1VCPA

Semliki forest virus capsid protein (crystal form i)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
CIFEVKHEGKVTGYACLVGDKVMKPAHVKGVIDNADLAKLAFKKSSKYDLECAQIPVHMRSDASKYTHEKPEGHYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFDNKGRVVAIVLGGANEGSRTALSVVTWNKDMVTRVTPEGSEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEMLIKI FOREST VIRUS CAPSID PROTEIN
publication title Structure of Semliki Forest virus core protein.
pubmed doi rcsb
source organism Semliki forest virus
molecule tags Viral protein
total genus 33
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcpA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcpA01
2A0QB 1EATA 1MBQA 3PLPA 1BRCE 4JZEH 4B74A 2WPMS 1MD7A 2OTVA 4NG9H 4CBNA 3STIA 4ABFA 5L6NH 7ESTE 1YM0A 2XC5A 1J14A 2ZC9H 1QB9A 1SGFA 3AASA 1SOZA 5DP4A 1O2UA 1W13U 1GJ4H 1TGBA 1G2MA 4MPWA 2V3OH 1O3AA 5ETXA 2SNWA 3D62A 4A7IB 4AOQA 1CA8B 1GVKB 1L4ZA 3FZZA 1ZPCA 4YOGA 4GHTA 1ELBA 1TA2A 1AUTC 2F9NA 2A7HA 2F9PA 1Z6EA 5FPSA 2C93B 2ZFPH 4Y8XA 1O5BB 4BAQB 3LGUA 3P92A 4MDSA 3LC3A 2SGEE 4IN1A 2F9OA 1GHXH 1V2QT 4MNYA 5EQRA 1YPMH 1V2PT 2VWLA 3PMBB 1B0EA 2BQ7B 3ESTA 4H4FA 1T7CA 5DP6A 2H5CA 3N7OA 2BOKA 4NA9H 1O2ZA 1KXFA 1XUFA 5DKMA 1Q3XA 1GDUA 1SBWA 1JIMA 4GPGA 4D7FA 1MH0A 5A09A 1O2NA 4HGCA 3ZZCA 1V2OT 3BEFB 1SGFG 1O2MA 3UWIA 2BXUH 1UMAH 2XC0A 1PPCE 1JMOH 1TOMH 2CV3A 2OLGA 3QN7A 1EPTC 4JYTA 3SV7A 2BY8X 1L2EA 2ZTZA 1SHYA 3GYMA 1O5AB 2JETB 1SQTA 4WMFA 3T25A 1RXPA 2TGTA 2H9HA 4K5ZA 4O03A 4BTIB 2QIQA 2OQ5A 1C9TA 2TIOA 4NZQA 9LPRA 1LHFH 2J94A 1OSSA 2G81E 1J9CH 3M5LA 3RXEA 1F2SE 1VCPA 1TNJA 3VB7A 2XCNA 1AO5A 2GZ7A 4BAOB 3GY3A 3SV2H 1FXYA 1YPHE 3KQCA 1NS3A 3R0FA 2PKSB 5DP3A 1V2NT 3V3MA 1MTNC 2TGPZ 1A3BH 1KYNA 1Y3YA 1O35A 3QZQA 1UTLM 2FI3E 4CRGA 3RXKA 3BG8A 1A4WH 1UTNA 1Y3WA 3RXVA 4DG4A 3F1SB 3KIDU 2Q6DA 3A84A 1SG8B 2FOBA 2PSYA 1MQ5A 1GCTB 3TK9A 4AG2A 3PWCA 2VNTA 1GMHG 3T26A 1FN8A 1CHGA 1TBQH 1C5QA 1EP5A 4X8SH 3RXGA 4DW2U 2J34A 3E0NB 1Y8TA 1ARCA 1GBAA 4TPIZ 1Y3XA 1AKSA 1MTUA 4YESB 4Y71A 2UWOA 2TBSA 3K6YA 4B76A 5FBIA 3ZZAA 1C2GA 1WV7H 1P01A 3PB1E 4JYUH 3RXBA 3ZZ9A 2G4TA 4NZLA 5DP5A 3BEIB 1FN6A 2I6SA 2ZCHP 3D65E 1MTSA 5H4IB 2YNBA 2C90B 1OKXA 3SOSA 1NRRH 1HJ8A 4JZDH 1ZSJA 1GI0A 1CU1A 2FOHA 1YKTA 4SGBE 5E8EH 2D2DA 4INKA 3BTGE 1FIZA 5FPYA 1RFNA 1C5WB 2FTLE 2QGRA 4DOQA 1P09A 2BZ6H 1F5RA 1HAGE 3S7KB 4X8TH 2BDIA 4CHAB 1GCDA 3RU4E 4RN6A 1NFUA 1SLUB 4HFPB 1JIRA 3MOCA 1C1UH 3RP2A 3U98H 3ZVDA 3TH4H 3RXFA 1NU9A 3BTHE 3KQDA 2HNTE 4IMQA 3ZZ7A 1TPPA 3FP7E 2O8TA 2FWWA 1FMGA 3NKKA 3PMHB 1D4PB 1UVUH 3TJUA 3MO3A 4WF8A 4BXSA 5LPRA 2GP9B 2GV7A 3V13A 2QAAA 1EB2A 2BDBA 1BTHH 3MH4A 3T62A 1TX6A 1XUGA 1T8OA 4UD9H 1UVPA 2OP9A 1CO7E 4BAHB 4CBOA 3GDVA 4Q80A 2Z9JA 3LPRA 2Z6BD 1EZQA 3A7TA 4ZMAH 1SI5H 3SJ9A 3MFJA 2VIQA 3I29A 1N6XA 1LVBA 3FANA 4ISNA 2GTBA 3PTNA 3MU8A 5AVDA 4YO9A 2JETC 3A89A 4ZHAA 2Z3EA 1O5DH 1QY6A 2A7JA 1GJ8B 8LPRA 2EA3A 1ELVA 2EI8A 1HAZB 2G5NA 4UFFH 2FZZA 3P70B 1FDPA 4K60A 3ENSB 1F92A 2FTMA 2VU8E 2AS9A 1IQIA 1KSNA 1A5IA 2FYRA 1P06A 5EQQA 1ARBA 1DFPA 4HI3A 2OXSA 2QA9E 2ZDAH 4IGDA 1FLEE 2VINA 2HPQH 2PKSC 1P2OA 3TNTA 1Z1IA 2BOHB 3A80A 1MKWK 2ZU3A 5DP7A 5GJ4B 3BSQA 2Y7ZA 2ZDKA 1ZRKA 2V35A 1DXWA 1YCPK 1EJMA 1HAYB 2Z3CA 3F6UH 5C1YA 1V2KT 3RXIA 1P04A 2QY0B 5A2MH 1EPTA 1BRBE 1CGIE 1VGCB 1TRYA 4A1TA 1DWCH 1GCTC 5C5NA 4Y7AA 1TIOA 1GHBF 1LDTT 3VPKA 3VB6A 4AFSA 3R3GB 3TH3H 3OY5U 1J8AA 1QIXB 1HIAA 1KXCA 2NU3E 2ZHFH 3LDXH 1C1MA 2SGAA 1HV7A 1MMJN 2WYJA 2ZGJA 4I8HA 2BY6X 1ESTA 2UWPA 1GBJA 1BQYA 4OS5A 3T5FH 2FI5E 3QTOH 4GAWA 2G5VA 1NO9H 1OOKB 1UHBA 5GIBA 5JDUB 3Q3YA 2VVUA 1QGFA 2IPHA 2ZEBA 2JH6D 3RXJA 3TK5A 3JZ2B 2A2QH 2BLOA 2TGAA 2W26A 3D23A 1V6DA 1NRNH 1WSSH 2XRCA 1DUAA 1HXEH 1K21H 5F03A 3LT3A 2VGCC 1O34A 2H6MA 3VGCB 4XOJA 1UK2A 4XBCA 3GCNA 4UEHH 1AB9B 2OC7A 2RA3A 4OS4A 2WV4A 1C5LH 4A5TS 2Y82A 3UIRA 2AERH 2HVXA 1O2OA 5L2ZH 4UFDH 3ELAH 2PR3A 3A86A 1WAYB 4CHAC 3OTJE 1RD3B 1S84A 3UQVA 2ZQ2A 1Z71A 2PHBA 4JK5A 1PPHE 1F5LA 1P12E 1RRKA 1AFEH 1TOCB 2GX4A 1G37A 2EI6A 3FP6E 2Q6FA 1ZZZA 1C5UA 1W11U 4ABBA 5JPMH 1GBEA 1GBTA 3DA9B 3SBKA 1ELTA 1H9HE 2VWNA 5EXMA 4LOYH 2QN5T 5JB8S 3ZVAA 1ESAA 3E16B 4FUCA 1ELGA 1P05A 3RLWH 1DICA 3ZYEA 1K2I1 1IQJA 1EKBB 1GBCA 2PWXA 1S85A 1UCYH 2V6NA 3AVZA 4NSYA 1GJ7B 1NPMA 3PTBA 3RXLA 2XBVA 2A4GA 3LKWA 4RKJB 3MU5A 2Q1JA 2OC0A 1HRTH 2D8WA 3E3TA 4IC5A 2G8TA 1K9OE 1TPAE 1HGTH 2BDCA 5HXFA 5EXLA 3MO6A 1O3OA 1MU6B 2FOCA 3UOPA 2BDGA 1MCTA 2HWLB 2UWLA 3UNQA 3ZZ5A 4B75A 1BTPA 3U9AH 1THSH 3SJKA 1S83A 1Z8IB 3SUGA 4FU9A 4WH6A 1P2NA 2AH4X 5AHGH 1G3BA 4AFZA 1DOJA 2KAIB 2Y5FA 1C2KA 3BEUA 3GCTF 2VIDA 1O2RA 1K1IA 2RA0A 1Z8RA 3UWJH 5L2YH 6GCHF 1LTOA 3W95A 1HFDA 2XNIA 1INCA 4Y79A 1VGCC 3KGPA 2V3HH 4K2YA 3U8RH 1TGSZ 1WQSA 2AFQB 2R9PA 4YTAA 3PMJA 4Y0ZE 1ELDE 4XBDA 5EXNA 4ABJA 2FO9A 5F8TA 6ESTA 1C2FA 4I32A 5HMAA 1NTPA 3RXAA 1E36B 4ZXXH 1QTFA 3A88A 2P93A 5TJXA 3K2UA 1P02A 2PLXA 2DUCA 1TBRH 2GKVE 3E8LA 3SU2A 1O3EA 2Z3DA 3A85A 1AMHA 3F68H 1IHTH 3L3TA 1AQ7A 1V2WT 4DIIH 1C5TA 4FUIA 3QUMP 2BXTH 1TPSA 2ZU4A 1L0ZA 1G32B 1DY8A 1MZDA 2ANMH 1P2QA 2AMPA 3VXFH 2F9VA 4ISHH 1O5GH 2SGFE 