3LKWA

Crystal structure of dengue virus 1 ns2b/ns3 protease active site mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
211
Chain Sequence
HMADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKVLWDTPSPGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWASVKKDLISYGGGWRFQGSWNAGEEVQVIAVEPGKNPKNVQTAPGTFKTPEGEVGAIALDFKPGTAGSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein,hydrolase
molecule keywords fusion protein of nonstructural protein 2B and nonstructural
publication title Serotype-specific structural differences in the protease-cofactor complexes of the dengue virus family.
pubmed doi rcsb
source organism Dengue virus type 1 (strain singapore/s275/1990)
total genus 32
structure length 211
sequence length 230
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lkwA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3lkwA01
1SGDE 2SGDE 1W0ZU 3DA9B 1BTPA 5H4IB 3NPSA 1XUKA 3PMAB 3P92A 1C5VA 2OTVA 3A83A 2WPHS 2VINA 1BUIA 5EOKA 2J38A 1F7ZA 2AYWA 1QURH 1UTJA 2FM2A 3SUDA 5IYTA 5FBIA 1LVBA 5HXFA 4ZKRU 3RXPA 4FUHA 1C2EA 1PQ5A 1O39A 4F4OC 1CT2E 2Z9KA 3VB4A 3BIVH 3K6ZA 4NA9H 1ABJH 1CQQA 1HIAB 4Y0YE 2UWOA 4AYYB 3A88A 6LPRA 1L0ZA 1MBMA 3EYDA 2A4OA 1UHBA 3GY2A 2TBSA 3TK5A 2FODA 1J14A 1C2GA 3ZV8A 1XUFA 1KIGH 1QR3E 1S82A 4I33A 3RXJA 1CHOG 3Q76A 3U1IB 5LH8A 1GCTC 1O3MA 1YPLH 4ABJA 1RRKA 1VJ9U 1FIZA 1MTWA 4LXBH 7GCHF 5JBTA 1UK4A 3SJOA 3FP8E 5E0JA 3QWCH 2OC0A 2SGPE 3RM2H 3HKIB 4R8TB 2XBWA 3ATIA 3GYMA 3KIDU 4DIIH 1BTWA 2ZGJA 1P2OA 4UD9H 1CE5A 4X8VH 1SGPE 2Z9IA 4KKDA 4CHAC 1D3TB 4HTCH 4E7NA 5A8YA 2ZFFH 2H9EH 3T27A 1O2YA 2FX4A 1P2NA 4U01A 1E36B 5ESTE 2ZU5A 2KAIA 1SB1H 1MQ5A 2AS9A 3PV4A 2TPIZ 2GT8A 1PPZA 1C2FA 1RTLA 2A7HA 2VWNA 1AZZA 1QA0A 2ZGHA 6CHAB 3RC4A 1FY4A 3TPIZ 3L3TA 1ZJKA 3LGUA 1NM6A 5DGJA 1ZHMA 3KEEA 1H1BA 1ZZZA 3OU0A 1LHGH 1O3JA 1WU1A 2HNTE 1UO6A 1XXDA 1ELFA 2AFQB 2BDHA 2BTCE 1O2GH 1WBGB 1HAZB 3CS7A 5E2OA 2D8WA 4DVAU 2Z9LA 4IMZA 1GMDF 1TGNA 5EXNA 1GBLA 1LKAA 3RXCA 2Z3CA 1M9UA 1KLTA 2G8TA 2BZ6H 5C20A 2A32A 3RXTA 2FS9A 3SUFA 1GHAF 2CHAC 3I78A 1Y3WA 3U8RH 2EC9H 1GDUA 4CR9A 1Z7KA 3STJA 1GJBB 4NG9H 2WPMS 2BXUH 2O8MA 1THPB 1C5LH 1N1LA 1VITG 1GHWH 1TGTA 1YLCA 1OWEA 3BV9B 4DG4A 1CU1A 2ZGBH 3SU0A 3A84A 1YPGH 4TWYA 1MAXA 3TJNA 3SNCA 4OS7A 4X2WA 4Y0ZE 1JIRA 2BLWA 3ZYDA 1NT1A 1QJ1B 3RMMH 3MHWU 3ODDA 1O5CB 2IOTA 3GY7A 4UFEH 3RMOH 3LOXA 1QL7A 1L1JA 3RXRA 4O3UA 3GCTG 1Y3VA 1P11E 1GHZA 4Y71A 4B2BA 2BQWB 1BDAA 4ZKSU 1G2MA 1NROH 4RSPA 4B75A 1LKBA 1SVPA 2ZHEH 2YNBA 4IBLH 5AVDA 3ZYEA 3SV9A 4BOHA 2ZDLA 2BLVA 2ANKH 2V3HH 2O8LA 1DM4B 1XVMA 1BB0B 2HNTC 1GG6B 5JYIA 4NFFA 3ZVBA 1K22H 1LPZB 1W10U 3PROA 4VGCC 1TALA 1O2OA 1MZDA 1PJPA 1GI9B 1K1NA 1IQNA 3SV7A 1YCPH 4XSKU 2P8OC 4OS2A 1UJ1A 5DP5A 1F5KU 1QHRB 1UVSH 1SC8U 5FAHA 1OWKA 2ZCKP 1SGFA 1YLDA 1V6DA 3TGJE 1XKBC 1TYNA 2QYIA 1AVWA 1RD3B 1K1OA 2SGFE 2HALA 3QGJA 3RXHA 1NRRH 3NXPA 1ELCA 4YM9A 1VITH 5JB8S 1K1IA 1ANCA 1QB9A 2AGEX 1PPGE 2VIDA 2C4FH 4CRDA 1O3NA 2A31A 2GGVB 5C5OA 4WMEA 1SSXA 4JZIA 1EOJA 1QCPA 2ZECA 5HM9A 3IWMA 1GHXH 2AIQA 4FUIA 4ABAA 1W11U 5GIBA 2Q6GA 3RXUA 4OS1A 3OTPA 1P2MA 1ZTKA 2JH6D 4INHA 1KDQB 2QXJA 1EATA 4ISNA 1JRTA 2O8UA 3KN2A 3CENA 2BVRH 2J4IA 3FZZA 1JRSA 1BA8B 3H5CB 1UCYH 4GHQA 5E2PA 1UTKA 2EI7A 4X2VA 3DD2H 3GISB 2ZC9H 3BTGE 2AIPA 2BLOA 2B8OH 4D9QA 1GCTB 2D1JA 2SGAA 1O3HA 1MKXH 2ASUB 1NRPH 1KTSB 2XC4A 1AN1E 1WTGH 2H5CA 1UTLM 4ZAEA 1GJ9B 2PHBA 3ZVFA 2UWPA 1ELBA 4DY7B 1IQLA 2F9VA 3K6YA 3T28A 2FTMA 4GSOA 4JYUH 5IDKA 1KXBA 3PWCA 1K1MA 2Y80A 3ATWA 1A5HA 5EQRA 2BY9X 4GCHG 1LVMA 2Y6TA 1BMAA 2Y5GA 1CSOE 1P9UA 4Y8XA 2BD2A 1ANBA 2ZTYA 1B0FA 4X8TH 2HGTH 3MFJA 3UR6A 4LZ1H 1CO7E 2PSYA 3ZVGA 4ZHMU 2A2QH 2GD4B 2G5NA 4FVDA 1AWHB 2UWLA 4H6TA 1JXPA 3MI4A 3TH3H 3I29A 3V0XA 3MNSA 1LPKB 3L6PA 4MLFB 1C1MA 1DT2A 3EE0B 3IG6B 2ZCHP 1O2MA 2WYJA 5L6NH 2PR3A 3RXSA 3MH6A 4ABHA 1GI2A 1ZHPA 3HK3B 1G37A 1P2IA 3A85A 2Y81A 2ODPA 1SGRE 2UUYA 1F5RA 1PQ7A 2M5TA 2ZHFH 1GI5A 3A7XA 1Z71A 1CBWC 2FLBH 3D23A 2F9UA 1ZSKA 3VGCB 1Y3XA 1QY6A 1EAXA 4AFSA 1C1NA 2SNWA 5EW1H 1J9CH 1E34B 1J16A 2QGRA 2R0LA 5JB9S 5L2YH 3HK6B 1INCA 1O3EA 2R0KA 1O2JA 1ZHRA 7KMEH 1F0RA 1EPTA 1BZXE 1DFPA 2QF0A 1SG8B 3RXFA 2BDBA 1Z8JB 5JBCS 1W14U 1P2JA 1FN6A 2QN5T 4ZMAH 5BRRE 4I8HA 1LTOA 1MCVA 3E0PB 3VPKA 2FPZA 3RMLH 4KELA 5ETXA 1PYTD 1Y8TA 5EQQA 3SQEE 3O8RA 1F0UA 1DSUA 2FOMB 3TJVA 3O8CA 1BTZA 1WYKA 5DO4H 1FJSA 1O2RA 3RXIA 1DSTA 3BSQA 3F1SB 1SFQB 3TH2H 4KTUA 3AK5A 1EASA 1V2ST 2JKHA 4YLUA 3A82A 1Y5UT 3F9FA 3E8LA 5A0AE 4NIXA 1AVGH 1ZJDA 1FV9A 1WQSA 3EAJA 1SOTA 2FOBA 1O35A 1QL9A 2Z9JA 4O03A 2QXGA 4Z0KA 1A0LA 5T6GA 1DWBH 1SBWA 2NU2E 1O2TA 2ANYA 1RS0A 3QN7A 1N6XA 2P94A 2OCVB 1VCWA 1HAVA 3P95A 4NFEA 3RXKA 2D26C 4AFZA 1WCZA 1TNGA 1Z1IA 3GICB 3SV6A 2W26A 1ZGIA 3ZZ6A 4OS5A 1GI1A 2VH0A 3P8FA 5DP6A 2F9BH 1VZQH 4K8YA 5A8XA 1MUEB 4INLA 3BTDE 2GMTC 1ELTA 2H9HA 1TBZH 2PGQB 1GI3A 3LC3A 4MPXA 1DY8A 3KL6A 5K0HA 4WXVA 2Y7XA 2XCNA 4CRBA 1Y59T 1ZGVA 2ZFTA 1LHEH 5GPIB 4K5ZA 3LH1A 1ELEE 3SU5A 1S0QA 5FX6A 3SO3A 4X6MA 2UUJB 2ULLA 2J9NA 2VVVA 1L1GA 2ZPRA 1LHCH 4AZ2B 1J17T 1UVOA 4K60A 3QZRA 2CF9H 1TGBA 1JMOH 2VNTA 1ZTLA 2WPLS 