1VCPA

Semliki forest virus capsid protein (crystal form i)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
CIFEVKHEGKVTGYACLVGDKVMKPAHVKGVIDNADLAKLAFKKSSKYDLECAQIPVHMRSDASKYTHEKPEGHYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFDNKGRVVAIVLGGANEGSRTALSVVTWNKDMVTRVTPEGSEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords SEMLIKI FOREST VIRUS CAPSID PROTEIN
publication title Structure of Semliki Forest virus core protein.
pubmed doi rcsb
source organism Semliki forest virus
total genus 33
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcpA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcpA01
1NFXA 1UK2A 2BY8X 2Z9KA 1UCYE 1VJ9U 1A1RA 1P2NA 4AYVB 6CHAC 3AW1A 3I78A 1QQUA 2ZGBH 1L1GA 1B7XB 4TWYA 5EQSA 1J15A 1AQ7A 1YPMH 4KTSA 3ZVCA 4HGCA 4SGAE 1EPTC 3GDVA 1OP8A 4X1PU 1GMDG 3TJVA 1GMCF 5TCAA 2C4FH 3PMJA 4KTUA 2OBOA 1TGBA 3MOCA 1SGEE 4ABJA 3M35A 3TNTA 1GG6B 1ABIH 1D3DB 1EP6A 5FXLA 3SU5A 3NKKA 3RMOH 7ESTE 2V35A 4X6MA 5HMAA 1GI1A 1ZSKA 5DP7A 1A0HB 3BG4B 4RN6A 3SJ9A 2GDDA 2XRCA 1SQTA 3NZIA 1T4UH 4Q7XA 1T7CA 2TGPZ 1TALA 5DP6A 1BJVA 2AGEX 4E05H 4YT7H 1O2SA 1IQMA 1GI5A 4Y11E 3KIDU 2SGAA 1NS3A 2A4GA 1GJBB 1KXAA 4Y8ZA 4ZXXH 1KLJH 5A8ZA 3SNCA 4DG4A 3S0NA 1C1QA 1O3JA 1V6DA 1NU7B 5T6FA 4TY7A 1C9TA 1O3MA 3TPIZ 2WPIS 1LVBA 1K9OE 1OWDA 1O3CA 2YNBA 1GHVH 4ZUHA 2ZDMA 1BMLA 3GY5A 4MPUA 5AVDA 1VCWA 3KEEA 4NSVA 3PLPA 4A1TA 2FZZA 3GCOA 5LPRA 5ABWA 5IYTA 3ITIA 2A7JA 1FPCH 1TQ0B 1GCTB 3MYWA 4MVNA 1LQDB 1N8OC 1RTKA 7GCHG 2ZCHP 5AFZH 3TK5A 4GCHF 5DGJA 5J4SA 3ZZ6A 1TE0A 1DM4B 1CHOG 1EZXC 1TNJA 2QCYA 5GCHG 2RA0A 4MPWA 3H7OA 2BOHB 1GHBF 3BTME 1T8MA 4I8LA 1AN1E 1A5IA 4B75A 1JRSA 1F5RA 5A8YA 4X6NA 4LZ1H 2HOBA 1NU9A 3LOXA 1JRTA 3RXJA 3RXQA 4ABDA 1W0YH 1GBBA 1C4U2 5FX5A 1CHGA 2PKAB 4BAKB 1O33A 1T31A 2XBYA 1Z8IB 1G3EA 3SUDA 2D1JA 3SI4H 2J95A 1L1JA 5FAHA 2OD3B 4ISLA 4Y10E 1P02A 3GY2A 2H6MA 1EOLA 5TCCA 1PFXC 1HAOH 5C5OA 1QJ7B 1UK4A 4O97A 4CREA 1BTPA 3HATH 4GUXA 2J38A 3FP6E 1J14A 1T4VH 1H8DH 2C3SA 3SV9A 1T8LA 2BM2A 3PM3A 4BANB 3P6ZB 1EASA 3O8DA 2QF3A 4D9RA 5I46H 4ZAEA 5FCKA 1HAVA 1CGJE 1P2KA 2HNTF 3OTJE 5DP8A 3SORA 1HNEE 3UNQA 3RXOA 1DLKB 4WH8A 3LIWA 3BG8A 1MUEB 2ODPA 2R3YA 2QF0A 1H9IE 1ZGVA 1ELAA 6GCHG 2Z9JA 4X1SU 3SQEE 3ZVFA 1JOUB 1V2MT 2BQ6B 3PB1E 1TNGA 4YLUA 3ZVBA 1GMHG 1A3BH 3VXEH 2GZ9A 4B74A 5EPNA 3MWIU 2CHAC 4XSKU 6CHAB 3A7YA 1F92A 4K60A 4UFFH 2ZNKH 3BTQE 1OWKA 2FI4E 1IQLA 1FONA 2WINI 4YM9A 3E3TA 3ENSB 3MH5A 2WPMS 1EPTB 2PSXA 1TBRH 4KP0A 3F6UH 2V6NA 1QTFA 2P8OC 1SB1H 1BOQA 3EA9A 2F3CE 1F0UA 2HPQH 1ELVA 1QRWA 1O2IA 2P3FH 4KGAA 1BTYA 3LGVA 5FBIA 1OPHB 1TGNA 5E0JA 2FYQA 4NG9H 3L33A 1ZGIA 4YOGA 1OWEA 1XUJA 2PFEA 4NA9H 4GHTA 1YC0A 2STAE 3K2UA 1ESTA 3QZRA 5DG6A 2GGVB 1C5MD 1OXGA 1MMJN 1O2OA 2SNVA 2ZDAH 1ANDA 1W13U 3GY6A 2GCTC 5FCRA 3RC5A 4DW2U 2FXRA 4ASHA 2ANYA 1TOMH 1YCPM 1C2GA 3KNXA 5AF9H 3D62A 3LU9B 1KXBA 3LC5A 5JBAS 2GMTB 3AAUA 1KTSB 1D9IA 2HRVA 4NWKA 1D3QB 1MBQA 1ZPCA 2ZFFH 3RXSA 3UIRA 3DFLA 4AFUA 3BIVH 5EXMA 3ATLA 2FLBH 1DVAH 3RXPA 1C5YB 2FOAA 1SGIB 1KXFA 3RXAA 2Z94A 1A4WH 5EPYA 3M3VA 1CT4E 3A8CA 3FZZA 2XC4A 4K8YA 2ZHEH 3L6PA 4UFEH 1TPOA 4INLA 3ZZ4A 3UNSA 3BEIB 1MH0A 4Y8YA 1HAGE 2ZEBA 3ATKA 1EOJA 1ETSH 1P04A 4FUGA 4XOJA 3UUZA 1S5SA 4XBBA 1FN6A 3ZZ3A 1TONA 2ZTXA 5DP4A 2VH0A 1NO9H 1N8OB 3HKIB 2ZPRA 1O2KA 5A8XA 4D7GA 4DJZB 1IOEA 4AYYB 1OYTH 3JZ2B 4OS6A 2ZFSA 1K21H 4MNVA 2ULLA 1P2IA 4BAMB 1KLIH 1GHXH 2CV3A 2P59A 3A7XA 1C5PA 2AMDA 3HPTB 3LGWA 2BD5A 1JMOH 3JZ1B 3LGIA 1OYQA 5DP5A 2P93A 2OC1A 1AIXH 1O3HA 3GYLB 4X8VH 2PSYA 1SGFA 1KXCA 1BMNH 3KL6A 1AVXA 1BTUA 1W14U 2VWLA 3SV6A 4K2YA 3RXVA 2PTCE 1V3XA 1OWIA 3WY8A 3VGCB 1H9HE 2ALPA 5F8TA 2NWNA 1SQOA 2VJ1A 1Z6JH 4RKJB 3U1JB 1JIMA 3TJNA 1G3BA 4JMYA 3SNEA 1V2QT 2BDCA 3H7TA 1HIAA 3T27A 3A82A 1WUNH 3F68H 1IQGA 4XFQA 5EG4A 1AWFH 3QTOH 1YPGH 3EDXB 3F1SB 2OUAA 3CS7A 3RC6A 4B71A 1C1WH 1P09A 3R0FA 3ZZ9A 3ZZ5A 4BTUB 3LC3A 4Y71A 2BOKA 1O3DA 1DT2A 1EAWA 1WYKA 1Q3XA 2OC8A 1TNKA 1GBJA 1ANCA 1CT0E 1MKWK 1P06A 3TGKE 2OQUA 4NIXA 1G3CA 1K22H 1V2TT 3QO6A 4BNRA 1GMDF 3ZZDA 4JZFH 3BTKE 3M5NA 1EJNA 3A80A 5HXFA 1O3IA 1ELCA 4DY7B 4B2AA 2WPLS 4DOQA 3MU8A 1AMHA 1CA0C 1HBTH 2XXLA 1QA0A 2EC9H 1GI8B 1QR3E 1MKXK 1NRSH 5C2ZA 3SNDA 3SN8A 2P8OB 2OC7A 3PTNA 1QIXB 2A2XH 4UFDH 4IMQA 3EYDA 1TBQH 1Y3WA 1KLTA 1F5KU 2ZIQH 1TYNA 1G32B 3ODFA 2VNTA 1MTNB 2FOFA 2BDYA 1C1UH 3FP8E 4ISOA 1O32A 4CHAB 4UEHH 4U2WA 3BSQA 1UCYH 1RIWB 1VCQA 5B6OA 3LGUA 4I31A 1IQFA 3SUGA 1DOJA 1UJ1A 2THFB 2ZFPH 1FN8A 3O8BA 2D8WA 1DSTA 2PGQB 1G9IE 2GCTB 4MNYA 1AD8H 1BHXF 1SBWA 1NFUA 4K3JA 1XVOA 3RLWH 1GBDA 3M3SA 2B5TB 1PPEE 1AGJA 4IW4E 3PWCA 1G36A 4CH2B 1ZYOA 3M7UA 1P9SA 1FNIA 4I8KA 3QUMP 2OINA 1LQEA 3ZVEA 1C1OA 3U8RH 1UVTH 2JH0D 2G55A 1GBMA 1O3PB 4KTCA 4O3UA 1O2YA 2ZU3A 5E2PA 3QLPH 2JETC 3BEFB 1ELTA 4FUBA 1SGTA 2YNAA 1IQHA 4ISIH 3SJOA 4K1SA 1G2MA 3UWIA 2GVFA 5GWZA 1HAZB 3KQDA 2WPKS 1NM6A 1O38A 3TJUA 3RMLH 2VU8E 2G51A 4E06H 1A61H 2ANKH 1FY1A 4JYUH 3K9XB 4I7YH 4A92A 2Z3EA 3DUXH 1YPHE 1TPAE 4INHA 1GCTC 1E37B 3M37A 4A6LA 1VITH 2C8WB 1EX3A 3NWUA 1DS2E 2UWOA 3HGPA 2WPJS 4CBOA 1S6HA 1FV9A 