2HNTF 3VGCC 8GCHG 5K0HA 1EB1H 3DFJA 4YT6H 1CA0B 3A7WA 4QT8C 2ESTE 3EYDA 1TX7A 4UDWH 2CGAA 1AB9C 1HB0B 1KIGH 4I31A 4FVBA 2GV6A 4OS7A 1DY9A 3MNCA 1PPEE 1VJAU 4D9RA 1W7GH 3RMNH 3SU6A 5LGOA 1XKBC 4NIXA 1BRUP 2B8OH 3LGYA 1GI5A 1QFKH 3SI3H 2BD7A 1ABIH 1GPZA 5EW1H 3GY7A 1G3CA 1O5EH 1C2LA 1C1WH 8ESTE 5CMXH 1P9UA 1C1VH 7GCHF 1PPZA 1DUEA 1ELFA 4AG1A 4LZ4B 2OQUA 4ESTE 1KTSB 3SHCH 4X1RU 3M35A 1ZPBA 2BVSH 1TNLA 4FU7A 3RC5A 1BBRH 5EPYA 2VH0A 1AIXH 2AIQA 3LGVA 1QR3E 3O8DA 1UTOA 5DG6A 3RC6A 4K8YA 3RXOA 1O2YA 1ELAA 4X2VA 2ZDMA 2FOMB 1FY4A 1GDNA 2Y5GA 5FAHA 4FUHA 2IN2A 1V2ST 3IG6B 1V2UT 3RXSA 1H8IH 3F9HA 1O3IA 5JB9S 1YPHC 1EJAA 1P3CA 1PFXC 1HYLA 5E2OA 3T28A 1QCPA 3SZNA 3NXPA 3PLKA 3MU4A 2BDAA 3MYWA 1VJ9U 5DJ7A 1NY22 1C5NH 2ZGHA 3NK8A 1GHZA 1DSTA 1YP9A 2A5KA 2WPKS 3MU1A 1ZR0A 1SGDE 3RMMH 5LPEA 2PGBB 2PKAB 3DUXH 1C4Y2 1D6WA 3M36A 2C8XB 4D8NA 1PYTC 3RLYH 5GWZA 2D26C 1L4DA 2VH6A 4MLFB 1T8NA 1CVWH 5E0JA 1D3QB 1KTTB 1S0RA 4X6OA 2A2XH 5EOKA 1TMTH 5AF9H 2C8YB 5EG4A 4Y76A 5HM9A 1SSXA 2ALVA 3LU9B 1HLTH 1GHAF 1GL0E 1NU7B 3HKIB 2A4QA 2J9NA 1VITF 3ATKA 1C2IA 3SORA 1FPCH 1A61H 1XX9A 3A87A 5SGAE 3S9CA 1YYY1 3KQBA 4CH2B 3T29A 1IQMA 3LH3A 1LO6A 4RKOB 5T6FA 3DHKH 4NCYA 3UFAA 3M3TA 4WXIA 1YBWA 2ZCKP 4R8TB 2C8WB 1ZMLA 2WINI 4IW4E 5LPFA 1TQ7B 1N8OB 4K3JA 1U6QA 3HPTB 3E0PB 5E0GA 2Z9KA 3ZZBA 3ATIA 2P95A 5HYOA 1ACBE 3FZDA 1NFYA 3LGWA 2OBOA 4FUBA 3A7VA 1FQ3A 3A8AA 1HAXB 1PPFE 2A7CA 3CP7A 1IQHA 1EXFA 1H8DH 3TH2H 3VFEA 2UUKB 1OWIA 1X7AC 4HZHA 4ABDA 1GHWH 1PQ8A 2R3YA 4ZROA 3A82A 3K9XB 3P95A 3TIUA 3OY6U 5J4QA 3LJJA 3Q3XA 1HAVB 4DT7B 3UREA 3QGJA 1HAOH 1SL3A 2XCFA 2FEQH 1UJ1A 1E38B 3EQ0H 4WWYA 1A3EH 1CA0C 1MZAA 7LPRA 1P57B 1TNHA 3NZIA 1SHHB 1TGTA 3SJOA 4B2AA 4AN7A 1QJ6B 4B1TA 1NRSH 5C3NA 5FHTA 2FM2A 1UK3A 1P9SA 1P8VC 4NA7A 1VZQH 2QV1A 4Z0KA 3O8BA 4GSOA 4X8VH 1A0HB 1JWTA 2YOLA 1XUKA 4Y7BA 3QTVH 1AUJA 3BF6H 3RXQA 4O3TA 1SVPA 1GBMA 4CRCA 1G30B 3M5MA 3SU3A 2ZHEH 4Q7XA 4Y10E 2YNAA 4Q7YA 1NRQH 3B8JA 5GPIB 1Z8JB 4J2YB 2GT7A 1NROH 1W14U 1K1NA 2FOFA 3IWMA 4CRFA 1MD8A 2B7DH 1XM1A 4OS6A 4ABIA 2ZKSA 6CHAB 1BDAA 4MNVA 1DITH 5F6MA 4B73A 3BG4B 5GCHG 4A1XA 1GMCG 1BCUH 4X2XA 2BX4A 1YPGH 1GHBG 3U69H 3TLOA 1O31A 4I8GA 4FUJA 4NFFA 1SQAA 4JZ1A 1PPGE 1A7SA 1IQFA 1O3GA 2P8OB 2FI4E 1K28D 1HXFH 1ZHMA 1EAWA 1AHTH 2VGCB 3SW2B 4O9VA 4AGKA 5I25A 1C1TA 1ETRH 1G9IE 2ZU1A 2BB4A 3MH6A 3KEEA 1O2JA 2PFEA 1LKAA 3EE0B 4FU8A 1PJPA 3STJA 2TPIZ 4DVAU 1A0JA 2ZFFH 2CJIA 2ASUB 2ZDNA 3PM3A 1GMDG 2GD4B 1FONA 1PPBH 1PQ7A 4OS2A 1QJ7B 1ORFA 1VCWA 1EZUC 4THNH 1XUHA 3RUOA 2FXRA 4K1EA 4X1PU 1E0FD 4X6NA 1LMWB 4ABEA 4E7NA 1K1LA 3MTYA 1TRMA 1DXPA 1S81A 1LCYA 3QX5H 1O30A 3MU0A 1HAPH 2BVRH 2O9QA 3HATH 1JXPA 2K1QA 1LHGH 1WYKA 3A8BA 1GGDB 2PSXA 1N8OC 1EAIA 3V7TA 1XXFA 2H9EH 1FY1A 1ZRBA 1OP0A 1QL7A 1S6FA 5DK1A 2F3CE 3BTME 2C3SA 4LK4A 8KME2 1V2VT 1C2DA 4K69A 3T27A 4MPUA 3O8CA 2RG3A 1NC6A 4WVPE 5J4SA 2FLBH 3H5CB 4MVNA 2KAIA 2H1UA 3A8CA 2Y5HA 1K1PA 1QRWA 1FY8E 2XBWA 4U32A 1QURH 4BNRA 4BAMB 2FODA 1AI8H 2ULLA 3SNEA 3E1XB 3TITA 2XWBI 2WPLS 1GI8B 5IYTA 3FVFB 4B2CA 3BN9A 2BQWB 3MMGA 2A5IA 1EP6A 1ETTH 3PO1B 2AGEX 4Y0YE 3ZZ3A 4WMEA 4X8UH 1EUFA 4GCHF 3LC5A 1Z6JH 2ZPRA 1YC0A 1YPKH 4X2YA 3TGJE 2GDEH 2J2UA 5GDSH 3QZRA 4UFEH 2FYQA 3EA8A 6LPRA 1J15A 3EA9A 3PLBA 1GJ9B 2A31A 2VVCA 2Y6TA 1MAXA 1GBFA 3UY9A 3U8OH 4XDEA 1QBVH 4ZH8A 4H42U 5FCKA 1GMHF 1LVOA 3S0NA 3VEQB 1OS8A 2V0BA 1D3TB 1P2IA 1GI1A 1Y5UT 1G2LA 4X1QU 4SGAE 1AZ8A 1ANBA 6CHAC 3BTEE 1XUIA 2GMTB 1LHCH 3SQHE 1HDTH 1SGTA 2BDYA 3BG4C 1SLXB 1GBKA 4A1VA 4I8JA 1SGEE 4AB8A 3UPEA 3EAJA 1P2JA 1DPOA 2R3UA 1A46H 2AMDA 1SGNE 3SV6A 2PUXB 1H9LB 2FOEA 1SQOA 4K8BA 1O3DA 2W3KA 3CS7A 1BHXF 1T4UH 4GVUA 2Y7XA 1BHXB 2P8OC 1BB0B 2BMGB 1MKWH 1DWBH 2F91A 2H5DA 3TNSA 2OC8A 1QA7A 1IQKA 3RC4A 2Z9GA 3SU1A 3RXRA 1YCPH 1H1BA 4BTUB 1QRXA 1QL9A 2P3TB 3IITA 2A4RA 2VIPA 1ZGVA 1T31A 1OWKA 2LPRA 2G51A 2BD2A 1TPOA 1UTMA 1BA8B 4MPXA 1C2EA 1O39A 1C1NA 1TYNA 3ZZDA 4JK6A 1S0QA 3UR9A 1HAIH 2FS9A 3U1IB 1OWJA 1SR5C 3ZVGA 2JH0D 2XYAA 2Z7FE 3UTUH 2CF9H 3BTKE 1EJNA 2GGVB 1DLEA 1DX5M 2GZ8A 1EOJA 5FXLA 2XC4A 1O3KA 3M3VA 2VJ1A 1GBHA 1EX3A 1PYTD 3P17H 3RXUA 5K7RA 3GDUA 4CRDA 1QQUA 1GGDC 1D9IA 1ANDA 1O2VA 2GCHG 1W3CA 3PROA 3ATLA 1SGIB 1O3CA 2VWMA 4DIHH 2VB0A 1CHOG 1O3FA 3U1JB 3Q77A 2EI7A 2PKAA 2ZP0H 1EQ9A 2R0LA 2WUBA 3ZVBA 1FZZA 1WUNH 1Y5BT 4WMDA 4AYVB 4YLUA 4R0IA 1UTQA 4K1TA 2IJOB 2XTTB 4TYDA 1ANEA 3SJ8A 1TNKA 1QB1A 1AY6H 1NN6A 1A5GH 1T8LA 2W7UA 1TLDA 1LHDH 1O2KA 3BV9B 1LKBA 1GVZA 1YCPM 3PO1C 4ASHA 2F9UA 4WJG2 2BD4A 3F9EA 3LOXA 3BTDE 5C20A 3QGNB 4KTSA 2PUQH 2FX6A 1HJ9A 1ELCA 3SGBE 2B9LA 1NFWA 1V2MT 2Z9LA 3KQEA 1KY9A 7KMEH 5L30H 1N1LA 4FUDA 1NT1A 2WYGA 3MH7A 1Z8GA 5JBAS 3P8FA 1QBOA 4ZHLU 1C9PA 2NU4E 2ZI2H 1OYTH 3UNSA 4D9QA 1W12U 2CHAB 3KF2A 4ZUHA 3RU4D 1GJCB 1KXEA 1PQAA 4M7GA 2PTCE 1B0FA 4K1SA 1AE8H 3ITIA 1Y3UA 1QRZA 1C1SA 1HNEE 1C5MD 3GDSA 4GHQA 2ZFRH 2CN0H 1HAVA 1Y5AT 3ZV9A 4B71A 3L6PA 2GMTC 2NU2E 3SU4A 5CE1A 5JBTA 4JZIA 2RDLA 1HAHH 3SV8A 2FESH 3I77A 3GOVB 2HOBA 3HGNA 4E06H 1C5VA 3MH5A 3EA7A 2TGDA 4IS5A 1SGYE 2ZFTA 1O2XA 5ESTE 1KDQB 1WTHD 4TWWA 2VIWA 2AMQA 3P8NA 