3D65E

Crystal structure of textilinin-1, a kunitz-type serine protease inhibitor from the australian common brown snake venom, in complex with trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Textilinin
publication title Crystal structure of Textilinin-1, a Kunitz-type serine protease inhibitor from the Australian Common Brown snake venom, in complex with trypsin
rcsb
source organism Pseudonaja textilis textilis
molecule tags Hydrolase inhibitor/hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d65E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3d65E02
1ZMNA 1C5MD 3MO3A 2FTMA 1BBRH 1QRWA 3ATWA 1OSSA 1SGTA 2R0KA 4AG2A 1BTWA 3M37A 1G3DA 2P3FH 4WH6A 2P95A 1ELFA 3VXEH 3GISB 1C5WB 1HBTH 3ZVEA 3HKJB 3BTKE 1Q3XA 3NXPA 1DDJA 4AGJA 1C5YB 3SGQE 2JETB 4Z0KA 1LHCH 4X2YA 1M9UA 1NO9H 2PKAA 1UCYK 1C1OA 2OQ5A 4X1PU 1EQ9A 4FVDA 1V2MT 2GGVB 4Y71A 1ZMLA 1O2GH 5EW1H 1NS3A 1KXDA 1NT1A 3BTWE 1GJCB 2BD4A 1HNEE 4ZKSU 1A46H 1IAUA 1TPPA 1XUJA 2ZKSA 2VWOA 1GG6B 1XKBC 3SJ9A 3NK8A 3RXLA 3RP2A 2AFQB 1XUIA 2G55A 2R9PA 1AGJA 4ZXYH 3ELAH 1WOFA 1AB9B 3ESTA 3NUMA 2HOBA 1P06A 1ZMJA 2FODA 2QXIA 1CU1A 1A4WH 3P8FA 4TPIZ 3KQDA 2GZ8A 3GICB 5A8XA 1P02A 3IWMA 4BAMB 1DE7H 1NN6A 1S0RA 3KN2A 5F8TA 3URCA 2GX4A 3TNSA 1TNJA 4Y8YA 1BTYA 1JRTA 1JBUH 2XBWA 2ZHFH 2Q6FA 3U8OH 3M3SA 1EAUA 3ZV9A 1Q31A 1EJNA 4GLYA 1TPAE 3S7HB 2FS9A 3BTTE 3TIUA 2QYIA 4WMDA 1O2YA 2FIRH 3HPTB 4OS2A 1PQ5A 1BCUH 1VCPA 2WPMS 3E3TA 1LHFH 2VVVA 1HJAB 5L30H 3SU5A 1SQTA 1P01A 1TNHA 1J16A 1MMJN 3SNAA 2ZGJA 1RJXB 2XC0A 5DP7A 1O5CB 2ZHEH 1BTUA 1K22H 1YLCA 3SU6A 3UUZA 3MTYA 4DIIH 4MVNA 3SUFA 1O2QA 3SV9A 2Q1JA 1A0HB 4D76A 1Q2WA 2BB4A 3GDSA 5A2MH 3BG8A 2F9PA 2HPQH 5K0HA 1HFDA 2YNAA 4DT7B 1AI8H 2GVFA 1SC8U 1T32A 2OXSA 2KAIB 2SGEE 1INCA 3T62A 1BT7A 5AVDA 1ELVA 1XUFA 1PQ7A 3SNDA 1CA0C 3SUEA 2FPZA 1NFUA 2AGEX 1BZXE 1DS2E 1F92A 1GL1A 1ESTA 2OP9A 2PV9B 1TONA 3AAVA 4RSPA 3B23B 4B2AA 1SGRE 2TIOA 3MI4A 4XDEA 4NFFA 3VGCB 4OS1A 1AWHB 2BVXH 3D49H 1O2HA 1P05A 1ELAA 4ZKRU 5E0JA 5DJ7A 2SGFE 4WXIA 1K21H 1N6YA 4GPGA 4HGCA 3RU4D 3D62A 3GYMA 2OC1A 1ORFA 2QF3A 1D6WA 1VJAU 1GBAA 4GSOA 4X8SH 3T5FH 2HVXA 2GZ7A 4H6TA 3A7WA 1IQJA 2DE8A 2VWMA 3AW1A 1SBWA 4MNWA 4RN6A 4BXSA 1GBKA 2ZCKP 1FLEE 1O33A 2FDAA 4Y7BA 4AGKA 3A89A 1CHOF 2R0LA 2QA9E 2F9OA 1DWDH 3TJUA 2VNTA 4IN2A 1MUEB 5E0GA 3A7YA 1FV9A 2OBQA 3DHKH 1TBQH 2V35A 1WQVH 4UFFH 1O37A 1UK3A 2ZDVH 4JZEH 1IQGA 1DWEH 1FDPA 1GMDG 2J4IA 1Z6JH 1VCQA 1DY9A 2XRCA 3MU8A 2JKHA 2ODYB 2V3OH 1EOJA 1Z71A 2GD4B 5DKMA 1LVMA 1IQKA 1FN6A 3TH3H 4K8YA 2GTBA 5JBTA 2FOHA 1P9SA 3WY8A 1GBTA 1IOEA 4MNVA 1D3DB 4TY6A 1WSSH 5C1UA 3I78A 4CREA 3GCNA 3IITA 3MO9A 1UO6A 4JMYA 1O36A 4J2YB 5L6NH 4K60A 1GG6C 1QB9A 1GI5A 3T29A 2QGRA 3KCGH 3SJIA 4GCHG 3U69H 3W94A 3F9GA 1C5OH 1DWCH 1UTMA 2OC8A 2VIPA 2XBVA 1L2EA 4ABEA 1A7SA 2Y82A 2GT7A 1E36B 2OINA 3STIA 1E38B 1K9OE 3KEEA 3RU4T 1TALA 1UMAH 2O9QA 2W3IA 3OU0A 1NPMA 5F6MA 5L2ZH 2QAAA 4X6OA 4F49A 2ULLA 3SQEE 3EYDA 1SGQE 3U8RH 4AX9H 2ZTXA 4Y8XA 4WJG2 3EQ0H 1FUJA 1GJAB 1A61H 3RXHA 3E0PB 3RUOA 4M7GA 1EJMA 1HJAC 3SORA 3TITA 5FBEA 3G01A 1TX8A 2OCVB 3R0FA 2XXLA 1KIGH 3F1SB 3KL6A 2RA0A 3GDVA 2ZEBA 4XFQA 1T7CA 1Y3WA 1BOQA 2SGAA 2AERH 3LGIA 4YO9A 5GPIB 1DFPA 2Y7XA 1HDTH 3SHAH 4Y76A 1TAWA 2V6NA 1V6DA 5JB9S 3ZZDA 2ANKH 3MHWU 4YTAA 1V2LT 1DWBH 2GP9B 3M5OA 4QT8C 5DP8A 4ESTE 3BV9B 2ZA5A 3K65B 1BUIA 1GHBF 1SHYA 1TE0A 1YF4A 2AMDA 1SGFG 1ZYOA 1C2JA 3O8CA 1LKBA 3KF2A 4YT7H 2BDGA 4IMZA 1UVOA 3L3TA 1QRXA 4K2YA 1RIWC 1V2OT 4GVUA 5FCKA 4MLFB 1CQQA 1O2RA 2EI6A 1TX7A 3UR9A 3ZZCA 3VGCC 5DP4A 2W26A 1HAVA 3VB5A 2B5TB 4FUIA 3NKKA 1OWEA 2Y81A 2EI7A 2ZDLA 2PUQH 3GY6A 1AUTC 1HXFH 1Y3XA 2BX4A 1GHAF 2Z9KA 5F8ZA 4VGCB 5EOKA 5B6OA 3BTHE 1CT4E 2J92A 1PQ8A 3MNCA 5SGAE 1XUGA 4Q2KA 4WMFA 2BDYA 4B75A 2VIDA 5J4QA 2AMPA 3T25A 4D9QA 1IQFA 1OWJA 2H1UA 5ETXA 5EXNA 1HYLA 1AHTH 1QA7A 1YPMH 3QO6A 1Z1JA 4A92A 1C5UA 1T4VH 2UUFB 1UTJA 5FPYA 1O2WA 1HRTH 1SGNE 4ISNA 1TGTA 1ELCA 2ALVA 3Q3YA 4A1VA 1SLUB 4AB8A 2BQ7B 2ZDAH 2B7DH 2XCFA 4THNH 1GHZA 1GCDA 1F2SE 1MTSA 3BSQA 1X7AC 4A5TS 2GCTB 3RLWH 2ZU3A 5EQQA 2BD5A 1YCPK 3AAUA 1ANDA 3GCTF 2CF8H 3KIDU 2ZFQH 2TGAA 1GI4A 1SMFE 1SLWB 3P8GA 3SGBE 3A88A 2BLQA 3DFJA 3SV8A 3UIRA 4MDSA 4NIVA 2HALA 4YZUA 1GCTC 1TOMH 2BOHB 1O2NA 4K5ZA 5A09A 2D26C 3LJOA 1HIAB 4GAWA 3SNCA 1BTXA 4UD9H 1HXEH 3RMNH 3SNEA 1MAYA 4ABAA 2VIOA 1CBWC 1MD8A 3TVJB 3U8TH 3GDUA 2FOCA 5JPMH 3RXIA 1EOLA 5T3HA 2OUAA 3SN8A 2ESTE 2G8TA 2ZFRH 1O2IA 2A0QB 2YNBA 4TYDA 5T6DA 1GBHA 2BLOA 1AKSB 1D4PB 1G3CA 1GGDB 3OSYA 4BTUB 2RDLA 4I8HA 2OC0A 4HTCH 1CGJE 1SVPA 2VIWA 2FESH 3FVFB 2O8TA 1O34A 1S5SA 2PTCE 1O3LA 1XMNB 1ZSKA 1BMLA 3TJNA 2C4FH 4XBCA 1HAYB 1V2NT 1WCZA 4X6PA 4AYYB 4CHAB 4KTUA 1LCYA 2PR3A 3E16B 1YYY1 4Q80A 1W14U 1SOZA 3R3GB 1GDUA 2ODQA 5ESBA 1PJPA 2BDCA 4IC6A 1O3MA 3M61U 1VGCB 3UR6A 4SGAE 1UTOA 1S6FA 1GBIA 4AZ2B 3RXRA 3RXVA 1L1NA 3ZVBA 3FFGA 3GCHB 1XVMA 4LK4A 1FN8A 3ATKA 8GCHF 2GCHF 4H42U 2CGAA 1DANH 1O2KA 2Q6DA 4GUXA 2CJIA 2STAE 1MTNB 5LPEA 3T2NA 2FM2A 3MH7A 4X6NA 2FYQA 1GI6A 1C2FA 2FX6A 1SGIB 1C1SA 5GCHG 4ZHLU 4ISHH 2ZCLP 1EP6A 3MU5A 