2WV4A 5HGGA 5JDUB 1V2OT 2BMGB 5T1VA 4Q2KA 4ISLA 4ZHAA 2WUBA 4NSVA 1YPEH 4DJZB 1EZQA 2VWLA 5E0GA 2GX4A 5HM2A 1YM0A 9ESTA 1KXEA 2D2DA 3U8TH 2RCEA 1HAPH 1C5QA 1HUTH 1NFWA 2O8WA 2UUFB 3TLOA 1QB1A 2OQUA 5A09A 5I25A 4ZH8A 1MBQA 3QZQA 3E6PH 1C4V2 2FESH 2FI3E 2RDLA 1SHYA 1SQAA 2GKVE 3UIRA 1O3CA 1UTQA 2GZ9A 1GMCG 1OOKB 1O5BB 1QB6A 3P8OA 2BY7X 1W8BH 3SU4A 3T2NA 1O31A 1E37B 1N6YA 1EZXC 2AMPA 4AGKA 3L33A 1QBNA 2TRMA 3PV5A 4XBDA 3RP2A 1W13U 4BAOB 1TGCA 3I77A 1C2JA 1ARCA 2FI5E 1CBWB 1TMTH 1HAIH 1FNIA 4UFDH 4TPYA 4I8LA 4FUFA 4QT8C 3PTNA 1GBDA 4Z6AH 3QGNB 1G2LA 1C1TA 3ZZ4A 3KQEA 1C1QA 1QGFA 3E16B 1O2WA 1NFXA 4MPVA 4XOJA 5HMAA 1GBCA 2F9OA 2QA9E 3ZZ3A 2CJIA 2G5VA 4B2AA 3GDVA 2PGBB 1IQIA 3C27B 3RUOA 2V35A 3RXVA 3SI4H 2F91A 4NA7A 1DXPA 1BJVA 5EQSA 1TONA 2XNIA 3E91A 3M3TA 4X1SU 1GBBA 1SLUB 1OXGA 3K2UA 2ZA5A 1WXRA 3M36A 4WY3A 1EZSC 1VITF 5FPTA 3U98H 3PLKA 1CA0B 1AE5A 1C5ZB 1BHXB 1YC0A 2J2UA 3URDA 1OP0A 2HVXA 4KTSA 2B7DH 1OWHA 2EI6A 5A0BA 2ZNKH 3ZZ7A 2ZFRH 2R3UA 3MU0A 5GCHF 4AX9H 1CVWH 2RA3A 2VU8E 1DUEA 1EKBB 4ASHA 2OXSA 4KGAA 1AVXA 3P8NA 4FUCA 3Q3YA 3E1XB 3LGVA 1ID5H 4A6LA 3GCTF 1O3GA 1SLVB 2BZAA 1NRNH 4H42U 4BTIB 1NS3A 3MYWA 5GWZA 2PWXA 1W2KH 1IQFA 1D3DB 2WPIS 2ZQ1A 1SPJA 2FYQA 3TGKE 3MO3A 2C8YB 2W7UA 3ESTA 1DOJA 3NCLA 1T8LA 2DE9A 2FOFA 3GOVB 1TWXB 4J1YA 2XC0A 4OM9A 4U32A 3OY5U 3LJJA 2Z3DA 2QV1A 5T6FA 1GI0A 4INKA 2F4LA 4FU7A 2OINA 3MO9A 4B71A 4AOQA 1DANH 2ZQ2A 1HRTH 1FIWA 1Q31A 2JH0D 3A8AA 3T5FH 1QQ4A 3CP7A 2OD3B 1OP8A 1HV7A 3TK9A 2IN2A 8KME2 1BTUA 2RG3A 3A8BA 1SR5C 4BNRA 2GMTB 4U2WA 2NU1E 4ABFA 2GZ7A 1ESAA 6GCHG 4UFGH 1EJNA 1HXFH 2IPHA 3EDXB 3SGBE 3A86A 3SNDA 1HXEH 3TITA 1WAYB 4GAWA 3ZZBA 2Z9GA 1O3IA 1BT7A 1GI7B 1JIMA 1BJUA 3LC5A 2ZDMA 1OYTH 2A45B 3SHAH 3VB6A 4X1PU 2FYRA 5C1UA 1DWEH 3RDZA 3HATH 1ELAA 2VH6A 3K65B 2XRCA 4IC5A 4Q80A 3AAVA 1UHBB 3AAUA 5ABWA 4BAHB 1QQUA 3BIUH 3S9CA 2ZEBA 3VGCC 5HYOA 2QY0B 1C2IA 1GBIA 2YNAA 1SGCA 1MTVA 1G36A 2TGDA 1HYLA 2SGEE 2XW9A 4SGBE 3SYJA 1SQTA 4AGJA 1C5OH 1QA7A 3W95A 1JBUH 1WQVH 4ISOA 1RIWB 3VXEH 4B2CA 1UTMA 3FAOA 1GGDB 2GT7A 2BB4A 3CS0A 3SJIA 2W5EA 3E3TA 1V2LT 5LPFA 4NWKA 1YBWA 4GCHF 5EGMA 3ZZ8A 1K1PA 4AG1A 2ZGCA 4E7RG 2W7SA 2OP9A 1P02A 1GHVH 1NO9H 2BYAX 1UTOA 2G55A 1HLTH 1O2HA 1TA6A 1MU8B 3URCA 1O0DH 2KAIB 1HAXB 4A7IB 2B0FA 1PYTC 3KGPA 5C1YA 5GDSH 2WV9A 2G51A 2ZU2A 1ABIH 1KDQA 1GDQA 3LU9B 5FCRA 2H2ZA 1A1RA 1HAYB 1QJ7B 4K1EA 4WH8A 5DG6A 1C2HA 3LKWA 1K1JA 5C1XA 1ZMJA 3B8JA 3QX5H 2QC2A 1VCPA 2BM2A 2QCYA 1BBRE 1XVOA 2Y7ZA 3VB7A 1SI5H 3LGWA 1D9IA 5SGAE 5DP4A 2J92A 1MH0A 1A3EH 1GI8B 3F9EA 4DIHH 2VWMA 2ZHQH 4IGDA 2PUQH 1RXPA 3RC6A 5C5NA 3FP6E 3PMJA 4H6SB 1IQMA 4NSYA 1JOUB 1P8VC 1FXYA 2VIOA 2BDGA 1Q3XA 5EPYA 5JPMH 1F5LA 1C1OA 1O2IA 3M5OA 5DP7A 4JYTA 4JMYA 2ZFQH 5DPAA 2LNCA 3RXEA 3EA7A 3VB5A 3V3MA 1MU6B 1C4U2 1EOLA 1XMNB 4AB9A 3AW0A 1FLEE 3BG8A 4A1TA 1C1WH 1NTPA 4X8SH 3NWUA 1D6RA 3BTFE 2FOHA 3GY4A 1V2MT 3SU1A 1BTHH 4Y7BA 2FS8A 1DWDH 3KQCA 1V2UT 1QRXA 1LDTT 4IC6A 3NZIA 2A5KA 1SGTA 1KLIH 3Q3KA 1EX3A 4J2YB 1HAHH 1FY3A 1CHGA 2QIQA 4UDWH 2V6NA 8GCHG 1QFKH 2ALVA 2PKAA 1PQ8A 2TIOA 5TCAA 3ELAH 1S5SA 3T25A 4GUXA 1C5PA 4D76A 2XBYA 1AUJA 4M9FA 4KTCA 4TY6A 5F03A 2VIPA 1HCGA 4NZQA 1SQOA 4I31A 3M37A 1O2PA 4NGAH 2ILNA 1NY22 2FOAA 2BD5A 2Z6BD 3A8DA 1FY8E 3BEUA 4Y79A 1O2ZA 2PUXB 5L2ZH 3SU2A 1H8DH 2THFB 1GCDA 2JETB 1UVUH 2R2MB 1VGCC 4HI3A 4Y76A 1B0EA 3V12A 2STAE 4YESB 1DS2E 1OWDA 1OYQA 1TGSZ 2VVUA 3RXOA 1SOZA 4RN6A 3RXAA 1OWJA 5FCKA 1AO5A 3M35A 3Q00A 4FU9A 4K8BA 1Z8IB 3QO6A 1C2DA 1GBEA 1S81A 1SLWB 1MCTA 4I8JA 3SORA 5LGOA 4BXWA 3UUZA 1GHBG 2R2WU 1Z8GA 1P05A 1VR1H 3GDSA 1FAKH 3M5LA 1ZMNA 3Q3XA 1C5MD 4MNXA 4ABBA 2G52A 3UY9A 5LPRA 1E0FD 1HJ8A 2P3FH 1FDPA 2PLXA 2BD8A 2BX3A 3ATMA 1NU9A 1WOFA 2TGAA 4JZFH 1VCQA 1QRWA 1MKWK 4KP0A 1GBTA 1ESBA 2ZF0H 1D4PB 2ANMH 3RXGA 1D6WA 5AFZH 3QUMP 4Y10E 1EAUA 5E8EH 1O2KA 1YPKH 2OQ5A 1LHDH 1A4WH 5G4BA 4CH8B 2V3OH 4NA8A 1D3QB 4TPIZ 3U8OH 2I6SA 4YTAA 3OYPA 1E38B 1P04A 2IJOB 3M7QA 2F83A 1O2UA 4B1TA 4FU8A 3PV2A 1QIXB 2CMYA 2Q6FA 3TGIE 2BY8X 3R3GB 1FPHH 1LCYA 2ZU1A 3MH7A 3RXDA 3A80A 1IQGA 1OX1A 1BMMH 1E35B 2SGQE 1ETRH 1A5IA 1UTPA 2BOKA 3KQDA 1GHYH 4BTUB 1C1VH 2FDAA 2VGCB 4CRCA 2BD3A 4FUGA 3SW2B 1CA0C 4U30A 3VB3A 1ETTH 3OY6U 1MTNC 2FOEA 4WMDA 3ODFA 4ZXXH 1OPHB 1SGQE 1WSSH 1S6FA 4HZHA 2VJ1A 3ZZCA 4UE7H 3LGIA 1ZPZA 2B9LA 1K21H 1HPGA 4BXSA 2OLGA 1PFXC 3RXLA 1AWFH 1GMHF 1QNJA 1LPGB 1YPHE 1AD8H 1DPOA 4FUBA 2C3SA 3HKJB 3GCHC 1L4ZA 1UVPA 2FOCA 1ZTJA 1SGEE 2QXIA 1XM1A 1YP9A 4F49A 1T4VH 2UUKB 1AKSA 3SHCH 2OC7A 1THRH 3RU4T 1MQ6A 1A5GH 5JBAS 3MNCA 3UOUA 2A5IA 3FFGA 1OP2A 1QTFA 4OS6A 1FMGA 5AHGH 1N8OC 4ZKOU 3F6UH 2C90B 1SFIA 2FP7B 1KXDA 1T8MA 1XUIA 2ZHWH 1O3DA 2XBXA 2XWAA 3P8GA 1AFEH 2ZIQH 5PTPA 1UK2A 1NFYA 4K69A 1EUFA 4XFQA 1G3EA 1W7XH 2OC1A 1O3PB 1TRNA 3PTBA 1O2QA 3FP7E 1Y5AT 2H5DA 3SV2H 2ZO3H 1W3CA 2BX4A 4D7GA 1TA2A 2PTCE 5DKMA 4IN1A 5T6DA 1NN6A 2BDYA 4RI0A 2P3TB 1BITA 1PPBH 3HGNA 1TNKA 4XDEA 5DK1A 2BXTH 3OSYA 4X1NU 1GL0E 3LIWA 4GLYA 1QBOA 1F92A 1GJ6A 1O37A 2ZFPH 1YPHC 4ABEA 1KYNA 2ZG0H 1GWAA 5F8ZA 4X2YA 1TNHA 1BRAA 2ZFSA 1C5NH 2FMJA 2Y5FA 4A5TS 5CHAC 2H1UA 1O3OA 4JYVH 