3SGAE 2C4FH 1TNGA 3C27B 2PV9B 4O3UA 2W7SA 3SO3A 3SI4H 4BTTB 2OD3B 1AGJA 1K22H 1O5FH 1TB6H 2Y80A 3GY8A 5FX6A 3RM0H 2BDHA 4Q2KA 1UTPA 5A8YA 4J1YA 1MKXK 3M7UA 1EOLA 1BUIA 1DWDH 1B7XB 1GL1A 1H9IE 2ZU2A 4YM9A 1ZSLA 4NIVA 3ODFA 1Y3VA 1W0ZU 4FVDA 1E37B 2PTNA 2ZHWH 1C2MA 1LVMA 1FIWA 2QF0A 1SLWB 5DP8A 4XBBA 1A5HA 2WPIS 1DM4B 4ZKOU 2BVXH 1VR1H 2EEKA 2ZECA 3MNSA 1C5YB 4ABAA 1TALA 1ID5H 4NWLA 1BTXA 1CQQA 2ZDLA 2JH5D 4TWYA 3UNRA 4INHA 2AGGX 4DGJA 2O8MA 4IBLH 1KXDA 2SNVA 4CRBA 1ZTLA 1QJ1B 3BIUH 2ZIQH 4AYYB 4AFUA 2P59A 4FXGH 1V2TT 4ZHMU 2FX4A 2CXVA 3U8TH 5B6OA 1GI9B 1GI2A 1ZOMA 2I6QA 1HJAB 3F9FA 3RMLH 1V2JT 1RJXB 1ETSH 3AW0A 2G4UA 1ZMNA 1GJAB 1SGRE 4DURA 1DT2A 2A1DB 1UK4A 5A8XA 2ZDVH 2BZAA 3RXMA 1ZSKA 5ABWA 1AVXA 3HK3B 2ZCLP 1CGJE 2FMJA 3GY2A 1BTUA 1D3PB 2G55A 1JOUB 3V0XA 4D7GA 4KGAA 2SGPE 4OGYA 2G00A 3VB5A 2SGQE 1FAXA 3GY4A 2Q6GA 1EASA 3KL6A 1KXBA 1CE5A 3DFLA 4Z6AH 3ZV8A 3E90B 4FUGA 4LXBH 3MNBA 1P10A 2BLVA 2QC2A 1TAWA 1GJBB 5TCCA 1O37A 2CF8H 2ZG0H 5DP9A 1W10U 4VGCB 2B5TB 2XBXA 5FX5A 1IAUA 1UCYE 2BD8A 3MO9A 3RXCA 2STAE 3P8GA 3KNXA 1GVLA 2EC9H 1YPEH 5BPEA 1HUTH 1OWDA 1S5SA 2QF3A 4X1SU 2CHAC 4TY7A 3BTTE 3RM2H 2GCTB 1KLJH 1C1OA 3BTWE 3B23B 1RTFB 1O2IA 2FDAA 3RXTA 1MCVA 3A83A 4OGXA 2ZGBH 4YOJA 3TGKE 4H6SB 3TU7H 3S69A 2UUJB 1A0LA 2FLRH 3I78A 3SU5A 1EZXC 3TPIZ 4O97A 2ZTYA 2O8LA 3MHWU 2AYWA 2QXGA 2ZPSA 4X6MA 1CBWB 1K1OA 2ZHDA 4ZXYH 2AGIX 1GJDB 1T4VH 1RTKA 3H7TA 1ZMJA 4WH8A 1W8BH 2ZFSA 1O32A 1ZYOA 2ZZUH 3GICB 1JBUH 3SJIA 1O3HA 5ESBA 4NIYA 3KN2A 1UVTH 2ZGXH 1C1RA 1THRH 2OBQA 1IHSH 5A0BA 3NUMA 1LQDB 4OS1A 1C5ZB 4GLYA 8GCHF 1LHEH 1J16A 1ELEE 5T6GA 1GJ6A 1C2JA 2HNTC 4NWKA 2A45B 4AFQA 3LGTA 1TMBH 1NZQH 1BIOA 1L1GA 2ZWLH 2FP7B 1FI8A 2OINA 3SUEA 1Q31A 4CH8B 4E7RG 1CT2E 1IOEA 2WV5A 1GI4A 1ZJDA 2C8ZB 1ZHPA 3ZVFA 2DE8A 1QB6A 1MAYA 5DO4H 1GDQA 2QCYA 2J92A 3K65B 4Y11E 4AGJA 5CHAB 4JZFH 4ISLA 3QK1A 1ZHRA 2A4OA 3LONA 4TPYA 1EAUA 1PQ5A 1QL8A 3MWIU 3UQOA 1V2LT 4NA8A 1SOTA 2IOTA 3F9GA 1TNIA 3SNDA 4GCHG 3ZZ4A 4CR9A 5C1UA 1VITH 1P03A 4AX9H 4ISOA 2A5AA 2J4IA 4WY3A 3RMOH 1C4U2 1GBBA 4I7YH 2H9TH 3RU4T 1UVSH 2BD3A 1M9UA 4X0WU 1NM6A 3Q00A 1F0TA 2BLQA 2ILNA 1O2LA 2ZO3H 3PWBA 3RDZA 2W5EA 2GVFA 4BXWA 2HGTH 1THPB 2F83A 1HJAC 4KELA 2WUCA 1GBDA 1IQLA 1BOQA 3DT0H 4I8KA 2W3IA 1RGQA 2ZFQH 3SV9A 1HCGA 4MG3A 1NFXA 1C5SA 1DANH 1OWHA 2J38A 3WY8A 4F4OC 4IN2A 1WTGH 1GHVH 2CMYA 4U01A 1TX8A 3GCOA 3VB3A 2Z9IA 2BD9A 1DS2E 1YF4A 3RXHA 3S9BA 1ESBA 5EW2H 1NRPH 1BBRE 2FOAA 1IQNA 4ZKNU 1GBLA 1FUJA 1SFIA 3DD2H 1K1JA 1O38A 1XUJA 3BIVH 1IQEA 1A1RA 4MQAA 1F0RA 5A0CA 1CT0E 4VGCC 1XVMA 3PV4A 1DDJA 1N6YA 4YT7H 1CGHA 4MNXA 1FY3A 1AU8A 4KTUA 1O5CB 3E6PH 3FFGA 3EDXB 1FNIA 2GCTC 1FY5A 4KP0A 2AIPA 3GCHB 3PMAB 2QXIA 1AFQB 3QDZB 1XVOA 4DJZB 2FIRH 1W0YH 5FBEA 3UR6A 1L1JA 2BHGA 1F5KU 2F9BH 4NFEA 1OWEA 1ZPZA 3T2NA 3NWUA 1QHRB 1YPLH 2GT8A 2ZF0H 1OXGA 1ZTKA 3AW1A 4FUEA 1O2QA 4A92A 4INLA 1CBWC 3UOUA 1WCZA 2ANYA 4KKDA 3C1KA 3OSYA 2M5TA 3UUZA 3V12A 3P6ZB 1WBGB 4BANB 2R2MB 3O8RA 3SGQE 2VWOA 4ZKSU 2R2WU 2VIOA 2RCEA 3FP8E 1T8MA 1ZTJA 2JKHA 1AWFH 3AAVA 4PROA 1F7ZA 1GWAA 5GXPA 2ALPA 1DLKB 4KTCA 1O3JA 5E2PA 1OYQA 2BD5A 2PW8H 3E91A 1GI7B 1LPZB 5AFYH 1YPJH 1BTWA 1L1NA 1BT7A 1FAKH 9ESTA 2WPJS 1YLCA 1A2CH 1C1PA 1BTYA 5DPAA 1V3XA 2BTCE 2ZHQH 1GG6B 3RXPA 4CREA 1XXDA 1P0SH 2P94A 1H4WA 5T6DA 5LH8A 1QQ4A 1EZSC 5FPTA 1W7XH 2GZ9A 4I33A 2ANKH 1RS0A 3MI4A 1XMNB 5G4BA 2XXLA 4WXVA 1OP8A 5CHAC 1TABE 1O2TA 2NU0E 1AVWA 1FJSA 1UTKA 3GISB 1C2HA 3SN8A 4ZAEA 2FOGA 5C2ZA 1BMAA 1KDQA 1SLVB 5EPNA 1D3DB 3GY6A 4BOHA 4U2WA 1ZLRA 2QYIA 2TRMA 3TJOA 2Z94A 1ZJKA 1Z1JA 1VCQA 3GCTG 1T32A 1AD8H 4XE4A 6GCHG 3EGKH 3A8DA 5GCHF 2P16A 3A81A 1GMCF 2HPPH 3L33A 3URDA 1UO6A 1RTLA 2DE9A 1BMMH 1CT4E 2STBE 5C67A 5DGJA 2ZU5A 2A32A 4X2WA 2O8UA 1AE5A 4NSVA 3QLPH 1F0UA 1O2HA 4HTCH 1LPKB 1C5OH 1TGNA 1RIWB 4AB9A 1WOFA 1KLTA 5PTPA 1B5GH 4Y6DA 1MTVA 1P2MA 2ANWA 3LH1A 5FCRA 3H7OA 1UTJA 2ZA5A 2BX3A 4FUFA 3RXDA 1CSOE 2XBYA 3MNXA 1TFXA 2D1JA 1MQ6A 3OYPA 3LIWA 1TRNA 1MUEB 3GY5A 1GBIA 1SB1H 1YGCH 2FS8A 1GMDF 4A6LA 3KCGH 4Y8ZA 1ZGIA 5TCAA 3HK6B 2VVVA 4D76A 4UONA 3QWCH 2ZPQA 1G3EA 1UCYK 2SFAA 1BMNH 1BRAA 3A7ZA 1AKSB 1SGCA 3GCHC 1AFQC 5JYIA 1O3NA 1TA6A 4Y8YA 3KHVA 5JBBS 1JRSA 3TGIE 1MBMA 2HLCA 3S9AA 1HBTH 5F8XA 1MU8B 3M5OA 1TQ0B 4RSPA 1Y59T 1DWEH 2BLWA 2ZQ1A 3SHAH 1SFQB 3ZZ8A 3FAOA 1AWHB 4GUXA 2SGDE 1JRTA 5HGGA 4MTBA 5IDKA 5I46H 2H2ZA 2AEIH 1E34B 2G52A 7GCHG 4YZUA 1Q2WA 1TE0A 4ISIH 1F0SA 1K1MA 4JCNA 1TBZH 2BM2A 1P3EA 1ABJH 3M7TA 4ABGA 3A7XA 3SU0A 3ZVCA 3Q3KA 4IC6A 3SNCA 2XW9A 1KLIH 1O36A 1LQEA 1BJUA 3BTFE 5C5OA 4UE7H 2NWNA 4U30A 3OU0A 1TWXB 3ATMA 4LZ1H 1TONA 3M3SA 1XKAC 1GI3A 4XFQA 3ZVEA 1GG6C 4IMZA 5F8ZA 3SUDA 2UUYA 1C5PA 3B9FH 4AZ2B 3ATWA 4CR5A 1V2RT 2BY7X 1SPJA 3TJNA 2ODPA 3M7QA 1BJVA 4H6TA 3ZZ6A 1LPGB 1O2SA 1TMUH 1C5XB 1QA0A 1WQVH 5T3HA 2BY5X 1BTZA 2BY9X 1DE7H 4BAKB 2BYAX 1O3PB 3M37A 1O3BA 3ODDA 1DSUA 2R0KA 2HALA 1G36A 2Y81A 4F49A 3URCA 5EODA 1BMLA 2P3UB 2FPZA 1D6RA 1S82A 2ODYB 2ZTXA 3GYLB 3W94A 1AVGH 5HM2A 1IQGA 2GDDA 1GHAG 1SC8U 4Q7ZA 1LVYA 2ZGCA 1VITG 1W2KH 5BRRE 1O33A 3SUFA 3SNAA 4AORA 1SMFE 3QO6A 