3LOXA 1S81A 1TIOA 3I29A 4FUCA 3OTJE 3URDA 4ZHMU 1C1PA 5J4SA 1BHXB 3UY9A 3O8DA 3I77A 2WUCA 1O32A 5LPRA 1Y3YA 1C4V2 3A8CA 1LO6A 2UWOA 4Y8ZA 2B0FA 3KGPA 4MNYA 2ZQ1A 2H9TH 2BD7A 2VGCC 1TA2A 2W7SA 3UTUH 3PWCA 1UHBA 2H6MA 2M5TA 1BRCE 1TBRH 5FHTA 1F5RA 1P2QA 1ZSLA 3RLYH 5L2YH 1NU9A 3M5NA 3MYWA 1RD3B 1BJUA 4I8GA 1BTPA 1XM1A 2UWPA 1ANBA 4K1EA 4OGXA 1O5AB 1C5NH 2GCTC 1DOJA 4JZIA 4UFDH 1W13U 1KDQB 4KELA 1EKBB 1TGSZ 1TMBH 1YPLH 2ZC9H 4BNRA 1K1OA 1QBOA 1BTZA 4LOYH 1HGTH 4WY3A 1QR3E 1S85A 1Z8GA 3TK5A 2ZF0H 2ZPQA 5DGJA 2NU3E 3U1IB 1D3PB 1PPBH 1EATA 1FONA 4HI3A 1LVOA 4KTSA 3RM0H 1ELBA 1TWXB 1YLDA 1TABE 3PLPA 1W11U 3DFLA 1HAXB 1EPTB 1G32B 1KXEA 2SGQE 2XYAA 4ASHA 1KXFA 2H5CA 2WPJS 3MNXA 3SNBA 5HXFA 2GT8A 1B7XB 4AORA 3MMGA 2LPRA 1UVSH 3S7KB 5TJXA 3UNQA 5C3NA 3A7TA 2XTTB 3EGKH 1C5TA 3EA8A 1LHGH 3LIWA 1G36A 2BY5X 1A5GH 4AFQA 1CVWH 2OBOA 5FBIA 3C27B 1JRSA 1JOUB 4XSKU 5JYIA 3A8BA 3MFJA 2FS8A 3ZVFA 1P3EA 2HNTE 4ISIH 1GHVH 2NU4E 2FOFA 2FX4A 3PLKA 5E2PA 1QURH 2PUXB 1DVAH 1WU1A 2PFEA 3RXCA 4XE4A 4DCDA 1YKTA 2XCNA 1O2LA 5HYOA 1RFNA 4AYVB 1NM6A 1LHDH 3A87A 1J9CH 1IQLA 2WPHS 2C8WB 1SOTA 3PLBA 4Y0ZE 1GI0A 1PPEE 1AE8H 2Z3CA 1HAZB 3BIVH 1V2TT 1GJBB 2RG3A 1EASA 5JBAS 4CR9A 3SV6A 2GDEH 1CT2E 1RS0A 1FMGA 1VGCC 1UTKA 5GJ4B 1DY8A 4UDWH 1CE5A 2QV1A 5G4BA 2FOGA 4Y11E 2ZGHA 3EDXB 2VH6A 3E90B 2UUKB 4JCNA 3GCHC 2BDHA 2Z7FE 3F6UH 2BYAX 2Y5HA 1GJ9B 4CRAA 1O3AA 1AZ8A 1BB0B 1C2DA 4XBBA 3SUGA 2GDDA 2ZTZA 1N8OC 2A7JA 1MAXA 4XOJA 4FU8A 1TOCB 3UQOA 1MTNC 1GHBG 2BQWB 3S0NA 3RDZA 1P0SH 4Y79A 1H1BA 3LC3A 3AVZA 1EZUC 4E05H 1PFXC 2BDAA 1T8MA 2NU1E 1A3EH 3UFAA 2V0BA 3BF6H 5CMXH 1NRNH 3A81A 2CXVA 1CO7E 2OC7A 3M5LA 2A4GA 1SGEE 2WINI 1ZLRA 1CT0E 1TYNA 1IQHA 3BG4C 2QCYA 1C1TA 4DGJA 5DK1A 3GY4A 4D8NA 1QJ6B 3PM3A 2A32A 2QN5T 1FXYA 6CHAC 4YLUA 1TRNA 4I33A 2EI8A 3ZZ4A 2EC9H 1GHAG 3JZ1B 1DLKB 5GDSH 4NG9H 1E0FD 2BMGB 3RC5A 4DVAU 1SGCA 4JZ1A 2K1QA 2P3UB 1LMWB 4UONA 6GCHF 1E34B 1FY1A 3V7TA 1Y8TA 1XX9A 3DUXH 1T31A 1C5VA 1W10U 4TWYA 3TH2H 1O5EH 4YESB 3UQVA 2VVCA 1HV7A 2SNVA 4BAQB 2GZ9A 1VJ9U 3EA9A 1YM0A 1C1VH 2BD2A 1O3FA 1MH0A 4O97A 3ZZAA 3RXAA 1BIOA 4YOGA 1MKWK 7GCHF 1VITG 1O31A 1HIAA 4NIYA 5E2OA 2SGDE 5EW2H 5FX5A 4E7NA 2BD3A 1NY22 1HAOH 4B71A 4GHTA 1MTUA 3V0XA 4A1XA 1BBRE 2F9BH 3HKIB 1NRRH 4FUFA 1VITH 1EB1H 2JETC 1TRMA 3VB4A 1S83A 5AF9H 1A3BH 5JBBS 1F0RA 2BZ6H 1QJ1B 3ODFA 4KP0A 3ATMA 1J17T 4HFPB 1MBMA 1AWFH 1TGCA 1BITA 1LVYA 2A4RA 3A7ZA 3PYHA 1GMHG 3RXEA 4ISLA 2JH5D 2XBXA 3LGWA 3GYLB 3B9FH 3ZVDA 3JZ2B 1SGYE 4IW4E 4IMQA 2ZDMA 2G51A 4OS5A 4Y10E 3VFEA 2J2UA 1RTFB 4HZHA 4E06H 1TBZH 3L6PA 1MD7A 4U30A 1QB1A 1AB9C 4OS6A 1G3BA 2VB0A 1P12E 2RA3A 3BTFE 2TBSA 1ABIH 1Z8RA 4WMEA 2AH4X 5A8ZA 3BTQE 1AZZA 1O3NA 3KQBA 2NU2E 1SB1H 1O2ZA 1PYTD 1IHSH 1PYTC 2QIQA 1UCYH 3MH4A 1GI1A 1QQUA 4F4OC 3LGTA 1T8OA 1L4DA 1V2JT 2O8LA 2NWNA 1PPFE 3S9BA 1AIXH 1T8NA 1H9IE 4NA8A 2FOMB 3TH4H 1CSOE 4Q7XA 3SJOA 1S82A 5A0BA 1GHYH 2PHBA 4NFEA 3BEFB 1SHHB 2Q6GA 1NFYA 3SO3A 4MPUA 1ABJH 3OY5U 4A1TA 3QX5H 1HJ8A 1ZPZA 2NU0E 1KXBA 5F8XA 5AFZH 3A82A 2FP7B 2BY7X 1ZJDA 5C67A 5HM9A 4BOHA 2IN2A 4DOQA 1ZGVA 1OYTH 2ALPA 4LXBH 1FPCH 3TNTA 2A1DB 3EA7A 5C1YA 1WUNH 1W2KH 1QY6A 2PKAB 4TWWA 3P6ZB 1D3QB 1WV7H 3SJ8A 1ESBA 1W7XH 2EA3A 2EEKA 2P8OB 1BMAA 2VIQA 3GY2A 3V12A 1C1UH 4D9RA 2PTNA 2HRVA 3RXMA 3HK6B 4NZLA 2XBYA 1EJAA 1MKXK 6ESTA 2VH0A 4DG4A 2ZQ2A 1O2VA 1DICA 2ZWLH 4FU7A 1GVLA 5EQRA 1UVPA 4IGDA 1GMCG 1KLIH 3PTNA 3BEIB 2FWWA 2G4TA 5DP9A 1ELDE 1O2JA 3W95A 2W7UA 1FJSA 1SGDE 1TFXA 2GCHG 3ZVAA 3ZZBA 4YM9A 3BN9A 2AIPA 4BANB 2PGQB 3RMMH 3H5CB 3O8RA 1NROH 1EUFA 3ITIA 1CGHA 3QZRA 1ZHMA 1C4U2 1SG8B 1AY6H 4ZH8A 2FLBH 2Z9LA 2ZHWH 2QXJA 1D3TB 3RXPA 2ANYA 3GY5A 7LPRA 5IYTA 5EPNA 1WYKA 1BRAA 2F3CE 2UUYA 3KQEA 4FUGA 3LGVA 4NGAH 5F03A 2P16A 2C93B 1OX1A 2A5KA 5ABWA 3NPSA 5DP3A 1GVZA 1JMOH 3AASA 3OY6U 3P17H 3PB1E 4E7RG 1EAWA 1G30B 1THRH 2BDIA 3RXOA 1TX6A 1ID5H 2A7CA 3LDXH 1BBRK 2A7HA 4NIXA 4JK6A 3E8LA 1GBJA 1O2OA 1TMUH 1CA8B 4B73A 1YP9A 2ILNA 4B1TA 1OWHA 3UPEA 2J94A 1O3IA 1FI8A 2FTLE 2G5VA 3P8OA 1B0FA 4A7IB 1AVXA 2CF9H 2J38A 1T8LA 1EZSC 3EAJA 2GKVE 4AG1A 5BPEA 3AW0A 1TNKA 2JH0D 2P3TB 2W5EA 1S6HA 1O3HA 1KTTB 2VU8E 3GCOA 1GJ5H 1KLJH 2Y6TA 2QC2A 1KTSB 2QXGA 1GMDF 2ZGBH 4IBLH 5I46H 1C5PA 2Y80A 3LGUA 1YPKH 5A0CA 3LC5A 1G2MA 2CN0H 1AO5A 1KLTA 1P57B 3VEQB 2FOBA 1ELTA 3EE0B 1QB6A 3SHCH 2IPHA 2XNIA 1QFKH 5CE1A 1SQAA 1F5LA 1MTWA 1YC0A 3M5MA 1GJ4H 1LPZB 1XXFA 1GL0E 1SLXB 1TGNA 3RXUA 3RXJA 3E91A 2IOTA 5EXMA 4RKJB 3BTGE 5FPSA 4AB9A 1DLEA 1YPHE 2THFB 3M35A 1ARBA 1C5ZB 2A2XH 1QQ4A 1LQEA 3T28A 1IQMA 1DITH 1J15A 3ZZ7A 3GY7A 1JIMA 1V3XA 2R3UA 1PPHE 1GHWH 4I31A 3P95A 4FUHA 4NSVA 1ACBE 1P2OA 1SQOA 2JH6D 1TGBA 1XKAC 2KAIA 1ARCA 1B5GH 3LJJA 1O30A 4ZXXH 3V13A 1HAHH 4TY7A 1C9TA 2P94A 4ABJA 1CHGA 2P8OC 3BTEE 4MTBA 3UWJH 4X8UH 3RXSA 1ZZZA 1DSUA 1NTPA 2FEQH 2XW9A 2ZHQH 2AGGX 1EZXC 1HPGA 2STBE 4FVBA 1VZQH 1SFIA 4Z6AH 4FU9A 2R3YA 2TGPZ 1V2VT 4INKA 1P3CA 1K1JA 1TNLA 1VCWA 3TPIZ 3SV7A 7ESTE 2SNWA 3A8DA 1JXPA 1TMTH 1TPSA 1P2JA 1QA0A 1YPGH 4WWYA 3A83A 1SGPE 4Q7YA 3FP8E 2RCEA 1C5RA 4JYVH 5A0AE 1H9HE 2C8XB 3HATH 3STJA 