1VCPA

Semliki forest virus capsid protein (crystal form i)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
149
structure length
149
Chain Sequence
b'CIFEVKHEGKVTGYACLVGDKVMKPAHVKGVIDNADLAKLAFKKSSKYDLECAQIPVHMRSDASKYTHEKPEGHYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFDNKGRVVAIVLGGANEGSRTALSVVTWNKDMVTRVTPEGSEEW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEMLIKI FOREST VIRUS CAPSID PROTEIN
publication title Structure of Semliki Forest virus core protein.
pubmed doi rcsb
source organism Semliki forest virus
molecule tags Viral protein
total genus 33
structure length 149
sequence length 149
chains with identical sequence B, C
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcpA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcpA01
3SUGA 1LMWB 5AFYH 1UO6A 1G37A 2BOKA 5HM9A 2CJIA 3MO9A 3W95A 2H5DA 3JZ2B 4XOJA 1MU6B 2GV7A 3Q77A 3V3MA 1DE7H 3T5FH 1QQ4A 1UCYE 2V3OH 2J9NA 2FYQA 2XBVA 6CHAB 1TQ0B 1EJMA 1TOCB 4JYTA 5FBIA 2O8TA 1AUTC 3SV9A 1NRQH 1MD8A 2FMJA 1ZLRA 5DO4H 2TBSA 1KY9A 4XBDA 3SV6A 1EQ9A 2ZA5A 3SI3H 1IQJA 3TNSA 1Z71A 3QO6A 5FBEA 2GMTC 3SJKA 1TB6H 1OKXA 4WF8A 2ODQA 1C2MA 3MH4A 1E37B 2VB0A 1P12E 1QJ1B 3FAOA 1EPTB 1N1LA 1ZZZA 2AMQA 3LC3A 1A0HB 4WH6A 2BD5A 4DY7B 3E0PB 1PPHE 1OYQA 2BY8X 3FP8E 2BOHB 3RC5A 1E36B 1Q2WA 1P2QA 1C1NA 3P70B 5JBAS 1NRPH 1F5KU 3DFJA 2Z3EA 1OXGA 2SGFE 5DP6A 1MTVA 3NK8A 1LHFH 1FJSA 4NFFA 1MMJN 3MU1A 1FZZA 3TH3H 3U8RH 2BDCA 1TPOA 1C5QA 4RSPA 2IJOB 5DP9A 1XKAC 1QIXB 3ZZ5A 1AN1E 2Y7ZA 1V2UT 1Y3XA 4ESTE 2AGEX 3BTTE 2VVVA 2G81E 1Z1JA 2BYAX 1SGCA 1ETRH 3PLKA 5DK1A 3MU8A 4FVBA 3ZZ3A 2BDYA 2P8OB 2A7CA 3D62A 2AGIX 2PKAA 2Z7FE 1K1PA 2QYIA 1DM4B 4WJG2 5JB8S 1BCUH 3SU0A 3SQEE 5EPYA 5EQQA 4ISNA 1NESE 3TIUA 2HRVA 4DGJA 2R9PA 3SGBE 1FY1A 2FTMA 1UTMA 2C8XB 1GGDC 3RXCA 1TNLA 3LDXH 2WPIS 3KQCA 2VIWA 1L1JA 1HAOH 2C93B 1EAWA 3TVJB 2ZFPH 2PKSB 2A5KA 1GI9B 1VITF 3U1IB 1DWBH 2H2ZA 4AFQA 4I8GA 3LC5A 1V2WT 1PPGE 3LPRA 4AYVB 4XFQA 1ZPBA 2GVFA 5DGJA 4CRDA 3PTNA 1L0ZA 1AKSB 1UTKA 2AYWA 3R3GB 5FCRA 2EI8A 3SU6A 1VCQA 3BTDE 1TMTH 1DWCH 3I78A 1NPMA 1V2NT 4DT7B 2Y5GA 1SGPE 2FTLE 2KAIA 4JZEH 1O2OA 3VB7A 1CA8B 2XBYA 2WYGA 2ZDAH 3BN9A 1O3AA 4RKOB 1KXDA 2ZU5A 1H1BA 1TNKA 3EA7A 4Y79A 1PJPA 4BAHB 3E90B 1J16A 4J1YA 2B7DH 3OY6U 2GCTC 1IQKA 3K9XB 5GCHG 3SU5A 1P09A 2GDEH 4Y10E 2BD4A 3DT0H 2A45B 2UUFB 1O3FA 5EG4A 1T31A 2QV1A 4K8YA 4ZHAA 1QA7A 2QXGA 1W12U 5C1YA 1C4Y2 5JB9S 4XE4A 1GI2A 2NWNA 1FY8E 3T29A 2VWNA 3QGNB 3A81A 3GOVB 4B74A 1SL3A 2PUXB 1ELCA 1P9UA 1BRUP 2H9TH 1W14U 3UUZA 1BT7A 1BDAA 3SN8A 1XXFA 3PB1E 2QAAA 1VJ9U 4MG3A 2XXLA 1WBGB 1ZTLA 5C1XA 1BIOA 1CO7E 5L6NH 2HNTF 4KELA 4UD9H 3RXSA 3GY2A 1P01A 1TX7A 5LH8A 4GCHF 3F9EA 1SQOA 3RM2H 4U32A 1C2HA 3UQOA 2BQ6B 4JZIA 1MH0A 3SI4H 3QK1A 1C1VH 1C5SA 2ANMH 1DWDH 3ATLA 3Q3XA 3RXFA 2AIPA 4XBBA 2BM2A 3P8NA 1OWEA 1JBUH 1M9UA 4O03A 2XNIA 2Z3DA 1C5OH 2F91A 4NZQA 2XCFA 1ESAA 1BJUA 1KXCA 2IN2A 1MU8B 4CR9A 1C1TA 1YC0A 1V6DA 3BG4C 5SGAE 1AWFH 2F9BH 1F5RA 4K2YA 5HXFA 1F0TA 1K1IA 1N6YA 5CMXH 3ZZ9A 1GI0A 3AAUA 1O3NA 5JDUB 3FP7E 2HWLB 2Y5HA 3TJOA 1GJ8B 5DP5A 1MKWK 1NN6A 1P02A 4TY6A 1O2LA 1BJVA 1EAXA 2A2XH 6GCHG 1L1GA 1C2FA 1D4PB 3BG8A 1MAXA 4E06H 3RU4T 1KYNA 4YLUA 1PPZA 4NA8A 1C1MA 1O39A 2ZKSA 3OX7U 1Z6EA 3BV9B 5L30H 4X2WA 1SGDE 1FY4A 3U69H 1DSTA 1OPHB 1W10U 1SFQB 2VGCB 3HK3B 1FI8A 2Y80A 2Y81A 4U01A 5DP4A 2BTCE 1HXFH 5E2OA 1UHBA 2G4TA 4HFPB 1K1OA 3ZZBA 3UNQA 2A32A 1A5HA 1TX8A 1O2JA 1H4WA 3KL6A 4Y0ZE 1TGBA 2UUJB 2OC1A 1AIXH 1RTLA 2QCYA 4ZKNU 1A0LA 2O8MA 5GIBA 4DG4A 2ZTYA 3FVFB 1MKWH 3FFGA 1GBMA 3VB3A 2W3IA 3IWMA 1O3IA 3K2UA 3U1JB 3DD2H 1C5ZB 1B0FA 5JBTA 1CGJE 2I6QA 2OLGA 1SGFA 1VCWA 3RLWH 4ZUHA 1HJ8A 3GICB 3LIWA 2TGPZ 4FUIA 4H6SB 4I32A 1E0FD 4NIVA 3SNAA 1S0RA 4KP0A 1YPLH 1GVLA 3MU4A 7KMEH 1DOJA 1O3JA 4CH8B 5F6MA 1TRYA 3UNSA 1DVAH 1FONA 2XRCA 1E34B 2RA0A 2ZFTA 1YPJH 1D6RA 1MBQA 3GCNA 4UFEH 2XW9A 4X6PA 1A61H 1GBEA 4YOIA 3GCOA 3EA8A 3RXDA 2BVRH 3SU3A 2FOFA 5K7RA 1EZXC 5FAHA 1L4DA 2WINI 1C1UH 2VWOA 1F5LA 1SI5H 1BTUA 1N6XA 6CHAC 1YF4A 2ZC9H 4CH2B 1J17T 4BAQB 5AFZH 3QN7A 1DPOA 1G9IE 1CU1A 2FOGA 2ZU2A 3NKKA 1ZTJA 2VIVA 3GY5A 4UDWH 2WPHS 1XM1A 3QGJA 1THSH 1O2NA 5ESBA 4MPUA 5C5OA 4FU9A 3M3VA 2J95A 1YLCA 1Q31A 1Z7KA 3VEQB 3QWCH 1MAYA 1A7SA 2JH6D 4A1TA 1S83A 1F0RA 2HPQH 4FUGA 2ZDNA 4CR5A 1P0SH 4GPGA 3ODDA 4VGCB 1H9HE 3QTOH 3EE0B 1KIGH 4H6TA 2GZ8A 1O2YA 2SGQE 3NUMA 2V0BA 1WQSA 3A7VA 3M35A 2ZGBH 3TLOA 5C3NA 2BHGA 2UWPA 2JKHA 3V7TA 1U6QA 4JZ1A 1C5PA 1NS3A 2BDBA 1O3DA 3FZDA 4NIXA 3UPEA 2QXIA 2SGDE 1RTKA 3RC6A 3VGCB 4BAMB 2ZGXH 1KLTA 3QDZB 1GCTC 1RFNA 1Z1IA 1G2LA 1H8IH 3E3TA 1GHZA 2BLOA 4LK4A 2AGGX 4RKJB 4FUHA 3S9AA 2ZCHP 1WSSH 2BY5X 4GCHG 2O8LA 4HGCA 2ZWLH 2QIQA 2W26A 2FOBA 3HK6B 2YNBA 2P8OC 3TNTA 1IQHA 1BITA 1SVPA 1PPCE 3A8DA 4IN2A 1O37A 2VJ1A 1HB0B 1P57B 2PHBA 3E16B 1TQ7B 1O5EH 2A0QB 1ZTKA 1CT2E 1DANH 1MTSA 4R0IA 3KF2A 4KTSA 4WMFA 3SHAH 1C1OA 3UQVA 1BTHH 2OXSA 1J8AA 1GMCF 3M3TA 3PMAB 1EOLA 4AZ2B 1ZHMA 2G00A 3MYWA 5A8YA 1WYKA 3L33A 1G30B 1MKXK 3O8CA 1EPTA 1DXPA 3P6ZB 1QA0A 7ESTE 2FOHA 3SV7A 2PKSC 1MTWA 1SG8B 3F6UH 5A8ZA 2J2UA 1GMDF 1CT4E 