3D65E

Crystal structure of textilinin-1, a kunitz-type serine protease inhibitor from the australian common brown snake venom, in complex with trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Textilinin
publication title Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom, in complex with trypsin
rcsb
source organism Pseudonaja textilis textilis
molecule tags Hydrolase inhibitor/hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d65E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d65E02
1HRTH 2ZU1A 2Z3DA 1TB6H 2ZTYA 2FODA 1G3BA 1P01A 1G32B 1P9UA 4I8GA 1C1SA 3RXCA 5GPIB 1P3EA 1GJDB 1L4ZA 4AFQA 1ZGVA 5E0HA 2HPQH 2NU1E 4YM9A 4VGCB 1W11U 1DICA 1P12E 1O3OA 1PJPA 3S9BA 1YC0A 1TGCA 3ZZAA 8KME2 3HKJB 3S7HB 1YPEH 1G30B 2C90B 5JB8S 1GJ7B 3GDSA 2ZHQH 1QQUA 4K5ZA 4ABAA 1C2JA 2BLOA 3KF2A 2PKAB 3T2NA 2HWLB 1ANDA 1ELAA 4X8VH 4AB8A 2SGAA 3RUOA 4YOGA 1IQIA 4B2BA 2A45B 1G2MA 2O8UA 3BTKE 3SNBA 1EQ9A 3OY6U 4AFZA 2ODQA 1F5KU 2A0QB 2UUKB 1CA0B 1V2ST 2ZU4A 3C1KA 1GBCA 1TPSA 1O37A 1OSSA 3RXQA 1LQEA 1Z7KA 2Z6BD 1EJMA 1S0RA 2STBE 2TGAA 1TNJA 1VJAU 1KSNA 2F9UA 4MLFB 1CHOF 1UHBB 1Z71A 1ID5H 2CMYA 3RMNH 1Y5AT 4NWKA 5LPEA 3SV8A 3HPTB 5C67A 3BIUH 4NIVA 1BB0B 1CA0C 2AYWA 2VIQA 3PROA 4YOIA 3QZQA 1HAHH 3UY9A 2QC2A 4XDEA 3GY7A 2Q6DA 9LPRA 3MNXA 1IQKA 1O35A 2HGTH 2YNBA 1UMAH 1TX6A 3A86A 4Q7XA 1FLEE 3SJKA 4D7FA 2VIOA 4O97A 1TNIA 1SGPE 1EP5A 1O36A 2FIRH 1TPAE 3DD2H 1GBFA 4AX9H 1C5LH 1BTZA 1YGCH 2NU0E 3A84A 1C5RA 1KDQA 2WYJA 3MU5A 3MYWA 1OKXA 1Z6JH 2P8OB 4LXBH 4GPGA 1SHHB 1Z8JB 1AE5A 5G4BA 2G5VA 4R8TB 3IWMA 1QB9A 3Q3KA 1LHEH 1F7ZA 1GJBB 1O3LA 1TALA 1UHBA 2FESH 4H6TA 4TY7A 1S85A 3QDZB 2G81E 5ESTE 4Z6AH 3VXEH 2ANWA 1QB1A 3GY3A 2P3FH 4ABHA 4NA9H 1L1GA 2ZQ1A 4XE4A 5FAHA 3K65B 2P8OC 1L0ZA 1XUFA 2G8TA 7LPRA 4CH2B 3E6PH 1C5OH 4DURA 2VVCA 3I77A 5AHGH 4ABJA 2XBWA 1QRZA 3E3TA 5ETXA 2BVRH 3RXOA 3T5FH 5E8EH 1BITA 2EI8A 4XFQA 2PGQB 2BMGB 3MOCA 1KTSB 3CS0A 2PUXB 2GTBA 8LPRA 3TIUA 1GBAA 1OWJA 1CT0E 3LDXH 1J16A 2ZF0H 1UTNA 2ZECA 1JBUH 4B73A 2O9QA 4O9VA 2WV5A 3VB7A 1Y59T 2GT7A 2Y5GA 3BSQA 3ZYEA 1B7XB 5JBCS 2C8YB 1G9IE 1PQAA 3GY6A 2SNWA 3ZVFA 1T31A 3SQEE 1WBGB 3DUXH 3O8RA 2AIPA 1ORFA 4X8SH 2O8TA 1DY8A 1O3BA 1CGHA 1AB9B 2BHGA 3LC3A 4X1SU 2Y6TA 1C5QA 1YP9A 3RXAA 4MG3A 1EJAA 1KYNA 2I6QA 5EOKA 2R2MB 3BTQE 1ZRBA 2TIOA 3F9HA 4X6MA 1SGFA 3SGAE 3SU0A 5A09A 3AAUA 6ESTA 4JCNA 1L1NA 5DP3A 1CHOG 2PGBB 1AB9C 1K1LA 2JETC 3TITA 2A7CA 2Y81A 2KAIA 2XNIA 1P2OA 1GMHF 1P05A 4U2WA 3BV9B 5EODA 4DCDA 3OTJE 5C1XA 3DT0H 3KQDA 3DFLA 2VIDA 2NWNA 2XCNA 1VCPA 1LTOA 2AS9A 1GHZA 3V12A 3P8NA 1BQYA 2Q6GA 3VB6A 2O8MA 2OCVB 4B1TA 3LIWA 1P57B 2QCYA 3BEIB 3ZVDA 3U9AH 1UCYE 1QFKH 3SHCH 3SUDA 1O2QA 1GBHA 1W7XH 4XBCA 4U32A 1Y5UT 1DPOA 1UTKA 2C3SA 3SUGA 1LCYA 1K9OE 2WUBA 1ZOMA 2ZP0H 2XBYA 3RXRA 3TK9A 4MNXA 3E16B 3SJ9A 1GBBA 3HGNA 1IQFA 2FM2A 2XTTB 3SV7A 1O5DH 1MTVA 2VWOA 3RXBA 1TBRH 1KIGH 3KQEA 1SG8B 3S9CA 4A92A 3ODFA 3MH7A 2HNTE 2BB4A 2H9TH 1V2RT 3F68H 4FXGH 4IC5A 4CRCA 4FU9A 1IQEA 1P09A 1VCWA 3I29A 3LH3A 3B9FH 1AU8A 1P2NA 1XUKA 1S5SA 2ZU5A 3OY5U 3FANA 1MD7A 2HPPH 3NK8A 4FUJA 3GCNA 4B2AA 3EGKH 2PSXA 2ZTXA 3P8OA 5TCCA 2AEIH 2QA9E 4CHAC 1F0RA 4IC6A 4A1XA 1XX9A 2WPJS 4WXIA 2HALA 4WY3A 5EXLA 4Y0YE 2EA3A 1QJ6B 1A5IA 3M5NA 4X0WU 5HMAA 4X2WA 1D9IA 1OWIA 4GLYA 4ABGA 1Q3XA 2Y82A 2R9PA 4Q7ZA 1NRQH 2WYGA 4DY7B 1QHRB 4A7IB 2CHAB 2FOMB 3TNSA 3GY2A 1O2GH 1Y3YA 1NRRH 1SGCA 1GPZA 1T4VH 3FZZA 4KTCA 3A87A 2OINA 5LPRA 4BTIB 1XUHA 2D26C 1CGIE 1AI8H 1CA8B 1O34A 4UFGH 1FY3A 4MTBA 1TMUH 2GZ9A 1UCYK 1A3EH 1BMAA 1C2IA 1FONA 1UVUH 3D23A 1GHVH 4FUHA 5E2PA 2H5CA 1MTNB 2PW8H 5AFYH 1DSUA 2HOBA 4WH8A 1EAIA 2CHAC 3HK3B 5L6NH 1UTOA 2ZG0H 2ZCHP 1C1RA 3EYDA 4FVDA 4Y8XA 3RXUA 1TNLA 1KY9A 2R3UA 1F5RA 2C4FH 2ZFQH 2D2DA 1P2KA 2A7HA 1AN1E 1OS8A 1XMNB 1GJAB 3S0NA 1V2UT 3MNCA 4Y7AA 1VGCB 1IQNA 1A0HB 1MU8B 2GD4B 4NIXA 4FU8A 5C20A 1MTNC 1RRKA 1C9TA 1CE5A 1GMHG 3E1XB 3GYLB 1NFUA 4UDWH 4K2YA 3G01A 1FY5A 2GCHF 3RXMA 2FWWA 5F8ZA 3RXHA 1TOMH 1HV7A 1OP8A 1IQMA 2VWLA 3SNDA 1LHDH 2PV9B 1CQQA 1VGCC 2ZCKP 1PPHE 4Y10E 1BT7A 2UWOA 1RTKA 4Y76A 1K21H 3P95A 1TFXA 4GHTA 1B5GH 1ZHMA 4X1RU 4X1NU 3LJOA 3RU4E 5FPTA 5C1YA 1G3CA 1P3CA 3SU5A 3VB3A 1ANCA 4CRDA 4X8TH 1PQ7A 1YPJH 3NPSA 4IS5A 1WTHD 3SV6A 5EW2H 3PO1B 1IQHA 3E0PB 1HCGA 4ABIA 1EOJA 1ELFA 2A4RA 1A0LA 1JWTA 1T8LA 4F49A 1WAYB 1GJ9B 3IG6B 1W7GH 1O0DH 5JBTA 4JK6A 4OGYA 3SV9A 1DVAH 3UPEA 1O3PB 1AGJA 3T62A 1BCUH 1GI1A 2P3UB 1ZHPA 4Y8ZA 4XSKU 2Z9JA 3MH4A 1BTWA 2BZAA 3PO1C 1BMNH 3QK1A 1TBQH 1NS3A 1V2TT 1FPCH 5DO4H 1P9SA 1JOUB 1SBWA 4R0IA 1C4U2 1A46H 1BTXA 1H9IE 2PSYA 2TBSA 1GHAF 1YPMH 2A2QH 4INKA 1PPBH 1TNKA 5E0JA 4ZROA 2VH0A 2GV6A 4CREA 1HBTH 3E0NB 4BANB 1ZSLA 3C27B 4TYDA 2OD3B 2OXSA 1TAWA 4MPUA 5T3HA 3M5MA 4RSPA 1AY6H 1BTUA 1GDQA 1TGTA 3ODDA 1TONA 1ZRKA 1DDJA 1DLKB 2JH6D 3U69H 1EPTC 1W14U 2Y80A 1HIAA 4NZLA 1THPB 5F03A 3RMMH 1RXPA 1W12U 2ZHFH 1ZLRA 1EX3A 1W0YH 3UQOA 4B74A 1GVLA 1GBLA 1SQAA 1WU1A 1WOFA 2BYAX 1EAXA 5HYOA 2JKHA 1BBRH 1KXBA 2HNTC 5CMXH 1GJ5H 1UK2A 2C8WB 2CJIA 4IBLH 3SJIA 2BD9A 3CENA 2AGGX 1C2DA 1HXFH 3L6PA 