1GBDA 1GDQA 2Z6BD 3S9AA 2FO9A 2D8WA 3PMAB 4D7FA 1QBVH 1VR1H 2VVUA 2PSYA 1GJDB 3S69A 4AFZA 3RXQA 1FAXA 1GJ7B 1HCGA 4ZKOU 1BA8B 1RTLA 2ANMH 3K9XB 1YCPM 1HAGE 1SL3A 1AVWA 4VGCC 2HNTC 1QIXB 4B74A 1BRUP 2PKSB 4I8KA 1EX3A 1J14A 3RXGA 1NFXA 1Z8IB 1HJ9A 2H5DA 2TGTA 4R0IA 2TGDA 5DP6A 1ZSJA 1CGIE 1C5LH 1C9PA 2O8MA 4WF8A 1O5FH 5ESTE 4IC5A 5K7RA 3VB3A 2CV3A 1SFQB 3FP6E 4UE7H 1GBCA 1DPOA 1BDAA 1P09A 1C1QA 1KY9A 3LH3A 5E0HA 4B76A 6GCHG 1JIRA 1CA0B 3SU0A 4ZHAA 2WPIS 1FY4A 1ZHPA 1ZRBA 1ZRKA 1K1IA 1A0JA 1V2PT 3UOUA 1O3CA 1OYQA 2XC4A 1C2GA 1O3DA 1OOKB 1LDTT 1RXPA 3NZIA 1GBFA 1TNIA 1C2IA 1L1JA 3ATIA 3PO1B 3VB7A 4JZFH 3O8BA 1CHOG 5T6GA 3CS7A 3RXBA 8LPRA 3GY3A 5GXPA 1ZGIA 2BD9A 3ZYDA 1Z7KA 1U6QA 1LVBA 2Z9IA 1HAVB 4UFGH 3TK9A 1XVOA 4OS4A 4KTCA 1O39A 2HLCA 5EPYA 5GWZA 4YOJA 1DX5M 2R2MB 1HLTH 2BY9X 4H6SB 3SU2A 2QF0A 2SFAA 1G2LA 1O3JA 3F9HA 2Z94A 1DXWA 1DUAA 1MZAA 1L0ZA 2UWLA 2ZDNA 1XXDA 3F9EA 1GI2A 4YOIA 1Z1IA 1QL7A 1YCPH 5DG6A 1V2KT 3OYPA 1RRKA 4FUEA 4RKOB 1GDNA 1NESE 1NZQH 1P11E 2FZZA 2A45B 1H9LB 4MPVA 5PTPA 4NWLA 4AFUA 1GGDC 1F5KU 3ENSB 2J95A 2HNTF 3RXTA 1ZR0A 3GOVB 5I25A 1ESAA 1QCPA 5H4IB 3ZYEA 2ZGXH 3D65E 3RXFA 2HPPH 2PW8H 4NSYA 5HM2A 3QDZB 4MNXA 1BTHH 4ZKNU 1O5DH 1Y3UA 4JZDH 2ZFFH 4YLQH 3ZV8A 3TK6A 2J34A 3A7VA 4NA9H 1P03A 1B0EA 3MWIU 2VWLA 5C20A 1FIZA 2Y7ZA 4I8LA 1A2CH 1FY8E 3RM2H 4CHAC 1O3OA 3RXDA 5LPFA 1FQ3A 1UTQA 2BY8X 1NFWA 1P9UA 2Z3EA 8ESTE 1JWTA 3L33A 2PGBB 4BAKB 1TB6H 5C5NA 2BX3A 2B9LA 1YBWA 4BTIB 1GWAA 2ZU5A 2ZU2A 1ETRH 1KXAA 2BVRH 3H7TA 3GY8A 1C2KA 1NRPH 1C5SA 1F0TA 3SOSA 2BZAA 5FCRA 2ANWA 2ZPSA 4X1NU 2F9VA 4K3JA 2BY6X 4K8BA 3SUDA 3RMLH 5EODA 1O2PA 2D2DA 1C4Y2 3Q00A 2ZIQH 1LHEH 3V3MA 1FPHH 4Q7ZA 3NWUA 4CRBA 3SJKA 2AEIH 1V2RT 1H4WA 1F0UA 4GHQA 1NRSH 3QLPH 1MCTA 2GV7A 1XUHA 3NCLA 3PV4A 1XUKA 2G52A 4I8JA 1ZHRA 4J1YA 2PKSC 3SI4H 3H7OA 1K1NA 1TPOA 1OWDA 4B2CA 4U01A 1K1MA 5FAHA 3MNBA 3P8NA 4ZUHA 3QK1A 3E6PH 1BQYA 3BEUA 4O03A 1A1RA 1W0ZU 4WVPE 2FMJA 1Y5BT 3P70B 1DT2A 1A5HA 4MPWA 1AQ7A 2BXUH 1PPCE 1EP5A 3F68H 5FPTA 1W12U 1P2KA 3U1JB 1HAIH 3SW2B 4UFEH 5GCHF 3HGNA 1RIWB 4NCYA 4XBDA 2ZU4A 1MQ6A 1C1MA 4I7YH 3LPRA 1GI8B 1DSTA 4DURA 2BOKA 3K6YA 1OP2A 1GI9B 1KSNA 3PO1C 2VJ1A 1NU7B 3A7XA 1AMHA 1LKAA 1UK4A 2OD3B 4ISOA 3QUMP 4JK5A 2TPIZ 1D6RA 2QY0B 1UVUH 2C90B 1GVKB 3MO6A 4FXGH 2R2WU 9ESTA 3FZZA 3S9CA 4CBOA 3A8AA 1FAKH 2A4QA 4OGYA 1O2XA 3LT3A 3TGIE 2ZZUH 1GBEA 4FUDA 1ELGA 3Q76A 2BXTH 1F7ZA 2BHGA 1V2WT 4CRGA 3VB6A 1EPTC 1WTHD 1HAPH 2XC5A 1BJVA 4OS7A 4X1RU 3QTOH 1AKSA 3QGNB 3GCTG 5HMAA 5DO4H 3DT0H 1PQAA 2BVSH 2GV6A 1YGCH 7KMEH 1H8DH 3KNXA 4Y7AA 9LPRA 2C8YB 1ETSH 1D9IA 1Z8JB 2WV5A 4DY7B 2ZGCA 3MOCA 4NWKA 1GHXH 2WYJA 4ZMAH 3T26A 3SI3H 1LTOA 1QL9A 2VWNA 4ABFA 1P2IA 1FZZA 5FXLA 1P2MA 2Z9GA 1UHBB 1C2HA 2ZTYA 1UTPA 1IQIA 1MU8B 2B8OH 3FZDA 2ZU1A 4JYTA 1GBMA 1S0QA 3PMHB 2HGTH 1BHXF 2BQ6B 3UNRA 1O2SA 3CP7A 3B8JA 5A8YA 3MU0A 1G37A 5C5OA 3Q3XA 3FANA 4LZ1H 1THSH 5E8EH 2DE9A 5EU8A 1H8IH 4X1QU 1GCTB 2PLXA 3ATLA 4X8TH 1K28D 1OP0A 1V2ST 3BIUH 4JYUH 1O3EA 1ANEA 4FUJA 1AFQB 1V2QT 5T6FA 5JB8S 2OTVA 4FUBA 2ZFSA 1ETTH 1BRBE 4MPXA 1SLVB 2Z3DA 1CBWB 1EXFA 3QWCH 1AD8H 5AHGH 1ZTKA 3MH6A 1Y5AT 1UTLM 2AYWA 3MH5A 1DXPA 2CMYA 2FXRA 4Y0YE 4CRDA 4IN1A 1EAXA 4PROA 8KME2 2FOEA 1SSXA 3RU4E 1G3EA 4CR5A 3A86A 1Y5UT 2P93A 1QHRB 2ASUB 4KGAA 1W0YH 4CH8B 2ZECA 1IQEA 1P8VC 1WAYB 3OX7U 4ABGA 3Q3KA 2F9NA 1FY5A 3TGJE 2GMTB 1O2TA 1O3BA 3SV2H 1KYNA 3CENA 5BRRE 3ODDA 2H9HA 1THPB 2FYRA 1J8AA 4K1SA 3ZZ9A 4WH8A 2ZO3H 1O0DH 3ZZ6A 8GCHG 3TGKE 2PSXA 1GBLA 2OQUA 2A4OA 3UWIA 2BM2A 1YPHC 5TCCA 3ZZ3A 1KDQA 4MG3A 3ZZ8A 2F9UA 2ZHDA 3PTBA 4ABDA 1TQ7B 1O3KA 1AFEH 2QXHA 2C3SA 4B2BA 4D7GA 1Z6EA 2BTCE 1ZPCA 4O3TA 1EZQA 1WBGB 1LPGB 2H9EH 4H4FA 2SGPE 4X6MA 1MZDA 2G00A 2CHAB 1OXGA 1QBNA 3LU9B 1O3PB 1C5QA 5C2ZA 1L4ZA 1SPJA 1OP8A 1PPGE 2FOAA 1K1LA 5DP5A 1C2EA 4BAOB 2VIVA 5CHAB 1P10A 1QNJA 1UK2A 1C1NA 1YPEH 2F83A 1EPTA 4BAHB 1HB0B 2LNCA 3KQCA 2ZCHP 4LZ4B 2AMQA 1DUEA 2A5AA 4I32A 1RTKA 1QGFA 2Y5GA 4ABBA 2I6SA 2P59A 3K2UA 3N7OA 1TA6A 1RGQA 4INLA 2IJOB 1ZPBA 1WTGH 3LGYA 4NZQA 3A84A 2HWLB 3A80A 3BTME 3KHVA 2XWBI 2ZG0H 5AFYH 2BD8A 5GIBA 1O3GA 1V2UT 3PROA 4YT6H 2VGCB 1IQNA 1VITF 3SU4A 5C1XA 4UEHH 2H2ZA 3RMOH 1TRYA 1LPKB 2XWAA 4X2WA 1FNIA 3DA9B 1AU8A 4A6LA 3VXFH 5LH8A 5TCAA 1MKWH 3U98H 2TRMA 2ZI2H 3M3TA 4X1SU 3A85A 3TLOA 4ZROA 1UVTH 1O2MA 1GI7B 3CS0A 1OKXA 2O8WA 4O3UA 3F9FA 3MU4A 1FIWA 1QTFA 1GMHF 3RXKA 1Y3VA 3TJOA 4AOQA 2C8ZB 1NRQH 1C5XB 2ZFTA 1WQSA 2A2QH 2BLWA 2UUJB 4GCHF 3TJVA 3M7QA 1LQDB 5HGGA 4INHA 2WPLS 3ZVCA 1W3CA 3FP7E 1UCYE 3P92A 1OWIA 1AFQC 2ODPA 1MQ5A 1MU6B 2WYGA 1T4UH 1ZOMA 1EAIA 3PWBA 1C1RA 3UNSA 1O5GH 2ZFPH 6LPRA 2ZPRA 1E35B 1F0SA 3QTVH 2PWXA 2D1JA 2A31A 5DPAA 3C1KA 3SBKA 1Y59T 1EB2A 2WUBA 4IS5A 3M3VA 1ZJKA 1NC6A 4CH2B 5EXLA 1HUTH 2Y5FA 4BTTB 1GI3A 5JDUB 3HGPA 1OPHB 1FY3A 4K1TA 2O8UA 1K2I1 1AE5A 1N1LA 2G81E 1QJ7B 3HK3B 3RC6A 1ANCA 2ZP0H 3E0NB 4WXVA 1TLDA 1TQ0B 2G4UA 3LH1A 2WV4A 4ZAEA 1ZTJA 4KKDA 3ZZ5A 1OS8A 3FAOA 1W7GH 1UTNA 3MNSA 2GMTC 2WPKS 4DW2U 4DJZB 1O2UA 2OLGA 3SU1A 3U9AH 4R8TB 3DD2H 1IHTH 2Z9JA 1ELEE 4SGBE 1G9IE 2F91A 