4OS1A 1ARCA 1P01A 1ZHRA 2BD9A 5C1XA 1W8BH 1D3PB 1XKBC 5C20A 1UTLM 2GT8A 3CS0A 3SV7A 2XBWA 1Y5UT 5HM9A 2R2MB 5DK1A 1ZPZA 2PKSB 2OQ5A 1AY6H 2KAIB 3RM0H 1YM0A 2VIPA 1L0ZA 1Z1JA 1HAYB 1H9LB 2ZGHA 2LNCA 2VVUA 2Z9LA 3GY3A 2P94A 5F8XA 1EZQA 4X2XA 2XWBI 3B8JA 1ELDE 1EB2A 4JZEH 2A31A 4HFPB 1K1OA 1ZTLA 3TITA 2HALA 2QY0B 3AW0A 4X2WA 2XC0A 1W7GH 2ZG0H 4O03A 1AO5A 1C4Y2 2IJOB 1V2JT 5A0AE 1SGYE 4D9QA 4GSOA 2FX4A 3C1KA 4YOJA 1BA8B 1IQNA 4FVBA 1G37A 1WV7H 1Y59T 1KIGH 1M9UA 4K1EA 1O2MA 1AU8A 1VJAU 1OSSA 1ABJH 1CT2E 1P2OA 1O3OA 1BJUA 4ZKSU 4IC6A 1BBRK 4Q7ZA 3SW2B 1PYTC 2J34A 3PV4A 1EATA 2HNTE 8ESTE 1BRBE 4UE7H 1X7AC 2B7DH 2STBE 2G4TA 3A8DA 1MAXA 3M36A 4E7RG 1TX7A 1P05A 1TGTA 1UHBA 2QV1A 2VIWA 1GJDB 1GI6A 1CGHA 2GKVE 1GJ4H 1J16A 1Q31A 3V3MA 2FDAA 5IDKA 1UK3A 2FODA 4X8TH 1Z1IA 2EI8A 1DUAA 3CP7A 2AFQB 4UD9H 3AAVA 1A0LA 5E2OA 4FUHA 1GL0E 2PUXB 1G3DA 2Z6BD 3P95A 4I8GA 1W3CA 1MBMA 1GL1A 1OKXA 3SJKA 2FTLE 3QZQA 4MNXA 2H5DA 4Z6AH 3IG6B 2ZTZA 2ZF0H 1GVZA 3RXUA 1RTLA 3KCGH 4CH8B 4MQAA 2ANMH 1J9CH 4XDEA 1UTJA 2W3IA 2YOLA 1EQ9A 4BTIB 1QL8A 3LJOA 3BTEE 5E0HA 4YTAA 2JH5D 1GHWH 1C2HA 2VIDA 3RXBA 3U98H 4ZKNU 2Z9IA 1DUEA 1LPZB 1C1MA 3URCA 5ESTE 2FM2A 2EI7A 2ZDNA 1GGDC 3DA9B 5BPEA 2GMTC 2QAAA 4TPIZ 1AKSA 2JETB 1Z7KA 1GJ5H 2OC0A 4H4FA 1S85A 3ZZAA 1W10U 2D2DA 4F49A 2H9TH 1THPB 3ATWA 2R0LA 3U9AH 1N6YA 1NRPH 3GCNA 5EODA 1HXFH 1FY8E 1HXEH 1F0TA 1MU8B 3TVJB 4FUEA 1LDTT 1P2QA 2A4RA 2LPRA 5DJ7A 4XE4A 1JWTA 1LKBA 2XC5A 1HYLA 4Q80A 4YZUA 1F2SE 1EUFA 3MTYA 5AFYH 1AI8H 2R9PA 1AWHB 1ESAA 2UUYA 2BD3A 4KKDA 2AGIX 3VB3A 1BRCE 3MU0A 1W11U 1AHTH 1IQEA 5LH8A 1B5GH 1O5EH 1RRKA 1O2HA 1NFWA 1O3NA 7LPRA 4RSPA 2FOHA 1C1VH 3BTFE 1K28D 1AE5A 1PJPA 1ZSLA 2TPIZ 2ZZUH 3TGJE 1OWJA 1S0QA 4JYVH 1KTTB 2Q1JA 2Y6TA 3TK9A 2QC2A 3RP2A 3VGCC 4X6PA 3MO9A 2VB0A 1A3EH 3UREA 3P70B 1MAYA 3KF2A 4AG2A 3M7QA 2FESH 4IBLH 2PHBA 1ESBA 1YCPK 1BTWA 2EA3A 2FO9A 1SGQE 1O2UA 1Z8RA 3K6YA 4WF8A 1BMAA 3FP7E 3SHCH 2DE9A 5EGMA 1VR1H 3A87A 1PQ8A 3F9FA 1BBRE 1GBFA 2ZFTA 1NN6A 1C5QA 2GTBA 4AFZA 4U32A 2F9PA 3OY6U 3S7KB 3M61U 3C27B 4AX9H 1N6XA 4ABHA 3TH3H 4H42U 4GPGA 1C9PA 1K1NA 1OS8A 2GX4A 1QQ4A 1ZLRA 2IPHA 1HFDA 1E34B 1O37A 1IQKA 1SOTA 2C93B 2ZKSA 3RXHA 3BTTE 1MCVA 3S9CA 1NRNH 3R3GB 1RFNA 1ZHMA 1ZSJA 1C5RA 2OP9A 4Y6DA 4B73A 4ZHAA 3RMNH 2AS9A 5ESBA 3ZYDA 1CO7E 1GJ8B 4ISNA 5L2ZH 3Q3KA 2Y5GA 4YESB 2O9QA 1BITA 2GCHG 3A84A 4DURA 2FS8A 1CSOE 3ZZ8A 1O2ZA 3KQEA 2BDGA 1NESE 2NU2E 2W7UA 2XCNA 4RKOB 1EAUA 1H8IH 3HGNA 1VGCC 8GCHG 3EQ0H 3SUFA 3MH6A 1EAXA 1MTNC 1SMFE 4K69A 3MO6A 2ZGJA 4A1XA 5EXNA 3FANA 3UQVA 2C90B 3E90B 4CBNA 2GV7A 4CHAC 4DIHH 4ABEA 1RIWC 2CN0H 1KSNA 1FY3A 2DUCA 1QL7A 4ABBA 3SO3A 4IS5A 4DVAU 1O2JA 3STIA 1IHSH 4D7FA 1RD3B 4KELA 4AORA 1SVPA 2ZQ2A 1TNIA 5EQRA 1QA7A 3LDXH 1GGDB 3NPSA 4FXGH 3MNSA 1ZRBA 1PYTD 3L3TA 3GISB 4Y8XA 2QXJA 2ZI2H 1K1IA 1GDNA 3T62A 2ZGCA 4NCYA 2FLRH 2ZGXH 3FZDA 1SPJA 1TFXA 3SGQE 1O3KA 1LHCH 1C5VA 1YLCA 3GYMA 3NUMA 3DD2H 1O5DH 3GDSA 2FPZA 3VB6A 2BLVA 2VVCA 3MNCA 4AGJA 1L4DA 2TGAA 2WUBA 3RU4D 3VB7A 2QXHA 2FIRH 4I8JA 2NU4E 2O8UA 1GBTA 4WVPE 2W7SA 1AFQC 1S84A 3RXMA 1CBWC 1HJ8A 3OU0A 1TGCA 5A0CA 4AB9A 1V2RT 4FUJA 2Q6GA 1LHGH 1IQJA 2UUFB 3VB5A 1SLUB 1V2NT 1XM1A 2F9UA 4OS7A 3UNRA 2G5VA 3S9BA 2O8MA 1MTWA 1NRRH 2ZFRH 8LPRA 1MZDA 1UVUH 4NFEA 4ZHMU 3LH3A 5DPAA 1BTXA 3RXFA 4K1TA 4Y7AA 4O9VA 3N7OA 1OOKB 2VWMA 3ZZBA 6LPRA 4NIVA 1BCUH 5HM2A 2I6QA 3A86A 2NU0E 3OYPA 1AZZA 3RXRA 3A7TA 1AE8H 1O3EA 1ZJKA 2BD2A 1LVYA 3Q00A 2VIOA 4TWWA 1FIZA 1S81A 1Y5BT 3P8NA 5FHTA 4GHQA 1L1NA 2XYAA 1GBIA 1WQVH 2ZHQH 4CRBA 1P03A 2BDBA 3TH2H 1SGRE 2TRMA 1CA8B 2WV5A 2PKSC 3RXCA 3T2NA 1BZXE 1YPJH 1INCA 1F5LA 4IC5A 3S7HB 2BDAA 1TQ7B 3VXFH 1GBCA 2BLQA 2HNTC 4WJG2 1YGCH 1HJ9A 4XBCA 3P8FA 4Y79A 3RXDA 1HJAB 2HVXA 1KYNA 1Y8TA 1C2EA 4JYTA 2CF9H 2FOBA 2ZPQA 3I77A 2BZAA 3M3TA 1H1BA 2Y7XA 2V3HH 1XVMA 4X6OA 5GIBA 2XWAA 5DKMA 3RXTA 3UQOA 3BF6H 1YKTA 3V7TA 1MKWH 1GHBG 3P8OA 3A8AA 2ASUB 1NPMA 2Y5HA 3BTWE 2GT7A 2RA3A 3UR9A 3FAOA 1TPSA 3TH4H 1KY9A 1TOCB 2ZHDA 2BXUH 3BEUA 4CRDA 1XXDA 3SU4A 1P0SH 2R3UA 2FP7B 4BXSA 1V2PT 3M7TA 4BXWA 4NIYA 4CR5A 3UTUH 4MTBA 2ZDLA 3PMAB 2V3OH 3DFJA 5F03A 2J94A 5L6NH 1DITH 2FMJA 1MTVA 4NA7A 4AZ2B 2GZ7A 1FZZA 7KMEH 1FAXA 1VGCB 1ACBE 2H1UA 5FBEA 3Q3YA 1TMBH 1P2MA 5F8ZA 2ZA5A 5LPFA 3LPRA 5EU8A 1DWDH 4OS5A 1GDUA 5EXLA 2G8TA 2A0QB 3LGTA 1ZR0A 1ELGA 5L30H 1MTUA 1BRUP 1UTPA 1GI3A 1UCYK 2SGDE 1ZHPA 2A5IA 5AHGH 2A1DB 4WWYA 1THSH 3SHAH 3LONA 2O8LA 3SGBE 3H5CB 2C8YB 2BY6X 1OP2A 4ABFA 3U69H 1SSXA 1Z8JB 2ZU1A 7GCHF 4MPVA 4U30A 1CHOF 4I8HA 3KN2A 2ANWA 1LHEH 2ZU5A 1YPLH 5GCHF 3T26A 2K1QA 1SGFG 2BDHA 1ZJDA 5CMXH 4U01A 1SR5C 3T5FH 5JBCS 2B8OH 2VIQA 2QA9E 4Y0YE 2PTNA 5BRRE 2ZDKA 1XUFA 1AFQB 3UY9A 1CBWB 1ZOMA 1P8VC 1SOZA 2Z3DA 2AYWA 3VEQB 1HCGA 3SI3H 1GHAG 4BAOB 1YPKH 1FMGA 4WXIA 1E35B 1QB9A 1GI0A 1C5SA 2G81E 2BTCE 4MNWA 2HWLB 5G4BA 2TGDA 3EA7A 4VGCC 1NTPA 5A2MH 4D8NA 3IITA 1P3EA 3HKJB 4A5TS 4IGDA 4FU9A 2ZCKP 2PKAA 5GDSH 4YO9A 1O5BB 3U1IB 2AMQA 4NA8A 1ELBA 5EQQA 3BV9B 4CRAA 1C1PA 5PTPA 5FPYA 2QN5T 1MCTA 3CENA 3SUEA 3D49H 1YYY1 4WXVA 1JBUH 5HYOA 2UUKB 2F9BH 1TNLA 2UWLA 