1DPOA

Structure of rat trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDCGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.59 A structure of trypsin at 120 K: comparison of low temperature and room temperature structures.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Serine protease
molecule keywords TRYPSIN
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dpoA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1dpoA02
3SV9A 3A7WA 5FPTA 1SGCA 2B5TB 2ZCHP 5EQSA 4NIYA 1CBWB 4IMQA 1EATA 4AOQA 2J4IA 3RUOA 1SGFA 2STBE 1H4WA 2OQ5A 1C5RA 1C9TA 3SOSA 3B9FH 5LGOA 1J14A 2A4RA 5EGMA 2SGQE 2W5EA 1BUIA 1KXEA 4YZUA 4GSOA 1KXBA 2WPLS 1O39A 2UUJB 2A7CA 3ODDA 1O2TA 1H1BA 1KDQB 1O3PB 1HDTH 1G3CA 2Z3CA 5FX6A 2FPZA 3SV6A 4D9RA 4HI3A 1HAOH 2OC1A 3SUDA 3A82A 1K2I1 7LPRA 2F9BH 1MQ6A 3JZ1B 5DP6A 3RU4T 1QBVH 4FUJA 1O2KA 4QT8C 1AB9B 1CA0B 1S85A 1AVXA 2TIOA 1RD3B 1OSSA 3TITA 2GVFA 1ZGVA 3BTDE 1TAWA 3T26A 1C1VH 2BLOA 1TNGA 1TALA 1F5KU 1FY5A 2SNVA 1THRH 2GP9B 2ANYA 2OBQA 3H5CB 1GHAF 2Z3EA 3EAJA 1YKTA 3SJ9A 5HXFA 3TPIZ 2LNCA 1Q2WA 1DLEA 2Z9KA 2Z3DA 1LO6A 3GY7A 3MU5A 4IGDA 5JBAS 1TABE 4X1SU 1QRWA 5F8XA 1TNIA 2ZGHA 2HNTF 4Y8YA 3E91A 1Y3VA 4ZHMU 1PPHE 3TGJE 2AGEX 1NM6A 4B1TA 1ZTJA 2XC4A 2BQ7B 5EG4A 5C2ZA 1EXFA 2AERH 2HNTE 5GPIB 3TGKE 1LMWB 3C1KA 3EA9A 4AGJA 2XC0A 3ZZDA 2ZC9H 2HLCA 1W0ZU 1AU8A 4RN6A 2HPQH 1C5LH 1B5GH 3GCTF 1JOUB 4ISOA 1OYTH 3TU7H 1O2VA 1OP8A 1P2MA 4IW4E 1PFXC 2ZDKA 2WPKS 1C5SA 1HJ8A 2ZGJA 1S81A 3F9FA 3P8NA 2ZGXH 2FX6A 2SGPE 3QGNB 2J2UA 2ANMH 3RLYH 5JB8S 2W3IA 3HK3B 1P3EA 3RXQA 4DURA 4MNXA 1K1JA 4BTIB 4JZEH 3RXEA 1C1QA 1EASA 3OSYA 2ZDNA 3BTME 1DANH 3PROA 1LVOA 2IN2A 2H2ZA 3QO6A 1DICA 1V2TT 2HALA 2G81E 1YPHE 2WUCA 8KME2 3FP6E 3OY6U 3RXOA 4X2WA 1ZOMA 1F5LA 1RXPA 1AFEH 1C1WH 4JYVH 3O8CA 4X2YA 1UVOA 1ARBA 1MTWA 1QBNA 3UWJH 3CENA 1GHXH 1C2GA 5A0BA 3Q3KA 1V2JT 1GI4A 4D7FA 5DP9A 1BIOA 1SGYE 3KN2A 1GVLA 3SU2A 2WV4A 3B23B 1C1PA 2UWLA 1G36A 5EQRA 1P0SH 1UK3A 5AFZH 4X1PU 1W12U 3A7ZA 3BEFB 1ZSKA 2XBVA 1K1OA 1P2OA 5GWZA 4K1EA 3E90B 1V2WT 5L6NH 5FX5A 5GJ4B 5F6MA 1MKWH 2R3UA 2R3YA 3VGCC 1T8OA 1SC8U 1GBMA 2FP7B 1NU9A 2AMDA 3K9XB 1NZQH 1BBRK 2VWNA 1EPTB 1P2KA 3RXRA 1V2ST 1DWEH 3E8LA 1BTUA 3M5NA 1ZMLA 1PPGE 3RM2H 5DPAA 1OP2A 1O2IA 1YCPH 2FI3E 2XC5A 2ZFPH 1O30A 4UFEH 3M5MA 3KQEA 3BTWE 1HJAB 3PWCA 1CT0E 1CA0C 1O38A 4E05H 3U9AH 3MO3A 1THSH 1GBTA 3HPTB 1GGDC 2FI4E 1G3BA 3S7KB 2ZPRA 2BVXH 3P70B 3NUMA 3M35A 4RKOB 4WH6A 1HJ9A 2XNIA 1DITH 1S84A 3SV2H 4CR5A 2B8OH 1A61H 2FDAA 4Y0ZE 1W13U 3S9AA 3PLPA 2VB0A 4BXSA 1GWAA 5EODA 1C1RA 4AORA 2O8TA 4YT7H 1C2KA 1TGNA 3FZZA 2J92A 4KP0A 2ZO3H 1HYLA 2PWXA 3GY8A 3ZZ6A 6CHAB 4X0WU 1EX3A 1B0EA 3K2UA 3QN7A 3MTYA 2VIWA 3F9GA 3TK9A 4MPWA 3PB1E 1DLKB 1V2PT 1UCYH 5SGAE 3RM0H 3PMBB 2HOBA 3MH7A 1P04A 1RTKA 3PMJA 5A2MH 3S9CA 4ZHAA 3L6PA 3TH2H 1HIAB 1VR1H 1SVPA 3M3SA 2YNAA 3W95A 1GDQA 1P2IA 3TNTA 3M36A 2BB4A 3SNDA 1TNLA 2PKSC 2BDBA 1IQLA 1YC0A 3FANA 4Y71A 2VVCA 1GHBF 1WSSH 2P3TB 2ZNKH 4ABGA 3V13A 1O5BB 5A09A 1TGCA 2QXHA 3SUFA 3MO6A 4NSVA 1LHGH 1MUEB 2A7HA 3RXBA 1GHBG 2O8WA 3NXPA 3U8RH 1T8LA 4OS6A 3MH6A 1O3LA 3BEIB 4IBLH 2H1UA 3V7TA 4ABEA 2ZDLA 3ZZ9A 3E0PB 5EOKA 3UTUH 2BOKA 1V2RT 1T4VH 1ELGA 1Y5AT 1NROH 4HZHA 5C3NA 3MNSA 4DOQA 4NIXA 1SOZA 2IPHA 2GCTC 4WMEA 4U32A 1A0JA 5BRRE 4X8SH 4NFEA 3LIWA 5AVDA 2W7UA 2BTCE 2Z7FE 4YLQH 1HJAC 1BRUP 1IQKA 3NKKA 1O2YA 1C1TA 1FDPA 1XUKA 3OX7U 1K1PA 2YOLA 3I29A 1P57B 1ZPBA 6GCHF 3N7OA 1XXDA 3VXEH 2VWOA 1FY3A 4MQAA 1EP6A 2Q6GA 7ESTE 2HVXA 3O8DA 3UR6A 3SJ8A 8GCHF 5DG6A 1LVYA 2FOEA 1HB0B 1ID5H 2A45B 3Q00A 1BTHH 5F8TA 3JZ2B 1O3AA 2OCVB 3VGCB 2VIVA 2STAE 1HFDA 2PFEA 1OWIA 1C5QA 1TLDA 4CR9A 2FOAA 2GCTB 3ATMA 1AFQB 2SFAA 1BMAA 3LGIA 3QUMP 3RXFA 3KQCA 2JH6D 4DGJA 3LH1A 3SI4H 1ZRBA 4JYTA 1TBQH 4MNVA 3T27A 1O3NA 1WCZA 1C2MA 1EZUC 3R0FA 3ATWA 2UUKB 4GHTA 2QF3A 2ZP0H 3BG4B 4AB9A 1GI0A 2GV7A 3UR9A 2P3UB 4JK6A 3FFGA 4Y8XA 1TA6A 2BMGB 2C93B 3GY6A 3RXDA 2BOHB 3M37A 5I46H 2K1QA 3UUZA 4ABHA 1OWKA 1FUJA 2BY7X 5E0JA 2VIOA 4CRAA 3URCA 1TFXA 1K1IA 1QCPA 1L1JA 3ODFA 2CMYA 1OWJA 1EAUA 3OYPA 1LPGB 3ZVCA 1N6XA 4Y7AA 1TRYA 5EW1H 5C1YA 1ELFA 5HGGA 4LZ1H 2XBYA 2OUAA 4I31A 3MWIU 1N8OB 1NN6A 2PSYA 3RXLA 4AZ2B 2TPIZ 3NZIA 4FVDA 1GJBB 4JMYA 9LPRA 3PWBA 1W7GH 1YPGH 3P92A 5K0HA 1THPB 3SJIA 1Q3XA 3ESTA 1MTSA 3KQDA 3SU3A 1W11U 1DY8A 1YM0A 3TIUA 4AN7A 4I8HA 3PV4A 3P8FA 1C5MD 2ZQ2A 1GGDB 1O3KA 1HUTH 4PROA 2BD4A 2F91A 4ZAEA 4FUDA 2OLGA 3SW2B 4NWKA 3O8BA 1GJ9B 2KAIB 5G4BA 1J9CH 2FESH 2B7DH 1PPZA 1HBTH 3SUGA 3SHCH 1VGCB 1YPJH 3A88A 4VGCB 2XCFA 4NGAH 4Z0KA 1HLTH 2ZGBH 3GCOA 1AUJA 5C20A 1CO7E 4DG4A 1O3MA 4MNYA 1ZPCA 3ZVGA 3ZVBA 1ZJKA 1CVWH 2D1JA 1UK4A 4Q80A 1ETTH 1GBCA 1C2FA 3U1IB 5A8ZA 2RCEA 3ITIA 5HM2A 4A92A 5B6OA 4FUIA 5C1XA 1IHSH 2R9PA 4I33A 5C67A 3ZZBA 3WY8A 1GI1A 2XYAA 1CHOF 2OC7A 1O32A 3RC4A 5C5OA 3PTNA 1TOCB 1RJXB 1JIRA 1F92A 2A5KA 3MNBA 1BQYA 2CGAA 1XXFA 2ODYB 1O2MA 3RXSA 3E6PH 1SSXA 3MNXA 5T6FA 4BOHA 1YBWA 1O2OA 5TCCA 2QF0A 4B76A 2SGAA 3A8CA 3QZQA 2FOGA 1AE8H 3A87A 3LJOA 4I8KA 4AG1A 1FY1A 3KNXA 1DX5M 1SGNE 2ESTE 3PLBA 