1UW7A

Nsp9 protein from sars-coronavirus.
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
122
structure length
122
Chain Sequence
FLEVLFQGPNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALLSDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSP9
publication title The Nsp9 Replicase Protein of Sars-Coronavirus, Structure and Functional Insights
pubmed doi rcsb
source organism Sars coronavirus hku-39849
molecule tags Viral protein
total genus 20
structure length 122
sequence length 122
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08710 nsp9 nsp9 replicase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.250 Mainly Beta Beta Barrel Thrombin, subunit H Replicase NSP9 1uw7A00
2J98A 1QZ8A 2J97A 5HIZA 2J98B 3EE7A 5C94A 5HIYA 1UW7A
chains in the Genus database with same CATH superfamily
1LVYA 1GBDA 1GJ7B 3BEFB 1CA0B 1TGTA 1TNIA 2BYAX 1O2OA 1ELAA 1SGPE 2FOCA 1UK3A 1YPEH 1HB0B 2ASUB 2XC0A 1TA6A 1TPAE 3QX5H 8LPRA 5FBEA 5EOKA 4YTAA 1QZ8A 1GI3A 1ZGVA 4FVBA 9LPRA 1QQUA 1OOKB 4WWYA 5H4IB 3MO9A 4KTSA 5FCRA 1O3EA 1LCYA 2XRCA 3Q3KA 3B23B 3SU6A 1BB0B 2BLOA 2J34A 2QIQA 1SGRE 1C5NH 5LPRA 3FAOA 3ZVDA 4INKA 1VKYA 1DITH 3B9FH 1CGIE 3Q3YA 3MH6A 5LPEA 2CXVA 4A1XA 3ZVGA 1P04A 3TNSA 2H6MA 1B0EA 1TONA 1ABJH 2B8OH 2R0KA 3BEIB 3TNTA 2JETB 2Z94A 3ATKA 2HRVA 3KQDA 2ODQA 1CBWB 1YPHC 3BV9B 3OFND 3STJA 2ZHWH 1RIWC 4ISHH 4ASUD 4AYVB 1HYLA 1SGQE 1C2IA 2Z9KA 2ZCKP 1GJDB 1BDAA 4I31A 1QB6A 4FUEA 1IQGA 1HAHH 2F9BH 3V12A 5CMXH 1SGDE 2OC7A 2YNAA 2PKSC 3AW1A 1LO6A 3VB3A 2BVXH 2ZQ2A 1IQLA 3MWIU 2GP9B 3SV8A 5FBIA 2F83A 2RA3A 1KXEA 2SGAA 1UMAH 3LIWA 1QBNA 5JPMH 1QB9A 1TA2A 2W26A 2QYIA 1DWCH 3FZDA 2P59A 2K8IA 1FLEE 4AFQA 1D3DB 1ORFA 3ZZAA 2BLWA 4M9FA 1PPEE 1C4U2 4XBCA 5FHTA 1AFEH 1BRCE 1UVTH 1BBRE 3SZEA 4A1VA 2TGAA 3QWCH 2ANKH 1DVAH 1MKXK 1CT4E 2FS8A 2G00A 3FP7E 4GSOA 4ZKNU 2HPPH 4ZHAA 1DM4B 2Y5HA 1S6LA 1NTPA 1UK2A 1S6HA 3FVFB 5AFYH 3LGYA 1F5LA 3F0PA 5T1VA 3A85A 2KFWA 5ESTE 2ALVA 4INLA 2VH0A 3U28C 3V7TA 2PUQH 3RXMA 1BA8B 2JH5D 2OBQA 1AE5A 2THFB 2XYAA 2G51A 2GZ8A 4MPXA 3A84A 5T6FA 4B73A 2BY7X 3TH4H 1NRQH 1FDPA 4AG2A 4KP0A 2XNIA 1O2IA 3E16B 3QLPH 3WWFA 2CGAA 3PRDA 2C4FH 1TGCA 1KLIH 2H9EH 2G5VA 1GVZA 3RXBA 1W0ZU 1C5SA 2QCYA 4AB8A 2TGTA 3IITA 3U1JB 1Y3VA 3MU5A 3GCOA 1QHRB 3LKWA 1ZJDA 3K65B 1HV7A 3OY5U 4UDWH 1W2KH 1WYKA 1SB1H 1GMDG 1ETSH 2IJD1 5GCHG 1PQ8A 1UCYE 2AMQA 4K1TA 1KTSB 4NA9H 2A7HA 3D65E 4Y8YA 1HAOH 3ODDA 3F2GA 2UWPA 3K9XB 1CA0C 4K1SA 2FYRA 1LKBA 1AB9B 3PMBB 4F49A 1O5EH 1D9IA 1TOMH 3OX7U 3MQKC 3P8NA 3PMJA 1B7XB 4KGAA 4RT0A 2OLGA 2WPMS 1T8OA 4Y0ZE 2BDYA 1C2FA 1O33A 5F8XA 1NC6A 4U32A 1GMHG 4BAHB 4M7GA 4RKJB 1ETRH 3GCTF 2J92A 3LJJA 3ODFA 5DP6A 5DK1A 2GMTC 2ZFFH 4MPVA 3ZZBA 2BQWB 1C2EA 5DP4A 7GCHG 4Q80A 5F6MA 5DPAA 1W7XH 2FLBH 1GBKA 3T2NA 1S83A 1NFXA 4K8BA 1GBHA 5B6LA 2PTCE 2WUCA 1V2OT 1C5VA 1BMNH 3U69H 2SGFE 2KR7A 2ZU2A 4B71A 1EX3A 2HALA 5GIBA 1FUJA 5C94A 2FODA 1CBWC 1V2WT 2F43B 1DY8A 2ZGCA 1RTLA 3PTBA 1O3GA 1O3OA 3RXLA 4ABIA 2ZTXA 3ESTA 4XD7D 1V2ST 2LNCA 2PHBA 4MNVA 2RG3A 1EZXC 3OSYA 6LPRA 2ZU5A 1C2GA 1SQOA 3ZV8A 1HAGE 1PQ5A 1Y5BT 3AAUA 3T5FH 5EODA 2W7SA 1ELVA 2DUCA 3BG4B 1OP8A 4TYDA 1GDNA 2R9PA 2Y5FA 1EB1H 4TSFD 5I46H 1P09A 2HNTE 1SG8B 5E0GA 4XRNA 1Z7KA 2KM0A 1WQSA 2FOFA 1FIWA 4NIWA 4JYUH 3UPEA 1AKSA 4BTTB 5EJZA 1NRSH 2BXTH 2XWBI 5FL7D 3T62A 3UTUH 1AUJA 4X8TH 3PLPA 3A81A 1BRBE 2EY4C 4AZ2B 1BJUA 1GCTC 4JYTA 3VB6A 1LHEH 1ZPBA 4NFFA 1SHHB 2FX4A 4IC6A 2O9QA 2ZI2H 2GX4A 2J98A 2PWXA 3BTDE 1TMBH 3TH2H 4ABGA 1WTGH 2GKVE 1TNLA 3ZZ9A 2ZFQH 1RTFB 1HJ9A 3R0FA 1DSUA 1SGFA 1CVWH 2FOMB 4Z6AH 2NWNA 2V3HH 3PLBA 3O8DA 3UR6A 3M36A 4CRFA 1P8VC 1W7GH 3B8JA 4FUCA 1LPGB 2ZDAH 1BCUH 1S0RA 4Y79A 2A7JA 3SNDA 3RLYH 1ELGA 3PTNA 5F53A 3UQOA 1F7ZA 2TGDA 1P12E 1TRNA 8KME2 3RXOA 2XC5A 4MG3A 5TCAA 3PYHA 3WY8A 1C5QA 1BUIA 1EZQA 1O2QA 1IQJA 1A5IA 1MABB 5K0HA 2TGPZ 2OUAA 3M61U 5KGOA 2ZHDA 2ZGXH 2F4LA 1BTPA 1W11U 1C2LA 2UUKB 3LOXA 4GVUA 2EI7A 2ZHFH 5HIYA 2BX4A 2ZFTA 3K2UA 1T7CA 2ALPA 2OINA 2BD8A 4DURA 1GI7B 2A5KA 3PV2A 5CHBA 1ARCA 3QN7A 4D9RA 2R2WU 4CRAA 2BVRH 1AB9C 2GDDA 4X6OA 3MO3A 4K8YA 2XBYA 2Y81A 2FOHA 4AFSA 2B0FA 1V2NT 3I29A 1TRYA 1DWEH 2BB4A 1UVUH 2WYJA 5AHGH 3RXUA 2VH6A 4ZROA 4X1QU 4X2VA 1ZZZA 4MPWA 4NG9H 1ELFA 1NBMD 5EG4A 1NU7B 3BTTE 3TGKE 3RXAA 2ANYA 3RMLH 1AKSB 3SUGA 2BOKA 3RU4D 2Y7ZA 4DY7B 2O8WA 1XUGA 1LVOA 1V2UT 2J4IA 2SGEE 3SBKA 1Z8GA 1XXDA 1N6XA 4E05H 1YLNA 1TBZH 2WYGA 2J98B 2D26C 1O2SA 1T32A 1YM0A 3TK5A 2QXHA 4CR5A 2ZA5A 3O8BA 2XWAA 3KQEA 4RN6A 4NZQA 2F9UA 2BQ7B 1GG6C 5TCCA 2Z9LA 4CR9A 1EPTA 3MH4A 1MBMA 1RFNA 2CV3A 4MVNA 4A1TA 4DVAU 3SV9A 1UVPA 1TIOA 2PLXA 2ZDMA 1F92A 2UUYA 3BG4C 1HLTH 4OS5A 3FOAA 2G55A 1OWDA 1KSNA 2FP7B 4CH8B 4ZXYH 1IQEA 5FPSA 5KECA 4AG1A 5F03A 3SJKA 1MH0A 2B9LA 4IN2A 2FOAA 4B6FA 1N1LA 3SV6A 2ZDLA 3M5NA 1DXWA 5PTPA 2QF3A 5FPYA 3VB5A 1O2YA 1O2GH 1XVMA 2F3CE 1O3NA 1FONA 1TABE 5JDUB 1UVSH 1P10A 1DICA 1RXPA 1F0SA 4UFEH 3ZYEA 6CHAC 3BTME 1Y3YA 1LVMA 2M2AA 1QL9A 1KIGH 2KCPA 3QTOH 2F9NA 3P8OA 3LH3A 1WXRA 4JYVH 1UTJA 2J95A 3TPIZ 1P2IA 4A5TS 2UUJB 4O3TA 3I78A 1FAKH 3GY5A 2Z9IA 1TB6H 3VEQB 1GHBF 1OPHB 2IPQX 1VR1H 2EI6A 3AVZA 4UONA 1HFDA 4H42U 1EP5A 1QJ1B 1C1OA 3BG8A 2R3UA 2A2QH 4YOJA 3N99A 3NK8A 1TNJA 2FYQA 1O2UA 3UWJH 3Q76A 5E0HA 2QGRA 4TPYA 2ZP0H 1SLUB 1ZTLA 3U8OH 2W3KA 1NPMA 3GY2A 3MH5A 4FXGH 1C2KA 1LTOA 1XMNB 1OWIA 3MH7A 