA 4BTTB 2CN0H 1YPLH 4NIXA 1ELTA 2PTCE 2XNIA 2P93A 1Y3VA 3D62A 1AN1E 4Q7XA 1OWJA 2EY4C 1Z6EA 5IDKA 3SQHE 1CSOE 4A1XA 3RLWH 4NZLA 4UFFH 5ETXA 1O3JA 3RM2H 3UOPA 2EI6A 3SJ8A 5C1XA 1D9IA 1C5RA 2C90B 1D6WA 2FP7B 2R0KA 1SQTA 5E0GA 3AK5A 1TNHA 4I33A 1NRSH 3ZVBA 1VCWA 1HAGE 3LC3A 1T8NA 4K8YA 1NBMD 2HNTF 4P00A 1GI7B 1MZAA 1P3CA 1PYTC 1PPHE 1BT7A 1IQEA 1ZTLA 1A0HB 3LDXH 1HXEH 1GI5A 1W0ZU 1C5LH 3M35A 3SV2H 1ACBE 1H8IH 1MZDA 3DSGA 1P2IA 4MNXA 2HRVA 4Y71A 2CF8H 5E0HA 1Z8JB 1K1MA 3RXPA 4AC9A 4X8VH 1HBTH 1AFQB 1AY6H 1L2EA 3TNTA 1C5SA 3RXEA 1XKAC 4I31A 1F92A 1ZMLA 4Q7ZA 2ZHWH 4D7GA 5F53A 3RXJA 2JJ1D 1B5GH 1TNLA 3UQVA 4H4FA 4BOHA 1NROH 6GCHF 5FAHA 1XKBC 3TVJB 5FX5A 3M36A 5DP5A 1LVBA 3PMHB 1C5VA 4Y79A 3EGKH 1BJVA 2L74A 3HGNA 3A83A 4FU7A 1XUFA 2P3TB 4TWWA 4LZ4B 1O2PA 4GVUA 4BTIB 2A4QA 1TPOA 5GPIB 7GCHG 4D8NA 4ZHMU 1W7GH 5TCCA 4H42U 1BZXE 5TJXA 4Y6DA 1TWXB 3GY2A 2O8UA 3EE0B 1XXFA 2GCHF 2BDBA 1T7CA 4GAWA 3ATLA 3F9GA 3RXUA 1OP8A 1ZHRA 1TBQH 2QA9E 4UEHH 3H7TA 5CDFE 3ZVCA 1YPMH 1EXFA 9ESTA 2ZDAH 1JOUB 3GY7A 2ZA5A 1MTUA 1GHAG 2THFB 2O8TA 4MLFB 1FONA 2Z94A 4NIWA 2W5EA 4R8TB 2W26A 3BTGE 1AFEH 1L4ZA 1MKXK 3QGNB 3SUGA 2ZNKH 1UCYH 1XVMA 2DE9A 4E7RG 1GL1A 1ZGVA 1BMMH 1C2JA 2FI4E 1BUIA 1O2IA 1SGRE 1LHGH 2JKHA 2Z9IA 3SV9A 1GG6C 1QL7A 4X6MA 2G5VA 1MTVA 1ETSH 2WPJS 4K1SA 1YYY1 2BLWA 1QGFA 1UVSH 5BPEA 5GNDA 1SB1H 3V13A 3FOAA 5FX6A 1QB9A 1GBBA 1KXAA 1TGCA 1SGNE 4FVBA 3AVZA 2FI5E 2FS9A 3A8BA 2ZHDA 1V2WT 2A7JA 1WCZA 4OS2A 5ESTE 1S83A 1W11U 4JK5A 1ARBA 1RTLA 2WPHS 2J94A 1HV7A 2BY7X 4BAHB 4JZ1A 1DFPA 1C5ZB 2EC9H 4ZKOU 3RXQA 5B6OA 4AYVB 5DGJA 4AB9A 1V2ST 2GZ7A 1ZTKA 3M61U 2ZTXA 3ZZ6A 5J4QA 1SLUB 1A5HA 1BA8B 2ZZUH 1UTKA 1RD3B 4I8GA 2GZ9A 1WAYB 4CBNA 5BRRE 1GG6B 2BM2A 1XUJA 2SFAA 5ABWA 2EA3A 3KF2A 2UWLA 4OM9A 1T8LA 1VCPA 5EQRA 1V2NT 4FVDA 2ZCKP 3FVFB 1OP2A 3HPTB 3PLPA 1ESAA 2ZTZA 4K1EA 4NGAH 3P8FA 4I8KA 1RFNA 1IQNA 3SYJA 2VIQA 1O3LA 1O3CA 2XW9A 1EJAA 4IN2A 1PQ7A 4OS6A 1OX1A 2ZU3A 1TFXA 1YPGH 1V2OT 2GVFA 1BMNH 1DANH 1QBVH 3LU9B 3OEED 4YO9A 3T5FH 4DJZB 1AZZA 2OBQA 1KY9A 4BTUB 4O3UA 3A8AA 1G36A 3A7XA 1ELBA 4XBBA 2OK5A 1K0HA 1Z71A 3A84A 5IK2D 1XX9A 2G00A 4BAKB 2ZDLA 4B6FA 1GHYH 3RU4D 1MU6B 4WH6A 1OWDA 1PYTD 1ORFA 1VR1H 5EXNA 4ABBA 1QZ8A 2JETC 1HAPH 4IW4E 1GDQA 4X8TH 2VWMA 4I8JA 5C5NA 3PTBA 1V2TT 1FUJA 3LGTA 1BITA 2ZFRH 4CH8B 5FCRA 3NKKA 3LH3A 1UVPA 1NC6A 2W3IA 4IBLH 2P95A 1UTNA 3BTEE 1YY3A 2VH6A 3GDSA 2GT7A 1ELVA 1TMUH 1L4DA 1GJ5H 5LPFA 1P2MA 1XUHA 4ASHA 3Q3KA 1SBWA 2GMTC 3GDUA 1ZGIA 3U28C 1P04A 3U8RH 2UWOA 3V3MA 5EOKA 3EE7A 3BTQE 1SG8B 2C3SA 3MI4A 4WY3A 4Z1MD 2A45B 2FX4A 3FZDA 4Z0KA 1TIOA 4ISLA 3RM0H 2Y5GA 1SQRA 1HJ9A 1ZSKA 2OXSA 3BG4B 4ESTE 1BRCE 5EPNA 1P02A 1GDNA 2Q6GA 3GCNA 4RT0A 1AVGH 2ZO3H 3SQEE 2TRMA 1CE5A 4D9RA 4QT8C 1C2KA 3P95A 4ACBA 2PP6A 1DUEA 1D3DB 1FX0B 3P92A 1GMHG 1K22H 1AE5A 1YWUA 2VU8E 3M5OA 3AW0A 4X2YA 4XSKU 5EU8A 1K1LA 5A0AE 2VIPA 1D3QB 1TOCB 1EB1H 5EJLA 1ETTH 2C4FH 4Q4LA 1P8VC 1EQ9A 4ZAEA 3RDZA 4TPIZ 4OGXA 1ELCA 1GBIA 1O3AA 4F48B 3TGKE 1VGCB 1EB2A 2V6NA 3VB6A 1A1RA 1O5GH 4GUXA 1XUGA 1F0TA 1P2JA 1EP6A 1BB0B 2H9EH 1O2ZA 3GYMA 1SLWB 1Z8RA 2C8ZB 2XTTB 3GY6A 3PO1C 2BY8X 2H6MA 1Z6JH 2HVXA 1SGEE 3QUMP 4A7IB 2WPDD 2QF4A 2PKAA 1OYTH 2HNTC 2XNDD 5J4SA 4NCYA 1TQ7B 1ESTA 2BOHB 3A89A 2F9NA 2ZDNA 4MG3A 2LPRA 4XDEA 5GCHG 1UCYE 1IOEA 1O3OA 4JZEH 3W94A 1MBQA 2ZGCA 1QTFA 2GV6A 1F7ZA 2OUAA 2Y7XA 2ZGBH 4CRCA 1C2LA 2XBVA 1KXBA 2BQ6B 1S84A 1HAHH 2ZKSA 3CS7A 1VITG 1EOJA 1CHGA 2Z3DA 3HKJB 2FYRA 4NFEA 1E79D 1RIWC 4A5TS 4CHAB 1C5MD 4ABEA 1PJPA 1S6LA 4D9QA 1TNJA 1TRMA 1EZQA 4E7NA 3S0NA 4FOUC 4CRDA 1G37A 5DP4A 2G8TA 2ZQ1A 2ZP0H 1ELFA 4YM9A 3E91A 2VIVA 1GCTB 1CBWC 2GDDA 1ZPZA 3B23B 4WH8A 2BX4A 2Y81A 2PSYA 3RXTA 8GCHG 3GCOA 2PSXA 1A5GH 5A0CA 1W0KD 2BVRH 5C1YA 3SHAH 3SJIA 1SPJA 1P57B 2UWPA 3KQDA 5DPAA 3FFGA 1NRQH 3A86A 1MUEB 3OY6U 1UHBA 2WV5A 4I32A 4IC6A 4TPYA 1SOZA 2NU2E 2BOKA 1NBME 1CHOG 3SO3A 1Y3WA 2O9QA 3GCTG 1HYLA 2BQWB 3BTHE 1QJ6B 2A4RA 3O8BA 2RCEA 4B1TA 5F8XA 1C2DA 5FBEA 3W95A 1EPTA 3SV6A 3QZRA 3H7OA 1C1UH 1Y5AT 2CHAC 3KIDU 3H5CB 1H8HD 2G4UA 2IPQX 3KQBA 2QXHA 3GCHB 1OYQA 4HI3A 1TBZH 1BHXB 1F5RA 1O5BB 1P9SA 1UW7A 4UFGH 4ZUHA 1T32A 2FLBH 1C5TA 1C5UA 1CBWB 1F0RA 1LVMA 2ZHFH 1HRTH 2ZPQA 4DIIH 2P59A 1JWTA 1OP0A 1FPCH 2AMPA 2PGQB 4ZXXH 3GY5A 1QBOA 5EQSA 2AGEX 1H4WA 1TX6A 1GVZA 1EJNA 1C2EA 2F9PA 3KYFA 1O5FH 4MTBA 3VB4A 2ZG0H 2Q6FA 1YLCA 2FOGA 2BYAX 3RMOH 1ZSLA 1SGQE 3PV2A 5SGAE 5FBIA 1YP9A 3QDZB 3U69H 4B2CA 1E1QD 5DP8A 4J1YA 1DX5M 3GISB 2Z3CA 3AASA 1Q2WA 4RSPA 1PFXC 1QA0A 1BCUH 1UTLM 4THNH 3BV9B 3EA7A 1K9OE 4KTUA 2VJ1A 2PHBA 3Q3XA 1NFYA 1C5XB 2KCOA 1AHTH 1V2RT 3ATIA 4IMZA 5EW1H 2CGAA 3SI3H 1D3PB 4GSOA 