3ATIA 3RP2A 3HATH 3ENSB 4SGAE 3STIA 4B74A 1LHCH 3RXTA 3E0NB 3M5LA 1SGEE 1GJ4H 1QRXA 5T6DA 7KMEH 1NO9H 4X8TH 3QZRA 1A46H 2EC9H 3M3VA 2Z9GA 2F83A 1MD7A 2IOTA 3E1XB 1P2QA 1GBEA 1TX8A 3CP7A 4THNH 5JYIA 3TH4H 4MPUA 1O34A 3SU4A 2ZTYA 1TB6H 3ZVDA 1O5CB 1GMHG 2BX3A 3KIDU 4MNWA 1GI7B 4IC6A 4OS1A 4ZKSU 1O0DH 4DIHH 1MTNC 2ZHQH 4DCDA 1YPMH 1A1RA 1BTZA 5AF9H 1LQEA 2FMJA 3LGWA 1SBWA 2P94A 5A0AE 5FAHA 1DY9A 1UHBB 1K1LA 3UWIA 1BTXA 2FXRA 1ZHMA 1S6FA 1HAVB 4DJZB 4U01A 1UJ1A 1IQIA 1QJ1B 1XM1A 1NFYA 2UUYA 5FPSA 3NWUA 1C5TA 5CHAC 1EKBB 3BG4C 3STJA 3EYDA 1D4PB 1KTSB 1QBOA 2OXSA 4UEHH 1GHYH 1AI8H 3A81A 1DPOA 4X1RU 4D7GA 1QRZA 2BD7A 1KLTA 1HAZB 1QL8A 2GMTC 4IC5A 1IQJA 2H9EH 2WYJA 5FHTA 2J95A 4Z6AH 1ZHRA 1Y8TA 2P95A 2W3KA 1XUFA 4YT6H 2M5TA 2FI5E 1J8AA 3F6UH 1V2NT 1FLEE 5EXMA 6ESTA 1D3DB 1E36B 1VJ9U 4K60A 2XWBI 2JH5D 2VINA 2FS8A 1AD8H 1F2SE 2FO9A 1W2KH 1WUNH 4AFZA 1P01A 5EU8A 1S0RA 1MBQA 4LZ4B 2GZ9A 1GBDA 2J38A 2R2WU 4A1XA 4FUHA 1LPKB 2BDHA 3MFJA 1QQUA 1DXPA 1Z71A 2CHAC 1O2SA 2VIQA 4XOJA 3A83A 3MU8A 1YF4A 3LJJA 1YGCH 1CA8B 2A7JA 3QTOH 2Q6DA 2BD3A 3EE0B 5E0HA 3GISB 2ZHWH 2ZFQH 4XSKU 2VNTA 1AUTC 2H5CA 1N6YA 1J15A 3DD2H 2AMQA 1O3OA 2AIQA 1GCTB 1PPBH 5A8XA 4NA7A 1W3CA 3U1JB 3LU9B 2VU8E 4TY7A 4LOYH 1NFUA 2ASUB 4R0IA 2GTBA 1A5GH 1UTNA 4AYYB 3UNQA 1H9LB 4CBNA 1TX7A 2V3OH 1SLUB 2BDYA 1OX1A 1ZHPA 4DW2U 1O2GH 3CS0A 3FP7E 2TRMA 2VVUA 3RXHA 2VIPA 1TGSZ 2DUCA 2YNBA 1D3TB 2CHAB 4LXBH 4Y7BA 3IITA 3M7UA 1EAXA 1C4U2 1NTPA 2Y80A 3HGNA 3TNSA 4K3JA 2C90B 3PMHB 1YYY1 2QXJA 3HKJB 3Q77A 1AIXH 1OWDA 1FIZA 1D9IA 4MVNA 2PW8H 4TYDA 4OGYA 4UFDH 4H42U 1MQ5A 2P8OB 3VFEA 1K28D 5F03A 1HPGA 3SV8A 2VH6A 1ELDE 2V6NA 1TX6A 3GY5A 2W7SA 1ANDA 1CQQA 1VCQA 1AHTH 4ABJA 2F9OA 3MI4A 3SJOA 1UCYK 1UVPA 2BY9X 2OTVA 3U69H 6CHAC 2J9NA 1EPTA 1O3JA 1TWXB 1JRSA 4Q7YA 4KKDA 1FPCH 1MAXA 3SJKA 2ZFFH 1E34B 1F0SA 1QHRB 1OPHB 1SLXB 2GT7A 3GDSA 2ZTZA 8ESTE 4YO9A 4BAKB 2FYQA 1IOEA 1GI3A 3TVJB 2BYAX 1P03A 2ZPSA 2Y6TA 1ZMNA 4J2YB 1UTMA 2RA3A 3IG6B 1EZXC 1UVUH 4WJG2 5JBCS 3UOUA 1GG6B 1WV7H 1DVAH 4I7YH 1DFPA 1BRAA 1QA7A 3BTQE 2BVSH 1INCA 1VJAU 3LGTA 3D23A 4WF8A 1Y5BT 9ESTA 4A6LA 1JBUH 1FAXA 2PTCE 1FN6A 1AVGH 3CS7A 4MPXA 4TY6A 1ZLRA 4K8YA 2D2DA 1YPLH 4I8JA 1F0RA 2A4OA 5K7RA 1KXAA 2NU1E 5J4QA 1GVZA 1OXGA 2P16A 1QQ4A 1S83A 3UOPA 5EPYA 2RDLA 1OS8A 1QB6A 3QTVH 3ZV8A 1Z8JB 2SGEE 4NA8A 1F5RA 2XRCA 5L2YH 3MU4A 4GLYA 2H6MA 4ASHA 3TK6A 5E2PA 3KF2A 3AVZA 2QC2A 1BJVA 2ZCLP 3F1SB 1UK2A 1H8IH 1WTHD 1S0QA 1P11E 3HK6B 2H9HA 5JBBS 1AKSA 2OP9A 3NK8A 1WQSA 1OWEA 4O03A 2QAAA 4YLUA 1B7XB 2Y5FA 2VVVA 3M5OA 1TA2A 3FVFB 2R0LA 4DT7B 3LH3A 1O2LA 1ZSLA 1GI9B 3RDZA 1C5OH 1N8OC 1NRSH 1O3IA 2SGFE 4X6NA 2BZ6H 2WPHS 1V2VT 3ZZCA 4BNRA 1TRNA 4GVUA 4A1TA 3RC5A 1P9SA 4H6SB 2Z94A 3K6YA 1DUEA 2ZTXA 3ZZ5A 3LGVA 1O5GH 5LPRA 4MG3A 4X8UH 1GJ6A 1ANCA 1O2RA 1TMBH 4JZFH 2UUFB 4ESTE 4ZHLU 2Z9IA 2HWLB 5FBIA 1BRBE 1PPCE 3LDXH 1JXPA 3VXFH 1N1LA 1T8NA 2HRVA 2QIQA 5T6GA 1VITH 1XUIA 3OTJE 3ZYEA 1SG8B 4Y0YE 4ZKNU 3SZNA 1LHFH 1A0LA 2A2XH 1F0UA 1GMCF 4Y76A 1SQTA 5GCHF 1VZQH 2A4GA 2ODQA 3U8OH 4NWLA 5EQQA 1KLIH 1GMDG 1Q31A 5DP7A 4XDEA 2ZECA 4KTSA 4D9QA 2ZDMA 1LVBA 4WMDA 4A7IB 3A7XA 4UFGH 5E8EH 1EJMA 3GDUA 1O2XA 3FZDA 4I8GA 5GCHG 3K6ZA 2FLBH 3A80A 4ABFA 4U2WA 1AFQC 4X2XA 2OD3B 3SU0A 3OU0A 3SO3A 3RMNH 2TGAA 3F68H 3A86A 2VWMA 4NZLA 1FPHH 1K1NA 3AW1A 1E0FD 1G2MA 1HIAA 1YLCA 5L30H 2GDEH 2CJIA 2J34A 1S82A 3RXAA 2EA3A 1EP5A 2G4TA 2WV5A 2AEIH 5DP8A 1GI6A 4ZKRU 5J4SA 4ABAA 1DUAA 4AFUA 1DXWA 3ZZAA 5JBTA 3DFLA 1WTGH 4MTBA 2ZGCA 1BMNH 1GHWH 1C5NH 2BQWB 1O36A 1K21H 1IQFA 3MHWU 3KL6A 2H9TH 1QTFA 2PTNA 5AFYH 3PTBA 4AGKA 1GBAA 2G00A 3SNBA 5TJXA 1TNJA 1MZAA 4Q7XA 1ANEA 1BZXE 2GZ7A 1O3FA 3SBKA 2EI7A 1MKXK 1SOTA 1AN1E 3ELAH 5JDUB 4MDSA 1FIWA 1J17T 1C1SA 1AQ7A 3ZZ3A 4OS2A 1SMFE 7GCHF 1WU1A 4YTAA 1V2KT 2Y82A 2TBSA 2PSXA 3HKIB 1CGIE 1GPZA 3EDXB 2PKSB 1ABIH 1EUFA 3A84A 1S5SA 1RS0A 3G01A 3AAVA 3SU1A 2Y7XA 2A5IA 1Z6JH 1G32B 3D62A 4SGBE 5PTPA 2ANWA 1UVTH 2JKHA 1QR3E 1FXYA 3GCNA 3VEQB 1KTTB 4FUBA 2D8WA 4FUEA 1O2QA 2RG3A 1VITF 1Z6EA 1ZYOA 3GDVA 4CRFA 2GD4B 2QY0B 1SI5H 1O35A 2CV3A 1MKXH 1UTKA 2VGCB 1LQDB 3U8TH 2ZU3A 1L1NA 2C8WB 4E06H 1A3EH 3DFJA 4FUGA 1DWCH 1IQNA 1A4WH 1C5YB 1O5FH 2BY5X 4OS5A 3S9BA 3SU5A 2O8LA 1TNHA 2PGBB 1TGBA 2G4UA 3K65B 1ELCA 1AO5A 3V12A 1BBRE 1C5VA 1A2CH 1TMUH 3MNCA 2XW9A 5H4IB 4I32A 2QN5T 5ESBA 1YCPK 3T62A 1WOFA 2PKAA 3SHAH 3SNAA 4K1SA 1MCTA 4NZQA 5LPFA 4K69A 2C8ZB 3SU6A 1O5DH 2TGPZ 1UTLM 4CRGA 1XKAC 3MOCA 2UWPA 1LKBA 4Y6DA 5HMAA 2CF9H 1PYTD 2OINA 1PPFE 3UNSA 1IQHA 1W7XH 1V2UT 3T28A 1TMTH 3M7TA 3RXCA 2ZU5A 4OGXA 1GI5A 3Q76A 2ZFTA 4YOJA 2QYIA 2QCYA 1VCPA 3P95A 3TK5A 4INKA 3RXIA 4E7NA 6LPRA 2XBWA 1DT2A 5DP4A 1FV9A 2GCHF 1PYTC 5CHAB 4NCYA 4DVAU 4ABDA 1XX9A 1HAGE 4O97A 5JB9S 4INHA 1DSTA 3H7TA 1FN8A 5DGJA 5CE1A 2G8TA 4X8VH 1H9HE 4DY7B 1MTVA 2FYRA 3RXPA 4Y79A 2I6SA 4FXGH 1BHXF 1MTNB 1BTPA 6GCHG 3T25A 2FS9A 1MD8A 3KCGH 5AHGH 3A8AA 1OKXA 2C8XB 3PM3A 1SGDE 1LKAA 4WH8A 1QIXB 3ATKA 1O33A 1Y59T 1CSOE 1DE7H 3GYMA 4HGCA 2WINI 1TPPA 3ZZ8A 3P8OA 3BG8A 1JRTA 4GCHG 3NPSA 3BSQA 1GVKB 4BTTB 