3V7TA 1V2TT 3GYLB 1AI8H 3GCNA 2Y5HA 1AY6H 1ZOMA 4LK4A 3SGAE 3U9AH 3P70B 2NU3E 2J94A 5EU8A 3S69A 1CHOF 3F9HA 4X0WU 1C5WB 3FZDA 1O32A 3RM0H 1TE0A 3RXQA 1O3KA 3JZ2B 3ENSB 1ZRBA 3UR9A 4Y8ZA 4MTBA 1VGCB 1RIWC 2ZCLP 4DW2U 1GGDC 1NRSH 2HOBA 1L4DA 1C1PA 1V2WT 1TX7A 3E90B 1B7XB 1DDJA 1EJMA 4AFUA 1HAVB 3UNRA 2BD9A 1ETSH 1X7AC 3A7VA 1LHFH 2VB0A 2HWLB 2C8WB 1IQHA 1CT0E 3S0NA 5EW2H 1GJAB 1C2LA 1BOQA 4HFPB 3O8DA 2PKSB 2ZTXA 3MU4A 3QTOH 1GJDB 3SU3A 1AB9B 1C1SA 1CGHA 5A2MH 3DFLA 2WYGA 3GY5A 3MH5A 3FANA 4AORA 2NU0E 3RXBA 2ZPSA 3MMGA 1AFQB 2ZHDA 3E0NB 2BVSH 5EXLA 1O36A 5FPSA 1NC6A 2DUCA 3KCGH 2BDIA 1HIAA 4IN2A 4X8UH 4PROA 2HPQH 7ESTE 1NZQH 3GY3A 4E05H 1FQ3A 1TNIA 2SNVA 3SV8A 1WV7H 3DUXH 4R0IA 4B76A 3UWJH 1QL8A 2HRVA 2BY6X 4OS4A 3UTUH 1G3DA 4ISIH 3BG4C 1C1UH 3B23B 1BBRK 4FVBA 2RA0A 4RKJB 1MD8A 2GCTB 3A87A 4BAKB 1P09A 5F8XA 1TMBH 1C2MA 1H4WA 1G3CA 3FVFB 2A4RA 3RLWH 2FEQH 1T8NA 1VJAU 1HAOH 1MMJN 4UONA 2Q1JA 1PPHE 2Y82A 1Z8RA 4YLQH 3KF2A 1BQYA 2V0BA 1EAWA 1O2SA 1BTYA 2R9PA 2C93B 2FX6A 2VWOA 1S83A 2A4GA 1AHTH 1OS8A 3DFJA 1BRBE 1CT4E 5DP3A 3EGKH 1MTNB 4Q7YA 1TBQH 2FXRA 1V2RT 2CGAA 2PV9B 1TQ0B 3UFAA 4D8NA 3UOPA 1C4Y2 1V3XA 3C1KA 5AF9H 3NKKA 4YT6H 1EJAA 3IITA 1FY1A 2IJD1 4GVUA 1YYY1 3ZVAA 5FPYA 3ZZAA 2GV6A 5C2ZA 1GJ4H 3QK1A 3SJ8A 4A1VA 1RTFB 1KXFA 1O33A 3S9BA 4IW4E 2XTTB 3GCHB 4FXGH 4Y6DA 1SMFE 2GV7A 1O2VA 1C9TA 3MO6A 3U69H 2A7CA 2GCHG 1TABE 3UQOA 1ORFA 3ZVEA 4D7FA 3SJKA 3M7TA 1MTSA 3DT0H 1CGIE 4WXIA 1GBJA 2W3KA 3MU8A 4FUDA 1U6QA 1O2LA 2HNTF 3EA9A 3SBKA 1N8OB 1S0RA 4WF8A 1B5GH 3AVZA 2CV3A 2ZU3A 4BAQB 4WH6A 1OSSA 4JK6A 1TNLA 1D3PB 4FUJA 2JETC 5GXPA 2AH4X 1QBVH 4GHTA 4RKOB 4IMQA 2PTNA 2ALPA 1O5FH 3TK6A 5CMXH 1S6HA 2WPKS 1SGFG 1P06A 3BTEE 1H9HE 3MU1A 5FXLA 4LZ4B 4CRAA 2ANWA 1G32B 2CXVA 2WINI 1YGCH 3H7TA 2BQ7B 3MWIU 1RFNA 1HNEE 4WMFA 3PO1B 2HPPH 3UPEA 1TMUH 1UVTH 1PPEE 1EZUC 2J34A 3M3VA 5E0HA 4A92A 3U1JB 5GNDA 3OX7U 1ARBA 1T4UH 5F8TA 1FN8A 1ANEA 2H6MA 5A8ZA 1A0JA 1AUTC 3D62A 3S7KB 1SLXB 1EP6A 1XUHA 4NWLA 1UCYE 1OKXA 3S9AA 4X6PA 1W12U 1MKWH 3G01A 1H8IH 4WWYA 3UWIA 1FONA 2XWBI 5CHAB 1XKAC 1C5XB 2A4QA 3PYHA 8GCHF 2GZ8A 4O97A 1AQ7A 1TPOA 5TJXA 1PQAA 1DWCH 2ZTZA 2ODQA 2K1QA 1G3BA 2G00A 2BQ6B 2WUCA 1IOEA 3A8CA 4X6OA 1UTNA 5J4SA 1V2JT 1DICA 4MPUA 3ATLA 2BDCA 1XX9A 2A2XH 1NU7B 1Y3YA 1CA8B 1NFUA 1QRZA 1H9IE 2FO9A 2O9QA 2SFAA 1DE7H 1GI6A 1IQEA 4JZEH 5EPNA 1IHTH 1P2KA 3SI3H 3RU4E 4ZROA 2VGCC 2G4TA 1IHSH 1HBTH 3ZV9A 1GBHA 4CBNA 2EA3A 2H9TH 1C5YB 2STBE 3A81A 2WV5A 2LPRA 1MTUA 1BTXA 3VXFH 4ISHH 4ZKNU 1Z6EA 1TNJA 2P3UB 3VEQB 3KNXA 5GCHG 3ZVDA 1EXFA 2ZWLH 1GHBF 3ITIA 2AEIH 1XUGA 2XC5A 3LPRA 1T32A 2QF3A 1SGNE 1BRUP 1S84A 1SL3A 2P95A 2OBQA 2XYAA 1L1NA 2ZU4A 1ELVA 1EQ9A 3TNSA 3GY8A 2BOHB 4MG3A 1FZZA 3M7UA 1ZLRA 3BG4B 3LJOA 3ZZ9A 3LONA 1K2I1 2FTLE 1C1RA 7GCHG 1GJ8B 2FLRH 1TOCB 1IQKA 1BIOA 1BMLA 3ZVCA 4NIWA 3F68H 4I32A 1O2NA 1T31A 1UK3A 2Q6DA 3QTVH 3TJUA 3SJ9A 1O5AB 2GDDA 1AGJA 5EG4A 1IQJA 3TIUA 3UNSA 4E06H 4SGAE 1OWIA 4ZXYH 2TGPZ 4NZLA 1DUAA 1V2QT 4TYDA 4AFQA 2FIRH 2ZKSA 3O8BA 2ZDKA 1EPTC 1HGTH 1O2XA 2GP9B 3BTQE 1GBKA 1ANDA 2O8TA 4X1RU 2BD7A 1GBMA 4XBBA 1AIXH 3TNTA 2C8XB 1V2KT 3SNAA 1CGJE 2FOGA 2P93A 1BCUH 3P6ZB 8LPRA 1C2KA 1XXFA 2GVFA 3PB1E 3K9XB 4GPGA 4CRFA 1TB6H 2ZGXH 3VFEA 1O5DH 4YZUA 1LVOA 1G9IE 3M5MA 1GL1A 1C5SA 4BANB 2VIVA 4OGYA 1BRCE 4MNVA 1BHXF 1DLEA 2P16A 1ACBE 1GVLA 3DHKH 3GY6A 4Y11E 2ZDVH 3HPTB 5DJ7A 1P01A 4CR5A 4Y7AA 3MNBA 3D49H 4K1TA 3SNEA 2Z3EA 1O5EH 4JZDH 2FWWA 1GMDG 1QJ6B 2G81E 3SZEA 2CN0H 1YCPM 2ZDAH 1LO6A 2I6QA 1ESTA 1GDNA 1GHAG 5AFYH 3WY8A 4YT7H 1YKTA 2GDEH 1O38A 4ZUHA 1ZR0A 2NWNA 3PWBA 2Z94A 3EA8A 1HDTH 3NUMA 4ABGA 4BTTB 4CREA 3T62A 1YPJH 3P17H 5K7RA 3ZZ5A 2AGIX 2GTBA 1SHHB 4Q7ZA 4FUEA 1LQEA 1LQDB 1P10A 3UQVA 3H09A 2OUAA 2F9NA 1LMWB 4D9RA 3SU6A 4CHAB 3SUEA 2OBOA 4YO9A 4K3JA 5GJ4B 4DT7B 1O3LA 3R0FA 2PKSC 3RC5A 3UNQA 3BTME 4HGCA 5FHTA 4AG2A 1AB9C 3SN8A 1GJCB 2XCFA 4WVPE 1AFQC 1TOMH 1S85A 1TBRH 1GBAA 4NIYA 1KXAA 3SZNA 4BAMB 1F0TA 1HAGE 9LPRA 1O5GH 2TGTA 1ZPBA 2AMQA 5F6MA 1KSNA 1V2PT 4TY7A 4THNH 1F2SE 3Q77A 3N7OA 2BY5X 3PLPA 3A7ZA 3BF6H 3EQ0H 5JBBS 4DURA 1FY5A 4A1XA 1SGYE 2PKAB 1KXCA 1WUNH 1GJ5H 2A1DB 1GBFA 1T8OA 2YOLA 1DITH 4YOJA 1H9LB 1BBRH 1C5RA 4B6FA 4UEHH 1TRYA 4O3TA 2GCTC 2FZZA 2OC8A 1ZRKA 2EEKA 3SGQE 3LT3A 1TPSA 2EI8A 2F9PA 1AU8A 3W94A 3MTYA 2XXLA 1DLKB 5C67A 3GCOA 1A0HB 1DX5M 3MOCA 5BPEA 3TVJB 1TRMA 2CHAB 3M61U 3STIA 2A5AA 3RXMA 3QDZB 1O30A 4I7YH 1ZSLA 2ZP0H 1ELDE 4MPWA 2A0QB 2VIQA 4JCNA 3QLPH 1FUJA 1V2NT 4CH2B 2FI4E 1P3EA 2NU4E 1HJAC 3MU5A 1BMNH 3TH4H 1TIOA 1O3FA 1GPZA 1EB1H 3LH3A 3RMNH 3A7YA 1TAWA 5FX5A 3BTHE 5CE1A 4OGXA 5J4QA 2BD4A 1GMCF 3BTTE 4ESTE 4UFFH 3MH4A 4I8KA 2QXHA 1K1LA 1G30B 2VIWA 3V13A 1HFDA 1O3BA 3SUGA 3SOSA 4H4FA 3D65E 1A2CH 3KQBA 1W0YH 1T7CA 3AASA 5EXMA 3SQHE 3BN9A 2WPJS 4DGJA 2R3YA 1ZMLA 2CF8H 1HB0B 1P03A 2BHGA 2ZI2H 2BDAA 2BVXH 3PLBA 1FI8A 1P9SA 1YF4A 4MVNA 4VGCB 5B6LA 4B74A 1IAUA 2WHXA 1Q2WA 1TPAE 4MDSA 1EB2A 3RU4D 2JH5D 3A89A 4NIVA 2P8OB 2ZZUH 7LPRA 1YCPK 4MQAA 5FBEA 1C5TA 2BLQA 1A46H 4DCDA 2J95A 1EPTB 1TFXA 1FAXA 1THSH 3F9GA 3TJOA 4JZ1A 3PM3A 3GDUA 2F3CE 3TU7H 1NPMA 3LDXH 3BTKE 