1AE5A 1PFXC 3LJOA 2VIOA 3SBKA 4BXSA 2BLQA 1H9LB 4MNWA 3QTVH 1WTHD 1NM6A 5LPFA 1WU1A 1BBRK 1BRCE 5EODA 2R0KA 1KLIH 1TOMH 1UVPA 3TH2H 2BX4A 5A2MH 2BZ6H 2IPHA 5DPAA 5EW2H 1Y3YA 1ZOMA 3BTEE 4BTUB 4X1QU 3K6YA 1TAWA 2G51A 3TK5A 2NU3E 1SGFG 3E0NB 1TBQH 4MPWA 3RMMH 3O8RA 2ALPA 1AWHB 2FLBH 2FS8A 5GJ4B 1V2OT 4KTUA 1T8NA 2A4RA 3LKWA 1CBWC 5ETXA 2ZG0H 1O0DH 1LVYA 1C1RA 2C4FH 2TGAA 3PMBB 5J4QA 5I25A 4JYVH 3KGPA 5DP8A 4OS7A 4FUFA 1WCZA 3RXHA 1GHAF 3RDZA 3RXQA 3ESTA 3FZZA 2FP7B 1BMNH 1YP9A 2BX3A 3Q3YA 3UY9A 2GKVE 3VXFH 1BZXE 2D8WA 2H6MA 2BD3A 4A5TS 2ZO3H 5EW1H 3BTME 5FPSA 1O3HA 1TIOA 1HAGE 2H9HA 1C2GA 1QCPA 2ZU1A 4K1EA 3CS7A 1P10A 3MH6A 1BRAA 1K22H 2F9VA 2V3HH 2P3TB 1QURH 4BAOB 2NU4E 3SJOA 1UK4A 3B9FH 1GG6B 1CHOG 4X1NU 2A4OA 2BVXH 3LGIA 1A5GH 4ISOA 3K6ZA 4I31A 3GISB 1YLDA 1IOEA 3RXIA 3C1KA 1DX5M 1ZPZA 1SR5C 3KQBA 2V6NA 1OP8A 1AKSA 1HFDA 3STIA 4O3TA 1O38A 2F3CE 1QR3E 4K8BA 2GCHF 2OC0A 1C5XB 5F8XA 5EOKA 5EXLA 1O2IA 1C1WH 1O5DH 1C5MD 5EQSA 1NRNH 4FUEA 2TGDA 3VFEA 2ZDLA 1O5BB 2OC7A 1TMBH 2TPIZ 2Z9IA 5DKMA 3BEFB 5I46H 3LGVA 1VR1H 3VPKA 2ZZUH 3V12A 5TCCA 1P2NA 1ZGVA 2WUBA 2BLWA 1A5IA 1AZZA 2A5IA 3I77A 4YO9A 3E1XB 1YPEH 3NPSA 1OP0A 4D7GA 2FLRH 3UWIA 2RG3A 3BTFE 4WXIA 2ZNKH 3RMOH 1MQ5A 4CBNA 3UOPA 2BY9X 4NGAH 2HPPH 1LVMA 2AERH 3UWJH 2AMDA 2OD3B 2G55A 1K1MA 5ESTE 1HAPH 2VGCC 1O32A 3F1SB 4NSYA 2YNAA 3D49H 1EAUA 4IN1A 1TE0A 4DOQA 1KXAA 1EUFA 4X6NA 3A89A 1GHYH 1GBCA 3MNBA 2FOEA 1THPB 5B6OA 4A1XA 1AUJA 1HCGA 4FU8A 2LNCA 4AGKA 1V2TT 1QB9A 4E7RG 3AW0A 4U2WA 5A0AE 4FUJA 1P06A 1T8LA 3PLPA 4X1SU 1NFWA 4CBOA 1DXWA 3KCGH 1CSOE 2WPJS 3MNSA 1GI5A 1SGYE 2BMGB 4X8UH 1W3CA 1SLXB 4YOJA 1KTTB 1O5AB 1NFXA 2RDLA 1DY8A 1O2SA 2SNVA 3U8OH 2ZHFH 5E0JA 4GVUA 5LPEA 5H4IB 2CF9H 3VB5A 1FNIA 3MNXA 1O30A 1FPHH 1GHBF 3SU2A 1O3LA 1F2SE 2PR3A 1QBNA 1GMCG 1C5VA 5BRRE 2FEQH 1EZQA 4K1SA 4Y0YE 2NU2E 2QXJA 4AFZA 3SNEA 3ATWA 2BVSH 2HNTC 3M61U 1PYTD 1MBMA 2G8TA 1FY3A 3A7WA 1O3EA 1K1NA 1LTOA 2FX4A 3F9HA 2BD9A 2CGAA 3T26A 4OGYA 3ZZ6A 1TABE 4NWKA 5A0CA 2ZHWH 3VXEH 1QGFA 1P11E 2PGBB 4MTBA 2ZGCA 4AX9H 3TJVA 1LHEH 3C27B 3AW1A 2FYRA 3KQEA 1ZGIA 1QJ6B 1C1PA 5T6FA 2JH5D 5E2PA 1GBLA 1UCYK 1WQVH 1YCPK 1AGJA 4RN6A 3UOUA 4HTCH 4Q7YA 1S82A 4B76A 1AVGH 2Z9LA 4TPYA 1E35B 1Z8RA 3A7XA 2Q6FA 3L3TA 1GVKB 4ABDA 3UTUH 3OU0A 1IQNA 5C5NA 3A7YA 4BTTB 1BMAA 3HGNA 4FXGH 1B7XB 1G32B 1T8OA 2FIRH 2R3YA 4B2AA 3TGJE 1C5TA 1GI8B 3BEIB 4Y8YA 1HUTH 3D23A 5LPRA 3RC4A 3TK6A 4ABEA 1NU9A 1GHAG 4D76A 1BB0B 2JETC 5DP7A 4INHA 4Q80A 3AVZA 3HATH 1EB2A 3UR6A 1GI3A 1P2IA 4BANB 1GJ6A 4X2VA 2XC4A 1G36A 1UMAH 3AAVA 3M36A 1YCPH 1UCYH 1YGCH 3RXPA 1TNGA 4AYYB 1INCA 1EZSC 1UVOA 4D9QA 3GY4A 4NA7A 2C90B 3VB6A 1SLVB 1XVMA 2P95A 1TFXA 2ODYB 3BTHE 1DDJA 1SHYA 3S9CA 1HAYB 1SOTA 2Y5FA 1FN8A 3GY8A 5T6DA 2BDIA 2F9UA 2BY6X 3ZV8A 1JOUB 4FUDA 3GCHB 5GXPA 1QQUA 1Y59T 3KN2A 4I33A 4I8KA 2ANKH 1ELBA 1KLJH 1NU7B 1GMHF 7GCHF 3V13A 2GP9B 4X1PU 3PROA 1FAKH 1BTWA 1DUAA 1LPGB 1BMLA 1GBIA 4HZHA 1QRZA 1GBHA 3OSYA 3T2NA 5A8XA 2O8UA 1ABJH 3MI4A 2XTTB 1A1RA 1GI4A 4CRBA 4B2CA 1FXYA 2EEKA 1TBRH 1CT0E 1Q3XA 1W7XH 1G3EA 2V35A 3RUOA 1FN6A 3MOCA 1LKAA 1K2I1 1TPAE 3AASA 3TH4H 1UTQA 1EKBB 1FIWA 5FX6A 2XWAA 1LDTT 1LVBA 5C20A 3G01A 3QUMP 1GBJA 1IQGA 1NT1A 2QA9E 4ISIH 2EC9H 4MNYA 3RLYH 1A3EH 4AOQA 4NIYA 3RXKA 1MTUA 1D6WA 1Z8JB 1K28D 2D26C 5JPMH 1C5NH 3SV8A 5A0BA 2RCEA 1J15A 2QN5T 3H5CB 1AD8H 1CGIE 2TGTA 2ZTZA 1AY6H 3MH5A 1MQ6A 4JK6A 1XUKA 1G3BA 1ELDE 1P9SA 3GDVA 5AHGH 3WY8A 4AN7A 1N8OB 2GT7A 2WUCA 1RTFB 2FM2A 3ELAH 1GBBA 2WYJA 1FY5A 1NFYA 3U98H 4B75A 1GJ5H 4CRCA 1YPKH 3ZVGA 4YT6H 5EGMA 4Q2KA 1ZR0A 3ZVDA 3EGKH 3LONA 2OC8A 2FO9A 1TNJA 1OWJA 1WAYB 2OBQA 3V0XA 4BAKB 1O3PB 3K65B 1TLDA 4BXWA 2EA3A 3W94A 1AZ8A 1WV7H 1TYNA 2Z9JA 1ZMJA 1BMMH 2WV4A 1VITG 1KXEA 4NIWA 4FU7A 2ZF0H 1C4U2 1O35A 3KEEA 1V2VT 1D3TB 4IW4E 2CHAB 1IQIA 3SJ9A 3M7QA 3OY5U 4FUBA 5TJXA 1D9IA 1PPFE 2ZHQH 1AVWA 3CS0A 1P2MA 2ZGJA 1LCYA 5E8EH 3M3SA 5TCAA 4OS2A 1UVSH 2A5AA 1FUJA 3CP7A 5BPEA 1Z8GA 1DY9A 1BTXA 1O5GH 2HALA 4X8SH 1KTSB 3RU4D 1ESTA 8LPRA 1BUIA 3RP2A 2BD8A 2VVUA 3O8BA 1ZSKA 1T32A 2BXUH 1SBWA 1EPTC 2J94A 2WPKS 1HIAB 1S6HA 4Z0KA 2Q6GA 3M5LA 2CXVA 1P2JA 1IQFA 3MU0A 1MZAA 1PQ8A 1GBKA 2WPLS 2PUQH 1ANBA 1EB1H 1ZSLA 1JMOH 4CRFA 2A2QH 2Y82A 1DSUA 1QB1A 2C8YB 1O2HA 3ZZDA 1AE8H 1GHXH 2SFAA 2F9PA 1FAXA 4K60A 2AEIH 1GJ9B 4U30A 3NWUA 4XDEA 2P94A 1D3PB 3LH1A 1KXBA 1HAVB 2Z9KA 1NTPA 5F8ZA 2G4UA 3SORA 1ELAA 1GCDA 1WOFA 4CHAB 1ZPCA 1T4UH 4BOHA 5AF9H 4UONA 1V2RT 1GBTA 1SLUB 1OOKB 1WUNH 1HAXB 2ESTE 1LO6A 5JYIA 2GDDA 4Z6AH 1SGRE 2AIQA 1HAHH 1QL8A 1SGNE 1B0EA 3F68H 3M5MA 5C2ZA 1GDNA 3ZVCA 4KTCA 3SNBA 4UFGH 1IHSH 3P17H 1QL7A 1SB1H 2UUYA 3IG6B 4I8LA 4LZ1H 1O2WA 1OSSA 2J34A 3ZZ7A 4AB8A 5LGOA 1E38B 3LT3A 1RIWB 1C1SA 3NXPA 3EYDA 5T3HA 4UEHH 1O2ZA 3P92A 4ZH8A 1HYLA 3BEUA 1O2QA 3M37A 2ZHEH 1AFQB 2R0LA 4SGAE 2ILNA 2A31A 1PQ5A 3RM0H 3B23B 3SOSA 3LOXA 1RJXB 3SU4A 1DLEA 4IGDA 1GMHG 1YPMH 2PFEA 2SGAA 1FPCH 3ENSB 3U8TH 3RXBA 2BQWB 2XBXA 3RXEA 4I8JA 3GDSA 5DG6A 1TA6A 4ZXYH 2ANWA 4OS4A 2XC5A 1QHRB 1SFIA 5HM2A 1QL9A 1RD3B 1T8MA 2ULLA 3QZQA 1SSXA 3RMLH 4YZUA 1X7AC 3A8BA 3M5OA 3ZZ8A 6ESTA 