1HAXB 2JETB 2BDCA 1C2DA 2ZU4A 3MU1A 4JZ1A 4YOGA 1KXDA 1O3EA 2GT8A 4NSYA 1O2ZA 5L2ZH 3EA7A 1T4UH 1CE5A 1BA8B 1F0TA 1P05A 1UO6A 2NWNA 1Z1IA 3DA9B 3O8RA 2AIPA 1FNIA 2AFQB 5E2OA 4X6PA 7GCHG 5EPNA 2F9NA 4MLFB 4JZDH 1SQAA 4Y8ZA 3SV7A 1GJ7B 1HAIH 1IQMA 2Y5HA 1UCYE 4CHAC 3E16B 2EI6A 5CMXH 4XBBA 1ESTA 3BTTE 1O2NA 1O31A 5FXLA 4E7RG 1UTJA 2SGDE 1GBJA 1KDQA 1QL7A 1P3CA 1QB1A 4Y10E 4ZH8A 3T5FH 3TLOA 2TGTA 1AY6H 1ZRKA 2GKVE 1FQ3A 3RXMA 1Y3WA 1BTWA 1O3CA 3KGPA 1XKBC 4JK5A 2ZHEH 3P8GA 1NRPH 2FLRH 1P9UA 3TJOA 4B2AA 1OOKB 1SHHB 2HNTC 1P8VC 1LTOA 2FX4A 3QLPH 1RGQA 1GI8B 2W26A 1KSNA 3MH5A 3UIRA 3ZVEA 2FODA 3TJVA 1LHDH 1O2WA 1QJ7B 1HNEE 5C1UA 1WAYB 1D3QB 3DHKH 2GMTB 4F49A 2V0BA 4CH2B 2AYWA 4JYUH 1GL0E 4KELA 2BLWA 1CHOG 1KXCA 2G51A 2GGVB 1L4DA 1NY22 1UTPA 2G5VA 1NRNH 2FOMB 4B75A 4TPIZ 1T7CA 1UTQA 4CBOA 3VB3A 4ISLA 1ZGIA 2ODPA 3BTHE 1UMAH 1D6WA 4NIWA 2O8MA 2ZKSA 1DSUA 1AB9C 1NS3A 1W0YH 1O3HA 4RKJB 1AVWA 3BN9A 3SORA 4X2VA 3RC6A 3TH3H 4AFQA 2FOCA 1SHYA 1QURH 3GOVB 2BM2A 3QK1A 3A7VA 4UDWH 1Y3XA 2A5AA 2Q6FA 3QGJA 1LCYA 1WQVH 3TGIE 1C9PA 3RU4E 1C5XB 4FU8A 1GMCG 2VJ1A 3A85A 2ZPQA 2ZA5A 2JETC 3ZV9A 1HAPH 1DOJA 1U6QA 2BY8X 5ETXA 5EXNA 1F7ZA 5DO4H 4FUFA 1QB9A 2NU0E 1K1MA 2SNWA 1O5AB 2ZG0H 1NPMA 2OC8A 5DJ7A 2OBOA 1QY6A 4IN2A 1BCUH 1BBRH 4BAMB 4WXVA 1C2EA 2FEQH 3ZVFA 5JPMH 3SNEA 1C1OA 4NG9H 2ZWLH 1C2IA 5FCKA 2BVRH 3GYLB 1CBWC 2PR3A 3AW0A 1YPKH 1KY9A 3SUEA 4ZXXH 2BXTH 4IS5A 1KIGH 1SGIB 1Z8RA 2O9QA 3A7TA 1IQGA 5FPYA 4B73A 2ZU1A 3VB7A 3RMMH 3GY4A 1A5IA 3UQOA 1GDNA 1V2QT 1BHXB 1BMLA 1J16A 4ZKOU 1T32A 4WXIA 2P93A 2CXVA 1BTYA 3TJUA 1MTUA 1HGTH 1G3DA 1HAHH 1AZ8A 1XMNB 2I6QA 2A0QB 4O9VA 3SQEE 4HTCH 2ZCKP 1TNKA 3PO1C 4I8LA 1XVOA 2PUQH 1SFQB 2FIRH 2F3CE 5DP5A 1SPJA 1QJ6B 1BOQA 1V6DA 1EB2A 1RFNA 1UVSH 1CHGA 1TPAE 1AZZA 1CGHA 1TONA 1Z8GA 2EI8A 4VGCC 2XXLA 3UFAA 2H5DA 4KTUA 1QGFA 1MKWK 2ZEBA 2THFB 2PLXA 1QFKH 3GY2A 1HV7A 3H7OA 4GCHF 4GAWA 3PMAB 2Y7ZA 4IMZA 3OY5U 1GJ5H 1C2JA 1G37A 1O3DA 3BTEE 4BANB 1E38B 5F8ZA 2ZIQH 4GHQA 1SR5C 1HRTH 2P8OC 2BLVA 1WBGB 1DWBH 1OYQA 3EA8A 1JMOH 3MYWA 5IDKA 1O3BA 2J94A 2ZDVH 4IN1A 3V0XA 3LGYA 1B0FA 1CT2E 2C4FH 1BB0B 1SFIA 4TWWA 1ESBA 1GJCB 2FWWA 5EXLA 8GCHG 3GCHB 2ZU2A 5HYOA 3A7YA 3BEUA 5BPEA 2FTMA 1GBKA 1GL1A 1ANBA 1RRKA 1T8MA 1S6HA 1ARCA 2GCHG 3F9HA 1O3GA 4CRCA 1O2PA 1C4V2 1BT7A 1AGJA 2G5NA 3I77A 3RXGA 3P6ZB 1EJAA 1P02A 2FM2A 1O37A 2P59A 1EB1H 1HXEH 4WVPE 4X1QU 1D3PB 2QV1A 3TJNA 1ZJDA 1K22H 3UY9A 4WWYA 1ZSJA 3RXKA 2NU2E 1GCTC 1IHTH 1A7SA 3P17H 1EQ9A 1HXFH 1ELBA 2GZ8A 4XFQA 3SN8A 5FCRA 1ZTKA 2V35A 1TPSA 2BDIA 3KHVA 3RLWH 4CRBA 1SGRE 1JIMA 1QA0A 4MPVA 1PQ5A 2RA0A 3M3TA 3VB6A 1A3BH 5LH8A 4YESB 3ATLA 2PHBA 3RXVA 4R8TB 5GDSH 1X7AC 1GDUA 4AX9H 2AGGX 1C1MA 1NU7B 2GV6A 4B2BA 3S0NA 1TQ0B 1Z8IB 1TQ7B 3VB5A 1QNJA 2WPMS 3BF6H 5TCAA 2BLQA 3LPRA 2XTTB 1SGQE 1MBMA 3W94A 1ETSH 2KAIA 4H6TA 3UNRA 1V2MT 1H9IE 4K1TA 1NC6A 2Z6BD 3UREA 1GG6C 1MMJN 4ISIH 3EQ0H 1VITG 3LT3A 1Z1JA 2PGQB 4UFFH 2ZFSA 3BTFE 4NIVA 4FVBA 4OS4A 1FZZA 4UE7H 3A8BA 4K8BA 1O5EH 4FU9A 2ULLA 2G55A 5HM9A 1FI8A 3A89A 1O2JA 1P06A 3S7HB 3BTKE 1C4Y2 1ELVA 1OP0A 4UD9H 3SGQE 4BXWA 1H8DH 3URDA 1PQAA 3VB4A 1RIWB 4M7GA 1VGCC 2IJOB 2TGDA 1EPTC 3RXJA 1EAWA 1AMHA 1C5ZB 2O8UA 2ZF0H 1GHZA 4XBDA 4F4OC 1C1UH 3ZZ7A 2OC0A 1L4ZA 2BXUH 3PO1B 4AB8A 3SGAE 1V2LT 1MAYA 2DE8A 1UHBA 4XE4A 1CGJE 1KXFA 5ABWA 1C5PA 3BIUH 3M7QA 3AAUA 3U98H 4WMFA 2V3HH 2F9VA 1AWFH 1NT1A 1AKSB 1TE0A 2Y81A 4TWYA 3F9EA 4O3TA 2LPRA 2HGTH 1EOLA 4A1VA 1NFXA 1YPHC 1TYNA 2WPIS 1BMMH 1PJPA 2EEKA 1GI2A 3D65E 4U30A 1HAYB 1MZDA 1YCPM 2BD9A 3FAOA 1WYKA 4B71A 2BY6X 2BD5A 1O2HA 4JZIA 2A2QH 2BQ6B 5I25A 2ALPA 3GCHC 3IWMA 2P3FH 1LVMA 1C5WB 3A8DA 1Z7KA 1GMHF 1L2EA 2ZHFH 3DUXH 2PUXB 1ELEE 3QX5H 1YLDA 3SI3H 4J1YA 3MH4A 1SLWB 3E3TA 2Q1JA 4KTCA 1SL3A 1OWHA 1A5HA 5FBEA 5LPEA 1K9OE 1LPZB 1ESAA 2R0KA 2FTLE 4GPGA 3BIVH 1MU8B 3LKWA 2AH4X 4NA9H 4Q2KA 4HFPB 2AMPA 3LONA 4FUCA 1VCWA 1EJNA 1P09A 3MMGA 3QWCH 1DM4B 1UTOA 1CT4E 3BTGE 3KEEA 1GMDF 3RMLH 2ILNA 2B0FA 2ZZUH 4INLA 4TPYA 1D6RA 2Y5GA 4Y11E 5T3HA 1PQ8A 1XUHA 3PLKA 1Y5UT 3D49H 2AGIX 3M61U 1GJDB 2VIDA 1P2JA 1PPEE 1L1GA 2A4QA 1EZQA 1P10A 1TBRH 3L33A 1ORFA 1BITA 3Q3XA 2BDAA 1ELTA 3EGKH 2QGRA 4LK4A 1BJUA 3FP8E 3I78A 4X6MA 1G30B 1FONA 3SGBE 5DP3A 1IQEA 3GICB 4YOIA 4K5ZA 1MU6B 2FOHA 4K2YA 1KLJH 1ETRH 4JCNA 2A32A 5E0GA 3SNCA 3T2NA 3PYHA 3GCTG 1BDAA 1V3XA 3GY3A 1XUGA 1FMGA 1IAUA 2D26C 1ELAA 1GBHA 1A0HB 2F9UA 1ACBE 4CH8B 1C2HA 5A0CA 1T31A 2A1DB 1QL9A 4YM9A 1W14U 2Z9LA 1XUJA 1SGPE 2NU4E 1FJSA 1DDJA 2ZQ1A 1SQOA 1SGFG 4RSPA 2JH0D 2WYGA 3AASA 4AG2A 3C27B 1FY8E 4AFSA 2VWLA 1EOJA 1L0ZA 1LHEH 1TGTA 4UONA 5A8YA 2XBXA 3S69A 2ANKH 4AYVB 1AWHB 1GBIA 1C2LA 2AS9A 4ZROA 1GCDA 4GUXA 8LPRA 3NCLA 1C1NA 2C8YB 4CHAB 1ZTLA 2HPPH 1FY4A 1O2UA 1P2NA 2FOFA 4H4FA 1GBLA 1HAVA 4OS7A 2G52A 4ZUHA 2B9LA 1GBFA 4NFFA 5GIBA 2F9PA 3LOXA 2Z9JA 1HCGA 4D8NA 2BD8A 2UWOA 2BDGA 2ZI2H 1SGTA 1TOMH 2VH0A 2OQUA 4ISHH 3UPEA 4ISNA 1KYNA 2ZFRH 5GXPA 2WPJS 1C5UA 2FOBA 5ESTE 3LC3A 1E35B 2XWAA 1EAIA 4CRDA 1TRMA 4ABBA 1ZR0A 1DS2E 3HGPA 1Y3UA 3KQBA 3L3TA 3QDZB 2BHGA 1EZSC 3Q3YA 3RU4D 1MCVA 1NRRH 1ZPZA 1SB1H 1BRCE 1GJAB 4X6OA 2XCNA 2FZZA 1GHAG 1SLVB 2GDDA 2DE9A 3T29A 4BTUB 1FAKH 2PKAB 2NU3E 2CF8H 5DK1A 2BD2A 1NRQH 3LC5A 3ZVAA 4O3UA 4FU7A 4ABIA 5DKMA 2QXGA 1XVMA 4WY3A 1TIOA 1GHVH 1G2LA 4X1NU 4ZXYH 4DIIH 3R3GB 3SQHE 3ZZ4A 5EW2H 4B2CA 1GJ8B 4KGAA 1P12E 5C5NA 3BV9B 1ABJH 1W10U 1RIWC 1Y3YA 3DT0H 3UQVA 2BZAA 3MU0A 2ZHDA 4BAHB 4D76A 1G3EA 2ALVA 3V3MA 1RTFB 1GBBA 1YP9A 1G9IE 2VGCC 2WUBA 3MO9A 1TPOA 4CREA 1M9UA 1V2OT 3VPKA 3ZYDA 3RXUA 5IYTA 1E37B 1TBZH 1DWDH 1AE5A 2PV9B 4BAOB 4XBCA 2CN0H 2ZDAH 1NFWA 1CU1A 3RMOH 4BAQB 2BX4A 2QXIA 2A31A 1JWTA 1ZZZA 3LGUA 1PQ7A 2C3SA 1NESE 1W8BH 1ZMJA 2GX4A 3B8JA 4A5TS 1LDTT 4ZMAH 4Q7ZA 1YPEH 2QA9E 1MH0A 2R2MB 1RTLA