3BTDE 1C2LA 1YPJH 2FI5E 4X8VH 5EQSA 3D23A 1C1WH 1A5IA 2FLRH 3K6ZA 3SZNA 3Q77A 1OWKA 4K69A 3VPKA 4X2XA 3UOPA 1A0LA 2BLVA 2G5NA 4O9VA 1BMNH 1O35A 3M36A 4CRFA 1P2NA 3QZQA 1TNGA 5EG4A 2FI4E 4ABHA 4U32A 3LKWA 3TU7H 1N6XA 3ZVGA 2VINA 4CRCA 1AVGH 1GMCF 5FX6A 2CHAC 5LGOA 1MKXH 2AGIX 2ZNKH 3MU1A 4TPYA 2FI3E 3SU3A 4X2VA 1N8OB 5CHAC 3M7UA 1GJ8B 3QN7A 2YOLA 3T27A 1PPZA 1E37B 5JBCS 4MQAA 3IG6B 1GBBA 1GJ6A 4NIWA 2A5IA 1O5BB 4AN7A 1MCVA 1UJ1A 1W8BH 3E1XB 1KXCA 2DUCA 3QGJA 2V3HH 1QL8A 1MTVA 5EGMA 4X0WU 1SGFA 3BG4B 4ABIA 4U2WA 1ZTLA 2AIQA 2W3KA 3SGAE 3RC4A 2I6QA 1BMMH 4CBNA 6CHAB 3PMBB 4NA7A 4DIHH 7GCHG 1MBQA 1AUJA 1GPZA 1C2MA 1O38A 1SR5C 1S84A 1DM4B 1AN1E 1K1PA 3PMJA 4Y6DA 4BXWA 2AS9A 3M7TA 1P04A 1L1GA 1SI5H 2BDBA 5IDKA 3LONA 3UREA 3SQHE 2J9NA 2ZDKA 4AFSA 1QRZA
chains in the Genus database with same CATH superfamily
1ZMNA 1C5MD 3MO3A 2FTMA 1BBRH 1QRWA 3ATWA 1OSSA 2RDEA 1SGTA 2R0KA 4AG2A 1BTWA 3M37A 1G3DA 2P3FH 4WH6A 2P95A 1ELFA 4TSFD 3VXEH 3GISB 1C5WB 1HBTH 3ZVEA 3HKJB 3BTKE 1Q3XA 3NXPA 1DDJA 4AGJA 1C5YB 3SGQE 2JETB 4Z0KA 1LHCH 3OTPA 1M9UA 1NO9H 2PKAA 1UCYK 4X2YA 1C1OA 2OQ5A 4X1PU 1EQ9A 4FVDA 1V2MT 2F4LA 2GGVB 4Y71A 1ZMLA 1O2GH 5EW1H 1NS3A 1KXDA 3AK5A 1NT1A 3BTWE 1GJCB 2BD4A 1HNEE 4ZKSU 1A46H 1IAUA 1TPPA 1XUJA 2ZKSA 2VWOA 1GG6B 1XKBC 3SJ9A 3NK8A 3RXLA 3RP2A 2AFQB 1XUIA 2G55A 2R9PA 1AGJA 4ZXYH 3ELAH 1WOFA 1AB9B 3ESTA 3NUMA 3PV5A 2HOBA 1P06A 1ZMJA 2FODA 2QXIA 1CU1A 1A4WH 3P8FA 4TPIZ 3KQDA 2GZ8A 3GICB 5A8XA 1P02A 3F2GA 3IWMA 4BAMB 1DE7H 1NN6A 1S0RA 3KN2A 5F8TA 3URCA 2GX4A 3TNSA 1TNJA 4Y8YA 1BTYA 1JRTA 1JBUH 3U28C 2XBWA 2ZHFH 2Q6FA 3U8OH 3M3SA 1EAUA 3ZV9A 1Q31A 1EJNA 4GLYA 1TPAE 3PV2A 3S7HB 1S6LA 2FS9A 3BTTE 3TIUA 2QYIA 4WMDA 1O2YA 2FIRH 3HPTB 4OS2A 1PQ5A 1BCUH 1VCPA 2WPMS 4FETA 3E3TA 1LHFH 2VVVA 1HJAB 5L30H 3SU5A 1SQTA 1P01A 1TNHA 1J16A 1MMJN 3SNAA 5EIYA 2ZGJA 1RJXB 2XC0A 5DP7A 1O5CB 2ZHEH 1BTUA 1K22H 1YLCA 3SU6A 3UUZA 3MTYA 4DIIH 4MVNA 3SUFA 2J97A 1O2QA 3SV9A 2Q1JA 1A0HB 4D76A 1Q2WA 2BB4A 3GDSA 5A2MH 3BG8A 2F9PA 2HPQH 5K0HA 2KCOA 1HFDA 2YNAA 4DT7B 1AI8H 2GVFA 1SC8U 1T32A 2OXSA 2KAIB 5C0UA 2SGEE 1INCA 3T62A 1BT7A 5AVDA 1ELVA 1XUFA 1PQ7A 3SNDA 1CA0C 3SUEA 2FPZA 1NFUA 2AGEX 1BZXE 1DS2E 1F92A 1GL1A 1ESTA 2OP9A 2PV9B 1TONA 3AAVA 4RSPA 2WV9A 3B23B 4B2AA 1SGRE 2TIOA 3MI4A 4XDEA 4NFFA 3VGCB 4OS1A 1AWHB 2BVXH 3D49H 1O2HA 1P05A 1ELAA 4ZKRU 5E0JA 5DJ7A 2SGFE 4WXIA 1K21H 1N6YA 4GPGA 4HGCA 3RU4D 3D62A 3GYMA 2OC1A 1ORFA 2QF3A 1D6WA 1VJAU 1GBAA 4GSOA 4X8SH 3T5FH 2HVXA 2GZ7A 4H6TA 3A7WA 1IQJA 2DE8A 2VWMA 3AW1A 1SBWA 4MNWA 1E1QD 4RN6A 4BXSA 1GBKA 2ZCKP 1FLEE 1O33A 2FDAA 4Y7BA 4AGKA 3A89A 1CHOF 2R0LA 2QA9E 2F9OA 1DWDH 3TJUA 2VNTA 4IN2A 1MUEB 5E0GA 3A7YA 1FV9A 2OBQA 3DHKH 1TBQH 2V35A 1WQVH 4UFFH 1O37A 1UK3A 2ZDVH 4JZEH 1IQGA 1DWEH 1FDPA 1GMDG 2J4IA 1Z6JH 1VCQA 1DY9A 2XRCA 2JIZD 1NBMD 2JKHA 2ODYB 3MU8A 2V3OH 1EOJA 1Z71A 2GD4B 5DKMA 1LVMA 1IQKA 1FN6A 3TH3H 5CDFE 4K8YA 2GTBA 5JBTA 2FOHA 1P9SA 3WY8A 1GBTA 1IOEA 4MNVA 1D3DB 4TY6A 1WSSH 5C1UA 3I78A 4CREA 3GCNA 3IITA 3MO9A 1UO6A 5GNDA 4JMYA 1O36A 4J2YB 5L6NH 2EQNA 4K60A 1GG6C 1QB9A 1GI5A 3T29A 1YLNA 2QGRA 3KCGH 3SJIA 4GCHG 3U69H 3W94A 3F9GA 1C5OH 1DWCH 1UTMA 2KX4A 2OC8A 2VIPA 2XBVA 1L2EA 4ABEA 1A7SA 2Y82A 2GT7A 1E36B 2OINA 3STIA 1E38B 1K9OE 3KEEA 3RU4T 1TALA 1UMAH 2O9QA 2W3IA 3OU0A 1NPMA 5F6MA 5L2ZH 1H8ED 2QAAA 4X6OA 4F49A 2ULLA 3SQEE 3EYDA 1SGQE 3U8RH 4AX9H 2ZTXA 4Y8XA 4WJG2 3EQ0H 1FUJA 1GJAB 1A61H 3RXHA 3E0PB 3RUOA 4M7GA 1EJMA 1HJAC 3SORA 3TITA 5FBEA 3G01A 1TX8A 5KGOA 2OCVB 3R0FA 2XXLA 1KIGH 2HVYB 3F1SB 3KL6A 2RA0A 3GDVA 2ZEBA 4XFQA 1T7CA 1Y3WA 1BOQA 2SGAA 2AERH 3LGIA 4YO9A 5GPIB 1DFPA 2Y7XA 1HDTH 3SHAH 4Y76A 1TAWA 2V6NA 1V6DA 5JB9S 3ZZDA 2ANKH 3MHWU 4YTAA 1V2LT 1DWBH 2GP9B 3M5OA 4QT8C 5DP8A 4ESTE 1SQRA 3BV9B 2ZA5A 3K65B 1BUIA 1GHBF 1SHYA 1TE0A 1YF4A 2AMDA 1SGFG 1ZYOA 1C2JA 3O8CA 1LKBA 3KF2A 4YT7H 3SZEA 2BDGA 4IMZA 1UVOA 3L3TA 1QRXA 4K2YA 1RIWC 1V2OT 3FOAA 4GVUA 5FCKA 4MLFB 1CQQA 1O2RA 2EI6A 1TX7A 2QE7D 3UR9A 3ZZCA 3VGCC 5DP4A 2W26A 1HAVA 3VB5A 2B5TB 4FUIA 3NKKA 1OWEA 4F55A 2Y81A 2EI7A 2ZDLA 2PUQH 3GY6A 1AUTC 1HXFH 1Y3XA 2BX4A 1GHAF 2Z9KA 5F8ZA 4VGCB 5EOKA 5B6OA 3BTHE 1CT4E 2J92A 1PQ8A 3MNCA 5SGAE 1XUGA 4Q2KA 4WMFA 2K8IA 2BDYA 4B75A 2VIDA 5J4QA 2AMPA 3T25A 4D9QA 1IQFA 1OWJA 2H1UA 5ETXA 5EXNA 1HYLA 4DT4A 1AHTH 1QA7A 1YPMH 3QO6A 1Z1JA 4A92A 1C5UA 1T4VH 2UUFB 1UTJA 5FPYA 1O2WA 1HRTH 1SGNE 4ISNA 1TGTA 1ELCA 2ALVA 3Q3YA 4A1VA 1SLUB 4AB8A 2BQ7B 2ZDAH 2B7DH 2XCFA 4THNH 1GHZA 1GCDA 1F2SE 1MTSA 3BSQA 1X7AC 4A5TS 2GCTB 3RLWH 2JJ1D 2ZU3A 5EQQA 2BD5A 4ASUD 1YCPK 3AAUA 1ANDA 3GCTF 2CF8H 3KIDU 2ZFQH 4HG6A 2TGAA 1GI4A 1SMFE 1SLWB 3P8GA 3SGBE 3A88A 2BLQA 3DFJA 3SV8A 3UIRA 4MDSA 4NIVA 2HALA 4YZUA 1GCTC 1TOMH 2LP6A 2BOHB 1O2NA 4K5ZA 5A09A 2YMSB 5C94A 2D26C 2WHXA 3LJOA 1HIAB 4GAWA 3SNCA 1BTXA 4UD9H 3F0OA 1HXEH 3RMNH 3SNEA 1MAYA 4ABAA 2VIOA 1CBWC 1MD8A 4XD7D 3TVJB 3U8TH 3GDUA 2FOCA 5JPMH 3RXIA 1EOLA 5T3HA 2OUAA 3SN8A 2ESTE 2G8TA 2ZFRH 1O2IA 2A0QB 2YNBA 4TYDA 5T6DA 1GBHA 2BLOA 1AKSB 1D4PB 1G3CA 1GGDB 3OSYA 4BTUB 2RDLA 4I8HA 4I86A 2OC0A 4HTCH 1CGJE 1SVPA 