3SOSA 2BXUH 5C1UA 2FEQH 1KLJH 1ZTJA 4I8JA 1C1WH 3QUMP 1C1UH 1P04A 4NIYA 2BDCA 3UWIA 4OS2A 1LHGH 1TPOA 4ISNA 3QGNB 2BDGA 1C5UA 1DWBH 3KGPA 3UR6A 2NU2E 3U8OH 4O03A 1ZJDA 3B23B 1PPZA 1P03A 1YYY1 3LH1A 2XWAA 1MD8A 1VITH 1DLEA 1WV7H 1YPGH 1C2GA 2V6NA 3ZV8A 1TGSZ 2QXJA 2QN5T 1GHYH 2GCHG 2OBQA 3TK5A 3M7TA 4B76A 3SZNA 4DIIH 1T7CA 1NT1A 1SI5H 2P59A 5C3NA 1GMCG 1YPKH 1ZYOA 3KL6A 3BG4C 1T8OA 2FX4A 3MH6A 4CR9A 2QXGA 4MNYA 4I8HA 3U8RH 5AF9H 2AGIX 2BDBA 1AVWA 4X2VA 4LOYH 4MNVA 1O5EH 1A7SA 3RM2H 2ZGBH 1JIRA 1HAVA 1SR5C 3VGCB 1GDUA 2BDHA 4ABEA 2EEKA 1QTFA 4ESTE 3PWBA 1BRBE 2VH6A 1P0SH 1AQ7A 1NM6A 1BJVA 4X1PU 1GBKA 1GJ6A 3PTBA 4BAKB 3ZZ8A 1OWDA 2QYIA 2THFB 2G4UA 3IITA 5A8XA 5EQQA 4CRGA 1O2PA 1W10U 2STAE 1GI2A 2H5DA 1VJ9U 2CV3A 2WINI 2A31A 3VGCC 1NZQH 3A8BA 4E7NA 3LGWA 1GHWH 2OP9A 2ZFSA 3LPRA 1YCPH 1O2OA 2Y5FA 3PLPA 1IOEA 1ELDE 5LH8A 3SV2H 2JH0D 3AAVA 1GHAG 2DE9A 1V2JT 8GCHG 3SUFA 1C2HA 3ZVCA 2PTCE 3M35A 1CGJE 1NESE 2JH5D 1AKSB 4IMQA 4K60A 4OS4A 4Z0KA 5GCHF 1N6YA 2C93B 1GCTB 3RXTA 1K1OA 2FTMA 4K3JA 3ATLA 2RA0A 1HB0B 1Q2WA 2BLWA 1RTFB 2WV4A 5IYTA 3RXSA 1HNEE 4K69A 4NGAH 1O2SA 3ATMA 3EE0B 4BTUB 3STIA 4DW2U 4AYYB 5K0HA 2VVUA 1FQ3A 1OWEA 3M37A 4BAQB 1GCTC 4AG2A 2AGEX 2BQ6B 5L2ZH 1TOCB 5LGOA 4DVAU 3NUMA 4IGDA 1EKBB 1MU6B 1O3FA 3P17H 3RLYH 2M5TA 4ABBA 2VINA 1ELEE 1MCVA 1XUJA 3PWCA 2F9OA 5DP6A 3SO3A 2PKAA 3M3TA 2QF0A 2BLQA 1SMFE 1UK4A 3RM0H 1K1IA 1TNHA 1E34B 3MO9A 3UIRA 3ZZ3A 1GHBF 2BTCE 5DP5A 1ABIH 3ITIA 4NIWA 1SLXB 2BX4A 3P6ZB 3A7XA 3TGJE 1YLCA 3HK6B 4BNRA 5A0CA 1CBWB 1GBMA 4AG1A 4MPWA 4I33A 2A5KA 1EAWA 2WUCA 1QY6A 1UTJA 2ZZUH 3LT3A 2H1UA 2RG3A 1XVOA 1SGFG 3EQ0H 1DITH 3BTME 1H4WA 5B6OA 5I46H 3PMAB 5K7RA 1P10A 3UFAA 3ENSB 1AHTH 4MPXA 2B5TB 2AIQA 4D7GA 1C1OA 2SGFE 3S7KB 3SUEA 3LJJA 4K1SA 1JXPA 2C8XB 1CBWC 1TMTH 4CRBA 3QWCH 3BG8A 4XOJA 1GI4A 1V2WT 4INLA 4JYVH 3LGTA 1KXFA 1A4WH 4WJG2 1TQ7B 3AW1A 2J9NA 4YTAA 1TRMA 1SLWB 2ESTE 4JK5A 1AZ8A 1TA6A 1O3HA 3U1IB 1NRNH 2TGPZ 4FUGA 1MKWH 1TIOA 5EPNA 1ANEA 3UNSA 4BXWA 1AVGH 1P02A 2W5EA 3QO6A 4NCYA 1OPHB 1O38A 3SU4A 2B7DH 2ZFPH 1A5GH 5C2ZA 1P8VC 3M61U 2Z7FE 1JRSA 1TQ0B 2BY5X 1FN6A 1XVMA 3AASA 4ZKSU 4THNH 2IPHA 3PMBB 1O3CA 1S83A 2J92A 2Q1JA 4Y11E 1P2JA 2J38A 3H7OA 2JETB 2PWXA 2Z9LA 3RMOH 4GSOA 3GYMA 5GCHG 2ZKSA 1O5CB 3N7OA 4X6NA 2AMQA 1SGNE 3K9XB 1ABJH 1YLDA 1ZGIA 1FDPA 2ZFRH 1MKXK 2AERH 4JYTA 2D1JA 1DFPA 1NC6A 2A4GA 2ZDAH 4UD9H 5ESBA 3SNAA 3VEQB 4IN2A 4WWYA 3LKWA 1FV9A 3TJVA 3UUZA 2ZQ2A 1ANBA 4UEHH 1NU9A 6LPRA 1P11E 1DANH 2B8OH 1O2VA 2SGPE 4KGAA 3ZVGA 1C5WB 3EDXB 2ZFTA 1D3PB 3U98H 2FYRA 2TGDA 2Z9GA 4I7YH 2BY7X 3BTDE 3FP6E 2BY8X 1FIZA 3NZIA 1SOZA 1MAYA 2R2WU 1NRSH 3A8AA 2BLVA 4X1QU 4X2YA 3A7YA 1EZSC 2RDLA 4CRFA 1T8NA 3MH5A 1GI5A 1O2ZA 1DWCH 1L4DA 2BVSH 3TH4H 4ZXXH 1SQTA 4CR5A 1ZZZA 2AMDA 1O2JA 4ZAEA 1BDAA 3UOPA 1OX1A 2ZEBA 1QA7A 3KCGH 4AYVB 3ESTA 4B71A 1PQ5A 2QXHA 2XRCA 1WQVH 3KNXA 3OX7U 4ZXYH 1GHBG 3NKKA 3LGYA 1VITF 2A2XH 4A5TS 5C5NA 4UFFH 2WPMS 2BX3A 4Q80A 2ZO3H 3RXEA 5IDKA 2BQ7B 4ISOA 2FPZA 4FUIA 4BAOB 1ZPBA 2PUQH 1H8IH 1NPMA 2FTLE 1BRUP 1C1QA 3ATWA 3KHVA 1PPGE 1LKBA 2BY6X 2FDAA 3ZVBA 1D3QB 2ZHEH 2GZ7A 1XM1A 4BTTB 4CHAB 3MTYA 1LHFH 4FUCA 1DUAA 1Y3XA 1A61H 2FLRH 1ETSH 1PFXC 3VB4A 1NO9H 3H7TA 1EP6A 1AZZA 1NY22 1C5NH 1W8BH 3LGUA 4MQAA 1O5FH 1OP0A 3EA9A 1MQ6A 2ANMH 4Y0ZE 3U8TH 2B0FA 3WY8A 1QBVH 4J2YB 3Q00A 3D62A 5GDSH 4ZHAA 1LPKB 3SGBE 4QT8C 3A7ZA 1EAUA 1F0UA 3BN9A 3H5CB 3W95A 1IHSH 4MDSA 4HGCA 3BF6H 3UOUA 1ZTLA 3DA9B 1J17T 1BHXB 6GCHF 1FPHH 5FCKA 2OLGA 3GCTF 2TGTA 3GCOA 1O2IA 3ZZ7A 2SGEE 1ELTA 2EC9H 1V2MT 1AUTC 1OWHA 2ULLA 2XWBI 1HJAB 1DUEA 2Y5HA 2P94A 1ELVA 3PB1E 3BTFE 1OWKA 1S0QA 1B0FA 2VNTA 4FUFA 1P2MA 3M3VA 3VPKA 1W2KH 3BTTE 3A80A 2W3KA 2PLXA 1YCPM 2FOHA 2ALVA 1TGNA 1FY4A 2R0LA 3KQCA 3A85A 3UQVA 1EB2A 1L1JA 3URCA 3GY5A 2OC0A 1TLDA 2F91A 1O2TA 4UFDH 1FI8A 5GIBA 3A83A 1TX7A 1SGRE 1HJAC 1DM4B 1SB1H 4Q7YA 1K28D 4XBDA 2UUJB 3LC5A 1GJCB 5HXFA 4OGXA 3BTEE 3ZV9A 2FOCA 1G37A 5E2OA 2H9EH 1H9HE 4MVNA 1CU1A 3TK6A 2GZ8A 1T8MA 1QBNA 2BDYA 5EXMA 4TWWA 4E7RG 3ZVEA 1BA8B 4WH6A 4K1EA 2WPIS 5A0AE 2FXRA 1O2HA 2BVXH 2Z3CA 2QY0B 2G4TA 3T26A 3LGVA 2A4QA 1AIXH 5EQSA 3V0XA 3ELAH 1WTGH 1RD3B 1O33A 1ARBA 4A1TA 1GMCF 3FP7E 3M5OA 5DJ7A 1O32A 2H6MA 1O2XA 2WPLS 1FJSA 2ZDLA 4H42U 3PMHB 3K6YA 1ACBE 3GOVB 4JYUH 2VU8E 3PLKA 1QL9A 3PYHA 1VITG 3RXKA 3BTHE 1F0TA 4DJZB 3RXIA 1YPLH 3A81A 5FX6A 5A2MH 3M3SA 4DG4A 4X6PA 1TRYA 1MAXA 1ZR0A 1BTYA 1NFXA 1M9UA 3KN2A 3MU4A 3RC6A 1DS2E 1D6WA 1NFWA 1KXAA 4YO9A 1ZTKA 1VR1H 1MTWA 2ZFFH 3GDUA 5A8YA 1BRCE 4B75A 5ABWA 2P93A 3RXVA 2ZU3A 1WSSH 2CN0H 2P3TB 1EPTB 4TPIZ 4KTUA 4KTSA 5F8XA 5EU8A 8GCHF 4NA7A 1GCDA 2OUAA 1SL3A 2A7JA 4ZHMU 3TNTA 2GCTB 1K1PA 1QQ4A 3A7TA 3KQBA 6GCHG 1KLIH 3TJNA 1SLVB 3GCTG 3SQHE 1GHXH 1MTUA 2ZDVH 2ZCLP 4OS5A 1SVPA 3VFEA 4O3TA 1AWHB 5HM2A 1GI3A 1Z8RA 1HJ9A 1LVMA 1N1LA 1IHTH 1IQGA 1F5LA 4XBBA 1O5AB 1XXDA 2ALPA 1O3DA 2ZDMA 3UNRA 1EOLA 1GBDA 3ZZDA 1GBIA 1LO6A 2ZA5A 3ZZ6A 2K1QA 4Y71A 5A0BA 1V2KT 2XBXA 3Q77A 4GHQA 2GCTC 3RC4A 1O2RA 3LOXA 1JMOH 1Z1JA 2VB0A 1HGTH 2XXLA 3P8GA 4JZEH 3TJOA 5CHAB 4OS1A 4D76A 