chains in the Genus database with same CATH superfamily
3SV9A 3A7WA 5FPTA 1SGCA 2B5TB 2ZCHP 5EQSA 4NIYA 1CBWB 4IMQA 1EATA 4AOQA 2J4IA 3RUOA 1SGFA 2STBE 4RT0A 1H4WA 2OQ5A 2KZ4A 1C5RA 1C9TA 3SOSA 3B9FH 5LGOA 1J14A 2A4RA 5EGMA 2SGQE 2W5EA 1BUIA 1KXEA 4YZUA 4GSOA 1KXBA 2WPLS 1O39A 2UUJB 2A7CA 3ODDA 1O2TA 1H1BA 1KDQB 1O3PB 1HDTH 1G3CA 2Z3CA 5FX6A 2FPZA 3SV6A 4D9RA 4HI3A 1HAOH 2OC1A 3GS9A 3SUDA 3A82A 1K2I1 7LPRA 2F9BH 1MQ6A 3JZ1B 5DP6A 3RU4T 1QBVH 4FUJA 1O2KA 4QT8C 1AB9B 1CA0B 1S85A 1AVXA 2TIOA 1RD3B 1OSSA 3TITA 2GVFA 1ZGVA 3BTDE 1TAWA 3T26A 1C1VH 2BLOA 1TNGA 1TALA 1F5KU 1FY5A 2J98B 2YMSC 2SNVA 1THRH 2GP9B 2ANYA 2OBQA 3H5CB 1GHAF 2Z3EA 3EAJA 4FOUC 1YKTA 3SJ9A 5HXFA 3TPIZ 2LNCA 1Q2WA 1DLEA 2Z9KA 2Z3DA 1LO6A 3GY7A 3MU5A 4IGDA 5JBAS 1TABE 4X1SU 1QRWA 5F8XA 1TNIA 2ZGHA 2HNTF 4Y8YA 3E91A 1Y3VA 4ZHMU 1PPHE 3TGJE 2AGEX 1NM6A 4B1TA 1ZTJA 2XC4A 2BQ7B 5EG4A 5C2ZA 1EXFA 2AERH 2HNTE 5GPIB 3TGKE 1LMWB 2WZQA 3C1KA 3EA9A 4AGJA 2XC0A 3ZZDA 2ZC9H 2HLCA 1W0ZU 1AU8A 4RN6A 2HPQH 1C5LH 1B5GH 3GCTF 1JOUB 4ISOA 1OYTH 3TU7H 1O2VA 1OP8A 1P2MA 4IW4E 1PFXC 2ZDKA 2WPKS 1C5SA 1HJ8A 2ZGJA 1S81A 3F9FA 3P8NA 5CDFE 2ZGXH 2FX6A 2SGPE 3QGNB 2J2UA 2ANMH 3RLYH 5JB8S 2W3IA 3HK3B 1P3EA 3RXQA 4DURA 4MNXA 1K1JA 4BTIB 4JZEH 3RXEA 1C1QA 1EASA 3OSYA 2ZDNA 3BTME 1DANH 3PROA 1LVOA 2IN2A 2H2ZA 3QO6A 1DICA 1V2TT 2HALA 2G81E 1YPHE 2WUCA 8KME2 1W0JD 3FP6E 3OY6U 3RXOA 3EE7A 4X2WA 1ZOMA 1F5LA 1RXPA 1AFEH 1C1WH 4JYVH 3O8CA 4X2YA 1UVOA 1ARBA 1MTWA 1QBNA 3UWJH 3CENA 1GHXH 1C2GA 5A0BA 3Q3KA 1V2JT 1GI4A 4D7FA 5DP9A 1BIOA 1SGYE 3KN2A 1GVLA 3SU2A 2WV4A 3B23B 1C1PA 2UWLA 1G36A 5EQRA 1P0SH 1UK3A 5AFZH 4X1PU 1W12U 3A7ZA 3BEFB 1ZSKA 2XBVA 1K1OA 1P2OA 5GWZA 4K1EA 5C0UA 3E90B 1V2WT 5L6NH 5FX5A 5GJ4B 5F6MA 1MKWH 2R3UA 2R3YA 3VGCC 1T8OA 3F0PA 1SC8U 1GBMA 2FP7B 1NU9A 2AMDA 3K9XB 1NZQH 1BBRK 2VWNA 1EPTB 1P2KA 4B6FA 3RXRA 1V2ST 1DWEH 3E8LA 2AHME 2XOKD 1BTUA 3M5NA 1ZMLA 1PPGE 4Q63A 3RM2H 5DPAA 1OP2A 1O2IA 1YCPH 2FI3E 2XC5A 2ZFPH 1O30A 3PV2A 4UFEH 3M5MA 3KQEA 3BTWE 1HJAB 3PWCA 1CT0E 1CA0C 1O38A 4E05H 3U9AH 3MO3A 1THSH 1GBTA 3HPTB 1GGDC 2FI4E 1G3BA 3S7KB 2ZPRA 2BVXH 3P70B 3NUMA 3M35A 4RKOB 4WH6A 1HJ9A 2XNIA 1DITH 1S84A 3SV2H 4CR5A 2B8OH 1A61H 2FDAA 4Y0ZE 1W13U 3S9AA 3PLPA 2VB0A 4BXSA 1GWAA 5EODA 1C1RA 4AORA 2O8TA 2QF5A 4YT7H 1C2KA 1TGNA 3FZZA 2F4LA 2J92A 4KP0A 2L74A 1HYLA 2ZO3H 2PWXA 3GY8A 3ZZ6A 6CHAB 4X0WU 1EX3A 1B0EA 3K2UA 1WXRA 3QN7A 5GNDA 3MTYA 2VIWA 3F9GA 3TK9A 4MPWA 3PB1E 1DLKB 2QF4A 1V2PT 1UCYH 5SGAE 3RM0H 3PMBB 2HOBA 3MH7A 1P04A 1RTKA 3PMJA 5A2MH 3S9CA 4ZHAA 2HVYB 3L6PA 3TH2H 1HIAB 1H8HD 1VR1H 1SVPA 3M3SA 2YNAA 3W95A 1GDQA 1P2IA 3TNTA 3M36A 2BB4A 3SNDA 1TNLA 2PKSC 2BDBA 1IQLA 1YC0A 3FANA 4Y71A 2VVCA 1GHBF 1WSSH 2P3TB 2ZNKH 4ABGA 3V13A 1O5BB 5A09A 1TGCA 2QXHA 3SUFA 3MO6A 4NSVA 1LHGH 1MUEB 2A7HA 3RXBA 1GHBG 2O8WA 3NXPA 3U8RH 1T8LA 4OS6A 3MH6A 1O3LA 3BEIB 4IBLH 2H1UA 3V7TA 4ABEA 2ZDLA 3ZZ9A 3E0PB 5EOKA 3UTUH 2J97A 2BOKA 1V2RT 1T4VH 3ZIAD 1ELGA 1Y5AT 1NROH 4HZHA 1QZ8A 5C3NA 3MNSA 4DOQA 4NIXA 1SOZA 2IPHA 2GCTC 3CNRA 4WMEA 4U32A 1A0JA 5BRRE 4X8SH 4NFEA 3LIWA 5AVDA 2W7UA 2BTCE 2Z7FE 4YLQH 1HJAC 1BRUP 1IQKA 3NKKA 1O2YA 1C1TA 1FDPA 1XUKA 3OX7U 1K1PA 2YOLA 3I29A 1P57B 1ZPBA 6GCHF 3N7OA 1XXDA 3VXEH 2VWOA 1FY3A 4MQAA 1EP6A 2Q6GA 7ESTE 2HVXA 3O8DA 3UR6A 3SJ8A 8GCHF 5DG6A 1LVYA 2FOEA 1HB0B 1ID5H 1YLNA 2A45B 3Q00A 1BTHH 5F8TA 3JZ2B 1O3AA 2OCVB 3VGCB 2VIVA 2STAE 1HFDA 2PFEA 1OWIA 1C5QA 1TLDA 4CR9A 2FOAA 2GCTB 3ATMA 1AFQB 2SFAA 1BMAA 3LGIA 3QUMP 3RXFA 3KQCA 2JH6D 4DGJA 3LH1A 3SI4H 1ZRBA 4JYTA 1TBQH 4MNVA 3T27A 1O3NA 1WCZA 1C2MA 1EZUC 3R0FA 3ATWA 2UUKB 4GHTA 2QF3A 2ZP0H 3BG4B 4AB9A 1GI0A 2GV7A 3UR9A 2P3UB 4JK6A 3FFGA 4Y8XA 1TA6A 2BMGB 2C93B 3GY6A 3RXDA 2BOHB 3M37A 5I46H 2K1QA 3UUZA 4ABHA 1OWKA 1FUJA 2BY7X 5E0JA 2JIZD 2VIOA 4CRAA 3URCA 1TFXA 1K1IA 1QCPA 1L1JA 3ODFA 2CMYA 1OWJA 1EAUA 3OYPA 1LPGB 3ZVCA 1N6XA 4Y7AA 1TRYA 5EW1H 5C1YA 1ELFA 5HGGA 4LZ1H 2XBYA 2OUAA 4I31A 3MWIU 1N8OB 1NN6A 2PSYA 3RXLA 4AZ2B 2TPIZ 3NZIA 4FVDA 2F43B 1GJBB 3N7EA 4JMYA 9LPRA 3PWBA 1W7GH 1YPGH 3P92A 5K0HA 1THPB 3SJIA 1Q3XA 3ESTA 5KECA 1MTSA 3KQDA 3SU3A 1W11U 1DY8A 1YM0A 3TIUA 4OM9A 4AN7A 4I8HA 3PV4A 3P8FA 1C5MD 2ZQ2A 1GGDB 1O3KA 1HUTH 4PROA 2BD4A 2F91A 4ZAEA 3N99A 4FUDA 2OLGA 3SW2B 4NWKA 3O8BA 1GJ9B 2KAIB 5G4BA 2PP6A 1J9CH 2FESH 2B7DH 1PPZA 1HBTH 3SUGA 3SHCH 1VGCB 1YPJH 3A88A 