1GHYH 1J17T 4JMYA 4NIWA 4TY6A 1BZXE 4NGAH 1Z7KA 1SGPE 3Q76A 4DCDA 2LNCA 3CS0A 1NESE 4ZKRU 1RIWC 3LJOA 1OPHB 1EAXA 2QXJA 1AN1E 5A8ZA 3K6ZA 1EPTB 1FV9A 2NU1E 3LGIA 1MTWA 3OX7U 1TGCA 1ANCA 2ZNKH 1BBRK 1BITA 2WPHS 5AFZH 1O3MA 1HIAB 4YLQH 5EGMA 3P8OA 3M61U 3NPSA 1AZZA 3CENA 3BTQE 1C4V2 1OP2A 1FPHH 1WU1A 4UFGH 2P3FH 4XSKU 1S6HA 3AAUA 3TK6A 1UHBB 1O0DH 3D49H 1QNJA 3VB4A 2BQ6B 1MTNB 1G3DA 3NCLA 3JZ1B 2O8WA 1QBNA 2GCHF 4MPVA 3PYHA 3TVJB 1KXAA 4B2BA 3HKJB 4DY7B 1P11E 2HRVA 2QXHA 2XWAA 3TJVA 1CHOF 1C1QA 4X6PA 1OX1A 2THFB 1HPGA 4I8LA 3HGPA 3SNBA 2PGQB 2B0FA 5A0AE 1GJ5H 4X1NU 4YOIA 1O3LA 2J95A 2OCVB 5C1XA 1UVOA 1O2GH 1MKXH 4E05H 5JBCS 1P2KA 1C5RA 3ZYDA 1DVAH 2ODQA 4CRAA 4JYVH 2VIVA 2OC1A 3A7YA 3S7HB 3VXEH 5E0HA 5EU8A 1O2WA 5EQSA 1O2PA 1SGQE 3G01A 1E35B 4MNWA 3M5NA 2OUAA 4ABHA 1GI6A 1YLDA 3SQEE 2UUFB
chains in the Genus database with same CATH superfamily
2A0QB 1EATA 1MBQA 3PLPA 1BRCE 4JZEH 4B74A 2WPMS 1MD7A 2OTVA 4NG9H 4CBNA 3STIA 4ABFA 5L6NH 1EFRD 7ESTE 1YM0A 2XC5A 1J14A 2ZC9H 1QB9A 2QF5A 1SGFA 3AASA 1SOZA 5DP4A 1O2UA 1W13U 1GJ4H 1TGBA 1G2MA 4MPWA 2V3OH 1O3AA 5ETXA 2SNWA 3D62A 4A7IB 4AOQA 1CA8B 1GVKB 1L4ZA 3FZZA 1ZPCA 4YOGA 4GHTA 3WW7A 1ELBA 1TA2A 3PRDA 1AUTC 2F9NA 2A7HA 2F9PA 1Z6EA 5FPSA 2C93B 2ZFPH 4Y8XA 3AK5A 1O5BB 4BAQB 3LGUA 3P92A 4MDSA 3LC3A 2SGEE 4IN1A 2F9OA 1GHXH 1V2QT 4MNYA 5EQRA 1YPMH 1V2PT 2VWLA 3PMBB 1B0EA 2BQ7B 3ESTA 4H4FA 5CHBA 1T7CA 5DP6A 2H5CA 3N7OA 2BOKA 4NA9H 1O2ZA 1KXFA 1XUFA 5DKMA 1Q3XA 1GDUA 1SBWA 1JIMA 4GPGA 4D7FA 1MH0A 5A09A 1O2NA 4HGCA 3ZZCA 1V2OT 3SYJA 3BEFB 1SGFG 1O2MA 3UWIA 2BXUH 2KCOA 1UMAH 2XC0A 1PPCE 1JMOH 1TOMH 2CV3A 2OLGA 3QN7A 1EPTC 4JYTA 3SV7A 2BY8X 1L2EA 2ZTZA 1SHYA 3GYMA 1O5AB 2JETB 1SQTA 4WMFA 3T25A 1RXPA 2TGTA 2H9HA 4K5ZA 4O03A 4BTIB 2QIQA 2OQ5A 1C9TA 2TIOA 4NZQA 9LPRA 1LHFH 2J94A 1OSSA 2G81E 1J9CH 3M5LA 3RXEA 1F2SE 1VCPA 1TNJA 3VB7A 2XCNA 1AO5A 2GZ7A 4BAOB 3GY3A 3SV2H 1FXYA 1YPHE 3KQCA 1NS3A 3R0FA 2PKSB 5DP3A 1V2NT 3V3MA 1MTNC 2TGPZ 1A3BH 1KYNA 1Y3YA 1O35A 3QZQA 1UTLM 2FI3E 2OK5A 4CRGA 3RXKA 3BG8A 1A4WH 1UTNA 1W0KD 1Y3WA 3RXVA 4DG4A 3F1SB 3KIDU 2Q6DA 3A84A 1SG8B 2FOBA 2PSYA 1MQ5A 1GCTB 3TK9A 4AG2A 3PWCA 2VNTA 1GMHG 3T26A 1FN8A 1CHGA 1TBQH 1C5QA 1EP5A 4X8SH 3RXGA 4DW2U 2J34A 3E0NB 1Y8TA 4HG6A 3UB0A 1ARCA 1GBAA 4TPIZ 2W6ID 1Y3XA 1AKSA 3F0PA 1MTUA 4YESB 4Y71A 2UWOA 2TBSA 3K6YA 2JJ2D 4B76A 5FBIA 3ZZAA 1C2GA 1WV7H 2KM0A 1P01A 3PB1E 4JYUH 3RXBA 3ZZ9A 2G4TA 4NZLA 5DP5A 3BEIB 1FN6A 2I6SA 2ZCHP 3D65E 1MTSA 5H4IB 2YNBA 2C90B 1OKXA 3SOSA 1NRRH 1HJ8A 4JZDH 1ZSJA 1GI0A 1CU1A 2FOHA 1YKTA 4SGBE 5E8EH 2D2DA 4INKA 3BTGE 1FIZA 5FPYA 1RFNA 1C5WB 2FTLE 2QGRA 4DOQA 1P09A 2BZ6H 1F5RA 1HAGE 5FL7D 3S7KB 4X8TH 2BDIA 4CHAB 1GCDA 3RU4E 4RN6A 1NFUA 1SLUB 4HFPB 1JIRA 3MOCA 1C1UH 3RP2A 3U98H 3ZVDA 3TH4H 3RXFA 1NU9A 3BTHE 3KQDA 4AC9A 2HNTE 4IMQA 3ZZ7A 1TPPA 3FP7E 2O8TA 2FWWA 1FMGA 3NKKA 3PMHB 1D4PB 1UVUH 3TJUA 3MO3A 4WF8A 4BXSA 5LPRA 2GP9B 2GV7A 4XD7D 3V13A 2QAAA 1EB2A 2BDBA 1BTHH 3MH4A 3T62A 1TX6A 3FO8D 1XUGA 1T8OA 4UD9H 1UVPA 2OP9A 1CO7E 4BAHB 4CBOA 3GDVA 4Q80A 2Z9JA 3LPRA 2Z6BD 1EZQA 3A7TA 4ZMAH 1SI5H 3SJ9A 3MFJA 2VIQA 3I29A 1N6XA 1LVBA 3FANA 4ISNA 2GTBA 3PTNA 3MU8A 5AVDA 4YO9A 2JETC 3A89A 4ZHAA 2Z3EA 1O5DH 1QY6A 2A7JA 1GJ8B 8LPRA 2EA3A 1ELVA 2EI8A 1HAZB 2G5NA 4UFFH 2FZZA 3P70B 1FDPA 4K60A 3ENSB 3VG8A 1F92A 2FTMA 2XOKD 2VU8E 2AS9A 1IQIA 1KSNA 1A5IA 2FYRA 1P06A 5EQQA 1ARBA 1DFPA 4HI3A 2OXSA 2QA9E 2ZDAH 4IGDA 1FLEE 2VINA 2HPQH 2PKSC 1P2OA 3TNTA 1Z1IA 2BOHB 3A80A 4ASUD 1MKWK 2ZU3A 5DP7A 5T1VA 5GJ4B 3BSQA 2Y7ZA 2ZDKA 1ZRKA 2V35A 1DXWA 1YCPK 1EJMA 1HAYB 2Z3CA 3F6UH 5C1YA 1V2KT 3RXIA 1P04A 2QY0B 5A2MH 1EPTA 1BRBE 1CGIE 1VGCB 1TRYA 4A1TA 1DWCH 1GCTC 5C5NA 4Y7AA 1TIOA 1GHBF 1LDTT 4ACAA 3VPKA 3VB6A 4AFSA 3R3GB 3TH3H 3OY5U 1J8AA 5C0TA 1QIXB 1HIAA 1KXCA 2NU3E 2ZHFH 3LDXH 1C1MA 2SGAA 1HV7A 1MMJN 1E1QD 2WYJA 2ZGJA 4I8HA 2BY6X 5EJLA 1ESTA 2UWPA 1GBJA 1BQYA 4OS5A 3T5FH 2FI5E 3QTOH 4GAWA 2G5VA 1NO9H 1OOKB 1UHBA 5GIBA 5JDUB 3Q3YA 2VVUA 1QGFA 2IPHA 2ZEBA 2JH6D 3RXJA 3TK5A 3JZ2B 2A2QH 2BLOA 2TGAA 2W26A 3D23A 1V6DA 3PRBA 1NRNH 1WSSH 2XRCA 1DUAA 1HXEH 1K21H 5F03A 3LT3A 2VGCC 1O34A 2H6MA 3VGCB 4XOJA 1SKYE 1UK2A 4XBCA 3GCNA 4UEHH 1AB9B 2OC7A 2RA3A 4OS4A 2WV4A 1C5LH 4A5TS 2Y82A 3UIRA 2AERH 2HVXA 1O2OA 5L2ZH 4UFDH 3ELAH 2PR3A 3A86A 1WAYB 4CHAC 3OTJE 1RD3B 4ZCNA 1S84A 3UQVA 2ZQ2A 1Z71A 2PHBA 4JK5A 1PPHE 5HKKD 1F5LA 1P12E 1RRKA 1AFEH 1TOCB 2GX4A 1G37A 2EI6A 3FP6E 2Q6FA 1ZZZA 1C5UA 1W11U 4ABBA 5JPMH 1GBEA 1GBTA 3DA9B 3SBKA 1ELTA 1H9HE 2VWNA 2F43B 4LOYH 2QN5T 5EXMA 5JB8S 3ZVAA 1ESAA 1YWUA 3E16B 4FUCA 1ELGA 1P05A 3RLWH 1DICA 3ZYEA 5GNDA 1K2I1 1IQJA 1EKBB 1GBCA 2PWXA 1S85A 1UCYH 2V6NA 3AVZA 4NSYA 1GJ7B 1NPMA 3PTBA 3RXLA 2XBVA 2A4GA 3LKWA 4RKJB 3MU5A 2Q1JA 2OC0A 1HRTH 2D8WA 3E3TA 4IC5A 2G8TA 1K9OE 1TPAE 1HGTH 2BDCA 5HXFA 5EXLA 3MO6A 1O3OA 1MU6B 2FOCA 3UOPA 2BDGA 1MCTA 1S6LA 2HWLB 2UWLA 3UNQA 3ZZ5A 4B75A 1BTPA 3U9AH 1THSH 3SJKA 1S83A 1Z8IB 3SUGA 4FU9A 4WH6A 1P2NA 2AH4X 5AHGH 1G3BA 4AFZA 1DOJA 2KAIB 2Y5FA 1C2KA 3BEUA 3GCTF 2VIDA 1O2RA 1K1IA 2RA0A 1Z8RA 3UWJH 5L2YH 6GCHF 2QF4A 1LTOA 