3LKWA

Crystal structure of dengue virus 1 ns2b/ns3 protease active site mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
211
Chain Sequence
HMADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKVLWDTPSPGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWASVKKDLISYGGGWRFQGSWNAGEEVQVIAVEPGKNPKNVQTAPGTFKTPEGEVGAIALDFKPGTAGSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fusion protein of nonstructural protein 2B and nonstructural
publication title Serotype-specific structural differences in the protease-cofactor complexes of the dengue virus family.
pubmed doi rcsb
source organism Dengue virus type 1 (strain singapore/s275/1990)
molecule tags Viral protein,hydrolase
total genus 32
structure length 211
sequence length 230
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lkwA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3lkwA01
1W2KH 5FCRA 1GBEA 2BZAA 2QN5T 1K21H 5C1YA 3PMAB 1C1PA 1FNIA 4ABGA 3S7HB 1EZUC 1GL1A 3KNXA 1QBOA 1GBJA 1D4PB 3PMBB 3UY9A 1J15A 1HJAC 2ZTYA 3H7OA 1UMAH 2F91A 2OQ5A 2XBXA 1MD8A 3A7WA 2FS9A 2QIQA 2ZGJA 4ISHH 4OS7A 4DCDA 5FAHA 1C1WH 5JYIA 5EW1H 2O8WA 3L33A 1FN8A 1O3KA 2FOEA 1PJPA 2BY6X 2FODA 4INKA 3SJ9A 1EAWA 1QNJA 1GBKA 1FMGA 1BTZA 2OP9A 1GPZA 3GICB 1HUTH 4YOJA 5AVDA 4NIVA 2P16A 5DPAA 1QTFA 2XCFA 5HM9A 2BX4A 3SU1A 3Q3KA 1A5GH 4XSKU 2WPIS 3QUMP 1BOQA 1TPOA 2FI3E 2Z7FE 2Z9LA 1FIWA 2WINI 1Y3XA 3I29A 1LKAA 2ALVA 1ZTLA 2ZDVH 4YZUA 4LXBH 1TPSA 3MU0A 1V2ST 3SZEA 4JZFH 3ESTA 3SN8A 1LCYA 4U01A 3T25A 3TVJB 7ESTE 5BPEA 3UR9A 1F0RA 2GGVB 4AYYB 1J8AA 4H6TA 1H9IE 3ZVAA 2XWBI 1RTFB 5E0HA 2CHAB 4AOQA 3GISB 3TH2H 4K5ZA 4YT7H 3SI4H 3E3TA 3KIDU 3BTFE 3E0NB 3MU8A 4MDSA 3F1SB 1DVAH 1O2XA 6GCHG 1K1MA 3HGPA 2BM2A 3HPTB 3IG6B 3A83A 2BXTH 4MTBA 3LGVA 1EJAA 3SORA 1NFUA 4ZKSU 1HAOH 1L1NA 1C1SA 5PTPA 4I8GA 1EX3A 2GVFA 2G81E 1SI5H 1Q31A 2OC0A 1FY5A 5CMXH 1P11E 1TYNA 1YGCH 1DLEA 2M5TA 3R3GB 2BD8A 1G3EA 1GI7B 1YPMH 2JETB 2FTLE 3MMGA 1LHGH 3UPEA 2FOGA 1MUEB 2EI7A 1W14U 1QQ4A 3TLOA 5JB9S 4IMQA 4ABAA 2BY9X 5L6NH 1ZRBA 2BDGA 4K3JA 1TE0A 2VGCB 4AGJA 3SU6A 5JBCS 5EPNA 2TGAA 1VITH 4ESTE 1QRZA 4AFQA 1YBWA 4B73A 2GV6A 1AGJA 2WYGA 2ZQ2A 3SNBA 1N6XA 3KGPA 1B0FA 1P2KA 1SQTA 3DT0H 4NWLA 3K9XB 2ZCLP 1GJ9B 2G4TA 4FU9A 4RKOB 4KGAA 5EXLA 3VEQB 3EQ0H 2C8WB 4ZXXH 1ZR0A 4BNRA 1YCPK 1TX7A 4ZHMU 2BVSH 1QJ1B 3F68H 2PKSC 1O5DH 