4VGCB 2XCFA 4NGAH 4Z0KA 1HLTH 3OEED 2ZGBH 3GCOA 1AUJA 5C20A 1CO7E 4DG4A 1O3MA 4MNYA 1ZPCA 3ZVGA 3ZVBA 1ZJKA 4F55A 1CVWH 2D1JA 1UK4A 4Q80A 1ETTH 1GBCA 1C2FA 1W0KD 3U1IB 5A8ZA 2RCEA 3ITIA 5HM2A 4A92A 5B6OA 4FUIA 5C1XA 1IHSH 2R9PA 4I33A 5C67A 3ZZBA 3WY8A 1GI1A 2XYAA 1CHOF 2OC7A 1O32A 3RC4A 5C5OA 3PTNA 1TOCB 1RJXB 1JIRA 1F92A 2A5KA 2W6JD 3MNBA 1BQYA 2CGAA 1XXFA 2ODYB 1O2MA 3RXSA 3E6PH 1SSXA 3MNXA 5T6FA 4BOHA 1YBWA 1O2OA 5TCCA 3VG8A 3WW7A 2QF0A 4B76A 2SGAA 3A8CA 3QZQA 2FOGA 1AE8H 3A87A 3LJOA 4I8KA 4AG1A 1FY1A 3KNXA 1DX5M 1SGNE 2ESTE 3PLBA 3ATIA 3RP2A 3HATH 3ENSB 4SGAE 3STIA 4B74A 2EY4C 1LHCH 3RXTA 3E0NB 3M5LA 1SGEE 1GJ4H 1QRXA 5T6DA 7KMEH 1NO9H 4X8TH 3PRDA 1A46H 2EC9H 3QZRA 3M3VA 1K0HA 2Z9GA 2F83A 1MD7A 2IOTA 3E1XB 1P2QA 1GBEA 1TX8A 3CP7A 4FETA 4THNH 5JYIA 3TH4H 4MPUA 1O34A 3SU4A 2ZTYA 1TB6H 3ZVDA 1O5CB 1GMHG 2BX3A 3KIDU 4MNWA 1GI7B 4IC6A 4OS1A 4ZKSU 1O0DH 4DIHH 1MTNC 2ZHQH 4DCDA 1YPMH 1A1RA 1BTZA 5AF9H 1LQEA 2FMJA 3LGWA 3FO8D 1SBWA 2P94A 5A0AE 5FAHA 1DY9A 1UHBB 1K1LA 3UWIA 1BTXA 2JDID 2FXRA 1ZHMA 1S6FA 1HAVB 4DJZB 4U01A 1UJ1A 1IQIA 1QJ1B 1XM1A 1NFYA 2UUYA 5FPSA 3NWUA 1C5TA 3FKSD 5CHAC 1EKBB 3BG4C 3STJA 3EYDA 2YMSD 1D4PB 1KTSB 1QBOA 2OXSA 4UEHH 1GHYH 1AI8H 3A81A 1DPOA 4X1RU 4D7GA 2K8IA 1QRZA 2BD7A 1KLTA 2J98A 1HAZB 1QL8A 2GMTC 4IC5A 1IQJA 2H9EH 2WYJA 5FHTA 2J95A 4Z6AH 1ZHRA 1Y8TA 2P95A 2W3KA 1XUFA 4YT6H 1WDIA 2M5TA 2FI5E 1J8AA 3F6UH 1V2NT 1FLEE 5EXMA 6ESTA 1D3DB 1E36B 1VJ9U 4K60A 1EFRD 2XWBI 2LELA 2JH5D 2VINA 2FS8A 1AD8H 1F2SE 2FO9A 1W2KH 1WUNH 4AFZA 1P01A 5EU8A 1S0RA 4RI0A 1MBQA 4LZ4B 2GZ9A 5HIYA 1GBDA 3NRLA 5KGOA 4D9QA 2J38A 2R2WU 4A1XA 4FUHA 1LPKB 2BDHA 3MFJA 1QQUA 1DXPA 2M2AA 1Z71A 2CHAC 1O2SA 2VIQA 3OTPA 4XOJA 3A83A 3F2FA 3MU8A 1YF4A 3LJJA 1YGCH 1CA8B 2A7JA 3QTOH 2Q6DA 2BD3A 3FOAA 2WHXA 3EE0B 5E0HA 3GISB 2ZHWH 2ZFQH 4XSKU 3PRBA 1AUTC 2VNTA 2H5CA 1N6YA 1J15A 3DD2H 2AMQA 1O3OA 2AIQA 1GCTB 1PPBH 5A8XA 4NA7A 1W3CA 3U1JB 3LU9B 2VU8E 4TY7A 4LOYH 2KX4A 1NFUA 2ASUB 4R0IA 2GTBA 1A5GH 1UTNA 4AYYB 3UNQA 1H9LB 4CBNA 1TX7A 2V3OH 1SLUB 2BDYA 1OX1A 1ZHPA 4DW2U 1O2GH 3CS0A 3FP7E 2TRMA 2VVUA 3UAIC 3RXHA 2VIPA 1TGSZ 2DUCA 2YNBA 1D3TB 1NBME 2CHAB 4LXBH 4Y7BA 3IITA 3M7UA 1EAXA 1C4U2 1NTPA 2Y80A 3HGNA 3TNSA 4K3JA 1VKYA 2C90B 3PMHB 1YYY1 2QXJA 4B6EA 3HKJB 3Q77A 1AIXH 1OWDA 1FIZA 1D9IA 4MVNA 2PW8H 4TYDA 4OGYA 4UFDH 4H42U 1MQ5A 2P8OB 3VFEA 1K28D 5F03A 1HPGA 3SV8A 3KQ5A 2VH6A 1ELDE 2V6NA 1TX6A 3GY5A 2W7SA 1ANDA 1CQQA 1VCQA 1AHTH 4ABJA 2F9OA 3MI4A 3SJOA 5C0TA 1UCYK 1UVPA 2BY9X 2OTVA 3U69H 6CHAC 2J9NA 1EPTA 1O3JA 1TWXB 1JRSA 4Q7YA 4KKDA 1FPCH 1MAXA 3SJKA 2ZFFH 1E34B 1F0SA 1QHRB 1OPHB 1SLXB 2GT7A 3GDSA 2ZTZA 8ESTE 4YO9A 4BAKB 5HKKD 2FYQA 1IOEA 1GI3A 3TVJB 3DSOA 2BYAX 1P03A 2ZPSA 2Y6TA 1ZMNA 4J2YB 1UTMA 2RA3A 3IG6B 1EZXC 1UVUH 4WJG2 2OK5A 5JBCS 3UOUA 1GG6B 1WV7H 1DVAH 4I7YH 1DFPA 1BRAA 1QA7A 3BTQE 2BVSH 1INCA 1VJAU 3LGTA 3D23A 4WF8A 1Y5BT 3SYJA 9ESTA 4A6LA 1JBUH 1FAXA 2PTCE 1FN6A 1AVGH 3CS7A 4MPXA 4TY6A 1ZLRA 4K8YA 2D2DA 1YPLH 4I8JA 1F0RA 1E1QD 2A4OA 5K7RA 2KR7A 1KXAA 2NU1E 5J4QA 1GVZA 3KYGA 1OXGA 2P16A 1QQ4A 1COWD 1S83A 3UOPA 5EPYA 2RDLA 4Q4LA 1OS8A 1QB6A 3QTVH 3ZV8A 1Z8JB 2SGEE 2JJ2D 4NA8A 1F5RA 2XRCA 5L2YH 3MU4A 4GLYA 2H6MA 4ASHA 3TK6A 5E2PA 3KF2A 3AVZA 2QC2A 1BJVA 2ZCLP 3F1SB 1UK2A 1H8IH 1WTHD 1S0QA 1P11E 3HK6B 2H9HA 5JBBS 1AKSA 2OP9A 5F53A 3NK8A 1WQSA 1OWEA 4O03A 2QAAA 4YLUA 1B7XB 2Y5FA 2IJD1 2VVVA 3M5OA 1TA2A 3FVFB 2R0LA 2JJ1D 4DT7B 3LH3A 1O2LA 1ZSLA 1GI9B 3RDZA 1C5OH 1N8OC 1NRSH 1O3IA 2SGFE 4X6NA 2QE7D 2BZ6H 2WPHS 1V2VT 3ZZCA 4BNRA 1TRNA 2KCAA 4GVUA 4A1TA 3RC5A 1P9SA 4H6SB 2Z94A 3K6YA 1DUEA 4XD7D 2ZTXA 3ZZ5A 3LGVA 1O5GH 5HIZA 5LPRA 3MQKC 4MG3A 4X8UH 1GJ6A 1ANCA 1O2RA 1TMBH 4JZFH 2UUFB 4ESTE 4ZHLU 2Z9IA 2HWLB 5FBIA 1BRBE 1PPCE 3LDXH 1JXPA 3VXFH 1N1LA 1T8NA 2HRVA 2QIQA 5T6GA 1VITH 1XUIA 5EJLA 3OTJE 3ZYEA 1SG8B 4Y0YE 4ZKNU 3SZNA 1LHFH 1A0LA 2A2XH 1F0UA 1GMCF 4Y76A 1SQTA 5GCHF 1VZQH 2A4GA 2ODQA 3W1EA 3U8OH 4NWLA 5EQQA 2HLDD 1KLIH 1GMDG 1Q31A 2W6ID 2ZECA 4KTSA 4XDEA 5DP7A 2ZDMA 1LVBA 4WMDA 4A7IB 3A7XA 4UFGH 5E8EH 2XNDD 1EJMA 2KCPA 3GDUA 1O2XA 3FZDA 4I8GA 5GCHG 3K6ZA 2FLBH 3A80A 4ABFA 4U2WA 1AFQC 4X2XA 2OD3B 3SU0A 3OU0A 3SO3A 3RMNH 2TGAA 3F68H 3A86A 2VWMA 4NZLA 1FPHH 1K1NA 3AW1A 1E0FD 1G2MA 1HIAA 1YLCA 5L30H 2GDEH 2CJIA 2J34A 1S82A 3RXAA 2EA3A 1EP5A 2G4TA 2WV5A 2AEIH 5DP8A 1GI6A 4ZKRU 5J4SA 4ABAA 1DUAA 4AFUA 1DXWA 3ZZAA 5JBTA 5EJZA 3DFLA 1WTGH 4MTBA 2ZGCA 1BMNH 1GHWH 1C5NH 2BQWB 1O36A 1K21H 1IQFA 3MHWU 3KL6A 2H9TH 1QTFA 2PTNA 5AFYH 3PTBA 4AGKA 1GBAA 2G00A 3SNBA 5TJXA 1TNJA 1MZAA 4Q7XA 1ANEA 1BZXE 2GZ7A 1O3FA 3SBKA 2EI7A 2WV9A 1MKXK 1SOTA 1AN1E 3ELAH 5JDUB 4MDSA 1FIWA 1J17T 1C1SA 1AQ7A 3ZZ3A 4OS2A 1SMFE 7GCHF 1WU1A 4YTAA 1V2KT 2Y82A 2TBSA 2PSXA 3HKIB 1CGIE 1GPZA 3EDXB 2PKSB 1ABIH 1EUFA 3A84A 1S5SA 1RS0A 3G01A 3AAVA 3SU1A 2Y7XA 2KM0A 2A5IA 1Z6JH 1G32B 3D62A 4SGBE 5PTPA 5EJ1A 2ANWA 1UVTH 2JKHA 1QR3E 1FXYA 3GCNA 3VEQB 1KTTB 4FUBA 2D8WA 4FUEA 1O2QA 2RG3A 1VITF 1Z6EA 1ZYOA 3GDVA 4CRFA 2GD4B 2QY0B 2EQNA 1SI5H 1O35A 2CV3A 1MKXH 1UTKA 2VGCB 1LQDB 3U8TH 2ZU3A 