1FXYA 3E6PH 4I32A 1QRZA 1FDPA 3MU5A 3Q3XA 3ZZ7A 1MQ5A 3EA8A 3LH1A 1VITG 2VGCC 6GCHF 4AOQA 2P16A 3KQCA 1O2GH 1V2VT 3SNBA 1PQ7A 1BDAA 3QWCH 5FPSA 1BTZA 3F9EA 5FX6A 2VINA 3TK6A 1GMHF 3SZNA 2J2UA 1O3GA 4FUDA 1TRMA 4ISHH 2ZCLP 2ZECA 1F0RA 5F6MA 3GCTG 4Y7BA 3U8TH 4IN1A 3UOUA 2WYJA 4ABIA 1ZRKA 1ELFA 1Z71A 5DP9A 1ARBA 4DIIH 2A5KA 1LHFH 3TNSA 3S69A 1D6RA 1GJ7B 3U8OH 1SGPE 1EPTA 1XUGA 1G2LA 2FI3E 4B2CA 4OGYA 5GPIB 1O31A 8KME2 4LOYH 3RXGA 1S83A 1PPZA 1U6QA 2BB4A 1BBRH 1ETRH 1V2UT 1B0EA 1SGCA 2AMPA 4NZLA 1T8OA 2SFAA 1O0DH 4FU7A 3E16B 1HIAB 1ETTH 3ZVAA 3BTDE 3S9AA 1K1LA 2QXGA 5CE1A 1QRXA 1ANBA 1TX6A 4JZ1A 2A2QH 1FUJA 1QB1A 3UR6A 1GJAB 4FUCA 1MD8A 1JXPA 1GI9B 4ZXYH 2V0BA 1CQQA 3G01A 3PYHA 4ESTE 5GXPA 3GY4A 1TA6A 5TJXA 3ESTA 1GCDA 3ATMA 1Y5AT 4JZIA 3RU4T 1P12E 2H9EH 2OTVA 2PW8H 5T3HA 3V13A 4CRCA 1XMNB 2UWPA 1IHTH 1O2NA 1OX1A 3W95A 1AFEH 1RTFB 2SGFE 2H5CA 1YPEH 1TPPA 1FIWA 3PMBB 1PPCE 1PQ5A 1Q2WA 3A8BA 1TBZH 3MH4A 3FVFB 5A09A 1V2ST 2BD4A 3MU1A 3ZYEA 1DY9A 2J4IA 1GI2A 3HK6B 1C5XB 1BUIA 2QGRA 1O30A 1UTQA 1DWEH 3SQHE 1MU6B 2Q6FA 1ANEA 2UUJB 2P3TB 1HAHH 4J2YB 4AB8A 1TMUH 3SU1A 3TLOA 1TLDA 3GOVB 4X1QU 1EB1H 1GPZA 2XBVA 1OWHA 2J9NA 1AUTC 5JYIA 1CVWH 1F0SA 4J1YA 1TMTH 2F9OA 2PLXA 1T8NA 1YLDA 3MU4A 3SU3A 2H2ZA 2W3KA 3MO3A 1C5WB 1HUTH 1C1RA 1KDQB 3MNBA 3QK1A 2AH4X 2VVVA 1IAUA 1WTGH 1BTHH 1C5NH 4B2BA 1HAIH 2ZC9H 4THNH 1XX9A 4VGCB 4BAQB 9ESTA 3PTBA 4WY3A 3QGJA 1C2KA 1SI5H 2VWOA 5JDUB 3TIUA 1C1TA 3LGYA 5K7RA 1BB0B 1IQIA 1C1SA 1NZQH 5C1UA 2CMYA 1EKBB 1UTKA 1TB6H 2PUQH 1G30B 4UDWH 1QB6A 2ODQA 2ILNA 4Q7YA 6ESTA 5LPEA 1XXFA 5LGOA 1D3TB 1W12U 1SL3A 3PROA 1C5TA 4CR9A 2SNWA 1S6FA 2BY7X 3RXLA 1LVOA 3PLKA 1HRTH 3EGKH 2AIPA 2VGCB 3LT3A 4BTTB 1E36B 4FUFA 2HGTH 5DO4H 1K1PA 2BX4A 3ELAH 1C2MA 1GHZA 2PWXA 1AUJA 1BIOA 4NWLA 1WCZA 3F9HA 3EAJA 2FOCA 3SGAE 1GI7B 2XW9A 1QL9A 1UTMA 4Y76A 3V12A 1PQAA 3ZV9A 1QCPA 4AFQA 3MNXA 3PO1C 3PMHB 2AERH 3T28A 3SU0A 1KXDA 1HB0B 4LK4A 1GWAA 3SU2A 4JCNA 1PPBH 3OX7U 3RLYH 3ZZCA 1YCPH 2BVXH 1SHHB 1FLEE 5K0HA 4AFSA 2VWNA 1YF4A 1HJAC 2WV4A 2HLCA 3M5OA 4BAHB 1O2RA 2FYRA 2ZTYA 2QYIA 3B23B 2ZDVH 4IN2A 4BOHA 3T29A 4DCDA 4ZKOU 1A0JA 1LVMA 1HGTH 3A89A 3TGIE 2OCVB 2WUCA 4ABGA 3A7VA 1SLVB 3RDZA 1J8AA 4GLYA 1O39A 1ORFA 2IOTA 1L2EA 2BQWB 5JBBS 3UOPA 5JB8S 2Y7ZA 1O2TA 3AVZA 1W7XH 1ZMJA 2BYAX 3GY7A 3E91A 1PPFE 3NCLA 2B9LA 5FPTA 3SU6A 1AVGH 1WAYB 2ZPSA 2BDIA 5CHAC 4TYDA 1GHYH 3ZVGA 1A7SA 1EJMA 1QBNA 1LCYA 1AB9C 1BHXB 1SLWB 4UFGH 1SGDE 1LPGB 1E38B 1NFYA 1ZTJA 3GDUA 5J4QA 2G52A 4GVUA 4H6SB 1UVSH 4NGAH 3QGNB 2G5NA 3DHKH 4NFFA 3OY5U 2BVSH 2FOMB 1BRAA 1SLXB 1DWBH 1HLTH 2BX3A 4INKA 3K6ZA 3W94A 5EW1H 1GHAF 3RUOA 4ZKRU 4AN7A 2FTMA 5JPMH 1NT1A 3RMMH 2AGGX 1QJ1B 3NK8A 4F4OC 1DANH 2TGTA 1C2DA 3GICB 3Q77A 1TNHA 5I25A 2J92A 4ZMAH 1UHBB 1DXPA 3KHVA 1BQYA 5GJ4B 5T6GA 1O3AA 3QDZB 1O5FH 3RU4E 3ZVDA 1LKAA 1SFIA 4B76A 1LO6A 2BZ6H 3QN7A 1V2LT 4K5ZA 2HPPH 1ID5H 2G4UA 1QY6A 2ESTE 1O2WA 3E1XB 3BIUH 4TY6A 1QJ6B 1Z6EA 1TRYA 1LTOA 3I29A 1AZ8A 3D65E 1WSSH 3ATIA 1O35A 1DE7H 2VH6A 2NU3E 1L4ZA 2RG3A 1YPHC 4TPYA 4X1NU 2OXSA 1E0FD 2C8ZB 3MI4A 5T6DA 2QXIA 2JH6D 2F83A 1HPGA 1PPHE 4YLQH 1TX8A 4JZDH 2BY5X 2BLOA 4HTCH 1GBHA 2TBSA 2WYGA 1GMCG 1VITF 3A88A 2FOEA 2VIVA 2F91A 2ZFQH 4X2VA 3STJA 2A7CA 1RS0A 4X8UH 3B9FH 2QIQA 2ZHWH 2ZO3H 1O36A 1GVLA 3E8LA 3SOSA 1LPKB 1Y3VA 4B1TA 1V2KT 3ZV8A 1XUKA 1UO6A 4YT6H 1K1JA 5EOKA 5E0GA 2KAIA 4DGJA 3GCTF 5H4IB 1FAKH 1RJXB 1UVPA 3P8GA 2F9NA 1C2JA 2Y81A 2I6SA 2GP9B 2P95A 4SGBE 1AKSB 2P3UB 4Z0KA 2ZQ1A 2EI6A 3O8RA 1O3FA 4UONA 1WBGB 3GCHC 1S82A 5C1YA 1HAXB 1P2JA 2Y80A 3AASA 2R0KA 3SV8A 1VCPA 3LJJA 1HAPH 3A7WA 1O5CB 2GDEH 3OSYA 1LHDH 4H6TA 3A85A 3Q76A 3RM2H 3RXIA 3NXPA 3MMGA 4NIWA 1CE5A 3PWBA 4LXBH 3P17H 3PO1B 3LKWA 2RCEA 1O2VA 1SFQB 4A1VA 4X8SH 4AG1A 3VFEA 1GBKA 1NY22 2FOGA 1P9UA 2D26C 4MPXA 1V2WT 2M5TA 1W2KH 1DXWA 1GJ9B 2A5AA 4FU8A 1K1MA 4X0WU 1YP9A 1C2FA 1FI8A 2A32A 1O5AB 3EE0B 1P10A 1Y3XA 2BVRH 4X1RU 2A4OA 1O2LA 3TJOA 4GCHG 1DSUA 1NROH 2C8XB 1PPGE 1QGFA 1NRQH 2ZU4A 9LPRA 5JB9S 1AVWA 1EXFA 4D76A 2O8TA 4GAWA 2A4QA 3V0XA 4AGKA 4I33A 1FQ3A 1J17T 2SGEE 1EP5A 4R8TB 1XUIA 1P57B 1DLEA 2BD7A 4WMFA 1FY5A 4ZH8A 4R0IA 2W5EA 3IWMA 1ELEE 1C5OH 2SGPE 2TIOA 1LMWB 2ZU2A 2XTTB 5CHAB 1W0ZU 2PR3A 1O34A 1OP0A 1ZTKA 3VB4A 1RGQA 5C5NA 3SBKA 1AB9B 1S0RA 1TRNA 1D6WA 2XNIA 2R2WU 1MKXH 1F7ZA 2CHAB 3BN9A 3MFJA 3URDA 1EZUC 1DPOA 4NZQA 1XUHA 1Y3YA 5JBTA 1QURH 3UFAA 1UTOA 3E0NB 4PROA 3SV2H 1EAIA 1HAVB 5DP3A 1TGSZ 3MH7A 2OLGA 4OGXA 4LZ4B 1C5ZB 1SG8B 2BMGB 1GJ6A 2RDLA 1ZMNA 1GBAA 4O3TA 1NC6A 1MTSA 3M5LA 2ZHFH 4X2YA 5HGGA 2OBQA 3BTGE 1UMAH 1D4PB 4Y0ZE 1B0FA 1EZSC 1Z8GA 1WU1A 3M5MA 1TA2A 1TWXB 2B0FA 1K2I1 3RXEA 3ODDA 1WQSA 4YOIA 1QBVH 2GZ8A 1KDQA 1QBOA 4WH6A 2FEQH 2G00A 1P3CA 1C5LH 1CU1A 4OS2A 1V2OT 2A45B 1QHRB 5C67A 4WMDA 2W26A 3PLBA 2FX6A 3RC4A 1ZMLA 3T25A 1A2CH 1GG6C 3GY8A 4CRGA 2Z9GA 2A7HA 1O3BA 3HK3B 2CF8H 4QT8C 3QTVH 1TIOA 1A46H 5C3NA 1SC8U 3K65B 1GDQA 3BG4C 3QX5H 4E7NA 1MD7A 2XBXA 1O2PA 1DICA 2AIQA 2WPHS 3DT0H 1ZPBA 1DDJA 3BTHE 2FWWA 2FS9A 4JK6A 1DWCH 2Q6DA 4JK5A 3RXKA 2Y82A 1TAWA 2BXTH 4A7IB 4MDSA 4MG3A 2GD4B 