1PPCE 1YPMH 1KY9A 4IS5A 1KTTB 1NESE 3RLYH 1K28D 2B5TB 1DY9A 4Q7XA 1A61H 1P57B 1ZYOA 3PO1C 1P3CA 3LGTA 3ATKA 2QAAA 6ESTA 1TX8A 3H7OA 1W7GH 2P59A 1C5UA 4ABIA 1AMHA 5DP8A 8ESTE 4MNWA 4AN7A 1P12E 1A3BH 6CHAC 1GVKB 2HLCA 3UREA 3ZZDA 1UCYK 4YOIA 3JZ1B 2ZPQA 4AB8A 1TPPA 4CRGA 1XUJA 2Z7FE 1O3AA 1P2QA 4YOGA 2GCHF 3A7TA 1ZSJA 1AKSB 4M7GA 1Y5BT 1MKXK 2DE8A 1AZ8A 2C8ZB 4O9VA 3OTJE 1EAIA 2XBVA 3AW1A 4LOYH 2AMDA 1J8AA 1DXWA 1O34A 3HGPA 5ESBA 3A7WA 1RGQA 1SGIB 3T29A 4K2YA 5LPEA 3BTWE 4AYVB 1ZPCA 3M3SA 4TWWA 3LGYA 1LVYA 4DOQA 5L30H 2PFEA 2VBCA 2WZQA 2OK5A 1NRQH 3MNXA 4X2XA 5C3NA 3NK8A 2W3IA 4ABDA 4ZHLU 4Y8YA 5I46H 2ODYB 4JK5A 1UMAH 2G4UA 3SNBA 2ZDNA 1WTHD 4NCYA 2ESTE 1DVAH 6GCHF 1F0SA 3B9FH 3T26A 4CBOA 4X1QU 3S7HB 1GVZA 2AERH 2PSXA 1K9OE 1GMHG 1RTKA 4K1SA 5T3HA 1KLJH 4XBCA 4X6NA 1P0SH 1GI4A 4XE4A 4I8GA 3M5NA 1L2EA 5TCCA 1JWTA 5EODA 1MZAA 1Z1JA 1A7SA 1HJ9A 1EP5A 2PW8H 4B6EA 2VVCA 1GG6C 5A0CA 1C9PA 1TLDA 1TQ7B 1Z6JH 1MD7A 1PPFE 3KHVA 3PMBB 3BEIB 1TX6A 1AE8H 1GJ7B 4MNYA 5B6OA 1FPCH 2AGGX 1V2VT 1MAYA 4WJG2 1J15A 2A7JA 4B73A 1ELGA 5DP9A 1RJXB 3PMHB 1HJAB 3BEFB 1Y3UA
chains in the Genus database with same CATH superfamily
1SGDE 2SGDE 1W0ZU 3DA9B 1BTPA 5H4IB 3NPSA 1XUKA 4RT1A 3PMAB 3P92A 1C5VA 2OTVA 3A83A 2WPHS 2VINA 1BUIA 5EOKA 2J38A 1F7ZA 2AYWA 1QURH 1UTJA 2FM2A 1YWUA 3SUDA 5IYTA 5FBIA 5C0UA 1LVBA 5HXFA 4ZKRU 3RXPA 4FUHA 1E1RD 1C2EA 1PQ5A 1O39A 2KFWA 4F4OC 1CT2E 2Z9KA 3VB4A 3BIVH 4P02A 3K6ZA 4NA9H 3DCLA 1ABJH 1CQQA 1HIAB 4Y0YE 2UWOA 4AYYB 3A88A 5DSFA 6LPRA 1L0ZA 1MBMA 3EYDA 2A4OA 1UHBA 3GY2A 2TBSA 3TK5A 2FODA 1J14A 1C2GA 3ZV8A 1XUFA 1KIGH 1QR3E 1S82A 4I33A 3RXJA 1CHOG 1VKYA 3Q76A 3U1IB 5LH8A 1GCTC 1O3MA 1YPLH 4ABJA 1RRKA 1VJ9U 1FIZA 1MTWA 4LXBH 7GCHF 5JBTA 1UK4A 2CK3D 3SJOA 3FP8E 5E0JA 3QWCH 2OC0A 2SGPE 3RM2H 3HKIB 4R8TB 2XBWA 3ATIA 3GYMA 2GJGA 3KIDU 4DIIH 1BTWA 2ZGJA 1P2OA 4UD9H 1CE5A 4X8VH 1SGPE 2Z9IA 4KKDA 4CHAC 1D3TB 4HTCH 4E7NA 5A8YA 2ZFFH 2H9EH 3T27A 1O2YA 2FX4A 1P2NA 4U01A 1E36B 5ESTE 2ZU5A 2KAIA 1SB1H 1MQ5A 2AS9A 3PV4A 2TPIZ 2GT8A 1PPZA 1C2FA 1RTLA 2A7HA 2VWNA 1UW7A 3ZIAD 1AZZA 1QA0A 2ZGHA 6CHAB 3RC4A 1FY4A 3TPIZ 3L3TA 1ZJKA 3LGUA 5HKKD 1NM6A 5DGJA 1ZHMA 3KEEA 1H1BA 1ZZZA 4FETA 4P00A 3OU0A 1LHGH 1O3JA 1WU1A 2HNTE 5DN6D 1UO6A 1XXDA 1ELFA 2AFQB 2BDHA 2BTCE 1O2GH 1WBGB 1HAZB 3CS7A 5E2OA 2D8WA 4DVAU 1W0KD 2Z9LA 3N99A 1GMDF 1TGNA 4IMZA 5EXNA 1GBLA 1LKAA 2KCYA 3RXCA 2Z3CA 1M9UA 1QZ8A 2G8TA 1KLTA 3DSGA 2BZ6H 5C20A 2A32A 3RXTA 2FS9A 3SUFA 1GHAF 2CHAC 3I78A 1Y3WA 3U8RH 2EC9H 1GDUA 4CR9A 1Z7KA 3STJA 1GJBB 4NG9H 2WPMS 2BXUH 2O8MA 1THPB 1C5LH 1N1LA 1VITG 1GHWH 1TGTA 1YLCA 1OWEA 3BV9B 4DG4A 1CU1A 2ZGBH 3SU0A 3A84A 1YPGH 4TWYA 1MAXA 3DSPA 3TJNA 3SNCA 4OS7A 4X2WA 4Y0ZE 1JIRA 2BLWA 2J5UA 3ZYDA 1NT1A 1QJ1B 3RMMH 3MHWU 3ODDA 1O5CB 3PRBA 2IOTA 3GY7A 4UFEH 3RMOH 3LOXA 1QL7A 1L1JA 3RXRA 4O3UA 3GCTG 1Y3VA 1P11E 1GHZA 4Y71A 2F43B 4B2BA 2BQWB 1BDAA 4ZKSU 1G2MA 1NROH 2W6JD 4RSPA 4B75A 1LKBA 1SVPA 2ZHEH 2YNBA 4IBLH 5AVDA 3ZYEA 3SV9A 4BOHA 2ZDLA 2BLVA 2ANKH 2V3HH 2O8LA 1DM4B 1XVMA 1BB0B 2HNTC 1GG6B 5JYIA 4NFFA 3ZVBA 1K22H 1LPZB 1W10U 3PROA 4VGCC 1TALA 1O2OA 1MZDA 1PJPA 1GI9B 1K1NA 1IQNA 3SV7A 1YCPH 4XSKU 2P8OC 4OS2A 1UJ1A 5DP5A 1F5KU 1QHRB 1UVSH 1SC8U 5FAHA 1OWKA 2ZCKP 1SGFA 1YLDA 1V6DA 3TGJE 1XKBC 5EJLA 1TYNA 2QYIA 1AVWA 1RD3B 1K1OA 2SGFE 2HALA 3QGJA 3RXHA 1NRRH 3NXPA 1ELCA 4YM9A 1VITH 5JB8S 1K1IA 1ANCA 1QB9A 2AGEX 4Q63A 1PPGE 2VIDA 2C4FH 4CRDA 1O3NA 2A31A 2GGVB 5C5OA 4WMEA 1SSXA 4JZIA 1EOJA 1QCPA 2ZECA 1EFRD 5HM9A 3IWMA 1GHXH 2AIQA 4FUIA 4ABAA 1W11U 5GIBA 2Q6GA 3RXUA 4OS1A 3OTPA 1P2MA 1ZTKA 2JH6D 1SKYE 4INHA 1KDQB 2QXJA 1EATA 4ISNA 1JRTA 2O8UA 3KN2A 3CENA 2BVRH 2J4IA 3FZZA 1JRSA 1BA8B 3H5CB 5C0TA 1UCYH 4GHQA 5E2PA 1UTKA 2EI7A 4X2VA 3DD2H 3GISB 3VG8A 2ZC9H 3BTGE 3MQKC 2AIPA 2BLOA 2B8OH 4D9QA 1GCTB 2D1JA 2SGAA 1O3HA 1MKXH 2ASUB 1NRPH 1KTSB 2XC4A 1AN1E 1WTGH 2IPQX 2H5CA 3N7DA 1UTLM 4ZAEA 1GJ9B 2PHBA 3ZVFA 3CNRA 2UWPA 1ELBA 4DY7B 1IQLA 2F9VA 3K6YA 3T28A 2FTMA 4GSOA 4JYUH 5IDKA 1KXBA 3PWCA 1K1MA 2Y80A 3ATWA 1A5HA 5EQRA 2BY9X 4GCHG 1LVMA 2Y6TA 1H8ED 1BMAA 2Y5GA 1CSOE 1P9UA 4Y8XA 2BD2A 1ANBA 2ZTYA 1B0FA 4X8TH 2HGTH 3MFJA 3UR6A 4LZ1H 1CO7E 2PSYA 3ZVGA 4ZHMU 2A2QH 2GD4B 2G5NA 4FVDA 1AWHB 2UWLA 4H6TA 1JXPA 3MI4A 3TH3H 3I29A 3V0XA 3MNSA 1LPKB 3EE7A 3L6PA 4MLFB 1C1MA 1DT2A 3EE0B 3IG6B 2ZCHP 1O2MA 2WYJA 5L6NH 2PR3A 3RXSA 3MH6A 4ABHA 1GI2A 2J98B 1ZHPA 3HK3B 1G37A 1P2IA 3A85A 2Y81A 2ODPA 1SGRE 2UUYA 1F5RA 1PQ7A 2M5TA 2ZHFH 1GI5A 3A7XA 1Z71A 1CBWC 2FLBH 3D23A 2F9UA 1ZSKA 3VGCB 1Y3XA 1QY6A 1EAXA 4AFSA 1C1NA 2SNWA 5EW1H 1J9CH 1E34B 1J16A 2QGRA 2R0LA 5JB9S 5L2YH 3HK6B 1INCA 1O3EA 2R0KA 1O2JA 1ZHRA 7KMEH 5IK2D 1F0RA 1EPTA 1BZXE 1DFPA 2QF0A 1SG8B 3RXFA 2BDBA 1Z8JB 5JBCS 1W14U 1P2JA 1FN6A 2QN5T 4ZMAH 5BRRE 4I8HA 1LTOA 1MCVA 3E0PB 3VPKA 2FPZA 3RMLH 4KELA 5ETXA 1PYTD 1Y8TA 5EQQA 3SQEE 3O8RA 1F0UA 1DSUA 2FOMB 3TJVA 3O8CA 2RDEA 1BTZA 1WYKA 5DO4H 1FJSA 1O2RA 3RXIA 1DSTA 3BSQA 3F1SB 1SFQB 3TH2H 4KTUA 3AK5A 1EASA 1V2ST 3DSOA 1KMHB 2JKHA 4YLUA 3A82A 1Y5UT 2PP6A 3F9FA 3E8LA 5A0AE 4NIXA 1AVGH 1ZJDA 1FV9A 1WQSA 3EAJA 1SOTA 2FOBA 1O35A 1QL9A 3OFND 