3D65E

Crystal structure of textilinin-1, a kunitz-type serine protease inhibitor from the australian common brown snake venom, in complex with trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords Textilinin
publication title Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom, in complex with trypsin
rcsb
source organism Pseudonaja textilis textilis
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d65E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d65E02
3HGNA 4DJZB 1QIXB 4CRGA 1QR3E 3NKKA 1C5XB 3VEQB 1LVYA 1V2LT 1Y59T 3EA9A 1S85A 1C1VH 1GBTA 1H9IE 3Q3YA 1LVBA 5TCAA 4BXWA 6GCHG 1S81A 5FBIA 1BRCE 1O3FA 2AYWA 4O9VA 5A8XA 1HAVB 2Z9KA 1TLDA 5C1XA 1BB0B 1LCYA 3KCGH 1EQ9A 1GCDA 5ESTE 1SC8U 4AYYB 1ZMNA 2BXUH 2BLVA 2BXTH 4H4FA 2G5NA 3M7QA 4AFQA 3AAVA 1ZRKA 1T4VH 1EOJA 1XKBC 2P8OB 3Q76A 1XUJA 2TIOA 2I6SA 1RXPA 2ZTXA 2BQ6B 3OY6U 5C3NA 2VIPA 3H7OA 1LHDH 1W10U 2FDAA 2V6NA 5FPTA 4KTSA 1XXDA 1UTLM 1ORFA 1WUNH 2F9OA 1B0FA 2R0KA 2OC8A 2HLCA 1RFNA 3K6YA 5J4QA 4B2AA 2D2DA 3A8CA 2VH0A 3F9EA 1DVAH 4OS7A 4INLA 1TMTH 1QGFA 1CSOE 1NZQH 1UCYE 4GAWA 1MCTA 1C5ZB 2NU4E 1C5PA 4AZ2B 2ZGBH 1O39A 2BDYA 2ZU2A 3SBKA 1BMAA 2BD5A 3BEIB 1JMOH 1SQTA 1XUHA 2OXSA 1S82A 5T6GA 1V2JT 3A7ZA 1NO9H 3M3TA 1HAZB 1UCYH 2CF9H 1YPLH 2H2ZA 1DOJA 3LGYA 1O35A 2B8OH 5FPYA 1ZTLA 5FHTA 5LH8A 2Q6FA 3S7HB 2A2XH 2FOAA 2XXLA 2WYGA 3PWCA 2BVXH 1TNIA 2W3IA 3BN9A 1QY6A 2A7HA 4JZFH 1W8BH 1ELBA 1QBNA 2AS9A 4XDEA 3QUMP 1O3OA 4Z6AH 1DFPA 1UK4A 3S7KB 4FU9A 4ISOA 3C27B 1T32A 1P2OA 2XWBI 1QFKH 1GMCF 4WY3A 2GX4A 2Z9JA 3A8BA 1F92A 1EJMA 1S0QA 4KKDA 3SU2A 4JMYA 1LO6A 1BTWA 1UVOA 4GHQA 1QB6A 1W7GH 1BJUA 2Y5GA 3FFGA 3SZNA 2A31A 1ELAA 2W26A 2ZU4A 2QGRA 1O2RA 3KNXA 1UCYK 1ZTJA 1P09A 3KQCA 1AZ8A 3RXJA 1C5NH 1IQJA 4MNWA 4IN2A 2UUYA 1W0YH 1O5GH 1SB1H 3QN7A 1MU8B 4A7IB 5EPYA 1AFQC 2W5EA 3NPSA 4X0WU 1ZMJA 4INHA 1ELTA 1CT0E 1MBMA 4CHAC 4NFEA 3RXBA 3OX7U 2FYQA 1F0RA 1MZAA 5CHAC 3SNAA 2FM2A 1P2MA 1GGDB 2Y80A 1E38B 1ZOMA 2FEQH 3A83A 5E8EH 2QV1A 5GCHG 4UONA 1G3BA 3IG6B 3QGJA 1IQLA 3LC3A 3TK5A 1J15A 1K1JA 3TNSA 2G55A 2AEIH 3LDXH 5C1UA 4JZ1A 3TIUA 4X8VH 1EX3A 1O2QA 3DFJA 1C2IA 4AB8A 1VCPA 2DUCA 4U32A 1H8IH 1BJVA 1GI4A 2F9BH 2B0FA 4WF8A 3SUDA 2GZ7A 2FLBH 1NFUA 2GKVE 4UFDH 4WMEA 4IC6A 1O5AB 1Y5BT 3EYDA 2WPHS 3BIUH 1SQOA 1NESE 1DLEA 5BPEA 1C2DA 1HCGA 2F9VA 4VGCC 1IQKA 4WJG2 2OUAA 1ETRH 5K7RA 1TGCA 2A1DB 3ZVBA 2VIDA 1TABE 1IHTH 1G3DA 4YZUA 1H9HE 1LMWB 4B75A 5FCRA 5L30H 4MDSA 2FXRA 3MH7A 5DP3A 1ANDA 1NROH 1NRRH 2ZDMA 1GL0E 6CHAB 1G2MA 1QJ1B 2ZFFH 4NIVA 3TJOA 2ANMH 1GJ8B 4GCHG 1GJCB 2BM2A 1CO7E 2J9NA 5I46H 1CGIE 2UUFB 1K22H 2BHGA 2ZGHA 2ZDAH 3A87A 1C5WB 5GIBA 3RXAA 3TPIZ 4NSVA 3AW1A 3W94A 3IITA 1T8LA 1C2GA 2C8YB 2BYAX 4CBOA 2FOHA 1O33A 1ZPBA 1NRQH 2PTNA 3UUZA 1B7XB 1G3CA 1HAHH 5DG6A 1BOQA 5DK1A 3LH1A 3LT3A 1SGFA 1A5GH 3LGVA 3SGQE 1DT2A 1SBWA 2Z9GA 3M61U 3SU0A 1O2JA 3LKWA 1RD3B 1TNJA 3T62A 1GI1A 1HAIH 1C4U2 1P2KA 5ETXA 1PFXC 2VH6A 3ZVDA 2BQWB 2BDIA 4GUXA 4YOGA 3LC5A 3SU6A 1O2HA 1W11U 1Y3YA 4YO9A 1TRMA 3SGBE 1C5RA 2AMDA 3FVFB 2HWLB 2PLXA 1O3CA 1QURH 3MU0A 4MPWA 1C5VA 3SHAH 3ZYEA 2RG3A 4ZKOU 2K1QA 4MNYA 1HNEE 1WBGB 4I33A 1HJAB 3PMAB 2XBWA 4ISHH 1BT7A 6ESTA 2P8OC 2SFAA 5FBEA 2UWLA 3PLPA 1TNGA 3ZZ5A 1V2PT 3M5NA 1TNHA 3ZZ3A 1GG6B 2PKAA 1XUFA 1TB6H 4ABBA 2HGTH 1UTJA 4JYUH 3RLYH 1IQGA 4B2BA 1VITG 4B73A 3RP2A 2IOTA 2YNBA 2VVVA 1YBWA 1ZHMA 4I8GA 3HGPA 2ZPRA 4YOJA 4ZUHA 1DY8A 1GBMA 1D6RA 3STJA 4BAHB 1X7AC 1HIAB 3BTDE 1C5UA 5A0CA 1PYTC 2BZAA 4Y7AA 2CJIA 3ODDA 3SQHE 2WPKS 2QN5T 1AWHB 4YT6H 4DT7B 3MO3A 4TYDA 1CBWB 3ODFA 3QK1A 4ISLA 2ZO3H 4XSKU 1OSSA 4AFZA 3QGNB 5EOKA 5JBAS 2P93A 3ZZ9A 3ZZDA 1ELCA 3GISB 2FOFA 3ATMA 2A4GA 1BRUP 4FUHA 1NN6A 1IQNA 3ITIA 1K21H 1BA8B 2NU2E 4E7NA 2R2WU 5A09A 3R3GB 2GV7A 1OX1A 2RCEA 3LGUA 4BANB 4D7GA 3GY3A 2QIQA 2BVSH 4NA7A 1V2ST 4LZ4B 1EJAA 3GCTF 5PTPA 4Y76A 1C1PA 1C1MA 1BRBE 4AGJA 3URDA 2XC5A 2SGQE 2CHAB 3PLKA 3BIVH 3GCNA 1QQUA 1YPHC 3PROA 4J2YB 1LQDB 1O5CB 2Z3DA 3QZRA 3SOSA 1BZXE 4OGXA 2BD7A 3OU0A 5C20A 5EW2H 1EZQA 1O5DH 1GI7B 2V35A 1TGSZ 4D7FA 1EAIA 1NY22 1TBZH 5DP7A 1HUTH 3B8JA 3D49H 2FESH 5DP5A 4ZXXH 3T2NA 2QC2A 1TNLA 3BV9B 1P04A 1GGDC 1Y5AT 2VNTA 4I8KA 1O2TA 4FU7A 4DG4A 2BY9X 3E91A 4I8LA 1GDNA 2PWXA 3FAOA 1B0EA 2SGAA 2A32A 1ZSKA 1XVOA 1CVWH 4Y0YE 3OYPA 1P05A 2ALPA 2Y81A 3MO6A 1L1NA 1BTXA 3RDZA 1O3BA 1PPHE 1E36B 4LK4A 1S6HA 1O5FH 3KF2A 4AB9A 3S0NA 4YLQH 1GBJA 1L4DA 2RDLA 1GWAA 3ZV8A 3VB6A 4BAMB 1AVGH 2QXHA 1HYLA 2RA3A 3BTWE 1FY5A 1NFWA 4CREA 1C5LH 1J17T 3BTGE 5TJXA 1CHOF 1FONA 4FUBA 2H9EH 4X8TH 1AUTC 3BF6H 2AMQA 3RMOH 3V13A 4AOQA 2R0LA 1D3PB 1YF4A 1NPMA 2BDBA 2BMGB 4KP0A 1SR5C 1DSTA 4SGAE 3TH3H 9LPRA 3QTOH 4X2WA 3STIA 3S9AA 2ZCKP 4MPVA 4IC5A 3F9FA 3LJJA 1P12E 1VITF 2VVUA 2ZC9H 1IQMA 4X6PA 2WINI 5E0GA 3RU4T 1GPZA 1A5IA 1LTOA 3OY5U 3NZIA 5AHGH 4NIXA 2Y82A 1O2VA 3KGPA 1QA7A 2EA3A 3GYLB 3ZVAA 6CHAC 1GBHA 4Y6DA 3PTBA 2R2MB 3PMHB 1TA2A 4X6OA 4ZXYH 5C2ZA 3K6ZA 5T6FA 1UK2A 1KXCA 2ZDVH 1LVOA 1C1NA 1QTFA 1RJXB 1S6FA 4K1EA 4DVAU 4DY7B 2VWMA 1WYKA 1SGFG 1VGCB 5GXPA 2EI6A 1KXBA 1GBKA 1AWFH 