1EB1H 1MQ5A 2CN0H 5I46H 1CHOF 1G2MA 1OWKA 3M5LA 4XBDA 4DW2U 2FM2A 1L2EA 3AASA 3QWCH 1IHTH 4X6PA 5F6MA 2F9VA 1MU6B 1V2VT 1A3BH 4MG3A 2G00A 4YOIA 1IQFA 1YM0A 1GBTA 1C1MA 1OKXA 1X7AC 4JK5A 2PKAA 3ZZ6A 1CU1A 4YTAA 1CQQA 4Y0YE 3S69A 2O9QA 1S5SA 1YPKH 3A8AA 1GHZA 3PLBA 4MNWA 3O8DA 5FBEA 1MTVA 3NK8A 5LPEA 1O2NA 2WV9A 1ZHMA 3QX5H 1GBBA 4IN2A 3RU4D 2C8XB 4VGCB 1KLTA 5C3NA 1AMHA 3OY6U 1HAGE 3M7QA 2BLQA 3Q3YA 2FESH 4K1SA 3RM0H 1BQYA 4BTIB 2FLBH 1TALA 3MO6A 3RXLA 5DP4A 4ZKOU 1L1JA 1UO6A 2ZU5A 3M3VA 1BHXF 4JYTA 2PUXB 3VXFH 1NFXA 1BTXA 1BCUH 5A0BA 1O2OA 1QGFA 1HJ8A 1D3QB 1WQSA 2BLWA 2ZU3A 2J34A 1F5KU 2ZHFH 4OS2A 1EAIA 1O39A 1Y3VA 1SGEE 4DURA 2V35A 3B23B 5J4QA 6LPRA 1JRTA 2W26A 2FOBA 1E37B 1SLXB 3GDVA 5DO4H 1P8VC 2W5EA 1ZOMA 1UCYE 4WMDA 3U8RH 2BDYA 3M5OA 3M7TA 4AORA 3V0XA 5C2ZA 2PFEA 1HAVB 1DE7H 4XFQA 2IJD1 1KXDA 3M3TA 4AX9H 1XKBC 4JZIA 1CSOE 3AK5A 1BZXE 4B1TA 1NT1A 1HNEE 1DITH 3MNSA 3KCGH 3UWJH 1P09A 2OBOA 2ZDLA 4I32A 3A82A 3CP7A 3P8NA 3KHVA 4Y8ZA 4KP0A 1GBAA 2QAAA 5TCCA 3RMNH 1QY6A 1T8MA 1HIAA 4X2YA 1BTHH 1TGTA 2IN2A 1DS2E 1G9IE 3RLWH 2DE9A 2D1JA 1UTPA 1WOFA 2BY5X 2P95A 3LT3A 4H6SB 5HYOA 1TGBA 2Z3DA 2GV7A 4OGYA 1F0TA 2SNVA 1OWHA 1C4U2 2QF3A 3SNAA 1YF4A 3FFGA 1ZZZA 2VGCC 1AFQB 2SGPE 2P3FH 4GLYA 3NUMA 1OYTH 1A61H 5GWZA 6GCHF 1BDAA 1RTKA 1WYKA 2AIPA 1H1BA 2AMQA 1C9TA 8KME2 1FUJA 1ZSLA 2AH4X 1G3CA 4OS6A 2A5IA 1H9LB 1HAYB 2BQWB 4O3UA 1HPGA 1C2IA 2Y5FA 4JZDH 5FX6A 1LHEH 1EPTA 5AHGH 1ANCA 3UR6A 1N1LA 2QCYA 2ANWA 3CS7A 5JPMH 2YNBA 5LPRA 1BIOA 1V2QT 1WCZA 1THRH 1ELBA 4X8VH 1E36B 2SGQE 5EODA 3M5NA 1KXCA 5EXMA 4X8TH 1D3PB 1TGCA 5ETXA 4RI0A 2Z9GA 3MOCA 2KAIA 1DOJA 2FTMA 1SR5C 2HPPH 4IS5A 3SU4A 1ELGA 3C1KA 1GG6C 2VJ1A 1P06A 2EI6A 3SGQE 3SU0A 1ZHPA 1NC6A 3FAOA 5GNDA 3TH3H 3ZVEA 4ZROA 1MKXH 1A3EH 3RXTA 3SI3H 1AKSB 3RUOA 2LNCA 1B7XB 1FN6A 1RD3B 1K28D 1K9OE 4K1TA 1GDNA 1TMBH 1BTPA 3RXVA 1PPBH 5E8EH 3MYWA 1O3PB 1NRRH 3HKJB 5C1XA 1OWEA 1GJAB 2B8OH 2ZI2H 1T8OA 1OPHB 1TNLA 1ZYOA 3DFJA 3SOSA 4IC5A 3D23A 3GCNA 2AIQA 1O3IA 3T27A 3SV6A 4FUBA 2GCHF 5C67A 1C1UH 1EOLA 1GHXH 1FONA 4XE4A 1ZJDA 3SHAH 3TGJE 1AWFH 3KQDA 4CHAB 1KXBA 1A7SA 1ELDE 4WXIA 3SQHE 1P9SA 1FLEE 1EZSC 1MAYA 2WPLS 3Q3XA 1XUKA 1GHBF 1FAKH 3GY7A 2CMYA 2HVXA 1GJ4H 3IWMA 3M7UA 2XW9A 3M35A 1K1LA 3E16B 1Z7KA 2Q6DA 3RXAA 1SLVB 2BLVA 1MMJN 1MBMA 1TABE 4JZ1A 3ZZ4A 4CRBA 4D7FA 4XOJA 4K69A 3EGKH 1SGPE 4UDWH 