2ZP0H 1C2EA 1GI1A 3PMJA 2J38A 1Y3UA 2VIDA 2W7UA 1L1NA 5CHAB 2ASUB 1SMFE 4Y71A 1O5FH 1NZQH 3M5NA 3SUFA 4AFUA 5EXNA 4WVPE 3HKIB 1AO5A 1O2VA 2ZFRH 1NY22 4ABFA 4ABJA 1RS0A 4X8TH 3A80A 1XUJA 1ETSH 1SQTA 3JZ1B 5FPYA 1HJAB 1NROH 1WTGH 1GJ4H 1IAUA 1GI6A 1ELGA 3ITIA 1MD7A 1MKXH 4YLQH 4IMZA 2K1QA 2GZ7A 2HLCA 1GJ7B 2PW8H 3RXVA 1TGCA 2WPMS 5IYTA 1O2TA 5C1UA 2GZ9A 1YPGH 2UWOA 2OBOA 5L2YH 2CF8H 1UVUH 2STAE 3ZVAA 3PLBA 3BTWE 1GDUA 4H42U 3MO3A 1TPSA 2VNTA 1BBRH 2PTCE 4THNH 4X8VH 1O2GH 2TRMA 1EX3A 5CE1A 4R8TB 4GUXA 3BTKE 1ANDA 1ETTH 1Y8TA 2F9NA 1SGQE 2FOAA 4WWYA 2OUAA 1VITH 1C5RA 1CVWH 1K21H 3ATMA 4IMQA 1OWDA 1AVXA 3EA9A 1RRKA 4LXBH 1C9TA 2F9OA 1YYY1 3MTYA 2B5TB 1BQYA 1S5SA 4MPVA 1GL0E 1QBOA 1JXPA 5JBCS 4Y7AA 1ZRBA 1W11U 3OTJE 1K1JA 3RXMA 3ZZCA 2XBWA 3FANA 1QFKH 1S85A 4I8HA 4B1TA 1P3CA 1ZMLA 1O31A 1FMGA 4IBLH 2AH4X 2BLVA 3A83A 1DLKB 2SGPE 1YPHC 3PM3A 4F49A 1P05A 2Q6DA 3SUDA 3E91A 4QT8C 1CGHA 1ZMNA 4E05H 2Z9GA 1SHHB 1JIMA 3ZYEA 4UE7H 2WV5A 2ZEBA 3GCHC 4AGJA 4WY3A 1ORFA 1IQEA 1LKBA 2RA3A 1BHXF 1EAIA 3RMNH 3RXUA 4LZ4B 1BOQA 1T7CA 1VGCB 1RXPA 3RXOA 1AHTH 2ZDMA 1IHTH 5J4SA 1KDQB 1TRNA 4BTIB 6GCHF 3SGQE 3QZRA 2J4IA 2Y6TA 1RGQA 1YBWA 2ZPSA 1AU8A 5HMAA 3BF6H 1XUFA 3S0NA 2BD7A 1GJBB 3L6PA 3NCLA 3MNCA 4ABGA 3F9FA 1ANCA 1DS2E 2BDHA 3PV4A 1GBDA 4DIHH 1EP6A 4YTAA 2FPZA 3DUXH 1OWHA 4WMEA 2ALVA 3TITA 1GHWH 1A0JA 3LU9B 3SZNA 4TYDA 1BRBE 2W3KA 2BQ7B 1GCTB 1OWIA 4AG2A 2Z6BD 4KKDA 1JWTA 5L2ZH 3TJUA 3PMHB 1VJAU 3KHVA 5DJ7A 1EOJA 1EJAA 1GWAA 2OINA 1O2MA 1TRMA 2ZPRA 3SGAE 1TX6A 2OP9A 3RXTA 3HPTB 4MVNA 4NCYA 1ESBA 1AB9B 4K5ZA 3PO1B 1TNHA 1N8OC 4Y8XA 4H4FA 2CV3A 4MNXA 2UWLA 4LOYH 1G3CA 1MZDA 4OGXA 1KXFA 1HXEH 1TA2A 4ZKSU 1MCVA 1V2JT 1K1LA 1NFUA 3I29A 2ZPQA 1BTPA 2JH0D 4MDSA 1JIRA 2XCNA 4GLYA 2QGRA 4OS1A 1TONA 2ANYA 2VU8E 3DHKH 3F9GA 8ESTE 1C2IA 4BNRA 1O36A 4K1TA 4MQAA 3LH3A 1V2ST 1LHGH 3PTBA 3Q00A 4IS5A 1CA0B 2EI7A 3SO3A 2R3UA 4GHQA 2B0FA 1ARCA 1CQQA 1H9IE 5HGGA 3S69A 3U9AH 2TIOA 3GYLB 1IQLA 3RXJA 1S84A 3SU1A 2OQ5A 1GMDG 4ZHLU 2CMYA 4GSOA 1W0ZU 2CHAC 1W0YH 1UTLM 4O9VA 1P2KA 2ZECA 1DFPA 2EI6A 1HV7A 2STBE 1D3DB 2ZQ2A 3T25A 5GWZA 3UFAA 3SJIA 4A1VA 1C2KA 5EQRA 1QRXA 3MFJA 1LVOA 4NZLA 1NC6A 4XBCA 3MHWU 1UTPA 3NZIA 4ZROA 4E7NA 1BHXB 1SGEE 1C9PA 1MTNB 2XWBI 5FHTA 1VZQH 1A46H 1DUEA 2DE9A 1O3KA 3MH7A 1V3XA 3E6PH 4FUCA 1C2JA 3TGIE 3KIDU 1TNIA 1CBWB 3EAJA 1SGIB 3CENA 4CRAA 4Y8ZA 1ID5H 3UNRA 1AFEH 1QB6A 2VH0A 3M7TA 4VGCC 1P3EA 2H1UA 1OYTH 2BDAA 3DA9B 1TPPA 1W7GH 3ODFA 1DT2A 3VB4A 1ZJKA 1C5YB 1FDPA 4JMYA 1F0SA 3ATKA 4Q7ZA 3UIRA 3IITA 4M7GA 2W5EA 4Y7BA 4JZFH 1C5WB 2QF0A 4I7YH 1G2MA 2SGEE 1O33A 2VVCA 2H5CA 2PKAB 4B71A 4CHAC 4Q7XA 5GPIB 3VGCC 1OP2A 1C4V2 1XUIA 2O8WA 1THRH 1BTYA 3A8CA 4WH8A 2NU1E 3S7HB 2THFB 1Z6JH 2ZCKP 4GHTA 1O3OA 2FI4E 1SLWB 2ZFSA 1EZUC 2HOBA 4ZKRU 2ZQ1A 3ZZ4A 1O34A 3MMGA 2P16A 2FESH 2GMTB 2SNWA 1XX9A 2R2WU 3E8LA 1HLTH 1P04A 4TWYA 3LGTA 3TJNA 2PSXA 4JK5A 2ZDKA 3QX5H 1LHCH 1LQEA 2FI5E 2A4GA 1GHVH 1RIWC 2VIQA 2FZZA 1PQAA 4X2YA 4WXVA 3ZV9A 2GX4A 2GCHG 1ELVA 1TGNA 1AFQC 3GCTF 1O3MA 1QBVH 1UVTH 1AQ7A 2LPRA 3BTQE 4CREA 1SQAA 1ZSJA 4ABAA 2D1JA 4D7FA 1EP5A 1F0UA 1SPJA 1O2KA 4AG1A 6LPRA 3N7OA 4PROA 4MLFB 4UFDH 1A3BH 1HIAA 1C1QA 3P95A 3Q76A 3HGPA 2KAIB 3B8JA 2PTNA 2Z3CA 3LGWA 8GCHF 1GPZA 1P03A 1ZHPA 3PYHA 2HGTH 1EATA 3RXLA 3A8AA 4DIIH 2IOTA 4TY7A 5CHAC 2C8WB 1UJ1A 2GT8A 3GDUA 4D9RA 1HPGA 1C5LH 4GAWA 2BZAA 5E0HA 1CE5A 4O3UA 1TGTA 1UTOA 2HVXA 1HAVA 1HJ9A 5FXLA 1HAIH 1Z8IB 3QLPH 3URCA 2ZGHA 1OWKA 1CHGA 3A7TA 1B5GH 3GYMA 1F7ZA 2BD2A 2P3FH 4MPXA 4INLA 3TK9A 3LGYA 3FP6E 5EPNA 3SNCA 2GGVB 1HJAC 1QJ7B 3A82A 1ABIH 1BA8B 2PV9B 2FDAA 4DCDA 1O5CB 3O8DA 1G3DA 2BB4A 1XXDA 4JCNA 1BTZA 1HNEE 1LQDB 3S9BA 3UR9A 4YOGA 1YPHE 8KME2 1LPZB 1GGDB 5EU8A 2W7SA 1QNJA 2I6SA 1HDTH 1O2UA 2FOCA 1S0QA 4AFSA 1SOZA 1V2QT 1ELTA 4ZAEA 1P8VC 1LPKB 2QXHA 3GY3A 2B9LA 5E0GA 1EASA 5GDSH 5F03A 2M5TA 2BXTH 1GJCB 3DFLA 5ABWA 1ELFA 1GHBG 3ATIA 3D65E 1QRWA 2GTBA 2AFQB 4X0WU 5JBBS 3P8FA 1ACBE 1BBRE 1LHDH 2FODA 1NO9H 2B8OH 4TWWA 4YT7H 7LPRA 3A88A 1ELEE 1UK3A 2VINA 4K3JA 1A4WH 1CHOF 4DW2U 1GG6C 2ZCLP 3RXRA 9LPRA 1TGSZ 4X6MA 2UUKB 4JZDH 3MO6A 1TALA 2VH6A 3LJJA 3P8OA 2FS9A 1Y3WA 2C3SA 1UTJA 1DWEH 1C5UA 1EXFA 2BY7X 2P59A 4IC6A 3GY7A 5FPTA 2ZTXA 3R0FA 3A87A 4INKA 2GCTB 2OTVA 1HRTH 4ZXXH 2VIPA 2XYAA 2A4QA 1AMHA 1S81A 1PQ7A 4NSVA 3HKJB 1V2KT 1QTFA 3OYPA 4ISHH 2GD4B 4O97A 1OS8A 1IQMA 1HGTH 3BIUH 3SUEA 1GL1A 1QY6A 2ODPA 2R2MB 2ZIQH 4AB9A 4YM9A 4ABIA 1P2OA 4YESB 1VGCC 2Q1JA 3EQ0H 1FLEE 1NRSH 2DUCA 4ZKOU 3TU7H 5IDKA 2H9EH 3TPIZ 1F92A 5A09A 3URDA 1GJDB 1TBZH 3RXAA 2FI3E 1GJAB 3T28A 1GI7B 4DJZB 1JRSA 1UHBB 1ZRKA 4DVAU 2Y7XA 2FWWA 2ZU3A 4ABBA 2JETB 1ARBA 3T27A 1OX1A 2OQUA 1YCPM 2D2DA 3EDXB 1MUEB 3MU5A 4HI3A 1ZJDA 1C2LA 1Y5UT 3BIVH 1V2LT 1VCPA 1XMNB 2PGQB 1YKTA 2P3UB 4A6LA 4OS6A 2FXRA 2QF3A 3SQHE 4Y76A 2G5VA 1GBAA 3SHCH 1V2MT 1GBFA 3A84A 4D8NA 3TGKE 4ASHA 4NA9H 1Y5AT 4A92A 1JRTA 4XSKU 3PWCA 2HNTE 1O3CA 2QC2A 2AS9A 3SNDA 2PSYA 3MWIU 2PWXA 1DICA 1W8BH 1GVZA 3ZZAA 3BG4B 2A7JA 2VWLA 4A7IB 4FVDA 2YOLA 3GY6A 2ZHDA 4F4OC 4K69A 3STJA 4IC5A 4SGBE 1K9OE 1AB9C 3PO1C 3ZVFA 4B2BA 1PPEE 