1SLUB 1LKAA 4X2XA 1C5ZB 2SGDE 3SI3H 3VB5A 2W7UA 3SJOA 7KMEH 3SU3A 1UTMA 4RN6A 1EPTA 3FAOA 1O3KA 1UVPA 1UTLM 1H8DH 1XUIA 4FUEA 1D4PB 4AORA 3JZ1B 2F9VA 2VIWA 1EZQA 4FUDA 4LZ4B 1WUNH 1UCYH 3BG4B 3BEUA 4ZH8A 4IW4E 4ZUHA 2A32A 2GGVB 2WPKS 5CHAC 3QX5H 1X7AC 1GL1A 4IMZA 4SGBE 5TJXA 3MO3A 3A82A 1FY8E 3K6ZA 4HFPB 1ZMLA 3QGJA 5DG6A 3SJ8A 1ESTA 2BXTH 3AVZA 1N8OB 1AO5A 4YESB 5JYIA 1QA0A 3BTGE 1S6HA 2WPHS 4ABFA 5FBIA 1LVBA 1V2QT 2W7SA 2VWMA 1KTTB 1ZSKA 4YZUA 3RU4D 2XBVA 3TJUA 4Y8YA 1GJ4H 1LVYA 2DUCA 1O2WA 2FO9A 4M7GA 2TPIZ 4GCHF 2NU4E 3SHAH 1N8OC 1V2OT 1Z8GA 1A0JA 1CHGA 2FP7B 2F9BH 1U6QA 5T6GA 4DIHH 4I8KA 3MU8A 3R0FA 2BD2A 3F9FA 2XW9A 2J4IA 3F1SB 1QL8A 1QR3E 5EPYA 1INCA 3DHKH 2P16A 3SU6A 1O3IA 2ZGCA 1ESBA 3SGQE 3UR9A 4E06H 3QN7A 3Q3YA 1T32A 4UE7H 1B0EA 1AMHA 1DXPA 1GI8B 1EUFA 3AW0A 5H4IB 1SGDE 1AWFH 3ZZ9A 4YT7H 2F9PA 4HI3A 1HLTH 2OBOA 3PLBA 2ZI2H 4OS6A 1RTLA 3TU7H 3OYPA 5PTPA 2VGCB 1YBWA 1WQSA 1QBOA 5F8TA 1TMBH 1DWEH 1Y3VA 1E0FD 4AFUA 4H6SB 5EGMA 4YT6H 3V3MA 1A2CH 3SNEA 2OQ5A 3ZZCA 1KXEA 1QL7A 1MMJN 1V2VT 3PTNA 1NU7B 2VVVA 1ZMJA 4NG9H 4WMDA 2FI4E 1LDTT 5EXNA 3S9AA 2BY9X 1HAIH 2GT8A 1A3BH 2ASUB 2VGCC 2XC4A 3RC5A 4CBNA 3FFGA 5JDUB 1O31A 1ZSJA 1O2YA 3VXFH 1GVZA 3TPIZ 2P95A 5DP8A 4ZKOU 4PROA 1XUGA 2ZNKH 1TRNA 1E37B 1KDQB 1TABE 3PM3A 4VGCC 2PKSB 5HM9A 1QNJA 3I78A 2D8WA 1FMGA 5TCAA 1SGYE 4AFSA 1QRXA 2GMTB 1EATA 2V35A 2BOHB 3LONA 3D65E 3M36A 3A7WA 2Z9IA 4B2CA 1J8AA 2ANYA 3E8LA 2AH4X 1AKSA 1G3DA 4WXVA 4D8NA 4AGJA 1SFIA 3RLWH 2PKSC 4CH8B 1T4UH 1THSH 2TRMA 1YF4A 4KP0A 1BRAA 1LVOA 1K1MA 2GMTC 1GI7B 4U01A 2BD5A 2FI5E 1HPGA 1S84A 1XXFA 4JZDH 4AB9A 3GISB 2BD7A 3SNCA 1OYQA 4FU7A 3A8CA 5DP4A 4A1VA 2ZU2A 1O3NA 2FOAA 1MUEB 2VIVA 2A5AA 2HRVA 2OC7A 1UVSH 4MNWA 4ZKRU 1W3CA 1BHXF 1QJ7B 1V2NT 1V2LT 2ZHWH 1GBEA 2I6SA 2SGQE 2ZTZA 4WVPE 4UFEH 5L2YH 3F6UH 4GCHG 4BXSA 5LPFA 5JBAS 1FY1A 2G51A 1V3XA 3T27A 1MTSA 1QRWA 3TVJB 1PYTD 3MHWU 4D9QA 2UWPA 5T6DA 3MO6A 1GMDF 2AFQB 3MNSA 2HLCA 1FAXA 2GP9B 4E05H 3K2UA 2ZPQA 2V3HH 4GUXA 3M7UA 1O5GH 3D49H 2QAAA 1ETRH 1D3TB 3U1JB 1C2MA 2PTNA 3CS7A 1QCPA 4FVBA 1Y8TA 1TNGA 2LNCA 3EAJA 3TH3H 1C2LA 2ZIQH 2ZDNA 9ESTA 2CF9H 4YLUA 4NFFA 1YKTA 1QJ1B 1Q31A 1TX8A 1RIWB 1LPZB 3RU4T 2SNVA 5GJ4B 1A1RA 1BJUA 1UJ1A 1C2KA 1EZUC 4OS7A 2KAIB 1RFNA 5JBBS 4INHA 3KIDU 5FBEA 4DOQA 1Y3WA 2FOFA 3SW2B 3RXLA 2FZZA 1HDTH 1HUTH 1AD8H 1RGQA 1C9PA 5FHTA 1CO7E 2FX6A 3F9EA 1E36B 1F2SE 4RKJB 3UWJH 2Z94A 3MNBA 1C4V2 4WF8A 1RIWC 1YM0A 1Z1IA 2W26A 3BIVH 5EG4A 3UTUH 1FZZA 3PV4A 2R3YA 4JZFH 3P8FA 1TA2A 1TE0A 2RA3A 1MH0A 3EA8A 1PYTC 3RDZA 2UUYA 4H4FA 1J9CH 3EA7A 5E0GA 4FUBA 2UUFB 4JMYA 3A88A 1BUIA 3GCHB 3RXFA 4AGKA 1GBTA 2OC1A 1K1NA 1TPPA 4AZ2B 1SGQE 4KELA 1ARCA 1GJ8B 1O3GA 5FX5A 2BD3A 3T25A 4NWLA 3T28A 2A5IA 1AE8H 1JIMA 1BBRE 3NCLA 2V0BA 1TBZH 1XKBC 2Z3EA 3RMLH 3O8DA 3W94A 1C5XB 5AFZH 1C5SA 2IJOB 3GCHC 1Y3UA 5AVDA 1GI9B 3KEEA 1CVWH 1O2UA 1C1VH 1DY9A 1G2LA 1W13U 8ESTE 1XKAC 3RP2A 2ZGXH 1HYLA 1SHYA 2NU3E 4GVUA 1PPEE 2ZGHA 2GV7A 1YPHE 5FPYA 2CGAA 3V7TA 3Q76A 4O3UA 2BDAA 2ZC9H 2QV1A 1OXGA 4K1TA 1DWDH 1O3JA 1DSTA 2OC8A 1O2MA 1ZPCA 4TY6A 1BMMH 3A89A 1C1NA 2H9HA 4Y7BA 2HNTF 1HXEH 1O2KA 3GY4A 3QTVH 4NSVA 2GVFA 2Z9KA 2HVXA 2A1DB 1OYTH 5DP9A 2J94A 1PPFE 2AMPA 4HZHA 3SU1A 4NFEA 1WCZA 2IOTA 4WMEA 1BIOA 1ZPZA 2VJ1A 3TLOA 1LMWB 2VWNA 5EW1H 3O8CA 3V13A 2BDIA 1SC8U 3A8DA 5T6FA 1GMDG 1AVXA 4J1YA 1NROH 4ASHA 4BOHA 4AN7A 2G5NA 1TWXB 1UVTH 2FLBH 3SU2A 4LK4A 1HAOH 5J4SA 3DFJA 1NTPA 4U30A 1JRTA 1KLTA 1GBJA 3RXDA 3FZDA 3OU0A 3M7QA 5HGGA 4A6LA 2ZPRA 2XYAA 1BTPA 4ISHH 1GL0E 1MCTA 2LPRA 1IAUA 1Z8IB 2ILNA 1HAPH 3M5LA 5JB9S 2Q6FA 2YOLA 4GAWA 1SOTA 1BBRK 1KXCA 1J15A 4I31A 3MU0A 3ZYDA 4LZ1H 1P2QA 3PMJA 5FXLA 1EJNA 1GDNA 2ODYB 3OSYA 1V6DA 4YLQH 2ZPSA 1DX5M 2FOGA 4JZ1A 1O3MA 5DGJA 5I25A 2GDEH 3QLPH 2BZ6H 1LHCH 1ELCA 5J4QA 2QF3A 1D3DB 4NZQA 4K8BA 1AFEH 2CXVA 1S82A 4K8YA 1K1JA 1K2I1 4BAMB 2XC5A 5F6MA 3FVFB 4BAHB 1Z6EA 5L30H 1UTPA 4I32A 1ESAA 3STJA 1GI6A 4ZKNU 3ZZ5A 1IQJA 2FYQA 3P70B 2GX4A 1MKXH 1H1BA 3O8BA 1RS0A 3SI4H 3E90B 1VZQH 4X6OA 3LGIA 3L33A 1EZXC 4ZHLU 4RKOB 2DE8A 1BTHH 1V2PT 1OOKB 3UREA 4DT7B 1GG6B 2ANKH 3CP7A 4F4OC 3T29A 2SFAA 3UNQA 1SGIB 4ISIH 5GXPA 3QTOH 2V3OH 2UWLA 3ZZ4A 4DGJA 1ZHRA 2VIPA 4MPVA 2FS9A 2GDDA 1IQLA 1MBMA 2BD8A 4TPYA 1MZAA 3HGPA 5C5OA 1A5HA 4Y79A 2F3CE 4CBOA 1C4Y2 3RXGA 1DT2A 3R3GB 1C5MD 2FMJA 5BRRE 1E38B 1TYNA 1GG6C 1CT4E 3E91A 1C2EA 1J14A 1CSOE 2Y7XA 1ELGA 5JPMH 3GY8A 3B8JA 1HFDA 7GCHF 2A4OA 1C2FA 2J95A 2O8LA 3SBKA 1RJXB 1NN6A 1CT2E 4CRAA 6CHAB 3TGIE 4ISLA 1S81A 1UK3A 2J34A 2BQWB 1G36A 2BOKA 1FN8A 3RXJA 1C1TA 3BTWE 3P92A 1YCPK 3HATH 2ODPA 1ELBA 1D6RA 4AOQA 4ZMAH 2O8WA 1G3EA 3GICB 3GDVA 1HIAB 5DPAA 1HAXB 3SORA 2FOEA 1MQ5A 4KKDA 1THRH 3MWIU 3URDA 1EASA 3FP8E 2ZHDA 5FCRA 6CHAC 3BEFB 1W0ZU 1PPCE 3MU1A 2EI7A 5DP7A 2FS8A 1LPGB 1MBQA 4X8UH 1O5BB 1QB6A 2EI6A 1GGDB 3NXPA 1O2LA 1L2EA 1GWAA 1SQOA 1DE7H 4WMFA 2CF8H 4Y6DA 1P2IA 3TGKE 3L3TA 1YPHC 3JZ2B 4IN1A 4NSYA 1S6FA 7ESTE 2B9LA 2ZDKA 2PHBA 1FXYA 1FIWA 1HAZB 3QZRA 4HTCH 3MFJA 4YOJA 1K22H 3MMGA 1FNIA 3HKIB 1HAYB 2XC0A 4ABDA 1P06A 1OP2A 1GGDC 3Q3XA 1GI0A 3F9GA 3S69A 2FOBA 1C1PA 1C5PA 2G55A 5DK1A 1SGEE 1SPJA 1PQ8A 2F83A 1UTQA 1WYKA 1FAKH 3LU9B 1LQDB 2OTVA 1EB1H 2GKVE 1O39A 1BMLA 1H9LB 4TWYA 2W3IA 3ATIA 2G00A 1NRPH 2QXIA 2H2ZA 1FUJA 1HAVB 2C8ZB 1AFQB 4I8LA 3NWUA 1E35B 1QIXB 1C5VA 1AUJA 1EXFA 1NFYA 4JZIA 1VCQA 4SGAE 1O30A 3ATKA 1F0SA 2BM2A 3ZZBA 2ZGJA 1UVOA 1SSXA 3SN8A 5EQRA 5DKMA 3TH2H 1AFQC 2XCFA 1HAGE 2RCEA 2YNAA 1ZMNA 2R0KA 1QURH 1SFQB 3MI4A 4NA8A 5CE1A 1MZDA 2Y7ZA 1BZXE 2OQUA 2IN2A 1F92A 5FPSA 3RXPA 1N6XA 3ZVAA 1UO6A 1C5YB 1DOJA 1HJ8A 1ETTH 4UONA 2G52A 2FI3E 5SGAE 5BPEA 7GCHG 2J2UA 1O3EA 4Q2KA 1C5TA 4D9RA 2PR3A 2PFEA 1MKWK 1KXDA 2ZWLH 1O2NA 1TGBA 1DXWA 2QIQA 5GWZA 1ZJKA 1QGFA 2F9NA 1BOQA 1GVKB 5A8ZA 1O3AA 1Y5BT 1SGTA 3A7VA 2QGRA 1C1MA 2BD4A