1FMGA 1OP0A 1LHDH 1VITF 1NT1A 3RC6A 3RXIA 3RXCA 3SUFA 2ZDNA 1K1JA 2NU0E 4GCHF 3KN2A 4UFFH 1KLTA 1RIWB 1UTQA 2H5CA 1DX5M 2JIZD 1T8NA 3NUMA 5J4SA 1E36B 1ELEE 4BTIB 2A0QB 4AGJA 2H1UA 2O8MA 1GBMA 1THPB 4AFUA 2YNBA 5T6GA 1ETTH 4MTBA 1PFXC 2PKSB 4FUIA 4SGBE 1RS0A 1BTYA 3DFLA 3RXEA 3SU0A 3KYFA 1ELBA 1D4PB 2KAIB 1AU8A 1SOTA 4GHTA 1GMCG 3SU2A 5AF9H 3V13A 1XKAC 3TJNA 1CU1A 2EQNA 1P2OA 1UTPA 1GJ6A 1P0SH 1O0DH 3VG8A 2OCVB 1E38B 2FOEA 1Y5UT 3P17H 1XUHA 4X1RU 4X2XA 1HUTH 1W12U 3URDA 3A7ZA 3F9HA 4X1PU 1DS2E 3SNAA 1ARBA 3A86A 4K2YA 1BOQA 1IOEA 3A82A 1O3MA 1TNGA 1LKAA 4FETA 1MAYA 1P2QA 4ABDA 5EU8A 1K22H 3W95A 2J5UA 4OS6A 2BLQA 4MNWA 3E0NB 3WW7A 3FN8A 3GCNA 2NU4E 4WXIA 3TGIE 1E37B 5GNDA 1GI0A 2A5IA 2ESTE 3M3TA 3F9EA 4WF8A 1AMHA 1AD8H 2PFEA 1W3CA 2VVVA 4Q2KA 4B2CA 2O8LA 3QUMP 1EQ9A 2EEKA 1CO7E 4XFQA 3BTFE 1O3AA 3PMAB 1VZQH 5DKMA 5DP7A 1SGFG 2LELA 1FY1A 3PROA 1C4Y2 1G32B 3N7DA 1HAVA 1O5CB 1O2NA 2BD4A 4U30A 1AGJA 3UB0A 1O5FH 1T4UH 3JZ1B 1G3CA 4NWLA 3CNRA 3RXKA 4JZ1A 3F2FA 1Z1JA 3Q3XA 1GVLA 2C8ZB 2QA9E 4J2YB 1E1QD 1ZTJA 3CP7A 1L1JA 3S7KB 2XCNA 2HOBA 4AGKA 3FO8D 4OGXA 1G2MA 3HK3B 3A8BA 2GCTB 1P2MA 3EA7A 2ZGJA 1WBGB 3O8CA 2P3FH 2BDAA 3ZIAD 1QNJA 1A0LA 1EAWA 3OEED 2XTTB 1UHBB 1C2JA 1SC8U 4P02A 5DP5A 5HKKD 3MO6A 1SQRA 3AW0A 2W3IA 1MTSA 1EJAA 3BEUA 4KKDA 1ZRBA 1C1TA 4FUFA 2HVYB 1FY5A 2GMTB 3M35A 4K3JA 2F91A 3RUOA 5GDSH 3KIDU 3SJ8A 4HFPB 4AOQA 5T3HA 2QC2A 1O3DA 1TWXB 1CHGA 1AHTH 1QURH 1E79D 3VXFH 3UR9A 1K0HA 1ZGIA 1ZYOA 1OXGA 1HAZB 4VGCB 4AX9H 1O3JA 1QGFA 3MMGA 2P93A 3KGPA 1OSSA 1BBRK 1L2EA 1LQEA 4MNYA 1KDQA 3TJVA 3SU1A 3EA8A 2ZIQH 2FOGA 3KNXA 2BTCE 2DE9A 1EXFA 4Z0KA 2ODPA 4NWKA 2BDHA 2Q6FA 3RXGA 4YESB 1GBJA 1K28D 1J15A 1INCA 2A7CA 3SYJA 4MDSA 1YYY1 3SQHE 1C2HA 2OC1A 5EJ1A 2C8XB 2FEQH 3QDZB 2P8OB 3NPSA 3SV2H 9ESTA 1VCQA 1RD3B 1BT7A 1JOUB 1B5GH 3DSPA 4BAOB 1W8BH 1QB1A 3C1KA 3UWIA 1TRMA 4OS2A 1EPTC 1P3CA 4I8JA 4D7FA 1FY3A 5IDKA 4KELA 1RTKA 1ESAA 1HDTH 1QBOA 1EJNA 1TALA 4OM9A 2STAE 1TNHA 3ATIA 3V0XA 1FY4A 1UCYK 1GCTB 2AYWA 1DT2A 4GLYA 4ISLA 5KEDA 1HAVB 1VJAU 2IJOB 2V0BA 4RSPA 2Z3EA 2VU8E 1MTWA 4I86A 5JB9S 3C27B 1PPBH 1H9HE 3UNQA 3SHAH 1ZMNA 2FMJA 5C0UA 1V2JT 3OE7D 4F48B 2AGIX 1SL3A 1MD8A 4DJZB 1TNKA 1W0YH 3H7OA 1K1LA 2WV5A 3QZQA 1ABIH 2IOTA 2TPIZ 1A46H 1ZSLA 4CHAC 1HJ8A 1WU1A 4CRDA 2GV6A 1O3BA 2V7QD 3SJIA 4F55A 6GCHG 5E2OA 2G8TA 5JB8S 1KY9A 1MQ6A 3E6PH 4YZUA 1BMLA 5FX6A 2J2UA 1JIRA 2BY5X 4ABHA 1UVOA 3ENSB 1ZSJA 5DP9A 1CT2E 3N7EA 1C1NA 1SSXA 1GBBA 1Z8JB 3DFJA 5JYIA 2VINA 1J9CH 1OKXA 1XUFA 1KDQB 5EGMA 4DG4A 7KMEH 1ANCA 2W6ID 1IQHA 1T4VH 1UK4A 2BD5A 1GHYH 5EW2H 2GCHF 2R0LA 1V2MT 1YC0A 3M3VA 4MPUA 3ZYDA 2FI3E 5A8XA 2HLDD 3FZZA 1V3XA 1XM1A 3E91A 2WV9A 2GCTC 2K1QA 3TU7H 2OD3B 3BTEE 1O2RA 1O2TA 1GBCA 1EOJA 2C3SA 3UIRA 3S9AA 4JZFH 4WY3A 2D2DA 2VBCA 1CHOF 4Y0YE 1F0TA 5C3NA 4NA7A 1BMFD 2G4UA 5EW1H 1CA8B 1MZDA 1BHXB 1SGEE 4FUJA 3SNEA 1PPCE 4VGCC 3TJOA 4BNRA 4CBOA 4P00A 3AK5A 5C1UA 4O3UA 1TX6A 3FP6E 2Q6GA 1AZZA 1SFQB 2V3OH 4XE4A 1FN8A 3UOPA 3ZVCA 5HGGA 2BZAA 2D8WA 1JIMA 4AC9A 4I33A 4B2BA 4NCYA 1TLDA 1MUEB 1NRRH 1SLVB 4IMQA 1JMOH 1UTMA 4XSKU 4XDEA 1TGBA 4ACAA 1G2LA 2BLVA 1JRTA 1FV9A 5FPTA 4FVDA 3RMOH 1HBTH 1S5SA 1GG6B 1E0FD 3LJOA 5AVDA 3O8RA 1W0KD 3GISB 2SGDE 4I8LA 1MCTA 3OAAD 3FP8E 1P11E 4O97A 1GJ9B 1OP2A 2P8OC 2G5NA 1O2JA 1PQ7A 2AMPA 2W7UA 1LQDB 1MBQA 3M5OA 4Q7YA 1X7AC 4YM9A 1AUTC 2FPZA 1MKWK 4I7YH 1P2NA 3TGJE 5JBBS 3T29A 3P8GA 3ZVAA 1C5WB 4ISOA 1P06A 4Y10E 4LXBH 2TIOA 3HPTB 2TBSA 1YPMH 3QK1A 2ILNA 6CHAB 5L2ZH 1Y59T 2XC4A 1E1RD 2BZ6H 1GMHF 2A2XH 1QIXB 1O36A 4AB9A 2GDEH 2PSXA 2ZECA 3UQVA 1HXFH 1YF4A 3CENA 1G3BA 2FOBA 7GCHF 1DLEA 1YWUA 2NU1E 2QY0B 1A2CH 2A31A 3UAIC 1EB2A 2UWOA 1C5UA 1AFQC 3OY6U 1J8AA 3U8TH 1BQYA 3Q00A 1L1GA 4NIYA 1QA7A 5EQSA 1VCWA 4D8NA 1DUAA 3PWCA 5BPEA 4GAWA 1MZAA 4JCNA 5HMAA 3A83A 2ZU4A 4JK5A 3ZVFA 4WJG2 4IN1A 3UY9A 5TJXA 1O3IA 5EPNA 3CS7A 1O2KA 1A0HB 5CE1A 3T25A 3AAVA 1O35A 1THSH 2KZ4A 4I8GA 3SGQE 3NCLA 1DY9A 1QBVH 2H2ZA 2JKHA 1P3EA 2QF4A 3KYGA 1Y8TA 2SNWA 2HVXA 4JMYA 2VVCA 3SGBE 1ACBE 2FTMA 3M7UA 1NO9H 3LGTA 4ISNA 3DSOA 1UTLM 1OS8A 2YMSD 3LDXH 2ZDKA 4B2AA 2WPKS 5DGJA 5L30H 1C1WH 1K1NA 1QQ4A 3P6ZB 3U1IB 1PJPA 4AN7A 1IQIA 3SI4H 2BXUH 1DDJA 1EATA 4D76A 4HZHA 1YBWA 1AVXA 1BMAA 1O39A 4RI0A 1Q3XA 3OEHD 1GL0E 2A4RA 2XW9A 1F5KU 1UJ1A 3ZZ3A 2AIPA 1A0JA 1H9IE 1Z8RA 2VIQA 1F2SE 5GWZA 2G52A 3GDVA 1ZLRA 3URCA 5J4QA 1TMTH 4TT3D 5FAHA 1QL8A 2GT7A 1DOJA 1MKXH 2FI4E 3MU0A 4UFDH 2SNVA 4UFGH 2PP6A 5EIYA 2C8YB 1EKBB 1WUNH 3GY7A 1GBIA 1GJ8B 2JH0D 5I25A 3ITIA 1JXPA 1WCZA 1K1MA 1NESE 2STBE 3F68H 3I77A 2JH6D 1O5DH 4GHQA 4TPIZ 1O3FA 1Z8IB 1CT0E 4F4OC 1HPGA 1GHAG 2L74A 2VB0A 3MTYA 4INHA 2BY9X 2GZ9A 1P01A 1PYTD 4JZDH 4J1YA 2BD7A 1JRSA 4K1EA 4DCDA 3VXEH 2HNTC 4UD9H 1H4WA 2PTNA 2GD4B 4YXWD 4UEHH 1GBLA 2VIWA 3BTHE 3TIUA 3ZZCA 4CBNA 5CDFE 2JJ2D 2ZFSA 3BSQA 1FN6A 2F9OA 3E1XB 3MYWA 1YCPH 4I8HA 5GXPA 2F9VA 1L1NA 1CE5A 3SUDA 2XBXA 2H5DA 5HIZA 3EE7A 1MQ5A 1EAXA 3CS0A 1D6WA 2ANWA 2ZHEH 2AH4X 3PMHB 3LT3A 4DIHH 3ZVBA 5T6DA 4X1SU 3E3TA 2FLRH 2QN5T 4B76A 1VITH 1EUFA 1GJBB 2BHGA 3BTKE 1C2DA 3P70B 1K21H 2BY8X 2WV4A 3M5MA 4DW2U 1C5RA 4LK4A 1ESBA 4JZEH 3SNBA 2ZQ1A 3LONA 4NA8A 1AVGH 4JZIA 4X6NA 3VPKA 5LH8A 1P02A 3LPRA 1A3BH 1GI2A 2AFQB 4U2WA 1HJAB 2GV7A 2UUFB 3SORA 5C67A 2I6SA 1GI5A 2ZFPH 3A88A 1OWHA 1DLKB 3S9CA 4Q7XA 1C5YB 2AIQA 3DUXH 3HGNA 4OGYA 1KYNA 2AEIH 4TWWA 