1L1NA 2C8WB 4E06H 1A3EH 3DFJA 4FUGA 1DWCH 1IQNA 1A4WH 1C5YB 1O5FH 2BY5X 4OS5A 3S9BA 3SU5A 2O8LA 1TNHA 2PGBB 1TGBA 2G4UA 3K65B 1ELCA 1AO5A 3V12A 1BBRE 1C5VA 1A2CH 1TMUH 3MNCA 2XW9A 5H4IB 4I32A 2QN5T 5ESBA 1YCPK 3T62A 1WOFA 2PKAA 3SHAH 3WWFA 3SNAA 4K1SA 1MCTA 4NZQA 5LPFA 4K69A 2C8ZB 3SU6A 1O5DH 2TGPZ 1UTLM 4CRGA 1XKAC 3MOCA 2UWPA 1LKBA 4Y6DA 5HMAA 2CF9H 1PYTD 2OINA 1PPFE 3UNSA 1IQHA 1W7XH 1KMHB 1V2UT 4DT4A 5B6LA 3T28A 1TMTH 3M7TA 3RXCA 2ZU5A 4OGXA 1GI5A 3Q76A 2ZFTA 4YOJA 2QYIA 2QCYA 1VCPA 3AK5A 3P95A 3TK5A 4INKA 3RXIA 4E7NA 6LPRA 2XBWA 1DT2A 5DP4A 1FV9A 3PV5A 2GCHF 1PYTC 5CHAB 4NCYA 4DVAU 4ABDA 1XX9A 1HAGE 5IK2D 4O97A 5JB9S 4INHA 1DSTA 3H7TA 1FN8A 5DGJA 5CE1A 1FX0B 2G8TA 4X8VH 1H9HE 4DY7B 1MTVA 2FYRA 3RXPA 4Y79A 2I6SA 4FXGH 1BHXF 1MTNB 1BTPA 6GCHG 3T25A 2FS9A 1MD8A 3KCGH 5AHGH 3A8AA 1OKXA 2C8XB 3PM3A 1SGDE 1LKAA 4WH8A 1QIXB 3ATKA 1O33A 1Y59T 1CSOE 1DE7H 3GYMA 4HGCA 2WINI 1TPPA 3ZZ8A 3P8OA 3BG8A 1JRTA 4GCHG 3NPSA 3BSQA 1GVKB 4BTTB 1HAXB 2JETB 2BDCA 1C2DA 2ZU4A 3MU1A 4JZ1A 4YOGA 1KXDA 1O3EA 2GT8A 4NSYA 1O2ZA 5L2ZH 3EA7A 1T4UH 1CE5A 1BA8B 1F0TA 3F3BA 1P05A 1UO6A 2NWNA 1Z1IA 3DA9B 3O8RA 2AIPA 1FNIA 4ZCNA 2AFQB 5E2OA 4X6PA 7GCHG 5EPNA 2F9NA 4MLFB 4JZDH 1SQAA 4Y8ZA 3SV7A 1GJ7B 3FN8A 1HAIH 1IQMA 2Y5HA 2LP6A 1UCYE 4CHAC 3E16B 2EI6A 5CMXH 4XBBA 1YWUA 1ESTA 3BTTE 1O2NA 1O31A 5FXLA 4E7RG 1UTJA 2SGDE 4M9FA 1GBJA 1KDQA 1QL7A 1P3CA 1QB1A 4Y10E 4ZH8A 3T5FH 3TLOA 2TGTA 1AY6H 1ZRKA 2GKVE 1FQ3A 3RXMA 4TT3D 1Y3WA 1BTWA 1O3CA 3KGPA 1XKBC 4JK5A 2ZHEH 3P8GA 1NRPH 2FLRH 1NBMD 1P9UA 3TJOA 4B2AA 1OOKB 1SHHB 2HNTC 1P8VC 1LTOA 2FX4A 3QLPH 1RGQA 1GI8B 2W26A 2KCYA 1KSNA 3MH5A 3UIRA 3ZVEA 2FODA 3TJVA 1LHDH 1O2WA 1QJ7B 1HNEE 3WWBA 5C1UA 1WAYB 1D3QB 5C94A 3DHKH 2GMTB 4F49A 2V0BA 4CH2B 2AYWA 4JYUH 1GL0E 4KELA 2BLWA 1CHOG 1KXCA 2G51A 2GGVB 1L4DA 1NY22 1UTPA 2G5VA 1NRNH 2FOMB 4B75A 4TPIZ 1T7CA 1UTQA 4CBOA 3VB3A 4ISLA 1ZGIA 2ODPA 3BTHE 1UMAH 1D6WA 4NIWA 2O8MA 2ZKSA 1DSUA 1AB9C 1NS3A 4XRNA 1W0YH 1O3HA 4RKJB 1AVWA 3BN9A 3SORA 4X2VA 3RC6A 3TH3H 4AFQA 2FOCA 1SHYA 1QURH 3GOVB 2BM2A 3QK1A 3A7VA 4UDWH 1Y3XA 4AC9A 2A5AA 2Q6FA 3DSGA 3QGJA 1LCYA 1WQVH 3TGIE 1C9PA 3RU4E 1C5XB 4FU8A 1GMCG 2VJ1A 3A85A 2ZPQA 2ZA5A 2JETC 3ZV9A 1HAPH 2WSSD 1DOJA 1U6QA 2BY8X 5ETXA 5EXNA 1F7ZA 5DO4H 4FUFA 1QB9A 2NU0E 1K1MA 2SNWA 4TSFD 1O5AB 2ZG0H 1NPMA 2OC8A 5DJ7A 2OBOA 1QY6A 4IN2A 1BCUH 1BBRH 4BAMB 4WXVA 1C2EA 2FEQH 3ZVFA 5JPMH 3SNEA 1C1OA 4NG9H 3UB0A 2VBCA 2GJGA 2ZWLH 1C2IA 5FCKA 2BVRH 3GYLB 1CBWC 2PR3A 3AW0A 1YPKH 5C17A 1UW7A 1KY9A 3SUEA 4ZXXH 2BXTH 4IS5A 1KIGH 1SGIB 1Z8RA 2O9QA 3A7TA 1IQGA 5FPYA 4B73A 2ZU1A 3VB7A 3RMMH 3GY4A 1A5IA 3U28C 3UQOA 1GDNA 1V2QT 1BHXB 1BMLA 3OE7D 1J16A 4ZKOU 1T32A 4WXIA 2P93A 2CXVA 1BTYA 2YMSB 3TJUA 1MTUA 1HGTH 1G3DA 3DSPA 1HAHH 4ASUD 1AZ8A 1XMNB 2I6QA 2A0QB 4O9VA 3SQEE 4HTCH 2ZCKP 1TNKA 3PO1C 4I8LA 1XVOA 2PUQH 1SFQB 2FIRH 2F3CE 5DP5A 1SPJA 1QJ6B 1BOQA 1V6DA 1EB2A 1RFNA 1UVSH 1CHGA 1TPAE 1AZZA 1CGHA 1TONA 1Z8GA 2EI8A 4VGCC 2XXLA 3UFAA 2H5DA 4KTUA 1QGFA 1MKWK 2ZEBA 2THFB 2PLXA 1QFKH 3GY2A 1HV7A 3H7OA 4GCHF 4GAWA 3PMAB 2Y7ZA 4IMZA 3OY5U 1GJ5H 1C2JA 3F2HA 1G37A 1O3DA 3BTEE 4BANB 1E38B 5F8ZA 2ZIQH 4GHQA 1SR5C 1HRTH 2P8OC 2BLVA 1WBGB 5DSFA 1DWBH 1OYQA 3EA8A 1JMOH 3MYWA 5IDKA 1O3BA 2J94A 2ZDVH 4IN1A 3V0XA 3LGYA 1B0FA 5T1VA 1CT2E 2C4FH 1BB0B 1SFIA 4TWWA 1ESBA 1GJCB 2FWWA 5EXLA 8GCHG 3GCHB 2ZU2A 5HYOA 3A7YA 3BEUA 5BPEA 2FTMA 4Z1MD 1GBKA 1GL1A 1ANBA 1RRKA 1T8MA 1S6HA 1ARCA 2GCHG 3F9HA 1O3GA 4CRCA 1O2PA 1C4V2 1BT7A 1AGJA 2G5NA 3I77A 2IPQX 3RXGA 3P6ZB 1EJAA 1P02A 2FM2A 1O37A 2P59A 1EB1H 1HXEH 4WVPE 4X1QU 1D3PB 2QV1A 3TJNA 1ZJDA 1K22H 3UY9A 4WWYA 1ZSJA 3RXKA 2NU2E 1GCTC 1IHTH 1A7SA 2KCOA 4ACBA 3P17H 1EQ9A 1HXFH 1ELBA 5CHBA 2GZ8A 4XFQA 3SN8A 1E1RD 5FCRA 1ZTKA 2V35A 1TPSA 1S6LA 2BDIA 3KHVA 3RLWH 4CRBA 1SGRE 1JIMA 1SQRA 1QA0A 4MPVA 1PQ5A 2RA0A 3M3TA 3VB6A 4HG6A 1A3BH 5LH8A 4YESB 3ATLA 2PHBA 3RXVA 4R8TB 5GDSH 1X7AC 1GDUA 4AX9H 2AGGX 1C1MA 1NU7B 2GV6A 4B2BA 3S0NA 1YY3A 1TQ0B 1Z8IB 1TQ7B 3F2GA 3VB5A 5EIYA 1QNJA 2WPMS 3BF6H 5TCAA 2BLQA 3LPRA 2XTTB 1SGQE 1MBMA 3W94A 1ETSH 2KAIA 3DCLA 4H6TA 2KFWA 2RFKC 5KEDA 1V2MT 3UNRA 1H9IE 4K1TA 1NC6A 2Z6BD 3UREA 3SZEA 1GG6C 1MMJN 4ISIH 3EQ0H 1VITG 3LT3A 1Z1JA 2PGQB 4UFFH 2ZFSA 3BTFE 4NIVA 3F0OA 4FVBA 4OS4A 1FZZA 4UE7H 3A8BA 4K8BA 1O5EH 4FU9A 2ULLA 2G55A 5HM9A 1FI8A 3A89A 1O2JA 1P06A 3S7HB 3BTKE 1C4Y2 1ELVA 1OP0A 4UD9H 3SGQE 4BXWA 1H8DH 3URDA 1PQAA 3VB4A 1RIWB 4M7GA 1VGCC 2IJOB 2TGDA 1EPTC 3RXJA 1EAWA 1AMHA 1C5ZB 2O8UA 2ZF0H 1GHZA 4XBDA 4F4OC 1C1UH 3ZZ7A 1OHHD 2OC0A 1L4ZA 2BXUH 3PO1B 4AB8A 3SGAE 1V2LT 1MAYA 2DE8A 1UHBA 4XE4A 1CGJE 1KXFA 5ABWA 1C5PA 3BIUH 3M7QA 3AAUA 3U98H 4WMFA 2V3HH 2F9VA 1AWFH 1NT1A 1AKSB 1TE0A 2Y81A 4TWYA 3F9EA 4O3TA 3H09A 2LPRA 2HGTH 1EOLA 4A1VA 1NFXA 1YPHC 1TYNA 2WPIS 1BMMH 1PJPA 2EEKA 1GI2A 3D65E 4U30A 1HAYB 5DN6D 3OEHD 1MZDA 1YCPM 2BD9A 1MABB 3FAOA 1WYKA 4B71A 2BY6X 2BD5A 1O2HA 4JZIA 2A2QH 2BQ6B 5I25A 2ALPA 3GCHC 3IWMA 2P3FH 1LVMA 1C5WB 3A8DA 1Z7KA 1GMHF 1L2EA 2ZHFH 3DUXH 2PUXB 1ELEE 3QX5H 4F48B 1YLDA 3SI3H 4J1YA 3MH4A 1SLWB 