chains in the Genus database with same CATH superfamily
1HRTH 2ZU1A 2Z3DA 1TB6H 2ZTYA 2FODA 1G3BA 2JJ2D 1P01A 1G32B 4RI0A 1P9UA 4I8GA 1C1SA 3RXCA 5GPIB 1P3EA 1GJDB 1L4ZA 4AFQA 1ZGVA 5E0HA 2HPQH 2NU1E 4YM9A 4VGCB 1W11U 1DICA 1P12E 1O3OA 1PJPA 3S9BA 1YC0A 1TGCA 3ZZAA 8KME2 3HKJB 3S7HB 1YPEH 1G30B 2C90B 5JB8S 1GJ7B 3GDSA 2ZHQH 1QQUA 4K5ZA 4ABAA 1C2JA 2BLOA 3KF2A 2PKAB 3T2NA 2HWLB 1ANDA 1ELAA 4X8VH 4AB8A 2SGAA 3RUOA 4YOGA 1IQIA 4B2BA 2A45B 1G2MA 2O8UA 3BTKE 3SNBA 3N7EA 1EQ9A 3OY6U 4AFZA 2ODQA 1F5KU 2A0QB 2UUKB 1CA0B 1V2ST 2ZU4A 3C1KA 1GBCA 1TPSA 1O37A 1OSSA 3RXQA 1LQEA 1Z7KA 3F0PA 2Z6BD 1EJMA 1S0RA 2STBE 2TGAA 1TNJA 1VJAU 1KSNA 2F9UA 4MLFB 1CHOF 1UHBB 1Z71A 1ID5H 2CMYA 3RMNH 1Y5AT 4NWKA 5LPEA 3SV8A 3HPTB 5C67A 3BIUH 4NIVA 1BB0B 1CA0C 2AYWA 2VIQA 3PROA 4YOIA 3QZQA 1HAHH 3UY9A 2QC2A 3OEED 4XDEA 3GY7A 2Q6DA 9LPRA 3MNXA 1IQKA 1O35A 2HGTH 2YNBA 1UMAH 1TX6A 3A86A 4Q7XA 1FLEE 3SJKA 4D7FA 2VIOA 4O97A 1TNIA 1SGPE 1EP5A 1O36A 2FIRH 1TPAE 3DD2H 1GBFA 4AX9H 1C5LH 1BTZA 1YGCH 2LELA 2NU0E 3A84A 1C5RA 1KDQA 2WYJA 1H8HD 3MU5A 5C94A 3MYWA 1OKXA 1Z6JH 2P8OB 4LXBH 4GPGA 1SHHB 1Z8JB 1AE5A 5G4BA 2G5VA 4R8TB 3IWMA 1QB9A 3Q3KA 1LHEH 1F7ZA 4RT0A 1GJBB 1O3LA 1TALA 1UHBA 2FESH 4H6TA 4TY7A 1S85A 3QDZB 2G81E 5ESTE 4Z6AH 3VXEH 2ANWA 1YLNA 1QB1A 3GY3A 2P3FH 5DSFA 4ABHA 4NA9H 1L1GA 2ZQ1A 4XE4A 5FAHA 1SQRA 3K65B 2P8OC 1L0ZA 1XUFA 2G8TA 7LPRA 4CH2B 3E6PH 1C5OH 4DURA 2VVCA 3I77A 5AHGH 4ABJA 2QF5A 2XBWA 1QRZA 3E3TA 5ETXA 2BVRH 3RXOA 3T5FH 5E8EH 5EIYA 1BITA 2EI8A 4XFQA 2PGQB 2BMGB 3MOCA 1KTSB 3CS0A 1WDIA 2PUXB 2GTBA 8LPRA 3TIUA 1GBAA 1OWJA 1CT0E 3LDXH 1J16A 2ZF0H 1UTNA 3PV5A 2ZECA 1JBUH 4B73A 2O9QA 4O9VA 2WV5A 3VB7A 1Y59T 2GT7A 2Y5GA 3BSQA 3ZYEA 1B7XB 5JBCS 2C8YB 1G9IE 1PQAA 3GY6A 2SNWA 3ZVFA 1T31A 3SQEE 1WBGB 3DUXH 3UAIC 2AIPA 3O8RA 1ORFA 4X8SH 2O8TA 1DY8A 1O3BA 1S6LA 1CGHA 1AB9B 2BHGA 3LC3A 4X1SU 2Y6TA 1C5QA 1YP9A 3RXAA 4MG3A 1EJAA 1KYNA 2I6QA 5EOKA 2R2MB 4DT4A 3BTQE 1ZRBA 2TIOA 3F9HA 4X6MA 1SGFA 3SGAE 3SU0A 5A09A 3AAUA 6ESTA 4JCNA 1L1NA 5DP3A 1CHOG 2PGBB 1AB9C 1K1LA 2JETC 3TITA 3FN8A 2A7CA 2Y81A 2KAIA 2XNIA 1P2OA 1GMHF 1P05A 4U2WA 3BV9B 5EODA 4DCDA 3OTJE 5C1XA 3DT0H 3PRBA 3FOAA 3KQDA 3DFLA 2VIDA 2NWNA 2XCNA 1VCPA 1LTOA 2AS9A 1GHZA 3V12A 3P8NA 1BQYA 2Q6GA 3F2HA 3VB6A 2O8MA 2OCVB 4B1TA 3LIWA 1P57B 2QCYA 3BEIB 3ZVDA 3U9AH 1UCYE 1QFKH 3SHCH 3SUDA 1O2QA 1GBHA 1W7XH 2V3MA 4U32A 4XBCA 1Y5UT 1DPOA 1UTKA 2C3SA 3SUGA 1LCYA 1K9OE 2WUBA 1ZOMA 2ZP0H 2XBYA 3RXRA 1E1RD 3TK9A 4MNXA 3E16B 3SJ9A 1GBBA 3HGNA 1IQFA 2FM2A 2XTTB 3H09A 3SV7A 1O5DH 1MTVA 2VWOA 3RXBA 1TBRH 1KIGH 3KQEA 1SG8B 3S9CA 4A92A 3ODFA 3MH7A 2HNTE 2BB4A 2H9TH 1V2RT 3F68H 4FXGH 4IC5A 4CRCA 4FU9A 1IQEA 1P09A 1VCWA 3I29A 3LH3A 3B9FH 1AU8A 1P2NA 1XUKA 1S5SA 2ZU5A 3OY5U 3FANA 1MD7A 2HPPH 3NK8A 4FUJA 3GCNA 4B2AA 3EGKH 2PSXA 2ZTXA 3P8OA 5TCCA 2AEIH 2QA9E 4CHAC 1F0RA 4IC6A 4A1XA 1XX9A 2WPJS 4WXIA 2HALA 4WY3A 5EXLA 4Y0YE 2EA3A 1QJ6B 1A5IA 3M5NA 4X0WU 5HMAA 4X2WA 1D9IA 1OWIA 4GLYA 4ABGA 1Q3XA 2Y82A 2R9PA 4Q7ZA 1NRQH 2WYGA 4DY7B 1QHRB 4A7IB 2CHAB 2FOMB 3TNSA 3GY2A 1O2GH 1Y3YA 1NRRH 1SGCA 3OAAD 1GPZA 1T4VH 3FZZA 4KTCA 3A87A 2OINA 5LPRA 4BTIB 1XUHA 2D26C 1CGIE 1AI8H 1CA8B 1O34A 4UFGH 1FY3A 4MTBA 1TMUH 2GZ9A 1UCYK 1A3EH 1BMAA 1C2IA 1FONA 1UVUH 3D23A 3W1EA 1GHVH 4FUHA 5E2PA 2H5CA 1MTNB 2PW8H 5AFYH 1DSUA 2HOBA 4WH8A 1EAIA 2CHAC 3HK3B 5L6NH 1UTOA 2ZG0H 2ZCHP 1C1RA 3EYDA 4FVDA 4Y8XA 3RXUA 1TNLA 1KY9A 2IPQX 2R3UA 1F5RA 2C4FH 2ZFQH 2D2DA 1P2KA 2A7HA 1AN1E 1OS8A 1XMNB 1GJAB 3S0NA 1V2UT 3MNCA 1FX0B 4FETA 5CDFE 4Y7AA 1VGCB 1IQNA 1A0HB 1MU8B 2GD4B 4NIXA 4FU8A 5C20A 1MTNC 1RRKA 1C9TA 1CE5A 1GMHG 3E1XB 3GYLB 1NFUA 4UDWH 4K2YA 3G01A 1FY5A 2GCHF 3RXMA 2FWWA 5F8ZA 3RXHA 1TOMH 1HV7A 1OP8A 1IQMA 2VWLA 3SNDA 1LHDH 2PV9B 1CQQA 1VGCC 2ZCKP 1PPHE 4Y10E 1BT7A 2UWOA 1RTKA 4Y76A 1K21H 3P95A 1TFXA 4GHTA 1B5GH 1ZHMA 4X1RU 4X1NU 3LJOA 3RU4E 5FPTA 5C1YA 1G3CA 1P3CA 3SU5A 3VB3A 1ANCA 4CRDA 4X8TH 1PQ7A 1YPJH 3NPSA 4IS5A 1WTHD 3SV6A 5EW2H 3PO1B 1IQHA 3E0PB 1HCGA 4ABIA 1K0HA 1EOJA 1ELFA 2A4RA 1A0LA 1JWTA 1T8LA 4F49A 1WAYB 1GJ9B 3IG6B 1W7GH 1O0DH 5JBTA 4JK6A 4OGYA 3SV9A 1DVAH 3UPEA 1O3PB 1AGJA 3T62A 1BCUH 1GI1A 2P3UB 1ZHPA 4F55A 4Y8ZA 4XSKU 2Z9JA 3MH4A 1BTWA 2BZAA 3PO1C 1BMNH 3QK1A 1TBQH 1NS3A 1V2TT 1FPCH 5DO4H 1P9SA 1JOUB 1SBWA 4R0IA 1C4U2 1A46H 1BTXA 1H9IE 2PSYA 