3STJA 2RDLA 1ACBE 2Z3CA 4B6FA 3S0NA 4Y11E 1DM4B 2WV4A 1C5ZB 1T32A 2FOHA 4DOQA 1TAWA 1HJAB 2PGBB 1NROH 5BRRE 1RIWC 4GHQA 1GMCG 1TRMA 1ANBA 1KLJH 3OY5U 3UREA 2AYWA 1ELVA 3GY2A 1TLDA 3GYLB 3R0FA 3RC4A 3RXMA 1DY8A 1KTTB 1NESE 8ESTE 1ESBA 3BTDE 1PPZA 1W11U 2BVXH 5HM2A 1WBGB 1HDTH 3VXEH 4CR5A 1MAXA 3K2UA 2RG3A 3S9AA 1DUEA 3UUZA 2VIVA 3ELAH 1O5GH 1OWIA 3DHKH 1L1GA 2QV1A 2VH0A 5CHAC 5EXNA 1KSNA 4ABBA 3DD2H 3P8OA 3BTHE 3Q76A 1Y5UT 1GVLA 2W3IA 3GYMA 4DGJA 2G8TA 3SV7A 1O2WA 1FAXA 1HLTH 1ANDA 2ZU1A 2ASUB 2VWNA 7GCHF 1O2KA 1YPHE 3ODDA 1SQAA 1AD8H 5LPFA 1NU9A 4BOHA 1IOEA 1O32A 2BDBA 3T5FH 1P2JA 5T3HA 1P3CA 1BB0B 2ZGXH 4ISNA 1PQ5A 2TRMA 3URCA 4WVPE 1ZPZA 3G01A 4NA9H 2NU4E 1YC0A 2ZG0H 1MD7A 3RXPA 1K2I1 3KQBA 5F8XA 2AGEX 5JBBS 3TU7H 1GVKB 3A87A 3LGTA 1M9UA 1CVWH 1GGDC 2ZP0H 1QB1A 1Y59T 1O3GA 2ZFPH 4Y79A 4PROA 3VB5A 1NO9H 4BTTB 1GJ7B 3D49H 2Z3EA 1PYTC 4SGAE 4X2VA 1LVBA 1P10A 1Y3UA 8GCHF 2XYAA 1UHBB 1DICA 1MTNB 1GMDG 1GI2A 1AY6H 2W3KA 2GZ9A 4KKDA 2O8LA 1XUGA 3ATMA 4ABFA 2GX4A 4THNH 1ARCA 3PMHB 1FI8A 1Q2WA 2OUAA 3F6UH 1TX8A 3VB4A 4B71A 2D2DA 5DK1A 5JB8S 1S6HA 1Z8IB 2C4FH 3LIWA 3LGUA 4LZ1H 1UTNA 2F4LA 1YLCA 1FXYA 1O2ZA 2ODPA 5FXLA 1SQOA 1LO6A 1CA8B 1Y5AT 4I8HA 1SGFA 3FANA 3I78A 3NKKA 4NIYA 1C2JA 1EQ9A 1Y3YA 1NFYA 2GDDA 1AU8A 1S82A 5DP5A 2PKSB 3GCHC 3V13A 3ZZCA 3P8FA 1CA0C 1KDQB 1PPGE 2F9BH 5DP8A 1O36A 3LDXH 1C4Y2 2QXIA 3BTGE 4X1NU 2WZQA 2H9HA 1D6WA 1K1IA 3LJOA 2EC9H 3RC5A 1OP8A 4E7NA 2YOLA 1GVZA 3RXKA 4ABEA 4CBOA 4A1VA 1XUFA 1YKTA 4ZH8A 3QZQA 1O3OA 3OSYA 5C5OA 2BXUH 1ESTA 2ZCHP 1MKWH 2WUCA 1B0EA 4B76A 1FJSA 2XC0A 1BMNH 1FQ3A 1LQDB 1Y5BT 2GTBA 1H4WA 2QA9E 1GJDB 4B2BA 2IJOB 2ZHWH 3L3TA 1OOKB 6CHAC 1P01A 1VCWA 1P2IA 3V3MA 1BRUP 1GJ5H 4K1EA 4Q80A 1A2CH 1GI6A 2QYIA 2ZECA 1SPJA 4U2WA 3RLYH 1O3MA 4ABDA 1BTYA 2ANKH 2F83A 5FBIA 2QC2A 2SGFE 3LGIA 1O2HA 1SGRE 1P9UA 1C5SA 5GCHG 4UE7H 4FUFA 3SJIA 2RCEA 3ATWA 1C2MA 1O2VA 1PYTD 1YLDA 2BB4A 1ETTH 2QGRA 2C3SA 1GHAF 3AW0A 4DIIH 1A5HA 4J2YB 2SFAA 1VR1H 1O3BA 4X6NA 3ZZDA 2AFQB 4D7GA 2ZTXA 2P94A 2FYRA 4BAKB 1AE8H 1SG8B 4NA7A 4R8TB 3ZZ9A 1GJBB 1C5TA 3HGNA 1W8BH 3PMJA 3ZZ5A 2ZHDA 4ISIH 3MU5A 1NFWA 4TPIZ 1TNIA 1KLIH 2WPKS 1O2TA 2ZA5A 4YO9A 2A31A 2Z9KA 2ZDNA 3SU2A 4GAWA 5AF9H 1C1NA 1LVMA 5AFZH 5G4BA 2HNTC 1JIRA 2C8YB 2C8ZB 2ZHEH 1BUIA 2R2MB 3BEUA 4Y0ZE 3LKWA 1SMFE 2NU2E 5ESTE 1MTNC 1C5VA 2FOFA 1F0SA 1JWTA 2BD3A 3DA9B 