3E3TA 2Q1JA 4KTCA 1SL3A 1OWHA 1A5HA 5FBEA 5LPEA 1K9OE 1LPZB 1ESAA 2R0KA 2FTLE 4GPGA 3BIVH 1MU8B 3LKWA 2AH4X 4NA9H 4Q2KA 4HFPB 2AMPA 3LONA 4FUCA 1VCWA 1EJNA 1P09A 3MMGA 3QWCH 1DM4B 1UTOA 1CT4E 3BTGE 3KEEA 1GMDF 3RMLH 2ILNA 2B0FA 2ZZUH 4INLA 4TPYA 1D6RA 2K0QA 2Y5GA 4Y11E 5T3HA 1PQ8A 1XUHA 3PLKA 1Y5UT 3D49H 2AGIX 3M61U 1GJDB 2VIDA 1P2JA 1PPEE 1L1GA 2A4QA 1EZQA 1P10A 1TBRH 3L33A 1ORFA 1BITA 3Q3XA 2BDAA 1ELTA 3EGKH 2QGRA 4LK4A 1BJUA 3FP8E 3I78A 4X6MA 1G30B 1FONA 3SGBE 5DP3A 1IQEA 2V3MA 3GICB 4YOIA 4K5ZA 1MU6B 2FOHA 4K2YA 1KLJH 1ETRH 4JCNA 2A32A 5E0GA 3SNCA 3T2NA 3PYHA 3GCTG 1BDAA 1V3XA 2RDEA 3GY3A 3OFND 1XUGA 1FMGA 1IAUA 2D26C 1ELAA 1GBHA 4P02A 1A0HB 2F9UA 1ACBE 4CH8B 1C2HA 5A0CA 1T31A 2A1DB 1QL9A 4YM9A 1W14U 2Z9LA 1XUJA 1SGPE 2NU4E 1FJSA 1DDJA 2ZQ1A 2V7QD 1SQOA 1SGFG 4RSPA 2JH0D 2WYGA 3AASA 4AG2A 3C27B 1FY8E 4AFSA 2VWLA 1EOJA 1L0ZA 1LHEH 1TGTA 4UONA 5A8YA 2XBXA 3S69A 2ANKH 4AYVB 1AWHB 1GBIA 1C2LA 1H8ED 2AS9A 4ACAA 4ZROA 1GCDA 4GUXA 8LPRA 3NCLA 1C1NA 2C8YB 4CHAB 1ZTLA 2HPPH 1FY4A 1O2UA 1P2NA 2FOFA 4H4FA 1GBLA 1HAVA 1SKYE 2G52A 4OS7A 4ZUHA 2B9LA 1GBFA 4NFFA 2J5UA 5GIBA 2F9PA 3LOXA 5FL7D 2Z9JA 1HCGA 4D8NA 2BD8A 2UWOA 2BDGA 2ZI2H 1SGTA 1TOMH 2VH0A 2OQUA 4ISHH 3UPEA 4ISNA 3KYFA 1KYNA 2ZFRH 5GXPA 2WPJS 1C5UA 2FOBA 5ESTE 3LC3A 1E35B 2XWAA 1EAIA 4CRDA 1TRMA 4ABBA 1ZR0A 1DS2E 3HGPA 1Y3UA 3KQBA 3L3TA 3QDZB 2BHGA 1EZSC 3Q3YA 3RU4D 1MCVA 1NRRH 1ZPZA 1SB1H 1BRCE 1GJAB 4X6OA 2XCNA 2FZZA 1GHAG 1SLVB 3OAAD 2GDDA 2DE9A 3N7DA 3T29A 4BTUB 1FAKH 2PKAB 2NU3E 2CF8H 5DK1A 2BD2A 1NRQH 4RT1A 3LC5A 3ZVAA 4O3UA 4FU7A 4ABIA 5DKMA 2QXGA 1XVMA 4WY3A 1TIOA 1GHVH 1G2LA 4X1NU 4ZXYH 4DIIH 3R3GB 3SQHE 3ZZ4A 5EW2H 4B2CA 1GJ8B 4KGAA 1P12E 5C5NA 3BV9B 1ABJH 1W10U 1RIWC 1Y3YA 2CK3D 3DT0H 3UQVA 2BZAA 3MU0A 2ZHDA 4BAHB 1E79D 4D76A 1G3EA 2ALVA 4I86A 3V3MA 1RTFB 1GBBA 1YP9A 1G9IE 2VGCC 2WUBA 2WPDD 3MO9A 1TPOA 4CREA 1M9UA 1V2OT 3VPKA 3ZYDA 3RXUA 5IYTA 1E37B 1TBZH 1DWDH 1AE5A 4P00A 2PV9B 2L6OA 4BAOB 4XBCA 2CN0H 2ZDAH 1NFWA 1CU1A 3RMOH 4BAQB 2BX4A 2QXIA 4YXWD 2A31A 1JWTA 1ZZZA 3LGUA 1BMFD 1PQ7A 2C3SA 1NESE 1W8BH 1ZMJA 2GX4A 3B8JA 4A5TS 1LDTT 4ZMAH 4Q7ZA 1YPEH 2QA9E 1MH0A 2R2MB 1RTLA
chains in the Genus database with same CATH topology
3SV9A 3A7WA 5FPTA 1SGCA 2B5TB 2ZCHP 5EQSA 4NIYA 1CBWB 4IMQA 1EATA 4AOQA 2J4IA 3RUOA 1SGFA 2STBE 1H4WA 2OQ5A 1C5RA 1C9TA 3SOSA 3B9FH 5LGOA 1J14A 2A4RA 5EGMA 2SGQE 2W5EA 1BUIA 1KXEA 4YZUA 4GSOA 1KXBA 2WPLS 1O39A 2UUJB 2A7CA 3ODDA 1O2TA 1H1BA 1KDQB 1O3PB 1HDTH 1G3CA 2Z3CA 5FX6A 2FPZA 3SV6A 4D9RA 4HI3A 1HAOH 2OC1A 3SUDA 3A82A 1K2I1 7LPRA 2F9BH 1MQ6A 3JZ1B 5DP6A 3RU4T 1QBVH 4FUJA 1O2KA 4QT8C 1AB9B 1CA0B 1S85A 1AVXA 2TIOA 1RD3B 1OSSA 3TITA 2GVFA 1ZGVA 3BTDE 1TAWA 3T26A 1C1VH 2BLOA 1TNGA 1TALA 1F5KU 1FY5A 2SNVA 1THRH 2GP9B 2ANYA 2OBQA 3H5CB 1GHAF 2Z3EA 3EAJA 1YKTA 3SJ9A 5HXFA 3TPIZ 2LNCA 1Q2WA 1DLEA 2Z9KA 2Z3DA 1LO6A 3GY7A 3MU5A 4IGDA 5JBAS 1TABE 4X1SU 1QRWA 5F8XA 1TNIA 2ZGHA 2HNTF 4Y8YA 3E91A 1Y3VA 4ZHMU 1PPHE 3TGJE 2AGEX 1NM6A 4B1TA 1ZTJA 2XC4A 2BQ7B 5EG4A 5C2ZA 1EXFA 2AERH 2HNTE 5GPIB 3TGKE 1LMWB 3C1KA 3EA9A 4AGJA 2XC0A 3ZZDA 2ZC9H 2HLCA 1W0ZU 1AU8A 4RN6A 2HPQH 1C5LH 1B5GH 3GCTF 1JOUB 4ISOA 1OYTH 3TU7H 1O2VA 1OP8A 1P2MA 4IW4E 1PFXC 2ZDKA 2WPKS 1C5SA 1HJ8A 2ZGJA 1S81A 3F9FA 3P8NA 2ZGXH 2FX6A 2SGPE 3QGNB 2J2UA 2ANMH 3RLYH 5JB8S 2W3IA 3HK3B 1P3EA 3RXQA 4DURA 4MNXA 1K1JA 4BTIB 4JZEH 3RXEA 1C1QA 1EASA 3OSYA 2ZDNA 3BTME 1DANH 3PROA 1LVOA 2IN2A 2H2ZA 3QO6A 1DICA 1V2TT 2HALA 2G81E 1YPHE 2WUCA 8KME2 3FP6E 3OY6U 3RXOA 4X2WA 1ZOMA 1F5LA 1RXPA 1AFEH 1C1WH 4JYVH 3O8CA 4X2YA 1UVOA 1ARBA 1MTWA 1QBNA 3UWJH 3CENA 1GHXH 1C2GA 5A0BA 3Q3KA 1V2JT 1GI4A 4D7FA 5DP9A 1BIOA 1SGYE 3KN2A 1GVLA 3SU2A 2WV4A 3B23B 1C1PA 2UWLA 1G36A 5EQRA 1P0SH 1UK3A 5AFZH 4X1PU 1W12U 3A7ZA 3BEFB 1ZSKA 2XBVA 1K1OA 1P2OA 5GWZA 4K1EA 3E90B 1V2WT 5L6NH 5FX5A 5GJ4B 5F6MA 1MKWH 2R3UA 2R3YA 3VGCC 1T8OA 1SC8U 1GBMA 2FP7B 1NU9A 2AMDA 3K9XB 1NZQH 1BBRK 2VWNA 1EPTB 1P2KA 3RXRA 1V2ST 1DWEH 3E8LA 1BTUA 3M5NA 1ZMLA 1PPGE 3RM2H 5DPAA 1OP2A 1O2IA 1YCPH 2FI3E 2XC5A 2ZFPH 1O30A 4UFEH 3M5MA 3KQEA 3BTWE 1HJAB 3PWCA 1CT0E 1CA0C 1O38A 4E05H 3U9AH 3MO3A 1THSH 1GBTA 3HPTB 1GGDC 2FI4E 1G3BA 3S7KB 2ZPRA 2BVXH 3P70B 3NUMA 3M35A 4RKOB 4WH6A 1HJ9A 2XNIA 1DITH 1S84A 3SV2H 4CR5A 2B8OH 1A61H 2FDAA 4Y0ZE 1W13U 3S9AA 3PLPA 2VB0A 4BXSA 1GWAA 5EODA 1C1RA 4AORA 2O8TA 4YT7H 1C2KA 1TGNA 3FZZA 2J92A 4KP0A 2ZO3H 1HYLA 2PWXA 3GY8A 3ZZ6A 6CHAB 4X0WU 1EX3A 1B0EA 3K2UA 3QN7A 3MTYA 2VIWA 3F9GA 3TK9A 4MPWA 3PB1E 1DLKB 1V2PT 1UCYH 5SGAE 3RM0H 3PMBB 2HOBA 3MH7A 1P04A 1RTKA 3PMJA 5A2MH 3S9CA 4ZHAA 3L6PA 3TH2H 1HIAB 1VR1H 1SVPA 3M3SA 2YNAA 3W95A 1GDQA 1P2IA 3TNTA 3M36A 2BB4A 3SNDA 1TNLA 2PKSC 2BDBA 1IQLA 1YC0A 3FANA 4Y71A 2VVCA 1GHBF 1WSSH 2P3TB 2ZNKH 4ABGA 3V13A 1O5BB 5A09A 1TGCA 2QXHA 3SUFA 3MO6A 4NSVA 1LHGH 1MUEB 2A7HA 3RXBA 1GHBG 2O8WA 3NXPA 3U8RH 1T8LA 4OS6A 3MH6A 1O3LA 3BEIB 4IBLH 2H1UA 3V7TA 4ABEA 2ZDLA 3ZZ9A 3E0PB 5EOKA 3UTUH 2BOKA 1V2RT 1T4VH 1ELGA 1Y5AT 1NROH 4HZHA 5C3NA 3MNSA 4DOQA 4NIXA 1SOZA 2IPHA 2GCTC 4WMEA 4U32A 1A0JA 