1TWXB 3ZVEA 3H7TA 2ZU4A 4UFFH 7GCHG 1XUHA 3ZVBA 1O3BA 4NWLA 2ZFQH 2O9QA 1T4VH 4CRGA 9ESTA 1W13U 3P8GA 5HYOA 2Z94A 1O3GA 1A2CH 2XC0A 1ANEA 1FIZA 2A1DB 1ZYOA 3GCTG 1Y5BT 3BSQA 2J92A 1SGTA 1PPBH 1ZHRA 5DP3A 1S6FA 1UTNA 1XUGA 2P93A 3Q3KA 1CA0C 1FQ3A 1NRRH 1J9CH 4Y6DA 2PLXA 1HBTH 2VWMA 4Y11E 1DITH 4WMDA 1MCTA 5EXMA 2G52A 4KGAA 1D3QB 5T6GA 1KDQA 2F83A 1W2KH 1AI8H 3BTGE 1UK2A 1L2EA 1C2DA 5K0HA 2ZDVH 4ISLA 5PTPA 4JYUH 8GCHG 2OCVB 3T62A 5FCKA 4X6OA 2AMPA 4MNVA 3S7KB 1KSNA 1TMUH 3SJ8A 1SC8U 3KQDA 1XVOA 3SW2B 1V2PT 1YM0A 5AVDA 2GV6A 3LGUA 4ZMAH 1XKBC 3RXGA 5GCHF 2FOMB 1O2RA 2NU0E 4X2XA 3PWBA 2DE8A 5C67A 3RU4E 3A86A 1J14A 5FX5A 2C8ZB 4NG9H 1MTNC 4OS5A 4ZHMU 4B73A 1EJNA 2ZFFH 3UREA 4ABHA 2A7HA 3SV2H 3ZYDA 3KNXA 4X1RU 3H7OA 1HAZB 2ZI2H 1O2XA 2G5NA 5G4BA 1Y3VA 3A85A 1H8DH 1FV9A 1GDQA 2FX6A 1L4ZA 4AORA 4DURA 5F8TA 4J2YB 3M7UA 2CN0H 3A7ZA 1O2PA 2BDGA 4NFEA 2QY0B 4TPIZ 1PYTC
chains in the Genus database with same CATH superfamily
3SUGA 1LMWB 5AFYH 1UO6A 1G37A 2BOKA 5HM9A 3OTPA 2CJIA 3MO9A 3W95A 2H5DA 3JZ2B 4XOJA 1MU6B 2GV7A 3Q77A 3V3MA 1DE7H 3T5FH 1QQ4A 1UCYE 2V3OH 2J9NA 2FYQA 2XBVA 6CHAB 1TQ0B 1W0JD 1EJMA 1TOCB 4JYTA 5FBIA 2O8TA 1AUTC 3SV9A 1NRQH 1MD8A 2FMJA 1ZLRA 5DO4H 2TBSA 1KY9A 4XBDA 4B6EA 3SV6A 1EQ9A 2ZA5A 3SI3H 1IQJA 3TNSA 1Z71A 3QO6A 5FBEA 2GMTC 3SJKA 1TB6H 1OKXA 4WF8A 2ODQA 4M9FA 1C2MA 3MH4A 1E37B 2VB0A 1P12E 1QJ1B 3FAOA 1EPTB 1N1LA 1ZZZA 2AMQA 3LC3A 1A0HB 4WH6A 2BD5A 4DY7B 3E0PB 1PPHE 1OYQA 2BY8X 3FP8E 2BOHB 3RC5A 1E36B 1Q2WA 1P2QA 1C1NA 3P70B 5FL7D 5JBAS 1NRPH 1F5KU 3DFJA 2Z3EA 1OXGA 2SGFE 5DP6A 1MTVA 5T1VA 3NK8A 1LHFH 1FJSA 4NFFA 1MMJN 3MU1A 1FZZA 3PRBA 3TH3H 3U8RH 2BDCA 1TPOA 1C5QA 4RSPA 2IJOB 5DP9A 4RI0A 1XKAC 1QIXB 3ZZ5A 1AN1E 2Y7ZA 1V2UT 1Y3XA 4ESTE 2AGEX 3BTTE 2VVVA 2G81E 1Z1JA 2BYAX 1SGCA 1ETRH 3PLKA 5DK1A 3MU8A 4FVBA 3ZZ3A 2BDYA 2P8OB 2A7CA 3D62A 4RT0A 2AGIX 2PKAA 2Z7FE 1K1PA 2QYIA 1DM4B 4WJG2 5JB8S 2KCOA 1BCUH 3SU0A 3SQEE 5EPYA 5EQQA 1W0KD 4ISNA 1NESE 3TIUA 2HRVA 4DGJA 2R9PA 3SGBE 1FY1A 5GNDA 2FTMA 1UTMA 2C8XB 1GGDC 3RXCA 1TNLA 3LDXH 2WPIS 3KQCA 2VIWA 1L1JA 1HAOH 2C93B 3DSGA 1EAWA 2JJ1D 3TVJB 2ZFPH 2PKSB 2A5KA 1GI9B 1VITF 3U1IB 2VBCA 1DWBH 2H2ZA 4AFQA 4I8GA 3LC5A 1V2WT 1PPGE 3LPRA 4AYVB 4Q4LA 1ZPBA 2GVFA 4XFQA 5DGJA 4CRDA 3PTNA 1L0ZA 1AKSB 1UTKA 2AYWA 3R3GB 5FCRA 2EI8A 3SU6A 1VCQA 3BTDE 1TMTH 1DWCH 3I78A 1NPMA 1V2NT 4DT7B 2Y5GA 1SGPE 2FTLE 2KAIA 4JZEH 1O2OA 3VB7A 1CA8B 2XBYA 2WYGA 2ZDAH 2W6ID 3BN9A 1O3AA 4RKOB 1KXDA 2ZU5A 1H1BA 1TNKA 3EA7A 4Y79A 4HG6A 1PJPA 4BAHB 2J98B 1J16A 3E90B 4J1YA 2B7DH 3OY6U 2GCTC 1IQKA 3K9XB 5GCHG 3SU5A 1P09A 2GDEH 4Y10E 2BD4A 3DT0H 2A45B 2UUFB 1O3FA 5EG4A 1T31A 2QV1A 4K8YA 4ZHAA 1QA7A 2QXGA 1W12U 5C1YA 1C4Y2 4FETA 5JB9S 4XE4A 1GI2A 2NWNA 1FY8E 3T29A 2VWNA 3QGNB 3A81A 3GOVB 4B74A 1SL3A 2PUXB 1ELCA 1P9UA 4I86A 1BRUP 2H9TH 1W14U 3N99A 3UUZA 3WWFA 1BT7A 1BDAA 3SN8A 1XXFA 3PB1E 2QAAA 1VJ9U 4MG3A 2XXLA 1WBGB 1ZTLA 5C1XA 1BIOA 1CO7E 5L6NH 2HNTF 4KELA 4UD9H 3RXSA 3GY2A 1P01A 1TX7A 5LH8A 4GCHF 3F9EA 1SQOA 3RM2H 4U32A 1C2HA 3UQOA 2BQ6B 4JZIA 1MH0A 3SI4H 3QK1A 1C1VH 1C5SA 2ANMH 1DWDH 3ATLA 3Q3XA 3RXFA 2AIPA 4XBBA 2BM2A 3P8NA 1OWEA 1JBUH 1M9UA 4O03A 4P02A 2XNIA 2Z3DA 1C5OH 2K8IA 2F91A 4NZQA 2XCFA 1ESAA 1BJUA 1KXCA 2IN2A 2W6JD 1MU8B 4CR9A 1C1TA 1YC0A 1V6DA 3BG4C 5SGAE 1AWFH 5CDFE 2F9BH 1F5RA 4K2YA 5HXFA 1F0TA 1K1IA 1N6YA 5CMXH 3ZZ9A 1GI0A 3AAUA 1O3NA 5JDUB 3FP7E 2HWLB 2Y5HA 3TJOA 1GJ8B 5DP5A 1MKWK 1NN6A 1P02A 4TY6A 1O2LA 5B6LA 1BJVA 1EAXA 2A2XH 6GCHG 1L1GA 1C2FA 1D4PB 3BG8A 1MAXA 4E06H 3RU4T 1KYNA 2QF4A 4YLUA 1PPZA 4NA8A 1C1MA 1O39A 2ZKSA 3OX7U 1Z6EA 3BV9B 5L30H 4X2WA 1SGDE 1FY4A 3U69H 1DSTA 1OPHB 1W10U 1SFQB 2VGCB 3HK3B 1FI8A 2Y80A 2Y81A 4U01A 5DP4A 2BTCE 1HXFH 5E2OA 1UHBA 2G4TA 4HFPB 1K1OA 3ZZBA 3UNQA 2A32A 1A5HA 1TX8A 5KGOA 1O2JA 1H4WA 3KL6A 4Y0ZE 1TGBA 2UUJB 2OC1A 1AIXH 1RTLA 2QCYA 3F2HA 4ZKNU 1A0LA 2O8MA 5GIBA 4DG4A 2ZTYA 3FVFB 1MKWH 3FFGA 1GBMA 3VB3A 2W3IA 3IWMA 1O3IA 3K2UA 3U1JB 3DD2H 1C5ZB 1B0FA 5JBTA 1CGJE 2I6QA 2OLGA 1SGFA 1VCWA 3RLWH 4ZUHA 1HJ8A 3GICB 3AK5A 3LIWA 2TGPZ 4FUIA 4H6SB 4I32A 1E0FD 4NIVA 3SNAA 1S0RA 4KP0A 1YPLH 1GVLA 3MU4A 7KMEH 1DOJA 1O3JA 4CH8B 5F6MA 1TRYA 3UNSA 1DVAH 1FONA 2XRCA 1E34B 2RA0A 2ZFTA 1YPJH 1D6RA 1MBQA 3GCNA 4UFEH 2XW9A 1VKYA 3FN8A 4X6PA 1A61H 1GBEA 4YOIA 3F3BA 3GCOA 3EA8A 3RXDA 2BVRH 3SU3A 1EFRD 2FOFA 5K7RA 1EZXC 5FAHA 1L4DA 2RDEA 2WINI 1C1UH 2VWOA 1F5LA 1SI5H 1BTUA 1N6XA 6CHAC 1YF4A 2ZC9H 4CH2B 1J17T 4BAQB 5AFZH 3QN7A 1DPOA 1G9IE 3H09A 1CU1A 2FOGA 2ZU2A 3NKKA 1ZTJA 2VIVA 3GY5A 4UDWH 2WPHS 1XM1A 3QGJA 1THSH 1O2NA 4F55A 5ESBA 4MPUA 5C5OA 4FU9A 3M3VA 3UB0A 2J95A 1YLCA 1UW7A 1Q31A 1Z7KA 3VEQB 3QWCH 1YWUA 1MAYA 1A7SA 2JH6D 4A1TA 1S83A 1F0RA 2HPQH 4FUGA 2ZDNA 4CR5A 1P0SH 4GPGA 3ODDA 4VGCB 1H9HE 3QTOH 3EE0B 1KIGH 4H6TA 2GZ8A 1O2YA 2SGQE 3NUMA 2V0BA 1WQSA 3A7VA 3M35A 2ZGBH 3TLOA 5C3NA 1COWD 2BHGA 2UWPA 2JKHA 2WV9A 3V7TA 1U6QA 4JZ1A 1C5PA 1NS3A 2BDBA 1O3DA 3FZDA 4NIXA 2RFKC 3UPEA 2QXIA 2SGDE 1RTKA 3RC6A 3VGCB 4BAMB 2ZGXH 1KLTA 3QDZB 1H8HD 1GCTC 1RFNA 1Z1IA 3WW7A 1G2LA 1H8IH 3E3TA 2K0QA 1GHZA 2BLOA 4LK4A 2AGGX 4RKJB 