3W95A 1HFDA 2XNIA 1INCA 4Y79A 1VGCC 3KQ5A 2IPQX 2V3HH 3KGPA 4K2YA 1TGSZ 3U8RH 1WQSA 2AFQB 2M2AA 2R9PA 4YTAA 3PMJA 2IJD1 4Y0ZE 1ELDE 4XBDA 5EXNA 1NBMD 4ABJA 2FO9A 5F8TA 6ESTA 1C2FA 4I32A 5HMAA 1NTPA 3RXAA 1E36B 3KYFA 4ZXXH 1QTFA 3A88A 2P93A 5TJXA 3K2UA 1P02A 2PLXA 2KR7A 2DUCA 1TBRH 2WHXA 2GKVE 3E8LA 3SU2A 1O3EA 2Z3DA 3A85A 1AMHA 3F68H 1IHTH 3L3TA 1AQ7A 1V2WT 3F2FA 2KFWA 4DIIH 1C5TA 4FUIA 3OFND 3QUMP 2BXTH 1TPSA 2ZU4A 3MQKC 1L0ZA 1G32B 1DY8A 1MZDA 2ANMH 1P2QA 2AMPA 3VXFH 2F9VA 4ISHH 1O5GH 2SGFE 2HNTF 3VGCC 8GCHG 5K0HA 1EB1H 3DFJA 4YT6H 1CA0B 3A7WA 4QT8C 2ESTE 3EYDA 1TX7A 4UDWH 2CGAA 1AB9C 1HB0B 1KIGH 4I31A 4FVBA 2GV6A 4OS7A 1DY9A 3MNCA 1PPEE 1VJAU 4D9RA 1W7GH 3RMNH 3SU6A 5LGOA 1XKBC 4NIXA 3DSGA 1BRUP 2B8OH 3LGYA 1GI5A 1QFKH 3SI3H 2BD7A 1ABIH 1GPZA 5EW1H 3GY7A 1G3CA 1O5EH 1C2LA 1C1WH 8ESTE 5CMXH 1P9UA 1C1VH 7GCHF 1PPZA 1DUEA 1ELFA 4AG1A 4LZ4B 2OQUA 4ESTE 1KTSB 3SHCH 4X1RU 3M35A 1ZPBA 2BVSH 1TNLA 4FU7A 3RC5A 1BBRH 5EPYA 2VH0A 1AIXH 2AIQA 3LGVA 1QR3E 3O8DA 1UTOA 5DG6A 3RC6A 4K8YA 3RXOA 1O2YA 1ELAA 4X2VA 2ZDMA 2FOMB 1FY4A 1GDNA 2Y5GA 5FAHA 4FUHA 2IN2A 2J5UA 1V2ST 3IG6B 1V2UT 3RXSA 1H8IH 3F9HA 1O3IA 2J98B 5JB9S 1YPHC 1EJAA 1P3CA 1PFXC 3OTPA 1HYLA 5F53A 5E2OA 3T28A 1QCPA 2HLDD 3SZNA 3NXPA 3PLKA 3MU4A 2BDAA 3MYWA 1VJ9U 5DJ7A 1NY22 2K8IA 1C5NH 2ZGHA 3NK8A 1GHZA 1DSTA 1YP9A 2A5KA 2WPKS 3MU1A 1ZR0A 1SGDE 3RMMH 5LPEA 2PGBB 2PKAB 3DUXH 1C4Y2 1D6WA 3M36A 2C8XB 4D8NA 1PYTC 3RLYH 5GWZA 2D26C 1L4DA 2JJ1D 2VH6A 4MLFB 1T8NA 1CVWH 5E0JA 1D3QB 1KTTB 1S0RA 5DN6D 4X6OA 2A2XH 5EOKA 1TMTH 5AF9H 2C8YB 5EG4A 4Y76A 5HM9A 1SSXA 2ALVA 3LU9B 1HLTH 1GHAF 1GL0E 1NU7B 3HKIB 2A4QA 2J9NA 1VITF 3ATKA 1C2IA 3SORA 1FPCH 1A61H 1XX9A 3A87A 5SGAE 3S9CA 1YYY1 3KQBA 4CH2B 3T29A 1IQMA 3LH3A 1LO6A 4RKOB 5T6FA 3DHKH 4NCYA 3UFAA 2WV9A 3M3TA 3F3BA 4WXIA 1YBWA 2ZCKP 4R8TB 2C8WB 1ZMLA 2WINI 4IW4E 5LPFA 1TQ7B 1N8OB 4K3JA 1U6QA 3HPTB 3E0PB 5E0GA 2Z9KA 3ZZBA 3ATIA 2P95A 5HYOA 1ACBE 3FZDA 1NFYA 3LGWA 2OBOA 4FUBA 3A7VA 1FQ3A 3A8AA 1HAXB 3U28C 1PPFE 2A7CA 1WXRA 3CP7A 1IQHA 1EXFA 4P02A 1H8DH 2LP6A 3TH2H 3VFEA 2UUKB 1OWIA 1X7AC 4HZHA 4ABDA 1GHWH 1PQ8A 2R3YA 4ZROA 3A82A 3K9XB 3P95A 3TIUA 3OY6U 5J4QA 3LJJA 3Q3XA 1HAVB 4DT7B 3UREA 3QGJA 1HAOH 1SL3A 2XCFA 2FEQH 1UJ1A 1E38B 3EQ0H 3N7EA 2VBCA 4WWYA 1A3EH 1CA0C 1MZAA 7LPRA 1P57B 1TNHA 3NZIA 1SHHB 1TGTA 3SJOA 4B2AA 4AN7A 1QJ6B 4B1TA 1NRSH 5C3NA 5FHTA 2FM2A 1UK3A 1P9SA 1P8VC 4NA7A 1VZQH 2QV1A 4Z0KA 3O8BA 3FN8A 4GSOA 4X8VH 1A0HB 2XNDD 1JWTA 2YOLA 1XUKA 4Y7BA 3QTVH 1AUJA 3BF6H 3RXQA 4O3TA 1SVPA 1GBMA 4CRCA 1G30B 3M5MA 3SU3A 2ZHEH 4Q7XA 4Y10E 2YNAA 4Q7YA 1NRQH 3B8JA 5GPIB 1Z8JB 4J2YB 2GT7A 1NROH 1W14U 1K1NA 2FOFA 3IWMA 4CRFA 1MD8A 2B7DH 1XM1A 4OS6A 4ABIA 2ZKSA 6CHAB 1BDAA 1E1RD 4MNVA 3N7DA 1DITH 5F6MA 4B73A 3BG4B 5GCHG 4A1XA 1GMCG 1BCUH 4X2XA 4XRNA 2RFKC 2BX4A 1YPGH 1GHBG 3U69H 3TLOA 1O31A 4I8GA 4FUJA 1BMFD 4NFFA 1SQAA 4JZ1A 1PPGE 1A7SA 1IQFA 1O3GA 2P8OB 2FI4E 1K28D 1HXFH 1VKYA 1ZHMA 1EAWA 3CNRA 1AHTH 2VGCB 3SW2B 4O9VA 4AGKA 5I25A 1C1TA 4B6FA 1ETRH 1G9IE 2ZU1A 2BB4A 3MH6A 3KEEA 1O2JA 2PFEA 1LKAA 3EE0B 2KCAA 4FU8A 1PJPA 3STJA 2TPIZ 4DVAU 1A0JA 2ZFFH 2CJIA 1COWD 2ASUB 2ZDNA 3PM3A 1GMDG 2GD4B 1FONA 1PPBH 1PQ7A 2KCPA 4OS2A 1QJ7B 1ORFA 1VCWA 1EZUC 4THNH 1XUHA 3RUOA 2FXRA 4K1EA 4RT0A 1E0FD 4X1PU 1LMWB 4X6NA 4ABEA 4E7NA 1K1LA 5KEDA 3MTYA 1TRMA 1DXPA 1S81A 1LCYA 3F0OA 3QX5H 1O30A 3MU0A 1HAPH 2BVRH 2O9QA 3HATH 1JXPA 3UAIC 2K1QA 1LHGH 1WYKA 3A8BA 1GGDB 2PSXA 1N8OC 1EAIA 3V7TA 1XXFA 2H9EH 1FY1A 1ZRBA 1OP0A 1QL7A 1S6FA 5DK1A 2F3CE 3BTME 2C3SA 4LK4A 8KME2 1V2VT 1C2DA 4K69A 3T27A 4MPUA 3O8CA 2RG3A 1NC6A 4WVPE 5J4SA 2FLBH 3H5CB 4MVNA 2KAIA 2H1UA 3A8CA 2Y5HA 1K1PA 1QRWA 1FY8E 2XBWA 4U32A 1QURH 4BNRA 4BAMB 2FODA 1AI8H 2ULLA 3SNEA 3E1XB 3TITA 2XWBI 2WPLS 1GI8B 5IYTA 3FVFB 4B2CA 3BN9A 2BQWB 3MMGA 2A5IA 1EP6A 1ETTH 3PO1B 2AGEX 4Y0YE 4Q63A 3ZZ3A 4WMEA 4X8UH 1EUFA 4GCHF 3LC5A 1Z6JH 2KZ4A 2ZPRA 1YC0A 1YPKH 4X2YA 3TGJE 2GDEH 2J2UA 5GDSH 3QZRA 4UFEH 2FYQA 3EA8A 6LPRA 1J15A 3EA9A 3PLBA 1GJ9B 2A31A 2VVCA 2Y6TA 1MAXA 1GBFA 3UY9A 3U8OH 4XDEA 1QBVH 4ZH8A 4H42U 5FCKA 2JDID 1GMHF 1LVOA 3S0NA 3VEQB 1OS8A 2V0BA 1D3TB 1P2IA 1GI1A 1Y5UT 1G2LA 5DSFA 4X1QU 4SGAE 1AZ8A 1ANBA 6CHAC 3BTEE 1XUIA 2GMTB 3EE7A 4RT1A 3F2GA 1LHCH 3SQHE 1HDTH 1SGTA 2BDYA 3BG4C 1SLXB 1GBKA 4A1VA 3PV5A 4I8JA 1SGEE 4AB8A 3UPEA 3EAJA 1P2JA 1DPOA 4RI0A 2R3UA 1A46H 2AMDA 1SGNE 3SV6A 2PUXB 1H9LB 2FOEA 1SQOA 4YXWD 4K8BA 1O3DA 2W3KA 3CS7A 1BHXF 1T4UH 4GVUA 2Y7XA 1BHXB 2P8OC 3NRLA 1BB0B 2BMGB 1MKWH 1DWBH 2F91A 2H5DA 3TNSA 1H8ED 2OC8A 1QA7A 1IQKA 3RC4A 2Z9GA 3SU1A 2F4LA 3RXRA 1YCPH 1H1BA 4BTUB 1QRXA 1QL9A 2P3TB 1OHHD 3IITA 2A4RA 2VIPA 1ZGVA 1T31A 1OWKA 2LPRA 2G51A 5EJZA 2BD2A 1TPOA 1UTMA 1BA8B 4MPXA 1C2EA 1O39A 1C1NA 1TYNA 3ZZDA 4JK6A 4B6EA 1S0QA 3UR9A 3DSOA 1HAIH 2FS9A 3U1IB 1OWJA 1SR5C 3ZVGA 3N99A 2JH0D 2XYAA 2K0QA 2Z7FE 3UTUH 2CF9H 3BTKE 1EJNA 2GGVB 2J98A 1DLEA 1DX5M 2GZ8A 1EOJA 5FXLA 2XC4A 1O3KA 3M3VA 2VJ1A 1GBHA 1EX3A 1PYTD 3P17H 3RXUA 5K7RA 3GDUA 1YY3A 1QQUA 4CRDA 1GGDC 1D9IA 1ANDA 1O2VA 2GCHG 1W3CA 4P00A 1YLNA 3PROA 4FOUC 3ATLA 1SGIB 