1P57B 1ZHRA 2FXRA 2VIDA 3SHCH 1D3PB 1QL7A 2A1DB 1LPZB 1BMMH 2BMGB 1ANDA 1OHHD 1IQFA 3MNCA 1UTOA 1ZOMA 5FCKA 2BDGA 4Y6DA 1HIAA 1WOFA 2A4OA 1FPCH 2HNTF 1QTFA 5DO4H 4TY7A 1YPLH 4K69A 3SJ9A 4ISIH 5A8YA 4XBBA 4ACBA 1G36A 1Z6EA 3QO6A 2CF8H 1IHSH 4ABAA 3KCGH 2CN0H 5IK2D 2ZZUH 1ID5H 1A5HA 3E0PB 3TJUA 2WUBA 4CRCA 1EPTB 1EOLA 1N6YA 1VCPA 3NKKA 4MNXA 3HKIB 4ZHLU 1O2VA 2CJIA 2I6QA 3MOCA 1MTNC 1NBME 4ZH8A 3WWBA 1SGYE 3RXQA 2Z9JA 3RU4E 2EC9H 2OK5A 3RP2A 4X1NU 1L4DA 2FIRH 3LH1A 2NU2E 2Q6DA 1GBAA 1ZSKA 1THRH 1EZUC 3A7WA 2FDAA 1H8HD 3KL6A 1E34B 1AZ8A 2FM2A 2A4QA 2HGTH 2AERH 4IW4E 2BD9A 3DD2H 2BM2A 1C2MA 2VWOA 3MU8A 1JWTA 1O3LA 2WZQA 3RXTA 4A92A 3TK6A 2PGQB 1P03A 3L33A 3MU4A 2FZZA 3VB7A 3GOVB 1S84A 1ESTA 4CHAB 4PROA 3DCLA 3BIUH 1SGNE 1H8DH 1H9LB 2CHAB 2JDID 3T26A 3ZZ5A 5C1XA 1MD7A 1K9OE 5CHAB 1MTUA 4NFEA 2QV1A 3S0NA 3KQCA 1GHWH 1BTXA 1UTNA 2Y5GA 2BY6X 1DUEA 1C1VH 1KMHB 3M5LA 2OQUA 3EAJA 1K1PA 3IG6B 5DN6D 5A8ZA 2VWNA 1Q31A 1BRAA 2OXSA 1TQ7B 1WSSH 4E7NA 3ZZ6A 1J16A 3ZV9A 2WHXA 1NZQH 2AGEX 1SOZA 1YPKH 2XBWA 2A32A 3MNBA 4K60A 4Q4LA 1P2JA 4Q7ZA 2Z9GA 1IAUA 3H09A 1HGTH 2EA3A 2KX4A 3SUEA 1KLJH 4Y8ZA 3D62A 1GMCF 3PRBA 1O31A 1ZPCA 1IQNA 2RDEA 2QXJA 2ZTZA 4Y8XA 1FPHH 3SZNA 4BANB 4I32A 1SLWB 4CRGA 1G30B 2A5AA 2W6JD 3RLWH 1HAYB 1KTTB 3EA9A 3DSGA 1WAYB 1MMJN 2J97A 3OU0A 3BTWE 2BD3A 1DWDH 5F8TA 1HJAC 1DWBH 1GI4A 1O2XA 3BF6H 1A3EH 8ESTE 8GCHF 2YMSC 1XX9A 7ESTE 1YLCA 3SU3A 3UNRA 4SGAE 1SFIA 1MAXA 1QA0A 2A4GA 3F6UH 4ESTE 4YLQH 2Z6BD 3SN8A 4ZCNA 2FO9A 2K0QA 1Z1IA 1YPGH 1YGCH 4WMEA 4DT7B 1OYTH 2CK3D 5EQQA 1ZHMA 4A6LA 1NM6A 2CF9H 3ZVEA 4UE7H 3PO1C 1MCVA 1OWJA 1FXYA 3KF2A 3MNSA 3OYPA 4FU7A 4A7IB 3SJOA 2ZPSA 2G4TA 1FX0B 1V2TT 3S9BA 1C5TA 2RCEA 1ANEA 3ATLA 1BITA 1VGCC 1WV7H 1YCPM 2OC0A 6ESTA 2PKAA 4IGDA 4HGCA 3SU5A 1TPOA 3L6PA 3SU4A 1AO5A 4DIIH 1FZZA 4X2WA 3LC5A 1GI6A 5C17A 4NGAH 3HATH 2KCOA 3T28A 4ZMAH 1N8OC 2GCHG 3EQ0H 2ZGBH 4YO9A 1PYTC 3ELAH 1TPPA 3A80A 2QXIA 1LHGH 1SQTA 3A7VA 4WH8A 1QR3E 1LHFH 2KCAA 2ZTYA 1YLDA 3M7QA 2WPLS 3A7TA 3TVJB 1CGHA 4FU8A 3A8AA 1AFQB 1NFWA 1LHCH 1CHOG 1KXFA 1FI8A 1W13U 3GCTG 1TGNA 3LGUA 1ZR0A 4H6TA 1GJAB 3LGWA 2O8TA 3BTQE 1GWAA 1PPHE 3GY6A 1FY8E 3HKJB 3M3SA 4OS4A 5LGOA 1SLXB 2QF0A 3RMMH 1C1PA 1MTVA 2P95A 2QE7D 3FKSD 4FUHA 5ETXA 1GHZA 4YOIA 3UFAA 2Y80A 4NIXA 3LGIA 2CHAC 2XCFA 1T8MA 5CHAC 2FESH 3KQ5A 2GGVB 3OTPA 3RXPA 1TE0A 1O2WA 2ZPRA 1GHVH 3U8RH 2EI8A 3GCHB 1AE8H 1FJSA 3GY3A 1C5LH 3Q77A 1TBQH 1P05A 4HTCH 4CREA 4Q63A 3FFGA 3E8LA 4R0IA 4MQAA 3G01A 2PUXB 1BTZA 1UO6A 2GT8A 3EGKH 4O9VA 4OS7A 1SGCA 1H1BA 2BQ6B 3A89A 2VGCC 1YCPK 1TOCB 4KTCA 4Y11E 5FX5A 1SMFE 1D3QB 3GY8A 1YY3A 5C5OA 1BZXE 1C5ZB 3JZ2B 1SQAA 1BTUA 1EAIA 2HLCA 2ZU3A 1C1RA 2YOLA 1GBFA 1YPJH 3TH3H 2R3YA 4IC5A 1Y3UA 1ZJKA 2WPHS 3FANA 1C5MD 3SOSA 1RRKA 1AN1E 1A4WH 5C2ZA 1W14U 1OWEA 2NU3E 2PKAB 4X0WU 5GJ4B 5DSFA 1PPGE 1DXPA 1Y3WA 2GZ7A 5L2YH 1CGJE 3VFEA 4MLFB 1V2KT 1ZRKA 2GVFA 2C8WB 4BAQB 5E2PA 3SV7A 1LPKB 2V3MA 5HM2A 3ZZDA 2P94A 3P92A 3MNXA 1S85A 1GDQA 2TRMA 1O5GH 3F9FA 3RXVA 1AY6H 3H7TA 2BX3A 2PR3A 1GJ5H 2R2MB 3PB1E 1OYQA 6GCHF 3W94A 3BN9A 2OP9A 2BOHB 2AHME 2FTLE 2HPQH 5DP3A 4IS5A 4X6MA 2QAAA 4FU9A 2BDCA 5EXLA 5K7RA 1TX8A 4NZLA 4QT8C 5JBTA 2GTBA 2JETC 5EXNA 4DOQA 5E8EH 1AWFH 3NWUA 1GMDF 4B74A 5GCHF 2SGQE 3T27A 1TFXA 4BXSA 3NXPA 1Y5AT 1O3HA 1GBEA 3U9AH 3S7HB 1GL1A 1LDTT 3UOUA 1Y3XA 2Q1JA 1P9UA 1GI9B 1O2MA 1GGDB 3HGPA 3KHVA 1QJ7B 4RKOB 1EJMA 1KXAA 1AVWA 2ZC9H 5DG6A 3RU4T 1UTKA 2GJGA 1G37A 1C5OH 1A5GH 3BTGE 1O5BB 4YLUA 1O2ZA 1PPFE 3E90B 4GPGA 3RXRA 3SW2B 1D3TB 2FS9A 2AMDA 2VIPA 3RC5A 3RXHA 3TITA 4I8KA 1W10U 3M7TA 4ZKRU 1LVBA 3UNSA 4ABFA 3N7OA 1GDUA 4WMDA 1MU8B 3RXJA 1D6RA 3GDUA 3LGVA 1O3PB 4WMFA 2IPHA 3QGNB 1V2PT 1NU9A 3VGCB 3EYDA 4LOYH 5C1YA 1A1RA 1SHYA 2FI5E 2ANMH 1BBRH 1GJ4H 1NFYA 3DT0H 1O5AB 3A8DA 4NSYA 1QY6A 2VWMA 3ATMA 1SGTA 1ZTKA 2AGGX 1BTWA 1HRTH 3F3BA 3GCHC 2L6OA 1EASA 3A7XA 3ZZ8A 3OTJE 2CMYA 2B5TB 3QZRA 3VB4A 2ZEBA 3A7YA 4FOUC 1SVPA 5ESBA 2JJ1D 1H8IH 1O3KA 1PPZA 3RDZA 4E7RG 1RJXB 2O8UA 2BVSH 3LC3A 3RMNH 1WTHD 3UUZA 1NFUA 1O34A 1AWHB 3RXFA 5B6OA 4X6PA 1O2PA 4NIVA 4LZ1H 1TMUH 1FQ3A 4YT6H 1P2KA 1XXFA 1Z71A 5GPIB 3LU9B 4ABEA 3K6ZA 4U01A 1XVOA 3TK9A 3A8CA 4FUDA 3SI3H 1IQKA 5C0TA 1C1MA 2Z7FE 1OX1A 4RT1A 1BJVA 1MTNB 1UCYH 2ZWLH 4K5ZA 2A45B 4XOJA 2PW8H 4E06H 5FXLA 1C1SA 1VJ9U 2ULLA 1ANBA 1KXBA 2B7DH 3P8FA 1GBTA 2J38A 2WSSD 3AASA 4ABBA 3DA9B 3R3GB 1XKBC 1WDIA 1SKYE 1T8LA 2VVUA 5IYTA 2SFAA 5HXFA 3IWMA 4CRBA 1GJCB 1C5XB 1HAPH 1ZMJA 3RM0H 3GS9A 4OS1A 4BOHA 2VJ1A 4IMZA 3RXSA 1LMWB 1CSOE 2P16A 1V2VT 1Q2WA 3RM2H 1DSTA 4CH2B 3STIA 2WPJS 4NSVA 3U98H 1GHBG 2Z3DA 1PQAA 2RFKC 3F1SB 5C20A 2Y6TA 1S6FA 5F8ZA 1P9SA 2VNTA 4B6EA 3D23A 2ZCHP 2ZKSA 4H4FA 2P3TB 5EXMA 4YOGA 2UWLA 1C1QA 3PV5A 3PWBA 2J9NA 2VWLA 1ZMLA 4ZXXH 1VITG 1H8ED 4GCHG 2W5EA 2QF5A 2OTVA 3A87A 1GPZA 2KAIA 5E0JA 1C9TA 1A61H 1GGDC 1V2LT 1W0JD 3NZIA 5A2MH 1J17T 1HAXB 5A0CA 1XUJA 1QJ6B 2BDIA 4BXWA 5ABWA 1SI5H 1S81A 1EAUA 3PM3A 1OWKA 2BD2A 3BIVH 3GY4A 2ZCLP 1TAWA 2Y82A 4JK6A 1K2I1 4FUGA 3QGJA 1BTHH 5EPYA 1C5PA 7LPRA 4B75A 1UW7A 5AFZH 1EZSC 4ZKOU 4WH6A 2WPDD 1IQMA 1QRZA 4ABJA 2OBOA 2ODYB 2VIVA 2HWLB 4Y7AA 2XOKD 3M37A 3SQEE 2ZPQA 1BIOA 1V2QT 2V35A 1FNIA 3F9GA 2H9TH 1BRUP 3VGCC 2ZG0H 1BHXF 1AQ7A 1SBWA 4X8VH 2J94A 2YMSB 3UREA 2ZF0H 1YKTA 2Y7XA 1C1UH 3S69A 2XNDD 1G3DA 3SNCA 1QFKH 4KTUA 5A0AE 3MI4A 4Y7BA 3SO3A 1GHAF 