2Z9JA 4O03A 2QXGA 4Z0KA 1A0LA 5T6GA 1DWBH 1SBWA 2NU2E 1O2TA 2ANYA 1RS0A 3QN7A 1N6XA 2P94A 2OCVB 1VCWA 1HAVA 3P95A 4NFEA 3RXKA 2D26C 5F53A 1WCZA 4AFZA 1TNGA 1Z1IA 3GICB 3SV6A 2W26A 1ZGIA 3ZZ6A 4OS5A 1GI1A 2VH0A 3P8FA 5DP6A 2F9BH 1VZQH 4K8YA 5A8XA 1MUEB 4INLA 3BTDE 4F48B 2GMTC 1ELTA 2H9HA 1TBZH 2PGQB 1GI3A 3LC3A 4MPXA 1DY8A 3KL6A 3FKSD 3OE7D 5K0HA 4WXVA 2Y7XA 2XCNA 4CRBA 1Y59T 1ZGVA 2ZFTA 1LHEH 5GPIB 4K5ZA 3LH1A 1ELEE 3SU5A 1S0QA 5FX6A 3SO3A 4X6MA 2UUJB 2ULLA 2J9NA 2VVVA 1L1GA 2ZPRA 1LHCH 4AZ2B 1J17T 1UVOA 4K60A 3QZRA 2CF9H 1TGBA 1JMOH 2VNTA 1ZTLA 2WPLS 2WV4A 5HGGA 5JDUB 1V2OT 2BMGB 5T1VA 4Q2KA 4ISLA 4ZHAA 2WUBA 4NSVA 1YPEH 4DJZB 1EZQA 2VWLA 5E0GA 1E79D 2GX4A 5HM2A 1YM0A 9ESTA 1KXEA 2D2DA 3U8TH 4YXWD 2RCEA 1HAPH 1C5QA 1HUTH 1NFWA 2O8WA 5CHBA 2UUFB 3TLOA 1NBME 1QB1A 2OQUA 5A09A 5I25A 4ZH8A 1MBQA 3QZQA 3E6PH 1C4V2 2FESH 2FI3E 2RDLA 1SHYA 1SQAA 2GKVE 3UIRA 1O3CA 1UTQA 2GZ9A 1GMCG 1OOKB 1O5BB 1QB6A 3P8OA 2BY7X 1W8BH 3SU4A 3T2NA 1O31A 1E37B 1N6YA 1EZXC 2AMPA 4AGKA 2KM0A 3L33A 1QBNA 2TRMA 3PV5A 4XBDA 3RP2A 1W13U 4BAOB 1TGCA 3I77A 1MABB 1C2JA 1ARCA 5HIYA 2FI5E 1CBWB 1TMTH 1HAIH 1FNIA 4UFDH 4TPYA 4I8LA 4FUFA 4QT8C 3PTNA 1GBDA 4Z6AH 3QGNB 3F2HA 3FN8A 1G2LA 1C1TA 3ZZ4A 3KQEA 1C1QA 1QGFA 3E16B 1O2WA 1NFXA 3OEED 4MPVA 4XOJA 5HMAA 1GBCA 2F9OA 2QA9E 3ZZ3A 2CJIA 2G5VA 4B2AA 3GDVA 2PGBB 1IQIA 3C27B 3RUOA 2V35A 3RXVA 3SI4H 2F91A 4NA7A 1DXPA 1BJVA 5EQSA 1TONA 2XNIA 3E91A 3M3TA 4X1SU 1GBBA 1SLUB 1OXGA 3K2UA 2ZA5A 1WXRA 3KYFA 3M36A 4WY3A 1EZSC 1VITF 5FPTA 3U98H 3PLKA 1CA0B 1AE5A 1C5ZB 1BHXB 1YC0A 2J2UA 3URDA 1OP0A 2HVXA 4KTSA 2B7DH 1OWHA 2EI6A 5A0BA 2ZNKH 3ZZ7A 2ZFRH 2R3UA 3MU0A 5GCHF 4AX9H 1CVWH 2RA3A 2VU8E 1DUEA 1EKBB 4ASHA 2OXSA 4KGAA 1AVXA 3P8NA 4FUCA 3Q3YA 3E1XB 3LGVA 1ID5H 4A6LA 2JJ2D 3GCTF 1O3GA 1SLVB 2BZAA 1NRNH 4H42U 4BTIB 1NS3A 3MYWA 5GWZA 2PWXA 1W2KH 1IQFA 1D3DB 2WPIS 2ZQ1A 1SPJA 2FYQA 3TGKE 3MO3A 2C8YB 2W7UA 3ESTA 1DOJA 3NCLA 5CDFE 1T8LA 2DE9A 2FOFA 3GOVB 1TWXB 4J1YA 2XC0A 4OM9A 4U32A 3OY5U 3LJJA 2Z3DA 2QV1A 5T6FA 1GI0A 4INKA 2F4LA 4FU7A 2OINA 3MO9A 4B71A 4AOQA 1DANH 2ZQ2A 1HRTH 1FIWA 1Q31A 2JH0D 3A8AA 3T5FH 1QQ4A 3CP7A 2OD3B 1OP8A 1HV7A 3TK9A 2IN2A 1COWD 8KME2 1BTUA 2RG3A 3A8BA 1SR5C 4BNRA 2GMTB 4U2WA 2NU1E 4ABFA 2GZ7A 1ESAA 6GCHG 4UFGH 1EJNA 1HXFH 2IPHA 3EDXB 3SGBE 3A86A 3SNDA 1HXEH 3TITA 1WAYB 2XNDD 4GAWA 3ZZBA 2Z9GA 1O3IA 1BT7A 1GI7B 1JIMA 1BJUA 3LC5A 2ZDMA 1OYTH 2A45B 3SHAH 3VB6A 4X1PU 2FYRA 5C1UA 1DWEH 3RDZA 3HATH 2K8IA 1ELAA 2VH6A 3K65B 2XRCA 4IC5A 4Q80A 3AAVA 1UHBB 3AAUA 5ABWA 4BAHB 1QQUA 3BIUH 3S9CA 2ZEBA 3VGCC 5HYOA 2QY0B 1C2IA 1GBIA 2YNAA 1SGCA 1MTVA 1G36A 2TGDA 1HYLA 2SGEE 2XW9A 4SGBE 3SYJA 1SQTA 4AGJA 1C5OH 1QA7A 3W95A 1JBUH 1WQVH 4ISOA 1RIWB 3VXEH 4B2CA 1UTMA 3FAOA 1GGDB 2GT7A 2BB4A 3CS0A 3SJIA 2W5EA 3E3TA 1V2LT 1YLNA 5LPFA 4NWKA 1YBWA 5EJ1A 4GCHF 5EGMA 3ZZ8A 1K1PA 4AG1A 2ZGCA 4E7RG 2W7SA 2OP9A 2KCPA 1P02A 1GHVH 1NO9H 2BYAX 1UTOA 1WDIA 2G55A 1HLTH 1O2HA 1TA6A 1MU8B 3URCA 1O0DH 2KAIB 1HAXB 1FX0B 4A7IB 2B0FA 1PYTC 3KGPA 5C1YA 5GDSH 2WV9A 2G51A 5FL7D 2ZU2A 1ABIH 1KDQA 1GDQA 3LU9B 5FCRA 2H2ZA 1A1RA 4ZCNA 2EY4C 2JIZD 1HAYB 1QJ7B 4K1EA 4WH8A 5DG6A 1C2HA 3LKWA 1K1JA 5C1XA 1ZMJA 3B8JA 3QX5H 3N7EA 2QC2A 1VCPA 2BM2A 2QCYA 1BBRE 1XVOA 2Y7ZA 3VB7A 1SI5H 3LGWA 1D9IA 5SGAE 5DP4A 2J92A 2KCOA 1MH0A 1A3EH 1GI8B 3F9EA 4DIHH 2VWMA 2ZHQH 4IGDA 2PUQH 1RXPA 3RC6A 5C5NA 3FP6E 3PMJA 4H6SB 1IQMA 4NSYA 1JOUB 2V7QD 1P8VC 1FXYA 2VIOA 2BDGA 1NBMD 1Q3XA 5EPYA 5JPMH 1F5LA 1C1OA 1O2IA 3M5OA 5DP7A 1BMFD 4JYTA 4JMYA 2ZFQH 5DPAA 2LNCA 3RXEA 3EA7A 3VB5A 3V3MA 1MU6B 1C4U2 1EOLA 1XMNB 2J97A 4AB9A 3AW0A 1FLEE 3BG8A 4A1TA 1C1WH 1NTPA 4X8SH 3NWUA 1D6RA 3BTFE 2FOHA 3GY4A 1V2MT 3SU1A 1BTHH 4Y7BA 2FS8A 1DWDH 3KQCA 1V2UT 1QRXA 1LDTT 4IC6A 3NZIA 2A5KA 1SGTA 1KLIH 3Q3KA 1EX3A 4J2YB 1HAHH 1FY3A 1CHGA 2QIQA 4UDWH 2V6NA 8GCHG 1QFKH 2ALVA 2KX4A 2PKAA 1PQ8A 2TIOA 5TCAA 3ELAH 1S5SA 3T25A 4GUXA 3FO8D 1C5PA 1YY3A 4D76A 2XBYA 1AUJA 4M9FA 4F55A 4KTCA 4TY6A 5F03A 2VIPA 1HCGA 4NZQA 1SQOA 4I31A 3M37A 1O2PA 4HG6A 2ILNA 4NGAH 1NY22 2FOAA 2BD5A 2Z6BD 3A8DA 1FY8E 3BEUA 4Y79A 1O2ZA 2PUXB 5L2ZH 3SU2A 1H8DH 2THFB 3WWBA 1GCDA 2JETB 1UVUH 2R2MB 1VGCC 4HI3A 4Y76A 1B0EA 3V12A 2STAE 4YESB 1DS2E 1OWDA 1OYQA 1TGSZ 2VVUA 3RXOA 1SOZA 2V3MA 4RN6A 3RXAA 1OWJA 5FCKA 1AO5A 3M35A 2KCAA 3Q00A 4FU9A 4K8BA 1Z8IB 3QO6A 1C2DA 1GBEA 1S81A 1SLWB 1MCTA 4I8JA 1SQRA 3SORA 5LGOA 4BXWA 3UUZA 4DT4A 1GHBG 2R2WU 1Z8GA 1P05A 1VR1H 3GDSA 1FAKH 3M5LA 1ZMNA 3Q3XA 1C5MD 4MNXA 4ABBA 2L74A 2G52A 3UY9A 5LPRA 1E0FD 1HJ8A 2P3FH 1FDPA 2PLXA 2BD8A 2BX3A 3ATMA 1NU9A 1WOFA 5C94A 2TGAA 4JZFH 1VCQA 1QRWA 1MKWK 4KP0A 1GBTA 1ESBA 2ZF0H 1D4PB 2ANMH 3RXGA 1D6WA 3FOAA 5AFZH 3QUMP 4Y10E 1EAUA 5E8EH 1O2KA 2KZ4A 1YPKH 2OQ5A 1LHDH 1A4WH 5G4BA 4Q4LA 2V3OH 4CH8B 4NA8A 1D3QB 4TPIZ 3U8OH 2I6SA 4YTAA 3OYPA 1E38B 1P04A 2IJOB 3M7QA 2F83A 1O2UA 4B1TA 4FU8A 3PV2A 1QIXB 2CMYA 2Q6FA 3TGIE 2BY8X 3R3GB 1FPHH 1LCYA 2ZU1A 3MH7A 3RXDA 3A80A 1IQGA 1OX1A 1BMMH 1E35B 2SGQE 1ETRH 1A5IA 1UTPA 2BOKA 3KQDA 1GHYH 4BTUB 2QF5A 1C1VH 2FDAA 2VGCB 4CRCA 2BD3A 4FUGA 3SW2B 3F0PA 5C17A 1CA0C 4U30A 3VB3A 1ETTH 3OY6U 