5LPEA 4CR5A 1ID5H 4U2WA 2ESTE 2P3TB 3ATLA 1QRXA 4TPYA 2PKSB 4ABFA 3RXSA 1QJ7B 3DT0H 3URCA 3DFLA 4BXSA 1GHAG 1SFQB 1WAYB 2WPJS 1AVXA 1V2WT 1TPAE 1G37A 1YM0A 1Z8IB 2GTBA 1W12U 3MU1A 5J4SA 1MZDA 1OP2A 1HAVA 5LPRA 1J16A 3CS0A 3LGIA 4MLFB 1O2ZA 5TCCA 1OWEA 3R0FA 4X2VA 4YOIA 5HGGA 2P59A 1ANEA 4U30A 1SGPE 1HDTH 1P02A 5HM9A 4IMQA 1JRTA 3TH2H 3TK9A 2P16A 1VZQH 1AKSB 1G2LA 1GHZA 4IN1A 1HJAC 2H1UA 2G4UA 2PSXA 4TPIZ 1IHSH 2GVFA 2BD3A 3MH4A 4UFEH 2SNWA 2VGCB 1GG6C 1UTMA 3M35A 3ATKA 3EAJA 3FP6E 1C2MA 2OP9A 1DICA 3H5CB 4XBBA 4HTCH 1A0LA 1FNIA 1F0TA 1UTNA 2O8TA 1JWTA 1YP9A 1NRPH 1EPTB 3A7YA 1HXEH 1A3BH 3HPTB 1AD8H 1ESAA 4KTCA 4JCNA 4WXVA 3F1SB 1D3TB 3TH4H 1MD7A 3UNRA 4NZLA 1BDAA 5EG4A 4K69A 1LKBA 4WXIA 3SJ8A 3P8FA 1V2VT 3UTUH 1AU8A 3TU7H 1O3EA 3JZ2B 1D3QB 1LKAA 3TITA 3GCHB 3RXMA 2WPIS 5EQQA 1A46H 2OC1A 4KGAA 1K28D 1CBWC 2CXVA 2QF0A 3VPKA 5C67A 1YKTA 2J34A 3TGKE 5E2OA 1T7CA 5C5NA 3BG4B 4RKJB 1Z71A 4X1NU 2IN2A 2EI7A 3SGAE 3KL6A 1K2I1 3SNCA 1CU1A 5I25A 3MNBA 2C4FH 4D76A 1FY3A 3MMGA 4FUCA 2ZU3A 1V2OT 4FUDA 4Q7XA 1A61H 2BY5X 2CHAC 3RXLA 1F2SE 1O3PB 3GICB 3Q3XA 1O2MA 1TFXA 1QA0A 3UWIA 5EU8A 1SGRE 2FOMB 3S69A 1C1WH 2GP9B 4LZ1H 1O2XA 1TPOA 2FS9A 3EE0B 1YYY1 5HXFA 3ZZ6A 1NFXA 1TRYA 4NFFA 4MNXA 3P92A 3SV9A 3TVJB 1ZJKA 3P6ZB 1HFDA 3QLPH 2HRVA 1JOUB 4UDWH 1FPCH 5FPSA 1WTHD 3I78A 2GCHG 1OP8A 1O3AA 3B9FH 1YCPM 1YPJH 1ZPZA 3NCLA 1P03A 3P70B 4IW4E 1EP5A 3GOVB 4XBCA 3HATH 4K3JA 2W3KA 4GSOA 3M36A 3U9AH 2Q6GA 5BRRE 4H42U 3RXTA 2PFEA 3GDSA 1MCVA 1OWDA 4O97A 1SGNE 3ELAH 1DY9A 1SGYE 2KAIB 1WSSH 4WMDA 1INCA 1GBDA 1TBRH 3I29A 1O5BB 2ILNA 1A2CH 3TK6A 4ASHA 3ZZBA 2BY8X 1TNKA 1C2KA 1LHCH 3GDUA 2IJOB 4I31A 3BTTE 3RM0H 1HAOH 1GHVH 1KXDA 2H5CA 2QXGA 3L3TA 3VB4A 1YPGH 1W14U 1TGNA 2Z3EA 1J8AA 3RMNH 5A0AE 1C1SA 3RXHA 3U98H 3M7UA 5JPMH 5DJ7A 4CBNA 1CA0B 3TJVA 2R9PA 3A8AA 1YLDA 2ZHFH 5L2ZH 1V2TT 1GI8B 1P2JA 6GCHF 1MD8A 1GI5A 1F0SA 1F7ZA 3SJOA 1GJ7B 1P2NA 2G8TA 2ZFTA 3MNSA 4NA8A 1HAYB 1ZSJA 2QYIA 3CS7A 1GJ4H 1MH0A 1DITH 1GCTB 5F8TA 3SU1A 1VGCC 1FY8E 2QCYA 2NU1E 1O3HA 1SHHB 1ZTKA 3VGCB 4A1XA 3FZZA 3RXCA 4NIYA 1AB9B 3VXEH 1GHXH 1O2PA 3LH3A 2OBOA 4F49A 5CMXH 2PKSC 4DURA 1KY9A 1PYTD 1K1NA 3RXIA 3UY9A 3ZV9A 1G9IE 1CQQA 1ESTA 1ABIH 1GHBG 5JB9S 2ANYA 3PLBA 1GMDG 1UTOA 1HAXB 1LPKB 1OWHA 1E37B 2FP7B 2PHBA 3RC5A 1EAWA 1W3CA 3LPRA 2SGDE 4XFQA 2A5AA 2QXIA 2Y7XA 4ZHMU 2A5IA 1GDQA 1P8VC 4JZDH 1VJAU 4NCYA 2XYAA 3UR9A 3E8LA 4NSYA 1ELVA 1GI3A 1KIGH 3RU4D 2Z9IA 5IDKA 4WH8A 1XM1A 1DPOA 3D23A 4Q7YA 3SUFA 1LHGH 2BD8A 3SQEE 1S0RA 1T31A 2VGCC 4RN6A 1BIOA 2ULLA 1TQ7B 1C2FA 2ZQ1A 1GVZA 2GCHF 4BAOB 1PPCE 1NTPA 2Y6TA 4Y8XA 1D3DB 4ZHLU 4ABDA 1C5TA 4E7RG 1N1LA 5F8ZA 1N8OB 2BTCE 1C5QA 1O31A 1O3DA 1FY1A 1QB1A 3ATIA 4CRDA 3PV4A 1EPTC 1GL1A 2FIRH 2VINA 5C5OA 3RXEA 1E0FD 4JYTA 2QF3A 1VITH 2FS8A 1EOLA 1HIAA 2C8WB 1V2NT 2FX4A 2ZQ2A 4E05H 2ZA5A 2VWNA 2OQ5A 3F6UH 3VXFH 2H9HA 4B76A 3UIRA 4FVDA 1MKWH 2ANKH 3GYMA 3RLWH 3U8OH 1LPGB 5E0HA 5DO4H 1GBBA 3GCHC 1AGJA 2AIQA 3VFEA 4CRFA 1KXFA 2O8LA 3PMJA 4B71A 3L6PA 1KLJH 1IAUA 4CR9A 1MTVA 3M5MA 2ZHEH 2VWLA 4WWYA 3LIWA 2XW9A 3BG4C 1D9IA 5EQRA 2ZI2H 3UWJH 3ZVFA 3H7TA 4CH2B 5GCHF 3QWCH 1V2UT 1GBIA 4Y0ZE 1W2KH 3V0XA 3A84A 2V3HH 1AZZA 4UFGH 1RIWB 1WQVH 1SGTA 3E1XB 3PO1B 2PR3A 1YPMH 2Z9LA 3M5OA 3VB7A 3U8TH 1B5GH 1MKWK 5GDSH 1ZJDA 5HMAA 1CT4E 2WV5A 4NWKA 4IS5A 1ZMLA 1WV7H 1G30B 3T29A 2Z7FE 4D9QA 1KXAA 1SL3A 3ZVEA 1D4PB 1JXPA 1ARCA 2XBVA 3ENSB 1UJ1A 4R8TB 1HGTH 1IQEA 1GI0A 4FU8A 1XMNB 1MQ5A 2BLWA 1E34B 4AYVB 1ZGVA 4X1PU 1UVTH 3U1IB 2BZ6H 1Y3XA 1UHBB 5T6DA 2TBSA 8GCHG 2B5TB 1QBOA 3MNCA 1G3EA 1P2QA 2FI4E 2ZP0H 2P95A 2NWNA 1O3MA 1CHGA 1MTWA 2LPRA 1K9OE 4JZIA 2XNIA 3PM3A 3UOPA 2ZPQA 1PQ8A 2WUCA 2ZFSA 4CH8B 2I6QA 4KTUA 1EZXC 5CE1A 4K1SA 3HKJB 1DXPA 1DANH 2QAAA 5GWZA 2M5TA 4GCHF 4FVBA 1AI8H 1SG8B 1BTUA 1C5SA 2FOEA 1CT2E 3MU5A 1C1OA 1RTFB 1OS8A 1Z8JB 2ZFRH 4R0IA 1BRAA 2OCVB 1HLTH 4AFSA 2SGEE 1NM6A 1GJBB 4U01A 4ISNA 5AFZH 2HPQH 2WPMS 1UTPA 3UQOA 4XE4A 1FAXA 2ODQA 2UUJB 2ZTYA 3BG8A 1AFEH 2A7JA 1LPZB 1T8MA 3SNDA 4DIIH 2AH4X 3ZZ4A 1YCPH 3RC6A 3TJNA 4I7YH 2O8MA 2HVXA 2TGPZ 1CA0C 1E35B 2HNTE 3A81A 3T27A 1DDJA 3BEUA 3KIDU 1XX9A 2BDHA 2ZHQH 2YNAA 1XUIA 1PQ7A 4ISIH 3QX5H 2FI3E 4OS5A 2ODYB 1OYTH 1A4WH 2C90B 4I8JA 4Q80A 2Y5FA 2XCFA 5ESBA 2UUKB 3ZYDA 1A5HA 1KDQB 4WVPE 3FZDA 5EXMA 5LGOA 1BTPA 1GCTC 1TOMH 2WUBA 1O30A 3MOCA 3SJKA 2ZHWH 1OKXA 1EP6A 1Z8GA 3RMLH 3VGCC 3M5LA 5GJ4B 5DP9A 2BDAA 1AB9C 5ABWA 2HPPH 1G32B 4AG1A 7ESTE 1YCPK 1FI8A 3K65B 1PPBH 1PJPA 1Y3UA 5FX5A 4ZH8A 2FYRA 2Q6DA 1O2NA 1AUJA 3KQDA 1FQ3A 5A8YA 3E16B 1HPGA 1BMNH 1UMAH 1C2HA 3P8NA 1DWEH 1P01A 3MI4A 1HRTH 1MBQA 1CE5A 4XBDA 4HI3A 1P11E 2STBE 4YM9A 3E0PB 1FY4A 1JRSA 1QQ4A 3SU3A 3BSQA 3SW2B 1TIOA 4GLYA 1ZR0A 1SFIA 3UREA 2ZDNA 2PGQB 7GCHG 4HGCA 4UD9H 3FANA 4GVUA 1C1UH 3MO9A 3UR6A 1ZYOA 4ABGA 1C2LA 8LPRA 1PQAA 1WCZA 1N6YA 5F03A 1SLXB 1OXGA 2BDCA 1F5KU 1J9CH 2Q1JA 3RXKA 1S84A 3L33A 1NU7B 1VR1H 1O2SA 3F9HA 1QB9A 1TA6A 2YOLA 1Y3WA 1HXFH 4ZMAH 3MU8A 1LHFH 4BTUB 1W0ZU 1MTSA 1HAPH 3QO6A 5DP8A 3P17H 1KSNA 3UPEA 1ETSH 1AMHA 1N8OC 3A89A 1K1IA 4IGDA 1TGTA 