2PV9B 2BY9X 1UTNA 4FUIA 5EW2H 2H9HA 1CGIE 4XBDA 1FY4A 4HZHA 3UWJH 3O8CA 3KQBA 1C5UA 1DX5M 3FFGA 5A0BA 4ABAA 1BMMH 3GCHB 2BLWA 5E8EH 1GVKB 1YBWA 1ZZZA 1H4WA 3A7ZA 1C2LA 2BQ7B 4OS4A 5SGAE 1GI4A 1XKAC 4DT7B 3F9GA 4MLFB 1WTHD 1O2XA 1BT7A 2JKHA 2Z7FE 4NSYA 3UPEA 4Q2KA 1QFKH 3VPKA 4ZROA 1MQ6A 3P92A 4ZHLU 2Z3CA 4IMZA 1N1LA 1THRH 1HDTH 2SGQE 3A81A 1P11E 1KXEA 3TU7H 1TABE 2ODYB 5L2YH 2XCFA 1RXPA 1C2IA 3SNAA 1HV7A 2GCHF 2IN2A 2BHGA 2CXVA 3SJ8A 1SGNE 1SQAA 1VZQH 4WMEA 3E0PB 1MZAA 2Y5FA 2CJIA 2DE8A 8GCHF 1FJSA 1DY8A 4FVDA 1Y3UA 5ETXA 4M7GA 3MHWU 1GBEA 2PGBB 2ZP0H 1C1NA 4CRFA 3SJIA 1GJCB 2EEKA 3D23A 1A5HA 3KGPA 2F9VA 2NU1E 1UVOA 2ZWLH 1WOFA 1O3LA 2ALVA 1O5GH 1EJAA 2O8WA 3A83A 2CGAA 1QNJA 2BD8A 4K8BA 1O2QA 1FPHH 1SHYA 1CA0B 4HI3A 1C4V2 1GBLA 1T32A 1JIRA 1DFPA 2GV6A 2AEIH 1A5GH 2FI5E
chains in the Genus database with same CATH superfamily
1NFXA 1UK2A 2BY8X 2Z9KA 1UCYE 1VJ9U 1A1RA 1P2NA 4AYVB 6CHAC 3AW1A 2J98A 3I78A 1QQUA 2ZGBH 1L1GA 1B7XB 4TWYA 5EQSA 1J15A 1AQ7A 1YPMH 4KTSA 3ZVCA 4HGCA 4P02A 4SGAE 1EPTC 1NBMD 3GDVA 5FL7D 1OP8A 4X1PU 1GMDG 3TJVA 1GMCF 5TCAA 2C4FH 3PMJA 4KTUA 4YXWD 2OBOA 1TGBA 3MOCA 1SGEE 4ABJA 3M35A 3TNTA 1GG6B 1ABIH 1D3DB 1EP6A 5FXLA 3SU5A 3NKKA 3RMOH 7ESTE 2V35A 4X6MA 5HMAA 1GI1A 1ZSKA 5DP7A 1A0HB 3BG4B 4RN6A 3SJ9A 2GDDA 2XRCA 1SQTA 3NZIA 1T4UH 4Q7XA 1T7CA 1KMHB 1TALA 2TGPZ 5DP6A 2M2AA 1BJVA 2AGEX 4E05H 4YT7H 1O2SA 1IQMA 1GI5A 4Y11E 3KIDU 2SGAA 1NS3A 2A4GA 1GJBB 1KXAA 4Y8ZA 4ZXXH 1KLJH 5A8ZA 3SNCA 4DG4A 3S0NA 1C1QA 1O3JA 1V6DA 1NU7B 5T6FA 4TY7A 1C9TA 1O3MA 3TPIZ 2WPIS 1LVBA 1K9OE 1OWDA 1O3CA 2YNBA 1GHVH 4ZUHA 2QF5A 2ZDMA 1BMLA 3GY5A 4MPUA 5AVDA 1VCWA 3KEEA 4NSVA 3PLPA 4A1TA 1COWD 2FZZA 3GCOA 5LPRA 5ABWA 4F48B 5IYTA 3ITIA 2A7JA 1FPCH 4B6FA 1TQ0B 1GCTB 3MYWA 4MVNA 1LQDB 1N8OC 1RTKA 3OFND 2ZCHP 5AFZH 5KGOA 3TK5A 4GCHF 5DGJA 7GCHG 5J4SA 3ZZ6A 1TE0A 1DM4B 1CHOG 1EZXC 1TNJA 2QCYA 5GCHG 2RA0A 4MPWA 3H7OA 2BOHB 1GHBF 3BTME 1T8MA 4I8LA 1YLNA 5DN6D 1AN1E 1A5IA 4B75A 1JRSA 1F5RA 5A8YA 4X6NA 4LZ1H 2HOBA 1NU9A 3LOXA 1JRTA 3RXJA 3RXQA 4ABDA 1W0YH 1GBBA 1C4U2 5FX5A 1CHGA 2PKAB 4BAKB 1O33A 1T31A 2XBYA 1Z8IB 2CK3D 1G3EA 3SUDA 2D1JA 3SI4H 2J95A 1L1JA 5FAHA 2OD3B 4ISLA 4Y10E 1P02A 3GY2A 2H6MA 1EOLA 5TCCA 1PFXC 1HAOH 5C5OA 2KM0A 1QJ7B 1UK4A 4O97A 4CREA 1BTPA 3HATH 4GUXA 2J38A 3FP6E 1J14A 3N7EA 1T4VH 1H8DH 2C3SA 3SV9A 1T8LA 2BM2A 3PM3A 4BANB 3P6ZB 1EASA 3O8DA 2QF3A 4D9RA 5I46H 4ZAEA 5FCKA 1HAVA 1CGJE 1P2KA 2HNTF 3OTJE 5DP8A 3SORA 1HNEE 3UNQA 3RXOA 1DLKB 4WH8A 3LIWA 3BG8A 1MUEB 2ODPA 2R3YA 2QF0A 1H9IE 1ZGVA 1ELAA 6GCHG 2Z9JA 4X1SU 3SQEE 3ZVFA 1JOUB 1V2MT 2BQ6B 3PB1E 1TNGA 1E79D 4B6EA 4YLUA 3ZVBA 1GMHG 1A3BH 3VXEH 2AHME 2GZ9A 4B74A 5EPNA 4RT0A 3MWIU 2CHAC 4XSKU 6CHAB 3A7YA 1F92A 4K60A 4UFFH 2ZNKH 3U28C 3BTQE 1OWKA 2FI4E 1IQLA 1FONA 2WINI 4YM9A 2KX4A 3E3TA 3ENSB 3MH5A 2WPMS 1EPTB 2PSXA 3SZEA 1TBRH 4KP0A 3F6UH 2V6NA 1QTFA 2P8OC 1EFRD 1SB1H 1BOQA 3EA9A 2F3CE 1F0UA 2KCYA 2HPQH 2WSSD 1ELVA 1QRWA 5C94A 1O2IA 2P3FH 4KGAA 1BTYA 3LGVA 5FBIA 1OPHB 1TGNA 5E0JA 2FYQA 4NG9H 3L33A 1ZGIA 4YOGA 1OWEA 1XUJA 2PFEA 4NA9H 4GHTA 1YC0A 2STAE 3K2UA 1ESTA 3QZRA 5EIYA 5DG6A 2GGVB 1C5MD 1OXGA 1MMJN 1O2OA 2SNVA 2ZDAH 1ANDA 1W13U 3GY6A 2GCTC 5FCRA 3RC5A 4DW2U 2FXRA 4ASHA 2ANYA 1TOMH 1YCPM 1C2GA 3KNXA 5AF9H 3D62A 3LU9B 1KXBA 3LC5A 5JBAS 2GMTB 3AAUA 1KTSB 1D9IA 2HRVA 4NWKA 1D3QB 1MBQA 2V7QD 1ZPCA 2ZFFH 3N7DA 3RXSA 3UIRA 3DFLA 4AFUA 3BIVH 5EXMA 3ATLA 2FLBH 1DVAH 3RXPA 4Q4LA 1C5YB 2FOAA 1SGIB 1KXFA 3RXAA 2Z94A 1A4WH 5EPYA 3M3VA 1CT4E 1W0KD 5CDFE 3A8CA 3FZZA 2XC4A 4K8YA 2ZHEH 3L6PA 4UFEH 1TPOA 4INLA 3ZZ4A 3UNSA 3BEIB 1MH0A 4Y8YA 1HAGE 2ZEBA 3ATKA 1EOJA 1ETSH 1P04A 4FUGA 4XOJA 3UUZA 1S5SA 4XBBA 1FN6A 3ZZ3A 1TONA 2ZTXA 5DP4A 2VH0A 1NO9H 1N8OB 3HKIB 2ZPRA 1O2KA 5A8XA 4D7GA 4DJZB 1IOEA 4AYYB 1OYTH 3JZ2B 4OS6A 2ZFSA 1K21H 4MNVA 2ULLA 1P2IA 4BAMB 1KLIH 1GHXH 2CV3A 2P59A 3A7XA 1C5PA 2AMDA 3HPTB 3LGWA 2BD5A 1JMOH 3JZ1B 3LGIA 1OYQA 5DP5A 2P93A 2OC1A 1AIXH 1O3HA 3GYLB 4X8VH 2PSYA 1SGFA 1KXCA 1BMNH 3KL6A 1AVXA 1BTUA 1W14U 2VWLA 3SV6A 4K2YA 3OTPA 3RXVA 2PTCE 1V3XA 1OWIA 2W6JD 3WY8A 3VGCB 1H9HE 2ALPA 5F8TA 2NWNA 1SQOA 2VJ1A 1Z6JH 4RKJB 3U1JB 1JIMA 3TJNA 1G3BA 4JMYA 3SNEA 1V2QT 2BDCA 3H7TA 1HIAA 4Q63A 3A82A 3T27A 1WUNH 3F68H 1IQGA 4XFQA 5EG4A 1AWFH 3QTOH 1YPGH 3EDXB 3F1SB 2OUAA 3CS7A 3RC6A 4B71A 1C1WH 1P09A 3R0FA 3ZZ9A 3ZZ5A 4BTUB 3EE7A 3LC3A 4Y71A 2BOKA 1O3DA 1DT2A 1EAWA 1WYKA 3PV5A 1Q3XA 2OC8A 1TNKA 1GBJA 3FO8D 1ANCA 1CT0E 1MKWK 1P06A 3TGKE 2OQUA 4NIXA 1G3CA 2WPDD 1K22H 1V2TT 3QO6A 4BNRA 1GMDF 3ZZDA 4JZFH 3BTKE 3M5NA 1EJNA 3A80A 5HXFA 1O3IA 1ELCA 4DY7B 4B2AA 2WPLS 4DOQA 3MU8A 1AMHA 1CA0C 1HBTH 2XXLA 1QA0A 2EC9H 1GI8B 1QR3E 3AK5A 1SQRA 1MKXK 1NRSH 5C2ZA 3SNDA 3SN8A 2P8OB 2OC7A 3PTNA 1QIXB 2A2XH 4UFDH 4IMQA 3EYDA 1TBQH 1Y3WA 1KLTA 5DSFA 1F5KU 2ZIQH 2IJD1 1TYNA 1G32B 3ODFA 2VNTA 1MTNB 2RFKC 2FOFA 2BDYA 1C1UH 3N99A 3FP8E 4ISOA 1O32A 4CHAB 4UEHH 4U2WA 3BSQA 1UCYH 1RIWB 1VCQA 5B6OA 3LGUA 3ZIAD 4I31A 1IQFA 3SUGA 1DOJA 1UJ1A 2THFB 2ZFPH 1FN8A 3O8BA 2D8WA 1DSTA 2PGQB 1G9IE 2GCTB 4MNYA 1AD8H 1BHXF 1SBWA 1NFUA 4K3JA 