4H42U 2Y7XA 3BIVH 4AZ2B 2ANYA 1C2FA 4X0WU 2W7SA 1VITG 1YPHC 2D8WA 4HTCH 2BDCA 4ABHA 4AB9A 3U69H 4CR9A 2VIWA 1F7ZA 1GBMA 2GT8A 4MLFB 3AAVA 4CRGA 2FEQH 1V2TT 4MPXA 1C1OA 3ZZBA 1NU7B 2ZWLH 4WXVA 3H5CB 1EAXA 1GCDA 4CRAA 1NRNH 3U1JB 1FY8E 1S83A 2H2ZA 2AERH 1C1RA 3UNSA 3W94A 1DLKB 1P05A 1D3TB 3RXHA 2WHXA 1RRKA 2A4OA 1EJNA 1SOTA 3SNCA 1XXFA 5FPSA 2J9NA 4RN6A 2VNTA 2A1DB 3LONA 4A92A 2V6NA 4A6LA 3F9FA 3RU4T 3MO3A 3A80A 1UTOA 3SJKA 1SHHB 2FI4E 2YNAA 2PUQH 2G52A 1BJVA 4ZKNU 3O8CA 3C27B 1V2MT 3E0PB 2XCNA 3K65B 4AG2A 2OINA 2Z94A 2D26C 5K7RA 1DX5M 3MH5A 3UNQA 1EATA 4FUDA 3GDUA 2P59A 2VINA 2EEKA 5HGGA 1DANH 3CS0A 1GG6B 2BD2A 2OD3B 2R0LA 2OXSA 3SUDA 1GBCA 3GCTG 1QBNA 5HMAA 3RDZA 2F9UA 4NFEA 1Z1JA 4BAMB 1P04A 3LH1A 3RXJA 3RXBA 4MPWA 5T1VA 1TPAE 2DE8A 4YM9A 4U32A 4GPGA 3TK9A 1SGTA 2A2QH 2F3CE 1BRCE 2AGIX 3A86A 3TH4H 4BANB 2OC7A 3GY6A 3E8LA 1JOUB 2CF9H 5EQRA 3VFEA 1AZ8A 1TGSZ 4D9RA 4GCHF 1AUJA 2UUJB 2ZKSA 3P17H 1ELFA 3WY8A 1ABIH 3BG4C 1ZTJA 4ZMAH 4INLA 1O31A 1HFDA 4Y8XA 2HLCA 3T29A 1LKBA 1O34A 1O5AB 3QGNB 3RMLH 1S0QA 2A0QB 2PGQB 3MH7A 1P2MA 2RA0A 2J95A 3MU1A 3MWIU 1GBLA 4XBCA 1GDUA 3E91A 3T62A 1CGHA 4FUHA 2FZZA 6ESTA 1C5OH 1YPLH 2OK5A 1G36A 3BN9A 4MPUA 4B6EA 1DSUA 3A7ZA 3OU0A 1DWDH 1C5MD 3PLKA 2GZ8A 1ZSJA 2ALPA 2ZNKH 1DT2A 2XXLA 1UCYH 3SNEA 1S84A 3FVFB 1Z6EA 1MKXK 1XKAC 2ZHQH 4WF8A 1HXFH 4E05H 3FZDA 3QDZB 2FOAA 4NZLA 4WMFA 4A1TA 4I31A 2Z9IA 4WH6A 3UTUH 5DP3A 2ZCKP 2XBYA 1G37A 1QR3E 1WXRA 1GMHG 1QHRB 3PWCA 1GL0E 1UVTH 4NCYA 2ZFQH 1NZQH 1O5EH 1BA8B 4MVNA 1BMAA 1RIWB 4JK6A 4XBBA 3LC3A 1ZMLA 2HGTH 4NGAH 3ZZAA 2WPHS 1YCPH 4M9FA 1Z8JB 3QN7A 2J94A 2V3OH 3A84A 5C20A 3PTNA 2H5DA 2V3HH 5GDSH 3RXIA 1WTHD 1DXWA 4FVBA 1MBQA 1Z1IA 4A7IB 1AE5A 1TNKA 2QXHA 4IMZA 2A5AA 5H4IB 2P8OC 5JBTA 3STIA 3QK1A 3GY8A 4FU7A 4U30A 2GMTC 3T28A 4OM9A 1QL7A 3KL6A 1LVOA 1YPGH 2VIPA 5CHAB 1C5QA 2ULLA 3TJVA 2ILNA 2H9EH 1QCPA 1LQEA 1GHWH 2PR3A 1P2QA 2OTVA 4WY3A 1W7XH 1QL8A 3A88A 3OTPA 4X8SH 4Y8YA 1SGQE 2ZFRH 3P95A 2ZU4A 1RGQA 5EU8A 1NN6A 1SBWA 1QA0A 1EPTC 1CGIE 2O8UA 4ZAEA 1UVOA 4BAOB 2XC5A 1C9PA 1HAPH 4FVDA 1YP9A 3RXDA 4F49A 2QXJA 4YESB 1CGJE 1KXFA 3SUEA 1OP0A 2UWOA 3KN2A 1JIMA 1CBWC 1TOMH 1QA7A 1INCA 1XVMA 4INHA 1HRTH 1GGDB 3P70B 1QQUA 3AVZA 1RJXB 1P0SH 4D9QA 1JMOH 3U8TH 2FOMB 3JZ1B 4IN1A 4X6OA 5B6OA 1QBVH 7LPRA 1IQMA 4ZXYH 3TK5A 1GCTC 2A2XH 1CE5A 1SGDE 3NWUA 1P2NA 1DFPA 