1XKAC 4ABHA 5A2MH 3PMBB 2D8WA 4AGKA 4Y8ZA 3JZ1B 4PROA 1WU1A 1SGIB 1TWXB 1NFYA 1DX5M 2OQUA 4UE7H 1QJ6B 2C93B 3M7TA 1EATA 1THSH 1JBUH 4ZAEA 1TMBH 1L4ZA 5JYIA 1O37A 3GY4A 2ZG0H 1GI6A 1Y5UT 2JH6D 1P3CA 3TNTA 2BOHB 2J95A 4Q7ZA 1BMMH 3NXPA 1SOTA 1C5MD 1O3JA 1AHTH 2C8ZB 2OTVA 3D65E 3P8GA 4BTIB 3E3TA 1AO5A 2V0BA 1NC6A 2HNTC 1LVMA 1NU9A 2GV6A 2ZTZA 4SGBE 4JZEH 1Q3XA 3EQ0H 4A6LA 1ZZZA 1ELDE 5FXLA 3S9BA 2XTTB 1OYQA 2FWWA 1ANBA 3AAUA 1RIWC 3KN2A 5DP4A 2OC0A 4FUIA 1GBLA 2SNVA 1ZRBA 1T8OA 3PO1C 2J2UA 4ABEA 2ZHDA 4AFUA 1DWDH 1BTHH 1H9LB 1T4UH 1XUGA 1EAXA 3M3SA 4O3TA 2C8XB 1Z7KA 2NU0E 1HV7A 5C1YA 1GJ5H 1BUIA 2TGDA 1L1JA 3CENA 3PWBA 4ABAA 1DXWA 1MTUA 1EXFA 2GGVB 1O2GH 3A82A 3O8CA 2CV3A 2CMYA 1K1PA 3UOUA 5SGAE 1QRZA 1KXEA 2G81E 3QTVH 1GBFA 4NIWA 1ZHRA 1LHEH 3BTKE 4X6MA 5HYOA 2ZF0H 1O2KA 1OWJA 3GY6A 1O2IA 2VU8E 2FODA 1SPJA 2HOBA 4ABIA 4ZHAA 1A7SA 4UEHH 2HNTF 4YESB 1BQYA 2KAIA 3BTFE 3A80A 3GY8A 4JK6A 2G52A 2Z94A 1GJAB 4E06H 2GZ8A 2BLQA 4OS1A 1O3GA 4J1YA 1FN6A 4YTAA 2ZWLH 3C1KA 2F83A 7GCHF 1GJ9B 4FUJA 3I77A 1H1BA 4UFFH 1C2EA 4K8BA 4B2CA 1O2LA 1KTTB 2ZU5A 2BVRH 2VWOA 3NUMA 1GBEA 2AGIX 4MTBA 3BTQE 1MTNB 2TGAA 1BTZA 4ZKNU 2ZCHP 3HK3B 1F5LA 3SJ9A 1BCUH 1FIWA 1GI2A 1TX8A 2VVCA 4ZKRU 1L1GA 3U8RH 2V3OH 3QZQA 1LQEA 2XBYA 2PSYA 3F9GA 1GHAF 1MKXH 2G51A 1O3KA 2TGTA 3MH6A 2AFQB 1K1MA 1K1LA 1KYNA 1DUAA 3GY5A 3RM2H 3Q77A 4ESTE 4X2YA 2ZU1A 1OPHB 2ZGJA 1FMGA 4LOYH 1EASA 1UO6A 1SVPA 3MTYA 1Z1JA 2R3YA 2B9LA 2GCTB 4LXBH 1ESBA 1FAKH 1O36A 1O2YA 1Z8RA 2EEKA 1Q31A 4YT7H 1T8NA 3A88A 1GJ6A 4NGAH 4Z0KA 2OBQA 3K2UA 1O2WA 2A7CA 1QRWA 4JYVH 2XBXA 2J4IA 5DGJA 3V3MA 3M3VA 4CRAA 2ZFQH 7KMEH 2FTLE 2BX3A 3LJOA 1O34A 4NZQA 4OS6A 1MUEB 2Z6BD 4X1QU 5EXLA 4FUGA 3U69H 4MPXA 2RA0A 1MKXK 2G4TA 6LPRA 1C5YB 5K0HA 2IPHA 5JBCS 3VB3A 4AG2A 1ZGIA 2ZGCA 4BTTB 8ESTE 3HK6B 4D9RA 4X1SU 1GBAA 3MU4A 4H6SB 1ACBE 4KELA 1ZPCA 1IQIA 4BAQB 2D1JA 2XC4A 2Z3CA 5JBBS 4D8NA 1C1QA 2DE9A 1L2EA 1MAXA 5F6MA 4FUFA 2BY7X 5AF9H 2ZDLA 5EXNA 1RTLA 3E90B 1UVUH 1OP0A 2FMJA 4INKA 4O03A 5A0BA 1KLTA 2ZECA 4CRBA 2ZNKH 4AX9H 1J14A 5JDUB 3EA7A 5DP6A 4CRCA 2ZIQH 3ESTA 2TPIZ 1FDPA 3U1JB 3VB5A 4OS2A 2BQ7B 1DWCH 2UWOA 3T28A 4I32A 3RXRA 3SUGA 3LU9B 3T25A 1P9UA 3SU4A 2ASUB 1EKBB 2O9QA 1XVMA 4H6TA 1C9PA 1SGCA 2VIVA 1BHXF 1C2JA 3O8RA 4A92A 1F0UA 2P94A 2W7UA 1GHYH 2PW8H 3EGKH 1O3LA 2BD4A 3PYHA 2FOGA 1GBCA 1AY6H 2BB4A 2STAE 4WMFA 1TE0A 1FPHH 2BOKA 1IOEA 3PTNA 1TPSA 1FJSA 1SOZA 3O8BA 1A3EH 5JB8S 1VJ9U 3MFJA 4FXGH 2H6MA 3GCTG 1Y3VA 1EB1H 2BLOA 3K9XB 2JETB 1BMLA 2F9UA 1ETTH 4THNH 5E0JA 2BD2A 3SN8A 1GMHG 3RXPA 3NWUA 1L0ZA 2JH5D 2O8UA 3UNSA 3RU4E 1DSUA 4Y79A 3N7OA 3RXVA 3LONA 1YPHE 4MPUA 2PV9B 1ELGA 1V2MT 1SMFE 1EUFA 1TPPA 3O8DA 3A8DA 1AN1E 2A4OA 1CA8B 5HM2A 3BTME 1GDUA 1ZSLA 3EA8A 1A0HB 5EPNA 1PPZA 1AQ7A 1SSXA 2QXJA 1EB2A 3LGWA 1P57B 3BTHE 4Y11E 1TQ0B 3SNBA 1DLKB 3KQEA 1TMUH 1THPB 1OOKB 5EQSA 8KME2 4Y8YA 2A5KA 2FO9A 3IWMA 1WTGH 3AASA 4FUEA 3LGTA 3SV7A 2HALA 5FCKA 1A0JA 1UVPA 2PUXB 2GMTB 3GCOA 4GHTA 4ZROA 3ZVCA 3V7TA 2W7SA 1RTKA 1VCQA 1BITA 4BAKB 3SI4H 1G36A 3AVZA 2UWPA 3SV2H 5IYTA 4DCDA 4JK5A 4XOJA 1GHWH 1UHBA 2VIWA 3RXGA 1NRSH 3TJUA 4BOHA 1TAWA 3WY8A 2F9PA 5DKMA 4X6NA 2VB0A 2H9TH 2QY0B 3A7WA 1NT1A 4K5ZA 1ANCA 1CHOG 1XUKA 4Y7BA 1DE7H 4Q2KA 2XCNA 1P9SA 5E2PA 2AERH 3MYWA 2FZZA 1JIMA 2C3SA 4IBLH 3BTEE 3UQVA 2NU3E 3SV6A 1UTQA 1UK3A 1VCWA 1O32A 2AIPA 1DWBH 2PGBB 1KLIH 2CF8H 2ZZUH 4OGYA 1V6DA 1ZLRA 5JBTA 1QNJA 3CP7A 2J94A 3SO3A 3T5FH 3ZZAA 3RMMH 4K1TA 1FIZA 1CGJE 1ARBA 3G01A 3Q3KA 1EZSC 2FOBA 1V2RT 1MTNC 5EODA 2ZKSA 1WOFA 3ZZCA 1QHRB 3GDVA 2AMPA 3NK8A 1CGHA 2G00A 1SLUB 2ANWA 4TY7A 1O3NA 3FP8E 2CGAA 4DGJA 2GDEH 2A4QA 3DA9B 3MWIU 1TRNA 1GHBF 1FXYA 3Q00A 1UVSH 3RXDA 1C5OH 1GMDF 1Z1IA 3HKIB 1SI5H 2OC7A 1Y8TA 2ZPSA 5FAHA 1MMJN 3MHWU 1U6QA 4A5TS 1YPKH 2BX4A 1RGQA 2O8WA 3RXQA 1EAUA 3A7VA 1KDQA 2PKAB 2GCTC 1C4V2 2GD4B 1ABJH 2PUQH 2FPZA 2FTMA 2OD3B 4YLUA 3TLOA 3ZZ7A 4GPGA 1UTKA 4Y71A 1FN8A 2SGPE 4NA9H 2EC9H 1HBTH 4BNRA 1FZZA 2J92A 1GMHF 2Y5HA 7LPRA 3S9CA 2P3FH 2ZEBA 1V3XA 1C1TA 4DW2U 3RXOA 2H5DA 3DHKH 5F8XA 4HFPB 4F4OC 1HJ8A 2AGGX 4MQAA 1BTYA 1IQFA 4OS4A 1P2IA 2Y7ZA 1MAYA 4MG3A 2LNCA 2P3UB 1HAGE 1N6XA 3A86A 2XC0A 1LDTT 1QCPA 4HZHA 1QL7A 3BEFB 3SUEA 1TOCB 1O38A 1SLVB 3LOXA 3RXFA 5A8ZA 2ODPA 1GVKB 1A1RA 3GY7A 1SLWB 5FX6A 1DUEA 2G5VA 2F9NA 2F3CE 3ATWA 1O0DH 3MH5A 3SI3H 4K8YA 4M7GA 3RC4A 3MNXA 3F68H 2VIOA 2JKHA 2XRCA 4NWLA 1SGDE 4X1RU 2GZ9A 1Q2WA 1WQSA 5EW1H 4ZKSU 1BHXB 5L2YH 1NS3A 1O2UA 1THRH 4X8SH 2B7DH 2ZGXH 1TX7A 1NRNH 1S83A 2BDGA 1TYNA 3SU5A 3A85A 1RRKA 2A0QB 4TWWA 1EZUC 1OWIA 1QBVH 3KHVA 1D6WA 1W13U 2JH0D 2FLRH 1K1OA 2BY6X 2F91A 1DS2E 1AFQB 1W7XH 2WYJA 4A1VA 2FX6A 1ZHPA 1PPFE 4CHAB 4WH6A 1ELEE 1SGQE 2FI5E 3B23B 5CHAB 4AORA 1P10A 3DUXH 4RKOB 1HJ9A 9ESTA 3TGIE 3OTJE 2GDDA 3DD2H 1YLCA 2TRMA 5H4IB 2AGEX 1RS0A 3M37A 4QT8C 1YPEH 2ZDKA 2VJ1A 1H4WA 1AKSA 2ZCLP 1FV9A 3SORA 1F5RA 2A4RA 2GT8A 3RUOA 1H8DH 1QL8A 1P0SH 1BBRE 1FLEE 2A2QH 2GT7A 5G4BA 2JETC 1C4Y2 1P3EA 2OLGA 1AIXH 1V2KT 4K2YA 3UFAA 3V12A 4X2XA 4O3UA 1YC0A 3QDZB 4DIHH 1PPEE 5LPFA 4I8HA 4AN7A 1HB0B 1JIRA 1C1RA 1TBQH 1BBRH 1MQ6A 3OSYA 3SV8A 2WV4A 2WPLS 5AVDA 1V2QT 1M9UA 1SQAA 2EI8A 4A1TA 8GCHF 1S5SA 3FP7E 2PTCE 1DM4B 2VIQA 3EDXB 1Z6JH 3TGJE 1EPTA 1GJDB 1O2OA 5L6NH 1ELFA 3W95A 4MNVA 5GPIB 1C9TA 3SHCH 3RXUA 3E0NB 4VGCB 1AVWA 1SGEE 1EJNA 1QL9A 2SGFE 4IMZA 1FUJA 1Z6EA 4ABJA 1TONA 4TWYA 1KTSB 2D26C 1GI9B 1MU6B 2R3UA 1GMCG 2BD9A 1O5EH 5AFYH 1XXFA 3T26A 2GMTC 3ZVGA 1O3IA 3A7TA 1PPGE 3PB1E 3ZZ8A 3AW0A 4B1TA 1IQHA 1SHYA 5T3HA 3D62A 2XWAA 1PQ5A 1BBRK 1TGBA 1TALA 1GVLA 4Y10E 2J38A 2QA9E 4K60A 5DPAA 2OINA 3KQBA 3KEEA 2CN0H 3GY2A 4MVNA 2DE8A 4TY6A 1YGCH 1AE8H 2A45B 5B6OA 2THFB 4DOQA 2ZFPH 1OWKA 5EGMA 2ALVA 1TX6A 3A7XA 2FOCA 4RSPA 4B74A 1P06A 3SJIA 3SNEA 3P95A 4NG9H 3P8OA 3E6PH 4X8UH 1AE5A 3UNQA