1XVOA 3RLWH 1GBDA 3M3SA 2B5TB 1PPEE 1AGJA 4IW4E 3PWCA 1G36A 4CH2B 1ZYOA 3M7UA 5EJLA 1P9SA 1FNIA 4I8KA 3QUMP 2OINA 1LQEA 3ZVEA 1C1OA 3U8RH 1UVTH 2JH0D 2G55A 1GBMA 1O3PB 4KTCA 4O3UA 1O2YA 2ZU3A 5E2PA 3QLPH 2JETC 3BEFB 1ELTA 4FUBA 1SGTA 2YNAA 1IQHA 4ISIH 3SJOA 4K1SA 1G2MA 3UWIA 2GVFA 5C17A 1FX0B 2J97A 5GWZA 1HAZB 3KQDA 2WPKS 3VG8A 1NM6A 1O38A 3TJUA 3RMLH 2VU8E 2G51A 4E06H 1A61H 2ANKH 2V3MA 1FY1A 4JYUH 3K9XB 4I7YH 4A92A 2Z3EA 3DUXH 1YPHE 1TPAE 4INHA 1GCTC 1E37B 3M37A 4A6LA 1VITH 2C8WB 1EX3A 3NWUA 1DS2E 2UWOA 1MABB 3HGPA 2WPJS 4CBOA 1S6HA 1FV9A 4OS1A 1ARCA 1P01A 1ZHRA 2BD9A 5C1XA 1W8BH 1D3PB 1XKBC 3KQ5A 5C20A 1UTLM 2GT8A 3CS0A 3SV7A 2XBWA 1Y5UT 5HM9A 2R2MB 3WWBA 5DK1A 1ZPZA 3H09A 2PKSB 2OQ5A 1AY6H 2KAIB 4M9FA 1YM0A 3RM0H 2VIPA 1L0ZA 1Z1JA 1HAYB 1H9LB 2ZGHA 2LNCA 2VVUA 2Z9LA 3GY3A 2P94A 5F8XA 1EZQA 4X2XA 2XWBI 3B8JA 1ELDE 1EB2A 4JZEH 2A31A 4HFPB 1K1OA 1ZTLA 3DSGA 3TITA 2HALA 2QY0B 3AW0A 4X2WA 2XC0A 1W7GH 2ZG0H 4O03A 1AO5A 1C4Y2 2IJOB 1V2JT 5A0AE 1SGYE 4D9QA 4GSOA 2FX4A 3C1KA 4YOJA 1VKYA 1BA8B 1IQNA 4FVBA 3WW7A 1G37A 1WV7H 5HIZA 1Y59T 1KIGH 1M9UA 4K1EA 3F2GA 1O2MA 1AU8A 1VJAU 1OSSA 1ABJH 1CT2E 1P2OA 1O3OA 1BJUA 3UAIC 4ZKSU 4IC6A 1BBRK 1YY3A 4Q7ZA 3F3BA 3SW2B 1PYTC 2J34A 2L6OA 3PV4A 1EATA 2HNTE 1UW7A 8ESTE 1BRBE 4UE7H 1X7AC 2B7DH 2STBE 2G4TA 2KCPA 3A8DA 1MAXA 3M36A 4E7RG 1NBME 1TX7A 1P05A 1TGTA 1UHBA 2QV1A 2VIWA 1GJDB 1GI6A 1CGHA 2GKVE 1GJ4H 1J16A 1Q31A 3V3MA 2FDAA 5IDKA 1UK3A 2FODA 4X8TH 1Z1IA 2EI8A 1DUAA 3CP7A 2AFQB 3NRLA 4UD9H 3AAVA 1A0LA 5E2OA 4FUHA 1GL0E 2PUXB 1G3DA 2Z6BD 3P95A 4I8GA 1W3CA 1MBMA 1GL1A 1OKXA 3SJKA 2FTLE 3QZQA 4MNXA 2H5DA 4Z6AH 3IG6B 2ZTZA 2ZF0H 1GVZA 3RXUA 1RTLA 3KCGH 4CH8B 4MQAA 2ANMH 1J9CH 4XDEA 1UTJA 2W3IA 2YOLA 1EQ9A 4BTIB 1QL8A 3LJOA 3BTEE 1OHHD 2GJGA 5E0HA 4ACAA 4YTAA 3OAAD 3OE7D 2XOKD 2JH5D 1GHWH 1C2HA 2VIDA 3RXBA 3U98H 4ZKNU 2Z9IA 1DUEA 1LPZB 1C1MA 3URCA 5ESTE 2FM2A 2EI7A 2ZDNA 2KCAA 1GGDC 3DA9B 5BPEA 2GMTC 2QAAA 4TPIZ 1AKSA 2JETB 1Z7KA 3DSOA 1GJ5H 2OC0A 4H4FA 1S85A 3ZZAA 1W10U 2D2DA 4F49A 2H9TH 1THPB 3ATWA 2R0LA 3U9AH 1N6YA 1NRPH 3GCNA 5EODA 1HXFH 1FY8E 1HXEH 1F0TA 1MU8B 3TVJB 4FUEA 1LDTT 1P2QA 2A4RA 2LPRA 5DJ7A 4XE4A 1JWTA 1LKBA 2XC5A 1HYLA 4Q80A 4YZUA 1F2SE 1EUFA 3MTYA 5AFYH 1AI8H 2YMSB 2R9PA 1AWHB 1ESAA 2UUYA 2BD3A 4KKDA 2L74A 2AGIX 3VB3A 1BRCE 3MU0A 1W11U 1AHTH 1IQEA 5LH8A 1B5GH 1O5EH 1RRKA 1O2HA 1NFWA 1O3NA 7LPRA 4RSPA 2FOHA 1C1VH 3BTFE 3DCLA 1K28D 1AE5A 1PJPA 1ZSLA 2TPIZ 2ZZUH 3TGJE 1OWJA 1S0QA 4JYVH 4F55A 1BMFD 1KTTB 2Q1JA 2Y6TA 3TK9A 2QC2A 3RP2A 3VGCC 4X6PA 3MO9A 2VB0A 1A3EH 3UREA 3P70B 1MAYA 3KF2A 4AG2A 3MQKC 3M7QA 2FESH 4IBLH 2PHBA 1ESBA 1YCPK 1BTWA 2EA3A 2FO9A 1SGQE 1O2UA 1Z8RA 3K6YA 4WF8A 1BMAA 3FP7E 3SHCH 2DE9A 5EGMA 1H8HD 1VR1H 3A87A 1PQ8A 3SYJA 3F9FA 1BBRE 1GBFA 2ZFTA 1NN6A 1C5QA 2GTBA 4AFZA 4U32A 2F9PA 3OY6U 3S7KB 3M61U 3C27B 4AX9H 1N6XA 4ABHA 3TH3H 4H42U 4GPGA 1C9PA 1K1NA 1OS8A 2GX4A 1QQ4A 1ZLRA 2IPHA 1HFDA 1E34B 1O37A 1IQKA 1SOTA 2C93B 2ZKSA 3RXHA 3BTTE 1MCVA 3S9CA 1NRNH 3R3GB 1RFNA 1ZHMA 1ZSJA 1C5RA 2OP9A 4Y6DA 4B73A 2HLDD 4TT3D 1H8ED 4ZHAA 3RMNH 2AS9A 1E1RD 3CNRA 5ESBA 3ZYDA 1CO7E 1GJ8B 4ISNA 5L2ZH 3Q3KA 2Y5GA 4YESB 2O9QA 1BITA 2GCHG 3A84A 4DURA 2FS8A 1CSOE 3ZZ8A 1O2ZA 3KQEA 2BDGA 1NESE 2NU2E 2W7UA 2XCNA 4RKOB 1EAUA 1H8IH 3GS9A 3HGNA 1VGCC 8GCHG 3EQ0H 3SUFA 3MH6A 1EAXA 1MTNC 1SMFE 4K69A 3MO6A 2ZGJA 4A1XA 5EXNA 3FANA 3UQVA 2C90B 3E90B 4CBNA 2GV7A 4CHAC 4DIHH 4ABEA 1RIWC 2CN0H 1KSNA 1FY3A 2DUCA 1QL7A 4HG6A 4ABBA 3SO3A 4IS5A 4DVAU 1QZ8A 1O2JA 3STIA 1IHSH 4D7FA 1RD3B 4KELA 4AORA 1SVPA 2ZQ2A 3OEHD 1TNIA 5EQRA 1QA7A 2JIZD 3LDXH 1GGDB 3NPSA 4FXGH 3MNSA 1ZRBA 4ZCNA 1PYTD 3L3TA 3GISB 4Y8XA 2QXJA 2ZI2H 5C0TA 1K1IA 1GDNA 3T62A 2J98B 2ZGCA 4NCYA 2FLRH 2ZGXH 3FZDA 1SPJA 1TFXA 3SGQE 1O3KA 1LHCH 1C5VA 1YLCA 3GYMA 3NUMA 3DD2H 1O5DH 3GDSA 2FPZA 3VB6A 2LP6A 2BLVA 2VVCA 3MNCA 4AGJA 1L4DA 2TGAA 2WUBA 3RU4D 3VB7A 2QXHA 2FIRH 4I8JA 3F0OA 5IK2D 2NU4E 2O8UA 1GBTA 4WVPE 2W7SA 1AFQC 1S84A 3RXMA 1CBWC 1HJ8A 3OU0A 1TGCA 5A0CA 4AB9A 1V2RT 4FUJA 2Q6GA 2KCOA 5EJZA 1LHGH 1IQJA 2UUFB 3VB5A 1SLUB 1V2NT 1XM1A 2F9UA 4OS7A 3UNRA 2G5VA 3S9BA 3UB0A 2O8MA 1MTWA 1NRRH 2ZFRH 8LPRA 1MZDA 1UVUH 4NFEA 4ZHMU 3LH3A 5DPAA 1BTXA 3RXFA 4K1TA 4Y7AA 4O9VA 3N7OA 2F4LA 1OOKB 2VWMA 5GNDA 3ZZBA 6LPRA 4NIVA 1BCUH 5HM2A 2I6QA 3A86A 2NU0E 3DSPA 3OYPA 1AZZA 3RXRA 4XRNA 3A7TA 1AE8H 1O3EA 1ZJKA 2BD2A 1LVYA 3Q00A 2VIOA 4TWWA 1FIZA 1S81A 1Y5BT 3P8NA 5FHTA 4GHQA 1L1NA 2XYAA 1GBIA 1WQVH 2ZHQH 4CRBA 1P03A 2BDBA 3TH2H 5KECA 1SGRE 3KYGA 2TRMA 1CA8B 2WV5A 2PKSC 3RXCA 3T2NA 1BZXE 1YPJH 1INCA 1F5LA 4IC5A 3S7HB 2BDAA 1TQ7B 3VXFH 1GBCA 2BLQA 2HNTC 4WJG2 1YGCH 1HJ9A 4XBCA 3P8FA 4Y79A 3RXDA 1HJAB 2JJ2D 2HVXA 1KYNA 1Y8TA 1C2EA 4JYTA 2CF9H 2FOBA 2ZPQA 3I77A 2BZAA 2IPQX 3M3TA 1H1BA 2Y7XA 2V3HH 1XVMA 4X6OA 4RI0A 5GIBA 2XWAA 5DKMA 3RXTA 3UQOA 3BF6H 1YKTA 3V7TA 1MKWH 1GHBG 3P8OA 3A8AA 2ASUB 1NPMA 5C0UA 2Y5HA 3BTWE 4OM9A 2GT7A 2RA3A 3UR9A 3FAOA 1TPSA 3TH4H 1KY9A 1TOCB 2ZHDA 2BXUH 3BEUA 4CRDA 1XXDA 1S6LA 1P0SH 3SU4A 2R3UA 2FP7B 4BXSA 1V2PT 3M7TA 4BXWA 4NIYA 4CR5A 3UTUH 4MTBA 1SKYE 2ZDLA 