5BRRE 4X8SH 4NFEA 3LIWA 5AVDA 2W7UA 2BTCE 2Z7FE 4YLQH 1HJAC 1BRUP 1IQKA 3NKKA 1O2YA 1C1TA 1FDPA 1XUKA 3OX7U 1K1PA 2YOLA 3I29A 1P57B 1ZPBA 6GCHF 3N7OA 1XXDA 3VXEH 2VWOA 1FY3A 4MQAA 1EP6A 2Q6GA 7ESTE 2HVXA 3O8DA 3UR6A 3SJ8A 8GCHF 5DG6A 1LVYA 2FOEA 1HB0B 1ID5H 2A45B 3Q00A 1BTHH 5F8TA 3JZ2B 1O3AA 2OCVB 3VGCB 2VIVA 2STAE 1HFDA 2PFEA 1OWIA 1C5QA 1TLDA 4CR9A 2FOAA 2GCTB 3ATMA 1AFQB 2SFAA 1BMAA 3LGIA 3QUMP 3RXFA 3KQCA 2JH6D 4DGJA 3LH1A 3SI4H 1ZRBA 4JYTA 1TBQH 4MNVA 3T27A 1O3NA 1WCZA 1C2MA 1EZUC 3R0FA 3ATWA 2UUKB 4GHTA 2QF3A 2ZP0H 3BG4B 4AB9A 1GI0A 2GV7A 3UR9A 2P3UB 4JK6A 3FFGA 4Y8XA 1TA6A 2BMGB 2C93B 3GY6A 3RXDA 2BOHB 3M37A 5I46H 2K1QA 3UUZA 4ABHA 1OWKA 1FUJA 2BY7X 5E0JA 2VIOA 4CRAA 3URCA 1TFXA 1K1IA 1QCPA 1L1JA 3ODFA 2CMYA 1OWJA 1EAUA 3OYPA 1LPGB 3ZVCA 1N6XA 4Y7AA 1TRYA 5EW1H 5C1YA 1ELFA 5HGGA 4LZ1H 2XBYA 2OUAA 4I31A 3MWIU 1N8OB 1NN6A 2PSYA 3RXLA 4AZ2B 2TPIZ 3NZIA 4FVDA 1GJBB 4JMYA 9LPRA 3PWBA 1W7GH 1YPGH 3P92A 5K0HA 1THPB 3SJIA 1Q3XA 3ESTA 1MTSA 3KQDA 3SU3A 1W11U 1DY8A 1YM0A 3TIUA 4AN7A 4I8HA 3PV4A 3P8FA 1C5MD 2ZQ2A 1GGDB 1O3KA 1HUTH 4PROA 2BD4A 2F91A 4ZAEA 4FUDA 2OLGA 3SW2B 4NWKA 3O8BA 1GJ9B 2KAIB 5G4BA 1J9CH 2FESH 2B7DH 1PPZA 1HBTH 3SUGA 3SHCH 1VGCB 1YPJH 3A88A 4VGCB 2XCFA 4NGAH 4Z0KA 1HLTH 2ZGBH 3GCOA 1AUJA 5C20A 1CO7E 4DG4A 1O3MA 4MNYA 1ZPCA 3ZVGA 3ZVBA 1ZJKA 1CVWH 2D1JA 1UK4A 4Q80A 1ETTH 1GBCA 1C2FA 3U1IB 5A8ZA 2RCEA 3ITIA 5HM2A 4A92A 5B6OA 4FUIA 5C1XA 1IHSH 2R9PA 4I33A 5C67A 3ZZBA 3WY8A 1GI1A 2XYAA 1CHOF 2OC7A 1O32A 3RC4A 5C5OA 3PTNA 1TOCB 1RJXB 1JIRA 1F92A 2A5KA 3MNBA 1BQYA 2CGAA 1XXFA 2ODYB 1O2MA 3RXSA 3E6PH 1SSXA 3MNXA 5T6FA 4BOHA 1YBWA 1O2OA 5TCCA 2QF0A 4B76A 2SGAA 3A8CA 3QZQA 2FOGA 1AE8H 3A87A 3LJOA 4I8KA 4AG1A 1FY1A 3KNXA 1DX5M 1SGNE 2ESTE 3PLBA 3ATIA 3RP2A 3HATH 3ENSB 4SGAE 3STIA 4B74A 1LHCH 3RXTA 3E0NB 3M5LA 1SGEE 1GJ4H 1QRXA 5T6DA 7KMEH 1NO9H 4X8TH 3QZRA 1A46H 2EC9H 3M3VA 2Z9GA 2F83A 1MD7A 2IOTA 3E1XB 1P2QA 1GBEA 1TX8A 3CP7A 4THNH 5JYIA 3TH4H 4MPUA 1O34A 3SU4A 2ZTYA 1TB6H 3ZVDA 1O5CB 1GMHG 2BX3A 3KIDU 4MNWA 1GI7B 4IC6A 4OS1A 4ZKSU 1O0DH 4DIHH 1MTNC 2ZHQH 4DCDA 1YPMH 1A1RA 1BTZA 5AF9H 1LQEA 2FMJA 3LGWA 1SBWA 2P94A 5A0AE 5FAHA 1DY9A 1UHBB 1K1LA 3UWIA 1BTXA 2FXRA 1ZHMA 1S6FA 1HAVB 4DJZB 4U01A 1UJ1A 1IQIA 1QJ1B 1XM1A 1NFYA 2UUYA 5FPSA 3NWUA 1C5TA 5CHAC 1EKBB 3BG4C 3STJA 3EYDA 1D4PB 1KTSB 1QBOA 2OXSA 4UEHH 1GHYH 1AI8H 3A81A 1DPOA 4X1RU 4D7GA 1QRZA 2BD7A 1KLTA 1HAZB 1QL8A 2GMTC 4IC5A 1IQJA 2H9EH 2WYJA 5FHTA 2J95A 4Z6AH 1ZHRA 1Y8TA 2P95A 2W3KA 1XUFA 4YT6H 2M5TA 2FI5E 1J8AA 3F6UH 1V2NT 1FLEE 5EXMA 6ESTA 1D3DB 1E36B 1VJ9U 4K60A 2XWBI 2JH5D 2VINA 2FS8A 1AD8H 1F2SE 2FO9A 1W2KH 1WUNH 4AFZA 1P01A 5EU8A 1S0RA 1MBQA 4LZ4B 2GZ9A 1GBDA 2J38A 2R2WU 4A1XA 4FUHA 1LPKB 2BDHA 3MFJA 1QQUA 1DXPA 1Z71A 2CHAC 1O2SA 2VIQA 4XOJA 3A83A 3MU8A 1YF4A 3LJJA 1YGCH 1CA8B 2A7JA 3QTOH 2Q6DA 2BD3A 3EE0B 5E0HA 3GISB 2ZHWH 2ZFQH 4XSKU 2VNTA 1AUTC 2H5CA 1N6YA 1J15A 3DD2H 2AMQA 1O3OA 2AIQA 1GCTB 1PPBH 5A8XA 4NA7A 1W3CA 3U1JB 3LU9B 2VU8E 4TY7A 4LOYH 1NFUA 2ASUB 4R0IA 2GTBA 1A5GH 1UTNA 4AYYB 3UNQA 1H9LB 4CBNA 1TX7A 2V3OH 1SLUB 2BDYA 1OX1A 1ZHPA 4DW2U 1O2GH 3CS0A 3FP7E 2TRMA 2VVUA 3RXHA 2VIPA 1TGSZ 2DUCA 2YNBA 1D3TB 2CHAB 4LXBH 4Y7BA 3IITA 3M7UA 1EAXA 1C4U2 1NTPA 2Y80A 3HGNA 3TNSA 4K3JA 2C90B 3PMHB 1YYY1 2QXJA 3HKJB 3Q77A 1AIXH 1OWDA 1FIZA 1D9IA 4MVNA 2PW8H 4TYDA 4OGYA 4UFDH 4H42U 1MQ5A 2P8OB 3VFEA 1K28D 5F03A 1HPGA 3SV8A 2VH6A 1ELDE 2V6NA 1TX6A 3GY5A 2W7SA 1ANDA 1CQQA 1VCQA 1AHTH 4ABJA 2F9OA 3MI4A 3SJOA 1UCYK 1UVPA 2BY9X 2OTVA 3U69H 6CHAC 2J9NA 1EPTA 1O3JA 1TWXB 1JRSA 4Q7YA 4KKDA 1FPCH 1MAXA 3SJKA 2ZFFH 1E34B 1F0SA 1QHRB 1OPHB 1SLXB 2GT7A 3GDSA 2ZTZA 8ESTE 4YO9A 4BAKB 2FYQA 1IOEA 1GI3A 3TVJB 2BYAX 1P03A 2ZPSA 2Y6TA 1ZMNA 4J2YB 1UTMA 2RA3A 3IG6B 1EZXC 1UVUH 4WJG2 5JBCS 3UOUA 1GG6B 1WV7H 1DVAH 4I7YH 1DFPA 1BRAA 1QA7A 3BTQE 2BVSH 1INCA 1VJAU 3LGTA 3D23A 4WF8A 1Y5BT 9ESTA 4A6LA 1JBUH 1FAXA 2PTCE 1FN6A 1AVGH 3CS7A 4MPXA 4TY6A 1ZLRA 4K8YA 2D2DA 1YPLH 4I8JA 1F0RA 2A4OA 5K7RA 1KXAA 2NU1E 5J4QA 1GVZA 1OXGA 2P16A 1QQ4A 1S83A 3UOPA 5EPYA 2RDLA 1OS8A 1QB6A 3QTVH 3ZV8A 1Z8JB 2SGEE 4NA8A 1F5RA 2XRCA 5L2YH 3MU4A 4GLYA 2H6MA 4ASHA 3TK6A 5E2PA 3KF2A 3AVZA 2QC2A 1BJVA 2ZCLP 3F1SB 1UK2A 1H8IH 1WTHD 1S0QA 1P11E 3HK6B 2H9HA 5JBBS 1AKSA 2OP9A 3NK8A 1WQSA 1OWEA 4O03A 2QAAA 4YLUA 1B7XB 2Y5FA 2VVVA 3M5OA 1TA2A 3FVFB 2R0LA 4DT7B 3LH3A 1O2LA 1ZSLA 1GI9B 3RDZA 1C5OH 1N8OC 1NRSH 1O3IA 2SGFE 4X6NA 2BZ6H 2WPHS 1V2VT 3ZZCA 4BNRA 1TRNA 4GVUA 4A1TA 3RC5A 1P9SA 4H6SB 2Z94A 3K6YA 1DUEA 2ZTXA 3ZZ5A 3LGVA 1O5GH 5LPRA 4MG3A 4X8UH 1GJ6A 1ANCA 1O2RA 1TMBH 4JZFH 2UUFB 4ESTE 4ZHLU 2Z9IA 2HWLB 5FBIA 1BRBE 1PPCE 3LDXH 1JXPA 3VXFH 1N1LA 1T8NA 2HRVA 2QIQA 5T6GA 1VITH 1XUIA 3OTJE 3ZYEA 1SG8B 4Y0YE 4ZKNU 3SZNA 1LHFH 1A0LA 2A2XH 1F0UA 1GMCF 4Y76A 1SQTA 5GCHF 1VZQH 2A4GA 2ODQA 3U8OH 4NWLA 5EQQA 1KLIH 1GMDG 1Q31A 5DP7A 4XDEA 2ZECA 4KTSA 4D9QA 2ZDMA 1LVBA 4WMDA 4A7IB 3A7XA 4UFGH 5E8EH 1EJMA 3GDUA 1O2XA 3FZDA 4I8GA 5GCHG 3K6ZA 2FLBH 3A80A 4ABFA 4U2WA 1AFQC 4X2XA 2OD3B 3SU0A 3OU0A 3SO3A 3RMNH 2TGAA 3F68H 3A86A <