4OS5A 2H1UA 2XYAA 3PLKA 2W6ID 3M7UA 3LIWA 3ENSB 1O2HA 2JH5D 1DS2E 3N7OA 1GI2A 3RC6A 3MTYA 1SFQB 4DVAU 1KXEA 2LP6A 4TYDA 1O5AB 1ZLRA 2CK3D 4SGBE 1HUTH 1C9PA 5C20A 1MAYA 5JB8S 3SJ9A 2XRCA 2BLVA 1EP5A 1ZRBA 1C1VH 1A0JA 1BTXA 3OU0A 1SLXB 1RGQA 1L1NA 1HCGA 1O34A 1TMTH 5GDSH 2ULLA 1CGHA 2FPZA 3A80A 3E8LA 3UPEA 1DWCH 2UUYA 3MHWU 2OC7A 1NM6A 3SORA 1WYKA 4YOIA 1HLTH 2CMYA 1DWDH 5JPMH 2UUJB 1C4Y2 2FOAA 1QURH 2JDID 2XBWA 2XC0A 5C17A 2J34A 2GDEH 1O2YA 5CHBA 2ILNA 4FUIA 4X2WA 1WXRA 3MYWA 1F0SA 1UVUH 1TA2A 1O36A 3MU1A 3LJOA 1AFQC 2QAAA 1BQYA 4K1TA 4H6TA 2VNTA 3RXRA 4MPWA 1EAIA 1C1QA 1TRNA 2Z9KA 3RC4A 2A0QB 1KXFA 1O35A 4JMYA 4X2XA 2LNCA 5EQQA 4DT4A 2VWOA 4AFZA 2BY6X 3DA9B 1YPHC 3UAIC 2BZ6H 3SU5A 3HK3B 3SU0A 1N6XA 2ZU1A 4H6SB 1GMDG 5L30H 2GP9B 2XOKD 4MPXA 4YT6H 3OYPA 4FXGH 5EIYA 2VVCA 2PKSB 3M3TA 1K1JA 3TK9A 1DVAH 1EKBB 4LOYH 4AYYB 2ALPA 3MH5A 1TLDA 3ODFA 3M37A 4K2YA 4WMFA 4DOQA 1GL0E 1P03A 1GJ8B 3L3TA 2ZFTA 4MDSA 2IJD1 2I6QA 1S85A 1SR5C 2JJ2D 2BVSH 2NU1E 4CRBA 1TNKA 4CRAA 3TJVA 3S9BA 2LELA 4E06H 2ZFFH 1NFWA 2VIDA 3D49H 1O2KA 2XWBI 2ZC9H 5EJ1A 2UUFB 5E2OA 2QF0A 1H9HE 3MNCA 4MVNA 3T28A 3QX5H 2FTMA 1A2CH 2QGRA 1NFXA 4RKOB 3OAAD 1Q31A 3NZIA 1GJDB 1O2LA 3FO8D 3TK5A 5FPYA 1S82A 3URCA 4MPVA 3ZZ3A 1SC8U 2PLXA 3F68H 1OSSA 1MCTA 4GPGA 2KR7A 1P09A 3SJKA 1GBKA 2FS8A 1PPGE 5HKKD 1DWEH 1TNIA 2IOTA 4YLUA 1GBFA 1O39A 1GBHA 2QC2A 2ZDMA 1BHXF 5FL7D 2P16A 3RU4E 1AVWA 5DJ7A 1EOLA 2YMSB 4Z6AH 2JH6D 4OS7A 2HLCA 1BTPA 3S69A 1BTWA 1BBRH 3VGCB 1KXCA 1SMFE 1GWAA 2BTCE 3LGUA 2ZCHP 1AIXH 3MH4A 3PWCA 1OKXA 1HXFH 2NU4E 4AB8A 1LKBA 4D7FA 1HIAA 1FAKH 3PWBA 1IQHA 1Y3YA 1LPGB 4RI0A 3SOSA 1QRZA 2PV9B 3KQ5A 1Z1JA 4ZKRU 3E0PB 4B75A 2FTLE 2ZI2H 2ZU5A 3A82A 1RTKA 4XD7D 2B0FA 3EYDA 1UHBB 3F9HA 5HIYA 2PUQH 3EQ0H 2TBSA 1LHFH 1FY4A 1FLEE 1MQ6A 3PM3A 3SGAE 5C2ZA 3RXMA 2WUCA 1FAXA 3LGIA 1D3TB 1TX7A 1KDQB 3LONA 1F5LA 1QY6A 1PPZA 3T27A 4Y8YA 2GCTB 5K7RA 2GZ8A 2ZU4A 1P01A 4AZ2B 4ZMAH 1EPTB 1AUTC 4U32A 3UWIA 2ANKH 4CBOA 1ARCA 2QN5T 8LPRA 1VCQA 2O8LA 3TITA 6LPRA 6GCHG 5LH8A 2OC0A 1AO5A 2QE7D 1E38B 3ZIAD 1DICA 1PPFE 2VWLA 3K6YA 5F03A 2KCAA 3DUXH 1EATA 4Y76A 3TJOA 1A61H 2GKVE 4NSVA 1XUKA 1SQAA 5T3HA 2KM0A 1GBEA 4IN1A 1O2TA 3NUMA 3FN8A 2KX4A 1QL8A 5A8XA 2PWXA 1XVOA 3A88A 2ZPSA 2M2AA 3K2UA 4LXBH 1WUNH 1IAUA 1O2NA 4FUHA 3WY8A 4RT1A 1J17T 3K9XB 1GJAB 1QR3E 1ELGA 2ANMH 4O3TA 2Z7FE 1EASA 2F43B 2GCHG 4F49A 4AFUA 1ZPCA 1O2UA 1ZRKA 4NWLA 1BMAA 2P3UB 2FEQH 3N7DA 4Y8ZA 2H2ZA 3MOCA 1GBMA 2Q1JA 3ZZBA 5DKMA 1O3FA 2DUCA 3MQKC 2G55A 1DY8A 1CT0E 2P8OC 3MO3A 1NPMA 3OX7U 4TT3D 2J98A 1TE0A 3CS0A 2AGGX 2BD5A 5KECA 1FN8A 2GV7A 1Q3XA 1AD8H 4BXSA 1WDIA 1P2NA 3ZZDA 4O03A 2FODA 1LMWB 4B71A 4XRNA 4X8UH 4AG2A 3DSPA 4JYUH 1UMAH 1C2HA 4HGCA 4K3JA 2AMQA 4AFSA 2TGDA 3NK8A 3MH6A 1NZQH 1TPPA 2YNAA 4TY6A 1GPZA 2OQ5A 1WBGB 1YCPH 2RDLA 1FIWA 4X1RU 2KAIA 1A46H 1O2VA 1UK2A 2K8IA 3A7WA 3F2FA 1HB0B 3UWJH 3PMAB 3BG4C 3I78A 3MNBA 4KGAA 4AORA 4NA8A 1PPEE 3RXFA 2QXJA 1FI8A 3KQEA 4NWKA 2NU0E 5LPEA 5DG6A 1O30A 4OGYA 1UO6A 3GICB 4BNRA 1Z8GA 1GJCB 4WVPE 3MNSA 7ESTE 3ZV9A 2GX4A 4AN7A 4HG6A 2P8OB 2A4GA 3RXAA 3LKWA 1YKTA 4CR5A 1IQJA 1EZXC 2HGTH 5JBAS 2O8MA 1LTOA 4NFFA 1SGPE 4LZ1H 5HYOA 1MQ5A 3BTFE 5FHTA 2ANYA 1SGYE 3C1KA 1VGCC 2VGCB 4K60A 1C2FA 2KZ4A 1O0DH 4WF8A 1V2LT 1E37B 1FN6A 4GCHF 1N8OB 1E35B 1BTUA 5H4IB 3VEQB 4A1VA 2R3YA 3SU2A 2J5UA 3EDXB 5DK1A 2TGTA 3LGYA 3ZVDA 4FUCA 3QZQA 3R3GB 1NESE 1PPBH 1O3MA 1FY3A 1UVOA 2AEIH 1C1MA 1JBUH 3SNCA 3A7ZA 1TPSA 2XBXA 5JBCS 1EUFA 1O2RA 3QK1A 3O8RA 3EA8A 1GHWH 3UTUH 1NS3A 4ASUD 4FUGA 2J38A 4CRGA 3TH2H 3A8DA 4ABFA 3MU5A 1BBRE 5HIZA 1G2MA 1AVXA 4CHAC 1C2GA 4KKDA 3VXFH 4ABIA 1VITF 4ISIH 1DITH 2AMDA 3TIUA 3E3TA 3PROA 1SOTA 5AFYH 2JIZD 4ABGA 1IQIA 1W3CA 1ZPBA 2RG3A 3TPIZ 3E1XB 3T26A 1DWBH 1LHDH 3BTTE 1FV9A 4DY7B 1C1PA 3K6ZA 4UDWH 1IQKA 3PTNA 1KLTA 3IWMA 2Z9LA 1QNJA 1GCTC 1T31A 5E2PA 3T25A 4ABDA 2BDYA 5FCKA 1C5WB 5E0JA 5A8YA 1H8ED 3S7HB 2XXLA 1P2OA 2EI7A 1GBCA 1C5OH 1UVTH 2A5AA 2B8OH 2OTVA 5FPSA 3I29A 5TCAA 3BEUA 4ZH8A 1FZZA 3DCLA 1BTHH 1GHBF 3M7TA 3WWBA 3MFJA 3CP7A 1KLJH 1HGTH 1A3BH 2OQUA 1ELAA 1HIAB 1W0YH 5C94A 1YLNA 1MTSA 1S0RA 2BVXH 1J14A 4J2YB 1KIGH 1MABB 3LC5A 1O2JA 4U30A 4AFQA 1DM4B 3ZVFA 3KCGH 2Y82A 3UB0A 2ODPA 3TGIE 1CGJE 2OC8A 2ZWLH 3NRLA 4B74A 3ZZCA 1BBRK 5A0BA 1Y59T 1CHOF 3V7TA 1GBLA 1GMCF 2G81E 5C67A 1OWEA 1TMBH 1K2I1 3U9AH 1ZSJA 2ZFSA 2SNVA 1G32B 2OINA 2Y80A 1C4U2 1TALA 1NU9A 2AGIX 3M5NA 3GCHC 1UTMA 5HXFA 2NWNA 3BG8A 4KP0A 3RC5A 2HNTE 1T8MA 2RA0A 4I8LA 3KQCA 1G2LA 1OOKB 4A1TA 4ZKSU 2EQNA 4B2BA 2KCYA 5HM2A 1O3NA 3G01A 1MU8B 1TRYA 2FOFA 2WUBA 1DPOA 1H9IE 3PLBA 2CJIA 2V35A 2XC5A 4ZXYH 2BLOA 1TONA 1BTYA 2WINI 