chains in the Genus database with same CATH superfamily
3HGNA 4DJZB 1QIXB 4CRGA 1QR3E 3NKKA 1C5XB 3VEQB 1LVYA 1V2LT 1Y59T 3EA9A 1S85A 1C1VH 1GBTA 1H9IE 3Q3YA 1LVBA 5TCAA 2KR7A 4BXWA 1S81A 6GCHG 5FBIA 1BRCE 1O3FA 2AYWA 4O9VA 5A8XA 1HAVB 2Z9KA 1TLDA 5C1XA 2KM0A 1BB0B 1LCYA 3KCGH 1EQ9A 3H09A 1GCDA 5ESTE 1SC8U 4AYYB 1ZMNA 2BXUH 2BLVA 5EJ1A 2BXTH 4H4FA 2G5NA 3M7QA 4AFQA 3AAVA 1ZRKA 1T4VH 1EOJA 1XKBC 2P8OB 3Q76A 1XUJA 2TIOA 2I6SA 1RXPA 2ZTXA 2BQ6B 3OY6U 5C3NA 2VIPA 3H7OA 1LHDH 1W10U 2FDAA 2V6NA 5FPTA 4KTSA 1XXDA 1UTLM 1ORFA 1WUNH 2F9OA 1B0FA 2R0KA 2OC8A 2HLCA 1RFNA 3K6YA 5J4QA 4B2AA 2D2DA 3A8CA 2VH0A 3F9EA 1DVAH 4OS7A 4INLA 1TMTH 1QGFA 1CSOE 3SZEA 1NZQH 1UCYE 4GAWA 1MCTA 1C5ZB 2NU4E 1C5PA 4AZ2B 2ZGBH 5KGOA 1O39A 5CHBA 2BDYA 2ZU2A 3SBKA 1BMAA 2BD5A 3BEIB 1JMOH 1SQTA 1XUHA 2OXSA 1S82A 5T6GA 1V2JT 3A7ZA 1NO9H 3M3TA 1HAZB 1UCYH 2CF9H 1YPLH 2H2ZA 1DOJA 3LGYA 1O35A 2B8OH 5FPYA 1ZTLA 5FHTA 2HVYB 2WSSD 5LH8A 2Q6FA 3S7HB 2A2XH 2FOAA 2XXLA 2WYGA 3FKSD 3PWCA 2BVXH 1TNIA 2W3IA 3BN9A 1QY6A 2A7HA 4JZFH 1W8BH 1ELBA 1QBNA 2AS9A 4XDEA 3QUMP 1O3OA 4Z6AH 1DFPA 1UK4A 3S7KB 4FU9A 4ISOA 3C27B 1T32A 1P2OA 2XWBI 1QFKH 1GMCF 4WY3A 2GX4A 2Z9JA 3A8BA 1F92A 5B6LA 1EJMA 1S0QA 4KKDA 3SU2A 4JMYA 2WHXA 1LO6A 1BTWA 1UVOA 4GHQA 1QB6A 1W7GH 1BJUA 2Y5GA 3FFGA 3SZNA 2A31A 1ELAA 2W26A 2ZU4A 2QGRA 1O2RA 3KNXA 1UCYK 1ZTJA 1P09A 3FO8D 3KQCA 1AZ8A 3RXJA 1C5NH 1IQJA 4MNWA 4IN2A 2UUYA 4Z1MD 1W0YH 1O5GH 1SB1H 3QN7A 1MU8B 4A7IB 2M2AA 5EPYA 1AFQC 2W5EA 3NPSA 4X0WU 1ZMJA 4INHA 1ELTA 1CT0E 1MBMA 4CHAC 4NFEA 3RXBA 3OX7U 2FYQA 1F0RA 1MZAA 5CHAC 3SNAA 3N7EA 2FM2A 1P2MA 1GGDB 2Y80A 1E38B 1ZOMA 2FEQH 3A83A 5E8EH 2QV1A 5GCHG 4UONA 3KQ5A 1FX0B 1G3BA 3IG6B 3QGJA 1IQLA 3LC3A 3TK5A 1J15A 1K1JA 3TNSA 2G55A 2AEIH 3LDXH 2PP6A 4JZ1A 3TIUA 5C1UA 4X8VH 1EX3A 2LP6A 1O2QA 3DFJA 1C2IA 4AB8A 1VCPA 2DUCA 4U32A 1H8IH 1BJVA 1GI4A 2F9BH 2B0FA 4WF8A 3SUDA 2GZ7A 2FLBH 1NFUA 2GKVE 4UFDH 4WMEA 5HIYA 4IC6A 1O5AB 1Y5BT 3EYDA 2WPHS 3BIUH 1SQOA 1NESE 1DLEA 5C94A 5BPEA 1C2DA 4ACBA 1HCGA 2F9VA 4VGCC 1IQKA 4WJG2 2OUAA 1ETRH 5K7RA 1TGCA 2A1DB 3ZVBA 2VIDA 1TABE 3DSGA 1IHTH 3F2FA 1G3DA 4YZUA 1H9HE 1LMWB 3NRLA 4B75A 5FCRA 5L30H 4MDSA 1H8ED 2FXRA 2YMSB 3MH7A 5DP3A 1ANDA 2J97A 1NROH 1NRRH 2ZDMA 1GL0E 6CHAB 1G2MA 1NBMD 1QJ1B 2ZFFH 4NIVA 3TJOA 2ANMH 1GJ8B 4GCHG 1GJCB 2BM2A 1CO7E 2J9NA 5I46H 1CGIE 2UUFB 1EFRD 1K22H 2BHGA 2ZGHA 2ZDAH 3A87A 1C5WB 5GIBA 3RXAA 3TPIZ 4ZCNA 4NSVA 3AW1A 3W94A 3IITA 1T8LA 1C2GA 2C8YB 2BYAX 4CBOA 2FOHA 1O33A 1ZPBA 1NRQH 2PTNA 3UUZA 1B7XB 1G3CA 1HAHH 5DG6A 1BOQA 5DK1A 3LH1A 3LT3A 1SGFA 1A5GH 3LGVA 3SGQE 4Q4LA 1DT2A 1SBWA 2Z9GA 3M61U 1E1RD 5F53A 3SU0A 1O2JA 3LKWA 1RD3B 1TNJA 3T62A 1GI1A 1HAIH 1C4U2 1P2KA 5ETXA 1PFXC 2VH6A 3ZVDA 2BQWB 2BDIA 4GUXA 4YOGA 3LC5A 3SU6A 1O2HA 1W11U 1Y3YA 4YO9A 1TRMA 3SGBE 1C5RA 2AMDA 3FVFB 3ZIAD 2HWLB 2PLXA 4ASUD 1O3CA 1QURH 3MU0A 4MPWA 2QF5A 1C5VA 3SHAH 3ZYEA 2RG3A 4ZKOU 2K1QA 4MNYA 1HNEE 1WBGB 4I33A 1HJAB 3PMAB 2XBWA 4ISHH 4B6EA 1BT7A 6ESTA 2P8OC 3OFND 2SFAA 5FBEA 2UWLA 3PLPA 1TNGA 3ZZ5A 1V2PT 3M5NA 1TNHA 3ZZ3A 1GG6B 2PKAA 1XUFA 1TB6H 4ABBA 2HGTH 1UTJA 4JYUH 3RLYH 1IQGA 4B2BA 1VITG 4B73A 3RP2A 2IOTA 2YNBA 2VVVA 1YBWA 1ZHMA 4I8GA 3HGPA 2ZPRA 5DSFA 4YOJA 4ZUHA 1DY8A 1GBMA 1D6RA 2KCOA 3STJA 4BAHB 1X7AC 1HIAB 4FOUC 3BTDE 1C5UA 5A0CA 1PYTC 2BZAA 4Y7AA 2CJIA 3ODDA 3SQHE 2WPKS 2QN5T 1AWHB 1YY3A 4YT6H 4DT7B 3MO3A 4TYDA 1CBWB 3ODFA 3QK1A 4ISLA 2ZO3H 4XSKU 1OSSA 4AFZA 3QGNB 5EOKA 5JBAS 2P93A 3ZZ9A 3ZZDA 1ELCA 3GISB 2FOFA 3ATMA 2A4GA 1BRUP 4FUHA 1NN6A 1IQNA 3ITIA 1K21H 1BA8B 2NU2E 1W0KD 4E7NA 2R2WU 5A09A 3R3GB 2GV7A 1OX1A 2RCEA 3LGUA 4BANB 4D7GA 3GY3A 2QIQA 2BVSH 4NA7A 1V2ST 4LZ4B 1EJAA 3GCTF 4YXWD 5PTPA 4Y76A 1C1PA 1C1MA 1BRBE 4AGJA 3URDA 2XC5A 2SGQE 2CHAB 3PLKA 3BIVH 3GCNA 3OEED 1QQUA 1YPHC 3PROA 4J2YB 1LQDB 1O5CB 2Z3DA 3QZRA 3SOSA 1BZXE 4OGXA 2BD7A 3OU0A 5C20A 5T1VA 5EW2H 5CDFE 1EZQA 1O5DH 1GI7B 2V35A 1TGSZ 4D7FA 1EAIA 1NY22 1TBZH 5DP7A 1HUTH 3B8JA 3D49H 2FESH 5DP5A 4ZXXH 3T2NA 4AC9A 2QC2A 1TNLA 2F4LA 3BV9B 1YWUA 1P04A 2JJ1D 1GGDC 1Y5AT 2VNTA 4I8KA 1O2TA 4FU7A 4DG4A 2BY9X 3E91A 4I8LA 1GDNA 2PWXA 3FAOA 1B0EA 2SGAA 2A32A 1ZSKA 1XVOA 1CVWH 4Y0YE 3OYPA 1P05A 2ALPA 2Y81A 3MO6A 1L1NA 1BTXA 3RDZA 1O3BA 3F2GA 1PPHE 1E36B 4LK4A 1S6HA 1O5FH 3F2HA 3KF2A 4AB9A 3OTPA 4YLQH 3S0NA 4P00A 1GBJA 1L4DA 2RDLA 1GWAA 3ZV8A 