1ZHPA 1QRWA 4TWYA 2ZO3H 3K6YA 5DJ7A 2RA0A 3GYMA 1KXDA 1IHTH 1YP9A 4O03A 1TPSA 2M5TA 1XUKA 1O32A 1T31A 3PO1B 1B0FA 5SGAE 2ZFRH 3F2HA 2D1JA 1F0RA 1ELDE 4Y71A 3TLOA 2XBVA 1VGCB 1K1IA 2FX6A 4WXVA 4R8TB 5DP8A 1GHXH 2C93B 2PV9B 5HM9A 1O30A 1TQ0B 1KXCA 1C9PA 3RC4A 1MKWH 1GI1A 3MFJA 1GCDA 1UHBA 1G9IE 3W1EA 4B1TA 5C5NA 2V6NA 2OQ5A 1MU6B 1TBRH 3DHKH 2G81E 1XUIA 1NY22 3GICB 1YPHE 1ELCA 1GI8B 1F0UA 3MU1A 1TYNA 3MHWU 4HG6A 1DANH 1DFPA 1DPOA 1HXEH 1N8OB 1NROH 3HK6B 3PLKA 4BTUB 2BDBA 4ZAEA 2WINI 3EE0B 1E35B 2LP6A 3KQBA 1HCGA 1AIXH 1S82A 4X2YA 4D7GA 4TY6A 3SGAE 4FUBA 4AYYB 4ASHA 5A0BA 2P3UB 4ZKSU 1FIZA 4IBLH 1WQVH 1ELTA 1FAXA 2SGPE 3GYLB 1JBUH 2XXLA 3EDXB 1NN6A 4XBDA 2WPIS 1V2RT 2FWWA 4BAKB 4THNH 2RDLA 5L6NH 3H5CB 1M9UA 5EQRA 1EP6A 4GUXA 2ZGHA 5HYOA 2PGBB 2OC8A 5G4BA 4WVPE 1SPJA 1A7SA 3ZZ4A 4DGJA 4Z1MD 4X8SH 2H9HA 3ZZ7A 1F5RA 1V6DA 4X8UH 5A09A 2QXGA 3F0OA 8GCHG 1Z6JH 4Y76A 5BRRE 4ZUHA 2F9PA 3KEEA 1EFRD 2ZNKH 3GDSA 2ZDVH 3ATWA 3D49H 3PV4A 1COWD 1O2LA 4HI3A 1O2HA 1O38A 1AI8H 1TGSZ 2VIOA 4H6SB 2KCYA 4AFZA 1L4ZA 1TX7A 1G3EA 3QTVH 1J14A 1DE7H 3L3TA 3RXDA 2AS9A 4DT4A 2DE8A 1L0ZA 2Z3CA 2ZU1A 5JBCS 1S0QA 5LPFA 3V3MA 1HAIH 1K1OA 4AORA 1NRNH 3NRLA 1QCPA 2VGCB 3P95A 1SGIB 2ZHQH 1HIAB 1RGQA 2LPRA 2PSYA 1HNEE 1NRPH 1NS3A 4BAMB 1SR5C 5EJLA 1O3CA 4LZ4B 1QRXA 1U6QA 5JBAS 4YT7H 1O37A 4D9QA 4ZHMU 1CQQA 2IN2A 1GVKB 2C90B 1ZPZA 1C4V2
chains in the Genus database with same CATH topology
2J98A 1QZ8A 2J97A 5HIZA 2J98B 3EE7A 5C94A 5HIYA 1UW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J98 A;  1QZ8 A;  2J97 A;  5HIZ A;  2J98 B;  3EE7 A;  5C94 A;  5HIY A;  1UW7 A; 
#chains in the Genus database with same CATH topology
 1LVY A;  1GBD A;  1GJ7 B;  3BEF B;  1CA0 B;  1TGT A;  1TNI A;  2BYA X;  1O2O A;  1ELA A;  1SGP E;  2FOC A;  1UK3 A;  1YPE H;  1HB0 B;  2ASU B;  2XC0 A;  1TA6 A;  1TPA E;  3QX5 H;  8LPR A;  5FBE A;  5EOK A;  4YTA A;  1QZ8 A;  1GI3 A;  1ZGV A;  4FVB A;  9LPR A;  1QQU A;  1OOK B;  4WWY A;  5H4I B;  3MO9 A;  4KTS A;  5FCR A;  1O3E A;  1LCY A;  2XRC A;  3Q3K A;  3B23 B;  3SU6 A;  1BB0 B;  2BLO A;  2J34 A;  2QIQ A;  1SGR E;  1C5N H;  5LPR A;  3FAO A;  3ZVD A;  4INK A;  1VKY A;  1DIT H;  3B9F H;  1CGI E;  3Q3Y A;  3MH6 A;  5LPE A;  2CXV A;  4A1X A;  3ZVG A;  1P04 A;  3TNS A;  2H6M A;  1B0E A;  1TON A;  1ABJ H;  2B8O H;  2R0K A;  3BEI B;  3TNT A;  2JET B;  2Z94 A;  3ATK A;  2HRV A;  3KQD A;  2ODQ A;  1CBW B;  1YPH C;  3BV9 B;  3OFN D;  3STJ A;  2ZHW H;  1RIW C;  4ISH H;  4ASU D;  4AYV B;  1HYL A;  1SGQ E;  1C2I A;  2Z9K A;  2ZCK P;  1GJD B;  1BDA A;  4I31 A;  1QB6 A;  4FUE A;  1IQG A;  1HAH H;  2F9B H;  3V12 A;  5CMX H;  1SGD E;  2OC7 A;  2YNA A;  2PKS C;  3AW1 A;  1LO6 A;  3VB3 A;  2BVX H;  2ZQ2 A;  1IQL A;  3MWI U;  2GP9 B;  3SV8 A;  5FBI A;  2F83 A;  2RA3 A;  1KXE A;  2SGA A;  1UMA H;  3LIW A;  1QBN A;  5JPM H;  1QB9 A;  1TA2 A;  2W26 A;  2QYI A;  1DWC H;  3FZD A;  2P59 A;  2K8I A;  1FLE E;  4AFQ A;  1D3D B;  1ORF A;  3ZZA A;  2BLW A;  4M9F A;  1PPE E;  1C4U 2;  4XBC A;  5FHT A;  1AFE H;  1BRC E;  1UVT H;  1BBR E;  3SZE A;  4A1V A;  2TGA A;  3QWC H;  2ANK H;  1DVA H;  1MKX K;  1CT4 E;  2FS8 A;  2G00 A;  3FP7 E;  4GSO A;  4ZKN U;  2HPP H;  4ZHA A;  1DM4 B;  2Y5H A;  1S6L A;  1NTP A;  1UK2 A;  1S6H A;  3FVF B;  5AFY H;  3LGY A;  1F5L A;  3F0P A;  5T1V A;  3A85 A;  2KFW A;  5EST E;  2ALV A;  4INL A;  2VH0 A;  3U28 C;  3V7T A;  2PUQ H;  3RXM A;  1BA8 B;  2JH5 D;  2OBQ A;  1AE5 A;  2THF B;  2XYA A;  2G51 A;  2GZ8 A;  4MPX A;  3A84 A;  5T6F A;  4B73 A;  2BY7 X;  3TH4 H;  1NRQ H;  1FDP A;  4AG2 A;  4KP0 A;  2XNI A;  1O2I A;  3E16 B;  3QLP H;  3WWF A;  2CGA A;  3PRD A;  2C4F H;  1TGC A;  1KLI H;  2H9E H;  2G5V A;  1GVZ A;  3RXB A;  1W0Z U;  1C5S A;  2QCY A;  4AB8 A;  2TGT A;  3IIT A;  3U1J B;  1Y3V A;  3MU5 A;  3GCO A;  1QHR B;  3LKW A;  1ZJD A;  3K65 B;  1HV7 A;  3OY5 U;  4UDW H;  1W2K H;  1WYK A;  1SB1 H;  1GMD G;  1ETS H;  2IJD 1;  5GCH G;  1PQ8 A;  1UCY E;  2AMQ A;  4K1T A;  1KTS B;  4NA9 H;  2A7H A;  3D65 E;  4Y8Y A;  1HAO H;  3ODD A;  3F2G A;  2UWP A;  3K9X B;  1CA0 C;  4K1S A;  2FYR A;  1LKB A;  1AB9 B;  3PMB B;  4F49 A;  1O5E H;  1D9I A;  1TOM H;  3OX7 U;  3MQK C;  3P8N A;  3PMJ A;  1B7X B;  4KGA A;  4RT0 A;  2OLG A;  2WPM S;  1T8O A;  4Y0Z E;  2BDY A;  1C2F A;  1O33 A;  5F8X A;  1NC6 A;  4U32 A;  1GMH G;  4BAH B;  4M7G A;  4RKJ B;  1ETR H;  3GCT F;  2J92 A;  3LJJ A;  3ODF A;  5DP6 A;  5DK1 A;  2GMT C;  2ZFF H;  4MPV A;  3ZZB A;  2BQW B;  1C2E A;  5DP4 A;  7GCH G;  4Q80 A;  5F6M A;  5DPA A;  1W7X H;  2FLB H;  1GBK A;  3T2N A;  1S83 A;  1NFX A;  4K8B A;  1GBH A;  5B6L A;  2PTC E;  2WUC A;  1V2O T;  1C5V A;  1BMN H;  3U69 H;  2SGF E;  2KR7 A;  2ZU2 A;  4B71 A;  1EX3 A;  2HAL A;  5GIB A;  1FUJ A;  5C94 A;  2FOD A;  1CBW C;  1V2W T;  2F43 B;  1DY8 A;  2ZGC A;  1RTL A;  3PTB A;  1O3G A;  1O3O A;  3RXL A;  4ABI A;  2ZTX A;  3EST A;  4XD7 D;  1V2S T;  2LNC A;  2PHB A;  4MNV A;  2RG3 A;  1EZX C;  3OSY A;  6LPR A;  2ZU5 A;  1C2G A;  1SQO A;  3ZV8 A;  1HAG E;  1PQ5 A;  1Y5B T;  3AAU A;  3T5F H;  5EOD A;  2W7S A;  1ELV A;  2DUC A;  3BG4 B;  1OP8 A;  4TYD A;  1GDN A;  2R9P A;  2Y5F A;  1EB1 H;  4TSF D;  5I46 H;  1P09 A;  2HNT E;  1SG8 B;  5E0G A;  4XRN A;  1Z7K A;  2KM0 A;  1WQS A;  2FOF A;  1FIW A;  4NIW A;  4JYU H;  3UPE A;  1AKS A;  