1MTNC 2FOEA 4WMDA 3KQ5A 3ODFA 4ZXXH 1OPHB 1SGQE 1WSSH 1S6FA 4HZHA 2VJ1A 3ZZCA 4UE7H 5KEDA 3LGIA 1ZPZA 2B9LA 1K21H 1HPGA 4BXSA 2OLGA 1PFXC 3RXLA 1AWFH 1GMHF 1QNJA 1LPGB 1YPHE 1AD8H 3F2FA 1DPOA 4FUBA 2C3SA 3HKJB 3GCHC 1L4ZA 1UVPA 2FOCA 1ZTJA 1SGEE 2QXIA 1XM1A 1YP9A 4F49A 1T4VH 2UUKB 1AKSA 3SHCH 2OC7A 1THRH 3RU4T 1MQ6A 1A5GH 2K0QA 5JBAS 3MNCA 3UOUA 2A5IA 3FFGA 1OP2A 1QTFA 4OS6A 1FMGA 2M2AA 5AHGH 1N8OC 4ZKOU 3F6UH 2C90B 1SFIA 2FP7B 1KXDA 1T8MA 1XUIA 2ZHWH 1O3DA 2XBXA 2XWAA 2XOKD 3P8GA 1AFEH 2ZIQH 5PTPA 1UK2A 1NFYA 4K69A 1EUFA 4XFQA 1G3EA 1W7XH 2OC1A 1O3PB 1TRNA 3PTBA 1O2QA 3FP7E 1Y5AT 1OHHD 2H5DA 3SV2H 2ZO3H 1W3CA 2BX4A 4D7GA 1TA2A 2PTCE 5DKMA 4IN1A 5T6DA 1NN6A 2BDYA 4RI0A 2P3TB 1BITA 1PPBH 3HGNA 1TNKA 4XDEA 5DK1A 2BXTH 3OSYA 4X1NU 1GL0E 3LIWA 4GLYA 1QBOA 1F92A 1GJ6A 1O37A 2ZFPH 1YPHC 4ABEA 1KYNA 2ZG0H 1GWAA 5F8ZA 4X2YA 1TNHA 1BRAA 2ZFSA 1C5NH 2FMJA 2Y5FA 4A5TS 5CHAC 2H1UA 1O3OA 4JYVH 3V7TA 1V2TT 3GYLB 2HVYB 1AI8H 3GCNA 2Y5HA 1AY6H 1ZOMA 4LK4A 3WW7A 3SGAE 3U9AH 3P70B 2NU3E 2J94A 5EU8A 3S69A 1CHOF 3F9HA 4X0WU 1C5WB 3FZDA 1O32A 3RM0H 1TE0A 3RXQA 1O3KA 3JZ2B 3ENSB 1ZRBA 3UR9A 4Y8ZA 4MTBA 4I86A 1VGCB 1RIWC 2ZCLP 4DW2U 1GGDC 1NRSH 2HOBA 1L4DA 2JDID 1C1PA 1V2WT 1TX7A 3E90B 1B7XB 1DDJA 1EJMA 4AFUA 1HAVB 3UNRA 2BD9A 1ETSH 1X7AC 3A7VA 1LHFH 2VB0A 2HWLB 2C8WB 1IQHA 1CT0E 3S0NA 5EW2H 1GJAB 1C2LA 1BOQA 4HFPB 3O8DA 2PKSB 2ZTXA 3MU4A 3QTOH 1GJDB 3SU3A 1AB9B 1C1SA 1CGHA 5A2MH 3DFLA 2WYGA 3GY5A 3MH5A 3FANA 4XRNA 4AORA 2NU0E 3RXBA 2ZPSA 3MMGA 1AFQB 2ZHDA 3E0NB 2BVSH 5EXLA 1O36A 5FPSA 1NC6A 2DUCA 2W6ID 3KCGH 2BDIA 1HIAA 4IN2A 4X8UH 3WWFA 4PROA 2HPQH 7ESTE 1NZQH 3GY3A 3UB0A 4E05H 1FQ3A 1TNIA 2SNVA 3SV8A 1WV7H 3DUXH 4R0IA 4B76A 3UWJH 1QL8A 4AC9A 2HRVA 2BY6X 4OS4A 3UTUH 1G3DA 4ISIH 3BG4C 1C1UH 3B23B 1BBRK 4FVBA 2RA0A 4RKJB 1MD8A 2GCTB 3A87A 4BAKB 1P09A 5F8XA 1TMBH 1C2MA 1H4WA 1G3CA 2YMSC 3FVFB 2A4RA 3RLWH 2FEQH 1T8NA 1VJAU 1HAOH 1MMJN 2AHME 4UONA 2Q1JA 1PPHE 2Y82A 1Z8RA 4YLQH 3KF2A 1BQYA 2V0BA 1EAWA 1O2SA 1BTYA 2R9PA 2C93B 2FX6A 2VWOA 1S83A 2A4GA 1AHTH 1OS8A 3DFJA 1BRBE 1CT4E 5DP3A 3EGKH 1MTNB 4Q7YA 1TBQH 2FXRA 1V2RT 2CGAA 2PV9B 1TQ0B 3UFAA 4D8NA 1S6LA 3UOPA 1C4Y2 1V3XA 3C1KA 5AF9H 3NKKA 4YT6H 1EJAA 3IITA 1FY1A 2IJD1 4GVUA 1YYY1 3ZVAA 5FPYA 3ZZAA 2GV6A 5C2ZA 3F2GA 1GJ4H 3QK1A 3SJ8A 4A1VA 1RTFB 1KXFA 1O33A 3S9BA 4IW4E 2XTTB 3GCHB 4FXGH 4Y6DA 1SMFE 2GV7A 1O2VA 1C9TA 3MO6A 3U69H 2A7CA 2GCHG 1TABE 3UQOA 1ORFA 3ZVEA 4D7FA 3SJKA 3M7TA 1MTSA 3DT0H 1CGIE 4WXIA 1GBJA 2W3KA 3MU8A 4FUDA 1U6QA 1O2LA 2HNTF 3EA9A 3SBKA 1N8OB 1S0RA 4WF8A 1B5GH 2LELA 3AVZA 2CV3A 2ZU3A 4BAQB 4WH6A 1OSSA 4JK6A 1TNLA 1D3PB 4FUJA 2JETC 5GXPA 2AH4X 1QBVH 4GHTA 4RKOB 4IMQA 2PTNA 2ALPA 4TT3D 1O5FH 3TK6A 5CMXH 1S6HA 2WPKS 1SGFG 1P06A 3BTEE 1H9HE 3MU1A 5FXLA 4LZ4B 4CRAA 2ANWA 1G32B 2CXVA 2WINI 1YGCH 3H7TA 2BQ7B 3MWIU 1RFNA 1HNEE 3KYGA 4WMFA 3PO1B 2HPPH 3UPEA 1TMUH 1UVTH 1PPEE 1EZUC 3F3BA 2J34A 3M3VA 5E0HA 4A92A 5GNDA 3U1JB 3OX7U 1ARBA 1T4UH 5F8TA 1FN8A 1ANEA 2H6MA 5A8ZA 1A0JA 1AUTC 3D62A 3S7KB 1SLXB 1EP6A 1XUHA 4NWLA 1UCYE 1OKXA 3S9AA 4X6PA 1W12U 1MKWH 3G01A 1H8IH 4WWYA 3UWIA 1FONA 2XWBI 5CHAB 1XKAC 3W1EA 1C5XB 2A4QA 3PYHA 8GCHF 2GZ8A 4O97A 1AQ7A 1TPOA 5TJXA 1PQAA 1DWCH 2ZTZA 2ODQA 2K1QA 1G3BA 2G00A 2BQ6B 2WUCA 1IOEA 3A8CA 4X6OA 1UTNA 5J4SA 1V2JT 1DICA 4MPUA 2L6OA 3ATLA 2BDCA 1XX9A 2A2XH 1NU7B 1Y3YA 1CA8B 1NFUA 1QRZA 1H9IE 2FO9A 2O9QA 2SFAA 1DE7H 1GI6A 1IQEA 4JZEH 5EPNA 1IHTH 1P2KA 3SI3H 3RU4E 2QF4A 4XD7D 4ZROA 2VGCC 2G4TA 1IHSH 1HBTH 3ZV9A 1GBHA 4CBNA 2EA3A 2H9TH 1C5YB 2STBE 3A81A 2WV5A 2LPRA 1MTUA 1K0HA 1BTXA 3VXFH 4ISHH 4ZKNU 1Z6EA 1TNJA 2P3UB 5EJZA 3VEQB 3KNXA 5GCHG 3ZVDA 1EXFA 2ZWLH 1GHBF 3ITIA 2AEIH 1XUGA 2XC5A 3LPRA 1T32A 2QF3A 1SGNE 1BRUP 1S84A 1SL3A 2P95A 2OBQA 2XYAA 1L1NA 2ZU4A 1ELVA 1EQ9A 3TNSA 3GY8A 2BOHB 4MG3A 1FZZA 2YMSD 3M7UA 1ZLRA 3BG4B 3LJOA 3ZZ9A 3LONA 1K2I1 2FTLE 1C1RA 7GCHG 1GJ8B 2FLRH 2YMSB 1TOCB 1IQKA 1BIOA 1BMLA 3ZVCA 4NIWA 3F68H 4I32A 1O2NA 1T31A 1UK3A 2Q6DA 3QTVH 3TJUA 3SJ9A 1O5AB 2GDDA 1AGJA 5EG4A 1IQJA 3TIUA 3UNSA 4E06H 4SGAE 1OWIA 4ZXYH 2TGPZ 4NZLA 1DUAA 1V2QT 4TYDA 4AFQA 2FIRH 2ZKSA 3O8BA 2ZDKA 1EPTC 1HGTH 1O2XA 2GP9B 3BTQE 1GBKA 1ANDA 2O8TA 4X1RU 2BD7A 1GBMA 4XBBA 1AIXH 3TNTA 2C8XB 1V2KT 3SNAA 1CGJE 2FOGA 2P93A 1BCUH 3P6ZB 8LPRA 1C2KA 1H8HD 1XXFA 2GVFA 3PB1E 3K9XB 4GPGA 4CRFA 1TB6H 2ZGXH 3VFEA 1O5DH 4YZUA 1LVOA 1G9IE 3M5MA 1GL1A 2HLDD 1C5SA 4BANB 2VIVA 4OGYA 1BRCE 4MNVA 1BHXF 1DLEA 2P16A 1ACBE 1GVLA 3DHKH 3GY6A 2J98A 2ZDVH 3HPTB 4Y11E 5DJ7A 1P01A 4CR5A 4Y7AA 3MNBA 3D49H 4K1TA 3SNEA 2Z3EA 1O5EH 4JZDH 2FWWA 1GMDG 1QJ6B 2G81E 3SZEA 2CN0H 1YCPM 2ZDAH 5KGOA 1LO6A 2I6QA 2LP6A 1ESTA 1GDNA 1GHAG 5AFYH 3WY8A 4YT7H 1YKTA 2GDEH 1O38A 4ZUHA 1ZR0A 2NWNA 3PWBA 2Z94A 3EA8A 1HDTH 3NUMA 4ABGA 4BTTB 4CREA 5KECA 3T62A 1YPJH 3P17H 5K7RA 3ZZ5A 2AGIX 2GTBA 1SHHB 4Q7ZA 4TSFD 4FUEA 1LQEA 1LQDB 1P10A 3H09A 3UQVA 2OUAA 2F9NA 1LMWB 4D9RA 3SU6A 4CHAB 3SUEA 2OBOA 4YO9A 4K3JA 5GJ4B 1W0JD 4DT7B 1O3LA 3R0FA 2PKSC 3RC5A 3UNQA 3BTME 4HGCA 5FHTA 4AG2A 1AB9C 3SN8A 1GJCB 2XCFA 4WVPE 1AFQC 1TOMH 1S85A 1TBRH 1GBAA 4NIYA 1KXAA 3SZNA 4BAMB 1F0TA 1HAGE 