3VB6A 4BAMB 1AVGH 2QXHA 1HYLA 2RA3A 3BTWE 1FY5A 1NFWA 4CREA 1C5LH 1J17T 3BTGE 5TJXA 1CHOF 1FONA 4FUBA 2H9EH 4X8TH 2J98A 1AUTC 3BF6H 2AMQA 3RMOH 3V13A 4AOQA 2R0LA 1D3PB 1YF4A 1NPMA 2BDBA 2BMGB 4KP0A 1SR5C 1DSTA 4SGAE 2RFKC 3TH3H 9LPRA 3QTOH 4X2WA 3STIA 2KCAA 3S9AA 2ZCKP 4MPVA 4IC5A 3F9FA 3LJJA 1P12E 1VITF 2VVUA 2YMSC 1IQMA 2ZC9H 4X6PA 2WINI 4HG6A 5E0GA 3RU4T 1GPZA 1A5IA 1LTOA 3OY5U 3NZIA 5AHGH 4NIXA 2Y82A 1O2VA 3KGPA 1QA7A 2EA3A 3GYLB 3FOAA 3ZVAA 4M9FA 4RT0A 6CHAC 1GBHA 4Y6DA 3WWFA 3PTBA 5HIZA 2R2MB 3PMHB 1TA2A 4X6OA 4ZXYH 5C2ZA 3K6ZA 5T6FA 1UK2A 1KXCA 2ZDVH 1LVOA 1C1NA 1QTFA 1RJXB 1S6FA 4K1EA 4DVAU 4DY7B 2VWMA 1WYKA 1SGFG 1VGCB 5GXPA 2EI6A 1KXBA 1GBKA 1AWFH 5LPEA 4CR5A 1ID5H 4U2WA 2ESTE 2P3TB 3ATLA 1QRXA 4TPYA 2PKSB 4ABFA 3RXSA 1QJ7B 3DT0H 3URCA 3DFLA 4BXSA 1GHAG 1SFQB 2KCYA 1WAYB 2WPJS 1AVXA 1V2WT 1TPAE 1G37A 1YM0A 1Z8IB 2GTBA 1W12U 3MU1A 4RI0A 5J4SA 1MZDA 1OP2A 1HAVA 5LPRA 1J16A 3CS0A 3LGIA 4MLFB 1O2ZA 5TCCA 1OWEA 3R0FA 4X2VA 4YOIA 5HGGA 2P59A 1ANEA 1KMHB 1WDIA 4U30A 1SGPE 1HDTH 1P02A 5HM9A 4IMQA 1JRTA 3TH2H 3TK9A 2P16A 1VZQH 1AKSB 1G2LA 2XNDD 1GHZA 4IN1A 1HJAC 2H1UA 2G4UA 2PSXA 4TPIZ 1IHSH 2GVFA 3KYGA 2BD3A 3MH4A 4UFEH 2SNWA 2VGCB 1GG6C 1UTMA 3M35A 3ATKA 3EAJA 3FP6E 1C2MA 2OP9A 1DICA 3H5CB 4XBBA 4HTCH 1A0LA 1FNIA 1F0TA 1UTNA 3VG8A 2O8TA 1JWTA 1YP9A 1NRPH 1EPTB 3A7YA 3DSOA 1HXEH 1A3BH 3HPTB 1AD8H 1ESAA 4KTCA 4JCNA 4WXVA 3F1SB 1D3TB 3TH4H 1MD7A 3UNRA 4NZLA 1BDAA 5EG4A 4K69A 1LKBA 4WXIA 3SJ8A 3P8FA 1V2VT 3UTUH 1AU8A 3TU7H 1O3EA 3JZ2B 1D3QB 1LKAA 3TITA 3GCHB 3RXMA 2WPIS 5EQQA 5EIYA 1A46H 1H8HD 2OC1A 4KGAA 1K28D 1CBWC 2CXVA 2QF0A 3VPKA 5C67A 1YKTA 2J34A 3TGKE 5E2OA 3CNRA 1T7CA 5C5NA 3BG4B 4RKJB 1Z71A 4X1NU 2IN2A 2EI7A 3SGAE 4DT4A 3KL6A 1K2I1 3SNCA 1CU1A 2JIZD 5I25A 3MNBA 2C4FH 4D76A 1FY3A 3MMGA 3N99A 4FUCA 2ZU3A 1V2OT 4FUDA 4Q7XA 1A61H 2BY5X 2CHAC 3RXLA 1F2SE 1O3PB 3GICB 2OK5A 3U28C 3Q3XA 1O2MA 1TFXA 1QA0A 3UWIA 5EU8A 1SGRE 2FOMB 3S69A 1C1WH 2GP9B 4LZ1H 1O2XA 1TPOA 2FS9A 3EE0B 1YYY1 5HXFA 3ZZ6A 1NFXA 1TRYA 4NFFA 4MNXA 3P92A 3SV9A 3TVJB 1ZJKA 3P6ZB 1HFDA 3QLPH 2HRVA 1JOUB 4UDWH 1FPCH 5FPSA 1WTHD 3I78A 2GCHG 1OP8A 1O3AA 3B9FH 1YCPM 1YPJH 1ZPZA 3NCLA 1P03A 3P70B 4IW4E 1EP5A 3GOVB 4XBCA 3F0PA 3HATH 4K3JA 2W3KA 4GSOA 3M36A 3U9AH 2Q6GA 5BRRE 4H42U 3RXTA 2PFEA 3GDSA 1MCVA 1OWDA 4O97A 2K8IA 1SGNE 3ELAH 2JDID 1DY9A 1SGYE 2KAIB 1WSSH 4WMDA 1INCA 1GBDA 1TBRH 3I29A 1O5BB 2ILNA 1A2CH 3TK6A 4ASHA 3ZZBA 2BY8X 1TNKA 2JJ2D 1C2KA 1LHCH 3GDUA 2IJOB 4I31A 3BTTE 3RM0H 1HAOH 1GHVH 1KXDA 2H5CA 2QXGA 3L3TA 3VB4A 1YPGH 1W14U 1TGNA 2Z3EA 1J8AA 3RMNH 5A0AE 1C1SA 3RXHA 3U98H 3M7UA 5JPMH 5DJ7A 1QZ8A 4CBNA 3KYFA 1CA0B 3TJVA 2R9PA 3A8AA 1YLDA 2ZHFH 5L2ZH 2KFWA 1V2TT 3OEHD 1GI8B 1P2JA 6GCHF 1MD8A 1GI5A 4P02A 1F0SA 1F7ZA 3SJOA 1GJ7B 1P2NA 2G8TA 2ZFTA 3MNSA 4NA8A 1HAYB 1ZSJA 2QYIA 3CS7A 1GJ4H 1MH0A 1SKYE 1DITH 1GCTB 5F8TA 3SU1A 1COWD 1VGCC 1FY8E 2QCYA 2NU1E 1O3HA 1SHHB 1ZTKA 3VGCB 4A1XA 3FZZA 3RXCA 4NIYA 1AB9B 3VXEH 1GHXH 1O2PA 3LH3A 2OBOA 4F49A 5CMXH 2PKSC 4DURA 1KY9A 1PYTD 1K1NA 3RXIA 3UY9A 3ZV9A 1G9IE 1CQQA 1ESTA 1ABIH 1GHBG 5JB9S 2ANYA 3PLBA 2KZ4A 1GMDG 1UTOA 5EJZA 1HAXB 1LPKB 1OWHA 1E37B 2FP7B 2PHBA 3RC5A 1EAWA 1W3CA 3LPRA 3UB0A 2SGDE 4XFQA 2A5AA 2QXIA 2Y7XA 4ZHMU 2A5IA 1GDQA 1P8VC 4JZDH 1VJAU 4NCYA 2XYAA 3UR9A 3E8LA 4NSYA 1ELVA 1GI3A 1KIGH 3RU4D 2Z9IA 5IDKA 4WH8A 1XM1A 1DPOA 3D23A 4Q7YA 3SUFA 1LHGH 2BD8A 3SQEE 1S0RA 1T31A 2VGCC 4RN6A 1BIOA 2ULLA 1TQ7B 1C2FA 2ZQ1A 1GVZA 2GCHF 4BAOB 1PPCE 1NTPA 2Y6TA 4Y8XA 1D3DB 4ZHLU 4ABDA 1C5TA 4E7RG 5EJLA 1N1LA 5F8ZA 1N8OB 2BTCE 1C5QA 1O31A 1O3DA 1FY1A 1QB1A 3ATIA 4CRDA 3PV4A 1EPTC 1GL1A 2FIRH 2VINA 5C5OA 3RXEA 1E0FD 4JYTA 2QF3A 1VITH 2FS8A 1EOLA 1HIAA 2C8WB 1V2NT 2FX4A 2ZQ2A 4E05H 2ZA5A 2VWNA 2OQ5A 3F6UH 3VXFH 2H9HA 4B76A 3UIRA 4FVDA 1MKWH 2ANKH 3GYMA 3RLWH 3U8OH 1LPGB 1S6LA 5E0HA 5DO4H 1GBBA 3GCHC 1AGJA 2AIQA 3VFEA 4CRFA 1KXFA 2O8LA 3PMJA 4B71A 3L6PA 1KLJH 1IAUA 4CR9A 1MTVA 3M5MA 2ZHEH 2VWLA 4WWYA 3PRBA 3LIWA 2XW9A 3BG4C 1D9IA 5EQRA 2ZI2H 3UWJH 3ZVFA 3H7TA 4CH2B 1K0HA 5GCHF 3QWCH 4TT3D 1V2UT 1GBIA 4Y0ZE 1W2KH 3V0XA 3A84A 2V3HH 1AZZA 4UFGH 1RIWB 1E79D 3GS9A 1WQVH 1SGTA 3E1XB 3PO1B 2PR3A 1YPMH 2Z9LA 3M5OA 3VB7A 3U8TH 1B5GH 1MKWK 5GDSH 1ZJDA 5HMAA 1CT4E 2WV5A 4NWKA 4IS5A 1ZMLA 5KEDA 1WV7H 1G30B 3T29A 2Z7FE 5FL7D 4D9QA 1KXAA 1SL3A 3ZVEA 1D4PB 1JXPA 1ARCA 2XBVA 2YMSD 3ENSB 1UJ1A 4R8TB 1HGTH 1IQEA 1GI0A 4FU8A 1XMNB 1MQ5A 2BLWA 1E34B 4AYVB 1ZGVA 4X1PU 1UVTH 3U1IB 2BZ6H 1Y3XA 4Q63A 1UHBB 5T6DA 2TBSA 8GCHG 2B5TB 1QBOA 3MNCA 1G3EA 1P2QA 1OHHD 2FI4E 2ZP0H 2P95A 2NWNA 1O3MA 1CHGA 1MTWA 2LPRA 1K9OE 4JZIA 2XNIA 3PM3A 3UOPA 2ZPQA 1PQ8A 2WUCA 2ZFSA 4CH8B 2I6QA 4KTUA 1EZXC 5CE1A 4K1SA 3HKJB 1DXPA 1DANH 2QAAA 5GWZA 2M5TA 4GCHF 4FVBA 1AI8H 1SG8B 1BTUA 1C5SA 2FOEA 1CT2E 3MU5A 1C1OA 1RTFB 1OS8A 1Z8JB 2ZFRH 4R0IA 1BRAA 2OCVB 1HLTH 3DSPA 4AFSA 2SGEE 1NM6A 1GJBB 4U01A 4ISNA 5AFZH 2HPQH 2WPMS 1UTPA 3UQOA 4XE4A 1FAXA 2ODQA 2UUJB 2ZTYA 3BG8A 5DN6D 1AFEH 2A7JA 1LPZB 1T8MA 3SNDA 4DIIH 2AH4X 3ZZ4A 1YCPH 3RC6A 3TJNA 4I7YH 2O8MA 2HVXA 2QF4A 2TGPZ 