1KMHB 2VIWA 2FESH 3FVFB 2O8TA 1O34A 1S5SA 2PTCE 1O3LA 1XMNB 1ZSKA 1BMLA 3TJNA 2C4FH 4XBCA 1HAYB 1V2NT 1WCZA 4X6PA 4AYYB 4CHAB 4KTUA 1LCYA 2PR3A 3E16B 1YYY1 4Q80A 1W14U 1SOZA 3R3GB 1GDUA 2ODQA 5ESBA 1PJPA 2BDCA 4IC6A 1O3MA 3M61U 1VGCB 3UR6A 4SGAE 1UTOA 1S6FA 1GBIA 4AZ2B 2M2AA 3RXRA 3RXVA 1L1NA 3WWBA 3ZVBA 3FFGA 3GCHB 1XVMA 4LK4A 1FN8A 3ATKA 8GCHF 2GCHF 4H42U 2CGAA 1DANH 1O2KA 2Q6DA 4GUXA 2CJIA 2STAE 1MTNB 5LPEA 3T2NA 2FM2A 3MH7A 5HIZA 4X6NA 2FYQA 1GI6A 1C2FA 2FX6A 1SGIB 1C1SA 5GCHG 4ZHLU 4ISHH 2ZCLP 1EP6A 3MU5A 3F2FA 3LOXA 1S81A 1TIOA 3I29A 4FUCA 3OTJE 3URDA 4ZHMU 1C1PA 5J4SA 1BHXB 3UY9A 3O8DA 3I77A 2QF5A 2WUCA 1O32A 3GS9A 5LPRA 1Y3YA 1C4V2 3A8CA 1LO6A 2UWOA 4Y8ZA 2B0FA 1W0KD 3KGPA 4MNYA 2ZQ1A 2H9TH 2BD7A 2VGCC 1TA2A 2W7SA 3UTUH 3PWCA 3OEHD 1UHBA 2H6MA 2M5TA 1BRCE 1TBRH 5FHTA 1F5RA 1P2QA 1ZSLA 3PRBA 3DSOA 3RLYH 3WWFA 5L2YH 1NU9A 3M5NA 3MYWA 1RD3B 1W0JD 3DSPA 1BJUA 4I8GA 1BTPA 1XM1A 2UWPA 1ANBA 4K1EA 4OGXA 1O5AB 1C5NH 2GCTC 1DOJA 4JZIA 4UFDH 1W13U 1KDQB 4KELA 1EKBB 1TGSZ 1TMBH 1YPLH 2ZC9H 4BNRA 1K1OA 1QBOA 1BTZA 4LOYH 1HGTH 1MABB 4WY3A 1QR3E 1S85A 1Z8GA 3TK5A 2ZF0H 2ZPQA 5DGJA 2NU3E 3U1IB 1D3PB 1PPBH 1EATA 1FONA 4HI3A 1LVOA 4KTSA 3RM0H 1ELBA 1TWXB 1YLDA 1TABE 3PLPA 1W11U 2YMSC 3DFLA 1HAXB 1EPTB 1G32B 1KXEA 2SGQE 2XYAA 3OAAD 4ASHA 5B6LA 1KXFA 2H5CA 2WPJS 3MNXA 3SNBA 5HXFA 2GT8A 1B7XB 4AORA 3MMGA 2LPRA 1UVSH 3S7KB 5TJXA 3UNQA 5C3NA 3A7TA 2XTTB 3EGKH 1C5TA 3EA8A 1LHGH 3LIWA 4RT1A 1G36A 2BY5X 1A5GH 4AFQA 1CVWH 2OBOA 5FBIA 3C27B 1JRSA 1JOUB 4XSKU 5JYIA 3A8BA 3MFJA 2FS8A 3ZVFA 1P3EA 2HNTE 4ISIH 1GHVH 2NU4E 2FOFA 2FX4A 3PLKA 5E2PA 1QURH 2PUXB 1DVAH 1WU1A 2PFEA 3RXCA 4XE4A 4DCDA 1YKTA 2XCNA 1O2LA 5HYOA 1RFNA 4AYVB 1NM6A 1LHDH 3A87A 1J9CH 1IQLA 2WPHS 2C8WB 1SOTA 3PLBA 4Y0ZE 1GI0A 1PPEE 1AE8H 2Z3CA 1HAZB 3BIVH 1V2TT 1GJBB 2RG3A 1EASA 5JBAS 4CR9A 3SV6A 2GDEH 1CT2E 1RS0A 1FMGA 1VGCC 1UTKA 5GJ4B 1DY8A 4UDWH 1CE5A 2QV1A 1VKYA 5G4BA 2FOGA 4Y11E 4B6EA 2ZGHA 3EDXB 2VH6A 3E90B 2UUKB 4JCNA 1COWD 2BDHA 3GCHC 2Z7FE 3F6UH 2BYAX 2Y5HA 1GJ9B 4CRAA 1O3AA 1AZ8A 1BB0B 1C2DA 4XBBA 3SUGA 2GDDA 2ZTZA 1N8OC 2A7JA 1MAXA 3PRDA 4XOJA 4FU8A 1TOCB 3UQOA 1MTNC 1GHBG 2BQWB 3S0NA 3RDZA 1P0SH 4Y79A 1H1BA 3LC3A 3AVZA 1EZUC 4E05H 1PFXC 2BDAA 1T8MA 2NU1E 1A3EH 2J98B 3UFAA 2V0BA 3BF6H 5CMXH 1NRNH 3A81A 2CXVA 1CO7E 2OC7A 3M5LA 2A4GA 4Q4LA 1SGEE 2WINI 1ZLRA 1CT0E 1TYNA 1IQHA 5KEDA 3BG4C 2QCYA 1C1TA 4DGJA 5DK1A 3GY4A 4D8NA 1QJ6B 3PM3A 2A32A 2QN5T 1FXYA 6CHAC 4YLUA 1TRNA 4I33A 2EI8A 3ZZ4A 2EC9H 1GHAG 3JZ1B 1DLKB 5GDSH 4NG9H 1E0FD 2BMGB 3RC5A 4DVAU 1SGCA 4JZ1A 2K1QA 2P3UB 1LMWB 4UONA 6GCHF 1E34B 1FY1A 3V7TA 1Y8TA 1XX9A 3DUXH 1T31A 1C5VA 1W10U 4TWYA 3OE7D 3TH2H 1O5EH 4YESB 3UQVA 2VVCA 1HV7A 2SNVA 4BAQB 2GZ9A 1VJ9U 3EA9A 1YM0A 1C1VH 2BD2A 1O3FA 1MH0A 4O97A 3ZZAA 3RXAA 1BIOA 4YOGA 1MKWK 7GCHF 1VITG 2WSSD 1O31A 1HIAA 4NIYA 5E2OA 2SGDE 5EW2H 5FX5A 4E7NA 2BD3A 1NY22 1HAOH 4B71A 4GHTA 1MTUA 3V0XA 4A1XA 1BBRE 2F9BH 3HKIB 1NRRH 1YWUA 4FUFA 1VITH 1EB1H 1E79D 2JETC 1TRMA 3VB4A 1S83A 5AF9H 1A3BH 5JBBS 1F0RA 2BZ6H 1QJ1B 3ODFA 4KP0A 3ATMA 1J17T 4HFPB 1MBMA 1AWFH 1TGCA 1BITA 1LVYA 2A4RA 3A7ZA 3PYHA 1GMHG 3RXEA 4ISLA 2JH5D 2XBXA 3LGWA 3GYLB 3B9FH 3ZVDA 3JZ2B 1SGYE 4IW4E 2KM0A 2ZDMA 2G51A 4IMQA 4OS5A 4Y10E 3VFEA 2J2UA 1RTFB 4HZHA 4E06H 1TBZH 3L6PA 1MD7A 4U30A 1QB1A 1AB9C 4OS6A 1G3BA 2VB0A 1P12E 2RA3A 3BTFE 1EFRD 2TBSA 1ABIH 1Z8RA 4WMEA 2AH4X 5A8ZA 3BTQE 1AZZA 1O3NA 3KQBA 2NU2E 1SB1H 1O2ZA 1PYTD 1IHSH 1PYTC 2QIQA 1UCYH 3MH4A 1GI1A 1QQUA 4F4OC 3LGTA 1T8OA 1L4DA 1V2JT 2O8LA 2KZ4A 2NWNA 1PPFE 3S9BA 3W1EA 1AIXH 1T8NA 1H9IE 4NA8A 2FOMB 3TH4H 1CSOE 4Q7XA 3SJOA 1S82A 5A0BA 1GHYH 2PHBA 4NFEA 3BEFB 1SHHB 2Q6GA 2QF4A 1NFYA 3SO3A 2JDID 4MPUA 1ABJH 3OY5U 3KYFA 4A1TA 3QX5H 1HJ8A 1ZPZA 2NU0E 1KXBA 5F8XA 5AFZH 3A82A 2FP7B 2BY7X 1ZJDA 5C67A 5HM9A 4BOHA 2IN2A 4DOQA 1ZGVA 1OYTH 2ALPA 4LXBH 1FPCH 3TNTA 2A1DB 3EA7A 5C1YA 1WUNH 1W2KH 1QY6A 2PKAB 4M9FA 4TWWA 3P6ZB 1D3QB 1WV7H 2KFWA 3SJ8A 1ESBA 1W7XH 2EA3A 2EEKA 2P8OB 1BMAA 2VIQA 1E1RD 3GY2A 3V12A 1C1UH 4D9RA 2PTNA 2HRVA 3RXMA 2AHME 3HK6B 4NZLA 2XBYA 1EJAA 1MKXK 6ESTA 2VH0A 4DG4A 2F43B 2ZQ2A 1O2VA 5C17A 1DICA 2ZWLH 4FU7A 1GVLA 5EQRA 1UVPA 4IGDA 1GMCG 1KLIH 3PTNA 3BEIB 2FWWA 2G4TA 5DP9A 1ELDE 1O2JA 3W95A 2W7UA 1FJSA 1SGDE 1TFXA 2GCHG 3ZVAA 3ZZBA 3SYJA 1K0HA 4YM9A 3BN9A 2AIPA 4BANB 2PGQB 3RMMH 3H5CB 3O8RA 1NROH 1EUFA 3ITIA 1CGHA 3QZRA 1ZHMA 1C4U2 1SG8B 1AY6H 4ZH8A 2FLBH 2Z9LA 2ZHWH 2QXJA 1D3TB 3RXPA 2ANYA 3GY5A 7LPRA 5IYTA 5EPNA 1WYKA 1BRAA 2F3CE 2UUYA 3KQEA 4FUGA 3LGVA 4NGAH 5F03A 2P16A 2C93B 1OX1A 2A5KA 5ABWA 3NPSA 5DP3A 1GVZA 1JMOH 3AASA 3OY6U 3P17H 3PB1E 4E7RG 1EAWA 1G30B 1THRH 2BDIA 3RXOA 1TX6A 1ID5H 2A7CA 3LDXH 1BBRK 2A7HA 4NIXA 4JK6A 3E8LA 1GBJA 1O2OA 1TMUH 1CA8B 3EE7A 4B73A 1YP9A 2ILNA 4B1TA 1OHHD 1OWHA 3UPEA 2J94A 1O3IA 1FI8A 2FTLE 2G5VA 3P8OA 1B0FA 4A7IB 1AVXA 3WW7A 2LELA 2CF9H 2J38A 1T8LA 1EZSC 3EAJA 2JJ2D 2GKVE 4AG1A 5BPEA 3AW0A 1TNKA 2JH0D 2P3TB 2W5EA 1S6HA 1O3HA 1KTTB 2VU8E 3GCOA 3NRLA 3FN8A 1GJ5H 1KLJH 2Y6TA 2QC2A 1KTSB 2QXGA 1GMDF 2L74A 2KCYA 2ZGBH 4IBLH 5I46H 