4FUHA 3S9AA 2ZCHP 1WSSH 2BY5X 4GCHG 2O8LA 4HGCA 2ZWLH 2QIQA 2W26A 2FOBA 3HK6B 2YNBA 2P8OC 3TNTA 1IQHA 1BITA 1SVPA 1PPCE 3A8DA 4IN2A 1O37A 2VJ1A 1HB0B 1P57B 2PHBA 3E16B 1TQ7B 1O5EH 2A0QB 1ZTKA 3OAAD 1CT2E 1DANH 1MTSA 4R0IA 3KF2A 4TT3D 4KTSA 4WMFA 3SHAH 1C1OA 3UQVA 1BTHH 2OXSA 1J8AA 1GMCF 4XRNA 3M3TA 3PMAB 1EOLA 4AZ2B 1ZHMA 2G00A 3MYWA 5A8YA 1WYKA 3L33A 1G30B 1MKXK 3O8CA 1EPTA 1DXPA 3EE7A 3P6ZB 1QA0A 7ESTE 2WSSD 2FOHA 3SV7A 2PKSC 1MTWA 1SG8B 3F6UH 5A8ZA 2J2UA 1GMDF 1CT4E 3NRLA 1AE5A 1PFXC 3LJOA 2VIOA 3SBKA 4BXSA 2BLQA 1H9LB 4MNWA 3QTVH 1WTHD 1NM6A 5LPFA 1WU1A 1BBRK 1BRCE 5EODA 2R0KA 1KLIH 1TOMH 1UVPA 3TH2H 2BX4A 5A2MH 2BZ6H 2IPHA 2V3MA 5DPAA 5EW2H 1Y3YA 3OFND 1ZOMA 3BTEE 4BTUB 4X1QU 3K6YA 1TAWA 2G51A 3TK5A 2NU3E 1SGFG 3E0NB 1TBQH 4MPWA 3RMMH 3O8RA 2ALPA 1AWHB 2FLBH 2FS8A 5GJ4B 1V2OT 4KTUA 1T8NA 2A4RA 2HLDD 3LKWA 1CBWC 5ETXA 2ZG0H 1O0DH 1LVYA 1C1RA 2C4FH 2TGAA 3PMBB 5J4QA 5I25A 4JYVH 3KGPA 5DP8A 4OS7A 4FUFA 1WCZA 3RXHA 1GHAF 3RDZA 2KX4A 3RXQA 3ESTA 3FZZA 2FP7B 1BMNH 1YP9A 2BX3A 3Q3YA 3UY9A 2GKVE 3VXFH 1BZXE 2D8WA 2H6MA 2BD3A 4A5TS 2ZO3H 5EW1H 3BTME 5FPSA 1O3HA 2WPDD 1TIOA 1HAGE 2H9HA 1C2GA 1QCPA 2ZU1A 4K1EA 2KCYA 3CS7A 1P10A 3MH6A 1BRAA 1K22H 2F9VA 2V3HH 2P3TB 1QURH 4BAOB 1FX0B 2NU4E 4OM9A 5F53A 3SJOA 1UK4A 2JJ2D 3B9FH 1GG6B 1CHOG 4X1NU 2A4OA 2BVXH 3LGIA 1A5GH 4ISOA 3K6ZA 4I31A 3GISB 1YLDA 1IOEA 3RXIA 3C1KA 1DX5M 1ZPZA 1SR5C 3KQBA 2V6NA 1OP8A 1AKSA 1HFDA 3STIA 4O3TA 1O38A 2F3CE 1QR3E 4K8BA 2KM0A 2GCHF 2OC0A 1C5XB 5F8XA 5EOKA 4P00A 5EXLA 1O2IA 1C1WH 1O5DH 1C5MD 4Z1MD 5EQSA 1NRNH 4FUEA 2TGDA 3VFEA 2ZDLA 1O5BB 2OC7A 1TMBH 2TPIZ 2Z9IA 5DKMA 3BEFB 5I46H 2YMSC 3LGVA 1VR1H 3VPKA 2J98A 2ZZUH 3V12A 5TCCA 1P2NA 1ZGVA 3KQ5A 2WUBA 2BLWA 1A5IA 1AZZA 2A5IA 3I77A 4YO9A 3E1XB 1YPEH 3NPSA 5IK2D 5C94A 1OP0A 4D7GA 2FLRH 3UWIA 2RG3A 3BTFE 4WXIA 2ZNKH 3RMOH 1MQ5A 4CBNA 3UOPA 2BY9X 4NGAH 2HPPH 1LVMA 2AERH 3UWJH 2AMDA 2OD3B 2G55A 1K1MA 5ESTE 1HAPH 2PP6A 2VGCC 1O32A 3F1SB 4NSYA 2YNAA 3D49H 1EAUA 4IN1A 1TE0A 4DOQA 1QZ8A 1KXAA 5C0TA 1EUFA 4X6NA 3A89A 1GHYH 1GBCA 3MNBA 2FOEA 3N7EA 1THPB 4ACBA 5B6OA 4A1XA 1AUJA 5C0UA 1HCGA 4FU8A 2LNCA 4AGKA 1V2TT 1QB9A 4E7RG 3AW0A 4U2WA 5A0AE 4FUJA 1P06A 1T8LA 3PLPA 4X1SU 1NFWA 4CBOA 1DXWA 3KCGH 1CSOE 2WPJS 5HKKD 3MNSA 1GI5A 1SGYE 2BMGB 4X8UH 1W3CA 1SLXB 4YOJA 1KTTB 1O5AB 1NFXA 2RDLA 3FOAA 1DY8A 5EJ1A 1O2SA 2SNVA 3U8OH 2ZHFH 5E0JA 4GVUA 5LPEA 5H4IB 2CF9H 3SYJA 3VB5A 1FNIA 3MNXA 1O30A 1FPHH 1GHBF 3SU2A 1O3LA 1F2SE 2PR3A 1QBNA 1GMCG 2GJGA 1C5VA 5BRRE 2FEQH 1EZQA 4K1SA 4Y0YE 2NU2E 2QXJA 4AFZA 3SNEA 3ATWA 2BVSH 2HNTC 3M61U 1PYTD 1MBMA 2G8TA 1FY3A 3A7WA 1O3EA 1K1NA 1LTOA 2FX4A 3F9HA 2BD9A 2CGAA 3T26A 4OGYA 3ZZ6A 1TABE 4NWKA 1E79D 5A0CA 2ZHWH 3VXEH 1QGFA 1P11E 2PGBB 4MTBA 2ZGCA 4AX9H 3TJVA 1LHEH 3C27B 3AW1A 2FYRA 3KQEA 1ZGIA 5KECA 1QJ6B 1C1PA 5T6FA 2JH5D 5E2PA 1GBLA 1UCYK 1WQVH 1YCPK 1AGJA 4RN6A 1NBMD 4HTCH 3UOUA 4Q7YA 1S82A 4B76A 1AVGH 2OK5A 2Z9LA 4TPYA 1E35B 1Z8RA 3A7XA 2Q6FA 3L3TA 1GVKB 4ABDA 3UTUH 3OU0A 1IQNA 5C5NA 3A7YA 4BTTB 1BMAA 3HGNA 4FXGH 1B7XB 1G32B 1T8OA 2FIRH 2R3YA 4B2AA 3TGJE 1C5TA 1GI8B 3BEIB 4Y8YA 4ASUD 1HUTH 3D23A 5LPRA 3RC4A 3TK6A 4ABEA 1NU9A 1GHAG 3GS9A 2YMSD 4D76A 1BB0B 2JETC 5DP7A 4INHA 4Q80A 3AVZA 3HATH 1EB2A 3UR6A 1GI3A 1E1RD 1P2IA 4BANB 1GJ6A 4X2VA 2XC4A 1G36A 1UMAH 3AAVA 1YY3A 3M36A 1YCPH 1UCYH 1YGCH 3RXPA 1TNGA 2IPQX 4AYYB 1INCA 1EZSC 1UVOA 4D9QA 3GY4A 4NA7A 2C90B 5EIYA 3VB6A 1SLVB 1XVMA 2P95A 1TFXA 2ODYB 3BTHE 1DDJA 1SHYA 3S9CA 1HAYB 1SOTA 2Y5FA 1FN8A 3GY8A 5T6DA 2BDIA 2F9UA 2BY6X 3ZV8A 1JOUB 4FUDA 3GCHB 5GXPA 1QQUA 1Y59T 3KN2A 4I33A 4I8KA 2ANKH 1ELBA 1KLJH 1NU7B 1GMHF 7GCHF 3V13A 2GP9B 4X1PU 3PROA 1FAKH 1BTWA 1DUAA 1LPGB 1BMLA 1GBIA 4HZHA 1QRZA 1GBHA 3OSYA 3T2NA 5A8XA 2O8UA 1ABJH 3MI4A 2XTTB 1A1RA 1GI4A 4CRBA 4B2CA 1FXYA 2EEKA 1TBRH 1CT0E 1Q3XA 1W7XH 1G3EA 2V35A 4Q63A 3RUOA 1FN6A 3MOCA 1LKAA 1K2I1 1TPAE 3AASA 3TH4H 1UTQA 1EKBB 1FIWA 5FX6A 2XWAA 1LDTT 1LVBA 5C20A 3G01A 3QUMP 1GBJA 1IQGA 1NT1A 2QA9E 4TSFD 4ISIH 2WHXA 2EC9H 4MNYA 3RLYH 1A3EH 4AOQA 4NIYA 3RXKA 1MTUA 1D6WA 1Z8JB 1K28D 2D26C 5JPMH 1C5NH 3SV8A 5A0BA 2RCEA 1J15A 3FKSD 2QN5T 3H5CB 1AD8H 1CGIE 2TGTA 2ZTZA 1AY6H 3MH5A 1MQ6A 4JK6A 1XUKA 1G3BA 1ELDE 1P9SA 3GDVA 5AHGH 3WY8A 2KZ4A 4AN7A 1N8OB 2GT7A 2WUCA 1RTFB 2FM2A 3ELAH 1GBBA 2WYJA 1FY5A 1NFYA 3U98H 4B75A 3DSPA 1GJ5H 4CRCA 1YPKH 3ZVGA 1NBME 4YT6H 5EGMA 4Q2KA 1ZR0A 3ZVDA 3EGKH 3LONA 2OC8A 2FO9A 1TNJA 1OWJA 1WAYB 2OBQA 3V0XA 4BAKB 1O3PB 3K65B 1TLDA 4BXWA 2EA3A 3W94A 1AZ8A 1WV7H 1TYNA 4YXWD 2Z9JA 1ZMJA 1BMMH 2M2AA 2WV4A 1VITG 1KXEA 4NIWA 4FU7A 2ZF0H 3WWBA 1C4U2 1O35A 3KEEA 1V2VT 1D3TB 4IW4E 2CHAB 1IQIA 3SJ9A 3M7QA 3OY5U 4FUBA 5TJXA 1D9IA 1PPFE 2ZHQH 1AVWA 3CS0A 1P2MA 2ZGJA 1LCYA 5E8EH 3M3SA 5TCAA 4OS2A 1UVSH 2A5AA 1FUJA 3CP7A 5BPEA 1Z8GA 1DY9A 1BTXA 1O5GH 2HALA 4X8SH 1KTSB 3RU4D 1ESTA 3F2FA 8LPRA 1BUIA 3RP2A 2BD8A 2VVUA 3O8BA 3OEED 1ZSKA 1T32A 2BXUH 1SBWA 1SQRA 5KEDA 1EPTC 2J94A 2WPKS 1HIAB 1S6HA 4Z0KA 2Q6GA 3M5LA 2CXVA 1P2JA 1IQFA 3MU0A 4RT1A 1MZAA 1PQ8A 1GBKA 2WPLS 2PUQH 1ANBA 1EB1H 1ZSLA 2L74A 1JMOH 3N7DA 4CRFA 2A2QH 2Y82A 1DSUA 1QB1A 