4BTT B;  5EJZ A;  1NRS H;  2BXT H;  2XWB I;  5FL7 D;  3T62 A;  3UTU H;  1AUJ A;  4X8T H;  3PLP A;  3A81 A;  1BRB E;  2EY4 C;  4AZ2 B;  1BJU A;  1GCT C;  4JYT A;  3VB6 A;  1LHE H;  1ZPB A;  4NFF A;  1SHH B;  2FX4 A;  4IC6 A;  2O9Q A;  2ZI2 H;  2GX4 A;  2J98 A;  2PWX A;  3BTD E;  1TMB H;  3TH2 H;  4ABG A;  1WTG H;  2GKV E;  1TNL A;  3ZZ9 A;  2ZFQ H;  1RTF B;  1HJ9 A;  3R0F A;  1DSU A;  1SGF A;  1CVW H;  2FOM B;  4Z6A H;  2NWN A;  2V3H H;  3PLB A;  3O8D A;  3UR6 A;  3M36 A;  4CRF A;  1P8V C;  1W7G H;  3B8J A;  4FUC A;  1LPG B;  2ZDA H;  1BCU H;  1S0R A;  4Y79 A;  2A7J A;  3SND A;  3RLY H;  1ELG A;  3PTN A;  5F53 A;  3UQO A;  1F7Z A;  2TGD A;  1P12 E;  1TRN A;  8KME 2;  3RXO A;  2XC5 A;  4MG3 A;  5TCA A;  3PYH A;  3WY8 A;  1C5Q A;  1BUI A;  1EZQ A;  1O2Q A;  1IQJ A;  1A5I A;  1MAB B;  5K0H A;  2TGP Z;  2OUA A;  3M61 U;  5KGO A;  2ZHD A;  2ZGX H;  2F4L A;  1BTP A;  1W11 U;  1C2L A;  2UUK B;  3LOX A;  4GVU A;  2EI7 A;  2ZHF H;  5HIY A;  2BX4 A;  2ZFT A;  3K2U A;  1T7C A;  2ALP A;  2OIN A;  2BD8 A;  4DUR A;  1GI7 B;  2A5K A;  3PV2 A;  5CHB A;  1ARC A;  3QN7 A;  4D9R A;  2R2W U;  4CRA A;  2BVR H;  1AB9 C;  2GDD A;  4X6O A;  3MO3 A;  4K8Y A;  2XBY A;  2Y81 A;  2FOH A;  4AFS A;  2B0F A;  1V2N T;  3I29 A;  1TRY A;  1DWE H;  2BB4 A;  1UVU H;  2WYJ A;  5AHG H;  3RXU A;  2VH6 A;  4ZRO A;  4X1Q U;  4X2V A;  1ZZZ A;  4MPW A;  4NG9 H;  1ELF A;  1NBM D;  5EG4 A;  1NU7 B;  3BTT E;  3TGK E;  3RXA A;  2ANY A;  3RML H;  1AKS B;  3SUG A;  2BOK A;  3RU4 D;  2Y7Z A;  4DY7 B;  2O8W A;  1XUG A;  1LVO A;  1V2U T;  2J4I A;  2SGE E;  3SBK A;  1Z8G A;  1XXD A;  1N6X A;  4E05 H;  1YLN A;  1TBZ H;  2WYG A;  2J98 B;  2D26 C;  1O2S A;  1T32 A;  1YM0 A;  3TK5 A;  2QXH A;  4CR5 A;  2ZA5 A;  3O8B A;  2XWA A;  3KQE A;  4RN6 A;  4NZQ A;  2F9U A;  2BQ7 B;  1GG6 C;  5TCC A;  2Z9L A;  4CR9 A;  1EPT A;  3MH4 A;  1MBM A;  1RFN A;  2CV3 A;  4MVN A;  4A1T A;  4DVA U;  3SV9 A;  1UVP A;  1TIO A;  2PLX A;  2ZDM A;  1F92 A;  2UUY A;  3BG4 C;  1HLT H;  4OS5 A;  3FOA A;  2G55 A;  1OWD A;  1KSN A;  2FP7 B;  4CH8 B;  4ZXY H;  1IQE A;  5FPS A;  5KEC A;  4AG1 A;  5F03 A;  3SJK A;  1MH0 A;  2B9L A;  4IN2 A;  2FOA A;  4B6F A;  1N1L A;  3SV6 A;  2ZDL A;  3M5N A;  1DXW A;  5PTP A;  2QF3 A;  5FPY A;  3VB5 A;  1O2Y A;  1O2G H;  1XVM A;  2F3C E;  1O3N A;  1FON A;  1TAB E;  5JDU B;  1UVS H;  1P10 A;  1DIC A;  1RXP A;  1F0S A;  4UFE H;  3ZYE A;  6CHA C;  3BTM E;  1Y3Y A;  1LVM A;  2M2A A;  1QL9 A;  1KIG H;  2KCP A;  3QTO H;  2F9N A;  3P8O A;  3LH3 A;  1WXR A;  4JYV H;  1UTJ A;  2J95 A;  3TPI Z;  1P2I A;  4A5T S;  2UUJ B;  4O3T A;  3I78 A;  1FAK H;  3GY5 A;  2Z9I A;  1TB6 H;  3VEQ B;  1GHB F;  1OPH B;  2IPQ X;  1VR1 H;  2EI6 A;  3AVZ A;  4UON A;  1HFD A;  4H42 U;  1EP5 A;  1QJ1 B;  1C1O A;  3BG8 A;  2R3U A;  2A2Q H;  4YOJ A;  3N99 A;  3NK8 A;  1TNJ A;  2FYQ A;  1O2U A;  3UWJ H;  3Q76 A;  5E0H A;  2QGR A;  4TPY A;  2ZP0 H;  1SLU B;  1ZTL A;  3U8O H;  2W3K A;  1NPM A;  3GY2 A;  3MH5 A;  4FXG H;  1C2K A;  1LTO A;  1XMN B;  1OWI A;  3MH7 A;  1FMG A;  1OP0 A;  1LHD H;  1VIT F;  1NT1 A;  3RC6 A;  3RXI A;  3RXC A;  3SUF A;  2ZDN A;  1K1J A;  2NU0 E;  4GCH F;  3KN2 A;  4UFF H;  1KLT A;  1RIW B;  1UTQ A;  2H5C A;  1DX5 M;  2JIZ D;  1T8N A;  3NUM A;  5J4S A;  1E36 B;  1ELE E;  4BTI B;  2A0Q B;  4AGJ A;  2H1U A;  2O8M A;  1GBM A;  1THP B;  4AFU A;  2YNB A;  5T6G A;  1ETT H;  4MTB A;  1PFX C;  2PKS B;  4FUI A;  4SGB E;  1RS0 A;  1BTY A;  3DFL A;  3RXE A;  3SU0 A;  3KYF A;  1ELB A;  1D4P B;  2KAI B;  1AU8 A;  1SOT A;  4GHT A;  1GMC G;  3SU2 A;  5AF9 H;  3V13 A;  1XKA C;  3TJN A;  1CU1 A;  2EQN A;  1P2O A;  1UTP A;  1GJ6 A;  1P0S H;  1O0D H;  3VG8 A;  2OCV B;  1E38 B;  2FOE A;  1Y5U T;  3P17 H;  1XUH A;  4X1R U;  4X2X A;  1HUT H;  1W12 U;  3URD A;  3A7Z A;  3F9H A;  4X1P U;  1DS2 E;  3SNA A;  1ARB A;  3A86 A;  4K2Y A;  1BOQ A;  1IOE A;  3A82 A;  1O3M A;  1TNG A;  1LKA A;  4FET A;  1MAY A;  1P2Q A;  4ABD A;  5EU8 A;  1K22 H;  3W95 A;  2J5U A;  4OS6 A;  2BLQ A;  4MNW A;  3E0N B;  3WW7 A;  3FN8 A;  3GCN A;  2NU4 E;  4WXI A;  3TGI E;  1E37 B;  5GND A;  1GI0 A;  2A5I A;  2EST E;  3M3T A;  3F9E A;  4WF8 A;  1AMH A;  1AD8 H;  2PFE A;  1W3C A;  2VVV A;  4Q2K A;  4B2C A;  2O8L A;  3QUM P;  1EQ9 A;  2EEK A;  1CO7 E;  4XFQ A;  3BTF E;  1O3A A;  3PMA B;  1VZQ H;  5DKM A;  5DP7 A;  1SGF G;  2LEL A;  1FY1 A;  3PRO A;  1C4Y 2;  1G32 B;  3N7D A;  1HAV A;  1O5C B;  1O2N A;  2BD4 A;  4U30 A;  1AGJ A;  3UB0 A;  1O5F H;  1T4U H;  3JZ1 B;  1G3C A;  4NWL A;  3CNR A;  3RXK A;  4JZ1 A;  3F2F A;  1Z1J A;  3Q3X A;  1GVL A;  2C8Z B;  2QA9 E;  4J2Y B;  1E1Q D;  1ZTJ A;  3CP7 A;  1L1J A;  3S7K B;  2XCN A;  2HOB A;  4AGK A;  3FO8 D;  4OGX A;  1G2M A;  3HK3 B;  3A8B A;  2GCT B;  1P2M A;  3EA7 A;  2ZGJ A;  1WBG B;  3O8C A;  2P3F H;  2BDA A;  3ZIA D;  1QNJ A;  1A0L A;  1EAW A;  3OEE D;  2XTT B;  1UHB B;  1C2J A;  1SC8 U;  4P02 A;  5DP5 A;  5HKK D;  3MO6 A;  1SQR A;  3AW0 A;  2W3I A;  1MTS A;  1EJA A;  3BEU A;  4KKD A;  1ZRB A;  1C1T A;  4FUF A;  2HVY B;  1FY5 A;  2GMT B;  3M35 A;  4K3J A;  2F91 A;  3RUO A;  5GDS H;  3KID U;  3SJ8 A;  4HFP B;  4AOQ A;  5T3H A;  2QC2 A;  1O3D A;  1TWX B;  1CHG A;  1AHT H;  1QUR H;  1E79 D;  3VXF H;  3UR9 A;  1K0H A;  1ZGI A;  1ZYO A;  1OXG A;  1HAZ B;  4VGC B;  4AX9 H;  1O3J