1C5PA 2Y80A 3LGUA 1YPKH 5A0CA 3LC5A 1G2MA 2CN0H 1AO5A 1KLTA 1P57B 3VEQB 2FOBA 1ELTA 3EE0B 1QB6A 3SHCH 2IPHA 2XNIA 1QFKH 3VG8A 2W6ID 1UW7A 5CE1A 1SQAA 1F5LA 1MTWA 1YC0A 3M5MA 1GJ4H 1LPZB 1XXFA 1GL0E 1SLXB 1TGNA 3RXUA 3RXJA 3E91A 2IOTA 2XOKD 5EXMA 4RKJB 3BTGE 5FPSA 4AB9A 4B6FA 1DLEA 1YPHE 2THFB 3M35A 1ARBA 1C5ZB 2A2XH 1QQ4A 1LQEA 3T28A 1IQMA 1DITH 1J15A 3ZZ7A 3GY7A 1JIMA 1V3XA 2R3UA 1PPHE 1GHWH 4I31A 3P95A 5DN6D 4FUHA 2WPDD 4NSVA 1ACBE 1P2OA 1SQOA 2JH6D 1TGBA 1XKAC 2KAIA 1ARCA 1B5GH 3LJJA 1O30A 4ZXXH 3V13A 1HAHH 4FOUC 1C9TA 2P94A 4TY7A 4ABJA 1CHGA 2P8OC 3BTEE 4MTBA 3UWJH 2RFKC 4X8UH 3RXSA 1ZZZA 2PP6A 1DSUA 1NTPA 2FEQH 2XW9A 2ZHQH 2AGGX 1EZXC 1HPGA 2STBE 4FVBA 1VZQH 1SFIA 4Z6AH 4FU9A 2R3YA 2TGPZ 1V2VT 4INKA 1P3CA 1K1JA 1TNLA 1VCWA 3DCLA 5EJ1A 3TPIZ 3SV7A 7ESTE 2SNWA 3A8DA 1JXPA 1TMTH 1TPSA 1P2JA 1QA0A 1YPGH 4WWYA 3A83A 2KCAA 1SGPE 3N99A 4Q7YA 3FP8E 2RCEA 1C5RA 4JYVH 5A0AE 1H9HE 2C8XB 5EJLA 3HATH 3STJA 1GBDA 1GDQA 2Z6BD 3S9AA 2FO9A 2D8WA 3PMAB 4D7FA 1QBVH 1VR1H 2VVUA 2PSYA 1GJDB 3S69A 4AFZA 3RXQA 1FAXA 1GJ7B 1HCGA 4ZKOU 1BA8B 1RTLA 1SKYE 2ANMH 3K9XB 1YCPM 1HAGE 1SL3A 1AVWA 4VGCC 2HNTC 1QIXB 4B74A 1BRUP 3FKSD 2PKSB 4I8KA 1EX3A 1J14A 3RXGA 1NFXA 3OFND 1Z8IB 3ZIAD 3F0PA 1HJ9A 2H5DA 2TGTA 4R0IA 2TGDA 5DP6A 5T1VA 1ZSJA 1CGIE 1C5LH 1C9PA 2O8MA 4WF8A 1O5FH 5ESTE 5FL7D 4IC5A 5K7RA 3VB3A 2CV3A 1SFQB 3FP6E 4YXWD 4UE7H 1GBCA 1DPOA 1BDAA 1P09A 1C1QA 1KY9A 3LH3A 5E0HA 4B76A 6GCHG 1JIRA 4RI0A 1CA0B 3SU0A 4ZHAA 2WPIS 1FY4A 1ZHPA 1ZRBA 1ZRKA 1K1IA 1A0JA 1V2PT 5KECA 3UOUA 1O3CA 1OYQA 2XC4A 1C2GA 1O3DA 1OOKB 1LDTT 1RXPA 3NZIA 1GBFA 1TNIA 1C2IA 1L1JA 3ATIA 3PO1B 3VB7A 4JZFH 3O8BA 1CHOG 5T6GA 3CS7A 3RXBA 8LPRA 3GY3A 5GXPA 4Q63A 1ZGIA 2BD9A 5HIYA 3ZYDA 1Z7KA 1U6QA 1LVBA 2Z9IA 1HAVB 4UFGH 1WDIA 3TK9A 1XVOA 4XRNA 4OS4A 4KTCA 2J5UA 1O39A 2HLCA 5EPYA 5GWZA 4YOJA 1DX5M 2R2MB 2YMSD 1HLTH 2BY9X 4H6SB 3SU2A 2QF0A 2SFAA 1G2LA 4RT0A 1O3JA 3F9HA 2Z94A 1DXWA 1DUAA 1MZAA 1L0ZA 2UWLA 4AC9A 2ZDNA 3KYGA 1XXDA 3F9EA 1GI2A 4YOIA 1Z1IA 1QL7A 1YCPH 5DG6A 1V2KT 3OYPA 1RRKA 4FUEA 4RKOB 1GDNA 1NESE 1NZQH 1P11E 2FZZA 2A45B 1H9LB 4MPVA 5PTPA 4NWLA 4AFUA 1GGDC 1F5KU 3ENSB 2J95A 2HNTF 2V7QD 3RXTA 1ZR0A 3GOVB 5I25A 1ESAA 1QCPA 5H4IB 3ZYEA 2ZGXH 3D65E 3RXFA 2HPPH 2PW8H 4NSYA 5HM2A 3QDZB 4MNXA 1BTHH 4ZKNU 1O5DH 1Y3UA 4JZDH 2ZFFH 4YLQH 3ZV8A 3TK6A 2J34A 3UB0A 3A7VA 4NA9H 1P03A 1B0EA 3MWIU 2VWLA 2OK5A 5C20A 1FIZA 2Y7ZA 5CHBA 4I8LA 1A2CH 1FY8E 3CNRA 3RM2H 1O3OA 3RXDA 4CHAC 5LPFA 1FQ3A 1UTQA 2BY8X 1NFWA 2W6JD 1P9UA 2Z3EA 2K0QA 8ESTE 1JWTA 3L33A 2PGBB 4BAKB 1TB6H 5C5NA 2BX3A 2B9LA 1YBWA 4BTIB 1GWAA 2ZU5A 2ZU2A 1ETRH 1KXAA 2BVRH 3H7TA 3GY8A 1C2KA 1NRPH 1C5SA 1F0TA 3SOSA 2BZAA 5FCRA 2ANWA 2ZPSA 4X1NU 2F9VA 4K3JA 2BY6X 4K8BA 3SUDA 2CK3D 5EODA 3RMLH 1O2PA 2D2DA 1C4Y2 3Q00A 2ZIQH 1LHEH 3V3MA 1FPHH 4Q7ZA 3NWUA 4CRBA 3SJKA 2AEIH 1V2RT 1H4WA 1F0UA 4GHQA 1NRSH 3QLPH 1MCTA 2GV7A 1XUHA 3NCLA 3PV4A 1XUKA 2G52A 4F48B 4I8JA 1ZHRA 4J1YA 2PKSC 3SI4H 3H7OA 1K1NA 1TPOA 1OWDA 4B2CA 4U01A 1K1MA 5FAHA 3MNBA 3P8NA 4ZUHA 3QK1A 3E6PH 1BQYA 3BEUA 4O03A 1A1RA 1W0ZU 4WVPE 2FMJA 1Y5BT 2XNDD 3P70B 1DT2A 1A5HA 4MPWA 1AQ7A 2BXUH 1PPCE 1EP5A 3F68H 5FPTA 1FX0B 1W12U 1P2KA 3U1JB 1HAIH 3SW2B 4UFEH 5GCHF 3HGNA 1RIWB 4NCYA 4XBDA 2ZU4A 1MQ6A 1C1MA 4I7YH 3LPRA 1GI8B 1DSTA 4P00A 4DURA 2BOKA 3K6YA 1OP2A 1GI9B 1KSNA 3PO1C 2VJ1A 1NU7B 3A7XA 1AMHA 1LKAA 1UK4A 2OD3B 4ISOA 3QUMP 4JK5A 2TPIZ 1D6RA 2QY0B 1UVUH 2C90B 1GVKB 3MO6A 4FXGH 3MQKC 2R2WU 9ESTA 3FZZA 3S9CA 4CBOA 3A8AA 1FAKH 2A4QA 4OGYA 1O2XA 3LT3A 3TGIE 3OEED 2ZZUH 1GBEA 4FUDA 1ELGA 3Q76A 2BXTH 1F7ZA 2BHGA 1V2WT 5F53A 4CRGA 3VB6A 1EPTC 1WTHD 1HAPH 2XC5A 1BJVA 4OS7A 4X1RU 3QTOH 1AKSA 3QGNB 3GCTG 5HMAA 5DO4H 3DT0H 1PQAA 2BVSH 2GV6A 2L6OA 1YGCH 7KMEH 1H8DH 3KNXA 4Y7AA 9LPRA 2C8YB 1ETSH 1D9IA 1Z8JB 2WV5A 4DY7B 2ZGCA 3MOCA 4NWKA 1GHXH 2WYJA 4ZMAH 3T26A 3SI3H 1LTOA 1QL9A 2VWNA 4ABFA 1P2IA 1FZZA 5FXLA 1P2MA 2Z9GA 1UHBB 1C2HA 2ZTYA 1UTPA 1IQIA 1MU8B 2B8OH 3FZDA 2ZU1A 4JYTA 1GBMA 1S0QA 3PMHB 2HGTH 1BHXF 2BQ6B 3UNRA 1O2SA 3CP7A 4TT3D 2HLDD 3B8JA 5A8YA 3MU0A 1G37A 5C5OA 3Q3XA 3FANA 4LZ1H 1THSH 5E8EH 2DE9A 5EU8A 1H8IH 4X1QU 1GCTB 2PLXA 2V3MA 3ATLA 4X8TH 1K28D 1OP0A 1V2ST 3BIUH 4JYUH 4Z1MD 1O3EA 1ANEA 4FUJA 1AFQB 1V2QT 5T6FA 5JB8S 2OTVA 4FUBA 2ZFSA 1ETTH 1BRBE 4MPXA 1SLVB 2Z3DA 1CBWB 1EXFA 3QWCH 1AD8H 5AHGH 2GJGA 1ZTKA 3MH6A 5HKKD 1Y5AT 1UTLM 2AYWA 3MH5A 1DXPA 2CMYA 2FXRA 4Y0YE 4CRDA 4IN1A 1EAXA 3DSGA 4PROA 2KCPA 8KME2 2FOEA 1SSXA 3RU4E 1G3EA 4CR5A 3A86A 1Y5UT 2P93A 1QHRB 2ASUB 4KGAA 1W0YH 3H09A 4CH8B 2ZECA 1IQEA 1P8VC 1WAYB 3OX7U 4ABGA 3Q3KA 2F9NA 1FY5A 3TGJE 2GMTB 1O2TA 1O3BA 3SV2H 1KYNA 3CENA 5BRRE 3ODDA 2H9HA 1THPB 2FYRA 1J8AA 4K1SA 3ZZ9A 4WH8A 2ZO3H 1O0DH 3ZZ6A 8GCHG 3TGKE 4OM9A 1WXRA 2PSXA 1GBLA 2OQUA 2A4OA 3UWIA 2BM2A 1YPHC 5TCCA 3ZZ3A 1KDQA 4MG3A 3ZZ8A 2F9UA 2ZHDA 3PTBA 4ABDA 1TQ7B 1O3KA 1AFEH 2QXHA 2C3SA 2KR7A 4B2BA 4D7GA 1Z6EA 2BTCE 1NBME 1ZPCA 1QZ8A 4O3TA 1EZQA 1WBGB 1LPGB 2H9EH 4H4FA 2SGPE 4X6MA 1MZDA 2G00A 2CHAB 1OXGA 1QBNA 3LU9B 1H8HD 1O3PB 1C5QA 5C2ZA 1YY3A 1L4ZA 1SPJA 1OP8A 1PPGE 2FOAA 