2C8YB 5DSFA 1O2HA 3ZZDA 1AE8H 1GHXH 2SFAA 2QF5A 2F9PA 1FAXA 4K60A 2AEIH 1GJ9B 4U30A 3NWUA 4XDEA 2P94A 1D3PB 3LH1A 1KXBA 1HAVB 2Z9KA 1NTPA 5F8ZA 2G4UA 3SORA 1ELAA 1GCDA 1WOFA 4CHAB 1ZPCA 1T4UH 4BOHA 5AF9H 4UONA 1V2RT 1GBTA 1SLUB 1OOKB 1WUNH 1HAXB 2ESTE 1LO6A 5JYIA 2GDDA 4Z6AH 1SGRE 2AIQA 1HAHH 1QL8A 1SGNE 1B0EA 3F68H 3M5MA 5C2ZA 1GDNA 3ZVCA 4KTCA 3SNBA 4UFGH 5C17A 1IHSH 3P17H 1QL7A 1SB1H 2UUYA 3IG6B 4I8LA 4LZ1H 1O2WA 1OSSA 2J34A 3ZZ7A 4AB8A 5LGOA 1E38B 3MQKC 3LT3A 1RIWB 1C1SA 3NXPA 3EYDA 5T3HA 4UEHH 1O2ZA 3P92A 4ZH8A 1HYLA 3BEUA 1O2QA 3M37A 2ZHEH 1AFQB 2R0LA 4SGAE 2ILNA 2A31A 1PQ5A 3RM0H 3B23B 3SOSA 3LOXA 1RJXB 3SU4A 1DLEA 4IGDA 1GMHG 1YPMH 2PFEA 2SGAA 1FPCH 3ENSB 3U8TH 3RXBA 3ZIAD 2J97A 2BQWB 2XBXA 3RXEA 4I8JA 3GDSA 5DG6A 1TA6A 4ZXYH 2ANWA 4OS4A 2XC5A 1QHRB 1SFIA 5HM2A 1QL9A 1RD3B 1T8MA 2ULLA 3QZQA 1SSXA 3RMLH 4YZUA 1X7AC 3A8BA 3M5OA 3ZZ8A 6ESTA 2ZP0H 1C2EA 1GI1A 3PMJA 2J38A 1Y3UA 2VIDA 2W7UA 1L1NA 5CHAB 2ASUB 1SMFE 4Y71A 1O5FH 1NZQH 3M5NA 3SUFA 4AFUA 5EXNA 4WVPE 3HKIB 1AO5A 1O2VA 2ZFRH 1NY22 4ABFA 4ABJA 1RS0A 4X8TH 3A80A 1XUJA 1ETSH 1SQTA 3JZ1B 5FPYA 2V7QD 1HJAB 1NROH 1WTGH 3F2GA 1GJ4H 1IAUA 1GI6A 1ELGA 3ITIA 1MD7A 1MKXH 4YLQH 2CK3D 4IMZA 2K1QA 2GZ7A 2HLCA 1GJ7B 2PW8H 3RXVA 1TGCA 2WPMS 5IYTA 1O2TA 5DN6D 5C1UA 2GZ9A 1YPGH 2UWOA 3UAIC 2OBOA 5L2YH 2CF8H 1UVUH 2STAE 3ZVAA 3PLBA 5HIZA 3BTWE 1GDUA 4H42U 3MO3A 1TPSA 2VNTA 1BBRH 2PTCE 4THNH 4X8VH 1O2GH 2TRMA 1EX3A 5CE1A 4R8TB 4GUXA 3BTKE 1ANDA 1ETTH 1Y8TA 2F9NA 1SGQE 2FOAA 4WWYA 2OUAA 1E1QD 1VITH 1C5RA 1CVWH 1K21H 3ATMA 4IMQA 1OWDA 1AVXA 3EA9A 1RRKA 4LXBH 1C9TA 2F9OA 1YYY1 3MTYA 2B5TB 1BQYA 1S5SA 4MPVA 1GL0E 1QBOA 1JXPA 5JBCS 4Y7AA 1ZRBA 1W11U 3OTJE 1K1JA 3RXMA 3ZZCA 2XBWA 3FANA 1QFKH 1S85A 4I8HA 4B1TA 1P3CA 1H8ED 1ZMLA 1O31A 1FMGA 4IBLH 2AH4X 2BLVA 3A83A 1DLKB 2SGPE 1YPHC 3PM3A 4F49A 1P05A 2Q6DA 3SUDA 2XNDD 3E91A 4QT8C 1CGHA 1ZMNA 4E05H 2Z9GA 1SHHB 1JIMA 3ZYEA 4UE7H 2EY4C 2WV5A 2ZEBA 3GCHC 4AGJA 4WY3A 1ORFA 1IQEA 1LKBA 2RA3A 1BHXF 1EAIA 3RMNH 3RXUA 4LZ4B 4ACAA 1BOQA 1T7CA 1VGCB 1RXPA 3FO8D 3RXOA 1AHTH 2ZDMA 1IHTH 5J4SA 1KDQB 1TRNA 4BTIB 6GCHF 3SGQE 3QZRA 2J4IA 2Y6TA 2QE7D 1RGQA 1YBWA 2ZPSA 1AU8A 5HMAA 3BF6H 1XUFA 3S0NA 2BD7A 1GJBB 3L6PA 3NCLA 3MNCA 4ABGA 3F9FA 1ANCA 1DS2E 2BDHA 3PV4A 1GBDA 4DIHH 1EP6A 2LP6A 2HVYB 4YTAA 2FPZA 1SKYE 3DUXH 1OWHA 3SZEA 4WMEA 2ALVA 3TITA 1GHWH 1A0JA 3LU9B 3SZNA 4TYDA 1BRBE 2W3KA 2BQ7B 1GCTB 1OWIA 4AG2A 2Z6BD 4KKDA 1JWTA 5L2ZH 3TJUA 3PMHB 1VJAU 3KHVA 5DJ7A 1EOJA 1EJAA 1GWAA 1KMHB 1O2MA 2OINA 1TRMA 2ZPRA 3SGAE 1TX6A 5EJZA 2OP9A 3RXTA 3HPTB 4MVNA 4NCYA 1ESBA 1AB9B 4K5ZA 3PO1B 1TNHA 1N8OC 4Y8XA 4H4FA 2CV3A 4MNXA 2UWLA 4LOYH 1G3CA 1MZDA 4OGXA 1KXFA 1HXEH 1TA2A 4ZKSU 1MCVA 1V2JT 1K1LA 1NFUA 3I29A 2ZPQA 1BTPA 2JH0D 4MDSA 1JIRA 2XCNA 4GLYA 2QGRA 4OS1A 1TONA 2ANYA 2VU8E 3DHKH 3F9GA 8ESTE 1C2IA 2J5UA 1O36A 4BNRA 4K1TA 1BMFD 4MQAA 3LH3A 1V2ST 1LHGH 3PTBA 3Q00A 4IS5A 1CA0B 2EI7A 3SO3A 2R3UA 4GHQA 2B0FA 1ARCA 1CQQA 1H9IE 5HGGA 3S69A 3U9AH 2TIOA 3GYLB 3KYGA 1IQLA 3RXJA 1S84A 3SU1A 2OQ5A 1GMDG 4ZHLU 2CMYA 4GSOA 1W0ZU 2CHAC 1W0YH 1UTLM 4O9VA 1P2KA 2ZECA 1DFPA 2EI6A 1HV7A 2STBE 1D3DB 2ZQ2A 3T25A 3CNRA 5GWZA 3UFAA 3SJIA 4A1VA 1C2KA 5EQRA 1QRXA 3MFJA 1LVOA 4NZLA 1NC6A 4XBCA 3MHWU 1UTPA 3NZIA 4ZROA 4E7NA 1BHXB 1SGEE 1C9PA 1MTNB 2KCAA 2XWBI 5FHTA 1VZQH 1A46H 1DUEA 2F4LA 2DE9A 3W1EA 1O3KA 3MH7A 1V3XA 3E6PH 4FUCA 1C2JA 3TGIE 3KIDU 1TNIA 1CBWB 3EAJA 1SGIB 3CENA 4CRAA 4Y8ZA 1ID5H 1WDIA 3UNRA 1AFEH 1QB6A 2VH0A 3M7TA 4VGCC 1P3EA 2H1UA 4B6FA 1OYTH 2BDAA 3DA9B 1TPPA 1W7GH 3ODFA 1DT2A 3VB4A 1ZJKA 1C5YB 1FDPA 4JMYA 1F0SA 3ATKA 4Q7ZA 3UIRA 3IITA 4M7GA 2W5EA 4Y7BA 4JZFH 1C5WB 2QF0A 4I7YH 1G2MA 2SGEE 1O33A 2VVCA 2H5CA 2PKAB 4B71A 4CHAC 4Q7XA 5GPIB 3VGCC 1OP2A 1C4V2 1XUIA 2O8WA 1THRH 1BTYA 3A8CA 4WH8A 2NU1E 3S7HB 2THFB 1Z6JH 2ZCKP 4GHTA 1O3OA 2FI4E 1SLWB 2ZFSA 1EZUC 2HOBA 4ZKRU 2ZQ1A 3ZZ4A 3KYFA 1O34A 3MMGA 2P16A 2FESH 3U28C 2GMTB 2SNWA 1XX9A 2R2WU 3E8LA 1HLTH 1P04A 4TWYA 3LGTA 3TJNA 2PSXA 4JK5A 3F0OA 2ZDKA 3QX5H 1LHCH 1LQEA 2FI5E 2A4GA 1GHVH 1RIWC 2VIQA 2FZZA 1PQAA 4X2YA 4WXVA 3ZV9A 2GX4A 2GCHG 1ELVA 1TGNA 1AFQC 3GCTF 1O3MA 1QBVH 1UVTH 2XOKD 1AQ7A 2LPRA 3BTQE 4CREA 1SQAA 1ZSJA 4ABAA 3PRDA 2JIZD 2D1JA 4D7FA 1EP5A 1F0UA 1SPJA 1O2KA 4AG1A 6LPRA 2YMSB 3N7OA 4PROA 4MLFB 4UFDH 1A3BH 1HIAA 1C1QA 1S6LA 3P95A 3Q76A 3HGPA 2KAIB 3B8JA 2PTNA 2Z3CA 3LGWA 8GCHF 1GPZA 1P03A 1ZHPA 3PYHA 2HGTH 1EATA 4FOUC 3A8AA 3RXLA 4DIIH 3OE7D 2IOTA 4TY7A 5CHAC 2C8WB 1UJ1A 2GT8A 3GDUA 4D9RA 1HPGA 1C5LH 4GAWA 2BZAA 5E0HA 1CE5A 4O3UA 1TGTA 1UTOA 2HVXA 1HAVA 1HJ9A 5FXLA 1HAIH 1Z8IB 3QLPH 3URCA 2ZGHA 1OWKA 1CHGA 3A7TA 1B5GH 2IJD1 3GYMA 1F7ZA 2BD2A 2P3FH 4MPXA 4INLA 3TK9A 3LGYA 3FP6E 5EPNA 3SNCA 2GGVB 1HJAC 1QJ7B 3A82A 1ABIH 1BA8B 2PV9B 4F48B 4AC9A 2FDAA 4DCDA 1O5CB 2AHME 3O8DA 1G3DA 3PV2A 2BB4A 1XXDA 4JCNA 1BTZA 1HNEE 1LQDB 3S9BA 3UR9A 4YOGA 1YPHE 8KME2 1LPZB 1GGDB 5EU8A 2W7SA 1QNJA 2I6SA 1HDTH 1O2UA 2FOCA 1S0QA 4AFSA 1SOZA 1V2QT 1ELTA 4ZAEA 1P8VC 1LPKB 2QXHA 3GY3A 2B9LA 5E0GA 1EASA 5GDSH 5F03A 2M5TA 2BXTH 1GJCB 3DFLA 5ABWA 1ELFA 1GHBG 3ATIA 3D65E 1QRWA 