3PMAB 2V3OH 3DFJA 5F03A 2J94A 5L6NH 1DITH 2FMJA 1MTVA 4NA7A 4AZ2B 2GZ7A 1FZZA 7KMEH 1FAXA 1VGCB 1ACBE 2H1UA 3F2HA 5FBEA 3Q3YA 1TMBH 1P2MA 5F8ZA 2ZA5A 5LPFA 3LPRA 5EU8A 1DWDH 4OS5A 1GDUA 2QF4A 5EXLA 2G8TA 2A0QB 3LGTA 1ZR0A 1ELGA 5B6LA 5L30H 1MTUA 1BRUP 1UTPA 1GI3A 2XNDD 1UCYK 2SGDE 1ZHPA 2A5IA 5AHGH 2A1DB 4WWYA 1THSH 3SHAH 3LONA 2O8LA 3SGBE 1YWUA 3H5CB 5EJ1A 2C8YB 2BY6X 1OP2A 4ABFA 3U69H 1SSXA 1Z8JB 2ZU1A 7GCHF 4MPVA 4U30A 1CHOF 4I8HA 3KN2A 2ANWA 2VBCA 1LHEH 2WV9A 2ZU5A 1YPLH 5GCHF 3T26A 5HIYA 2K1QA 1SGFG 2JDID 2BDHA 1ZJDA 5CMXH 4U01A 1SR5C 3T5FH 5JBCS 2B8OH 2VIQA 2QA9E 4Y0YE 2PTNA 5BRRE 2ZDKA 1XUFA 1AFQB 3UY9A 1CBWB 1ZOMA 1P8VC 1SOZA 2Z3DA 2AYWA 3PRDA 3VEQB 1HCGA 3FKSD 3SI3H 1GHAG 4BAOB 1YPKH 1FMGA 4WXIA 1E35B 1QB9A 1GI0A 1C5SA 2G81E 2BTCE 4MNWA 2HWLB 5G4BA 2TGDA 3EA7A 4VGCC 1NTPA 5A2MH 5KEDA 4D8NA 3IITA 1P3EA 3HKJB 4A5TS 4IGDA 4FU9A 2ZCKP 2PKAA 5GDSH 4YO9A 1O5BB 3U1IB 2AMQA 4NA8A 2YMSC 1ELBA 5EQQA 3BV9B 4CRAA 1C1PA 5PTPA 5FPYA 1W0JD 2QN5T 1MCTA 3CENA 3SUEA 3D49H 1YYY1 4WXVA 1JBUH 5HYOA 2UUKB 2F9BH 1TNLA 2UWLA 1FXYA 5HKKD 3E6PH 4I32A 1QRZA 1FDPA 3MU5A 3Q3XA 3ZZ7A 1MQ5A 3EA8A 3LH1A 1VITG 2VGCC 6GCHF 4AOQA 2P16A 3KQCA 1O2GH 1V2VT 3SNBA 1PQ7A 1BDAA 3QWCH 5FPSA 1BTZA 3F9EA 3PV2A 5FX6A 2VINA 3TK6A 1GMHF 3SZNA 2J2UA 1O3GA 4FUDA 1TRMA 4ISHH 2ZCLP 2ZECA 1F0RA 5F6MA 4ACBA 3GCTG 4Y7BA 3U8TH 4IN1A 3UOUA 2WYJA 4ABIA 1ZRKA 1ELFA 1Z71A 5DP9A 1ARBA 4DIIH 2A5KA 1LHFH 3TNSA 3S69A 1D6RA 1GJ7B 3U8OH 1SGPE 1EPTA 1XUGA 1G2LA 2FI3E 4B2CA 4OGYA 5GPIB 1O31A 8KME2 4LOYH 3RXGA 4DT4A 1S83A 1PPZA 1U6QA 2BB4A 1BBRH 1ETRH 1V2UT 1B0EA 1SGCA 2AMPA 4NZLA 1T8OA 2SFAA 1O0DH 4FU7A 3E16B 1HIAB 1ETTH 3ZVAA 3BTDE 3S9AA 1K1LA 2QXGA 5CE1A 1QRXA 1ANBA 1TX6A 4JZ1A 2A2QH 1FUJA 1QB1A 3UR6A 1GJAB 4FUCA 1MD8A 1JXPA 1GI9B 4ZXYH 2V0BA 1CQQA 3G01A 3PYHA 4ESTE 5GXPA 4ASUD 3GY4A 1TA6A 5TJXA 3ESTA 1GCDA 3ATMA 1Y5AT 4JZIA 3RU4T 1P12E 2H9EH 2OTVA 2PW8H 5T3HA 3V13A 4CRCA 1XMNB 2UWPA 1IHTH 1O2NA 1OX1A 3W95A 1AFEH 1RTFB 2SGFE 2H5CA 1YPEH 1TPPA 1FIWA 3PMBB 1PPCE 1PQ5A 1Q2WA 3A8BA 1TBZH 3MH4A 3FVFB 5A09A 1V2ST 2BD4A 3MU1A 3ZYEA 1DY9A 2J4IA 1K0HA 1GI2A 3HK6B 1C5XB 1BUIA 5CHBA 2QGRA 1O30A 1UTQA 1DWEH 3SQHE 1MU6B 2K8IA 2Q6FA 1ANEA 2KFWA 2P3TB 1HAHH 2UUJB 4J2YB 4AB8A 1TMUH 3SU1A 3TLOA 1TLDA 3GOVB 4X1QU 1EB1H 1GPZA 2XBVA 1WXRA 1OWHA 2J9NA 1AUTC 2RDEA 1CVWH 1F0SA 4J1YA 5JYIA 1TMTH 2F9OA 2PLXA 1T8NA 1YLDA 3MU4A 3SU3A 2H2ZA 4I86A 2W3KA 3MO3A 1C5WB 1HUTH 1C1RA 1KDQB 3MNBA 3QK1A 2AH4X 2VVVA 1IAUA 4Z1MD 1WTGH 1BTHH 1C5NH 4B2BA 1HAIH 2ZC9H 4THNH 3OEED 1XX9A 4VGCB 4BAQB 9ESTA 3PTBA 4WY3A 3QGJA 1C2KA 1SI5H 2VWOA 5JDUB 3TIUA 1C1TA 3LGYA 1E1QD 5K7RA 1BB0B 1IQIA 1C1SA 1NZQH 5C1UA 2CMYA 1EKBB 1UTKA 1TB6H 2PUQH 1G30B 4UDWH 1QB6A 2ODQA 2ILNA 4Q7YA 6ESTA 5LPEA 1XXFA 5LGOA 1D3TB 1W12U 1SL3A 3PROA 1C5TA 4CR9A 2SNWA 1S6FA 2BY7X 3RXLA 1LVOA 3PLKA 1HRTH 3EGKH 2AIPA 2VGCB 3LT3A 4BTTB 1E36B 4FUFA 2HGTH 5DO4H 2KR7A 1K1PA 2K0QA 2BX4A 3ELAH 1C2MA 1GHZA 2PWXA 1AUJA 1BIOA 4NWLA 1WCZA 3F9HA 3EAJA 2FOCA 3SGAE 1GI7B 2XW9A 1QL9A 1UTMA 4Y76A 3V12A 1PQAA 3ZV9A 1QCPA 1WDIA 3MNXA 3PO1C 4AFQA 3PMHB 2AERH 3T28A 3SU0A 1KXDA 1HB0B 4LK4A 1GWAA 3SU2A 4JCNA 1PPBH 3OX7U 3RLYH 3ZZCA 1YCPH 2BVXH 1SHHB 1FLEE 5K0HA 4AFSA 2VWNA 1YF4A 1HJAC 2WV4A 4P00A 2HLCA 3M5OA 4BAHB 1O2RA 2FYRA 2ZTYA 2QYIA 3B23B 2ZDVH 4IN2A 4BOHA 3T29A 4DCDA 4ZKOU 1A0JA 1LVMA 1HGTH 2YMSD 3A89A 3TGIE 2OCVB 2WUCA 4ABGA 3A7VA 1SLVB 3RDZA 1J8AA 4GLYA 1O39A 1ORFA 2IOTA 1L2EA 2BQWB 5JBBS 3UOPA 5JB8S 2Y7ZA 1O2TA 3AVZA 1W7XH 1ZMJA 2BYAX 3GY7A 3E91A 1PPFE 3NCLA 2B9LA 5FPTA 3SU6A 1AVGH 1WAYB 2ZPSA 2BDIA 2OK5A 5CHAC 4TYDA 1GHYH 3ZVGA 1A7SA 1EJMA 1QBNA 3F0PA 1LCYA 1AB9C 1BHXB 1SLWB 4UFGH 1SGDE 1LPGB 1E38B 1NFYA 1ZTJA 3GDUA 5J4QA 2G52A 4GVUA 4H6SB 1UVSH 4NGAH 3QGNB 2G5NA 3DHKH 4NFFA 2LELA 3OY5U 4FETA 2BVSH 2FOMB 1BRAA 1SLXB 1DWBH 1HLTH 2BX3A 4INKA 3K6ZA 3W94A 5EW1H 1GHAF 2WZQA 3RUOA 3FOAA 4ZKRU 4AN7A 2FTMA 5JPMH 1NT1A 3RMMH 2AGGX 1QJ1B 3NK8A 4F4OC 1DANH 2TGTA 1C2DA 3GICB 3Q77A 1TNHA 5I25A 2J92A 4ZMAH 3WWFA 1UHBB 1DXPA 3KHVA 1BQYA 5GJ4B 5T6GA 1O3AA 3QDZB 1O5FH 2QE7D 3RU4E 3ZVDA 1LKAA 1SFIA 4B76A 1LO6A 2BZ6H 3QN7A 1V2LT 4K5ZA 2HPPH 1ID5H 2G4UA 1QY6A 2ESTE 1O2WA 3E1XB 3BIUH 4TY6A 1QJ6B 1Z6EA 1TRYA 5T1VA 1LTOA 3I29A 1AZ8A 3D65E 1WSSH 3ATIA 1O35A 1DE7H 2VH6A 2NU3E 1L4ZA 2RG3A 1YPHC 4TPYA 4X1NU 2OXSA 1E0FD 2C8ZB 3MI4A 5T6DA 2QXIA 2JH6D 2F83A 1HPGA 1PPHE 4YLQH 1TX8A 4JZDH 2BY5X 2BLOA 4HTCH 1GBHA 2TBSA 2WYGA 1GMCG 1VITF 3A88A 2FOEA 2VIVA 2F91A 2ZFQH 4X2VA 3STJA 2A7CA 1RS0A 4X8UH 3B9FH 2QIQA 2ZHWH 2ZO3H 1O36A 1GVLA 3E8LA 3SOSA 5F53A 1LPKB 1Y3VA 4B1TA 1V2KT 3ZV8A 1XUKA 1UO6A 4YT6H 1K1JA 5EOKA 5E0GA 2KAIA 4DGJA 3GCTF 5H4IB 1FAKH 1RJXB 1UVPA 3P8GA 3FN8A 2F9NA 1C2JA 2Y81A 2I6SA 2GP9B 2P95A 4SGBE 1AKSB 2P3UB 4Z0KA 2ZQ1A 2EI6A 3O8RA 1O3FA 4FOUC 4UONA 1WBGB 3GCHC 1S82A 5C1YA 1HAXB 1P2JA 2Y80A 3AASA 2EY4C 2R0KA 4AC9A 3SV8A 1VCPA 3LJJA 1HAPH 3A7WA 1O5CB 2GDEH 3OSYA 1LHDH 4H6TA 3A85A 3Q76A 3RM2H 3RXIA 3NXPA 3MMGA 4NIWA 1CE5A 3PWBA 4LXBH 3P17H 3PO1B 3LKWA 2RCEA 1O2VA 1SFQB 4A1VA 4X8SH 4AG1A 3VFEA 1GBKA 1NY22 2FOGA 