1A4WH 4B75A 1FPCH 2H6MA 4E06H 4DVAU 2B0FA 1O37A 5E0GA 4NSVA 1O3LA 1IQKA 1UK4A 2CJIA 3VB3A 1ZLRA 2BY8X 3BTTE 4MPVA 2NU0E 1PQAA 4O03A 2A32A 4XDEA 3QLPH 4ASHA 3BV9B 2OBQA 1B5GH 2FYQA 4OS1A 3U8OH 3VB7A 1XVOA 3BEIB 1VJAU 2QXGA 1ARBA 4JZEH 4I7YH 1EJMA 1C2GA 2ZGBH 3FP7E 2BOHB 2BDHA 3TJUA 1YPEH 3UNRA 1RS0A 2ODYB 1FDPA 3GCHB 1TNGA 2EI8A 2XC4A 1E34B 1O2LA 1O5BB 1CA0B 3UOPA 4NWKA 1TRYA 2F9NA 3EA7A 1V3XA 3LPRA 2UUFB 4Y76A 2JH6D 3A8CA 3TJNA 1ZGIA 2FS8A 3EA9A 3K6YA 4NA8A 1C1TA 1C5LH 4IGDA 2A7HA 3A8DA 3BTME 3MO9A 1IQEA 2ZFTA 2STBE 1SOZA 1G2LA 4HI3A 2BVRH 3LH3A 4HZHA 5IDKA 2ZIQH 1HAVA 5L2YH 2FP7B 3S9BA 2G5NA 2AMPA 1WAYB 1J14A 1TNHA 6CHAB 1OS8A 1ESAA 3E6PH 3TK6A 3MU4A 1OSSA 1V2NT 2VIDA 2ZGHA 1LMWB 1O2YA 1O2PA 5LGOA 1XX9A 1AFEH 3LC5A 1TONA 1A1RA 2RA3A 2PWXA 3ATLA 3F9EA 1CT2E 2BTCE 5F03A 3ZZ8A 2ZQ1A 4TWWA 2FOCA 1VZQH 1V2KT 1T7CA 4ZUHA 4AFZA 4ZKRU 3RU4E 2FXRA 4HFPB 1XMNB 1BBRE 2NU1E 4UFEH 1O3JA 1NRPH 1OP2A 1V2LT 2AEIH 4O9VA 1BBRH 1GMHF 2NWNA 1W0ZU 4JYVH 3QTOH 5AFYH 2Y81A 2TGPZ 1AZZA 5T6DA 3P8GA 3A7YA 1UTJA 2OC1A 1CO7E 4GHTA 1C2DA 1IAUA 3SUFA 4FU8A 2FLRH 1P3EA 3K6ZA 2ZEBA 1DDJA 1WQVH 1C2HA 1O2QA 1ZJKA 1MKWK 1AIXH 5A0AE 2IPHA 1C5PA 1SVPA 1DWBH 4I8KA 2Y82A 4QT8C 5DP9A 4Y7BA 1Z8RA 2A7JA 1HGTH 3MFJA 1V2UT 1G32B 4IBLH 4CRFA 3PM3A 4YOGA 1K1OA 1NPMA 1TA2A 2PTNA 1EUFA 1OXGA 1J16A 1HAZB 2CV3A 2FPZA 2VWLA 2WPMS 9ESTA 1O3AA 4NSYA 1F5RA 1EZXC 2FIRH 5FX5A 4CH8B 5A8ZA 1DSTA 2BQ6B 8LPRA 5I25A 1TIOA 1JRSA 3ITIA 4UFDH 2THFB 5EQQA 5L2ZH 1ORFA 2FMJA 4MQAA 1TMUH 1VCQA 2BZ6H 4X1QU 1PQ8A 1J9CH 1E0FD 3FP8E 2P93A 1CT0E 1AKSA 2A5KA 2R3UA 1ZRKA 3NXPA 4UFGH 3V12A 4NIXA 1DWEH 3VGCC 3NPSA 2HWLB 3GDSA 1C2EA 2UUYA 2A45B 4Y7AA 3RMMH 5E2OA 1PPCE 1IQLA 1AN1E 1ZMJA 2TIOA 2Z9JA 4MNYA 4FUIA 2VIOA 1ZPCA 1UVUH 1DY9A 3CENA 4GSOA 3OTJE 1MCVA 1O3DA 4X2WA 1AB9C 1V2JT 2J2UA 1TQ0B 3ODFA 4K60A 1AWHB 2BD9A 1IHSH 1O33A 3DUXH 5IYTA 4ABJA 1ZMNA 2VVUA 1ZTKA 1TX6A 3NZIA 2AS9A 3A8BA 2PKAB 1G3BA 4UONA 1SFIA 2XNIA 5E0JA 5EOKA 2I6SA 1UTQA 4NZQA 1MTSA 3ATIA 1O38A 1LPZB 3GY5A 1OWDA 1ZHRA 2OC8A 4BXSA 1O3EA 2K1QA 4FUEA 4NG9H 1THSH 3EE0B 3KQEA 1Z8GA 2XBVA 2AGGX 1GI4A 1UK2A 2BX3A 1O35A 4K2YA 1PFXC 3ZYDA 3BG4B 4D8NA 1W13U 1GJ6A 1W10U 5DP6A 4AB8A 3MNBA 1C1VH 1ID5H 4JCNA 2ZDAH 5A0CA 3S9CA 1XUHA 3D62A 4LOYH 3SV8A 1LHFH 5EPYA 5LH8A 1ELEE 1O2SA 1NTPA 3MTYA 3SQEE 1KTSB 1TMTH 4DY7B 2BDIA 4OGXA 4ISOA 1GMCF 2O8TA 