1O3CA 2VWMA 4DIHH 2VB0A 5HIZA 1CHOG 1O3FA 3U1JB 3Q77A 2EI7A 2PKAA 2ZP0H 1EQ9A 2R0LA 4I86A 2WUBA 3ZVBA 1FZZA 1WUNH 1Y5BT 4WMDA 4AYVB 4YLUA 4R0IA 1UTQA 4K1TA 3WWFA 2IJOB 2XTTB 4TYDA 1ANEA 3SJ8A 1TNKA 1QB1A 2QE7D 1AY6H 1NN6A 1A5GH 1T8LA 2W7UA 1TLDA 1LHDH 1O2KA 3BV9B 1LKBA 1GVZA 1YCPM 3PO1C 4ASHA 2F9UA 4WJG2 2BD4A 3F9EA 3LOXA 3BTDE 5C20A 3QGNB 1H8HD 4KTSA 2PUQH 2FX6A 1HJ9A 1ELCA 3SGBE 2B9LA 1NFWA 1V2MT 2Z9LA 3KQEA 1KY9A 7KMEH 5L30H 1N1LA 4FUDA 1NT1A 2WYGA 3MH7A 1Z8GA 5JBAS 3P8FA 1QBOA 4ZHLU 1C9PA 2NU4E 2ZI2H 1OYTH 3UNSA 4D9QA 1W12U 2CHAB 3KF2A 4ZUHA 3RU4D 1GJCB 1KXEA 4FETA 1PQAA 2EY4C 4M7GA 2PTCE 1B0FA 4K1SA 1AE8H 3ITIA 1Y3UA 1QRZA 1C1SA 1HNEE 1C5MD 3GDSA 4GHQA 2ZFRH 2CN0H 1HAVA 1Y5AT 3ZV9A 4B71A 3L6PA 2GMTC 2NU2E 3SU4A 5CE1A 1KMHB 5JBTA 4JZIA 2RDLA 1HAHH 3SV8A 2FESH 3I77A 3WWBA 3GOVB 2HOBA 3HGNA 4E06H 1C5VA 3MH5A 3EA7A 2TGDA 4IS5A 1SGYE 4Z1MD 2ZFTA 1O2XA 5ESTE 1KDQB 1WTHD 4TWWA 2VIWA 2AMQA 3P8NA 3SGAE 2C4FH 1TNGA 3C27B 2PV9B 2YMSB 4O3UA 2W7SA 3SO3A 3SI4H 4BTTB 2OD3B 1AGJA 1K22H 1O5FH 1TB6H 2Y80A 3GY8A 5FX6A 3RM0H 2BDHA 4Q2KA 1UTPA 1K0HA 5A8YA 4J1YA 1MKXK 3DCLA 3M7UA 1EOLA 1BUIA 1DWDH 1B7XB 1GL1A 1H9IE 2ZU2A 4YM9A 1ZSLA 4NIVA 3ODFA 1Y3VA 1W0ZU 3FOAA 1E37B 4FVDA 2PTNA 2ZHWH 1C2MA 1LVMA 1FIWA 2QF0A 1SLWB 5DP8A 4XBBA 1A5HA 2WPIS 1DM4B 4ZKOU 2BVXH 1VR1H 2EEKA 2ZECA 3MNSA 1C5YB 4ABAA 1TALA 1ID5H 4NWLA 1BTXA 1CQQA 2ZDLA 2JH5D 4TWYA 3UNRA 4INHA 2AGGX 4DGJA 2O8MA 4IBLH 1KXDA 2SNVA 4CRBA 1ZTLA 1QJ1B 3BIUH 2ZIQH 4AYYB 4AFUA 2P59A 4FXGH 1V2TT 4ZHMU 2FX4A 2CXVA 3U8TH 5B6OA 1GI9B 1GI2A 1ZOMA 2I6QA 1HJAB 3F9FA 3RMLH 1V2JT 1RJXB 4TSFD 1ETSH 3AW0A 3OAAD 2G4UA 1ZMNA 1GJAB 1SGRE 4DURA 1DT2A 2A1DB 1UK4A 5A8XA 2ZDVH 2BZAA 3RXMA 1ZSKA 5ABWA 1AVXA 3HK3B 2ZCLP 1CGJE 2FMJA 3GY2A 1BTUA 1D3PB 2G55A 1JOUB 3V0XA 4D7GA 5IK2D 4KGAA 2SGPE 4OGYA 2G00A 3VB5A 2SGQE 1FAXA 3GY4A 2Q6GA 1EASA 3KL6A 1KXBA 1CE5A 3DFLA 4Z6AH 3ZV8A 3E90B 4FUGA 4LXBH 3MNBA 1P10A 2BLVA 2QC2A 1TAWA 1GJBB 5TCCA 1O37A 2CF8H 2ZG0H 5DP9A 1W10U 4VGCB 3W1EA 2B5TB 2XBXA 5FX5A 1IAUA 1UCYE 2BD8A 3MO9A 3RXCA 2STAE 3P8GA 3KNXA 1GVLA 2EC9H 1YPEH 5BPEA 1HUTH 1OWDA 1S5SA 2QF3A 4X1SU 2CHAC 4TY7A 3BTTE 3RM2H 2GCTB 1KLJH 1C1OA 3BTWE 3B23B 1RTFB 1O2IA 2FDAA 3RXTA 1MCVA 3A83A 4OGXA 2ZGBH 4YOJA 3TGKE 2CK3D 4H6SB 3TU7H 3S69A 2UUJB 1A0LA 2FLRH 3I78A 3SU5A 1EZXC 3TPIZ 4O97A 2ZTYA 2O8LA 3MHWU 4ACBA 2AYWA 2QXGA 2ZPSA 5KECA 4X6MA 1CBWB 1K1OA 2ZHDA 4ZXYH 2AGIX 1GJDB 1T4VH 1RTKA 3H7TA 1ZMJA 4WH8A 1W8BH 2ZFSA 1O32A 1UW7A 1ZYOA 2ZZUH 3GICB 1JBUH 3SJIA 1O3HA 5ESBA 4NIYA 3KN2A 1UVTH 2YMSC 4F48B 2ZGXH 1C1RA 1THRH 2OBQA 5C0UA 1IHSH 2KCYA 5A0BA 3NUMA 1LQDB 4OS1A 1C5ZB 4GLYA 8GCHF 1LHEH 1J16A 1ELEE 5T6GA 1GJ6A 1C2JA 2HNTC 1MABB 4NWKA 2A45B 4AFQA 3LGTA 1TMBH 1NZQH 1BIOA 1L1GA 2ZWLH 2FP7B 1FI8A 2OINA 3SUEA 1Q31A 4CH8B 4E7RG 1CT2E 5EIYA 1IOEA 2WV5A 1GI4A 1ZJDA 2C8ZB 1ZHPA 3ZVFA 2DE8A 1QB6A 1MAYA 5DO4H 1GDQA 2QCYA 2J92A 3K65B 4Y11E 4AGJA 5CHAB 4JZFH 4ISLA 3QK1A 1ZHRA 2A4OA 3LONA 4TPYA 1EAUA 1PQ5A 1QL8A 3MWIU 3UQOA 1V2LT 4NA8A 1SOTA 2IOTA 3F9GA 1TNIA 3SNDA 1SQRA 2WZQA 4GCHG 3ZZ4A 4CR9A 5C1UA 1VITH 1P03A 4AX9H 4ISOA 2A5AA 2J4IA 4WY3A 3RMOH 1C4U2 1GBBA 4I7YH 2H9TH 3RU4T 1UVSH 2BD3A 1M9UA 4X0WU 1NM6A 3Q00A 1F0TA 2BLQA 2ILNA 1O2LA 2ZO3H 3PWBA 3RDZA 2W5EA 2GVFA 2L6OA 3OEHD 4BXWA 2HGTH 1THPB 2F83A 1HJAC 4KELA 2WUCA 1GBDA 4OM9A 1IQLA 1BOQA 3DT0H 4I8KA 2W6JD 2W3IA 1RGQA 2ZFQH 3SV9A 1HCGA 4MG3A 1NFXA 1C5SA 1DANH 1OWHA 2J38A 3WY8A 4F4OC 4IN2A 1WTGH 2LELA 1GHVH 2CMYA 4U01A 1TX8A 3GCOA 3VB3A 2Z9IA 2BD9A 1DS2E 1YF4A 3RXHA 3S9BA 1ESBA 5EW2H 1NRPH 1BBRE 2FOAA 1IQNA 4ZKNU 1GBLA 1FUJA 1SFIA 3DD2H 1K1JA 1O38A 1XUJA 3BIVH 1IQEA 1A1RA 4MQAA 1F0RA 5A0CA 1CT0E 3F2HA 4VGCC 1XVMA 3PV4A 1DDJA 1N6YA 4YT7H 1CGHA 4MNXA 1FY3A 1AU8A 4KTUA 1FX0B 1O5CB 3E6PH 3FFGA 3EDXB 1FNIA 2AHME 2GCTC 1FY5A 4KP0A 2AIPA 3GCHB 3PMAB 2QXIA 1AFQB 3QDZB 1XVOA 4M9FA 4DJZB 2FIRH 1W0YH 5FBEA 3UR6A 1L1JA 2BHGA 1F5KU 2F9BH 4NFEA 1OWEA 1ZPZA 3T2NA 3NWUA 1QHRB 1YPLH 2GT8A 2ZF0H 1OXGA 1ZTKA 3AW1A 4FUEA 1O2QA 4A92A 4INLA 1CBWC 3UOUA 1WCZA 2ANYA 1NBME 3C1KA 4KKDA 3OSYA 2M5TA 3UUZA 3V12A 3P6ZB 1WBGB 4BANB 2R2MB 3O8RA 3SGQE 2VWOA 4ZKSU 2R2WU 2VIOA 2RCEA 3FP8E 1T8MA 1ZTJA 2JKHA 1AWFH 3AAVA 4PROA 1F7ZA 1GWAA 5GXPA 2ALPA 1DLKB 4KTCA 1O3JA 5E2PA 1OYQA 2BD5A 2PW8H 3E91A 1GI7B 1LPZB 5AFYH 1YPJH 1BTWA 1L1NA 1BT7A 1FAKH 9ESTA 2WPJS 1YLCA 1A2CH 1C1PA 1BTYA 2KX4A 5DPAA 1V3XA 2BTCE 2ZHQH 1GG6B 3RXPA 4CREA 1XXDA 1P0SH 2P94A 1H4WA 5T6DA 5LH8A 1QQ4A 1EZSC 5FPTA 1W7XH 3PV2A 2GZ9A 4I33A 2ANKH 1RS0A 3MI4A 1XMNB 5G4BA 2XXLA 4WXVA 1OP8A 5CHAC 1TABE 1O2TA 2NU0E 3GS9A 1AVWA 1FJSA 1UTKA 3GISB 1C2HA 3SN8A 4ZAEA 2FOGA 5C2ZA 1BMAA 1KDQA 1SLVB 5EPNA 1D3DB 3GY6A 4BOHA 1QZ8A 4U2WA 1ZLRA 2QYIA 2TRMA 1W0JD 3TJOA 2Z94A 1ZJKA 1Z1JA 1VCQA 3GCTG 1T32A 1AD8H 4XE4A 6GCHG 3EGKH 3A8DA 2JIZD 5GCHF 2P16A 3A81A 1GMCF 2HPPH 3DSPA 3L33A 1WDIA 3URDA 1UO6A 3OEED 1RTLA 2RDEA 2DE9A 1BMMH 1CT4E 2STBE 5C67A 5DGJA 2ZU5A 2A32A 4X2WA 2O8UA 1AE5A 4NSVA 3QLPH 1F0UA 1O2HA 4HTCH 1LPKB 1C5OH 1TGNA 1RIWB 4AB9A 1WOFA 5B6LA 5C94A 1KLTA 5PTPA 1B5GH 4Y6DA 1MTVA 1P2MA 2ANWA 