2WSSD 3SNEA 3C27B 4BAOB 5T1VA 3BTWE 4WWYA 3SU6A 2ZFPH 3ITIA 3S7KB 1FY1A 3OY5U 1O37A 2F9BH 1DE7H 4AX9H 5A8ZA 4OS1A 1O38A 2R9PA 4FUJA 3RXSA 1UK3A 2IPHA 1UCYK 2FLRH 5L6NH 2F83A 2H5DA 1GGDB 3H09A 3SUEA 2H9TH 2A1DB 2A7CA 2F91A 4CR9A 4DURA 3DSOA 2CXVA 1O3HA 2ANWA 2BY5X 3EAJA 1PQ8A 3K65B 2BD9A 1J8AA 2HPPH 3TU7H 1SGFG 1WOFA 4ISNA 1FY5A 1ANDA 4X6NA 4WXIA 2QV1A 2Z9GA 3FKSD 2J98B 2OP9A 2VBCA 3SBKA 3UUZA 1HPGA 1KTTB 3MH7A 3TLOA 5K0HA 1FMGA 1AKSA 5EODA 9LPRA 1LHCH 3A7YA 3UQOA 1EJMA 4X8SH 2Y6TA 3IITA 2ESTE 3TJUA 2FWWA 5CE1A 2A32A 2VINA 1ABIH 4GHTA 4DCDA 5C0TA 3QGJA 5E8EH 3VB3A 1QQ4A 3LH1A 1E0FD 1YF4A 3CENA 2RFKC 2J4IA 3UNSA 2DE8A 4A92A 4X0WU 2QF5A 4CREA 5HGGA 1O3DA 3A81A 1CO7E 1C1RA 2FI3E 3ZVAA 3F0PA 4LK4A 1V2MT 2HVYB 2F9OA 2KAIB 2Y7ZA 3FP8E 3P8GA 3STJA 1UK4A 1PQ5A 2FOEA 4X1NU 3SI4H 6CHAC 4HFPB 1XUIA 4XE4A 1SL3A 5DSFA 1E36B 2PUXB 1QB6A 2AERH 1GHVH 3VPKA 2SNWA 3SNBA 5JBBS 1DSUA 1FJSA 2SGFE 1YLDA 1C2IA 4BAQB 5CHAB 5JYIA 3F9EA 2P94A 1V2QT 3MU4A 5CMXH 1P3EA 1GI4A 5GIBA 2VIWA 3A85A 3SZEA 5JDUB 1BMLA 1NTPA 1KLIH 4Y11E 1RS0A 1O2QA 2ZGXH 1U6QA 3GDVA 4U01A 1IQMA 1TGBA 2HPQH 4B76A 1S81A 1VJ9U 2PKSC 5FPTA 2XWAA 3IG6B 5T6FA 2ZPRA 3ZZ9A 1N6YA 5C5OA 1QFKH 2R3UA 2J92A 3E16B 3UNRA 3QTVH 1QRXA 4DW2U 5ESBA 1IHTH 3UREA 1O3BA 3KHVA 1AWFH 4NIYA 2WV9A 3ELAH 2EI8A 1G3DA 3L33A 2Z9JA 3SN8A 1K1PA 1TPAE 1O5CB 1O3EA 5HM9A 2XC4A 1CT4E 6CHAB 2XCNA 2QY0B 1ZYOA 1KMHB 4Y8XA 4X1SU 3RXKA 1MD7A 3FP7E 1UTOA 1YC0A 3F0OA 5T6GA 1YBWA 1Y5UT 3BIVH 5C1UA 3ZZ7A 1M9UA 2ZIQH 1W12U 2TPIZ 1JMOH 1G3CA 3JZ2B 4KELA 1DLEA 2QXIA 4ISOA 1L0ZA 1MH0A 2QIQA 1THPB 1P2QA 5F8TA 3ZYDA 4I8HA 3SZNA 1N1LA 1ELEE 4FU8A 2BD7A 1T8OA 2AIQA 1O2MA 1LPKB 3FP6E 4DIHH 2Q6DA 2VWNA 2PTNA 2D26C 2BXTH 3NPSA 1PPCE 1AQ7A 1K1NA 4X1QU 2OBOA 3E6PH 3T2NA 3TGJE 2YMSC 3JZ1B 3LPRA 1THSH 2BDGA 1QCPA 3RXDA 4B6EA 4F55A 1QL9A 2YNBA 3MO6A 4NA7A 4XBDA 3L6PA 3TJNA 1HAOH 1FXYA 3VGCC 1O2XA 2FOMB 4D76A 3RXBA 2PGBB 1LHEH 5PTPA 2R2WU 1MKWH 2FXRA 3FANA 7GCHF 3NCLA 1K1IA 2ZDVH 2OLGA 1X7AC 2EEKA 2PKAB 5I25A 2F3CE 3SV7A 2K1QA 1W0JD 3MU0A 1KXDA 4AGJA 1TBRH 2KCPA 4Y0ZE 2FOBA 1MAXA 1TQ0B 1BRAA 5B6LA 1O3GA 3FAOA 4FETA 1VKYA 1GI0A 1WQSA 2F9VA 1Y5BT 1PQAA 1FY8E 3M7QA 1YPHE 3U1JB 1ZZZA 2G51A 4NZQA 1GI9B 3ZZ8A 3MU8A 1NFUA 2XBYA 3EA9A 4VGCB 1Y8TA 2H5CA 2HOBA 1A5IA 1S6FA 4U2WA 1ZHPA 2WHXA 1H9LB 2SGQE 3ATKA 3BSQA 1C2MA 1YPKH 5F8ZA 3RU4T 1WU1A 1CT2E 3GY3A 2GCTC 3F2GA 1YPEH 1EPTC 2V7QD 1GHAF 4B73A 2ZEBA 1V2JT 2WPMS 3GOVB 3S9CA 1GVLA 3VXEH 3SU3A 3B9FH 3Q00A 1HAYB 1INCA 2OC1A
chains in the Genus database with same CATH topology
2J98A 3EE7A 5HIZA 5C94A 1QZ8A 5HIYA 1UW7A 2J98B 2J97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J98 A;  3EE7 A;  5HIZ A;  5C94 A;  1QZ8 A;  5HIY A;  1UW7 A;  2J98 B;  2J97 A; 
#chains in the Genus database with same CATH topology
 1YM0 A;  3SHC H;  1O5D H;  3GY4 A;  1C4V 2;  2B7D H;  3VB5 A;  4INK A;  1HJA C;  2VVU A;  5IYT A;  1EAW A;  1F5K U;  1Y3U A;  3R0F A;  1JIM A;  1NRR H;  1D4P B;  2B5T B;  3KYG A;  1RRK A;  5JB9 S;  2G5N A;  4JK6 A;  1W7X H;  1B0E A;  2NU3 E;  3RMM H;  1QA7 A;  2HAL A;  1FQ3 A;  2QYI A;  3SU1 A;  1MTW A;  4ABA A;  1RJX B;  4MPU A;  5C0U A;  3BTM E;  2STA E;  4Y7B A;  2L6O A;  2Y5F A;  3MO9 A;  2BD8 A;  4Q80 A;  5L2Z H;  1KSN A;  3SJO A;  4WJG 2;  3BTK E;  3PMJ A;  2ZHE H;  1GJ6 A;  4YTA A;  1J16 A;  5DN6 D;  3TK6 A;  2W7U A;  1FDP A;  1OPH B;  1CU1 A;  3D65 E;  3P8O A;  3OEH D;  5LPR A;  4JYV H;  1W2K H;  1J9C H;  1ABJ H;  3GY8 A;  1V2K T;  2C8X B;  4UON A;  1BTZ A;  1P11 E;  1DLK B;  3PV4 A;  4A6L A;  4YT7 H;  1GBJ A;  1JRS A;  3MMG A;  2RA3 A;  4BAN B;  2ZTY A;  5DP6 A;  2WYG A;  4INH A;  4TY7 A;  4BAM B;  1OWK A;  2HLD D;  1W10 U;  2H9H A;  3E0N B;  1AKS B;  2A5K A;  2G52 A;  1LVO A;  2TGP Z;  1HJA B;  2WPI S;  3UOU A;  2Z3E A;  2SGE E;  1G3B A;  2V0B A;  5EXM A;  3U98 H;  1RXP A;  3OE7 D;  3TH3 H;  5EW2 H;  3ZZ4 A;  2BHG A;  2C93 B;  3AAV A;  1SFI A;  3RLY H;  5AF9 H;  3M5M A;  2BXU H;  4WME A;  2OCV B;  3RP2 A;  2RDE A;  5LGO A;  5A09 A;  1CQQ A;  3A7V A;  1HJ8 A;  1V2V T;  1GHZ A;  2FX6 A;  4K69 A;  1NY2 2;  5GJ4 B;  2Y5H A;  4DT7 B;  4FUD A;  3NWU A;  1HAI H;  1YPJ H;  1GJ7 B;  4MQA A;  3F6U H;  1O2S A;  3AAU A;  2BD4 A;  3GYL B;  2BD2 A;  1WQV H;  3TNS A;  1SGT A;  3SV8 A;  1EFR D;  3RXV A;  1F2S E;  4HTC H;  1AWH B;  1ZTJ A;  1B0F A;  4AGK A;  3KGP A;  1K21 H;  4XOJ A;  1CGI E;  3P8N A;  4I86 A;  1SGD E;  5KGO A;  1L1J A;  4AOQ A;  4Y7A A;  4WXV A;  3ZVG A;  2R2M B;  5G4B A;  2BMG B;  1DUA A;  4DGJ A;  1SGC A;  5EGM A;  3HAT H;  3DD2 H;  2ZHQ H;  1BDA A;  3LJJ A;  2YOL A;  2VGC C;  1IHS H;  1L1G A;  1P06 