2FWWA 1MH0A 3SUGA 1QB6A 4BAQB 4B74A 1LTOA 2WPJS 3LGYA 1EAUA 4CBNA 1AUTC 1WSSH 4ABIA 1BHXB 2JKHA 3SZNA 2HNTF 2XBWA 5CE1A 1N8OC 1ZSKA 1VGCC 1JBUH 2HPQH 3RXFA 2I6QA 1DPOA 1QURH 2WYJA 3SU5A 3NCLA 4FXGH 3VB6A 1VCPA 2BYAX 5DG6A 2B7DH 5GXPA 4CRDA 2A4RA 1V2WT 5EW2H 3RXQA 4BAHB 4YT6H 2GKVE 1FY4A 1UTMA 3ATKA 1HIAB 3A85A 3TJOA 2BD4A 2P3UB 1MTWA 1O3HA 3ZYEA 2UWLA 2Q1JA 4NFFA 4I33A 4NIWA 3LGWA 1KIGH 2JH0D 3I77A 5A8YA 1C5YB 4GUXA 3OYPA 5FHTA 1UHBA 1JXPA 3U9AH 2SGDE 2ZPQA 4AG1A 4Q2KA 1S6FA 2P8OB 3EA8A 4A5TS 5JDUB 1W12U 3SBKA 5A09A 3MI4A 2J38A 3Q00A 5EGMA 2GMTB 3M61U 3U98H 1MCTA 1UCYK 3MHWU 1FZZA 1Z71A 1SL3A 1TNJA 1YYY1 2PW8H 1O3CA 3QGJA 4X6MA 3GY3A 4Y71A 1WU1A 3AW1A 1GMDF 1GJ8B 2Y7ZA 3SJ8A 3GCOA 1WUNH 4I8LA 2H9TH 1EPTB 2GCTC 4TY7A 4ZHLU 3KQCA 5E2PA 4UEHH 2PHBA 3RP2A 3UQOA 1TRNA 2FO9A 1TBRH 1EP6A 1GI0A 2OLGA 1CBWB 3LU9B 3P6ZB 1XXDA 1ZPBA 4X2XA 2PTCE 3GY4A 3UOUA 1KDQA 1RFNA 1T4VH 1TBZH 2SGEE 3F9HA 3PO1C 4TYDA 2KAIB 3PV2A 1SGCA 3SHCH 3RXSA 1SGNE 1XM1A 3SU3A 3B8JA 3PTBA 1MZAA 1TA6A 1BTWA 1LVYA 1YPJH 2STAE 1KYNA 5FPTA 4DIHH 2BD5A 3TNSA 1S81A 4Q7YA 1HAXB 1GCTB 3SYJA 1SGYE 2ZGCA 1GBHA 2GD4B 2GCHG 3HATH 4GVUA 1GBFA 4X8UH 2GZ7A 1E35B 3OX7U 2H1UA 2H5CA 4I8JA 4RSPA 1O2RA 3PB1E 3D65E 1L0ZA 3QZRA 1ELCA 2R3YA 1GHBG 5DGJA 4O97A 1U6QA 4YLUA 1K1NA 1FV9A 3BG8A 1BJUA 1O5CB 2BHGA 2PSXA 3RC6A 3UQVA 1FY3A 1MTUA 1S85A 2BOKA 1HBTH 3B9FH 3UFAA 2BD7A 1H8IH 1GHYH 3EYDA 4YLQH 3V7TA 1IQIA 5DJ7A 1F2SE 2VIQA 1OYQA 1ELAA 4UFFH 4M7GA 2FDAA 2G55A 3SGAE 2BDAA 1V2RT 2GDEH 3O8RA 1EOJA 3LOXA 4Y10E 5GJ4B 1UTKA 1D3DB 2C93B 5GCHF 2ZC9H 2ANMH 2Y5GA 1D9IA 4CREA 1K1JA 4A1XA 2CXVA 5C1UA 4WMEA 4CH2B 2VU8E 4F4OC 4TPYA 1BT7A 4DT7B 3TITA 1GJCB 1C5NH 1LHCH 1MZDA 2CHAC 2VVCA 2F9OA 1W0YH 1NRSH 1CHGA 2BY7X 1A5IA 3PYHA 4UD9H 2ZZUH 2Q6FA 1Y8TA 2ZFFH 1FY1A 1O2MA 2C90B 3JZ2B 1QJ7B 5HXFA 2UUKB 1T8NA 1K22H 4KTSA 1P12E 3GOVB 1P2OA 4K8BA 4DG4A 3HK3B 1IQNA 3MNXA 4D76A 4E7RG 3S7KB 5SGAE 1DWCH 5F8TA 1D6RA 7GCHG 1GHVH 2QF0A 1PPHE 1G30B 1ZGVA 2JETC 2WUBA 4KTUA 1A0LA 1LPKB 5FPYA 3T26A 5FCKA 2ZDKA 4RKJB 4MNXA 3SJOA 3ZVCA 2DUCA 1W7GH 4Y6DA 3RMOH 3IITA 1SHYA 4DJZB 1EB2A 2BQ7B 1HV7A 1EKBB 1HYLA 3A7XA 2BLOA 4H4FA 1BTUA 2O8MA 4ISLA 1RTLA 4AFSA 2CGAA 2XRCA 1VITF 2CF8H 2OCVB 1V2PT 3SV2H 3BIUH 3PLPA 2W7UA 3PV4A 3ZVBA 5TJXA 2VWOA 3BSQA 3URDA 4OS4A 1O0DH 1OX1A 2BMGB 1FIZA 1SGFG 2QY0B 4Z0KA 2LPRA 3A7VA 8GCHG 2VVVA 