1CA0C 1E35B 2HNTE 3A81A 3DCLA 3T27A 1DDJA 3BEUA 3KIDU 1XX9A 2BDHA 2ZHQH 2YNAA 1XUIA 1PQ7A 4ISIH 3QX5H 2FI3E 4OS5A 2ODYB 1OYTH 1A4WH 2C90B 4I8JA 4Q80A 2Y5FA 2XCFA 5ESBA 2UUKB 3ZYDA 1A5HA 1KDQB 4WVPE 3FZDA 5EXMA 5LGOA 1BTPA 1GCTC 1TOMH 2W6ID 1O30A 2WUBA 3MOCA 3SJKA 2WV9A 2ZHWH 1OKXA 1EP6A 1Z8GA 4ACAA 3RMLH 3VGCC 3M5LA 5GJ4B 3WWBA 5DP9A 2BDAA 1AB9C 5ABWA 2HPPH 1G32B 4AG1A 7ESTE 1YCPK 1FI8A 3K65B 1PPBH 1PJPA 1Y3UA 5FX5A 4ZH8A 3PV2A 2FYRA 2Q6DA 1O2NA 1AUJA 3KQDA 1FQ3A 5A8YA 3E16B 1HPGA 1BMNH 1UMAH 1C2HA 3P8NA 1DWEH 1P01A 3MI4A 1HRTH 1MBQA 2EQNA 1CE5A 4XBDA 4HI3A 1P11E 2STBE 4YM9A 3E0PB 1FY4A 2EY4C 1JRSA 1QQ4A 3SU3A 3BSQA 3SW2B 1TIOA 4GLYA 1ZR0A 1SFIA 3UREA 2ZDNA 2PGQB 7GCHG 4HGCA 4UD9H 4FETA 3FANA 4GVUA 1C1UH 3MO9A 5C0TA 3UR6A 1ZYOA 4ABGA 1C2LA 8LPRA 1PQAA 1WCZA 1N6YA 5F03A 2RDEA 1SLXB 1OXGA 2BDCA 1F5KU 1J9CH 2Q1JA 3RXKA 1S84A 3L33A 1NU7B 1VR1H 1O2SA 3F9HA 1QB9A 3SYJA 1TA6A 2YOLA 1Y3WA 1HXFH 4ZMAH 3MU8A 1LHFH 4BTUB 1W0ZU 1MTSA 5HKKD 1HAPH 3QO6A 5DP8A 3P17H 1KSNA 3UPEA 1ETSH 1AMHA 1N8OC 3A89A 1K1IA 4IGDA 1TGTA 1XKAC 4ABHA 2XOKD 5A2MH 3PMBB 2D8WA 4AGKA 4Y8ZA 3JZ1B 4PROA 1WU1A 1SGIB 1TWXB 1NFYA 1DX5M 2OQUA 3EE7A 4UE7H 1QJ6B 2C93B 3M7TA 1EATA 1THSH 1VKYA 1JBUH 4ZAEA 2W6JD 1YLNA 1TMBH 1L4ZA 5JYIA 5KECA 1O37A 3GY4A 2ZG0H 1GI6A 1Y5UT 2JH6D 1P3CA 3TNTA 2BOHB 2J95A 4Q7ZA 3AK5A 1BMMH 3NXPA 1SOTA 1C5MD 1O3JA 1AHTH 2C8ZB 2OTVA 3D65E 3P8GA 4BTIB 3E3TA 5C17A 1AO5A 2V0BA 1NC6A 2HNTC 1LVMA 1NU9A 2GV6A 2ZTZA 4SGBE 4JZEH 1Q3XA 3EQ0H 4A6LA 1ZZZA 1ELDE 5FXLA 3S9BA 2XTTB 1OYQA 2FWWA 1ANBA 3AAUA 1RIWC 3KN2A 5DP4A 2OC0A 4FUIA 1GBLA 2SNVA 1ZRBA 1T8OA 3PO1C 2J2UA 4ABEA 2ZHDA 4AFUA 3WW7A 1DWDH 1BTHH 1H9LB 1T4UH 1XUGA 3F0OA 1EAXA 3M3SA 4O3TA 2IPQX 2C8XB 1Z7KA 2NU0E 1HV7A 5C1YA 1GJ5H 4XD7D 1BUIA 2TGDA 1L1JA 3CENA 3PWBA 4ABAA 1DXWA 1MTUA 1EXFA 2GGVB 1O2GH 3A82A 4B6FA 3O8CA 2QE7D 2CV3A 2CMYA 1K1PA 3UOUA 5SGAE 1QRZA 1KXEA 4XRNA 2G81E 3QTVH 1GBFA 5IK2D 4NIWA 1ZHRA 1LHEH 3BTKE 4X6MA 5HYOA 2ZF0H 1O2KA 1OWJA 3GY6A 1O2IA 2VU8E 2FODA 1SPJA 2HOBA 4ABIA 4ZHAA 1A7SA 4UEHH 2HNTF 4YESB 1BQYA 2KAIA 3BTFE 3A80A 3GY8A 4JK6A 2GJGA 2G52A 2Z94A 1GJAB 4E06H 2GZ8A 2BLQA 4OS1A 1O3GA 4J1YA 1FN6A 2KCPA 4YTAA 2ZWLH 3C1KA 2F83A 4OM9A 7GCHF 1GJ9B 4FUJA 3I77A 1H1BA 4UFFH 1C2EA 4K8BA 4B2CA 1O2LA 1KTTB 2ZU5A 2BVRH 2VWOA 3N7DA 3NUMA 1GBEA 2AGIX 4MTBA 3BTQE 1MTNB 2TGAA 1BTZA 4ZKNU 2ZCHP 3HK3B 1F5LA 3SJ9A 1BCUH 1FIWA 1GI2A 1TX8A 2VVCA 4ZKRU 1L1GA 3U8RH 2V3OH 3QZQA 1LQEA 2XBYA 2PSYA 3F9GA 1GHAF 1MKXH 2G51A 1O3KA 2TGTA 3MH6A 2AFQB 1K1MA 1K1LA 1KYNA 1DUAA 3GY5A 3RM2H 3Q77A 4ESTE 4X2YA 2ZU1A 1OPHB 2ZGJA 1FMGA 4LOYH 1EASA 1UO6A 1SVPA 3MTYA 1Z1JA 2R3YA 2B9LA 2GCTB 4LXBH 1ESBA 1FAKH 1O36A 1O2YA 1Z8RA 2EEKA 1Q31A 4YT7H 1T8NA 3A88A 1GJ6A 4NGAH 4Z0KA 2OBQA 3K2UA 1O2WA 2A7CA 1QRWA 4JYVH 2XBXA 2J4IA 5DGJA 3V3MA 3M3VA 4CRAA 2ZFQH 7KMEH 2FTLE 2BX3A 3LJOA 1O34A 4RT1A 4NZQA 4OS6A 1MUEB 2Z6BD 4X1QU 5EXLA 4FUGA 3U69H 4MPXA 2RA0A 1MKXK 2G4TA 6LPRA 1C5YB 5K0HA 2IPHA 5JBCS 3VB3A 4AG2A 1ZGIA 2ZGCA 4BTTB 8ESTE 1UW7A 3HK6B 4D9RA 4X1SU 1GBAA 3MU4A 4H6SB 1ACBE 4KELA 1ZPCA 1IQIA 4BAQB 2D1JA 2XC4A 2Z3CA 5JBBS 4D8NA 1C1QA 2DE9A 1L2EA 1MAXA 5F6MA 4FUFA 2BY7X 5AF9H 2ZDLA 5EXNA 1RTLA 3E90B 1UVUH 1OP0A 2FMJA 4INKA 4O03A 5A0BA 1KLTA 2ZECA 4CRBA 2ZNKH 4AX9H 1J14A 2L6OA 5JDUB 3EA7A 3FN8A 5DP6A 4CRCA 2ZIQH 3ESTA 2TPIZ 1FDPA 3U1JB 3VB5A 4OS2A 2BQ7B 1DWCH 2UWOA 3T28A 4I32A 3RXRA 3SUGA 3LU9B 3T25A 1P9UA 3SU4A 2ASUB 2F43B 1EKBB 2O9QA 1XVMA 4H6TA 1C9PA 1SGCA 3OE7D 2VIVA 1BHXF 1C2JA 3O8RA 4A92A 1F0UA 2P94A 2W7UA 1GHYH 2PW8H 3EGKH 1O3LA 2BD4A 3PYHA 2FOGA 1GBCA 1AY6H 2BB4A 2STAE 4WMFA 1TE0A 1FPHH 1NBME 2BOKA 1IOEA 3PTNA 1TPSA 1FJSA 1SOZA 3O8BA 1A3EH 5JB8S 1VJ9U 3MFJA 4FXGH 2H6MA 3GCTG 1Y3VA 1EB1H 2BLOA 3K9XB 2JETB 1BMLA 2F9UA 1ETTH 4THNH 5E0JA 2BD2A 3SN8A 1GMHG 3RXPA 3NWUA 1L0ZA 2JH5D 2O8UA 3UNSA 3RU4E 1DSUA 4Y79A 3N7OA 3RXVA 3LONA 1YPHE 4MPUA 2PV9B 1ELGA 1V2MT 1SMFE 1EUFA 1TPPA 3O8DA 3A8DA 1AN1E 2A4OA 1CA8B 5HM2A 3BTME 1GDUA 1ZSLA 3EA8A 1A0HB 5EPNA 1PPZA 1AQ7A 1SSXA 2QXJA 1EB2A 3LGWA 1P57B 3BTHE 4Y11E 1TQ0B 3SNBA 1DLKB 3KQEA 1TMUH 1THPB 1OOKB 5EQSA 8KME2 4Y8YA 2A5KA 2FO9A 3IWMA 1WTGH 3AASA 4FUEA 3LGTA 3SV7A 2HALA 5FCKA 1A0JA 1UVPA 2PUXB 2GMTB 3GCOA 4GHTA 4ZROA 3ZVCA 3V7TA 2W7SA 1RTKA 1VCQA 1BITA 4BAKB 3SI4H 1G36A 3AVZA 2UWPA 3SV2H 5IYTA 4DCDA 4JK5A 4XOJA 4F48B 1GHWH 1UHBA 2VIWA 3RXGA 1NRSH 3TJUA 4BOHA 1TAWA 3WY8A 3W1EA 2F9PA 5DKMA 2LELA 4X6NA 2VB0A 2H9TH 2QY0B 2WPDD 1NT1A 3A7WA 4K5ZA 1ANCA 1CHOG 1XUKA 4Y7BA 1DE7H 2V7QD 4Q2KA 2WZQA 2XCNA 1P9SA 5E2PA 2AERH 3MYWA 2FZZA 1JIMA 2C3SA 4IBLH 3BTEE 3UQVA 2NU3E 3SV6A 1UTQA 1UK3A 1VCWA 1O32A 2AIPA 1DWBH 1KLIH 2CF8H 2PGBB 2ZZUH 4OGYA 1V6DA 1ZLRA 5JBTA 1QNJA 3CP7A 2J94A 3SO3A 2IJD1 3T5FH 3ZZAA 3RMMH 4K1TA 1FIZA 1CGJE 1ARBA 3G01A 3Q3KA 1EZSC 2FOBA 1V2RT 1MTNC 5EODA 2ZKSA 1WOFA 3ZZCA 4I86A 1QHRB 3GDVA 2AMPA 3NK8A 1CGHA 2G00A 1SLUB 2ANWA 4TY7A 1O3NA 3FP8E 1MABB 2CGAA 4DGJA 2GDEH 2A4QA 3DA9B 3MWIU 1TRNA 1GHBF 1FXYA 3Q00A 1UVSH 3RXDA 2VBCA 1C5OH 1GMDF 1Z1IA 3HKIB 1SI5H 2OC7A 1Y8TA 2KX4A 2ZPSA 5FAHA 1MMJN 