A;  1C1W H;  3AW1 A;  1N8O C;  5C3N A;  3SUF A;  1OS8 A;  3E90 B;  1UTJ A;  2TGA A;  3LT3 A;  3WWF A;  5HMA A;  1BIO A;  3ZVE A;  1HAV A;  2YMS D;  2UUK B;  3STI A;  1OHH D;  1P2K A;  2BX3 A;  1C5Y B;  1O3I A;  2ZGH A;  3M3V A;  5EPY A;  1BMF D;  1O31 A;  1AMH A;  1G9I E;  4X1P U;  4YLQ H;  1LVY A;  3LOX A;  2GJG A;  1TB6 H;  3Q77 A;  7KME H;  1LCY A;  1HFD A;  1VZQ H;  4HZH A;  4BXW A;  1GJ9 B;  4UD9 H;  1GMH F;  3PYH A;  1TOM H;  1GJB B;  1GBD A;  5A2M H;  1EZS C;  3PRD A;  1Y3X A;  2BD3 A;  3PV5 A;  3DFJ A;  4RN6 A;  4CH2 B;  1CVW H;  2BQ7 B;  4O9V A;  2SGD E;  4WMD A;  2ZCL P;  5AHG H;  4MNW A;  1GVK B;  1HDT H;  1B7X B;  1XXD A;  3N99 A;  2GD4 B;  3UR9 A;  1NU7 B;  1O3P B;  3EST A;  3UFA A;  1BRU P;  3SGQ E;  1IQG A;  4M9F A;  1W8B H;  3BEI B;  1EAU A;  1SHH B;  3PB1 E;  2CF9 H;  1FIZ A;  2FDA A;  4IMQ A;  1LDT T;  2BDC A;  3CNR A;  2Z6B D;  1C5P A;  5EXL A;  1SKY E;  2J2U A;  2BZA A;  4JZI A;  3I77 A;  2VIO A;  1QBN A;  4CRF A;  5F6M A;  2A31 A;  1ELD E;  1BOQ A;  2STB E;  3RML H;  2BDH A;  1C1S A;  2AIP A;  4K8B A;  1SGI B;  1JRT A;  2GT8 A;  2R0L A;  5GCH F;  1AUJ A;  1WTH D;  4TSF D;  1ETR H;  1S5S A;  1O3K A;  3OTP A;  1TAW A;  3U8T H;  4FUE A;  2A5I A;  1MCV A;  1GCD A;  1IQF A;  3KN2 A;  3UY9 A;  1QHR B;  1O33 A;  1SI5 H;  3RXL A;  1MKW K;  1C5Q A;  1Z1I A;  5GWZ A;  3QN7 A;  4TWY A;  3M5L A;  3ZZ5 A;  1W13 U;  3SGB E;  1EZU C;  2V3H H;  4Q63 A;  3O8D A;  3SNA A;  3OFN D;  1WV7 H;  8EST E;  1LKA A;  1NO9 H;  1TGS Z;  3W1E A;  1VJA U;  3V0X A;  4R0I A;  2JET B;  1MBM A;  1QQU A;  3F3B A;  3QO6 A;  1KTS B;  3ATM A;  2OD3 B;  5AFZ H;  3WW7 A;  4JCN A;  3ZV8 A;  1GBA A;  1TX8 A;  8GCH F;  2QXG A;  1HAX B;  1K1O A;  4MNV A;  3SND A;  4ZCN A;  1AI8 H;  1DY9 A;  2CV3 A;  3A87 A;  1UTQ A;  1UJ1 A;  1SVP A;  4GCH G;  2WZQ A;  6EST A;  2ODY B;  1DT2 A;  2GMT B;  1ZMJ A;  3QTO H;  4X2V A;  3MNX A;  1S0Q A;  4ISH H;  1K28 D;  4FUB A;  1DDJ A;  2V3O H;  4IS5 A;  1ZJD A;  1D6R A;  1GGD C;  4YXW D;  1DXW A;  1LPZ B;  1YCP M;  4B2A A;  8KME 2;  2ODQ A;  3UNQ A;  3D23 A;  2PW8 H;  3GCT F;  1FPH H;  1C1O A;  1ANB A;  4YZU A;  3VB7 A;  5JBT A;  1GHX H;  3BEF B;  5GXP A;  1GDU A;  3BTD E;  3URD A;  3FZZ A;  1A4W H;  1XMN B;  2FES H;  3HKI B;  1THR H;  4KTS A;  4DG4 A;  1GI8 B;  3KL6 A;  1SLV B;  2JH0 D;  2BB4 A;  2AHM E;  4E05 H;  1E1R D;  2VB0 A;  1V2P T;  1EX3 A;  3HGP A;  1ANE A;  1QIX B;  2GGV B;  2WPK S;  1G30 B;  3PRB A;  1GBT A;  1OWI A;  1MTN C;  1T4U H;  1EAX A;  4JYT A;  4NSY A;  2FIR H;  2W3K A;  1NRN H;  4SGA E;  1MMJ N;  2G4T A;  2A7H A;  2FYQ A;  2HWL B;  3M3S A;  1TAB E;  4NG9 H;  2ZQ2 A;  2J97 A;  1O32 A;  3ATW A;  4GLY A;  2BY9 X;  1AZ8 A;  4IGD A;  5DP9 A;  2ZU2 A;  4UFD H;  1GHB G;  1QJ1 B;  3PO1 B;  3F9F A;  3PMB B;  1Z8I B;  5DP3 A;  2BDI A;  2SGP E;  1QRW A;  3Q3Y A;  1V2U T;  2A2X H;  1AU8 A;  1P12 E;  1MKX H;  4ACA A;  1H1B A;  5I46 H;  4NIV A;  1AE8 H;  2O8W A;  2V3M A;  1AGJ A;  1NRP H;  5EJZ A;  1GI1 A;  1GJ4 H;  1P0S H;  1S6H A;  1MD8 A;  5CHA C;  1ESB A;  2D8W A;  4X6P A;  5AVD A;  3BF6 H;  3HK6 B;  4Y10 E;  1C9T A;  1VIT H;  4UE7 H;  3RUO A;  1LQE A;  3DFL A;  1RIW B;  4Q7Y A;  3T62 A;  3RMN H;  1CA8 B;  1A7S A;  3P70 B;  1GMC G;  1GI6 A;  1P10 A;  5KED A;  1KDQ A;  3KEE A;  5EG4 A;  2ASU B;  4XBC A;  2AS9 A;  2ZF0 H;  1SQO A;  2F9U A;  3QWC H;  1O2O A;  1MTN B;  1O2G H;  3ZZA A;  1ID5 H;  3B8J A;  2AYW A;  2FMJ A;  3SU4 A;  2C8Y B;  3RXO A;  1TA6 A;  4JZD H;  1W14 U;  2J95 A;  1OXG A;  3F1S B;  4ZHL U;  2B9L A;  3RXG A;  2ALV A;  2PFE A;  4M7G A;  2K0Q A;  3MWI U;  3F2H A;  3DT0 H;  3LGW A;  4OS4 A;  1LQD B;  1C1T A;  1YGC H;  3A7T A;  1LO6 A;  4RKJ B;  2A2Q H;  4FUF A;  1DXP A;  3UIR A;  4JZF H;  2FZZ A;  1TGN A;  4YES B;  2GTB A;  1C5N H;  2D2D A;  2AH4 X;  1HAV B;  1ANC A;  4PRO A;  7LPR A;  3SW2 B;  3NXP A;  5DP7 A;  4ZHA A;  4I7Y H;  1RTF B;  2W7S A;  3UR6 A;  1HNE E;  2F4L A;  2W6J D;  4FU9 A;  1O5E H;  1H8D H;  1G3E A;  1GI3 A;  2WPL S;  4YOJ A;  4Y0Y E;  2J9N A;  1AB9 C;  2IJO B;  1TYN A;  4ABH A;  5L2Y H;  1DOJ A;  1YCP K;  4X6O A;  1SGF A;  3SUD A;  3V12 A;  4ABJ A;  3P17 H;  2C8W B;  3U1I B;  2I6S A;  2FOC A;  1WSS H;  3T29 A;  3U8O H;  2QF3 A;  1CA0 C;  1T4V H;  3S9A A;  1Z7K A;  2WYJ A;  3RXH A;  3TH4 H;  3VG8 A;  3N7E A;  2XCF A;  1BRB E;  1E34 B;  3ZYE A;  1TNG A;  1P9U A;  2AFQ B;  3OTJ E;  1F0U A;  2ZEC A;  3ODD A;  1J15 A;  3GS9 A;  2CHA B;  3OSY A;  4P02 A;  1GMD F;  1NT1 A;  4GHQ A;  2SGA A;  3RXC A;  5FXL A;  1C1N A;  1SSX A;  2A4O A;  4UFE H;  1ZR0 A;  2PR3 A;  2BDA A;  5DO4 H;  4INL A;  3P6Z B;  