2TBSA 1GHAF 1YPMH 2A2QH 1H8ED 4OM9A 2J98A 4INKA 1PPBH 1TNKA 5E0JA 4ZROA 2VH0A 2GV6A 4CREA 1HBTH 3E0NB 4BANB 1ZSLA 4I86A 4Q4LA 3C27B 4TYDA 2OD3B 2OXSA 1TAWA 4MPUA 5T3HA 3M5MA 4RSPA 1AY6H 2VBCA 1BTUA 1GDQA 1TGTA 3ODDA 1TONA 1ZRKA 2F43B 1DDJA 1DLKB 2JH6D 3U69H 1EPTC 1W14U 2Y80A 1HIAA 4NZLA 1THPB 5F03A 3RMMH 1RXPA 1W12U 2ZHFH 1ZLRA 1EX3A 1W0YH 3UQOA 4B74A 1GVLA 1GBLA 1SQAA 1WU1A 1WOFA 2BYAX 1EAXA 5HYOA 2JKHA 1BBRH 1KXBA 2HNTC 5CMXH 1GJ5H 1UK2A 2C8WB 2CJIA 4IBLH 3SJIA 2BD9A 3CENA 2AGGX 1C2DA 1HXFH 3L6PA 3SOSA 2BXUH 5C1UA 2FEQH 1KLJH 1ZTJA 4I8JA 1C1WH 3QUMP 1C1UH 1P04A 4NIYA 2BDCA 3UWIA 4OS2A 1LHGH 1TPOA 4ISNA 3QGNB 2BDGA 1C5UA 1DWBH 3KGPA 3UR6A 2NU2E 3U8OH 4O03A 1ZJDA 3B23B 1PPZA 1P03A 1YYY1 3LH1A 2XWAA 1MD8A 1VITH 1DLEA 1WV7H 1YPGH 1C2GA 2V6NA 3ZV8A 1TGSZ 2HLDD 2QXJA 2QN5T 1GHYH 2GCHG 2OBQA 2YMSC 3TK5A 3M7TA 4B76A 3SZNA 4DIIH 1T7CA 1NT1A 1SI5H 2P59A 5C3NA 1GMCG 1YPKH 1ZYOA 3KL6A 3BG4C 1T8OA 2FX4A 3MH6A 4CR9A 2QXGA 4MNYA 4I8HA 3U8RH 5C17A 5AF9H 2AGIX 2BDBA 1AVWA 4X2VA 4LOYH 4MNVA 1O5EH 1A7SA 3RM2H 2ZGBH 1JIRA 1HAVA 1SR5C 3VGCB 2L74A 1GDUA 2BDHA 4ABEA 2EEKA 1QTFA 4ESTE 3PWBA 1BRBE 2VH6A 1P0SH 1AQ7A 1NM6A 1BJVA 4X1PU 4Z1MD 1GBKA 1GJ6A 3PTBA 4BAKB 3ZZ8A 1OWDA 2QYIA 2THFB 2G4UA 3IITA 5A8XA 5EQQA 4CRGA 1O2PA 1W10U 2STAE 1GI2A 2H5DA 1VJ9U 2CV3A 2WINI 5EJZA 2A31A 3VGCC 1NZQH 3N7DA 3A8BA 4E7NA 5HKKD 3LGWA 1GHWH 2OP9A 2KCOA 4P00A 2ZFSA 3LPRA 1YCPH 1O2OA 2Y5FA 2KCYA 3PLPA 1IOEA 1ELDE 5LH8A 3SV2H 2JH0D 3PV2A 3AAVA 1GHAG 2DE9A 1V2JT 8GCHG 3SUFA 1C2HA 3ZVCA 2PTCE 3M35A 1CGJE 1NESE 2JH5D 1AKSB 4IMQA 4K60A 4OS4A 4Z0KA 5GCHF 2KX4A 2KCPA 1N6YA 2C93B 1GCTB 3RXTA 1K1OA 2FTMA 4K3JA 3ATLA 2RA0A 1HB0B 1Q2WA 2BLWA 1RTFB 2WV4A 5IYTA 3RXSA 1HNEE 4K69A 4NGAH 1O2SA 3ATMA 3EE0B 4BTUB 2F4LA 3STIA 4DW2U 4AYYB 5K0HA 2VVUA 4TSFD 1FQ3A 1OWEA 3M37A 4BAQB 1GCTC 4AG2A 2AGEX 2BQ6B 5L2ZH 1TOCB 5LGOA 4DVAU 3NUMA 4IGDA 1EKBB 1MU6B 1O3FA 3P17H 3RLYH 2PP6A 2M5TA 4ABBA 2VINA 1ELEE 1MCVA 1XUJA 3PWCA 2F9OA 5DP6A 3DSOA 3SO3A 1NBME 2PKAA 3M3TA 2QF0A 2BLQA 1SMFE 1UK4A 3RM0H 1K1IA 1TNHA 1E34B 3MO9A 3UIRA 3ZZ3A 1GHBF 2BTCE 5DP5A 2M2AA 1ABIH 3ITIA 4NIWA 1SLXB 2BX4A 3P6ZB 3A7XA 3TGJE 1YLCA 3HK6B 4BNRA 5A0CA 1CBWB 1GBMA 4AG1A 4MPWA 4I33A 2A5KA 1EAWA 3KYGA 2WUCA 1QY6A 1UTJA 3F2FA 5KECA 2ZZUH 3LT3A 2H1UA 2RG3A 1XVOA 1SGFG 3EQ0H 1DITH 3BTME 1H4WA 5B6OA 5I46H 2EQNA 3PMAB 5K7RA 1P10A 2K8IA 3UFAA 3ENSB 1AHTH 4MPXA 2B5TB 2AIQA 4D7GA 1C1OA 2SGFE 3S7KB 3SUEA 3LJJA 4K1SA 2K0QA 1JXPA 2C8XB 1CBWC 1TMTH 4CRBA 3QWCH 3BG8A 4XOJA 1GI4A 1V2WT 4INLA 4JYVH 3LGTA 1KXFA 1A4WH 4WJG2 1TQ7B 3AW1A 2J9NA 4YTAA 1TRMA 1SLWB 2ESTE 4JK5A 1AZ8A 1TA6A 1O3HA 3U1IB 1NRNH 2TGPZ 4FUGA 1MKWH 1EFRD 1TIOA 1ANEA 5EPNA 3UNSA 4BXWA 1AVGH 1P02A 2W5EA 3QO6A 4NCYA 1OPHB 1O38A 3SU4A 2B7DH 2ZFPH 1A5GH 5C2ZA 1P8VC 3M61U 2Z7FE 1JRSA 1E1QD 1TQ0B 2BY5X 1FN6A 1XVMA 3AASA 4ZKSU 4THNH 2IPHA 3PMBB 1O3CA 1S83A 3SYJA 2J92A 2Q1JA 2AHME 4Y11E 1P2JA 2J38A 3F3BA 3H7OA 2JETB 2PWXA 2Z9LA 3RMOH 4GSOA 3GYMA 5GCHG 2ZKSA 1O5CB 3N7OA 4X6NA 4XD7D 2AMQA 1SGNE 3K9XB 1ABJH 1YLDA 1ZGIA 1FDPA 2KZ4A 2ZFRH 1MKXK 2AERH 4JYTA 2D1JA 1DFPA 1NC6A 2A4GA 2ZDAH 4UD9H 5ESBA 3SNAA 3VEQB 1BMFD 4IN2A 4WWYA 3LKWA 1FV9A 3TJVA 3UUZA 2ZQ2A 1ANBA 4UEHH 1NU9A 6LPRA 1P11E 1DANH 2B8OH 1O2VA 2SGPE 4RT1A 4KGAA 3ZVGA 1C5WB 3EDXB 2ZFTA 1D3PB 3U98H 2FYRA 2TGDA 2Z9GA 4I7YH 2BY7X 3BTDE 3FP6E 2BY8X 1FIZA 3NZIA 1SOZA 1MAYA 2R2WU 2WSSD 1NRSH 3A8AA 2BLVA 4X1QU 2GJGA 4X2YA 3A7YA 1EZSC 2RDLA 4CRFA 1T8NA 3MH5A 1GI5A 1O2ZA 1DWCH 1L4DA 2BVSH 3TH4H 4ZXXH 1SQTA 3WWBA 4CR5A 1ZZZA 2AMDA 1O2JA 4ZAEA 1BDAA 3UOPA 1OX1A 2ZEBA 1QA7A 3KCGH 4AYVB 3ESTA 4B71A 1PQ5A 2QXHA 2XRCA 1WQVH 3KNXA 3OX7U 4ZXYH 1GHBG 3NKKA 3LGYA 1VITF 2A2XH 4A5TS 5C5NA 4UFFH 2WPMS 2BX3A 4Q80A 2ZO3H 3RXEA 5IDKA 2BQ7B 4ISOA 2FPZA 4FUIA 4BAOB 1ZPBA 2PUQH 1H8IH 1NPMA 2FTLE 1BRUP 1C1QA 3ATWA 3KHVA 1PPGE 1LKBA 2BY6X 2FDAA 3ZVBA 1D3QB 2ZHEH 2GZ7A 1XM1A 4BTTB 4CHAB 3MTYA 1LHFH 4FUCA 1DUAA 3KQ5A 1Y3XA 1A61H 2FLRH 1ETSH 1PFXC 3VB4A 1NO9H 3H7TA 1EP6A 1AZZA 1NY22 1C5NH 1W8BH 3LGUA 4MQAA 1O5FH 1OP0A 3EA9A 1MQ6A 2ANMH 4Y0ZE 3U8TH 2B0FA 3WY8A 1QBVH 4J2YB 3Q00A 3D62A 5GDSH 4ZHAA 1LPKB 3SGBE 4QT8C 3DCLA 3A7ZA 1EAUA 1F0UA 3BN9A 3H5CB 1YY3A 3W95A 1IHSH 4XRNA 4MDSA 4HGCA 3BF6H 3UOUA 1ZTLA 3DA9B 1J17T 1BHXB 6GCHF 1FPHH 5FCKA 2OLGA 3GCTF 2TGTA 3GCOA 5GNDA 1O2IA 2XNDD 3ZZ7A 2SGEE 1ELTA 2EC9H 1V2MT 1AUTC 1OWHA 2ULLA 2XWBI 1HJAB 1DUEA 2Y5HA 3DSPA 2P94A 1ELVA 3PB1E 3BTFE 1OWKA 1S0QA 1B0FA 2VNTA 4FUFA 1P2MA 3M3VA 3UB0A 3VPKA 1W2KH 3BTTE 3A80A 3CNRA 2W3KA 2PLXA 1YCPM 2KM0A 2FOHA 3FKSD 2ALVA 1TGNA 1FY4A 2R0LA 3KQCA 3A85A 3UQVA 1EB2A 1L1JA 3URCA 3GY5A 2OC0A 1TLDA 2F91A 1O2TA 4UFDH 1FI8A 5GIBA 3A83A 1TX7A 1SGRE 1HJAC 1DM4B 1SB1H 4M9FA 4Q7YA 1K28D 4XBDA 2UUJB 3LC5A 1GJCB 5HXFA 4OGXA 3BTEE 3ZV9A 2FOCA 1G37A 5E2OA 2H9EH 1H9HE 4MVNA 1CU1A 3TK6A 2GZ8A 3OTPA 1T8MA 1QBNA 2BDYA 5EXMA 4TWWA 4E7RG 3ZVEA 1BA8B 4WH6A 1VKYA 4K1EA 2WPIS 5A0AE 2FXRA 1O2HA 2BVXH 2Z3CA 2QY0B 2G4TA 3T26A 3LGVA 2A4QA 1AIXH 1COWD 5EQSA 5DN6D 3V0XA 3ELAH 1WTGH 1RD3B 1O33A 1ARBA 4A1TA 1GMCF 3EE7A 5HIZA 