3OAAD 9LPRA 1O5GH 2TGTA 1ZPBA 2AMQA 5F6MA 1KSNA 1V2PT 4TY7A 4THNH 1F2SE 3Q77A 3N7OA 2BY5X 3PLPA 3A7ZA 3BF6H 3EQ0H 3GS9A 3PRDA 1FY5A 5JBBS 4DURA 4A1XA 1SGYE 2PKAB 1KXCA 1WUNH 1GJ5H 2A1DB 1GBFA 1T8OA 2YOLA 1DITH 4YOJA 1H9LB 1BBRH 1C5RA 4B6FA 4UEHH 1TRYA 4O3TA 2GCTC 2FZZA 2EQNA 2OC8A 1ZRKA 2EEKA 3SGQE 3LT3A 1TPSA 2WPDD 2EI8A 3OEHD 2F9PA 4ACAA 1AU8A 3W94A 3MTYA 2XXLA 1DLKB 5C67A 3GCOA 1A0HB 1DX5M 3MOCA 5BPEA 3TVJB 1TRMA 2CHAB 3M61U 3STIA 2A5AA 3RXMA 3QDZB 1O30A 4I7YH 1ZSLA 2ZP0H 1ELDE 4MPWA 2A0QB 2VIQA 4JCNA 3QLPH 1FUJA 1V2NT 4CH2B 2FI4E 1P3EA 2NU4E 1HJAC 3MU5A 1BMNH 3TH4H 1TIOA 1O3FA 1GPZA 1EB1H 3LH3A 3RMNH 3A7YA 1TAWA 5FX5A 3BTHE 5CE1A 4OGXA 5J4QA 2BD4A 1GMCF 3BTTE 4ESTE 4UFFH 3MH4A 4I8KA 2QXHA 1K1LA 1G30B 2KR7A 2VIWA 3V13A 1HFDA 1O3BA 3SUGA 3SOSA 4H4FA 3D65E 1A2CH 3KQBA 1W0YH 1T7CA 3AASA 5EXMA 3SQHE 3BN9A 2WPJS 4DGJA 2R3YA 1ZMLA 2CF8H 1HB0B 1P03A 2BHGA 2ZI2H 5EIYA 2BDAA 2BVXH 3PLBA 1FI8A 1P9SA 1YF4A 4MVNA 4VGCB 5B6LA 4B74A 1IAUA 2WHXA 1Q2WA 1TPAE 4MDSA 1EB2A 3RU4D 2JH5D 3A89A 4NIVA 2P8OB 2ZZUH 7LPRA 1YCPK 4MQAA 5FBEA 1C5TA 2BLQA 1A46H 1E1QD 4ACBA 4DCDA 2J95A 1EPTB 1TFXA 1FAXA 1THSH 3F9GA 3TJOA 4JZ1A 3PM3A 3GDUA 2F3CE 3TU7H 1NPMA 3LDXH 3BTKE 1PPCE 5HIZA 1YPMH 1KY9A 4IS5A 1KTTB 1NESE 3RLYH 1K28D 4Z1MD 2B5TB 1DY9A 4Q7XA 1A61H 1P57B 1ZYOA 3PO1C 1P3CA 3LGTA 3ATKA 2QAAA 6ESTA 1TX8A 3H7OA 1W7GH 2P59A 1C5UA 4ABIA 1AMHA 5DP8A 8ESTE 4MNWA 4AN7A 1P12E 1A3BH 6CHAC 3UAIC 1GVKB 2HLCA 3UREA 3ZZDA 1UCYK 4ASUD 4YOIA 3JZ1B 2WSSD 2ZPQA 4AB8A 1TPPA 4CRGA 1XUJA 2Z7FE 1O3AA 1P2QA 4YOGA 2GCHF 3A7TA 1ZSJA 1AKSB 4M7GA 1Y5BT 1MKXK 2DE8A 1AZ8A 2C8ZB 4O9VA 3OTJE 4RT0A 1EAIA 2XBVA 3AW1A 4LOYH 2AMDA 1J8AA 1DXWA 1O34A 3HGPA 5ESBA 3A7WA 1RGQA 1SGIB 3T29A 2JJ1D 4K2YA 5LPEA 3BTWE 4AYVB 1ZPCA 3M3SA 4TWWA 3F0OA 3LGYA 1LVYA 4DOQA 5L30H 2PFEA 2VBCA 3U28C 2WZQA 2OK5A 1NRQH 3MNXA 4X2XA 5C3NA 3NK8A 2W3IA 4FOUC 4ABDA 4ZHLU 4Y8YA 5I46H 2ODYB 4JK5A 1UMAH 2G4UA 3SNBA 2ZDNA 2RFKC 1WTHD 4NCYA 2ESTE 1DVAH 6GCHF 1F0SA 3B9FH 3T26A 4CBOA 4X1QU 3S7HB 1GVZA 2AERH 2PSXA 1K9OE 1GMHG 1RTKA 4K1SA 5T3HA 1KLJH 4XBCA 4X6NA 1P0SH 1GI4A 4XE4A 4I8GA 2QE7D 3M5NA 1L2EA 5TCCA 1JWTA 5EODA 1MZAA 1Z1JA 1A7SA 1HJ9A 1EP5A 2PW8H 4B6EA 2VVCA 1GG6C 5A0CA 1C9PA 1TLDA 1TQ7B 1Z6JH 1MD7A 1PPFE 3KHVA 3PMBB 3BEIB 1TX6A 3NRLA 1AE8H 1GJ7B 4MNYA 5B6OA 1FPCH 2AGGX 1V2VT 1MAYA 4WJG2 1J15A 2A7JA 4B73A 1ELGA 5DP9A 1RJXB 3PMHB 1HJAB 3BEFB 1Y3UA
chains in the Genus database with same CATH topology
1SGDE 2SGDE 1W0ZU 3DA9B 1BTPA 5H4IB 3NPSA 1XUKA 3PMAB 3P92A 1C5VA 2OTVA 3A83A 2WPHS 2VINA 1BUIA 5EOKA 2J38A 1F7ZA 2AYWA 1QURH 1UTJA 2FM2A 3SUDA 5IYTA 5FBIA 5C0UA 1LVBA 5HXFA 4ZKRU 3RXPA 4FUHA 1E1RD 1C2EA 1PQ5A 1O39A 2KFWA 4F4OC 1CT2E 2Z9KA 3VB4A 3BIVH 3K6ZA 4NA9H 3DCLA 1ABJH 1CQQA 1HIAB 4Y0YE 2UWOA 4AYYB 3A88A 5DSFA 6LPRA 1L0ZA 1MBMA 3EYDA 2A4OA 1UHBA 3GY2A 2TBSA 3TK5A 2FODA 1J14A 1C2GA 3ZV8A 1XUFA 1KIGH 1QR3E 1S82A 4I33A 3RXJA 1CHOG 3Q76A 3U1IB 5LH8A 1GCTC 1O3MA 1YPLH 4ABJA 1RRKA 1VJ9U 1FIZA 1MTWA 4LXBH 7GCHF 5JBTA 1UK4A 2CK3D 3SJOA 3FP8E 5E0JA 3QWCH 2OC0A 2SGPE 3RM2H 3HKIB 4R8TB 2XBWA 3ATIA 3GYMA 3KIDU 4DIIH 1BTWA 2ZGJA 1P2OA 4UD9H 1CE5A 4X8VH 1SGPE 2Z9IA 4KKDA 4CHAC 1D3TB 4HTCH 4E7NA 5A8YA 2ZFFH 2H9EH 3T27A 1O2YA 2FX4A 1P2NA 4U01A 1E36B 5ESTE 2ZU5A 2KAIA 1SB1H 1MQ5A 2AS9A 3PV4A 2TPIZ 2GT8A 1PPZA 1C2FA 1RTLA 2A7HA 2VWNA 3ZIAD 1AZZA 1QA0A 2ZGHA 6CHAB 3RC4A 1FY4A 3TPIZ 3L3TA 1ZJKA 3LGUA 5HKKD 1NM6A 5DGJA 1ZHMA 3KEEA 1H1BA 1ZZZA 4FETA 3OU0A 1LHGH 1O3JA 1WU1A 2HNTE 5DN6D 1UO6A 1XXDA 1ELFA 2AFQB 2BDHA 2BTCE 1O2GH 1WBGB 1HAZB 3CS7A 5E2OA 2D8WA 4DVAU 1W0KD 2Z9LA 4IMZA 1GMDF 1TGNA 5EXNA 3N99A 1GBLA 1LKAA 2KCYA 3RXCA 2Z3CA 1M9UA 1KLTA 2G8TA 2BZ6H 5C20A 2A32A 3RXTA 2FS9A 3SUFA 1GHAF 2CHAC 3I78A 1Y3WA 3U8RH 2EC9H 1GDUA 4CR9A 1Z7KA 3STJA 1GJBB 4NG9H 2WPMS 2BXUH 2O8MA 1THPB 1C5LH 1N1LA 1VITG 1GHWH 1TGTA 1YLCA 1OWEA 3BV9B 4DG4A 1CU1A 2ZGBH 3SU0A 3A84A 1YPGH 4TWYA 1MAXA 3TJNA 3DSPA 3SNCA 4OS7A 4X2WA 4Y0ZE 1JIRA 2BLWA 2J5UA 3ZYDA 1NT1A 1QJ1B 3RMMH 3MHWU 3ODDA 1O5CB 3PRBA 2IOTA 3GY7A 4UFEH 3RMOH 3LOXA 1QL7A 1L1JA 3RXRA 4O3UA 3GCTG 1Y3VA 1P11E 1GHZA 4Y71A 2F43B 4B2BA 2BQWB 1BDAA 4ZKSU 1G2MA 1NROH 4RSPA 2W6JD 4B75A 1LKBA 1SVPA 2ZHEH 2YNBA 4IBLH 5AVDA 3ZYEA 3SV9A 4BOHA 2ZDLA 2BLVA 2ANKH 2V3HH 2O8LA 1DM4B 1XVMA 1BB0B 2HNTC 1GG6B 5JYIA 4NFFA 3ZVBA 1K22H 1LPZB 1W10U 3PROA 4VGCC 1TALA 1O2OA 1MZDA 1PJPA 1GI9B 1K1NA 1IQNA 3SV7A 1YCPH 4XSKU 2P8OC 4OS2A 1UJ1A 5DP5A 1F5KU 1QHRB 1UVSH 1SC8U 5FAHA 1OWKA 2ZCKP 1SGFA 1YLDA 1V6DA 3TGJE 1XKBC 1TYNA 2QYIA 1AVWA 1RD3B 1K1OA 2SGFE 2HALA 3QGJA 3RXHA 1NRRH 3NXPA 1ELCA 4YM9A 1VITH 5JB8S 1K1IA 1ANCA 1QB9A 2AGEX 4Q63A 1PPGE 2VIDA 2C4FH 4CRDA 1O3NA 2A31A 2GGVB 5C5OA 4WMEA 1SSXA 4JZIA 1EOJA 1QCPA 2ZECA 5HM9A 1EFRD 3IWMA 1GHXH 2AIQA 4FUIA 4ABAA 1W11U 5GIBA 2Q6GA 3RXUA 4OS1A 3OTPA 1P2MA 1ZTKA 2JH6D 1SKYE 4INHA 1KDQB 2QXJA 1EATA 4ISNA 1JRTA 2O8UA 3KN2A 3CENA 2BVRH 2J4IA 3FZZA 1JRSA 1BA8B 3H5CB 5C0TA 1UCYH 4GHQA 5E2PA 1UTKA 2EI7A 4X2VA 3DD2H 3GISB 3VG8A 2ZC9H 3BTGE 2AIPA 2BLOA 2B8OH 4D9QA 1GCTB 2D1JA 2SGAA 1O3HA 1MKXH 2ASUB 1NRPH 1KTSB 2XC4A 1AN1E 1WTGH 3N7DA 2H5CA 