1ZMN A;  1XM1 A;  2ZGJ A;  1IQL A;  2FOH A;  1A0L A;  4ZKN U;  5T6D A;  3BN9 A;  4KTC A;  4Q2K A;  2BLQ A;  1HAZ B;  1KYN A;  4ZRO A;  4XFQ A;  1ZOM A;  4AG1 A;  1FNI A;  1WTG H;  4O97 A;  2TIO A;  2VVV A;  4YOG A;  4VGC C;  1AB9 B;  3VFE A;  1DST A;  2KFW A;  2ZDK A;  1QB1 A;  2FM2 A;  2QCY A;  3QLP H;  2WV4 A;  4NA9 H;  2ZFQ H;  1TGT A;  3DHK H;  1QJ7 B;  1ZJK A;  2IN2 A;  2M5T A;  1V3X A;  4MNY A;  1OWH A;  1CA0 B;  1COW D;  3RXI A;  1SHY A;  1JIR A;  3Q76 A;  4F4O C;  1NN6 A;  1UTP A;  4K5Z A;  3O8C A;  1A3E H;  2FO9 A;  1V6D A;  3BIU H;  3LGV A;  1P05 A;  1JXP A;  1ZHM A;  3A8C A;  4IC5 A;  3KNX A;  2VH0 A;  2P3F H;  2D1J A;  1BJU A;  1O2W A;  4BTT B;  2CN0 H;  1YPL H;  4NIX A;  1ELT A;  2PTC E;  2XNI A;  2P93 A;  1Y3V A;  3D62 A;  1AN1 E;  4Q7X A;  1OWJ A;  2EY4 C;  1Z6E A;  5IDK A;  3SQH E;  1CSO E;  4A1X A;  3RLW H;  4NZL A;  4UFF H;  5ETX A;  1O3J A;  3RM2 H;  3UOP A;  2EI6 A;  3SJ8 A;  5C1X A;  1D9I A;  1C5R A;  2C90 B;  1D6W A;  2FP7 B;  2R0K A;  1SQT A;  5E0G A;  3AK5 A;  1TNH A;  4I33 A;  1NRS H;  3ZVB A;  1VCW A;  1HAG E;  3LC3 A;  1T8N A;  4K8Y A;  1NBM D;  2HNT F;  4P00 A;  1GI7 B;  1MZA A;  1P3C A;  1PYT C;  1PPH E;  1BT7 A;  1IQE A;  1ZTL A;  1A0H B;  3LDX H;  1HXE H;  1GI5 A;  1W0Z U;  1C5L H;  3M35 A;  3SV2 H;  1ACB E;  1H8I H;  1MZD A;  3DSG A;  1P2I A;  4MNX A;  2HRV A;  4Y71 A;  2CF8 H;  5E0H A;  1Z8J B;  1K1M A;  3RXP A;  4AC9 A;  4X8V H;  1HBT H;  1AFQ B;  1AY6 H;  1L2E A;  3TNT A;  1C5S A;  3RXE A;  1XKA C;  4I31 A;  1F92 A;  1ZML A;  4Q7Z A;  2ZHW H;  4D7G A;  5F53 A;  3RXJ A;  2JJ1 D;  1B5G H;  1TNL A;  3UQV A;  4H4F A;  4BOH A;  1NRO H;  6GCH F;  5FAH A;  1XKB C;  3TVJ B;  5FX5 A;  3M36 A;  5DP5 A;  1LVB A;  3PMH B;  1C5V A;  4Y79 A;  3EGK H;  1BJV A;  2L74 A;  3HGN A;  3A83 A;  4FU7 A;  1XUF A;  2P3T B;  4TWW A;  4LZ4 B;  1O2P A;  4GVU A;  4BTI B;  2A4Q A;  1TPO A;  5GPI B;  7GCH G;  4D8N A;  4ZHM U;  1W7G H;  5TCC A;  4H42 U;  1BZX E;  5TJX A;  4Y6D A;  1TWX B;  3GY2 A;  2O8U A;  3EE0 B;  1XXF A;  2GCH F;  2BDB A;  1T7C A;  4GAW A;  3ATL A;  3F9G A;  3RXU A;  1OP8 A;  1ZHR A;  1TBQ H;  2QA9 E;  4UEH H;  3H7T A;  5CDF E;  3ZVC A;  1YPM H;  1EXF A;  9EST A;  2ZDA H;  1JOU B;  3GY7 A;  2ZA5 A;  1MTU A;  1GHA G;  2THF B;  2O8T A;  4MLF B;  1FON A;  2Z94 A;  4NIW A;  2W5E A;  4R8T B;  2W26 A;  3BTG E;  1AFE H;  1L4Z A;  1MKX K;  3QGN B;  3SUG A;  2ZNK H;  1UCY H;  1XVM A;  2DE9 A;  4E7R G;  1GL1 A;  1ZGV A;  1BMM H;  1C2J A;  2FI4 E;  1BUI A;  1O2I A;  1SGR E;  1LHG H;  2JKH A;  2Z9I A;  3SV9 A;  1GG6 C;  1QL7 A;  4X6M A;  2G5V A;  1MTV A;  1ETS H;  2WPJ S;  4K1S A;  1YYY 1;  2BLW A;  1QGF A;  1UVS H;  5BPE A;  5GND A;  1SB1 H;  3V13 A;  3FOA A;  5FX6 A;  1QB9 A;  1GBB A;  1KXA A;  1TGC A;  1SGN E;  4FVB A;  3AVZ A;  2FI5 E;  2FS9 A;  3A8B A;  2ZHD A;  1V2W T;  2A7J A;  1WCZ A;  4OS2 A;  5EST E;  1S83 A;  1W11 U;  4JK5 A;  1ARB A;  1RTL A;  2WPH S;  2J94 A;  1HV7 A;  2BY7 X;  4BAH B;  4JZ1 A;  1DFP A;  1C5Z B;  2EC9 H;  4ZKO U;  3RXQ A;  5B6O A;  4AYV B;  5DGJ A;  4AB9 A;  1V2S T;  2GZ7 A;  1ZTK A;  3M61 U;  2ZTX A;  3ZZ6 A;  5J4Q A;  1SLU B;  1A5H A;  1BA8 B;  2ZZU H;  1UTK A;  1RD3 B;  4I8G A;  2GZ9 A;  1WAY B;  4CBN A;  5BRR E;  1GG6 B;  2BM2 A;  1XUJ A;  2SFA A;  5ABW A;  2EA3 A;  3KF2 A;  2UWL A;  4OM9 A;  1T8L A;  1VCP A;  5EQR A;  1V2N T;  4FVD A;  2ZCK P;  3FVF B;  1OP2 A;  3HPT B;  3PLP A;  1ESA A;  2ZTZ A;  4K1E A;  4NGA H;  3P8F A;  4I8K A;  1RFN A;  1IQN A;  3SYJ A;  2VIQ A;  1O3L A;  1O3C A;  2XW9 A;  1EJA A;  4IN2 A;  1PQ7 A;  4OS6 A;  1OX1 A;  2ZU3 A;  1TFX A;  1YPG H;  1V2O T;  2GVF A;  1BMN H;  1DAN H;  1QBV H;  3LU9 B;  3OEE D;  4YO9 A;  3T5F H;  4DJZ B;  1AZZ A;  2OBQ A;  1KY9 A;  4BTU B;  4O3U A;  3A8A A;  1G36 A;  3A7X A;  1ELB A;  4XBB A;  2OK5 A;  1K0H A;  1Z71 A;  3A84 A;  5IK2 D;  1XX9 A;  2G00 A;  4BAK B;  2ZDL A;  4B6F A;  1GHY H;  3RU4 D;  1MU6 B;  4WH6 A;  1OWD A;  1PYT D;  1ORF A;  1VR1 H;  5EXN A;  4ABB A;  1QZ8 A;  2JET C;  1HAP H;  4IW4 E;  1GDQ A;  4X8T H;  2VWM A;  4I8J A;  5C5N A;  3PTB A;  1V2T T;  1FUJ A;  3LGT A;  1BIT A;  2ZFR H;  4CH8 B;  5FCR A;  3NKK A;  3LH3 A;  1UVP A;  1NC6 A;  2W3I A;  4IBL H;  2P95 A;  1UTN A;  3BTE E;  1YY3 A;  2VH6 A;  3GDS A;  2GT7 A;  1ELV A;  1TMU H;  1L4D A;  1GJ5 H;  5LPF A;  1P2M A;  1XUH A;  4ASH A;  3Q3K A;  1SBW A;  2GMT C;  3GDU A;  1ZGI A;  3U28 C;  1P04 A;  3U8R H;  2UWO A;  3V3M A;  5EOK A;  3EE7 A;  3BTQ E;  1SG8 B;  2C3S A;  3MI4 A;  4WY3 A;  4Z1M D;  2A45 B;  2FX4 A;  3FZD A;  4Z0K A;  1TIO A;  4ISL A;  3RM0 H;  2Y5G A;  1SQR A;  