1XUJA 3RXUA 1NS3A 5K0HA 1J17T 5DP7A 4BTUB 4OS5A 1TBQH 2ZPSA 1O3FA 1PQ7A 5TCAA 1SLUB 2A4GA 4ZHAA 2SGAA 1AVXA 1TB6H 3AAUA 3A89A 2Y6TA 2G51A 1GI1A 4CRCA 2HALA 1QRWA 2SNWA 1KY9A 3H7TA 3RXRA 2TBSA 3DFLA 1LDTT 2R0KA 1BBRK 1TWXB 2ZU2A 3UWIA 2FI5E 3MH6A 1V6DA 1W3CA 1THPB 3TGIE 1QRXA 1GI3A 2Z6BD 4J1YA 1O2IA 3TGKE 1C5UA 5DKMA 4MNVA 1EXFA 1QJ6B 3ZZ7A 4VGCC 1SLWB 3SO3A 3VGCB 1P57B 1YCPM 2PV9B 3ZVGA 4FUJA 3PROA 1AHTH 1WTGH 2XTTB 3GCTF 4AFUA 4AGKA 2OQUA 4TY6A 4LZ4B 3T2NA 1P02A 1ETSH 1HAHH 1O2UA 5F8ZA 2VWMA 4AYVB 3M36A 1L4DA 2TPIZ 1GI8B 1Z6JH 1C5WB 3BTQE 1GDQA 4SGBE 4O3TA 3QO6A 3PWBA 1AB9B 1BMMH 1AVGH 1AI8H 1O30A 5C5NA 4WJG2 2IOTA 2TGDA 1EZQA 1F0UA 1A0JA 2VBCA 1A0HB 5ESBA 2ZO3H 1QL9A 2V0BA 1T31A 2B5TB 1NY22 3RXGA 1PPEE 4WH8A 5EG4A 1LHDH 5JBAS 2AMDA 4Z6AH 2VH6A 4WWYA 1IQGA 1UK3A 3L6PA 1GI9B 5A2MH 2FX6A 1O2JA 1UVSH 3EDXB 1C4V2 1NM6A 1EP5A 3RXCA 1A46H 2HOBA 4B2AA 1SC8U 2B9LA 1QIXB 1TPPA 1UJ1A 1KXEA 1AQ7A 3E90B 1G3DA 2Y5HA 4FUGA 1GHAG 4JMYA 1GBIA 4KELA 5L30H 3O8BA 3RM2H 1IQJA 3MH4A 4FUCA 3M5MA 1L4ZA 4BXWA 1DUAA 1TGNA 3ZZ3A 5EQSA 3Q77A 9LPRA 1PPFE 4Q7XA 2NU3E 3TNTA 1OWJA 3EAJA 3W95A 2P3TB 1RXPA 1MU8B 2ODQA 3E1XB 1AFQC 4X1RU 1E38B 3SV9A 3KEEA 2HNTE 3M3SA 3FZZA 5T6GA 1DXPA 2J4IA 1HAIH 3UIRA 5GIBA 5A8XA 3ZV9A 3VPKA 2ZDMA 3A7TA 4LK4A 1F92A 3ZVFA 1KXAA 2HRVA 1HJ9A 1F5LA 1WV7H 1N8OB 1VGCB 4R0IA 3ENSB 1TFXA 5ABWA 1BMLA 1IQHA 4X1SU 4B2CA 1C1QA 1V2OT 2GP9B 2WV5A 4TWYA 1TOCB 3F9GA 5B6LA 1T4UH 1LPGB 1ABJH 1SB1H 1SFQB 3BF6H 1SSXA 1GWAA 1O5FH 3QTVH 2PSYA 3BTEE 1ELTA 2ZPRA 1TQ7B 1AO5A 3N7OA 5J4SA 3SW2B 2UWPA 1C2KA 1NRQH 3KF2A 2FX4A 1C5RA 3SGBE 2G5VA 1QB9A 1K1PA 3H09A 1Y3WA 2EA3A 3ZVDA 1QFKH 2A4QA 3MNCA 4X1PU 1EASA 1MQ6A 2R9PA 1O3NA 1SGIB 2J92A 1BITA 2Q6GA 3BTKE 1C5XB 3SNDA 1CHOG 1XUIA 3ZV8A 1H9HE 2ESTE 4AN7A 1UTLM 3TIUA 1VJ9U 4K8YA 3RXOA 1CT4E 2ZFSA 5GPIB 1HB0B 1O2GH 1H8DH 3BTWE 4HGCA 1S0RA 1HXEH 3LJJA 3HKIB 4IW4E 1T8LA 3P92A 1Q3XA 5T6FA 4Q7ZA 2PLXA 3RXEA 1AVWA 3BEFB 2JH5D 2Y80A 2GCTB 2ZF0H 3U1IB 2F9PA 3PV5A 1BRBE 3TPIZ 4CHAC 1C2LA 1BRAA 1GI5A 2R2WU 2G4UA 1P03A 1ETRH 2GT7A 4IC6A 1ANEA 2XWAA 3PO1B 2A7CA 1GBDA 2TGTA 3A81A 7KMEH 4KTCA 1FPHH 3M37A 2VB0A 2ZTZA 3FP6E 3HK6B 1UVPA 1HCGA 4GCHG 1N6YA 4JYUH
chains in the Genus database with same CATH superfamily