1P9UA 2D26C 4MPXA 1V2WT 2M5TA 1W2KH 1DXWA 1GJ9B 2A5AA 4FU8A 1K1MA 4X0WU 1YP9A 1C2FA 1FI8A 2A32A 1O5AB 3EE0B 3W1EA 1P10A 1Y3XA 2BVRH 4X1RU 2A4OA 1O2LA 3TJOA 4GCHG 1DSUA 1NROH 2C8XB 1PPGE 1QGFA 1NRQH 2ZU4A 9LPRA 5JB9S 1AVWA 1EXFA 4D76A 2O8TA 4GAWA 2A4QA 3V0XA 4AGKA 4I33A 1FQ3A 1J17T 2SGEE 1EP5A 4R8TB 1XUIA 1P57B 1DLEA 2BD7A 4WMFA 1FY5A 4ZH8A 4R0IA 2W5EA 3IWMA 1ELEE 1C5OH 2SGPE 2TIOA 1LMWB 2ZU2A 2XTTB 5CHAB 1W0ZU 2PR3A 1O34A 1OP0A 1ZTKA 3VB4A 1RGQA 5C5NA 4RT1A 3SBKA 1AB9B 1S0RA 1TRNA 1D6WA 2XNIA 2R2WU 1MKXH 1F7ZA 2CHAB 3BN9A 3MFJA 3URDA 1EZUC 1DPOA 4NZQA 1XUHA 1Y3YA 5JBTA 1QURH 3UFAA 1UTOA 3E0NB 4PROA 3SV2H 1EAIA 1HAVB 5DP3A 1TGSZ 3MH7A 2OLGA 4OGXA 4LZ4B 1C5ZB 1SG8B 2BMGB 1GJ6A 2RDLA 1ZMNA 1GBAA 4O3TA 1NC6A 1MTSA 3M5LA 2ZHFH 4X2YA 5HGGA 2OBQA 3BTGE 1UMAH 1D4PB 4Y0ZE 1B0FA 1EZSC 1Z8GA 1WU1A 3M5MA 1TA2A 1TWXB 2B0FA 1K2I1 2JJ1D 3ODDA 3RXEA 1WQSA 4YOIA 1QBVH 2GZ8A 1KDQA 3F2FA 1QBOA 4WH6A 2FEQH 2G00A 1P3CA 1C5LH 1CU1A 4OS2A 1V2OT 2A45B 1QHRB 5C67A 4WMDA 2W26A 3PLBA 2FX6A 3RC4A 1ZMLA 3PRBA 3T25A 1A2CH 1GG6C 3GY8A 4CRGA 2Z9GA 2A7HA 1O3BA 2J5UA 3HK3B 2CF8H 4QT8C 3QTVH 1TIOA 1A46H 5C3NA 1SC8U 3K65B 1GDQA 3BG4C 3QX5H 4E7NA 1MD7A 2XBXA 1O2PA 1DICA 2AIQA 2WPHS 3DT0H 1ZPBA 1DDJA 3BTHE 2FWWA 2EQNA 2FS9A 4JK6A 1DWCH 2Q6DA 4JK5A 2HVYB 3RXKA 2Y82A 1TAWA 2BXTH 4A7IB 4MDSA 4MG3A 2GD4B 2PV9B 2BY9X 1UTNA 4FUIA 5EW2H 2H9HA 1CGIE 4XBDA 1FY4A 4HZHA 2F43B 3UWJH 3O8CA 3KQBA 1C5UA 1DX5M 3FFGA 5A0BA 4ABAA 1BMMH 3GCHB 2BLWA 5E8EH 1GVKB 1YBWA 1ZZZA 1H4WA 3A7ZA 1C2LA 2KZ4A 2BQ7B 4OS4A 5SGAE 1GI4A 1XKAC 4DT7B 3F9GA 4MLFB 1WTHD 1O2XA 1BT7A 2JKHA 2Z7FE 4NSYA 3UPEA 4Q2KA 1QFKH 3VPKA 2W6ID 4ZROA 1MQ6A 3P92A 4ZHLU 2Z3CA 4IMZA 1N1LA 1THRH 1HDTH 2SGQE 3A81A 1P11E 1KXEA 3TU7H 1TABE 2ODYB 5L2YH 2XCFA 1RXPA 1C2IA 2WHXA 1HV7A 2GCHF 3SNAA 2IN2A 2BHGA 2CXVA 3SJ8A 1SGNE 1SQAA 1VZQH 4WMEA 3E0PB 1MZAA 2Y5FA 3KYFA 2CJIA 2DE8A 8GCHF 1FJSA 1DY8A 4XD7D 4FVDA 1Y3UA 5ETXA 4M7GA 3MHWU 1GBEA 2PGBB 2ZP0H 1C1NA 4CRFA 3SJIA 1GJCB 2EEKA 3D23A 4TSFD 1A5HA 3KGPA 2F9VA 2PP6A 2NU1E 1UVOA 2ZWLH 1WOFA 1O3LA 2ALVA 1O5GH 1EJAA 2O8WA 3A83A 2CGAA 1QNJA 2BD8A 4K8BA 1O2QA 1FPHH 1SHYA 1CA0B 4HI3A 1C4V2 1GBLA 1T32A 1JIRA 1DFPA 2GV6A 2AEIH 1A5GH 2FI5E
chains in the Genus database with same CATH topology
1NFXA 1UK2A 2BY8X 2Z9KA 1UCYE 1VJ9U 1A1RA 1P2NA 4AYVB 6CHAC 3AW1A 3I78A 1QQUA 2ZGBH 1L1GA 1B7XB 4TWYA 5EQSA 1J15A 1AQ7A 1YPMH 4KTSA 3ZVCA 4HGCA 4SGAE 1EPTC 3GDVA 1OP8A 4X1PU 1GMDG 3TJVA 1GMCF 5TCAA 2C4FH 3PMJA 4KTUA 2OBOA 1TGBA 3MOCA 1SGEE 4ABJA 3M35A 3TNTA 1GG6B 1ABIH 1D3DB 1EP6A 5FXLA 3SU5A 3NKKA 3RMOH 7ESTE 2V35A 4X6MA 5HMAA 1GI1A 1ZSKA 5DP7A 1A0HB 3BG4B 4RN6A 3SJ9A 2GDDA 2XRCA 1SQTA 3NZIA 1T4UH 4Q7XA 1T7CA 2TGPZ 1TALA 5DP6A 1BJVA 2AGEX 4E05H 4YT7H 1O2SA 1IQMA 1GI5A 4Y11E 3KIDU 2SGAA 1NS3A 2A4GA 1GJBB 1KXAA 4Y8ZA 4ZXXH 1KLJH 5A8ZA 3SNCA 4DG4A 3S0NA 1C1QA 1O3JA 1V6DA 1NU7B 5T6FA 4TY7A 1C9TA 1O3MA 3TPIZ 2WPIS 1LVBA 1K9OE 1OWDA 1O3CA 2YNBA 1GHVH 4ZUHA 2ZDMA 1BMLA 3GY5A 4MPUA 5AVDA 1VCWA 3KEEA 4NSVA 3PLPA 4A1TA 2FZZA 3GCOA 5LPRA 5ABWA 5IYTA 3ITIA 2A7JA 1FPCH 1TQ0B 1GCTB 3MYWA 4MVNA 1LQDB 1N8OC 1RTKA 7GCHG 2ZCHP 5AFZH 3TK5A 4GCHF 5DGJA 5J4SA 3ZZ6A 1TE0A 1DM4B 1CHOG 1EZXC 1TNJA 2QCYA 5GCHG 2RA0A 4MPWA 3H7OA 2BOHB 1GHBF 3BTME 1T8MA 4I8LA 1AN1E 1A5IA 4B75A 1JRSA 1F5RA 5A8YA 4X6NA 4LZ1H 2HOBA 1NU9A 3LOXA 1JRTA 3RXJA 3RXQA 4ABDA 1W0YH 1GBBA 1C4U2 5FX5A 1CHGA 2PKAB 4BAKB 1O33A 1T31A 2XBYA 1Z8IB 1G3EA 3SUDA 2D1JA 3SI4H 2J95A 1L1JA 5FAHA 2OD3B 4ISLA 4Y10E 1P02A 3GY2A 2H6MA 1EOLA 5TCCA 1PFXC 1HAOH 5C5OA 1QJ7B 1UK4A 4O97A 4CREA 1BTPA 3HATH 4GUXA 2J38A 3FP6E 1J14A 1T4VH 1H8DH 2C3SA 3SV9A 1T8LA 2BM2A 3PM3A 4BANB 3P6ZB 1EASA 3O8DA 2QF3A 4D9RA 5I46H 4ZAEA 5FCKA 1HAVA 1CGJE 1P2KA 2HNTF 3OTJE 5DP8A 3SORA 1HNEE 3UNQA 3RXOA 1DLKB 4WH8A 3LIWA 3BG8A 1MUEB 2ODPA 2R3YA 2QF0A 1H9IE 1ZGVA 1ELAA 6GCHG 2Z9JA 4X1SU 3SQEE 3ZVFA 1JOUB 1V2MT 2BQ6B 3PB1E 1TNGA 4YLUA 3ZVBA 1GMHG 1A3BH 3VXEH 2GZ9A 4B74A 5EPNA 3MWIU 2CHAC 4XSKU 6CHAB 3A7YA 1F92A 4K60A 4UFFH 2ZNKH 3BTQE 1OWKA 2FI4E 1IQLA 1FONA 2WINI 4YM9A 3E3TA 3ENSB 3MH5A 2WPMS 1EPTB 2PSXA 1TBRH 4KP0A 3F6UH 2V6NA 1QTFA 2P8OC 1SB1H 1BOQA 3EA9A 2F3CE 1F0UA 2HPQH 1ELVA 1QRWA 1O2IA 2P3FH 4KGAA 1BTYA 3LGVA 5FBIA 1OPHB 1TGNA 5E0JA 2FYQA 4NG9H 3L33A 1ZGIA 4YOGA 1OWEA 1XUJA 2PFEA 4NA9H 4GHTA 1YC0A 2STAE 3K2UA 1ESTA 3QZRA 5DG6A 2GGVB 1C5MD 1OXGA 1MMJN 1O2OA 2SNVA 2ZDAH 1ANDA 1W13U 3GY6A 2GCTC 5FCRA 3RC5A 4DW2U 2FXRA 4ASHA 2ANYA 1TOMH 1YCPM 1C2GA 3KNXA 5AF9H 3D62A 3LU9B 1KXBA 3LC5A 5JBAS 2GMTB 3AAUA 1KTSB 1D9IA 2HRVA 4NWKA 1D3QB 1MBQA 1ZPCA 2ZFFH 3RXSA 3UIRA 3DFLA 4AFUA 3BIVH 5EXMA 3ATLA 2FLBH 1DVAH 3RXPA 1C5YB 2FOAA 1SGIB 1KXFA 3RXAA 2Z94A 1A4WH 5EPYA 3M3VA 1CT4E 3A8CA 3FZZA 2XC4A 4K8YA 2ZHEH 3L6PA 4UFEH 1TPOA 4INLA 3ZZ4A 3UNSA 3BEIB 1MH0A 4Y8YA 1HAGE 2ZEBA 3ATKA 1EOJA 1ETSH 1P04A 4FUGA 4XOJA 3UUZA 1S5SA 4XBBA 1FN6A 3ZZ3A 1TONA 2ZTXA 5DP4A 2VH0A 1NO9H 1N8OB 3HKIB 2ZPRA 1O2KA 5A8XA 4D7GA 4DJZB 1IOEA 4AYYB 1OYTH 3JZ2B 4OS6A 2ZFSA 1K21H 4MNVA 2ULLA 1P2IA 4BAMB 1KLIH 1GHXH 2CV3A 2P59A 3A7XA 1C5PA 2AMDA 3HPTB 3LGWA 2BD5A 