3FP7E 3M5OA 5DJ7A 1O32A 2H6MA 1O2XA 2WPLS 1FJSA 2ZDLA 4H42U 3PMHB 3K6YA 1ACBE 5EJLA 3GOVB 4JYUH 2VU8E 3PLKA 1QL9A 3PYHA 1VITG 3RXKA 3BTHE 1F0TA 4DJZB 3RXIA 1YPLH 3A81A 5FX6A 5A2MH 3M3SA 4DG4A 4X6PA 1TRYA 2EY4C 2WPDD 3ZIAD 1MAXA 1ZR0A 1BTYA 1NFXA 1M9UA 3KN2A 3MU4A 3RC6A 1DS2E 1D6WA 1NFWA 1KXAA 4YO9A 1ZTKA 1VR1H 1MTWA 2ZFFH 3GDUA 5A8YA 1BRCE 4B75A 5ABWA 2P93A 3RXVA 2ZU3A 1WSSH 2CN0H 2P3TB 1EPTB 4TPIZ 4KTUA 4KTSA 5F8XA 5EU8A 8GCHF 4NA7A 1GCDA 2OUAA 1SL3A 2A7JA 4ZHMU 3TNTA 2GCTB 1K1PA 1QQ4A 3A7TA 3KQBA 6GCHG 1W0JD 2WV9A 1KLIH 3TJNA 1SLVB 3GCTG 3SQHE 1GHXH 1MTUA 2ZDVH 2ZCLP 4OS5A 2YMSD 1SVPA 3VFEA 4O3TA 1AWHB 4YXWD 5HM2A 1GI3A 1Z8RA 1HJ9A 1LVMA 1N1LA 1IHTH 1IQGA 1F5LA 4XBBA 1O5AB 1XXDA 2ALPA 1O3DA 2ZDMA 3UNRA 1EOLA 1GBDA 3ZZDA 1GBIA 1LO6A 2ZA5A 3ZZ6A 2K1QA 4Y71A 3WW7A 1V2KT 2XBXA 5A0BA 3Q77A 4GHQA 2GCTC 3RC4A 1O2RA 3LOXA 1JMOH 1Z1JA 2VB0A 1HGTH 2XXLA 3P8GA 3MQKC 4JZEH 3TJOA 5CHAB 4OS1A 4D76A 1SLUB 1LKAA 4X2XA 1C5ZB 2SGDE 3SI3H 3VB5A 2W7UA 3SJOA 7KMEH 3SU3A 1UTMA 4RN6A 1EPTA 3FAOA 1O3KA 1UVPA 2YMSB 2KFWA 1UTLM 1H8DH 1XUIA 4FUEA 1D4PB 4AORA 3JZ1B 2F9VA 2VIWA 1EZQA 4FUDA 4LZ4B 1WUNH 1UCYH 3BG4B 3BEUA 4ZH8A 4IW4E 4ZUHA 2A32A 2GGVB 2WPKS 5CHAC 2WZQA 3QX5H 1X7AC 1GL1A 4IMZA 4SGBE 5TJXA 3MO3A 3A82A 1FY8E 3K6ZA 4HFPB 1ZMLA 3QGJA 5DG6A 3SJ8A 1ESTA 2BXTH 3AVZA 1N8OB 1AO5A 4YESB 5JYIA 1QA0A 3BTGE 1S6HA 2WPHS 4ABFA 5FBIA 1LVBA 1V2QT 5KEDA 2W7SA 2VWMA 1KTTB 5IK2D 1ZSKA 4YZUA 3RU4D 2XBVA 3TJUA 4Y8YA 1GJ4H 1LVYA 2DUCA 1O2WA 2FO9A 4M7GA 2TPIZ 4GCHF 2NU4E 3SHAH 1N8OC 1V2OT 1Z8GA 1A0JA 1WXRA 1CHGA 2FP7B 2F9BH 4B6FA 1U6QA 5T6GA 4DIHH 4I8KA 3MU8A 3R0FA 2BD2A 3F9FA 2XW9A 2J4IA 3F1SB 1QL8A 1QR3E 5EPYA 1INCA 3DHKH 2P16A 3SU6A 1O3IA 2ZGCA 1ESBA 3SGQE 3UR9A 4E06H 3QN7A 3Q3YA 2W6JD 1T32A 4UE7H 1B0EA 1AMHA 1DXPA 1GI8B 1EUFA 3AW0A 5H4IB 1SGDE 1AWFH 3ZZ9A 4YT7H 2F9PA 4HI3A 1HLTH 2OBOA 3PLBA 2ZI2H 4OS6A 1RTLA 3TU7H 3OYPA 5PTPA 2VGCB 1YBWA 1WQSA 1QBOA 5F8TA 1TMBH 3KYFA 1DWEH 1Y3VA 1E0FD 4AFUA 4H6SB 5EGMA 4YT6H 3V3MA 1A2CH 3SNEA 2OQ5A 3ZZCA 1KXEA 1QL7A 3SZEA 1MMJN 1V2VT 3PTNA 1NU7B 2VVVA 1ZMJA 4NG9H 3NRLA 4WMDA 2FI4E 1LDTT 5EXNA 3S9AA 2BY9X 1HAIH 2GT8A 1A3BH 2ASUB 2VGCC 2XC4A 3RC5A 1YWUA 4CBNA 3FFGA 5JDUB 1O31A 1ZSJA 1O2YA 3VXFH 1GVZA 3TPIZ 2P95A 5DP8A 4ZKOU 4PROA 1XUGA 2ZNKH 1TRNA 1E37B 1KDQB 1TABE 3PM3A 4VGCC 2PKSB 5HM9A 1QNJA 2CK3D 3I78A 2D8WA 1FMGA 5TCAA 1SGYE 4AFSA 1QRXA 4ASUD 2GMTB 1EATA 2V35A 2BOHB 4B6EA 3LONA 3D65E 3M36A 3A7WA 2Z9IA 4B2CA 1J8AA 2ANYA 3E8LA 2AH4X 4F48B 1AKSA 1G3DA 2RDEA 4WXVA 4D8NA 5T1VA 1SFIA 4AGJA 3RLWH 2PKSC 4CH8B 1T4UH 1THSH 2TRMA 1YF4A 4KP0A 1BRAA 1LVOA 1K1MA 2GMTC 1GI7B 4U01A 2BD5A 2FI5E 1HPGA 1S84A 1XXFA 4ACBA 4JZDH 4AB9A 3GISB 2BD7A 3SNCA 1OYQA 4FU7A 3A8CA 5DP4A 4A1VA 2ZU2A 4Q63A 1O3NA 2FOAA 1MUEB 2VIVA 2A5AA 2HRVA 2OC7A 1UVSH 4MNWA 4ZKRU 1W3CA 1BHXF 1QJ7B 1V2NT 1V2LT 2ZHWH 1GBEA 2I6SA 2SGQE 2ZTZA 4WVPE 4UFEH 5L2YH 3F6UH 4GCHG 4BXSA 3VG8A 5LPFA 5JBAS 1FY1A 2G51A 1V3XA 3T27A 1MTSA 1QRWA 3TVJB 1PYTD 3MHWU 3PRDA 4D9QA 2UWPA 4ZCNA 5T6DA 3MO6A 1GMDF 2AFQB 3MNSA 2HLCA 2W6ID 5HIYA 3OEHD 1FAXA 2GP9B 4E05H 3K2UA 2ZPQA 2V3HH 4GUXA 3M7UA 1O5GH 3D49H 2QAAA 1ETRH 5F53A 1D3TB 3U1JB 1C2MA 2PTNA 3CS7A 1QCPA 4FVBA 1Y8TA 1TNGA 2LNCA 3EAJA 3TH3H 1C2LA 2ZIQH 5FL7D 2ZDNA 9ESTA 2CF9H 4YLUA 4NFFA 1SKYE 1YKTA 1QJ1B 1Q31A 1TX8A 1RIWB 1LPZB 3RU4T 2SNVA 5GJ4B 1A1RA 1BJUA 1UJ1A 1C2KA 3F0OA 1EZUC 4OS7A 2KAIB 1RFNA 5JBBS 4INHA 3KIDU 5FBEA 4DOQA 1Y3WA 2FOFA 3SW2B 3RXLA 2FZZA 1HDTH 2KR7A 1HUTH 1AD8H 1RGQA 1C9PA 5FHTA 1CO7E 2FX6A 3F9EA 1E36B 3OFND 1F2SE 2LP6A 4RKJB 3UWJH 2Z94A 3MNBA 1C4V2 4WF8A 1RIWC 1YM0A 1Z1IA 2W26A 3BIVH 5EG4A 3UTUH 1FZZA 3PV4A 2R3YA 4JZFH 3P8FA 1TA2A 1TE0A 2RA3A 1MH0A 3EA8A 1PYTC 3RDZA 2UUYA 4H4FA 1J9CH 5B6LA 3EA7A 5E0GA 1E79D 4FUBA 2UUFB 4JMYA 3A88A 1BUIA 3GCHB 3RXFA 4AGKA 1GBTA 2OC1A 3GS9A 1K1NA 1TPPA 4AZ2B 1SGQE 4KELA 1NBMD 1ARCA 1GJ8B 1O3GA 5FX5A 2BD3A 3T25A 4NWLA 3T28A 2A5IA 1AE8H 1JIMA 1BBRE 3NCLA 2V0BA 1TBZH 1XKBC 2Z3EA 3RMLH 3O8DA 5EJ1A 3W94A 1C5XB 5AFZH 1C5SA 2IJOB 3GCHC 1Y3UA 5AVDA 1GI9B 2J97A 3KEEA 1CVWH 1O2UA 1C1VH 1DY9A 1G2LA 1W13U 8ESTE 1XKAC 3RP2A 2ZGXH 1HYLA 1SHYA 2NU3E 4GVUA 1PPEE 2ZGHA 2GV7A 1YPHE 5FPYA 2CGAA 3V7TA 3Q76A 1UW7A 4O3UA 2BDAA 2ZC9H 2QV1A 1OXGA 4K1TA 1DWDH 1O3JA 1DSTA 2OC8A 1O2MA 1ZPCA 4TY6A 1BMMH 3A89A 1C1NA 2H9HA 4Y7BA 2HNTF 1HXEH 1O2KA 3GY4A 3QTVH 4NSVA 2GVFA 2KCAA 2Z9KA 2HVXA 2A1DB 1OYTH 5DP9A 2J94A 4HG6A 3FO8D 1PPFE 2AMPA 4HZHA 3SU1A 2J5UA 4NFEA 1WCZA 2IOTA 4WMEA 1BIOA 1ZPZA 2VJ1A 3TLOA 1LMWB 2VWNA 5EW1H 3O8CA 3V13A 2BDIA 1SC8U 3A8DA 3N99A 5T6FA 1GMDG 1AVXA 4J1YA 1NROH 4ASHA 4BOHA 4AN7A 2G5NA 1TWXB 1UVTH 2FLBH 3SU2A 4LK4A 1HAOH 5J4SA 3DFJA 1NTPA 4U30A 5KGOA 1JRTA 1KLTA 1GBJA 3RXDA 3FZDA 3OU0A 3M7QA 5HGGA 4A6LA 2ZPRA 2XYAA 1BTPA 4ISHH 1GL0E 1MCTA 2LPRA 1OHHD 1IAUA 1Z8IB 2ILNA 1HAPH 3M5LA 5JB9S 2Q6FA 2YOLA 4GAWA 1QZ8A 1SOTA 1BBRK 1KXCA 1J15A 4I31A 3MU0A 3ZYDA 4P02A 4LZ1H 1P2QA 2QE7D 3PMJA 2HVYB 5FXLA 1EJNA 1GDNA 2ODYB 3OSYA 1V6DA 4YLQH 2ZPSA 1DX5M 2FOGA 5C0TA 4JZ1A 1O3MA 5DGJA 5I25A 2GDEH 3QLPH 2BZ6H 1LHCH 1ELCA 