3MHWU 1U6QA 4A5TS 1YPKH 2BX4A 1RGQA 2O8WA 3RXQA 1EAUA 3A7VA 1KDQA 2PKAB 3MQKC 2GCTC 1C4V2 4TSFD 2GD4B 2J5UA 1ABJH 2PUQH 4F55A 2FPZA 2FTMA 2OD3B 4YLUA 3TLOA 2CK3D 3ZZ7A 4GPGA 1UTKA 4Y71A 1FN8A 2SGPE 4NA9H 2EC9H 1HBTH 4BNRA 1FZZA 3UAIC 2J92A 1GMHF 2Y5HA 7LPRA 3S9CA 2P3FH 5GNDA 2ZEBA 1V3XA 1C1TA 4DW2U 3RXOA 2H5DA 3DHKH 5F8XA 4HFPB 4F4OC 1HJ8A 2AGGX 4MQAA 1BTYA 1IQFA 4OS4A 1P2IA 2Y7ZA 1MAYA 4MG3A 2LNCA 2P3UB 1HAGE 1N6XA 3A86A 2XC0A 1LDTT 1QCPA 4HZHA 1QL7A 3BEFB 3SUEA 1TOCB 1O38A 1SLVB 3LOXA 3RXFA 5A8ZA 2ODPA 1GVKB 1A1RA 3GY7A 1SLWB 5FX6A 1DUEA 2G5VA 2F9NA 2F3CE 3ATWA 1O0DH 1SQRA 3MH5A 3SI3H 4K8YA 4M7GA 2V3MA 3RC4A 3MNXA 3F68H 2VIOA 2JKHA 2XRCA 4NWLA 1SGDE 4X1RU 2GZ9A 1Q2WA 1WQSA 5EW1H 4ZKSU 1BHXB 5L2YH 1NS3A 1O2UA 1THRH 4X8SH 2B7DH 2ZGXH 1TX7A 1NRNH 1S83A 2BDGA 1TYNA 3SU5A 3A85A 1RRKA 2A0QB 3OAAD 4TWWA 1EZUC 1OWIA 1QBVH 3KHVA 1D6WA 1W13U 2JH0D 2FLRH 1K1OA 2BY6X 2F91A 1DS2E 1AFQB 1W7XH 2WYJA 4A1VA 2FX6A 1ZHPA 2K0QA 1PPFE 1E1QD 4CHAB 4WH6A 1ELEE 1SGQE 2FI5E 3B23B 5CHAB 4AORA 1P10A 3DUXH 4RKOB 1HJ9A 9ESTA 3TGIE 1WXRA 3OTJE 2GDDA 3DD2H 1YLCA 2TRMA 5H4IB 2AGEX 1RS0A 3M37A 4QT8C 1YPEH 2ZDKA 2VJ1A 1H4WA 1AKSA 2ZCLP 1FV9A 3SORA 1F5RA 2A4RA 2GT8A 3RUOA 1H8DH 1QL8A 1P0SH 1BBRE 1FLEE 2A2QH 2GT7A 5G4BA 2JETC 1C4Y2 1P3EA 2OLGA 1AIXH 1V2KT 4K2YA 3UFAA 3V12A 4X2XA 4O3UA 1YC0A 3QDZB 4DIHH 1PPEE 5LPFA 4I8HA 4AN7A 1HB0B 1JIRA 1C1RA 1TBQH 2AHME 2HLDD 1BBRH 1MQ6A 3OSYA 3SV8A 2WV4A 2WPLS 5AVDA 1V2QT 1M9UA 1SQAA 2EI8A 4A1TA 8GCHF 1S5SA 3FP7E 2PTCE 1DM4B 2VIQA 3EDXB 1Z6JH 1BMFD 3TGJE 1EPTA 1GJDB 1O2OA 5L6NH 1ELFA 3W95A 4MNVA 5GPIB 1C9TA 3SHCH 3RXUA 3E0NB 4VGCB 1AVWA 1SGEE 1EJNA 1QL9A 2SGFE 4IMZA 1FUJA 1Z6EA 2J98B 4ABJA 1TONA 4TWYA 1KTSB 2D26C 1GI9B 1MU6B 2R3UA 1GMCG 2BD9A 1O5EH 3PV5A 5AFYH 1XXFA 3T26A 2GMTC 3ZVGA 1O3IA 3A7TA 1PPGE 5C0UA 2L74A 3PB1E 3ZZ8A 3AW0A 4B1TA 1IQHA 1SHYA 5T3HA 3D62A 2XWAA 3F3BA 1PQ5A 1BBRK 1TGBA 1TALA 1GVLA 4Y10E 2J38A 2QA9E 4K60A 5DPAA 2OINA 3KQBA 3KEEA 2CN0H 3GY2A 4MVNA 2DE8A 4TY6A 1YGCH 3PRDA 1AE8H 2A45B 5B6OA 2THFB 4DOQA 2ZFPH 1OWKA 5EGMA 2ALVA 1TX6A 3A7XA 2FOCA 4RSPA 4B74A 1P06A 3SJIA 3SNEA 3P95A 4NG9H 3P8OA 3E6PH 4X8UH 1W0JD 1AE5A 3UNQA
chains in the Genus database with same CATH topology
3HGNA 4DJZB 1QIXB 4CRGA 1QR3E 3NKKA 1C5XB 3VEQB 1LVYA 1V2LT 1Y59T 3EA9A 1S85A 1C1VH 1GBTA 1H9IE 3Q3YA 1LVBA 5TCAA 4BXWA 6GCHG 1S81A 5FBIA 1BRCE 1O3FA 2AYWA 4O9VA 5A8XA 1HAVB 2Z9KA 1TLDA 5C1XA 1BB0B 1LCYA 3KCGH 1EQ9A 1GCDA 5ESTE 1SC8U 4AYYB 1ZMNA 2BXUH 2BLVA 2BXTH 4H4FA 2G5NA 3M7QA 4AFQA 3AAVA 1ZRKA 1T4VH 1EOJA 1XKBC 2P8OB 3Q76A 1XUJA 2TIOA 2I6SA 1RXPA 2ZTXA 2BQ6B 3OY6U 5C3NA 2VIPA 3H7OA 1LHDH 1W10U 2FDAA 2V6NA 5FPTA 4KTSA 1XXDA 1UTLM 1ORFA 1WUNH 2F9OA 1B0FA 2R0KA 2OC8A 2HLCA 1RFNA 3K6YA 5J4QA 4B2AA 2D2DA 3A8CA 2VH0A 3F9EA 1DVAH 4OS7A 4INLA 1TMTH 1QGFA 1CSOE 1NZQH 1UCYE 4GAWA 1MCTA 1C5ZB 2NU4E 1C5PA 4AZ2B 2ZGBH 1O39A 2BDYA 2ZU2A 3SBKA 1BMAA 2BD5A 3BEIB 1JMOH 1SQTA 1XUHA 2OXSA 1S82A 5T6GA 1V2JT 3A7ZA 1NO9H 3M3TA 1HAZB 1UCYH 2CF9H 1YPLH 2H2ZA 1DOJA 3LGYA 1O35A 2B8OH 5FPYA 1ZTLA 5FHTA 5LH8A 2Q6FA 3S7HB 2A2XH 2FOAA 2XXLA 2WYGA 3PWCA 2BVXH 1TNIA 2W3IA 3BN9A 1QY6A 2A7HA 4JZFH 1W8BH 1ELBA 1QBNA 2AS9A 4XDEA 3QUMP 1O3OA 4Z6AH 1DFPA 1UK4A 3S7KB 4FU9A 4ISOA 3C27B 1T32A 1P2OA 2XWBI 1QFKH 1GMCF 4WY3A 2GX4A 2Z9JA 3A8BA 1F92A 1EJMA 1S0QA 4KKDA 3SU2A 4JMYA 1LO6A 1BTWA 1UVOA 4GHQA 1QB6A 1W7GH 1BJUA 2Y5GA 3FFGA 3SZNA 2A31A 1ELAA 2W26A 2ZU4A 2QGRA 1O2RA 3KNXA 1UCYK 1ZTJA 1P09A 3KQCA 1AZ8A 3RXJA 1C5NH 1IQJA 4MNWA 4IN2A 2UUYA 1W0YH 1O5GH 1SB1H 3QN7A 1MU8B 4A7IB 5EPYA 1AFQC 2W5EA 3NPSA 4X0WU 1ZMJA 4INHA 1ELTA 1CT0E 1MBMA 4CHAC 4NFEA 3RXBA 3OX7U 2FYQA 1F0RA 1MZAA 5CHAC 3SNAA 2FM2A 1P2MA 1GGDB 2Y80A 1E38B 1ZOMA 2FEQH 3A83A 5E8EH 2QV1A 5GCHG 4UONA 1G3BA 3IG6B 3QGJA 1IQLA 3LC3A 3TK5A 1J15A 1K1JA 3TNSA 2G55A 2AEIH 3LDXH 5C1UA 4JZ1A 3TIUA 4X8VH 1EX3A 1O2QA 3DFJA 1C2IA 4AB8A 1VCPA 2DUCA 4U32A 1H8IH 1BJVA 1GI4A 2F9BH 2B0FA 4WF8A 3SUDA 2GZ7A 2FLBH 1NFUA 2GKVE 4UFDH 4WMEA 4IC6A 1O5AB 1Y5BT 3EYDA 2WPHS 3BIUH 1SQOA 1NESE 1DLEA 5BPEA 1C2DA 1HCGA 2F9VA 4VGCC 1IQKA 4WJG2 2OUAA 1ETRH 5K7RA 1TGCA 2A1DB 3ZVBA 2VIDA 1TABE 1IHTH 1G3DA 4YZUA 1H9HE 1LMWB 4B75A 5FCRA 5L30H 4MDSA 2FXRA 3MH7A 5DP3A 1ANDA 1NROH 1NRRH 2ZDMA 1GL0E 6CHAB 1G2MA 1QJ1B 2ZFFH 4NIVA 3TJOA 2ANMH 1GJ8B 4GCHG 1GJCB 2BM2A 1CO7E 2J9NA 5I46H 1CGIE 2UUFB 1K22H 2BHGA 2ZGHA 2ZDAH 3A87A 1C5WB 5GIBA 3RXAA 3TPIZ 4NSVA 3AW1A 3W94A 3IITA 1T8LA 1C2GA 2C8YB 2BYAX 4CBOA 2FOHA 1O33A 1ZPBA 1NRQH 2PTNA 3UUZA 1B7XB 1G3CA 1HAHH 5DG6A 1BOQA 5DK1A 3LH1A 3LT3A 1SGFA 1A5GH 3LGVA 3SGQE 1DT2A 1SBWA 2Z9GA 3M61U 3SU0A 1O2JA 3LKWA 1RD3B 1TNJA 3T62A 1GI1A 1HAIH 1C4U2 1P2KA 5ETXA 1PFXC 2VH6A 3ZVDA 2BQWB 2BDIA 4GUXA 4YOGA 3LC5A 3SU6A 1O2HA 1W11U 1Y3YA 4YO9A 1TRMA 3SGBE 1C5RA 2AMDA 3FVFB 2HWLB 2PLXA 1O3CA 1QURH 3MU0A 4MPWA 1C5VA 3SHAH 3ZYEA 2RG3A 4ZKOU 2K1QA 4MNYA 1HNEE 1WBGB 4I33A 1HJAB 3PMAB 2XBWA 4ISHH 1BT7A 6ESTA 2P8OC 2SFAA 5FBEA 2UWLA 3PLPA 1TNGA 3ZZ5A 1V2PT 3M5NA 1TNHA 3ZZ3A 1GG6B 2PKAA 1XUFA 1TB6H 4ABBA 2HGTH 1UTJA 4JYUH 3RLYH 1IQGA 