3LH1A 5FCRA 3H7OA 1UTJA 2ZA5A 2BX3A 1E79D 4FUFA 3RXDA 1CSOE 2XBYA 3MNXA 1TFXA 2D1JA 1MQ6A 3OYPA 3LIWA 1TRNA 1MUEB 3GY5A 1GBIA 1SB1H 1YGCH 2FS8A 1GMDF 4A6LA 3KCGH 4Y8ZA 1ZGIA 4TT3D 5TCAA 3HK6B 2VVVA 4D76A 4UONA 4F55A 2GJGA 3QWCH 2ZPQA 1G3EA 1UCYK 2SFAA 1BMNH 1BRAA 3A7ZA 1AKSB 1SGCA 3GCHC 1AFQC 5JYIA 1O3NA 1TA6A 4Y8YA 3KHVA 5JBBS 1JRSA 3TGIE 1MBMA 2HLCA 3S9AA 1HBTH 5F8XA 1MU8B 3M5OA 1TQ0B 4RSPA 1Y59T 1DWEH 2BLWA 2ZQ1A 3SHAH 1SFQB 3ZZ8A 3FAOA 1AWHB 4GUXA 2SGDE 1JRTA 5HGGA 4MTBA 5IDKA 5I46H 4Q4LA 2H2ZA 2AEIH 1E34B 2G52A 7GCHG 4YZUA 1Q2WA 1TE0A 4ISIH 1F0SA 1K1MA 4JCNA 1TBZH 2BM2A 1P3EA 1ABJH 3M7TA 4ABGA 3SZEA 3KYGA 4DT4A 3A7XA 3SU0A 3ZVCA 3Q3KA 4IC6A 3SNCA 2XW9A 5KGOA 1KLIH 1O36A 1LQEA 1BJUA 3BTFE 5C5OA 4UE7H 3FKSD 2NWNA 4U30A 2HVYB 3OU0A 1TWXB 3ATMA 5CDFE 4LZ1H 1TONA 3M3SA 1XKAC 1GI3A 4XFQA 3ZVEA 1GG6C 4IMZA 5F8ZA 3SUDA 2UUYA 1C5PA 3B9FH 5HIYA 4AZ2B 3ATWA 4CR5A 1V2RT 2BY7X 1SPJA 3TJNA 2ODPA 2YMSD 1BJVA 3M7QA 4H6TA 3ZZ6A 1LPGB 1O2SA 1TMUH 2V7QD 1C5XB 1QA0A 3H09A 1WQVH 5T3HA 2BY5X 1BTZA 2BY9X 1DE7H 4BAKB 2BYAX 1O3PB 3M37A 1O3BA 3ODDA 1DSUA 2R0KA 2HALA 1G36A 2Y81A 4F49A 3URCA 5EODA 1BMLA 2P3UB 2FPZA 2V3MA 1D6RA 1S82A 2ODYB 2ZTXA 3GYLB 3W94A 1AVGH 5HM2A 1IQGA 2GDDA 1GHAG 1SC8U 4Q7ZA 1LVYA 2ZGCA 1VITG 1W2KH 2EQNA 5BRRE 1O33A 3SUFA 3SNAA 4AORA 1SMFE 3QO6A 1GHYH 1J17T 4JMYA 4NIWA 4TY6A 1BZXE 4NGAH 1Z7KA 1SGPE 3Q76A 4DCDA 2LNCA 3CS0A 1NESE 4ZKRU 1RIWC 2WPDD 3LJOA 1OPHB 1EAXA 2QXJA 1AN1E 5A8ZA 3K6ZA 1EPTB 1FV9A 2NU1E 3LGIA 1MTWA 3OX7U 1TGCA 1ANCA 2ZNKH 1BBRK 5EJ1A 2L74A 1BITA 2WPHS 5AFZH 1O3MA 1HIAB 4YLQH 5EGMA 3P8OA 3M61U 3NPSA 1AZZA 3CENA 3BTQE 1C4V2 1OP2A 2J97A 5C17A 1FPHH 1WU1A 4UFGH 2P3FH 4XSKU 1S6HA 3AAUA 3TK6A 1UHBB 1O0DH 3D49H 1QNJA 3VB4A 2BQ6B 1MTNB 1G3DA 2WSSD 3NCLA 3JZ1B 2O8WA 1QBNA 2GCHF 4MPVA 3PYHA 3TVJB 1KXAA 4B2BA 3HKJB 4DY7B 1P11E 2HRVA 2QXHA 2XWAA 3TJVA 1CHOF 3OE7D 1C1QA 4X6PA 3ZIAD 1OX1A 2THFB 1HPGA 4I8LA 3HGPA 3SNBA 2PGQB 2B0FA 5A0AE 1GJ5H 4X1NU 4YOIA 1O3LA 2J95A 2OCVB 5C1XA 1UVOA 1O2GH 2PP6A 1MKXH 4E05H 5JBCS 1P2KA 1C5RA 3ZYDA 1DVAH 2ODQA 4CRAA 4JYVH 2VIVA 2OC1A 3A7YA 3S7HB 3VXEH 5E0HA 5EU8A 1O2WA 5EQSA 1O2PA 1SGQE 3G01A 1E35B 4MNWA 3M5NA 2OUAA 4ABHA 1GI6A 1YLDA 3SQEE 2UUFB
chains in the Genus database with same CATH topology
2A0QB 1EATA 1MBQA 3PLPA 1BRCE 4JZEH 4B74A 2WPMS 1MD7A 2OTVA 4NG9H 4CBNA 3STIA 4ABFA 5L6NH 7ESTE 1YM0A 2XC5A 1J14A 2ZC9H 1QB9A 1SGFA 3AASA 1SOZA 5DP4A 1O2UA 1W13U 1GJ4H 1TGBA 1G2MA 4MPWA 2V3OH 1O3AA 5ETXA 2SNWA 3D62A 4A7IB 4AOQA 1CA8B 1GVKB 1L4ZA 3FZZA 1ZPCA 4YOGA 4GHTA 1ELBA 1TA2A 1AUTC 2F9NA 2A7HA 2F9PA 1Z6EA 5FPSA 2C93B 2ZFPH 4Y8XA 1O5BB 4BAQB 3LGUA 3P92A 4MDSA 3LC3A 2SGEE 4IN1A 2F9OA 1GHXH 1V2QT 4MNYA 5EQRA 1YPMH 1V2PT 2VWLA 3PMBB 1B0EA 2BQ7B 3ESTA 4H4FA 1T7CA 5DP6A 2H5CA 3N7OA 2BOKA 4NA9H 1O2ZA 1KXFA 1XUFA 5DKMA 1Q3XA 1GDUA 1SBWA 1JIMA 4GPGA 4D7FA 1MH0A 5A09A 1O2NA 4HGCA 3ZZCA 1V2OT 3BEFB 1SGFG 1O2MA 3UWIA 2BXUH 1UMAH 2XC0A 1PPCE 1JMOH 1TOMH 2CV3A 2OLGA 3QN7A 1EPTC 4JYTA 3SV7A 2BY8X 1L2EA 2ZTZA 1SHYA 3GYMA 1O5AB 2JETB 1SQTA 4WMFA 3T25A 1RXPA 2TGTA 2H9HA 4K5ZA 4O03A 4BTIB 2QIQA 2OQ5A 1C9TA 2TIOA 4NZQA 9LPRA 1LHFH 2J94A 1OSSA 2G81E 1J9CH 3M5LA 3RXEA 1F2SE 1VCPA 1TNJA 3VB7A 2XCNA 1AO5A 2GZ7A 4BAOB 3GY3A 3SV2H 1FXYA 1YPHE 3KQCA 1NS3A 3R0FA 2PKSB 5DP3A 1V2NT 3V3MA 1MTNC 2TGPZ 1A3BH 1KYNA 1Y3YA 1O35A 3QZQA 1UTLM 2FI3E 4CRGA 3RXKA 3BG8A 1A4WH 1UTNA 1Y3WA 3RXVA 4DG4A 3F1SB 3KIDU 2Q6DA 3A84A 1SG8B 2FOBA 2PSYA 1MQ5A 1GCTB 3TK9A 4AG2A 3PWCA 2VNTA 1GMHG 3T26A 1FN8A 1CHGA 1TBQH 1C5QA 1EP5A 4X8SH 3RXGA 4DW2U 2J34A 3E0NB 1Y8TA 1ARCA 1GBAA 4TPIZ 1Y3XA 1AKSA 1MTUA 4YESB 4Y71A 2UWOA 2TBSA 3K6YA 4B76A 5FBIA 3ZZAA 1C2GA 1WV7H 1P01A 3PB1E 4JYUH 3RXBA 3ZZ9A 2G4TA 4NZLA 5DP5A 3BEIB 1FN6A 2I6SA 2ZCHP 3D65E 1MTSA 5H4IB 2YNBA 2C90B 1OKXA 3SOSA 1NRRH 1HJ8A 4JZDH 1ZSJA 1GI0A 1CU1A 2FOHA 1YKTA 4SGBE 5E8EH 2D2DA 4INKA 3BTGE 1FIZA 5FPYA 1RFNA 1C5WB 2FTLE 2QGRA 4DOQA 1P09A 2BZ6H 1F5RA 1HAGE 3S7KB 4X8TH 2BDIA 4CHAB 1GCDA 3RU4E 4RN6A 1NFUA 1SLUB 4HFPB 1JIRA 3MOCA 1C1UH 3RP2A 3U98H 3ZVDA 3TH4H 3RXFA 1NU9A 3BTHE 3KQDA 2HNTE 4IMQA 3ZZ7A 1TPPA 3FP7E 2O8TA 2FWWA 1FMGA 3NKKA 3PMHB 1D4PB 1UVUH 3TJUA 3MO3A 4WF8A 4BXSA 5LPRA 2GP9B 2GV7A 3V13A 2QAAA 1EB2A 2BDBA 1BTHH 3MH4A 3T62A 1TX6A 1XUGA 1T8OA 4UD9H 1UVPA 2OP9A 1CO7E 4BAHB 4CBOA 3GDVA 4Q80A 2Z9JA 3LPRA 2Z6BD 1EZQA 3A7TA 4ZMAH 1SI5H 3SJ9A 3MFJA 2VIQA 3I29A 1N6XA 1LVBA 3FANA 4ISNA 2GTBA 3PTNA 3MU8A 5AVDA 4YO9A 2JETC 3A89A 4ZHAA 2Z3EA 1O5DH 1QY6A 2A7JA 1GJ8B 8LPRA 2EA3A 1ELVA 2EI8A 1HAZB 2G5NA 4UFFH 2FZZA 3P70B 1FDPA 4K60A 3ENSB 1F92A 2FTMA 2VU8E 2AS9A 1IQIA 1KSNA 1A5IA 2FYRA 1P06A 5EQQA 1ARBA 1DFPA 4HI3A 2OXSA 2QA9E 2ZDAH 4IGDA 1FLEE 2VINA 2HPQH 2PKSC 1P2OA 3TNTA 1Z1IA 2BOHB 3A80A 1MKWK 2ZU3A 5DP7A 5GJ4B 3BSQA 2Y7ZA 2ZDKA 1ZRKA 2V35A 1DXWA 1YCPK 1EJMA 1HAYB 2Z3CA 3F6UH 5C1YA 1V2KT 3RXIA 1P04A 2QY0B 5A2MH 1EPTA 1BRBE 1CGIE 1VGCB 1TRYA 4A1TA 1DWCH 1GCTC 5C5NA 4Y7AA 1TIOA 1GHBF 1LDTT 3VPKA 3VB6A 4AFSA 3R3GB 3TH3H 3OY5U 1J8AA 1QIXB 1HIAA 1KXCA 2NU3E 2ZHFH 3LDXH 1C1MA 2SGAA 1HV7A 1MMJN 2WYJA 2ZGJA 4I8HA 2BY6X 1ESTA 