1K1LA 5DP5A 1C2EA 4BAOB 2VIVA 5CHAB 1P10A 1QNJA 5C0TA 1UK2A 1C1NA 3N7DA 1YPEH 2F83A 1EPTA 4BAHB 1HB0B 2LNCA 3KQCA 2ZCHP 4LZ4B 2AMQA 1DUEA 2A5AA 4I32A 1RTKA 1QGFA 2Y5GA 4ABBA 2I6SA 2P59A 3K2UA 3N7OA 1TA6A 1RGQA 4INLA 2IJOB 1ZPBA 1WTGH 3LGYA 4NZQA 3A84A 2HWLB 3A80A 3BTME 3KHVA 2XWBI 2ZG0H 5AFYH 2BD8A 5GIBA 1O3GA 5EJZA 1V2UT 3PROA 4YT6H 2VGCB 1IQNA 1VITF 3SU4A 5C1XA 4UEHH 2H2ZA 3RMOH 1TRYA 1LPKB 2XWAA 4X2WA 1FNIA 3DA9B 1AU8A 4A6LA 3VXFH 5LH8A 5TCAA 1MKWH 3U98H 2TRMA 2ZI2H 3M3TA 4X1SU 3A85A 3TLOA 4ZROA 1UVTH 1O2MA 1GI7B 3CS0A 1OKXA 2O8WA 4O3UA 3F9FA 3MU4A 1FIWA 1QTFA 1GMHF 3RXKA 1Y3VA 4P02A 3TJOA 4AOQA 2C8ZB 1NRQH 1C5XB 2ZFTA 1WQSA 2A2QH 2WZQA 2BLWA 2UUJB 4GCHF 3TJVA 3M7QA 1LQDB 5HGGA 4INHA 2WPLS 5DSFA 3ZVCA 1W3CA 3FP7E 1UCYE 3P92A 1OWIA 1AFQC 2ODPA 1MQ5A 1MU6B 2WYGA 1T4UH 1ZOMA 1EAIA 3PWBA 1C1RA 3UNSA 1O5GH 2ZFPH 6LPRA 2ZPRA 1E35B 1F0SA 3QTVH 2PWXA 2D1JA 2IJD1 2A31A 5DPAA 3C1KA 3SBKA 1Y59T 1EB2A 2WUBA 4IS5A 3M3VA 1ZJKA 1NC6A 4CH2B 5EXLA 1HUTH 2Y5FA 4BTTB 1GI3A 2J98A 5JDUB 3HGPA 1OPHB 3N7EA 1FY3A 4K1TA 2O8UA 1K2I1 1AE5A 1N1LA 2G81E 1QJ7B 3HK3B 3RC6A 1ANCA 2ZP0H 3E0NB 4WXVA 1TLDA 1TQ0B 2G4UA 3LH1A 2WV4A 4ZAEA 1ZTJA 4KKDA 3ZZ5A 1OS8A 3F2HA 3FAOA 1W7GH 1UTNA 3MNSA 2VBCA 2GMTC 2WPKS 4DW2U 4ACBA 4DJZB 1O2UA 2OLGA 3SU1A 3U9AH 4R8TB 3DD2H 4ZCNA 1IHTH 2Z9JA 1ELEE 4SGBE 1G9IE 2F91A 3BTDE 1C2LA 1YPJH 2FI5E 4X8VH 5EQSA 3D23A 1C1WH 1A5IA 2FLRH 3K6ZA 3SZNA 4ACAA 3Q77A 1OWKA 4K69A 3VPKA 3F3BA 4X2XA 3UOPA 1A0LA 2BLVA 2G5NA 4O9VA 1BMNH 1O35A 3M36A 4CRFA 1P2NA 3QZQA 1TNGA 5EG4A 2FI4E 5IK2D 4ABHA 4U32A 3LKWA 3TU7H 1N6XA 3ZVGA 2VINA 4CRCA 1AVGH 1GMCF 5FX6A 2CHAC 5LGOA 1MKXH 2AGIX 2ZNKH 3MU1A 4TPYA 2FI3E 3SU3A 4X2VA 1N8OB 5CHAC 3M7UA 1GJ8B 3QN7A 2YOLA 3T27A 1PPZA 1E37B 5JBCS 4MQAA 3IG6B 1GBBA 1GJ6A 4NIWA 2A5IA 1O5BB 4AN7A 2EY4C 1MCVA 1UJ1A 3FO8D 1W8BH 3E1XB 1KXCA 2DUCA 3QGJA 2V3HH 1QL8A 1MTVA 5EGMA 4X0WU 1SGFA 3BG4B 4ABIA 4U2WA 1ZTLA 2AIQA 2W3KA 3SGAE 3RC4A 2I6QA 1BMMH 4CBNA 6CHAB 3PMBB 2IPQX 3KQ5A 4NA7A 4DIHH 7GCHG 1MBQA 1AUJA 1GPZA 1C2MA 1O38A 3UAIC 1SR5C 1S84A 1BMFD 1DM4B 1AN1E 1K1PA 3PMJA 4Y6DA 4BXWA 2AS9A 3M7TA 1P04A 1L1GA 1SI5H 2BDBA 5IDKA 3LONA 3UREA 3SQHE 2J9NA 2ZDKA 4AFSA 1QRZA
chains in the Genus database with same CATH topology
1ZMNA 1C5MD 3MO3A 2FTMA 1BBRH 1QRWA 3ATWA 1OSSA 1SGTA 2R0KA 4AG2A 1BTWA 3M37A 1G3DA 2P3FH 4WH6A 2P95A 1ELFA 3VXEH 3GISB 1C5WB 1HBTH 3ZVEA 3HKJB 3BTKE 1Q3XA 3NXPA 1DDJA 4AGJA 1C5YB 3SGQE 2JETB 4Z0KA 1LHCH 4X2YA 1M9UA 1NO9H 2PKAA 1UCYK 1C1OA 2OQ5A 4X1PU 1EQ9A 4FVDA 1V2MT 2GGVB 4Y71A 1ZMLA 1O2GH 5EW1H 1NS3A 1KXDA 1NT1A 3BTWE 1GJCB 2BD4A 1HNEE 4ZKSU 1A46H 1IAUA 1TPPA 1XUJA 2ZKSA 2VWOA 1GG6B 1XKBC 3SJ9A 3NK8A 3RXLA 3RP2A 2AFQB 1XUIA 2G55A 2R9PA 1AGJA 4ZXYH 3ELAH 1WOFA 1AB9B 3ESTA 3NUMA 2HOBA 1P06A 1ZMJA 2FODA 2QXIA 1CU1A 1A4WH 3P8FA 4TPIZ 3KQDA 2GZ8A 3GICB 5A8XA 1P02A 3IWMA 4BAMB 1DE7H 1NN6A 1S0RA 3KN2A 5F8TA 3URCA 2GX4A 3TNSA 1TNJA 4Y8YA 1BTYA 1JRTA 1JBUH 2XBWA 2ZHFH 2Q6FA 3U8OH 3M3SA 1EAUA 3ZV9A 1Q31A 1EJNA 4GLYA 1TPAE 3S7HB 2FS9A 3BTTE 3TIUA 2QYIA 4WMDA 1O2YA 2FIRH 3HPTB 4OS2A 1PQ5A 1BCUH 1VCPA 2WPMS 3E3TA 1LHFH 2VVVA 1HJAB 5L30H 3SU5A 1SQTA 1P01A 1TNHA 1J16A 1MMJN 3SNAA 2ZGJA 1RJXB 2XC0A 5DP7A 1O5CB 2ZHEH 1BTUA 1K22H 1YLCA 3SU6A 3UUZA 3MTYA 4DIIH 4MVNA 3SUFA 1O2QA 3SV9A 2Q1JA 1A0HB 4D76A 1Q2WA 2BB4A 3GDSA 5A2MH 3BG8A 2F9PA 2HPQH 5K0HA 1HFDA 2YNAA 4DT7B 1AI8H 2GVFA 1SC8U 1T32A 2OXSA 2KAIB 2SGEE 1INCA 3T62A 1BT7A 5AVDA 1ELVA 1XUFA 1PQ7A 3SNDA 1CA0C 3SUEA 2FPZA 1NFUA 2AGEX 1BZXE 1DS2E 1F92A 1GL1A 1ESTA 2OP9A 2PV9B 1TONA 3AAVA 4RSPA 3B23B 4B2AA 1SGRE 2TIOA 3MI4A 4XDEA 4NFFA 3VGCB 4OS1A 1AWHB 2BVXH 3D49H 1O2HA 1P05A 1ELAA 4ZKRU 5E0JA 5DJ7A 2SGFE 4WXIA 1K21H 1N6YA 4GPGA 4HGCA 3RU4D 3D62A 3GYMA 2OC1A 1ORFA 2QF3A 1D6WA 1VJAU 1GBAA 4GSOA 4X8SH 3T5FH 2HVXA 2GZ7A 4H6TA 3A7WA 1IQJA 2DE8A 2VWMA 3AW1A 1SBWA 4MNWA 4RN6A 4BXSA 1GBKA 2ZCKP 1FLEE 1O33A 2FDAA 4Y7BA 4AGKA 3A89A 1CHOF 2R0LA 2QA9E 2F9OA 1DWDH 3TJUA 2VNTA 4IN2A 1MUEB 5E0GA 3A7YA 1FV9A 2OBQA 3DHKH 1TBQH 2V35A 1WQVH 4UFFH 1O37A 1UK3A 2ZDVH 4JZEH 1IQGA 1DWEH 1FDPA 1GMDG 2J4IA 1Z6JH 1VCQA 1DY9A 2XRCA 3MU8A 2JKHA 2ODYB 2V3OH 1EOJA 1Z71A 2GD4B 5DKMA 1LVMA 1IQKA 1FN6A 3TH3H 4K8YA 2GTBA 5JBTA 2FOHA 1P9SA 3WY8A 1GBTA 1IOEA 4MNVA 1D3DB 4TY6A 1WSSH 5C1UA 3I78A 4CREA 3GCNA 3IITA 3MO9A 1UO6A 4JMYA 1O36A 4J2YB 5L6NH 4K60A 1GG6C 1QB9A 1GI5A 3T29A 2QGRA 3KCGH 3SJIA 4GCHG 3U69H 3W94A 3F9GA 1C5OH 1DWCH 1UTMA 2OC8A 2VIPA 2XBVA 1L2EA 4ABEA 1A7SA 2Y82A 2GT7A 1E36B 2OINA 3STIA 1E38B 1K9OE 3KEEA 3RU4T 1TALA 1UMAH 2O9QA 2W3IA 3OU0A 1NPMA 5F6MA 5L2ZH 2QAAA 4X6OA 4F49A 2ULLA 3SQEE 3EYDA 1SGQE 3U8RH 4AX9H 2ZTXA 4Y8XA 4WJG2 3EQ0H 1FUJA 1GJAB 1A61H 3RXHA 3E0PB 3RUOA 4M7GA 1EJMA 1HJAC 3SORA 3TITA 5FBEA 3G01A 1TX8A 2OCVB 3R0FA 2XXLA 1KIGH 3F1SB 3KL6A 2RA0A 3GDVA 2ZEBA 4XFQA 1T7CA 1Y3WA 1BOQA 2SGAA 2AERH 3LGIA 4YO9A 5GPIB 1DFPA 2Y7XA 1HDTH 3SHAH 4Y76A 1TAWA 2V6NA 1V6DA 5JB9S 3ZZDA 2ANKH 3MHWU 4YTAA 1V2LT 1DWBH 2GP9B 3M5OA 4QT8C 5DP8A 4ESTE 3BV9B 2ZA5A 3K65B 1BUIA 1GHBF 1SHYA 1TE0A 1YF4A 2AMDA 1SGFG 1ZYOA 1C2JA 