4B2BA 1VITG 4B73A 3RP2A 2IOTA 2YNBA 2VVVA 1YBWA 1ZHMA 4I8GA 3HGPA 2ZPRA 4YOJA 4ZUHA 1DY8A 1GBMA 1D6RA 3STJA 4BAHB 1X7AC 1HIAB 3BTDE 1C5UA 5A0CA 1PYTC 2BZAA 4Y7AA 2CJIA 3ODDA 3SQHE 2WPKS 2QN5T 1AWHB 4YT6H 4DT7B 3MO3A 4TYDA 1CBWB 3ODFA 3QK1A 4ISLA 2ZO3H 4XSKU 1OSSA 4AFZA 3QGNB 5EOKA 5JBAS 2P93A 3ZZ9A 3ZZDA 1ELCA 3GISB 2FOFA 3ATMA 2A4GA 1BRUP 4FUHA 1NN6A 1IQNA 3ITIA 1K21H 1BA8B 2NU2E 4E7NA 2R2WU 5A09A 3R3GB 2GV7A 1OX1A 2RCEA 3LGUA 4BANB 4D7GA 3GY3A 2QIQA 2BVSH 4NA7A 1V2ST 4LZ4B 1EJAA 3GCTF 5PTPA 4Y76A 1C1PA 1C1MA 1BRBE 4AGJA 3URDA 2XC5A 2SGQE 2CHAB 3PLKA 3BIVH 3GCNA 1QQUA 1YPHC 3PROA 4J2YB 1LQDB 1O5CB 2Z3DA 3QZRA 3SOSA 1BZXE 4OGXA 2BD7A 3OU0A 5C20A 5EW2H 1EZQA 1O5DH 1GI7B 2V35A 1TGSZ 4D7FA 1EAIA 1NY22 1TBZH 5DP7A 1HUTH 3B8JA 3D49H 2FESH 5DP5A 4ZXXH 3T2NA 2QC2A 1TNLA 3BV9B 1P04A 1GGDC 1Y5AT 2VNTA 4I8KA 1O2TA 4FU7A 4DG4A 2BY9X 3E91A 4I8LA 1GDNA 2PWXA 3FAOA 1B0EA 2SGAA 2A32A 1ZSKA 1XVOA 1CVWH 4Y0YE 3OYPA 1P05A 2ALPA 2Y81A 3MO6A 1L1NA 1BTXA 3RDZA 1O3BA 1PPHE 1E36B 4LK4A 1S6HA 1O5FH 3KF2A 4AB9A 3S0NA 4YLQH 1GBJA 1L4DA 2RDLA 1GWAA 3ZV8A 3VB6A 4BAMB 1AVGH 2QXHA 1HYLA 2RA3A 3BTWE 1FY5A 1NFWA 4CREA 1C5LH 1J17T 3BTGE 5TJXA 1CHOF 1FONA 4FUBA 2H9EH 4X8TH 1AUTC 3BF6H 2AMQA 3RMOH 3V13A 4AOQA 2R0LA 1D3PB 1YF4A 1NPMA 2BDBA 2BMGB 4KP0A 1SR5C 1DSTA 4SGAE 3TH3H 9LPRA 3QTOH 4X2WA 3STIA 3S9AA 2ZCKP 4MPVA 4IC5A 3F9FA 3LJJA 1P12E 1VITF 2VVUA 2ZC9H 1IQMA 4X6PA 2WINI 5E0GA 3RU4T 1GPZA 1A5IA 1LTOA 3OY5U 3NZIA 5AHGH 4NIXA 2Y82A 1O2VA 3KGPA 1QA7A 2EA3A 3GYLB 3ZVAA 6CHAC 1GBHA 4Y6DA 3PTBA 2R2MB 3PMHB 1TA2A 4X6OA 4ZXYH 5C2ZA 3K6ZA 5T6FA 1UK2A 1KXCA 2ZDVH 1LVOA 1C1NA 1QTFA 1RJXB 1S6FA 4K1EA 4DVAU 4DY7B 2VWMA 1WYKA 1SGFG 1VGCB 5GXPA 2EI6A 1KXBA 1GBKA 1AWFH 5LPEA 4CR5A 1ID5H 4U2WA 2ESTE 2P3TB 3ATLA 1QRXA 4TPYA 2PKSB 4ABFA 3RXSA 1QJ7B 3DT0H 3URCA 3DFLA 4BXSA 1GHAG 1SFQB 1WAYB 2WPJS 1AVXA 1V2WT 1TPAE 1G37A 1YM0A 1Z8IB 2GTBA 1W12U 3MU1A 5J4SA 1MZDA 1OP2A 1HAVA 5LPRA 1J16A 3CS0A 3LGIA 4MLFB 1O2ZA 5TCCA 1OWEA 3R0FA 4X2VA 4YOIA 5HGGA 2P59A 1ANEA 4U30A 1SGPE 1HDTH 1P02A 5HM9A 4IMQA 1JRTA 3TH2H 3TK9A 2P16A 1VZQH 1AKSB 1G2LA 1GHZA 4IN1A 1HJAC 2H1UA 2G4UA 2PSXA 4TPIZ 1IHSH 2GVFA 2BD3A 3MH4A 4UFEH 2SNWA 2VGCB 1GG6C 1UTMA 3M35A 3ATKA 3EAJA 3FP6E 1C2MA 2OP9A 1DICA 3H5CB 4XBBA 4HTCH 1A0LA 1FNIA 1F0TA 1UTNA 2O8TA 1JWTA 1YP9A 1NRPH 1EPTB 3A7YA 1HXEH 1A3BH 3HPTB 1AD8H 1ESAA 4KTCA 4JCNA 4WXVA 3F1SB 1D3TB 3TH4H 1MD7A 3UNRA 4NZLA 1BDAA 5EG4A 4K69A 1LKBA 4WXIA 3SJ8A 3P8FA 1V2VT 3UTUH 1AU8A 3TU7H 1O3EA 3JZ2B 1D3QB 1LKAA 3TITA 3GCHB 3RXMA 2WPIS 5EQQA 1A46H 2OC1A 4KGAA 1K28D 1CBWC 2CXVA 2QF0A 3VPKA 5C67A 1YKTA 2J34A 3TGKE 5E2OA 1T7CA 5C5NA 3BG4B 4RKJB 1Z71A 4X1NU 2IN2A 2EI7A 3SGAE 3KL6A 1K2I1 3SNCA 1CU1A 5I25A 3MNBA 2C4FH 4D76A 1FY3A 3MMGA 4FUCA 2ZU3A 1V2OT 4FUDA 4Q7XA 1A61H 2BY5X 2CHAC 3RXLA 1F2SE 1O3PB 3GICB 3Q3XA 1O2MA 1TFXA 1QA0A 3UWIA 5EU8A 1SGRE 2FOMB 3S69A 1C1WH 2GP9B 4LZ1H 1O2XA 1TPOA 2FS9A 3EE0B 1YYY1 5HXFA 3ZZ6A 1NFXA 1TRYA 4NFFA 4MNXA 3P92A 3SV9A 3TVJB 1ZJKA 3P6ZB 1HFDA 3QLPH 2HRVA 1JOUB 4UDWH 1FPCH 5FPSA 1WTHD 3I78A 2GCHG 1OP8A 1O3AA 3B9FH 1YCPM 1YPJH 1ZPZA 3NCLA 1P03A 3P70B 4IW4E 1EP5A 3GOVB 4XBCA 3HATH 4K3JA 2W3KA 4GSOA 3M36A 3U9AH 2Q6GA 5BRRE 4H42U 3RXTA 2PFEA 3GDSA 1MCVA 1OWDA 4O97A 1SGNE 3ELAH 1DY9A 1SGYE 2KAIB 1WSSH 4WMDA 1INCA 1GBDA 1TBRH 3I29A 1O5BB 2ILNA 1A2CH 3TK6A 4ASHA 3ZZBA 2BY8X 1TNKA 1C2KA 1LHCH 3GDUA 2IJOB 4I31A 3BTTE 3RM0H 1HAOH 1GHVH 1KXDA 2H5CA 2QXGA 3L3TA 3VB4A 1YPGH 1W14U 1TGNA 2Z3EA 1J8AA 3RMNH 5A0AE 1C1SA 3RXHA 3U98H 3M7UA 5JPMH 5DJ7A 4CBNA 1CA0B 3TJVA 2R9PA 3A8AA 1YLDA 2ZHFH 5L2ZH 1V2TT 1GI8B 1P2JA 6GCHF 1MD8A 1GI5A 1F0SA 1F7ZA 3SJOA 1GJ7B 1P2NA 2G8TA 2ZFTA 3MNSA 4NA8A 1HAYB 1ZSJA 2QYIA 3CS7A 1GJ4H 1MH0A 1DITH 1GCTB 5F8TA 3SU1A 1VGCC 1FY8E 2QCYA 2NU1E 1O3HA 1SHHB 1ZTKA 3VGCB 4A1XA 3FZZA 3RXCA 4NIYA 1AB9B 3VXEH 1GHXH 1O2PA 3LH3A 2OBOA 4F49A 5CMXH 2PKSC 4DURA 1KY9A 1PYTD 1K1NA 3RXIA 3UY9A 3ZV9A 1G9IE 1CQQA 1ESTA 1ABIH 1GHBG 5JB9S 2ANYA 3PLBA 1GMDG 1UTOA 1HAXB 1LPKB 1OWHA 1E37B 2FP7B 2PHBA 3RC5A 1EAWA 1W3CA 3LPRA 2SGDE 4XFQA 2A5AA 2QXIA 2Y7XA 4ZHMU 2A5IA 1GDQA 1P8VC 4JZDH 1VJAU 4NCYA 2XYAA 3UR9A 3E8LA 4NSYA 1ELVA 1GI3A 1KIGH 3RU4D 2Z9IA 5IDKA 4WH8A 1XM1A 1DPOA 3D23A 4Q7YA 3SUFA 1LHGH 2BD8A 3SQEE 1S0RA 1T31A 2VGCC 4RN6A 1BIOA 2ULLA 1TQ7B 1C2FA 2ZQ1A 1GVZA 2GCHF 4BAOB 1PPCE 1NTPA 2Y6TA 4Y8XA 1D3DB 4ZHLU 4ABDA 1C5TA 4E7RG 1N1LA 5F8ZA 1N8OB 2BTCE 1C5QA 1O31A 1O3DA 1FY1A 1QB1A 3ATIA 4CRDA 3PV4A 1EPTC 1GL1A 2FIRH 2VINA 5C5OA 3RXEA 1E0FD 4JYTA 2QF3A 1VITH 2FS8A 1EOLA 1HIAA 2C8WB 1V2NT 2FX4A 2ZQ2A 4E05H 2ZA5A 2VWNA 2OQ5A 3F6UH 3VXFH 2H9HA 4B76A 3UIRA 4FVDA 1MKWH 2ANKH 3GYMA 3RLWH 3U8OH 1LPGB 5E0HA 5DO4H 1GBBA 3GCHC 1AGJA 2AIQA 3VFEA 4CRFA 1KXFA 2O8LA 3PMJA 4B71A 3L6PA 1KLJH 1IAUA 4CR9A 1MTVA 3M5MA 2ZHEH 2VWLA 4WWYA 3LIWA 2XW9A 3BG4C 1D9IA 5EQRA 2ZI2H 3UWJH 3ZVFA 3H7TA 4CH2B 5GCHF 3QWCH 1V2UT 1GBIA 4Y0ZE 1W2KH 3V0XA 3A84A 2V3HH 1AZZA 4UFGH 1RIWB 1WQVH 1SGTA 3E1XB 3PO1B 2PR3A 1YPMH 2Z9LA 3M5OA 3VB7A 3U8TH 1B5GH 1MKWK 5GDSH 1ZJDA 5HMAA 1CT4E 2WV5A 4NWKA 4IS5A 1ZMLA