5J4QA 2QF3A 1D3DB 3AK5A 4NZQA 4K8BA 1AFEH 2CXVA 1S82A 4K8YA 1K1JA 1K2I1 4BAMB 2XC5A 5F6MA 3FVFB 4BAHB 1Z6EA 5L30H 1UTPA 4I32A 1ESAA 3STJA 1GI6A 4ZKNU 3ZZ5A 1IQJA 2FYQA 3P70B 2GX4A 1MKXH 1H1BA 3O8BA 1RS0A 3SI4H 3E90B 1VZQH 4X6OA 3LGIA 3L33A 1EZXC 4ZHLU 4RKOB 2DE8A 1BTHH 3F2GA 1V2PT 1OOKB 3UREA 4DT7B 1GG6B 2ANKH 3CP7A 4F4OC 3T29A 2SFAA 3UNQA 1SGIB 4ISIH 5GXPA 3QTOH 2V3OH 2UWLA 3ZZ4A 4DGJA 1ZHRA 2VIPA 3DSGA 4MPVA 2FS9A 2GDDA 1IQLA 1MBMA 2BD8A 4TPYA 1MZAA 3HGPA 5C5OA 1A5HA 4Y79A 2F3CE 4CBOA 1C4Y2 3RXGA 1DT2A 3R3GB 1C5MD 2FMJA 5BRRE 1E38B 2JIZD 1TYNA 2QF4A 1GG6C 1CT4E 3E91A 1C2EA 1J14A 1CSOE 2Y7XA 1ELGA 5JPMH 3GY8A 3B8JA 1HFDA 7GCHF 2J98B 2A4OA 2V7QD 1C2FA 2J95A 2O8LA 3SBKA 1RJXB 1NN6A 1CT2E 4CRAA 6CHAB 3TGIE 4ISLA 1S81A 1UK3A 2J34A 2BQWB 1G36A 2BOKA 1FN8A 3RXJA 1C1TA 3BTWE 3P92A 1YCPK 3HATH 2ODPA 2RFKC 1ELBA 1D6RA 4AOQA 4ZMAH 2O8WA 1G3EA 3GICB 3GDVA 1HIAB 5DPAA 1HAXB 1KMHB 3SORA 2FOEA 1MQ5A 4FOUC 4KKDA 1THRH 3MWIU 3URDA 1EASA 3FP8E 2ZHDA 5FCRA 6CHAC 3BEFB 3OE7D 1W0ZU 1PPCE 3MU1A 2EI7A 5DP7A 2FS8A 1LPGB 1MBQA 4X8UH 1O5BB 1QB6A 2EI6A 1GGDB 3NXPA 1O2LA 5C0UA 2WHXA 1L2EA 1GWAA 1SQOA 1DE7H 4WMFA 2CF8H 4Y6DA 1P2IA 3TGKE 3L3TA 1YPHC 3JZ2B 4IN1A 4NSYA 1S6FA 7ESTE 2B9LA 2L6OA 2ZDKA 2PHBA 1FXYA 1FIWA 5CHBA 1HAZB 3QZRA 4HTCH 3MFJA 4YOJA 1K22H 3MMGA 1FNIA 3HKIB 1HAYB 2XC0A 4ABDA 1P06A 2JDID 1OP2A 1GGDC 2OK5A 3Q3XA 3WWFA 1GI0A 3F9GA 3S69A 4ACAA 2FOBA 1C1PA 1C5PA 2G55A 5DK1A 1SGEE 1SPJA 1PQ8A 2F83A 1UTQA 1WYKA 1FAKH 3LU9B 1LQDB 2OTVA 1EB1H 2GKVE 1O39A 1BMLA 1H9LB 1MABB 4TWYA 2W3IA 3ATIA 2G00A 1NRPH 2QXIA 2H2ZA 1FUJA 1HAVB 2C8ZB 1AFQB 4I8LA 3NWUA 1E35B 1QIXB 1C5VA 1AUJA 1EXFA 1NFYA 4JZIA 1VCQA 4SGAE 1O30A 3ATKA 1F0SA 2BM2A 3ZZBA 2ZGJA 1UVOA 1SSXA 3SN8A 5EQRA 5DKMA 3TH2H 4AC9A 1AFQC 2XCFA 1HAGE 2RCEA 3U28C 2YNAA 1ZMNA 2R0KA 1QURH 1SFQB 3MI4A 4NA8A 5CE1A 1MZDA 2Y7ZA 4TT3D 1BZXE 2OQUA 2IN2A 1F92A 5FPSA 3RXPA 1N6XA 3ZVAA 1UO6A 1C5YB 1DOJA 1HJ8A 1ETTH 4UONA 2G52A 2FI3E 5SGAE 5BPEA 7GCHG 2J2UA 1O3EA 4Q2KA 1C5TA 4D9RA 2PR3A 2IJD1 2PFEA 1MKWK 1KXDA 2ZWLH 1O2NA 1TGBA 1DXWA 2QIQA 5GWZA 1ZJKA 1QGFA 2F9NA 1BOQA 1GVKB 5A8ZA 1O3AA 2JJ1D 1W0KD 1Y5BT 1SGTA 3A7VA 2QGRA 2XOKD 1C1MA 2BD4A
chains in the Genus database with same CATH topology
1HRTH 2ZU1A 2Z3DA 1TB6H 2ZTYA 2FODA 1G3BA 1P01A 1G32B 1P9UA 4I8GA 1C1SA 3RXCA 5GPIB 1P3EA 1GJDB 1L4ZA 4AFQA 1ZGVA 5E0HA 2HPQH 2NU1E 4YM9A 4VGCB 1W11U 1DICA 1P12E 1O3OA 1PJPA 3S9BA 1YC0A 1TGCA 3ZZAA 8KME2 3HKJB 3S7HB 1YPEH 1G30B 2C90B 5JB8S 1GJ7B 3GDSA 2ZHQH 1QQUA 4K5ZA 4ABAA 1C2JA 2BLOA 3KF2A 2PKAB 3T2NA 2HWLB 1ANDA 1ELAA 4X8VH 4AB8A 2SGAA 3RUOA 4YOGA 1IQIA 4B2BA 2A45B 1G2MA 2O8UA 3BTKE 3SNBA 1EQ9A 3OY6U 4AFZA 2ODQA 1F5KU 2A0QB 2UUKB 1CA0B 1V2ST 2ZU4A 3C1KA 1GBCA 1TPSA 1O37A 1OSSA 3RXQA 1LQEA 1Z7KA 2Z6BD 1EJMA 1S0RA 2STBE 2TGAA 1TNJA 1VJAU 1KSNA 2F9UA 4MLFB 1CHOF 1UHBB 1Z71A 1ID5H 2CMYA 3RMNH 1Y5AT 4NWKA 5LPEA 3SV8A 3HPTB 5C67A 3BIUH 4NIVA 1BB0B 1CA0C 2AYWA 2VIQA 3PROA 4YOIA 3QZQA 1HAHH 3UY9A 2QC2A 4XDEA 3GY7A 2Q6DA 9LPRA 3MNXA 1IQKA 1O35A 2HGTH 2YNBA 1UMAH 1TX6A 3A86A 4Q7XA 1FLEE 3SJKA 4D7FA 2VIOA 4O97A 1TNIA 1SGPE 1EP5A 1O36A 2FIRH 1TPAE 3DD2H 1GBFA 4AX9H 1C5LH 1BTZA 1YGCH 2NU0E 3A84A 1C5RA 1KDQA 2WYJA 3MU5A 3MYWA 1OKXA 1Z6JH 2P8OB 4LXBH 4GPGA 1SHHB 1Z8JB 1AE5A 5G4BA 2G5VA 4R8TB 3IWMA 1QB9A 3Q3KA 1LHEH 1F7ZA 1GJBB 1O3LA 1TALA 1UHBA 2FESH 4H6TA 4TY7A 1S85A 3QDZB 2G81E 5ESTE 4Z6AH 3VXEH 2ANWA 1QB1A 3GY3A 2P3FH 4ABHA 4NA9H 1L1GA 2ZQ1A 4XE4A 5FAHA 3K65B 2P8OC 1L0ZA 1XUFA 2G8TA 7LPRA 4CH2B 3E6PH 1C5OH 4DURA 2VVCA 3I77A 5AHGH 4ABJA 2XBWA 1QRZA 3E3TA 5ETXA 2BVRH 3RXOA 3T5FH 5E8EH 1BITA 2EI8A 4XFQA 2PGQB 2BMGB 3MOCA 1KTSB 3CS0A 2PUXB 2GTBA 8LPRA 3TIUA 1GBAA 1OWJA 1CT0E 3LDXH 1J16A 2ZF0H 1UTNA 2ZECA 1JBUH 4B73A 2O9QA 4O9VA 2WV5A 3VB7A 1Y59T 2GT7A 2Y5GA 3BSQA 3ZYEA 1B7XB 5JBCS 2C8YB 1G9IE 1PQAA 3GY6A 2SNWA 3ZVFA 1T31A 3SQEE 1WBGB 3DUXH 3O8RA 2AIPA 1ORFA 4X8SH 2O8TA 1DY8A 1O3BA 1CGHA 1AB9B 2BHGA 3LC3A 4X1SU 2Y6TA 1C5QA 1YP9A 3RXAA 4MG3A 1EJAA 1KYNA 2I6QA 5EOKA 2R2MB 3BTQE 1ZRBA 2TIOA 3F9HA 4X6MA 1SGFA 3SGAE 3SU0A 5A09A 3AAUA 6ESTA 4JCNA 1L1NA 5DP3A 1CHOG 2PGBB 1AB9C 1K1LA 2JETC 3TITA 2A7CA 2Y81A 2KAIA 2XNIA 1P2OA 1GMHF 1P05A 4U2WA 3BV9B 5EODA 4DCDA 3OTJE 5C1XA 3DT0H 3KQDA 3DFLA 2VIDA 2NWNA 2XCNA 1VCPA 1LTOA 2AS9A 1GHZA 3V12A 3P8NA 1BQYA 2Q6GA 3VB6A 2O8MA 2OCVB 4B1TA 3LIWA 1P57B 2QCYA 3BEIB 3ZVDA 3U9AH 1UCYE 1QFKH 3SHCH 3SUDA 1O2QA 1GBHA 1W7XH 4XBCA 4U32A 1Y5UT 1DPOA 1UTKA 2C3SA 3SUGA 1LCYA 1K9OE 2WUBA 1ZOMA 2ZP0H 2XBYA 3RXRA 3TK9A 4MNXA 3E16B 3SJ9A 1GBBA 3HGNA 1IQFA 2FM2A 2XTTB 3SV7A 1O5DH 1MTVA 2VWOA 3RXBA 1TBRH 1KIGH 3KQEA 1SG8B 3S9CA 4A92A 3ODFA 3MH7A 2HNTE 2BB4A 2H9TH 1V2RT 3F68H 4FXGH 4IC5A 4CRCA 4FU9A 1IQEA 1P09A 1VCWA 3I29A 3LH3A 3B9FH 1AU8A 1P2NA 1XUKA 1S5SA 2ZU5A 3OY5U 3FANA 1MD7A 2HPPH 3NK8A 4FUJA 3GCNA 4B2AA 3EGKH 2PSXA 2ZTXA 3P8OA 5TCCA 2AEIH 2QA9E 4CHAC 1F0RA 4IC6A 4A1XA 1XX9A 2WPJS 4WXIA 2HALA 4WY3A 5EXLA 4Y0YE 2EA3A 1QJ6B 1A5IA 3M5NA 4X0WU 5HMAA 4X2WA 1D9IA 1OWIA 4GLYA 4ABGA 1Q3XA 2Y82A 2R9PA 4Q7ZA 1NRQH 2WYGA 4DY7B 1QHRB 4A7IB 