1JMOH 3JZ1B 3LGIA 1OYQA 5DP5A 2P93A 2OC1A 1AIXH 1O3HA 3GYLB 4X8VH 2PSYA 1SGFA 1KXCA 1BMNH 3KL6A 1AVXA 1BTUA 1W14U 2VWLA 3SV6A 4K2YA 3RXVA 2PTCE 1V3XA 1OWIA 3WY8A 3VGCB 1H9HE 2ALPA 5F8TA 2NWNA 1SQOA 2VJ1A 1Z6JH 4RKJB 3U1JB 1JIMA 3TJNA 1G3BA 4JMYA 3SNEA 1V2QT 2BDCA 3H7TA 1HIAA 3T27A 3A82A 1WUNH 3F68H 1IQGA 4XFQA 5EG4A 1AWFH 3QTOH 1YPGH 3EDXB 3F1SB 2OUAA 3CS7A 3RC6A 4B71A 1C1WH 1P09A 3R0FA 3ZZ9A 3ZZ5A 4BTUB 3LC3A 4Y71A 2BOKA 1O3DA 1DT2A 1EAWA 1WYKA 1Q3XA 2OC8A 1TNKA 1GBJA 1ANCA 1CT0E 1MKWK 1P06A 3TGKE 2OQUA 4NIXA 1G3CA 1K22H 1V2TT 3QO6A 4BNRA 1GMDF 3ZZDA 4JZFH 3BTKE 3M5NA 1EJNA 3A80A 5HXFA 1O3IA 1ELCA 4DY7B 4B2AA 2WPLS 4DOQA 3MU8A 1AMHA 1CA0C 1HBTH 2XXLA 1QA0A 2EC9H 1GI8B 1QR3E 1MKXK 1NRSH 5C2ZA 3SNDA 3SN8A 2P8OB 2OC7A 3PTNA 1QIXB 2A2XH 4UFDH 4IMQA 3EYDA 1TBQH 1Y3WA 1KLTA 1F5KU 2ZIQH 1TYNA 1G32B 3ODFA 2VNTA 1MTNB 2FOFA 2BDYA 1C1UH 3FP8E 4ISOA 1O32A 4CHAB 4UEHH 4U2WA 3BSQA 1UCYH 1RIWB 1VCQA 5B6OA 3LGUA 4I31A 1IQFA 3SUGA 1DOJA 1UJ1A 2THFB 2ZFPH 1FN8A 3O8BA 2D8WA 1DSTA 2PGQB 1G9IE 2GCTB 4MNYA 1AD8H 1BHXF 1SBWA 1NFUA 4K3JA 1XVOA 3RLWH 1GBDA 3M3SA 2B5TB 1PPEE 1AGJA 4IW4E 3PWCA 1G36A 4CH2B 1ZYOA 3M7UA 1P9SA 1FNIA 4I8KA 3QUMP 2OINA 1LQEA 3ZVEA 1C1OA 3U8RH 1UVTH 2JH0D 2G55A 1GBMA 1O3PB 4KTCA 4O3UA 1O2YA 2ZU3A 5E2PA 3QLPH 2JETC 3BEFB 1ELTA 4FUBA 1SGTA 2YNAA 1IQHA 4ISIH 3SJOA 4K1SA 1G2MA 3UWIA 2GVFA 5GWZA 1HAZB 3KQDA 2WPKS 1NM6A 1O38A 3TJUA 3RMLH 2VU8E 2G51A 4E06H 1A61H 2ANKH 1FY1A 4JYUH 3K9XB 4I7YH 4A92A 2Z3EA 3DUXH 1YPHE 1TPAE 4INHA 1GCTC 1E37B 3M37A 4A6LA 1VITH 2C8WB 1EX3A 3NWUA 1DS2E 2UWOA 3HGPA 2WPJS 4CBOA 1S6HA 1FV9A 4OS1A 1ARCA 1P01A 1ZHRA 2BD9A 5C1XA 1W8BH 1D3PB 1XKBC 5C20A 1UTLM 2GT8A 3CS0A 3SV7A 2XBWA 1Y5UT 5HM9A 2R2MB 5DK1A 1ZPZA 2PKSB 2OQ5A 1AY6H 2KAIB 3RM0H 1YM0A 2VIPA 1L0ZA 1Z1JA 1HAYB 1H9LB 2ZGHA 2LNCA 2VVUA 2Z9LA 3GY3A 2P94A 5F8XA 1EZQA 4X2XA 2XWBI 3B8JA 1ELDE 1EB2A 4JZEH 2A31A 4HFPB 1K1OA 1ZTLA 3TITA 2HALA 2QY0B 3AW0A 4X2WA 2XC0A 1W7GH 2ZG0H 4O03A 1AO5A 1C4Y2 2IJOB 1V2JT 5A0AE 1SGYE 4D9QA 4GSOA 2FX4A 3C1KA 4YOJA 1BA8B 1IQNA 4FVBA 1G37A 1WV7H 1Y59T 1KIGH 1M9UA 4K1EA 1O2MA 1AU8A 1VJAU 1OSSA 1ABJH 1CT2E 1P2OA 1O3OA 1BJUA 4ZKSU 4IC6A 1BBRK 4Q7ZA 3SW2B 1PYTC 2J34A 3PV4A 1EATA 2HNTE 8ESTE 1BRBE 4UE7H 1X7AC 2B7DH 2STBE 2G4TA 3A8DA 1MAXA 3M36A 4E7RG 1TX7A 1P05A 1TGTA 1UHBA 2QV1A 2VIWA 1GJDB 1GI6A 1CGHA 2GKVE 1GJ4H 1J16A 1Q31A 3V3MA 2FDAA 5IDKA 1UK3A 2FODA 4X8TH 1Z1IA 2EI8A 1DUAA 3CP7A 2AFQB 4UD9H 3AAVA 1A0LA 5E2OA 4FUHA 1GL0E 2PUXB 1G3DA 2Z6BD 3P95A 4I8GA 1W3CA 1MBMA 1GL1A 1OKXA 3SJKA 2FTLE 3QZQA 4MNXA 2H5DA 4Z6AH 3IG6B 2ZTZA 2ZF0H 1GVZA 3RXUA 1RTLA 3KCGH 4CH8B 4MQAA 2ANMH 1J9CH 4XDEA 1UTJA 2W3IA 2YOLA 1EQ9A 4BTIB 1QL8A 3LJOA 3BTEE 5E0HA 4YTAA 2JH5D 1GHWH 1C2HA 2VIDA 3RXBA 3U98H 4ZKNU 2Z9IA 1DUEA 1LPZB 1C1MA 3URCA 5ESTE 2FM2A 2EI7A 2ZDNA 1GGDC 3DA9B 5BPEA 2GMTC 2QAAA 4TPIZ 1AKSA 2JETB 1Z7KA 1GJ5H 2OC0A 4H4FA 1S85A 3ZZAA 1W10U 2D2DA 4F49A 2H9TH 1THPB 3ATWA 2R0LA 3U9AH 1N6YA 1NRPH 3GCNA 5EODA 1HXFH 1FY8E 1HXEH 1F0TA 1MU8B 3TVJB 4FUEA 1LDTT 1P2QA 2A4RA 2LPRA 5DJ7A 4XE4A 1JWTA 1LKBA 2XC5A 1HYLA 4Q80A 4YZUA 1F2SE 1EUFA 3MTYA 5AFYH 1AI8H 2R9PA 1AWHB 1ESAA 2UUYA 2BD3A 4KKDA 2AGIX 3VB3A 1BRCE 3MU0A 1W11U 1AHTH 1IQEA 5LH8A 1B5GH 1O5EH 1RRKA 1O2HA 1NFWA 1O3NA 7LPRA 4RSPA 2FOHA 1C1VH 3BTFE 1K28D 1AE5A 1PJPA 1ZSLA 2TPIZ 2ZZUH 3TGJE 1OWJA 1S0QA 4JYVH 1KTTB 2Q1JA 2Y6TA 3TK9A 2QC2A 3RP2A 3VGCC 4X6PA 3MO9A 2VB0A 1A3EH 3UREA 3P70B 1MAYA 3KF2A 4AG2A 3M7QA 2FESH 4IBLH 2PHBA 1ESBA 1YCPK 1BTWA 2EA3A 2FO9A 1SGQE 1O2UA 1Z8RA 3K6YA 4WF8A 1BMAA 3FP7E 3SHCH 2DE9A 5EGMA 1VR1H 3A87A 1PQ8A 3F9FA 1BBRE 1GBFA 2ZFTA 1NN6A 1C5QA 2GTBA 4AFZA 4U32A 2F9PA 3OY6U 3S7KB 3M61U 3C27B 4AX9H 1N6XA 4ABHA 3TH3H 4H42U 4GPGA 1C9PA 1K1NA 1OS8A 2GX4A 1QQ4A 1ZLRA 2IPHA 1HFDA 1E34B 1O37A 1IQKA 1SOTA 2C93B 2ZKSA 3RXHA 3BTTE 1MCVA 3S9CA 1NRNH 3R3GB 1RFNA 1ZHMA 1ZSJA 1C5RA 2OP9A 4Y6DA 4B73A 4ZHAA 3RMNH 2AS9A 5ESBA 3ZYDA 1CO7E 1GJ8B 4ISNA 5L2ZH 3Q3KA 2Y5GA 4YESB 2O9QA 1BITA 2GCHG 3A84A 4DURA 2FS8A 1CSOE 3ZZ8A 1O2ZA 3KQEA 2BDGA 1NESE 2NU2E 2W7UA 2XCNA 4RKOB 1EAUA 1H8IH 3HGNA 1VGCC 8GCHG 3EQ0H 3SUFA 3MH6A 1EAXA 1MTNC 1SMFE 4K69A 3MO6A 2ZGJA 4A1XA 5EXNA 3FANA 3UQVA 2C90B 3E90B 4CBNA 2GV7A 4CHAC 4DIHH 4ABEA 1RIWC 2CN0H 1KSNA 1FY3A 2DUCA 1QL7A 4ABBA 3SO3A 4IS5A 4DVAU 1O2JA 3STIA 1IHSH 4D7FA 1RD3B 4KELA 4AORA 1SVPA 2ZQ2A 1TNIA 5EQRA 1QA7A 3LDXH 1GGDB 3NPSA 4FXGH 3MNSA 1ZRBA 1PYTD 3L3TA 3GISB 4Y8XA 2QXJA 2ZI2H 1K1IA 1GDNA 3T62A 2ZGCA 4NCYA 2FLRH 2ZGXH 3FZDA 1SPJA 1TFXA 3SGQE 1O3KA 1LHCH 1C5VA 1YLCA 3GYMA 3NUMA 3DD2H 1O5DH 3GDSA 2FPZA 3VB6A 2BLVA 2VVCA 3MNCA 4AGJA 1L4DA 2TGAA 2WUBA 3RU4D 3VB7A 2QXHA 2FIRH 4I8JA 2NU4E 2O8UA 1GBTA 4WVPE 2W7SA 1AFQC 1S84A 3RXMA 1CBWC 1HJ8A 3OU0A 1TGCA 5A0CA 4AB9A 1V2RT 4FUJA 2Q6GA 1LHGH 1IQJA 2UUFB 3VB5A 1SLUB 1V2NT 1XM1A 2F9UA 4OS7A 3UNRA 2G5VA 3S9BA 2O8MA 1MTWA 1NRRH 2ZFRH 8LPRA 1MZDA 1UVUH 4NFEA 4ZHMU 3LH3A 5DPAA 1BTXA 3RXFA 4K1TA 4Y7AA 4O9VA 3N7OA 1OOKB 2VWMA 3ZZBA 6LPRA 4NIVA 1BCUH 5HM2A 2I6QA 3A86A 2NU0E 3OYPA 1AZZA 3RXRA 3A7TA 1AE8H 1O3EA 1ZJKA 2BD2A 1LVYA 3Q00A 2VIOA 4TWWA