A;  1QGF A;  3MMG A;  2P93 A;  3KGP A;  1OSS A;  1BBR K;  1L2E A;  1LQE A;  4MNY A;  1KDQ A;  3TJV A;  3SU1 A;  3EA8 A;  2ZIQ H;  2FOG A;  3KNX A;  2BTC E;  2DE9 A;  1EXF A;  4Z0K A;  2ODP A;  4NWK A;  2BDH A;  2Q6F A;  3RXG A;  4YES B;  1GBJ A;  1K28 D;  1J15 A;  1INC A;  2A7C A;  3SYJ A;  4MDS A;  1YYY 1;  3SQH E;  1C2H A;  2OC1 A;  5EJ1 A;  2C8X B;  2FEQ H;  3QDZ B;  2P8O B;  3NPS A;  3SV2 H;  9EST A;  1VCQ A;  1RD3 B;  1BT7 A;  1JOU B;  1B5G H;  3DSP A;  4BAO B;  1W8B H;  1QB1 A;  3C1K A;  3UWI A;  1TRM A;  4OS2 A;  1EPT C;  1P3C A;  4I8J A;  4D7F A;  1FY3 A;  5IDK A;  4KEL A;  1RTK A;  1ESA A;  1HDT H;  1QBO A;  1EJN A;  1TAL A;  4OM9 A;  2STA E;  1TNH A;  3ATI A;  3V0X A;  1FY4 A;  1UCY K;  1GCT B;  2AYW A;  1DT2 A;  4GLY A;  4ISL A;  5KED A;  1HAV B;  1VJA U;  2IJO B;  2V0B A;  4RSP A;  2Z3E A;  2VU8 E;  1MTW A;  4I86 A;  5JB9 S;  3C27 B;  1PPB H;  1H9H E;  3UNQ A;  3SHA H;  1ZMN A;  2FMJ A;  5C0U A;  1V2J T;  3OE7 D;  4F48 B;  2AGI X;  1SL3 A;  1MD8 A;  4DJZ B;  1TNK A;  1W0Y H;  3H7O A;  1K1L A;  2WV5 A;  3QZQ A;  1ABI H;  2IOT A;  2TPI Z;  1A46 H;  1ZSL A;  4CHA C;  1HJ8 A;  1WU1 A;  4CRD A;  2GV6 A;  1O3B A;  2V7Q D;  3SJI A;  4F55 A;  6GCH G;  5E2O A;  2G8T A;  5JB8 S;  1KY9 A;  1MQ6 A;  3E6P H;  4YZU A;  1BML A;  5FX6 A;  2J2U A;  1JIR A;  2BY5 X;  4ABH A;  1UVO A;  3ENS B;  1ZSJ A;  5DP9 A;  1CT2 E;  3N7E A;  1C1N A;  1SSX A;  1GBB A;  1Z8J B;  3DFJ A;  5JYI A;  2VIN A;  1J9C H;  1OKX A;  1XUF A;  1KDQ B;  5EGM A;  4DG4 A;  7KME H;  1ANC A;  2W6I D;  1IQH A;  1T4V H;  1UK4 A;  2BD5 A;  1GHY H;  5EW2 H;  2GCH F;  2R0L A;  1V2M T;  1YC0 A;  3M3V A;  4MPU A;  3ZYD A;  2FI3 E;  5A8X A;  2HLD D;  3FZZ A;  1V3X A;  1XM1 A;  3E91 A;  2WV9 A;  2GCT C;  2K1Q A;  3TU7 H;  2OD3 B;  3BTE E;  1O2R A;  1O2T A;  1GBC A;  1EOJ A;  2C3S A;  3UIR A;  3S9A A;  4JZF H;  4WY3 A;  2D2D A;  2VBC A;  1CHO F;  4Y0Y E;  1F0T A;  5C3N A;  4NA7 A;  1BMF D;  2G4U A;  5EW1 H;  1CA8 B;  1MZD A;  1BHX B;  1SGE E;  4FUJ A;  3SNE A;  1PPC E;  4VGC C;  3TJO A;  4BNR A;  4CBO A;  4P00 A;  3AK5 A;  5C1U A;  4O3U A;  1TX6 A;  3FP6 E;  2Q6G A;  1AZZ A;  1SFQ B;  2V3O H;  4XE4 A;  1FN8 A;  3UOP A;  3ZVC A;  5HGG A;  2BZA A;  2D8W A;  1JIM A;  4AC9 A;  4I33 A;  4B2B A;  4NCY A;  1TLD A;  1MUE B;  1NRR H;  1SLV B;  4IMQ A;  1JMO H;  1UTM A;  4XSK U;  4XDE A;  1TGB A;  4ACA A;  1G2L A;  2BLV A;  1JRT A;  1FV9 A;  5FPT A;  4FVD A;  3RMO H;  1HBT H;  1S5S A;  1GG6 B;  1E0F D;  3LJO A;  5AVD A;  3O8R A;  1W0K D;  3GIS B;  2SGD E;  4I8L A;  1MCT A;  3OAA D;  3FP8 E;  1P11 E;  4O97 A;  1GJ9 B;  1OP2 A;  2P8O C;  2G5N A;  1O2J A;  1PQ7 A;  2AMP A;  2W7U A;  1LQD B;  1MBQ A;  3M5O A;  4Q7Y A;  1X7A C;  4YM9 A;  1AUT C;  2FPZ A;  1MKW K;  4I7Y H;  1P2N A;  3TGJ E;  5JBB S;  3T29 A;  3P8G A;  3ZVA A;  1C5W B;  4ISO A;  1P06 A;  4Y10 E;  4LXB H;  2TIO A;  3HPT B;  2TBS A;  1YPM H;  3QK1 A;  2ILN A;  6CHA B;  5L2Z H;  1Y59 T;  2XC4 A;  1E1R D;  2BZ6 H;  1GMH F;  2A2X H;  1QIX B;  1O36 A;  4AB9 A;  2GDE H;  2PSX A;  2ZEC A;  3UQV A;  1HXF H;  1YF4 A;  3CEN A;  1G3B A;  2FOB A;  7GCH F;  1DLE A;  1YWU A;  2NU1 E;  2QY0 B;  1A2C H;  2A31 A;  3UAI C;  1EB2 A;  2UWO A;  1C5U A;  1AFQ C;  3OY6 U;  1J8A A;  3U8T H;  1BQY A;  3Q00 A;  1L1G A;  4NIY A;  1QA7 A;  5EQS A;  1VCW A;  4D8N A;  1DUA A;  3PWC A;  5BPE A;  4GAW A;  1MZA A;  4JCN A;  5HMA A;  3A83 A;  2ZU4 A;  4JK5 A;  3ZVF A;  4WJG 2;  4IN1 A;  3UY9 A;  5TJX A;  1O3I A;  5EPN A;  3CS7 A;  1O2K A;  1A0H B;  5CE1 A;  3T25 A;  3AAV A;  1O35 A;  1THS H;  2KZ4 A;  4I8G A;  3SGQ E;  3NCL A;  1DY9 A;  1QBV H;  2H2Z A;  2JKH A;  1P3E A;  2QF4 A;  3KYG A;  1Y8T A;  2SNW A;  2HVX A;  4JMY A;  2VVC A;  3SGB E;  1ACB E;  2FTM A;  3M7U A;  1NO9 H;  3LGT A;  4ISN A;  3DSO A;  1UTL M;  1OS8 A;  2YMS D;  3LDX H;  2ZDK A;  4B2A A;  2WPK S;  5DGJ A;  5L30 H;  1C1W H;  1K1N A;  1QQ4 A;  3P6Z B;  3U1I B;  1PJP A;  4AN7 A;  1IQI A;  3SI4 H;  2BXU H;  1DDJ A;  1EAT A;  4D76 A;  4HZH A;  1YBW A;  1AVX A;  1BMA A;  1O39 A;  4RI0 A;  1Q3X A;  3OEH D;  1GL0 E;  2A4R A;  2XW9 A;  1F5K U;  1UJ1 A;  3ZZ3 A;  2AIP A;  1A0J A;  1H9I E;  1Z8R A;  2VIQ A;  1F2S E;  5GWZ A;  2G52 A;  3GDV A;  1ZLR A;  3URC A;  5J4Q A;  1TMT H;  4TT3 D;  5FAH A;  1QL8 A;  2GT7 A;  1DOJ A;  1MKX H;  2FI4 E;  3MU0 A;  4UFD H;  2SNV A;  4UFG H;  2PP6 A;  5EIY A;  2C8Y B;  1EKB B;  1WUN H;  3GY7 A;  1GBI A;  1GJ8 B;  2JH0 D;  5I25 A;  3ITI A;  1JXP A;  1WCZ A;  1K1M A;  1NES E;  2STB E;  3F68 H;  3I77 A;  2JH6 D;  1O5D H;  4GHQ A;  4TPI Z;  1O3F A;  1Z8I B;  1CT0 E;  4F4O C;  1HPG A;  1GHA G;  2L74 A;  2VB0 A;  3MTY A;  4INH A;  2BY9 X;  2GZ9 A;  1P01 A;  1PYT D;  4JZD H;  4J1Y A;  2BD7 A;  1JRS A;  4K1E A;  4DCD A;  3VXE H;  2HNT C;  4UD9 H;  1H4W A;  2PTN A;  2GD4 B;  4YXW D;  4UEH H;  1GBL A;  2VIW A;  3BTH E;  3TIU A;  3ZZC A;  4CBN A;  5CDF E;  2JJ2 D;  2ZFS A;  3BSQ A;  1FN6 A;  2F9O A;  3E1X B;  3MYW A;  1YCP H;  4I8H A;  5GXP A;  2F9V A;  1L1N A;  1CE5 A;  3SUD A;  2XBX A;  2H5D A;  5HIZ A;  3EE7 A;  1MQ5 A;  1EAX A;  3CS0 A;  1D6W A;  2ANW A;  2ZHE H;  2AH4 X;  3PMH B;  3LT3 A;  4DIH H;  3ZVB A;  5T6D A;  4X1S U;  3E3T A;  2FLR H;  2QN5 T;  4B76 A;  1VIT H;  1EUF A;  1GJB B;  2BHG A;  3BTK E;  1C2D A;  3P70 B;  1K21 H;  2BY8 X;  