2GTBA 2AFQB 4X0WU 5JBBS 3P8FA 1ACBE 1BBRE 1LHDH 2FODA 1NO9H 2B8OH 4TWWA 4YT7H 7LPRA 3A88A 1ELEE 1UK3A 2VINA 4K3JA 1A4WH 1CHOF 4DW2U 1GG6C 2ZCLP 3RXRA 9LPRA 1TGSZ 4X6MA 2UUKB 4JZDH 3MO6A 1TALA 2VH6A 3LJJA 3P8OA 2FS9A 1Y3WA 2C3SA 1UTJA 1DWEH 1C5UA 1EXFA 2BY7X 2P59A 4IC6A 3GY7A 5FPTA 2ZTXA 3R0FA 3A87A 4INKA 2GCTB 2OTVA 1HRTH 4ZXXH 2VIPA 2XYAA 2A4QA 1AMHA 1S81A 1PQ7A 4NSVA 3HKJB 1V2KT 1QTFA 3OYPA 4ISHH 2GD4B 4O97A 1OS8A 1IQMA 1HGTH 3BIUH 3SUEA 1GL1A 1QY6A 2ODPA 2R2MB 2ZIQH 4AB9A 4YM9A 4ABIA 1P2OA 4YESB 1VGCC 2Q1JA 3EQ0H 1FLEE 1NRSH 2DUCA 4ZKOU 3TU7H 5IDKA 2H9EH 3TPIZ 1F92A 5A09A 3URDA 1GJDB 1TBZH 3RXAA 4ZCNA 2FI3E 1GJAB 3T28A 1GI7B 4DJZB 1JRSA 1UHBB 4XD7D 1ZRKA 4DVAU 2Y7XA 2FWWA 2ZU3A 4ABBA 2JETB 1ARBA 3T27A 1OX1A 2OQUA 1YCPM 3DCLA 2D2DA 3EDXB 1MUEB 3MU5A 4HI3A 1ZJDA 1C2LA 2F43B 1Y5UT 3BIVH 1V2LT 1VCPA 1K0HA 1XMNB 2PGQB 1YKTA 2P3UB 4A6LA 4OS6A 2FXRA 2QF3A 3SQHE 4Y76A 2G5VA 1GBAA 3SHCH 1V2MT 1GBFA 3A84A 3VG8A 4D8NA 3TGKE 4ASHA 4NA9H 1Y5AT 4A92A 1JRTA 4XSKU 3PWCA 2HNTE 1O3CA 2L6OA 2QC2A 2AS9A 3SNDA 2PSYA 3MWIU 2PWXA 1DICA 1W8BH 1GVZA 3ZZAA 5HIYA 3BG4B 2A7JA 2VWLA 4A7IB 4FVDA 2YOLA 3GY6A 2ZHDA 4F4OC 4K69A 3STJA 4IC5A 4SGBE 1K9OE 1AB9C 3PO1C 3ZVFA 4B2BA 1PPEE 1TWXB 3ZVEA 3H7TA 2ZU4A 4UFFH 7GCHG 1XUHA 3ZVBA 1O3BA 4NWLA 2ZFQH 1OHHD 2O9QA 1T4VH 4CRGA 2JDID 1W13U 3P8GA 9ESTA 2Z94A 5HYOA 1O3GA 1A2CH 2XC0A 1ANEA 1FIZA 2A1DB 1ZYOA 3GCTG 1Y5BT 3BSQA 2J92A 1SGTA 1PPBH 1ZHRA 5DP3A 1S6FA 1UTNA 1XUGA 2P93A 3Q3KA 2LELA 3F0PA 1CA0C 1FQ3A 1NRRH 1J9CH 4Y6DA 2PLXA 3OEHD 1HBTH 2VWMA 4Y11E 1DITH 4WMDA 1MCTA 5EXMA 2G52A 4KGAA 1D3QB 5T6GA 1KDQA 2F83A 1W2KH 1AI8H 3BTGE 1UK2A 1L2EA 1C2DA 5K0HA 2ZDVH 4ISLA 5PTPA 4JYUH 8GCHG 5EJLA 2OCVB 3T62A 5CHBA 5FCKA 4X6OA 4DT4A 2AMPA 4MNVA 3S7KB 1KSNA 1TMUH 3SJ8A 1SC8U 3KQDA 1XVOA 1YLNA 3SW2B 1V2PT 1YM0A 5AVDA 2GV6A 1WXRA 3LGUA 4ZMAH 1XKBC 3RXGA 5GCHF 2FOMB 1O2RA 2NU0E 4X2XA 3PWBA 2DE8A 3PV5A 5C67A 3RU4E 3DSOA 2KR7A 3A86A 1J14A 5FX5A 2C8ZB 4NG9H 1MTNC 2EQNA 4OS5A 4ZHMU 4B73A 1EJNA 1MABB 2ZFFH 3UREA 4ABHA 2WZQA 2KFWA 2A7HA 3SV2H 3ZYDA 3KNXA 4X1RU 3H7OA 1HAZB 2ZI2H 1O2XA 2G5NA 5G4BA 1Y3VA 3A85A 1H8DH 1FV9A 1GDQA 2FX6A 1L4ZA 4AORA 4DURA 5F8TA 4J2YB 3M7UA 2CN0H 3A7ZA 1O2PA 2KCPA 2BDGA 4NFEA 2QY0B 4TPIZ 1PYTC
chains in the Genus database with same CATH topology
3SUGA 1LMWB 5AFYH 1UO6A 1G37A 2BOKA 5HM9A 2CJIA 3MO9A 3W95A 2H5DA 3JZ2B 4XOJA 1MU6B 2GV7A 3Q77A 3V3MA 1DE7H 3T5FH 1QQ4A 1UCYE 2V3OH 2J9NA 2FYQA 2XBVA 6CHAB 1TQ0B 1EJMA 1TOCB 4JYTA 5FBIA 2O8TA 1AUTC 3SV9A 1NRQH 1MD8A 2FMJA 1ZLRA 5DO4H 2TBSA 1KY9A 4XBDA 3SV6A 1EQ9A 2ZA5A 3SI3H 1IQJA 3TNSA 1Z71A 3QO6A 5FBEA 2GMTC 3SJKA 1TB6H 1OKXA 4WF8A 2ODQA 1C2MA 3MH4A 1E37B 2VB0A 1P12E 1QJ1B 3FAOA 1EPTB 1N1LA 1ZZZA 2AMQA 3LC3A 1A0HB 4WH6A 2BD5A 4DY7B 3E0PB 1PPHE 1OYQA 2BY8X 3FP8E 2BOHB 3RC5A 1E36B 1Q2WA 1P2QA 1C1NA 3P70B 5JBAS 1NRPH 1F5KU 3DFJA 2Z3EA 1OXGA 2SGFE 5DP6A 1MTVA 3NK8A 1LHFH 1FJSA 4NFFA 1MMJN 3MU1A 1FZZA 3TH3H 3U8RH 2BDCA 1TPOA 1C5QA 4RSPA 2IJOB 5DP9A 1XKAC 1QIXB 3ZZ5A 1AN1E 2Y7ZA 1V2UT 1Y3XA 4ESTE 2AGEX 3BTTE 2VVVA 2G81E 1Z1JA 2BYAX 1SGCA 1ETRH 3PLKA 5DK1A 3MU8A 4FVBA 3ZZ3A 2BDYA 2P8OB 2A7CA 3D62A 2AGIX 2PKAA 2Z7FE 1K1PA 2QYIA 1DM4B 4WJG2 5JB8S 1BCUH 3SU0A 3SQEE 5EPYA 5EQQA 4ISNA 1NESE 3TIUA 2HRVA 4DGJA 2R9PA 3SGBE 1FY1A 2FTMA 1UTMA 2C8XB 1GGDC 3RXCA 1TNLA 3LDXH 2WPIS 3KQCA 2VIWA 1L1JA 1HAOH 2C93B 1EAWA 3TVJB 2ZFPH 2PKSB 2A5KA 1GI9B 1VITF 3U1IB 1DWBH 2H2ZA 4AFQA 4I8GA 3LC5A 1V2WT 1PPGE 3LPRA 4AYVB 4XFQA 1ZPBA 2GVFA 5DGJA 4CRDA 3PTNA 1L0ZA 1AKSB 1UTKA 2AYWA 3R3GB 5FCRA 2EI8A 3SU6A 1VCQA 3BTDE 1TMTH 1DWCH 3I78A 1NPMA 1V2NT 4DT7B 2Y5GA 1SGPE 2FTLE 2KAIA 4JZEH 1O2OA 3VB7A 1CA8B 2XBYA 2WYGA 2ZDAH 3BN9A 1O3AA 4RKOB 1KXDA 2ZU5A 1H1BA 1TNKA 3EA7A 4Y79A 1PJPA 4BAHB 3E90B 1J16A 4J1YA 2B7DH 3OY6U 2GCTC 1IQKA 3K9XB 5GCHG 3SU5A 1P09A 2GDEH 4Y10E 2BD4A 3DT0H 2A45B 2UUFB 1O3FA 5EG4A 1T31A 2QV1A 4K8YA 4ZHAA 1QA7A 2QXGA 1W12U 5C1YA 1C4Y2 5JB9S 4XE4A 1GI2A 2NWNA 1FY8E 3T29A 2VWNA 3QGNB 3A81A 3GOVB 4B74A 1SL3A 2PUXB 1ELCA 1P9UA 1BRUP 2H9TH 1W14U 3UUZA 1BT7A 1BDAA 3SN8A 1XXFA 3PB1E 2QAAA 1VJ9U 4MG3A 2XXLA 1WBGB 1ZTLA 5C1XA 1BIOA 1CO7E 5L6NH 2HNTF 4KELA 4UD9H 3RXSA 3GY2A 1P01A 1TX7A 5LH8A 4GCHF 3F9EA 1SQOA 3RM2H 4U32A 1C2HA 3UQOA 2BQ6B 4JZIA 1MH0A 3SI4H 3QK1A 1C1VH 1C5SA 2ANMH 1DWDH 3ATLA 3Q3XA 3RXFA 2AIPA 4XBBA 2BM2A 3P8NA 1OWEA 1JBUH 1M9UA 4O03A 2XNIA 2Z3DA 1C5OH 2F91A 4NZQA 2XCFA 1ESAA 1BJUA 1KXCA 2IN2A 1MU8B 4CR9A 1C1TA 1YC0A 1V6DA 3BG4C 5SGAE 1AWFH 2F9BH 1F5RA 4K2YA 5HXFA 1F0TA 1K1IA 1N6YA 5CMXH 3ZZ9A 1GI0A 3AAUA 1O3NA 5JDUB 3FP7E 2HWLB 2Y5HA 3TJOA 1GJ8B 5DP5A 1MKWK 1NN6A 1P02A 4TY6A 1O2LA 1BJVA 1EAXA 2A2XH 6GCHG 1L1GA 1C2FA 1D4PB 3BG8A 1MAXA 4E06H 3RU4T 1KYNA 4YLUA 1PPZA 4NA8A 1C1MA 1O39A 2ZKSA 3OX7U 1Z6EA 3BV9B 5L30H 4X2WA 1SGDE 1FY4A 3U69H 1DSTA 1OPHB 1W10U 1SFQB 2VGCB 3HK3B 1FI8A 2Y80A 2Y81A 4U01A 5DP4A 2BTCE 1HXFH 5E2OA 1UHBA 2G4TA 4HFPB 1K1OA 3ZZBA 3UNQA 2A32A 1A5HA 1TX8A 1O2JA 1H4WA 3KL6A 4Y0ZE 1TGBA 2UUJB 2OC1A 1AIXH 1RTLA 2QCYA 4ZKNU 1A0LA 2O8MA 5GIBA 4DG4A 2ZTYA 3FVFB 1MKWH 3FFGA 1GBMA 3VB3A 2W3IA 3IWMA 1O3IA 3K2UA 