1HJ9 A;  1ZSK A;  2OXS A;  3BG4 B;  4EST E;  1BRC E;  5EPN A;  1P02 A;  1GDN A;  2Q6G A;  3GCN A;  4RT0 A;  1AVG H;  2ZO3 H;  3SQE E;  2TRM A;  1CE5 A;  4D9R A;  4QT8 C;  1C2K A;  3P95 A;  4ACB A;  2PP6 A;  1DUE A;  1D3D B;  1FX0 B;  3P92 A;  1GMH G;  1K22 H;  1AE5 A;  1YWU A;  2VU8 E;  3M5O A;  3AW0 A;  4X2Y A;  4XSK U;  5EU8 A;  1K1L A;  5A0A E;  2VIP A;  1D3Q B;  1TOC B;  1EB1 H;  5EJL A;  1ETT H;  2C4F H;  4Q4L A;  1P8V C;  1EQ9 A;  4ZAE A;  3RDZ A;  4TPI Z;  4OGX A;  1ELC A;  1GBI A;  1O3A A;  4F48 B;  3TGK E;  1VGC B;  1EB2 A;  2V6N A;  3VB6 A;  1A1R A;  1O5G H;  4GUX A;  1XUG A;  1F0T A;  1P2J A;  1EP6 A;  1BB0 B;  2H9E H;  1O2Z A;  3GYM A;  1SLW B;  1Z8R A;  2C8Z B;  2XTT B;  3GY6 A;  3PO1 C;  2BY8 X;  2H6M A;  1Z6J H;  2HVX A;  1SGE E;  3QUM P;  4A7I B;  2WPD D;  2QF4 A;  2PKA A;  1OYT H;  2HNT C;  2XND D;  5J4S A;  4NCY A;  1TQ7 B;  1EST A;  2BOH B;  3A89 A;  2F9N A;  2ZDN A;  4MG3 A;  2LPR A;  4XDE A;  5GCH G;  1UCY E;  1IOE A;  1O3O A;  4JZE H;  3W94 A;  1MBQ A;  2ZGC A;  1QTF A;  2GV6 A;  1F7Z A;  2OUA A;  2Y7X A;  2ZGB H;  4CRC A;  1C2L A;  2XBV A;  1KXB A;  2BQ6 B;  1S84 A;  1HAH H;  2ZKS A;  3CS7 A;  1VIT G;  1EOJ A;  1CHG A;  2Z3D A;  3HKJ B;  2FYR A;  4NFE A;  1E79 D;  1RIW C;  4A5T S;  4CHA B;  1C5M D;  4ABE A;  1PJP A;  1S6L A;  4D9Q A;  1TNJ A;  1TRM A;  1EZQ A;  4E7N A;  3S0N A;  4FOU C;  4CRD A;  1G37 A;  5DP4 A;  2G8T A;  2ZQ1 A;  2ZP0 H;  1ELF A;  4YM9 A;  3E91 A;  2VIV A;  1GCT B;  1CBW C;  2GDD A;  1ZPZ A;  3B23 B;  4WH8 A;  2BX4 A;  2Y81 A;  2PSY A;  3RXT A;  8GCH G;  3GCO A;  2PSX A;  1A5G H;  5A0C A;  1W0K D;  2BVR H;  5C1Y A;  3SHA H;  3SJI A;  1SPJ A;  1P57 B;  2UWP A;  3KQD A;  5DPA A;  3FFG A;  1NRQ H;  3A86 A;  1MUE B;  3OY6 U;  1UHB A;  2WV5 A;  4I32 A;  4IC6 A;  4TPY A;  1SOZ A;  2NU2 E;  2BOK A;  1NBM E;  1CHO G;  3SO3 A;  1Y3W A;  2O9Q A;  3GCT G;  1HYL A;  2BQW B;  3BTH E;  1QJ6 B;  2A4R A;  3O8B A;  2RCE A;  4B1T A;  5F8X A;  1C2D A;  5FBE A;  3W95 A;  1EPT A;  3SV6 A;  3QZR A;  3H7O A;  1C1U H;  1Y5A T;  2CHA C;  3KID U;  3H5C B;  1H8H D;  2G4U A;  2IPQ X;  3KQB A;  2QXH A;  3GCH B;  1OYQ A;  4HI3 A;  1TBZ H;  1BHX B;  1F5R A;  1O5B B;  1P9S A;  1UW7 A;  4UFG H;  4ZUH A;  1T32 A;  2FLB H;  1C5T A;  1C5U A;  1CBW B;  1F0R A;  1LVM A;  2ZHF H;  1HRT H;  2ZPQ A;  4DII H;  2P59 A;  1JWT A;  1OP0 A;  1FPC H;  2AMP A;  2PGQ B;  4ZXX H;  3GY5 A;  1QBO A;  5EQS A;  2AGE X;  1H4W A;  1TX6 A;  1GVZ A;  1EJN A;  1C2E A;  2F9P A;  3KYF A;  1O5F H;  4MTB A;  3VB4 A;  2ZG0 H;  2Q6F A;  1YLC A;  2FOG A;  2BYA X;  3RMO H;  1ZSL A;  1SGQ E;  3PV2 A;  5SGA E;  5FBI A;  1YP9 A;  3QDZ B;  3U69 H;  4B2C A;  1E1Q D;  5DP8 A;  4J1Y A;  1DX5 M;  3GIS B;  2Z3C A;  3AAS A;  1Q2W A;  4RSP A;  1PFX C;  1QA0 A;  1BCU H;  1UTL M;  4THN H;  3BV9 B;  3EA7 A;  1K9O E;  4KTU A;  2VJ1 A;  2PHB A;  3Q3X A;  1NFY A;  1C5X B;  2KCO A;  1AHT H;  1V2R T;  3ATI A;  4IMZ A;  5EW1 H;  2CGA A;  3SI3 H;  1D3P B;  4GSO A;  4OS5 A;  2H1U A;  2XYA A;  3PLK A;  2W6I D;  3M7U A;  3LIW A;  3ENS B;  1O2H A;  2JH5 D;  1DS2 E;  3N7O A;  1GI2 A;  3RC6 A;  3MTY A;  1SFQ B;  4DVA U;  1KXE A;  2LP6 A;  4TYD A;  1O5A B;  1ZLR A;  2CK3 D;  4SGB E;  1HUT H;  1C9P A;  5C20 A;  1MAY A;  5JB8 S;  3SJ9 A;  2XRC A;  2BLV A;  1EP5 A;  1ZRB A;  1C1V H;  1A0J A;  1BTX A;  3OU0 A;  1SLX B;  1RGQ A;  1L1N A;  1HCG A;  1O34 A;  1TMT H;  5GDS H;  2ULL A;  1CGH A;  2FPZ A;  3A80 A;  3E8L A;  3UPE A;  1DWC H;  2UUY A;  3MHW U;  2OC7 A;  1NM6 A;  3SOR A;  1WYK A;  4YOI A;  1HLT H;  2CMY A;  1DWD H;  5JPM H;  2UUJ B;  1C4Y 2;  2FOA A;  1QUR H;  2JDI D;  2XBW A;  2XC0 A;  5C17 A;  2J34 A;  2GDE H;  1O2Y A;  5CHB A;  2ILN A;  4FUI A;  4X2W A;  1WXR A;  3MYW A;  1F0S A;  1UVU H;  1TA2 A;  1O36 A;  3MU1 A;  3LJO A;  1AFQ C;  2QAA A;  1BQY A;  4K1T A;  4H6T A;  2VNT A;  3RXR A;  4MPW A;  1EAI A;  1C1Q A;  1TRN A;  2Z9K A;  3RC4 A;  2A0Q B;  1KXF A;  1O35 A;  4JMY A;  4X2X A;  2LNC A;  5EQQ A;  4DT4 A;  2VWO A;  4AFZ A;  2BY6 X;  3DA9 B;  1YPH C;  3UAI C;  2BZ6 H;  3SU5 A;  3HK3 B;  3SU0 A;  1N6X A;  2ZU1 A;  4H6S B;  1GMD G;  5L30 H;  2GP9 B;  2XOK D;  4MPX A;  4YT6 H;  3OYP A;  4FXG H;  5EIY A;  2VVC A;  2PKS B;  3M3T A;  1K1J A;  3TK9 A;  1DVA H;  1EKB B;  4LOY H;  4AYY B;  2ALP A;  3MH5 A;  1TLD A;  3ODF A;  3M37 A;  4K2Y A;  4WMF A;  4DOQ A;  1GL0 E;  1P03 A;  1GJ8 B;  3L3T A;  2ZFT A;  4MDS A;  2IJD 1;  2I6Q A;  1S85 A;  1SR5 C;  2JJ2 D;  2BVS H;  2NU1 E;  4CRB A;  1TNK A;  4CRA A;  3TJV A;  3S9B A;  2LEL A;  4E06 H;  2ZFF H;  1NFW A;  2VID A;  3D49 H;  1O2K A;  2XWB I;  2ZC9 