2WV4 A;  3M5M A;  4DW2 U;  1C5R A;  4LK4 A;  1ESB A;  4JZE H;  3SNB A;  2ZQ1 A;  3LON A;  4NA8 A;  1AVG H;  4JZI A;  4X6N A;  3VPK A;  5LH8 A;  1P02 A;  3LPR A;  1A3B H;  1GI2 A;  2AFQ B;  4U2W A;  1HJA B;  2GV7 A;  2UUF B;  3SOR A;  5C67 A;  2I6S A;  1GI5 A;  2ZFP H;  3A88 A;  1OWH A;  1DLK B;  3S9C A;  4Q7X A;  1C5Y B;  2AIQ A;  3DUX H;  3HGN A;  4OGY A;  1KYN A;  2AEI H;  4TWW A;  1P57 B;  1ZHR A;  2FXR A;  2VID A;  3SHC H;  1D3P B;  1QL7 A;  2A1D B;  1LPZ B;  1BMM H;  2BMG B;  1AND A;  1OHH D;  1IQF A;  3MNC A;  1UTO A;  1ZOM A;  5FCK A;  2BDG A;  4Y6D A;  1HIA A;  1WOF A;  2A4O A;  1FPC H;  2HNT F;  1QTF A;  5DO4 H;  4TY7 A;  1YPL H;  4K69 A;  3SJ9 A;  4ISI H;  5A8Y A;  4XBB A;  4ACB A;  1G36 A;  1Z6E A;  3QO6 A;  2CF8 H;  1IHS H;  4ABA A;  3KCG H;  2CN0 H;  5IK2 D;  2ZZU H;  1ID5 H;  1A5H A;  3E0P B;  3TJU A;  2WUB A;  4CRC A;  1EPT B;  1EOL A;  1N6Y A;  1VCP A;  3NKK A;  4MNX A;  3HKI B;  4ZHL U;  1O2V A;  2CJI A;  2I6Q A;  3MOC A;  1MTN C;  1NBM E;  4ZH8 A;  3WWB A;  1SGY E;  3RXQ A;  2Z9J A;  3RU4 E;  2EC9 H;  2OK5 A;  3RP2 A;  4X1N U;  1L4D A;  2FIR H;  3LH1 A;  2NU2 E;  2Q6D A;  1GBA A;  1ZSK A;  1THR H;  1EZU C;  3A7W A;  2FDA A;  1H8H D;  3KL6 A;  1E34 B;  1AZ8 A;  2FM2 A;  2A4Q A;  2HGT H;  2AER H;  4IW4 E;  2BD9 A;  3DD2 H;  2BM2 A;  1C2M A;  2VWO A;  3MU8 A;  1JWT A;  1O3L A;  2WZQ A;  3RXT A;  4A92 A;  3TK6 A;  2PGQ B;  1P03 A;  3L33 A;  3MU4 A;  2FZZ A;  3VB7 A;  3GOV B;  1S84 A;  1EST A;  4CHA B;  4PRO A;  3DCL A;  3BIU H;  1SGN E;  1H8D H;  1H9L B;  2CHA B;  2JDI D;  3T26 A;  3ZZ5 A;  5C1X A;  1MD7 A;  1K9O E;  5CHA B;  1MTU A;  4NFE A;  2QV1 A;  3S0N A;  3KQC A;  1GHW H;  1BTX A;  1UTN A;  2Y5G A;  2BY6 X;  1DUE A;  1C1V H;  1KMH B;  3M5L A;  2OQU A;  3EAJ A;  1K1P A;  3IG6 B;  5DN6 D;  5A8Z A;  2VWN A;  1Q31 A;  1BRA A;  2OXS A;  1TQ7 B;  1WSS H;  4E7N A;  3ZZ6 A;  1J16 A;  3ZV9 A;  2WHX A;  1NZQ H;  2AGE X;  1SOZ A;  1YPK H;  2XBW A;  2A32 A;  3MNB A;  4K60 A;  4Q4L A;  1P2J A;  4Q7Z A;  2Z9G A;  1IAU A;  3H09 A;  1HGT H;  2EA3 A;  2KX4 A;  3SUE A;  1KLJ H;  4Y8Z A;  3D62 A;  1GMC F;  3PRB A;  1O31 A;  1ZPC A;  1IQN A;  2RDE A;  2QXJ A;  2ZTZ A;  4Y8X A;  1FPH H;  3SZN A;  4BAN B;  4I32 A;  1SLW B;  4CRG A;  1G30 B;  2A5A A;  2W6J D;  3RLW H;  1HAY B;  1KTT B;  3EA9 A;  3DSG A;  1WAY B;  1MMJ N;  2J97 A;  3OU0 A;  3BTW E;  2BD3 A;  1DWD H;  5F8T A;  1HJA C;  1DWB H;  1GI4 A;  1O2X A;  3BF6 H;  1A3E H;  8EST E;  8GCH F;  2YMS C;  1XX9 A;  7EST E;  1YLC A;  3SU3 A;  3UNR A;  4SGA E;  1SFI A;  1MAX A;  1QA0 A;  2A4G A;  3F6U H;  4EST E;  4YLQ H;  2Z6B D;  3SN8 A;  4ZCN A;  2FO9 A;  2K0Q A;  1Z1I A;  1YPG H;  1YGC H;  4WME A;  4DT7 B;  1OYT H;  2CK3 D;  5EQQ A;  1ZHM A;  4A6L A;  1NM6 A;  2CF9 H;  3ZVE A;  4UE7 H;  3PO1 C;  1MCV A;  1OWJ A;  1FXY A;  3KF2 A;  3MNS A;  3OYP A;  4FU7 A;  4A7I B;  3SJO A;  2ZPS A;  2G4T A;  1FX0 B;  1V2T T;  3S9B A;  1C5T A;  2RCE A;  1ANE A;  3ATL A;  1BIT A;  1VGC C;  1WV7 H;  1YCP M;  2OC0 A;  6EST A;  2PKA A;  4IGD A;  4HGC A;  3SU5 A;  1TPO A;  3L6P A;  3SU4 A;  1AO5 A;  4DII H;  1FZZ A;  4X2W A;  3LC5 A;  1GI6 A;  5C17 A;  4NGA H;  3HAT H;  2KCO A;  3T28 A;  4ZMA H;  1N8O C;  2GCH G;  3EQ0 H;  2ZGB H;  4YO9 A;  1PYT C;  3ELA H;  1TPP A;  3A80 A;  2QXI A;  1LHG H;  1SQT A;  3A7V A;  4WH8 A;  1QR3 E;  1LHF H;  2KCA A;  2ZTY A;  1YLD A;  3M7Q A;  2WPL S;  3A7T A;  3TVJ B;  1CGH A;  4FU8 A;  3A8A A;  1AFQ B;  1NFW A;  1LHC H;  1CHO G;  1KXF A;  1FI8 A;  1W13 U;  3GCT G;  1TGN A;  3LGU A;  1ZR0 A;  4H6T A;  1GJA B;  3LGW A;  2O8T A;  3BTQ E;  1GWA A;  1PPH E;  3GY6 A;  1FY8 E;  3HKJ B;  3M3S A;  4OS4 A;  5LGO A;  1SLX B;  2QF0 A;  3RMM H;  1C1P A;  1MTV A;  2P95 A;  2QE7 D;  3FKS D;  4FUH A;  5ETX A;  1GHZ A;  4YOI A;  3UFA A;  2Y80 A;  4NIX A;  3LGI A;  2CHA C;  2XCF A;  1T8M A;  5CHA C;  2FES H;  3KQ5 A;  2GGV B;  3OTP A;  3RXP A;  1TE0 A;  1O2W A;  2ZPR A;  1GHV H;  3U8R H;  2EI8 A;  3GCH B;  1AE8 H;  1FJS A;  3GY3 A;  1C5L H;  3Q77 A;  1TBQ H;  1P05 A;  4HTC H;  4CRE A;  4Q63 A;  3FFG A;  3E8L A;  4R0I A;  4MQA A;  3G01 A;  2PUX B;  1BTZ A;  1UO6 A;  2GT8 A;  3EGK H;  4O9V A;  4OS7 A;  1SGC A;  1H1B A;  2BQ6 B;  3A89 A;  2VGC C;  1YCP K;  1TOC B;  4KTC A;  4Y11 E;  5FX5 A;  1SMF E;  1D3Q B;  3GY8 A;  1YY3 A;  5C5O A;  1BZX E;  1C5Z B;  3JZ2 B;  1SQA A;  1BTU A;  1EAI A;  2HLC A;  2ZU3 A;  1C1R A;  2YOL A;  1GBF A;  1YPJ H;  3TH3 H;  2R3Y A;  4IC5 A;  1Y3U A;  1ZJK A;  2WPH S;  3FAN A;  1C5M D;  3SOS A;  1RRK A;  1AN1 E;  1A4W H;  5C2Z A;  1W14 U;  1OWE A;  2NU3 E;  2PKA B;  4X0W U;  5GJ4 B;  5DSF A;  1PPG E;  1DXP A;  1Y3W A;  2GZ7 A;  5L2Y H;  1CGJ E;  3VFE A;  4MLF B;  1V2K T;  1ZRK A;  2GVF A;  2C8W B;  4BAQ B;  5E2P A;  3SV7 A;  1LPK B;  2V3M A;  5HM2 A;  3ZZD A;  2P94 A;  3P92 A;  3MNX A;  1S85 A;  1GDQ A;  2TRM A;  1O5G H;  3F9F A;  3RXV A;  1AY6 H;  3H7T A;  2BX3 A;  2PR3 A;  1GJ5 H;  2R2M B;  3PB1 E;  1OYQ A;  6GCH F;  3W94 A;  3BN9 A;  2OP9 A;  2BOH B;  2AHM E;  2FTL E;  2HPQ H;  5DP3 A;  4IS5 A;  4X6M A;  2QAA A;  4FU9 A;  2BDC A;  5EXL A;  5K7R A;  1TX8 A;  4NZL A;  4QT8 C;  5JBT A;  2GTB A;  2JET C;  5EXN A;  4DOQ A;  5E8E H;  1AWF H;  3NWU A;  1GMD F;  4B74 A;  5GCH F;  2SGQ E;  3T27 A;  1TFX A;  4BXS A;  3NXP A;  1Y5A T;  1O3H A;  