1UTLM 4ZAEA 1GJ9B 2PHBA 3ZVFA 2UWPA 1ELBA 4DY7B 1IQLA 2F9VA 3K6YA 3T28A 2FTMA 4GSOA 4JYUH 5IDKA 1KXBA 3PWCA 1K1MA 2Y80A 3ATWA 1A5HA 5EQRA 2BY9X 4GCHG 1LVMA 2Y6TA 1H8ED 1BMAA 2Y5GA 1CSOE 1P9UA 4Y8XA 2BD2A 1ANBA 2ZTYA 1B0FA 4X8TH 2HGTH 3MFJA 3UR6A 4LZ1H 1CO7E 2PSYA 3ZVGA 4ZHMU 2A2QH 2GD4B 2G5NA 4FVDA 1AWHB 2UWLA 4H6TA 1JXPA 3MI4A 3TH3H 3I29A 3V0XA 3MNSA 1LPKB 3L6PA 4MLFB 1C1MA 1DT2A 3EE0B 3IG6B 2ZCHP 1O2MA 2WYJA 5L6NH 2PR3A 3RXSA 3MH6A 4ABHA 1GI2A 1ZHPA 3HK3B 1G37A 1P2IA 3A85A 2Y81A 2ODPA 1SGRE 2UUYA 1F5RA 1PQ7A 2M5TA 2ZHFH 1GI5A 3A7XA 1Z71A 1CBWC 2FLBH 3D23A 2F9UA 1ZSKA 3VGCB 1Y3XA 1QY6A 1EAXA 4AFSA 1C1NA 2SNWA 5EW1H 1J9CH 1E34B 1J16A 2QGRA 2R0LA 5JB9S 5L2YH 3HK6B 1INCA 1O3EA 2R0KA 1O2JA 1ZHRA 7KMEH 5IK2D 1F0RA 1EPTA 1BZXE 1DFPA 2QF0A 1SG8B 3RXFA 2BDBA 1Z8JB 5JBCS 1W14U 1P2JA 1FN6A 2QN5T 4ZMAH 5BRRE 4I8HA 1LTOA 1MCVA 3E0PB 3VPKA 2FPZA 3RMLH 4KELA 5ETXA 1PYTD 1Y8TA 5EQQA 3SQEE 3O8RA 1F0UA 1DSUA 2FOMB 3TJVA 3O8CA 1BTZA 1WYKA 5DO4H 1FJSA 1O2RA 3RXIA 1DSTA 3BSQA 3F1SB 1SFQB 3TH2H 4KTUA 3AK5A 1EASA 1V2ST 3DSOA 1KMHB 2JKHA 4YLUA 3A82A 1Y5UT 3F9FA 3E8LA 5A0AE 4NIXA 1AVGH 1ZJDA 1FV9A 1WQSA 3EAJA 1SOTA 2FOBA 1O35A 1QL9A 3OFND 2Z9JA 4O03A 2QXGA 4Z0KA 1A0LA 5T6GA 1DWBH 1SBWA 2NU2E 1O2TA 2ANYA 1RS0A 3QN7A 1N6XA 2P94A 2OCVB 1VCWA 1HAVA 3P95A 4NFEA 3RXKA 2D26C 4AFZA 1WCZA 5F53A 1TNGA 1Z1IA 3GICB 3SV6A 2W26A 1ZGIA 3ZZ6A 4OS5A 1GI1A 2VH0A 3P8FA 5DP6A 2F9BH 1VZQH 4K8YA 5A8XA 1MUEB 4INLA 3BTDE 2GMTC 1ELTA 2H9HA 1TBZH 2PGQB 1GI3A 3LC3A 4MPXA 1DY8A 3KL6A 3FKSD 3OE7D 5K0HA 4WXVA 2Y7XA 2XCNA 4CRBA 1Y59T 1ZGVA 2ZFTA 1LHEH 5GPIB 4K5ZA 3LH1A 1ELEE 3SU5A 1S0QA 5FX6A 3SO3A 4X6MA 2UUJB 2ULLA 2J9NA 2VVVA 1L1GA 2ZPRA 1LHCH 4AZ2B 1J17T 1UVOA 4K60A 3QZRA 2CF9H 1TGBA 1JMOH 2VNTA 1ZTLA 2WPLS 2WV4A 5HGGA 5JDUB 1V2OT 2BMGB 5T1VA 4Q2KA 4ISLA 4ZHAA 2WUBA 4NSVA 1YPEH 4DJZB 1EZQA 2VWLA 5E0GA 2GX4A 1E79D 5HM2A 1YM0A 9ESTA 1KXEA 2D2DA 3U8TH 4YXWD 2RCEA 1HAPH 1C5QA 1HUTH 1NFWA 2O8WA 5CHBA 2UUFB 3TLOA 1NBME 1QB1A 2OQUA 5A09A 5I25A 4ZH8A 1MBQA 3QZQA 3E6PH 1C4V2 2FESH 2FI3E 2RDLA 1SHYA 1SQAA 2GKVE 3UIRA 1O3CA 1UTQA 2GZ9A 1GMCG 1OOKB 1O5BB 1QB6A 3P8OA 2BY7X 1W8BH 3SU4A 3T2NA 1O31A 1E37B 1N6YA 1EZXC 2AMPA 4AGKA 2KM0A 3L33A 1QBNA 2TRMA 3PV5A 4XBDA 3RP2A 1W13U 4BAOB 1TGCA 3I77A 1MABB 1C2JA 1ARCA 2FI5E 1CBWB 1TMTH 1HAIH 1FNIA 4UFDH 4TPYA 4I8LA 4FUFA 4QT8C 3PTNA 1GBDA 4Z6AH 3QGNB 3F2HA 3FN8A 1G2LA 1C1TA 3ZZ4A 3KQEA 1C1QA 1QGFA 3E16B 1O2WA 1NFXA 4MPVA 4XOJA 3OEED 5HMAA 1GBCA 2F9OA 2QA9E 3ZZ3A 2CJIA 2G5VA 4B2AA 3GDVA 2PGBB 1IQIA 3C27B 3RUOA 2V35A 3RXVA 3SI4H 2F91A 4NA7A 1DXPA 1BJVA 5EQSA 1TONA 2XNIA 3E91A 3M3TA 4X1SU 1GBBA 1SLUB 1OXGA 3K2UA 2ZA5A 1WXRA 3M36A 4WY3A 1EZSC 1VITF 5FPTA 3U98H 3PLKA 1CA0B 1AE5A 1C5ZB 1BHXB 1YC0A 2J2UA 3URDA 1OP0A 2HVXA 4KTSA 2B7DH 1OWHA 2EI6A 5A0BA 2ZNKH 3ZZ7A 2ZFRH 2R3UA 3MU0A 5GCHF 4AX9H 1CVWH 2RA3A 2VU8E 1DUEA 1EKBB 4ASHA 2OXSA 4KGAA 1AVXA 3P8NA 4FUCA 3Q3YA 3E1XB 3LGVA 1ID5H 4A6LA 3GCTF 2JJ2D 1O3GA 1SLVB 2BZAA 1NRNH 4H42U 4BTIB 1NS3A 3MYWA 5GWZA 2PWXA 1W2KH 1IQFA 1D3DB 2WPIS 2ZQ1A 1SPJA 2FYQA 3TGKE 3MO3A 2C8YB 2W7UA 3ESTA 1DOJA 3NCLA 5CDFE 1T8LA 2DE9A 2FOFA 3GOVB 1TWXB 4J1YA 2XC0A 4OM9A 4U32A 3OY5U 3LJJA 2Z3DA 2QV1A 5T6FA 1GI0A 4INKA 2F4LA 4FU7A 2OINA 3MO9A 4B71A 4AOQA 1DANH 2ZQ2A 1HRTH 1FIWA 1Q31A 2JH0D 3A8AA 3T5FH 1QQ4A 3CP7A 2OD3B 1OP8A 1HV7A 3TK9A 2IN2A 1COWD 8KME2 1BTUA 2RG3A 3A8BA 1SR5C 4BNRA 2GMTB 4U2WA 2NU1E 4ABFA 2GZ7A 1ESAA 6GCHG 4UFGH 1EJNA 1HXFH 2IPHA 3EDXB 3SGBE 3A86A 3SNDA 1HXEH 3TITA 1WAYB 2XNDD 4GAWA 3ZZBA 2Z9GA 1O3IA 1BT7A 1GI7B 1JIMA 1BJUA 3LC5A 2ZDMA 1OYTH 2A45B 3SHAH 3VB6A 4X1PU 2FYRA 5C1UA 1DWEH 3RDZA 3HATH 2K8IA 1ELAA 2VH6A 3K65B 2XRCA 4IC5A 4Q80A 3AAVA 1UHBB 3AAUA 5ABWA 4BAHB 1QQUA 3BIUH 3S9CA 2ZEBA 3VGCC 5HYOA 2QY0B 1C2IA 1GBIA 2YNAA 1SGCA 1MTVA 1G36A 2TGDA 1HYLA 2SGEE 2XW9A 4SGBE 3SYJA 1SQTA 4AGJA 1C5OH 1QA7A 3W95A 1JBUH 1WQVH 4ISOA 1RIWB 3VXEH 4B2CA 1UTMA 3FAOA 1GGDB 2GT7A 2BB4A 3CS0A 3SJIA 2W5EA 3E3TA 1V2LT 5LPFA 4NWKA 1YBWA 4GCHF 5EGMA 3ZZ8A 1K1PA 4AG1A 2ZGCA 4E7RG 2W7SA 2OP9A 2KCPA 1P02A 1GHVH 1NO9H 2BYAX 1UTOA 2G55A 1HLTH 1O2HA 1TA6A 1MU8B 3URCA 1O0DH 2KAIB 1HAXB 1FX0B 4A7IB 2B0FA 1PYTC 3KGPA 5C1YA 5GDSH 2WV9A 2G51A 5FL7D 2ZU2A 1ABIH 1KDQA 1GDQA 3LU9B 5FCRA 2H2ZA 1A1RA 4ZCNA 2JIZD 1HAYB 1QJ7B 4K1EA 4WH8A 5DG6A 1C2HA 3LKWA 1K1JA 5C1XA 1ZMJA 3B8JA 3QX5H 3N7EA 2QC2A 1VCPA 2BM2A 2QCYA 1BBRE 1XVOA 2Y7ZA 3VB7A 1SI5H 3LGWA 1D9IA 5SGAE 5DP4A 2J92A 2KCOA 1MH0A 1A3EH 1GI8B 3F9EA 4DIHH 2VWMA 2ZHQH 4IGDA 2PUQH 1RXPA 3RC6A 5C5NA 3FP6E 3PMJA 4H6SB 1IQMA 4NSYA 1JOUB 2V7QD 1P8VC 1FXYA 2VIOA 2BDGA 1Q3XA 5EPYA 5JPMH 1NBMD 1F5LA 1C1OA 1O2IA 3M5OA 5DP7A 1BMFD 4JYTA 4JMYA 2ZFQH 5DPAA 2LNCA 3RXEA 3EA7A 3VB5A 3V3MA 1MU6B 1C4U2 1EOLA 1XMNB 4AB9A 3AW0A 1FLEE 3BG8A 4A1TA 1C1WH 1NTPA 4X8SH 3NWUA 1D6RA 3BTFE 2FOHA 3GY4A 1V2MT 3SU1A 1BTHH 4Y7BA 2FS8A 1DWDH 3KQCA 1V2UT 1QRXA 1LDTT 4IC6A 3NZIA 2A5KA 1SGTA 1KLIH 3Q3KA 1EX3A 4J2YB 1HAHH 1FY3A 1CHGA 2QIQA 4UDWH 2V6NA 8GCHG 1QFKH 2ALVA 2PKAA 1PQ8A 2TIOA 5TCAA 3ELAH 1S5SA 3T25A 4GUXA 3FO8D 1C5PA 4D76A 2XBYA 1AUJA 4M9FA 4F55A 4KTCA 4TY6A 5F03A 2VIPA 1HCGA