2CHAB 2FOMB 3TNSA 3GY2A 1O2GH 1Y3YA 1NRRH 1SGCA 1GPZA 1T4VH 3FZZA 4KTCA 3A87A 2OINA 5LPRA 4BTIB 1XUHA 2D26C 1CGIE 1AI8H 1CA8B 1O34A 4UFGH 1FY3A 4MTBA 1TMUH 2GZ9A 1UCYK 1A3EH 1BMAA 1C2IA 1FONA 1UVUH 3D23A 1GHVH 4FUHA 5E2PA 2H5CA 1MTNB 2PW8H 5AFYH 1DSUA 2HOBA 4WH8A 1EAIA 2CHAC 3HK3B 5L6NH 1UTOA 2ZG0H 2ZCHP 1C1RA 3EYDA 4FVDA 4Y8XA 3RXUA 1TNLA 1KY9A 2R3UA 1F5RA 2C4FH 2ZFQH 2D2DA 1P2KA 2A7HA 1AN1E 1OS8A 1XMNB 1GJAB 3S0NA 1V2UT 3MNCA 4Y7AA 1VGCB 1IQNA 1A0HB 1MU8B 2GD4B 4NIXA 4FU8A 5C20A 1MTNC 1RRKA 1C9TA 1CE5A 1GMHG 3E1XB 3GYLB 1NFUA 4UDWH 4K2YA 3G01A 1FY5A 2GCHF 3RXMA 2FWWA 5F8ZA 3RXHA 1TOMH 1HV7A 1OP8A 1IQMA 2VWLA 3SNDA 1LHDH 2PV9B 1CQQA 1VGCC 2ZCKP 1PPHE 4Y10E 1BT7A 2UWOA 1RTKA 4Y76A 1K21H 3P95A 1TFXA 4GHTA 1B5GH 1ZHMA 4X1RU 4X1NU 3LJOA 3RU4E 5FPTA 5C1YA 1G3CA 1P3CA 3SU5A 3VB3A 1ANCA 4CRDA 4X8TH 1PQ7A 1YPJH 3NPSA 4IS5A 1WTHD 3SV6A 5EW2H 3PO1B 1IQHA 3E0PB 1HCGA 4ABIA 1EOJA 1ELFA 2A4RA 1A0LA 1JWTA 1T8LA 4F49A 1WAYB 1GJ9B 3IG6B 1W7GH 1O0DH 5JBTA 4JK6A 4OGYA 3SV9A 1DVAH 3UPEA 1O3PB 1AGJA 3T62A 1BCUH 1GI1A 2P3UB 1ZHPA 4Y8ZA 4XSKU 2Z9JA 3MH4A 1BTWA 2BZAA 3PO1C 1BMNH 3QK1A 1TBQH 1NS3A 1V2TT 1FPCH 5DO4H 1P9SA 1JOUB 1SBWA 4R0IA 1C4U2 1A46H 1BTXA 1H9IE 2PSYA 2TBSA 1GHAF 1YPMH 2A2QH 4INKA 1PPBH 1TNKA 5E0JA 4ZROA 2VH0A 2GV6A 4CREA 1HBTH 3E0NB 4BANB 1ZSLA 3C27B 4TYDA 2OD3B 2OXSA 1TAWA 4MPUA 5T3HA 3M5MA 4RSPA 1AY6H 1BTUA 1GDQA 1TGTA 3ODDA 1TONA 1ZRKA 1DDJA 1DLKB 2JH6D 3U69H 1EPTC 1W14U 2Y80A 1HIAA 4NZLA 1THPB 5F03A 3RMMH 1RXPA 1W12U 2ZHFH 1ZLRA 1EX3A 1W0YH 3UQOA 4B74A 1GVLA 1GBLA 1SQAA 1WU1A 1WOFA 2BYAX 1EAXA 5HYOA 2JKHA 1BBRH 1KXBA 2HNTC 5CMXH 1GJ5H 1UK2A 2C8WB 2CJIA 4IBLH 3SJIA 2BD9A 3CENA 2AGGX 1C2DA 1HXFH 3L6PA 3SOSA 2BXUH 5C1UA 2FEQH 1KLJH 1ZTJA 4I8JA 1C1WH 3QUMP 1C1UH 1P04A 4NIYA 2BDCA 3UWIA 4OS2A 1LHGH 1TPOA 4ISNA 3QGNB 2BDGA 1C5UA 1DWBH 3KGPA 3UR6A 2NU2E 3U8OH 4O03A 1ZJDA 3B23B 1PPZA 1P03A 1YYY1 3LH1A 2XWAA 1MD8A 1VITH 1DLEA 1WV7H 1YPGH 1C2GA 2V6NA 3ZV8A 1TGSZ 2QXJA 2QN5T 1GHYH 2GCHG 2OBQA 3TK5A 3M7TA 4B76A 3SZNA 4DIIH 1T7CA 1NT1A 1SI5H 2P59A 5C3NA 1GMCG 1YPKH 1ZYOA 3KL6A 3BG4C 1T8OA 2FX4A 3MH6A 4CR9A 2QXGA 4MNYA 4I8HA 3U8RH 5AF9H 2AGIX 2BDBA 1AVWA 4X2VA 4LOYH 4MNVA 1O5EH 1A7SA 3RM2H 2ZGBH 1JIRA 1HAVA 1SR5C 3VGCB 1GDUA 2BDHA 4ABEA 2EEKA 1QTFA 4ESTE 3PWBA 1BRBE 2VH6A 1P0SH 1AQ7A 1NM6A 1BJVA 4X1PU 1GBKA 1GJ6A 3PTBA 4BAKB 3ZZ8A 1OWDA 2QYIA 2THFB 2G4UA 3IITA 5A8XA 5EQQA 4CRGA 1O2PA 1W10U 2STAE 1GI2A 2H5DA 1VJ9U 2CV3A 2WINI 2A31A 3VGCC 1NZQH 3A8BA 4E7NA 3LGWA 1GHWH 2OP9A 2ZFSA 3LPRA 1YCPH 1O2OA 2Y5FA 3PLPA 1IOEA 1ELDE 5LH8A 3SV2H 2JH0D 3AAVA 1GHAG 2DE9A 1V2JT 8GCHG 3SUFA 1C2HA 3ZVCA 2PTCE 3M35A 1CGJE 1NESE 2JH5D 1AKSB 4IMQA 4K60A 4OS4A 4Z0KA 5GCHF 1N6YA 2C93B 1GCTB 3RXTA 1K1OA 2FTMA 4K3JA 3ATLA 2RA0A 1HB0B 1Q2WA 2BLWA 1RTFB 2WV4A 5IYTA 3RXSA 1HNEE 4K69A 4NGAH 1O2SA 3ATMA 3EE0B 4BTUB 3STIA 4DW2U 4AYYB 5K0HA 2VVUA 1FQ3A 1OWEA 3M37A 4BAQB 1GCTC 4AG2A 2AGEX 2BQ6B 5L2ZH 1TOCB 5LGOA 4DVAU 3NUMA 4IGDA 1EKBB 1MU6B 1O3FA 3P17H 3RLYH 2M5TA 4ABBA 2VINA 1ELEE 1MCVA 1XUJA 3PWCA 2F9OA 5DP6A 3SO3A 2PKAA 3M3TA 2QF0A 2BLQA 1SMFE 1UK4A 3RM0H 1K1IA 1TNHA 1E34B 3MO9A 3UIRA 3ZZ3A 1GHBF 2BTCE 5DP5A 1ABIH 3ITIA 4NIWA 1SLXB 2BX4A 3P6ZB 3A7XA 3TGJE 1YLCA 3HK6B 4BNRA 5A0CA 1CBWB 1GBMA 4AG1A 4MPWA 4I33A 2A5KA 1EAWA 2WUCA 1QY6A 1UTJA 2ZZUH 3LT3A 2H1UA 2RG3A 1XVOA 1SGFG 3EQ0H 1DITH 3BTME 1H4WA 5B6OA 5I46H 3PMAB 5K7RA 1P10A 3UFAA 3ENSB 1AHTH 4MPXA 2B5TB 2AIQA 4D7GA 1C1OA 2SGFE 3S7KB 3SUEA 3LJJA 4K1SA 1JXPA 2C8XB 1CBWC 1TMTH 4CRBA 3QWCH 3BG8A 4XOJA 1GI4A 1V2WT 4INLA 4JYVH 3LGTA 1KXFA 1A4WH 4WJG2 1TQ7B 3AW1A 2J9NA 4YTAA 1TRMA 1SLWB 2ESTE 4JK5A 1AZ8A 1TA6A 1O3HA 3U1IB 1NRNH 2TGPZ 4FUGA 1MKWH 1TIOA 5EPNA 1ANEA 3UNSA 4BXWA 1AVGH 1P02A 2W5EA 3QO6A 4NCYA 1OPHB 1O38A 3SU4A 2B7DH 2ZFPH 1A5GH 5C2ZA 1P8VC 3M61U 2Z7FE 1JRSA 1TQ0B 2BY5X 1FN6A 1XVMA 3AASA 4ZKSU 4THNH 2IPHA 3PMBB 1O3CA 1S83A 2J92A 2Q1JA 4Y11E 1P2JA 2J38A 3H7OA 2JETB 2PWXA 2Z9LA 3RMOH 4GSOA 3GYMA 5GCHG 2ZKSA 1O5CB 3N7OA 4X6NA 2AMQA 1SGNE 3K9XB 1ABJH 1YLDA 1ZGIA 1FDPA 2ZFRH 1MKXK 2AERH 4JYTA 2D1JA 1DFPA 1NC6A 2A4GA 2ZDAH 4UD9H 5ESBA 3SNAA 3VEQB 4IN2A 4WWYA 3LKWA 1FV9A 3TJVA 3UUZA 2ZQ2A 1ANBA 4UEHH 1NU9A 6LPRA 1P11E 1DANH 2B8OH 1O2VA 2SGPE 4KGAA 3ZVGA 1C5WB 3EDXB 2ZFTA 1D3PB 3U98H 2FYRA 2TGDA 2Z9GA 4I7YH 2BY7X 3BTDE 3FP6E 2BY8X 1FIZA 3NZIA 1SOZA 1MAYA 2R2WU 1NRSH 3A8AA 2BLVA 4X1QU 4X2YA 3A7YA 1EZSC 2RDLA 4CRFA 1T8NA 3MH5A 1GI5A 1O2ZA 1DWCH 1L4DA 2BVSH 3TH4H 4ZXXH 1SQTA 4CR5A 1ZZZA 2AMDA 1O2JA 4ZAEA 1BDAA 3UOPA 1OX1A 2ZEBA 1QA7A 3KCGH 4AYVB 3ESTA 4B71A 1PQ5A 2QXHA 2XRCA 1WQVH 3KNXA 3OX7U 4ZXYH 1GHBG 3NKKA 3LGYA 1VITF 2A2XH 4A5TS 5C5NA 4UFFH 2WPMS 2BX3A 4Q80A 2ZO3H 3RXEA 5IDKA 2BQ7B 4ISOA 2FPZA 4FUIA 4BAOB 1ZPBA 2PUQH 1H8IH 1NPMA 2FTLE 1BRUP 1C1QA 3ATWA 3KHVA 1PPGE 1LKBA 2BY6X 2FDAA 3ZVBA 1D3QB 2ZHEH 2GZ7A 1XM1A 4BTTB 4CHAB 3MTYA 1LHFH 4FUCA 1DUAA 1Y3XA 1A61H 2FLRH 1ETSH 1PFXC 3VB4A 1NO9H 3H7TA 1EP6A 1AZZA 1NY22 1C5NH 1W8BH 3LGUA 4MQAA 1O5FH 1OP0A 3EA9A 1MQ6A 2ANMH 4Y0ZE 3U8TH 2B0FA 3WY8A 1QBVH 4J2YB 3Q00A 3D62A 5GDSH 4ZHAA