H;  5EJ1 A;  2UUF B;  5E2O A;  2QF0 A;  1H9H E;  3MNC A;  4MVN A;  3T28 A;  3QX5 H;  2FTM A;  1A2C H;  2QGR A;  1NFX A;  4RKO B;  3OAA D;  1Q31 A;  3NZI A;  1GJD B;  1O2L A;  3FO8 D;  3TK5 A;  5FPY A;  1S82 A;  3URC A;  4MPV A;  3ZZ3 A;  1SC8 U;  2PLX A;  3F68 H;  1OSS A;  1MCT A;  4GPG A;  2KR7 A;  1P09 A;  3SJK A;  1GBK A;  2FS8 A;  1PPG E;  5HKK D;  1DWE H;  1TNI A;  2IOT A;  4YLU A;  1GBF A;  1O39 A;  1GBH A;  2QC2 A;  2ZDM A;  1BHX F;  5FL7 D;  2P16 A;  3RU4 E;  1AVW A;  5DJ7 A;  1EOL A;  2YMS B;  4Z6A H;  2JH6 D;  4OS7 A;  2HLC A;  1BTP A;  3S69 A;  1BTW A;  1BBR H;  3VGC B;  1KXC A;  1SMF E;  1GWA A;  2BTC E;  3LGU A;  2ZCH P;  1AIX H;  3MH4 A;  3PWC A;  1OKX A;  1HXF H;  2NU4 E;  4AB8 A;  1LKB A;  4D7F A;  1HIA A;  1FAK H;  3PWB A;  1IQH A;  1Y3Y A;  1LPG B;  4RI0 A;  3SOS A;  1QRZ A;  2PV9 B;  3KQ5 A;  1Z1J A;  4ZKR U;  3E0P B;  4B75 A;  2FTL E;  2ZI2 H;  2ZU5 A;  3A82 A;  1RTK A;  4XD7 D;  2B0F A;  3EYD A;  1UHB B;  3F9H A;  5HIY A;  2PUQ H;  3EQ0 H;  2TBS A;  1LHF H;  1FY4 A;  1FLE E;  1MQ6 A;  3PM3 A;  3SGA E;  5C2Z A;  3RXM A;  2WUC A;  1FAX A;  3LGI A;  1D3T B;  1TX7 A;  1KDQ B;  3LON A;  1F5L A;  1QY6 A;  1PPZ A;  3T27 A;  4Y8Y A;  2GCT B;  5K7R A;  2GZ8 A;  2ZU4 A;  1P01 A;  4AZ2 B;  4ZMA H;  1EPT B;  1AUT C;  4U32 A;  3UWI A;  2ANK H;  4CBO A;  1ARC A;  2QN5 T;  8LPR A;  1VCQ A;  2O8L A;  3TIT A;  6LPR A;  6GCH G;  5LH8 A;  2OC0 A;  1AO5 A;  2QE7 D;  1E38 B;  3ZIA D;  1DIC A;  1PPF E;  2VWL A;  3K6Y A;  5F03 A;  2KCA A;  3DUX H;  1EAT A;  4Y76 A;  3TJO A;  1A61 H;  2GKV E;  4NSV A;  1XUK A;  1SQA A;  5T3H A;  2KM0 A;  1GBE A;  4IN1 A;  1O2T A;  3NUM A;  3FN8 A;  2KX4 A;  1QL8 A;  5A8X A;  2PWX A;  1XVO A;  3A88 A;  2ZPS A;  2M2A A;  3K2U A;  4LXB H;  1WUN H;  1IAU A;  1O2N A;  4FUH A;  3WY8 A;  4RT1 A;  1J17 T;  3K9X B;  1GJA B;  1QR3 E;  1ELG A;  2ANM H;  4O3T A;  2Z7F E;  1EAS A;  2F43 B;  2GCH G;  4F49 A;  4AFU A;  1ZPC A;  1O2U A;  1ZRK A;  4NWL A;  1BMA A;  2P3U B;  2FEQ H;  3N7D A;  4Y8Z A;  2H2Z A;  3MOC A;  1GBM A;  2Q1J A;  3ZZB A;  5DKM A;  1O3F A;  2DUC A;  3MQK C;  2G55 A;  1DY8 A;  1CT0 E;  2P8O C;  3MO3 A;  1NPM A;  3OX7 U;  4TT3 D;  2J98 A;  1TE0 A;  3CS0 A;  2AGG X;  2BD5 A;  5KEC A;  1FN8 A;  2GV7 A;  1Q3X A;  1AD8 H;  4BXS A;  1WDI A;  1P2N A;  3ZZD A;  4O03 A;  2FOD A;  1LMW B;  4B71 A;  4XRN A;  4X8U H;  4AG2 A;  3DSP A;  4JYU H;  1UMA H;  1C2H A;  4HGC A;  4K3J A;  2AMQ A;  4AFS A;  2TGD A;  3NK8 A;  3MH6 A;  1NZQ H;  1TPP A;  2YNA A;  4TY6 A;  1GPZ A;  2OQ5 A;  1WBG B;  1YCP H;  2RDL A;  1FIW A;  4X1R U;  2KAI A;  1A46 H;  1O2V A;  1UK2 A;  2K8I A;  3A7W A;  3F2F A;  1HB0 B;  3UWJ H;  3PMA B;  3BG4 C;  3I78 A;  3MNB A;  4KGA A;  4AOR A;  4NA8 A;  1PPE E;  3RXF A;  2QXJ A;  1FI8 A;  3KQE A;  4NWK A;  2NU0 E;  5LPE A;  5DG6 A;  1O30 A;  4OGY A;  1UO6 A;  3GIC B;  4BNR A;  1Z8G A;  1GJC B;  4WVP E;  3MNS A;  7EST E;  3ZV9 A;  2GX4 A;  4AN7 A;  4HG6 A;  2P8O B;  2A4G A;  3RXA A;  3LKW A;  1YKT A;  4CR5 A;  1IQJ A;  1EZX C;  2HGT H;  5JBA S;  2O8M A;  1LTO A;  4NFF A;  1SGP E;  4LZ1 H;  5HYO A;  1MQ5 A;  3BTF E;  5FHT A;  2ANY A;  1SGY E;  3C1K A;  1VGC C;  2VGC B;  4K60 A;  1C2F A;  2KZ4 A;  1O0D H;  4WF8 A;  1V2L T;  1E37 B;  1FN6 A;  4GCH F;  1N8O B;  1E35 B;  1BTU A;  5H4I B;  3VEQ B;  4A1V A;  2R3Y A;  3SU2 A;  2J5U A;  3EDX B;  5DK1 A;  2TGT A;  3LGY A;  3ZVD A;  4FUC A;  3QZQ A;  3R3G B;  1NES E;  1PPB H;  1O3M A;  1FY3 A;  1UVO A;  2AEI H;  1C1M A;  1JBU H;  3SNC A;  3A7Z A;  1TPS A;  2XBX A;  5JBC S;  1EUF A;  1O2R A;  3QK1 A;  3O8R A;  3EA8 A;  1GHW H;  3UTU H;  1NS3 A;  4ASU D;  4FUG A;  2J38 A;  4CRG A;  3TH2 H;  3A8D A;  4ABF A;  3MU5 A;  1BBR E;  5HIZ A;  1G2M A;  1AVX A;  4CHA C;  1C2G A;  4KKD A;  3VXF H;  4ABI A;  1VIT F;  4ISI H;  1DIT H;  2AMD A;  3TIU A;  3E3T A;  3PRO A;  1SOT A;  5AFY H;  2JIZ D;  4ABG A;  1IQI A;  1W3C A;  1ZPB A;  2RG3 A;  3TPI Z;  3E1X B;  3T26 A;  1DWB H;  1LHD H;  3BTT E;  1FV9 A;  4DY7 B;  1C1P A;  3K6Z A;  4UDW H;  1IQK A;  3PTN A;  1KLT A;  3IWM A;  2Z9L A;  1QNJ A;  1GCT C;  1T31 A;  5E2P A;  3T25 A;  4ABD A;  2BDY A;  5FCK A;  1C5W B;  5E0J A;  5A8Y A;  1H8E D;  3S7H B;  2XXL A;  1P2O A;  2EI7 A;  1GBC A;  1C5O H;  1UVT H;  2A5A A;  2B8O H;  2OTV A;  5FPS A;  3I29 A;  5TCA A;  3BEU A;  4ZH8 A;  1FZZ A;  3DCL A;  1BTH H;  1GHB F;  3M7T A;  3WWB A;  3MFJ A;  3CP7 A;  1KLJ H;  1HGT H;  1A3B H;  2OQU A;  1ELA A;  1HIA B;  1W0Y H;  5C94 A;  1YLN A;  1MTS A;  1S0R A;  2BVX H;  1J14 A;  4J2Y B;  1KIG H;  1MAB B;  3LC5 A;  1O2J A;  4U30 A;  4AFQ A;  1DM4 B;  3ZVF