3O8CA 1LKBA 3KF2A 4YT7H 2BDGA 4IMZA 1UVOA 3L3TA 1QRXA 4K2YA 1RIWC 1V2OT 4GVUA 5FCKA 4MLFB 1CQQA 1O2RA 2EI6A 1TX7A 3UR9A 3ZZCA 3VGCC 5DP4A 2W26A 1HAVA 3VB5A 2B5TB 4FUIA 3NKKA 1OWEA 2Y81A 2EI7A 2ZDLA 2PUQH 3GY6A 1AUTC 1HXFH 1Y3XA 2BX4A 1GHAF 2Z9KA 5F8ZA 4VGCB 5EOKA 5B6OA 3BTHE 1CT4E 2J92A 1PQ8A 3MNCA 5SGAE 1XUGA 4Q2KA 4WMFA 2BDYA 4B75A 2VIDA 5J4QA 2AMPA 3T25A 4D9QA 1IQFA 1OWJA 2H1UA 5ETXA 5EXNA 1HYLA 1AHTH 1QA7A 1YPMH 3QO6A 1Z1JA 4A92A 1C5UA 1T4VH 2UUFB 1UTJA 5FPYA 1O2WA 1HRTH 1SGNE 4ISNA 1TGTA 1ELCA 2ALVA 3Q3YA 4A1VA 1SLUB 4AB8A 2BQ7B 2ZDAH 2B7DH 2XCFA 4THNH 1GHZA 1GCDA 1F2SE 1MTSA 3BSQA 1X7AC 4A5TS 2GCTB 3RLWH 2ZU3A 5EQQA 2BD5A 1YCPK 3AAUA 1ANDA 3GCTF 2CF8H 3KIDU 2ZFQH 2TGAA 1GI4A 1SMFE 1SLWB 3P8GA 3SGBE 3A88A 2BLQA 3DFJA 3SV8A 3UIRA 4MDSA 4NIVA 2HALA 4YZUA 1GCTC 1TOMH 2BOHB 1O2NA 4K5ZA 5A09A 2D26C 3LJOA 1HIAB 4GAWA 3SNCA 1BTXA 4UD9H 1HXEH 3RMNH 3SNEA 1MAYA 4ABAA 2VIOA 1CBWC 1MD8A 3TVJB 3U8TH 3GDUA 2FOCA 5JPMH 3RXIA 1EOLA 5T3HA 2OUAA 3SN8A 2ESTE 2G8TA 2ZFRH 1O2IA 2A0QB 2YNBA 4TYDA 5T6DA 1GBHA 2BLOA 1AKSB 1D4PB 1G3CA 1GGDB 3OSYA 4BTUB 2RDLA 4I8HA 2OC0A 4HTCH 1CGJE 1SVPA 2VIWA 2FESH 3FVFB 2O8TA 1O34A 1S5SA 2PTCE 1O3LA 1XMNB 1ZSKA 1BMLA 3TJNA 2C4FH 4XBCA 1HAYB 1V2NT 1WCZA 4X6PA 4AYYB 4CHAB 4KTUA 1LCYA 2PR3A 3E16B 1YYY1 4Q80A 1W14U 1SOZA 3R3GB 1GDUA 2ODQA 5ESBA 1PJPA 2BDCA 4IC6A 1O3MA 3M61U 1VGCB 3UR6A 4SGAE 1UTOA 1S6FA 1GBIA 4AZ2B 3RXRA 3RXVA 1L1NA 3ZVBA 3FFGA 3GCHB 1XVMA 4LK4A 1FN8A 3ATKA 8GCHF 2GCHF 4H42U 2CGAA 1DANH 1O2KA 2Q6DA 4GUXA 2CJIA 2STAE 1MTNB 5LPEA 3T2NA 2FM2A 3MH7A 4X6NA 2FYQA 1GI6A 1C2FA 2FX6A 1SGIB 1C1SA 5GCHG 4ZHLU 4ISHH 2ZCLP 1EP6A 3MU5A 3LOXA 1S81A 1TIOA 3I29A 4FUCA 3OTJE 3URDA 4ZHMU 1C1PA 5J4SA 1BHXB 3UY9A 3O8DA 3I77A 2WUCA 1O32A 5LPRA 1Y3YA 1C4V2 3A8CA 1LO6A 2UWOA 4Y8ZA 2B0FA 3KGPA 4MNYA 2ZQ1A 2H9TH 2BD7A 2VGCC 1TA2A 2W7SA 3UTUH 3PWCA 1UHBA 2H6MA 2M5TA 1BRCE 1TBRH 5FHTA 1F5RA 1P2QA 1ZSLA 3RLYH 5L2YH 1NU9A 3M5NA 3MYWA 1RD3B 1BJUA 4I8GA 1BTPA 1XM1A 2UWPA 1ANBA 4K1EA 4OGXA 1O5AB 1C5NH 2GCTC 1DOJA 4JZIA 4UFDH 1W13U 1KDQB 4KELA 1EKBB 1TGSZ 1TMBH 1YPLH 2ZC9H 4BNRA 1K1OA 1QBOA 1BTZA 4LOYH 1HGTH 4WY3A 1QR3E 1S85A 1Z8GA 3TK5A 2ZF0H 2ZPQA 5DGJA 2NU3E 3U1IB 1D3PB 1PPBH 1EATA 1FONA 4HI3A 1LVOA 4KTSA 3RM0H 1ELBA 1TWXB 1YLDA 1TABE 3PLPA 1W11U 3DFLA 1HAXB 1EPTB 1G32B 1KXEA 2SGQE 2XYAA 4ASHA 1KXFA 2H5CA 2WPJS 3MNXA 3SNBA 5HXFA 2GT8A 1B7XB 4AORA 3MMGA 2LPRA 1UVSH 3S7KB 5TJXA 3UNQA 5C3NA 3A7TA 2XTTB 3EGKH 1C5TA 3EA8A 1LHGH 3LIWA 1G36A 2BY5X 1A5GH 4AFQA 1CVWH 2OBOA 5FBIA 3C27B 1JRSA 1JOUB 4XSKU 5JYIA 3A8BA 3MFJA 2FS8A 3ZVFA 1P3EA 2HNTE 4ISIH 1GHVH 2NU4E 2FOFA 2FX4A 3PLKA 5E2PA 1QURH 2PUXB 1DVAH 1WU1A 2PFEA 3RXCA 4XE4A 4DCDA 1YKTA 2XCNA 1O2LA 5HYOA 1RFNA 4AYVB 1NM6A 1LHDH 3A87A 1J9CH 1IQLA 2WPHS 2C8WB 1SOTA 3PLBA 4Y0ZE 1GI0A 1PPEE 1AE8H 2Z3CA 1HAZB 3BIVH 1V2TT 1GJBB 2RG3A 1EASA 5JBAS 4CR9A 3SV6A 2GDEH 1CT2E 1RS0A 1FMGA 1VGCC 1UTKA 5GJ4B 1DY8A 4UDWH 1CE5A 2QV1A 5G4BA 2FOGA 4Y11E 2ZGHA 3EDXB 2VH6A 3E90B 2UUKB 4JCNA 3GCHC 2BDHA 2Z7FE 3F6UH 2BYAX 2Y5HA 1GJ9B 4CRAA 1O3AA 1AZ8A 1BB0B 1C2DA 4XBBA 3SUGA 2GDDA 2ZTZA 1N8OC 2A7JA 1MAXA 4XOJA 4FU8A 1TOCB 3UQOA 1MTNC 1GHBG 2BQWB 3S0NA 3RDZA 1P0SH 4Y79A 1H1BA 3LC3A 3AVZA 1EZUC 4E05H 1PFXC 2BDAA 1T8MA 2NU1E 1A3EH 3UFAA 2V0BA 3BF6H 5CMXH 1NRNH 3A81A 2CXVA 1CO7E 2OC7A 3M5LA 2A4GA 1SGEE 2WINI 1ZLRA 1CT0E 1TYNA 1IQHA 3BG4C 2QCYA 1C1TA 4DGJA 5DK1A 3GY4A 4D8NA 1QJ6B 3PM3A 2A32A 2QN5T 1FXYA 6CHAC 4YLUA 1TRNA 4I33A 2EI8A 3ZZ4A 2EC9H 1GHAG 3JZ1B 1DLKB 5GDSH 4NG9H 1E0FD 2BMGB 3RC5A 4DVAU 1SGCA 4JZ1A 2K1QA 2P3UB 1LMWB 4UONA 6GCHF 1E34B 1FY1A 3V7TA 1Y8TA 1XX9A 3DUXH 1T31A 1C5VA 1W10U 4TWYA 3TH2H 1O5EH 4YESB 3UQVA 2VVCA 1HV7A 2SNVA 4BAQB 2GZ9A 1VJ9U 3EA9A 1YM0A 1C1VH 2BD2A 1O3FA 1MH0A 4O97A 3ZZAA 3RXAA 1BIOA 4YOGA 1MKWK 7GCHF 1VITG 1O31A 1HIAA 4NIYA 5E2OA 2SGDE 5EW2H 5FX5A 4E7NA 2BD3A 1NY22 1HAOH 4B71A 4GHTA 1MTUA 3V0XA 4A1XA 1BBRE 2F9BH 3HKIB 1NRRH 4FUFA 1VITH 1EB1H 2JETC 1TRMA 3VB4A 1S83A 5AF9H 1A3BH 5JBBS 1F0RA 2BZ6H 1QJ1B 3ODFA 4KP0A 3ATMA 1J17T 4HFPB 1MBMA 1AWFH 1TGCA 1BITA 1LVYA 2A4RA 3A7ZA 3PYHA 1GMHG 3RXEA 4ISLA 2JH5D 2XBXA 3LGWA 3GYLB 3B9FH 3ZVDA 3JZ2B 1SGYE 4IW4E 4IMQA 2ZDMA 2G51A 4OS5A 4Y10E 3VFEA 2J2UA 1RTFB 4HZHA 4E06H 1TBZH 3L6PA 1MD7A 4U30A 1QB1A 1AB9C 4OS6A 1G3BA 2VB0A 1P12E 2RA3A 3BTFE 2TBSA 1ABIH 1Z8RA 4WMEA 2AH4X 5A8ZA 3BTQE 1AZZA 1O3NA 3KQBA 2NU2E 1SB1H 1O2ZA 1PYTD 1IHSH 1PYTC 2QIQA 1UCYH 3MH4A 1GI1A 1QQUA 4F4OC 3LGTA 1T8OA 1L4DA 1V2JT 2O8LA 2NWNA 1PPFE 3S9BA 1AIXH 1T8NA 1H9IE 4NA8A 2FOMB 3TH4H 1CSOE 4Q7XA 3SJOA 1S82A 5A0BA 1GHYH 2PHBA 4NFEA 3BEFB 1SHHB 2Q6GA 1NFYA 3SO3A 4MPUA 1ABJH 3OY5U 4A1TA 3QX5H 1HJ8A 1ZPZA 2NU0E 1KXBA 5F8XA 5AFZH 3A82A 2FP7B 2BY7X 1ZJDA 5C67A 5HM9A 4BOHA 2IN2A 4DOQA 1ZGVA 1OYTH 2ALPA 4LXBH 1FPCH 3TNTA 2A1DB 3EA7A 5C1YA 1WUNH 1W2KH 1QY6A 2PKAB 4TWWA 3P6ZB 1D3QB 1WV7H 3SJ8A 1ESBA 1W7XH 2EA3A 2EEKA 2P8OB 1BMAA 2VIQA 3GY2A 3V12A 1C1UH 4D9RA 2PTNA 2HRVA 3RXMA 3HK6B 4NZLA 2XBYA 1EJAA 1MKXK 6ESTA 2VH0A 4DG4A 2ZQ2A 1O2VA 1DICA 2ZWLH 4FU7A 1GVLA 5EQRA 1UVPA 4IGDA 1GMCG 1KLIH 3PTNA 3BEIB