3U1JB 3DD2H 1C5ZB 1B0FA 5JBTA 1CGJE 2I6QA 2OLGA 1SGFA 1VCWA 3RLWH 4ZUHA 1HJ8A 3GICB 3LIWA 2TGPZ 4FUIA 4H6SB 4I32A 1E0FD 4NIVA 3SNAA 1S0RA 4KP0A 1YPLH 1GVLA 3MU4A 7KMEH 1DOJA 1O3JA 4CH8B 5F6MA 1TRYA 3UNSA 1DVAH 1FONA 2XRCA 1E34B 2RA0A 2ZFTA 1YPJH 1D6RA 1MBQA 3GCNA 4UFEH 2XW9A 4X6PA 1A61H 1GBEA 4YOIA 3GCOA 3EA8A 3RXDA 2BVRH 3SU3A 2FOFA 5K7RA 1EZXC 5FAHA 1L4DA 2WINI 1C1UH 2VWOA 1F5LA 1SI5H 1BTUA 1N6XA 6CHAC 1YF4A 2ZC9H 4CH2B 1J17T 4BAQB 5AFZH 3QN7A 1DPOA 1G9IE 1CU1A 2FOGA 2ZU2A 3NKKA 1ZTJA 2VIVA 3GY5A 4UDWH 2WPHS 1XM1A 3QGJA 1THSH 1O2NA 5ESBA 4MPUA 5C5OA 4FU9A 3M3VA 2J95A 1YLCA 1Q31A 1Z7KA 3VEQB 3QWCH 1MAYA 1A7SA 2JH6D 4A1TA 1S83A 1F0RA 2HPQH 4FUGA 2ZDNA 4CR5A 1P0SH 4GPGA 3ODDA 4VGCB 1H9HE 3QTOH 3EE0B 1KIGH 4H6TA 2GZ8A 1O2YA 2SGQE 3NUMA 2V0BA 1WQSA 3A7VA 3M35A 2ZGBH 3TLOA 5C3NA 2BHGA 2UWPA 2JKHA 3V7TA 1U6QA 4JZ1A 1C5PA 1NS3A 2BDBA 1O3DA 3FZDA 4NIXA 3UPEA 2QXIA 2SGDE 1RTKA 3RC6A 3VGCB 4BAMB 2ZGXH 1KLTA 3QDZB 1GCTC 1RFNA 1Z1IA 1G2LA 1H8IH 3E3TA 1GHZA 2BLOA 4LK4A 2AGGX 4RKJB 4FUHA 3S9AA 2ZCHP 1WSSH 2BY5X 4GCHG 2O8LA 4HGCA 2ZWLH 2QIQA 2W26A 2FOBA 3HK6B 2YNBA 2P8OC 3TNTA 1IQHA 1BITA 1SVPA 1PPCE 3A8DA 4IN2A 1O37A 2VJ1A 1HB0B 1P57B 2PHBA 3E16B 1TQ7B 1O5EH 2A0QB 1ZTKA 1CT2E 1DANH 1MTSA 4R0IA 3KF2A 4KTSA 4WMFA 3SHAH 1C1OA 3UQVA 1BTHH 2OXSA 1J8AA 1GMCF 3M3TA 3PMAB 1EOLA 4AZ2B 1ZHMA 2G00A 3MYWA 5A8YA 1WYKA 3L33A 1G30B 1MKXK 3O8CA 1EPTA 1DXPA 3P6ZB 1QA0A 7ESTE 2FOHA 3SV7A 2PKSC 1MTWA 1SG8B 3F6UH 5A8ZA 2J2UA 1GMDF 1CT4E 1AE5A 1PFXC 3LJOA 2VIOA 3SBKA 4BXSA 2BLQA 1H9LB 4MNWA 3QTVH 1WTHD 1NM6A 5LPFA 1WU1A 1BBRK 1BRCE 5EODA 2R0KA 1KLIH 1TOMH 1UVPA 3TH2H 2BX4A 5A2MH 2BZ6H 2IPHA 5DPAA 5EW2H 1Y3YA 1ZOMA 3BTEE 4BTUB 4X1QU 3K6YA 1TAWA 2G51A 3TK5A 2NU3E 1SGFG 3E0NB 1TBQH 4MPWA 3RMMH 3O8RA 2ALPA 1AWHB 2FLBH 2FS8A 5GJ4B 1V2OT 4KTUA 1T8NA 2A4RA 3LKWA 1CBWC 5ETXA 2ZG0H 1O0DH 1LVYA 1C1RA 2C4FH 2TGAA 3PMBB 5J4QA 5I25A 4JYVH 3KGPA 5DP8A 4OS7A 4FUFA 1WCZA 3RXHA 1GHAF 3RDZA 3RXQA 3ESTA 3FZZA 2FP7B 1BMNH 1YP9A 2BX3A 3Q3YA 3UY9A 2GKVE 3VXFH 1BZXE 2D8WA 2H6MA 2BD3A 4A5TS 2ZO3H 5EW1H 3BTME 5FPSA 1O3HA 1TIOA 1HAGE 2H9HA 1C2GA 1QCPA 2ZU1A 4K1EA 3CS7A 1P10A 3MH6A 1BRAA 1K22H 2F9VA 2V3HH 2P3TB 1QURH 4BAOB 2NU4E 3SJOA 1UK4A 3B9FH 1GG6B 1CHOG 4X1NU 2A4OA 2BVXH 3LGIA 1A5GH 4ISOA 3K6ZA 4I31A 3GISB 1YLDA 1IOEA 3RXIA 3C1KA 1DX5M 1ZPZA 1SR5C 3KQBA 2V6NA 1OP8A 1AKSA 1HFDA 3STIA 4O3TA 1O38A 2F3CE 1QR3E 4K8BA 2GCHF 2OC0A 1C5XB 5F8XA 5EOKA 5EXLA 1O2IA 1C1WH 1O5DH 1C5MD 5EQSA 1NRNH 4FUEA 2TGDA 3VFEA 2ZDLA 1O5BB 2OC7A 1TMBH 2TPIZ 2Z9IA 5DKMA 3BEFB 5I46H 3LGVA 1VR1H 3VPKA 2ZZUH 3V12A 5TCCA 1P2NA 1ZGVA 2WUBA 2BLWA 1A5IA 1AZZA 2A5IA 3I77A 4YO9A 3E1XB 1YPEH 3NPSA 1OP0A 4D7GA 2FLRH 3UWIA 2RG3A 3BTFE 4WXIA 2ZNKH 3RMOH 1MQ5A 4CBNA 3UOPA 2BY9X 4NGAH 2HPPH 1LVMA 2AERH 3UWJH 2AMDA 2OD3B 2G55A 1K1MA 5ESTE 1HAPH 2VGCC 1O32A 3F1SB 4NSYA 2YNAA 3D49H 1EAUA 4IN1A 1TE0A 4DOQA 1KXAA 1EUFA 4X6NA 3A89A 1GHYH 1GBCA 3MNBA 2FOEA 1THPB 5B6OA 4A1XA 1AUJA 1HCGA 4FU8A 2LNCA 4AGKA 1V2TT 1QB9A 4E7RG 3AW0A 4U2WA 5A0AE 4FUJA 1P06A 1T8LA 3PLPA 4X1SU 1NFWA 4CBOA 1DXWA 3KCGH 1CSOE 2WPJS 3MNSA 1GI5A 1SGYE 2BMGB 4X8UH 1W3CA 1SLXB 4YOJA 1KTTB 1O5AB 1NFXA 2RDLA 1DY8A 1O2SA 2SNVA 3U8OH 2ZHFH 5E0JA 4GVUA 5LPEA 5H4IB 2CF9H 3VB5A 1FNIA 3MNXA 1O30A 1FPHH 1GHBF 3SU2A 1O3LA 1F2SE 2PR3A 1QBNA 1GMCG 1C5VA 5BRRE 2FEQH 1EZQA 4K1SA 4Y0YE 2NU2E 2QXJA 4AFZA 3SNEA 3ATWA 2BVSH 2HNTC 3M61U 1PYTD 1MBMA 2G8TA 1FY3A 3A7WA 1O3EA 1K1NA 1LTOA 2FX4A 3F9HA 2BD9A 2CGAA 3T26A 4OGYA 3ZZ6A 1TABE 4NWKA 5A0CA 2ZHWH 3VXEH 1QGFA 1P11E 2PGBB 4MTBA 2ZGCA 4AX9H 3TJVA 1LHEH 3C27B 3AW1A 2FYRA 3KQEA 1ZGIA 1QJ6B 1C1PA 5T6FA 2JH5D 5E2PA 1GBLA 1UCYK 1WQVH 1YCPK 1AGJA 4RN6A 3UOUA 4HTCH 4Q7YA 1S82A 4B76A 1AVGH 2Z9LA 4TPYA 1E35B 1Z8RA 3A7XA 2Q6FA 3L3TA 1GVKB 4ABDA 3UTUH 3OU0A 1IQNA 5C5NA 3A7YA 4BTTB 1BMAA 3HGNA 4FXGH 1B7XB 1G32B 1T8OA 2FIRH 2R3YA 4B2AA 3TGJE 1C5TA 1GI8B 3BEIB 4Y8YA 1HUTH 3D23A 5LPRA 3RC4A 3TK6A 4ABEA 1NU9A 1GHAG 4D76A 1BB0B 2JETC 5DP7A 4INHA 4Q80A 3AVZA 3HATH 1EB2A 3UR6A 1GI3A 1P2IA 4BANB 1GJ6A 4X2VA 2XC4A 1G36A 1UMAH 3AAVA 3M36A 1YCPH 1UCYH 1YGCH 3RXPA 1TNGA 4AYYB 1INCA 1EZSC 1UVOA 4D9QA 3GY4A 4NA7A 2C90B 3VB6A 1SLVB 1XVMA 2P95A 1TFXA 2ODYB 3BTHE 1DDJA 1SHYA 3S9CA 1HAYB 1SOTA 2Y5FA 1FN8A 3GY8A 5T6DA 2BDIA 2F9UA 2BY6X 3ZV8A 1JOUB 4FUDA 3GCHB 5GXPA 1QQUA 1Y59T 3KN2A 4I33A 4I8KA 2ANKH 1ELBA 1KLJH 1NU7B 1GMHF 7GCHF 3V13A 2GP9B 4X1PU 3PROA 1FAKH 1BTWA 1DUAA 1LPGB 1BMLA 1GBIA 4HZHA 1QRZA 1GBHA 3OSYA 3T2NA 5A8XA 2O8UA 1ABJH 3MI4A 2XTTB 1A1RA 1GI4A 4CRBA 4B2CA 1FXYA 2EEKA 1TBRH 1CT0E 1Q3XA 1W7XH 1G3EA 2V35A 3RUOA 1FN6A 3MOCA 1LKAA 1K2I1 1TPAE 3AASA 3TH4H 1UTQA 1EKBB 1FIWA 5FX6A 2XWAA 1LDTT 1LVBA 5C20A 3G01A 3QUMP 1GBJA 1IQGA 1NT1A 2QA9E 4ISIH 2EC9H 4MNYA 3RLYH 1A3EH 4AOQA 4NIYA 3RXKA 1MTUA 1D6WA 1Z8JB 1K28D 2D26C 5JPMH 1C5NH 3SV8A 5A0BA 2RCEA 1J15A 2QN5T 3H5CB 1AD8H 1CGIE 2TGTA 2ZTZA 1AY6H 3MH5A 1MQ6A 4JK6A 1XUKA 1G3BA 1ELDE 1P9SA 3GDVA 5AHGH 3WY8A 4AN7A 1N8OB 2GT7A 2WUCA 1RTFB 2FM2A 3ELAH 1GBBA 2WYJA 1FY5A 1NFYA 3U98H 4B75A 1GJ5H 4CRCA 1YPKH 3ZVGA 4YT6H 5EGMA 4Q2KA 1ZR0A 3ZVDA 3EGKH 3LONA