A;  3KCG H;  2Y82 A;  3UB0 A;  2ODP A;  3TGI E;  1CGJ E;  2OC8 A;  2ZWL H;  3NRL A;  4B74 A;  3ZZC A;  1BBR K;  5A0B A;  1Y59 T;  1CHO F;  3V7T A;  1GBL A;  1GMC F;  2G81 E;  5C67 A;  1OWE A;  1TMB H;  1K2I 1;  3U9A H;  1ZSJ A;  2ZFS A;  2SNV A;  1G32 B;  2OIN A;  2Y80 A;  1C4U 2;  1TAL A;  1NU9 A;  2AGI X;  3M5N A;  3GCH C;  1UTM A;  5HXF A;  2NWN A;  3BG8 A;  4KP0 A;  3RC5 A;  2HNT E;  1T8M A;  2RA0 A;  4I8L A;  3KQC A;  1G2L A;  1OOK B;  4A1T A;  4ZKS U;  2EQN A;  4B2B A;  2KCY A;  5HM2 A;  1O3N A;  3G01 A;  1MU8 B;  1TRY A;  2FOF A;  2WUB A;  1DPO A;  1H9I E;  3PLB A;  2CJI A;  2V35 A;  2XC5 A;  4ZXY H;  2BLO A;  1TON A;  1BTY A;  2WIN I;  2WSS D;  3SNE A;  3C27 B;  4BAO B;  5T1V A;  3BTW E;  4WWY A;  3SU6 A;  2ZFP H;  3ITI A;  3S7K B;  1FY1 A;  3OY5 U;  1O37 A;  2F9B H;  1DE7 H;  4AX9 H;  5A8Z A;  4OS1 A;  1O38 A;  2R9P A;  4FUJ A;  3RXS A;  1UK3 A;  2IPH A;  1UCY K;  2FLR H;  5L6N H;  2F83 A;  2H5D A;  1GGD B;  3H09 A;  3SUE A;  2H9T H;  2A1D B;  2A7C A;  2F91 A;  4CR9 A;  4DUR A;  3DSO A;  2CXV A;  1O3H A;  2ANW A;  2BY5 X;  3EAJ A;  1PQ8 A;  3K65 B;  2BD9 A;  1J8A A;  2HPP H;  3TU7 H;  1SGF G;  1WOF A;  4ISN A;  1FY5 A;  1AND A;  4X6N A;  4WXI A;  2QV1 A;  2Z9G A;  3FKS D;  2J98 B;  2OP9 A;  2VBC A;  3SBK A;  3UUZ A;  1HPG A;  1KTT B;  3MH7 A;  3TLO A;  5K0H A;  1FMG A;  1AKS A;  5EOD A;  9LPR A;  1LHC H;  3A7Y A;  3UQO A;  1EJM A;  4X8S H;  2Y6T A;  3IIT A;  2EST E;  3TJU A;  2FWW A;  5CE1 A;  2A32 A;  2VIN A;  1ABI H;  4GHT A;  4DCD A;  5C0T A;  3QGJ A;  5E8E H;  3VB3 A;  1QQ4 A;  3LH1 A;  1E0F D;  1YF4 A;  3CEN A;  2RFK C;  2J4I A;  3UNS A;  2DE8 A;  4A92 A;  4X0W U;  2QF5 A;  4CRE A;  5HGG A;  1O3D A;  3A81 A;  1CO7 E;  1C1R A;  2FI3 E;  3ZVA A;  3F0P A;  4LK4 A;  1V2M T;  2HVY B;  2F9O A;  2KAI B;  2Y7Z A;  3FP8 E;  3P8G A;  3STJ A;  1UK4 A;  1PQ5 A;  2FOE A;  4X1N U;  3SI4 H;  6CHA C;  4HFP B;  1XUI A;  4XE4 A;  1SL3 A;  5DSF A;  1E36 B;  2PUX B;  1QB6 A;  2AER H;  1GHV H;  3VPK A;  2SNW A;  3SNB A;  5JBB S;  1DSU A;  1FJS A;  2SGF E;  1YLD A;  1C2I A;  4BAQ B;  5CHA B;  5JYI A;  3F9E A;  2P94 A;  1V2Q T;  3MU4 A;  5CMX H;  1P3E A;  1GI4 A;  5GIB A;  2VIW A;  3A85 A;  3SZE A;  5JDU B;  1BML A;  1NTP A;  1KLI H;  4Y11 E;  1RS0 A;  1O2Q A;  2ZGX H;  1U6Q A;  3GDV A;  4U01 A;  1IQM A;  1TGB A;  2HPQ H;  4B76 A;  1S81 A;  1VJ9 U;  2PKS C;  5FPT A;  2XWA A;  3IG6 B;  5T6F A;  2ZPR A;  3ZZ9 A;  1N6Y A;  5C5O A;  1QFK H;  2R3U A;  2J92 A;  3E16 B;  3UNR A;  3QTV H;  1QRX A;  4DW2 U;  5ESB A;  1IHT H;  3URE A;  1O3B A;  3KHV A;  1AWF H;  4NIY A;  2WV9 A;  3ELA H;  2EI8 A;  1G3D A;  3L33 A;  2Z9J A;  3SN8 A;  1K1P A;  1TPA E;  1O5C B;  1O3E A;  5HM9 A;  2XC4 A;  1CT4 E;  6CHA B;  2XCN A;  2QY0 B;  1ZYO A;  1KMH B;  4Y8X A;  4X1S U;  3RXK A;  1MD7 A;  3FP7 E;  1UTO A;  1YC0 A;  3F0O A;  5T6G A;  1YBW A;  1Y5U T;  3BIV H;  5C1U A;  3ZZ7 A;  1M9U A;  2ZIQ H;  1W12 U;  2TPI Z;  1JMO H;  1G3C A;  3JZ2 B;  4KEL A;  1DLE A;  2QXI A;  4ISO A;  1L0Z A;  1MH0 A;  2QIQ A;  1THP B;  1P2Q A;  5F8T A;  3ZYD A;  4I8H A;  3SZN A;  1N1L A;  1ELE E;  4FU8 A;  2BD7 A;  1T8O A;  2AIQ A;  1O2M A;  1LPK B;  3FP6 E;  4DIH H;  2Q6D A;  2VWN A;  2PTN A;  2D26 C;  2BXT H;  3NPS A;  1PPC E;  1AQ7 A;  1K1N A;  4X1Q U;  2OBO A;  3E6P H;  3T2N A;  3TGJ E;  2YMS C;  3JZ1 B;  3LPR A;  1THS H;  2BDG A;  1QCP A;  3RXD A;  4B6E A;  4F55 A;  1QL9 A;  2YNB A;  3MO6 A;  4NA7 A;  4XBD A;  3L6P A;  3TJN A;  1HAO H;  1FXY A;  3VGC C;  1O2X A;  2FOM B;  4D76 A;  3RXB A;  2PGB B;  1LHE H;  5PTP A;  2R2W U;  1MKW H;  2FXR A;  3FAN A;  7GCH F;  3NCL A;  1K1I A;  2ZDV H;  2OLG A;  1X7A C;  2EEK A;  2PKA B;  5I25 A;  2F3C E;  3SV7 A;  2K1Q A;  1W0J D;  3MU0 A;  1KXD A;  4AGJ A;  1TBR H;  2KCP A;  4Y0Z E;  2FOB A;  1MAX A;  1TQ0 B;  1BRA A;  5B6L A;  1O3G A;  3FAO A;  4FET A;  1VKY A;  1GI0 A;  1WQS A;  2F9V A;  1Y5B T;  1PQA A;  1FY8 E;  3M7Q A;  1YPH E;  3U1J B;  1ZZZ A;  2G51 A;  4NZQ A;  1GI9 B;  3ZZ8 A;  3MU8 A;  1NFU A;  2XBY A;  3EA9 A;  4VGC B;  1Y8T A;  2H5C A;  2HOB A;  1A5I A;  1S6F A;  4U2W A;  1ZHP A;  2WHX A;  1H9L B;  2SGQ E;  3ATK A;  3BSQ A;  1C2M A;  1YPK H;  5F8Z A;  3RU4 T;  1WU1 A;  1CT2 E;  3GY3 A;  2GCT C;  3F2G A;  1YPE H;  1EPT C;  2V7Q D;  1GHA F;  4B73 A;  2ZEB A;  1V2J T;  2WPM S;  3GOV B;  3S9C A;  1GVL A;  3VXE H;  3SU3 A;  3B9F H;  3Q00 A;  1HAY B;  1INC A;  2OC1 A; 
#chains in the Genus database with same CATH homology
 2J98 A;  3EE7 A;  5HIZ A;  5C94 A;  1QZ8 A;  5HIY A;  1UW7 A;  2J98 B;  2J97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...