1GBE A;  3U9A H;  3S7H B;  1GL1 A;  1LDT T;  3UOU A;  1Y3X A;  2Q1J A;  1P9U A;  1GI9 B;  1O2M A;  1GGD B;  3HGP A;  3KHV A;  1QJ7 B;  4RKO B;  1EJM A;  1KXA A;  1AVW A;  2ZC9 H;  5DG6 A;  3RU4 T;  1UTK A;  2GJG A;  1G37 A;  1C5O H;  1A5G H;  3BTG E;  1O5B B;  4YLU A;  1O2Z A;  1PPF E;  3E90 B;  4GPG A;  3RXR A;  3SW2 B;  1D3T B;  2FS9 A;  2AMD A;  2VIP A;  3RC5 A;  3RXH A;  3TIT A;  4I8K A;  1W10 U;  3M7T A;  4ZKR U;  1LVB A;  3UNS A;  4ABF A;  3N7O A;  1GDU A;  4WMD A;  1MU8 B;  3RXJ A;  1D6R A;  3GDU A;  3LGV A;  1O3P B;  4WMF A;  2IPH A;  3QGN B;  1V2P T;  1NU9 A;  3VGC B;  3EYD A;  4LOY H;  5C1Y A;  1A1R A;  1SHY A;  2FI5 E;  2ANM H;  1BBR H;  1GJ4 H;  1NFY A;  3DT0 H;  1O5A B;  3A8D A;  4NSY A;  1QY6 A;  2VWM A;  3ATM A;  1SGT A;  1ZTK A;  2AGG X;  1BTW A;  1HRT H;  3F3B A;  3GCH C;  2L6O A;  1EAS A;  3A7X A;  3ZZ8 A;  3OTJ E;  2CMY A;  2B5T B;  3QZR A;  3VB4 A;  2ZEB A;  3A7Y A;  4FOU C;  1SVP A;  5ESB A;  2JJ1 D;  1H8I H;  1O3K A;  1PPZ A;  3RDZ A;  4E7R G;  1RJX B;  2O8U A;  2BVS H;  3LC3 A;  3RMN H;  1WTH D;  3UUZ A;  1NFU A;  1O34 A;  1AWH B;  3RXF A;  5B6O A;  4X6P A;  1O2P A;  4NIV A;  4LZ1 H;  1TMU H;  1FQ3 A;  4YT6 H;  1P2K A;  1XXF A;  1Z71 A;  5GPI B;  3LU9 B;  4ABE A;  3K6Z A;  4U01 A;  1XVO A;  3TK9 A;  3A8C A;  4FUD A;  3SI3 H;  1IQK A;  5C0T A;  1C1M A;  2Z7F E;  1OX1 A;  4RT1 A;  1BJV A;  1MTN B;  1UCY H;  2ZWL H;  4K5Z A;  2A45 B;  4XOJ A;  2PW8 H;  4E06 H;  5FXL A;  1C1S A;  1VJ9 U;  2ULL A;  1ANB A;  1KXB A;  2B7D H;  3P8F A;  1GBT A;  2J38 A;  2WSS D;  3AAS A;  4ABB A;  3DA9 B;  3R3G B;  1XKB C;  1WDI A;  1SKY E;  1T8L A;  2VVU A;  5IYT A;  2SFA A;  5HXF A;  3IWM A;  4CRB A;  1GJC B;  1C5X B;  1HAP H;  1ZMJ A;  3RM0 H;  3GS9 A;  4OS1 A;  4BOH A;  2VJ1 A;  4IMZ A;  3RXS A;  1LMW B;  1CSO E;  2P16 A;  1V2V T;  1Q2W A;  3RM2 H;  1DST A;  4CH2 B;  3STI A;  2WPJ S;  4NSV A;  3U98 H;  1GHB G;  2Z3D A;  1PQA A;  2RFK C;  3F1S B;  5C20 A;  2Y6T A;  1S6F A;  5F8Z A;  1P9S A;  2VNT A;  4B6E A;  3D23 A;  2ZCH P;  2ZKS A;  4H4F A;  2P3T B;  5EXM A;  4YOG A;  2UWL A;  1C1Q A;  3PV5 A;  3PWB A;  2J9N A;  2VWL A;  1ZML A;  4ZXX H;  1VIT G;  1H8E D;  4GCH G;  2W5E A;  2QF5 A;  2OTV A;  3A87 A;  1GPZ A;  2KAI A;  5E0J A;  1C9T A;  1A61 H;  1GGD C;  1V2L T;  1W0J D;  3NZI A;  5A2M H;  1J17 T;  1HAX B;  5A0C A;  1XUJ A;  1QJ6 B;  2BDI A;  4BXW A;  5ABW A;  1SI5 H;  1S81 A;  1EAU A;  3PM3 A;  1OWK A;  2BD2 A;  3BIV H;  3GY4 A;  2ZCL P;  1TAW A;  2Y82 A;  4JK6 A;  1K2I 1;  4FUG A;  3QGJ A;  1BTH H;  5EPY A;  1C5P A;  7LPR A;  4B75 A;  1UW7 A;  5AFZ H;  1EZS C;  4ZKO U;  4WH6 A;  2WPD D;  1IQM A;  1QRZ A;  4ABJ A;  2OBO A;  2ODY B;  2VIV A;  2HWL B;  4Y7A A;  2XOK D;  3M37 A;  3SQE E;  2ZPQ A;  1BIO A;  1V2Q T;  2V35 A;  1FNI A;  3F9G A;  2H9T H;  1BRU P;  3VGC C;  2ZG0 H;  1BHX F;  1AQ7 A;  1SBW A;  4X8V H;  2J94 A;  2YMS B;  3URE A;  2ZF0 H;  1YKT A;  2Y7X A;  1C1U H;  3S69 A;  2XND D;  1G3D A;  3SNC A;  1QFK H;  4KTU A;  5A0A E;  3MI4 A;  4Y7B A;  3SO3 A;  1GHA F;  1ZHP A;  1QRW A;  4TWY A;  2ZO3 H;  3K6Y A;  5DJ7 A;  2RA0 A;  3GYM A;  1KXD A;  1IHT H;  1YP9 A;  4O03 A;  1TPS A;  2M5T A;  1XUK A;  1O32 A;  1T31 A;  3PO1 B;  1B0F A;  5SGA E;  2ZFR H;  3F2H A;  2D1J A;  1F0R A;  1ELD E;  4Y71 A;  3TLO A;  2XBV A;  1VGC B;  1K1I A;  2FX6 A;  4WXV A;  4R8T B;  5DP8 A;  1GHX H;  2C93 B;  2PV9 B;  5HM9 A;  1O30 A;  1TQ0 B;  1KXC A;  1C9P A;  3RC4 A;  1MKW H;  1GI1 A;  3MFJ A;  1GCD A;  1UHB A;  1G9I E;  3W1E A;  4B1T A;  5C5N A;  2V6N A;  2OQ5 A;  1MU6 B;  1TBR H;  3DHK H;  2G81 E;  1XUI A;  1NY2 2;  3GIC B;  1YPH E;  1ELC A;  1GI8 B;  1F0U A;  3MU1 A;  1TYN A;  3MHW U;  4HG6 A;  1DAN H;  1DFP A;  1DPO A;  1HXE H;  1N8O B;  1NRO H;  3HK6 B;  3PLK A;  4BTU B;  2BDB A;  4ZAE A;  2WIN I;  3EE0 B;  1E35 B;  2LP6 A;  3KQB A;  1HCG A;  1AIX H;  1S82 A;  4X2Y A;  4D7G A;  4TY6 A;  3SGA E;  4FUB A;  4AYY B;  4ASH A;  5A0B A;  2P3U B;  4ZKS U;  1FIZ A;  4IBL H;  1WQV H;  1ELT A;  1FAX A;  2SGP E;  3GYL B;  1JBU H;  2XXL A;  3EDX B;  1NN6 A;  4XBD A;  2WPI S;  1V2R T;  2FWW A;  4BAK B;  4THN H;  2RDL A;  5L6N H;  3H5C B;  1M9U A;  5EQR A;  1EP6 A;  4GUX A;  2ZGH A;  5HYO A;  2PGB B;  2OC8 A;  5G4B A;  4WVP E;  1SPJ A;  1A7S A;  3ZZ4 A;  4DGJ A;  4Z1M D;  4X8S H;  2H9H A;  3ZZ7 A;  1F5R A;  1V6D A;  4X8U H;  5A09 A;  2QXG A;  3F0O A;  8GCH G;  1Z6J H;  4Y76 A;  5BRR E;  4ZUH A;  2F9P A;  3KEE A;  1EFR D;  2ZNK H;  3GDS A;  2ZDV H;  3ATW A;  3D49 H;  3PV4 A;  1COW D;  1O2L A;  4HI3 A;  1O2H A;  1O38 A;  1AI8 H;  1TGS Z;  2VIO A;  4H6S B;  2KCY A;  4AFZ A;  1L4Z A;  1TX7 A;  1G3E A;  3QTV H;  1J14 A;  1DE7 H;  3L3T A;  3RXD A;  2AS9 A;  4DT4 A;  2DE8 A;  1L0Z A;  2Z3C A;  2ZU1 A;  5JBC S;  1S0Q A;  5LPF A;  3V3M A;  1HAI H;  1K1O A;  4AOR A;  1NRN H;  3NRL A;  1QCP A;  2VGC B;  3P95 A;  1SGI B;  2ZHQ H;  1HIA B;  1RGQ A;  2LPR A;  2PSY A;  1HNE E;  1NRP H;  1NS3 A;  4BAM B;  1SR5 C;  5EJL A;  1O3C A;  4LZ4 B;  1QRX A;  1U6Q A;  5JBA S;  4YT7 H;  1O37 A;  4D9Q A;  4ZHM U;  1CQQ A;  2IN2 A;  1GVK B;  2C90 B;  1ZPZ A;  1C4V 2; 
#chains in the Genus database with same CATH homology
 2J98 A;  1QZ8 A;  2J97 A;  5HIZ A;  2J98 B;  3EE7 A;  5C94 A;  5HIY A;  1UW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...