2UWPA 1GBJA 1BQYA 4OS5A 3T5FH 2FI5E 3QTOH 4GAWA 2G5VA 1NO9H 1OOKB 1UHBA 5GIBA 5JDUB 3Q3YA 2VVUA 1QGFA 2IPHA 2ZEBA 2JH6D 3RXJA 3TK5A 3JZ2B 2A2QH 2BLOA 2TGAA 2W26A 3D23A 1V6DA 1NRNH 1WSSH 2XRCA 1DUAA 1HXEH 1K21H 5F03A 3LT3A 2VGCC 1O34A 2H6MA 3VGCB 4XOJA 1UK2A 4XBCA 3GCNA 4UEHH 1AB9B 2OC7A 2RA3A 4OS4A 2WV4A 1C5LH 4A5TS 2Y82A 3UIRA 2AERH 2HVXA 1O2OA 5L2ZH 4UFDH 3ELAH 2PR3A 3A86A 1WAYB 4CHAC 3OTJE 1RD3B 1S84A 3UQVA 2ZQ2A 1Z71A 2PHBA 4JK5A 1PPHE 1F5LA 1P12E 1RRKA 1AFEH 1TOCB 2GX4A 1G37A 2EI6A 3FP6E 2Q6FA 1ZZZA 1C5UA 1W11U 4ABBA 5JPMH 1GBEA 1GBTA 3DA9B 3SBKA 1ELTA 1H9HE 2VWNA 5EXMA 4LOYH 2QN5T 5JB8S 3ZVAA 1ESAA 3E16B 4FUCA 1ELGA 1P05A 3RLWH 1DICA 3ZYEA 1K2I1 1IQJA 1EKBB 1GBCA 2PWXA 1S85A 1UCYH 2V6NA 3AVZA 4NSYA 1GJ7B 1NPMA 3PTBA 3RXLA 2XBVA 2A4GA 3LKWA 4RKJB 3MU5A 2Q1JA 2OC0A 1HRTH 2D8WA 3E3TA 4IC5A 2G8TA 1K9OE 1TPAE 1HGTH 2BDCA 5HXFA 5EXLA 3MO6A 1O3OA 1MU6B 2FOCA 3UOPA 2BDGA 1MCTA 2HWLB 2UWLA 3UNQA 3ZZ5A 4B75A 1BTPA 3U9AH 1THSH 3SJKA 1S83A 1Z8IB 3SUGA 4FU9A 4WH6A 1P2NA 2AH4X 5AHGH 1G3BA 4AFZA 1DOJA 2KAIB 2Y5FA 1C2KA 3BEUA 3GCTF 2VIDA 1O2RA 1K1IA 2RA0A 1Z8RA 3UWJH 5L2YH 6GCHF 1LTOA 3W95A 1HFDA 2XNIA 1INCA 4Y79A 1VGCC 3KGPA 2V3HH 4K2YA 3U8RH 1TGSZ 1WQSA 2AFQB 2R9PA 4YTAA 3PMJA 4Y0ZE 1ELDE 4XBDA 5EXNA 4ABJA 2FO9A 5F8TA 6ESTA 1C2FA 4I32A 5HMAA 1NTPA 3RXAA 1E36B 4ZXXH 1QTFA 3A88A 2P93A 5TJXA 3K2UA 1P02A 2PLXA 2DUCA 1TBRH 2GKVE 3E8LA 3SU2A 1O3EA 2Z3DA 3A85A 1AMHA 3F68H 1IHTH 3L3TA 1AQ7A 1V2WT 4DIIH 1C5TA 4FUIA 3QUMP 2BXTH 1TPSA 2ZU4A 1L0ZA 1G32B 1DY8A 1MZDA 2ANMH 1P2QA 2AMPA 3VXFH 2F9VA 4ISHH 1O5GH 2SGFE 2HNTF 3VGCC 8GCHG 5K0HA 1EB1H 3DFJA 4YT6H 1CA0B 3A7WA 4QT8C 2ESTE 3EYDA 1TX7A 4UDWH 2CGAA 1AB9C 1HB0B 1KIGH 4I31A 4FVBA 2GV6A 4OS7A 1DY9A 3MNCA 1PPEE 1VJAU 4D9RA 1W7GH 3RMNH 3SU6A 5LGOA 1XKBC 4NIXA 1BRUP 2B8OH 3LGYA 1GI5A 1QFKH 3SI3H 2BD7A 1ABIH 1GPZA 5EW1H 3GY7A 1G3CA 1O5EH 1C2LA 1C1WH 8ESTE 5CMXH 1P9UA 1C1VH 7GCHF 1PPZA 1DUEA 1ELFA 4AG1A 4LZ4B 2OQUA 4ESTE 1KTSB 3SHCH 4X1RU 3M35A 1ZPBA 2BVSH 1TNLA 4FU7A 3RC5A 1BBRH 5EPYA 2VH0A 1AIXH 2AIQA 3LGVA 1QR3E 3O8DA 1UTOA 5DG6A 3RC6A 4K8YA 3RXOA 1O2YA 1ELAA 4X2VA 2ZDMA 2FOMB 1FY4A 1GDNA 2Y5GA 5FAHA 4FUHA 2IN2A 1V2ST 3IG6B 1V2UT 3RXSA 1H8IH 3F9HA 1O3IA 5JB9S 1YPHC 1EJAA 1P3CA 1PFXC 1HYLA 5E2OA 3T28A 1QCPA 3SZNA 3NXPA 3PLKA 3MU4A 2BDAA 3MYWA 1VJ9U 5DJ7A 1NY22 1C5NH 2ZGHA 3NK8A 1GHZA 1DSTA 1YP9A 2A5KA 2WPKS 3MU1A 1ZR0A 1SGDE 3RMMH 5LPEA 2PGBB 2PKAB 3DUXH 1C4Y2 1D6WA 3M36A 2C8XB 4D8NA 1PYTC 3RLYH 5GWZA 2D26C 1L4DA 2VH6A 4MLFB 1T8NA 1CVWH 5E0JA 1D3QB 1KTTB 1S0RA 4X6OA 2A2XH 5EOKA 1TMTH 5AF9H 2C8YB 5EG4A 4Y76A 5HM9A 1SSXA 2ALVA 3LU9B 1HLTH 1GHAF 1GL0E 1NU7B 3HKIB 2A4QA 2J9NA 1VITF 3ATKA 1C2IA 3SORA 1FPCH 1A61H 1XX9A 3A87A 5SGAE 3S9CA 1YYY1 3KQBA 4CH2B 3T29A 1IQMA 3LH3A 1LO6A 4RKOB 5T6FA 3DHKH 4NCYA 3UFAA 3M3TA 4WXIA 1YBWA 2ZCKP 4R8TB 2C8WB 1ZMLA 2WINI 4IW4E 5LPFA 1TQ7B 1N8OB 4K3JA 1U6QA 3HPTB 3E0PB 5E0GA 2Z9KA 3ZZBA 3ATIA 2P95A 5HYOA 1ACBE 3FZDA 1NFYA 3LGWA 2OBOA 4FUBA 3A7VA 1FQ3A 3A8AA 1HAXB 1PPFE 2A7CA 3CP7A 1IQHA 1EXFA 1H8DH 3TH2H 3VFEA 2UUKB 1OWIA 1X7AC 4HZHA 4ABDA 1GHWH 1PQ8A 2R3YA 4ZROA 3A82A 3K9XB 3P95A 3TIUA 3OY6U 5J4QA 3LJJA 3Q3XA 1HAVB 4DT7B 3UREA 3QGJA 1HAOH 1SL3A 2XCFA 2FEQH 1UJ1A 1E38B 3EQ0H 4WWYA 1A3EH 1CA0C 1MZAA 7LPRA 1P57B 1TNHA 3NZIA 1SHHB 1TGTA 3SJOA 4B2AA 4AN7A 1QJ6B 4B1TA 1NRSH 5C3NA 5FHTA 2FM2A 1UK3A 1P9SA 1P8VC 4NA7A 1VZQH 2QV1A 4Z0KA 3O8BA 4GSOA 4X8VH 1A0HB 1JWTA 2YOLA 1XUKA 4Y7BA 3QTVH 1AUJA 3BF6H 3RXQA 4O3TA 1SVPA 1GBMA 4CRCA 1G30B 3M5MA 3SU3A 2ZHEH 4Q7XA 4Y10E 2YNAA 4Q7YA 1NRQH 3B8JA 5GPIB 1Z8JB 4J2YB 2GT7A 1NROH 1W14U 1K1NA 2FOFA 3IWMA 4CRFA 1MD8A 2B7DH 1XM1A 4OS6A 4ABIA 2ZKSA 6CHAB 1BDAA 4MNVA 1DITH 5F6MA 4B73A 3BG4B 5GCHG 4A1XA 1GMCG 1BCUH 4X2XA 2BX4A 1YPGH 1GHBG 3U69H 3TLOA 1O31A 4I8GA 4FUJA 4NFFA 1SQAA 4JZ1A 1PPGE 1A7SA 1IQFA 1O3GA 2P8OB 2FI4E 1K28D 1HXFH 1ZHMA 1EAWA 1AHTH 2VGCB 3SW2B 4O9VA 4AGKA 5I25A 1C1TA 1ETRH 1G9IE 2ZU1A 2BB4A 3MH6A 3KEEA 1O2JA 2PFEA 1LKAA 3EE0B 4FU8A 1PJPA 3STJA 2TPIZ 4DVAU 1A0JA 2ZFFH 2CJIA 2ASUB 2ZDNA 3PM3A 1GMDG 2GD4B 1FONA 1PPBH 1PQ7A 4OS2A 1QJ7B 1ORFA 1VCWA 1EZUC 4THNH 1XUHA 3RUOA 2FXRA 4K1EA 4X1PU 1E0FD 4X6NA 1LMWB 4ABEA 4E7NA 1K1LA 3MTYA 1TRMA 1DXPA 1S81A 1LCYA 3QX5H 1O30A 3MU0A 1HAPH 2BVRH 2O9QA 3HATH 1JXPA 2K1QA 1LHGH 1WYKA 3A8BA 1GGDB 2PSXA 1N8OC 1EAIA 3V7TA 1XXFA 2H9EH 1FY1A 1ZRBA 1OP0A 1QL7A 1S6FA 5DK1A 2F3CE 3BTME 2C3SA 4LK4A 8KME2 1V2VT 1C2DA 4K69A 3T27A 4MPUA 3O8CA 2RG3A 1NC6A 4WVPE 5J4SA 2FLBH 3H5CB 4MVNA 2KAIA 2H1UA 3A8CA 2Y5HA 1K1PA 1QRWA 1FY8E 2XBWA 4U32A 1QURH 4BNRA 4BAMB 2FODA 1AI8H 2ULLA 3SNEA 3E1XB 3TITA 2XWBI 2WPLS 1GI8B 5IYTA 3FVFB 4B2CA 3BN9A 2BQWB 3MMGA 2A5IA 1EP6A 1ETTH 3PO1B 2AGEX 4Y0YE 3ZZ3A 4WMEA 4X8UH 1EUFA 4GCHF 3LC5A 1Z6JH 2ZPRA 1YC0A 1YPKH 4X2YA 3TGJE 2GDEH 2J2UA 5GDSH 3QZRA 4UFEH 2FYQA 3EA8A 6LPRA 1J15A 3EA9A 3PLBA 1GJ9B 2A31A 2VVCA 2Y6TA 1MAXA 1GBFA 3UY9A 3U8OH 4XDEA 1QBVH 4ZH8A 4H42U 5FCKA 1GMHF 1LVOA 3S0NA 3VEQB 1OS8A 2V0BA 1D3TB 1P2IA 1GI1A 1Y5UT 1G2LA 4X1QU 4SGAE 1AZ8A 1ANBA 6CHAC 3BTEE 1XUIA 2GMTB 1LHCH 3SQHE 1HDTH 1SGTA 2BDYA