1W2KH 5FCRA 1GBEA 2BZAA 2QN5T 1K21H 5C1YA 2EY4C 3PMAB 1C1PA 1FNIA 2CK3D 4ABGA 3S7HB 1EZUC 1GL1A 3KNXA 1QBOA 1GBJA 1D4PB 3PMBB 3UY9A 1J15A 1HJAC 2ZTYA 3H7OA 1UMAH 2F91A 2OQ5A 2XBXA 1MD8A 2WPDD 3A7WA 2FS9A 2QIQA 2ZGJA 4ISHH 4OS7A 4DCDA 5FAHA 1C1WH 3FO8D 5JYIA 5EW1H 2O8WA 3L33A 1FN8A 1O3KA 2FOEA 1PJPA 2BY6X 2FODA 4INKA 3SJ9A 1EAWA 1QNJA 1GBKA 1FMGA 1BTZA 2OP9A 1GPZA 3GICB 1HUTH 4YOJA 5AVDA 4NIVA 2P16A 5DPAA 1QTFA 2XCFA 5HM9A 2W6ID 2BX4A 3SU1A 3Q3KA 1A5GH 4XSKU 2WPIS 3QUMP 1BOQA 1TPOA 2FI3E 2Z7FE 2Z9LA 1FIWA 2WINI 1Y3XA 3I29A 1LKAA 4RT0A 2ALVA 1ZTLA 2ZDVH 4YZUA 4LXBH 1TPSA 2JDID 3MU0A 1V2ST 3SZEA 4JZFH 5CHBA 3ESTA 3SN8A 1LCYA 4U01A 3T25A 3TVJB 7ESTE 5BPEA 3UR9A 1F0RA 2GGVB 4AYYB 1J8AA 4H6TA 1H9IE 3ZVAA 2XWBI 4DT4A 1RTFB 5E0HA 2CHAB 4AOQA 3GISB 3TH2H 4K5ZA 4YT7H 3SI4H 3E3TA 3KIDU 3BTFE 3E0NB 3MU8A 4MDSA 3F1SB 1DVAH 1O2XA 6GCHG 1K1MA 3HGPA 2IPQX 2BM2A 3HPTB 3IG6B 5HKKD 3A83A 2BXTH 4MTBA 3LGVA 1EJAA 3SORA 1NFUA 4ZKSU 1S6LA 1HAOH 1L1NA 1C1SA 5PTPA 4I8GA 1EX3A 4ZCNA 2GVFA 2G81E 1SI5H 1Q31A 2OC0A 1FY5A 5CMXH 1P11E 1TYNA 1YGCH 1DLEA 2M5TA 3R3GB 2BD8A 1G3EA 1GI7B 1YPMH 2JETB 2FTLE 3MMGA 1LHGH 2KCAA 2FOGA 3UPEA 1MUEB 2EI7A 1W14U 1QQ4A 3TLOA 5JB9S 4IMQA 4ABAA 2BY9X 5L6NH 1ZRBA 2BDGA 4K3JA 1TE0A 2VGCB 4AGJA 3SU6A 5JBCS 5EPNA 2TGAA 1VITH 4ESTE 1QRZA 4AFQA 1YBWA 4B73A 2GV6A 1AGJA 2WYGA 2ZQ2A 3SNBA 1N6XA 3KGPA 2L6OA 1B0FA 1P2KA 1SQTA 3DT0H 4NWLA 3K9XB 2ZCLP 1GJ9B 2G4TA 4FU9A 4RKOB 4KGAA 5EXLA 3VEQB 4F48B 3EQ0H 2C8WB 4ZXXH 1ZR0A 4BNRA 1YCPK 1TX7A 4ZHMU 2BVSH 1QJ1B 3F68H 2PKSC 1O5DH 1EB1H 1MQ5A 2CN0H 5I46H 1CHOF 1G2MA 1OWKA 3F2FA 3M5LA 4XBDA 2FM2A 4DW2U 1L2EA 3AASA 3QWCH 1IHTH 4X6PA 5F6MA 2F9VA 1MU6B 1V2VT 1A3BH 4MG3A 2G00A 4YOIA 1IQFA 1YM0A 1GBTA 1C1MA 1OKXA 1X7AC 4JK5A 2PKAA 3ZZ6A 1CU1A 4YTAA 1CQQA 4Y0YE 3S69A 2O9QA 1S5SA 1YPKH 3A8AA 1GHZA 3PLBA 4MNWA 3O8DA 5FBEA 1MTVA 3NK8A 5LPEA 1O2NA 2JJ1D 2WV9A 1ZHMA 3QX5H 1GBBA 4IN2A 3RU4D 2C8XB 1W0KD 4VGCB 1KLTA 5C3NA 1AMHA 3OY6U 1HAGE 3M7QA 2BLQA 2KCOA 2FESH 3Q3YA 4K1SA 3RM0H 1NBMD 1BQYA 4BTIB 2FLBH 1TALA 3MO6A 3RXLA 5DP4A 4ZKOU 2JJ2D 1L1JA 1UO6A 2ZU5A 1BHXF 3M3VA 4JYTA 2PUXB 3VXFH 1NFXA 1BTXA 1BCUH 5A0BA 1O2OA 1QGFA 1HJ8A 1D3QB 1WQSA 2BLWA 2ZU3A 2J34A 1F5KU 2ZHFH 4OS2A 1EAIA 1O39A 1Y3VA 1SGEE 4DURA 2V35A 3B23B 5J4QA 6LPRA 1JRTA 2W26A 2FOBA 1E37B 1SLXB 3GDVA 5DO4H 1P8VC 2W5EA 1ZOMA 1UCYE 4WMDA 3U8RH 2BDYA 3M5OA 3M7TA 4AORA 3V0XA 5C2ZA 2PFEA 1HAVB 1DE7H 4XFQA 2IJD1 1KXDA 3M3TA 4AX9H 1XKBC 4JZIA 1CSOE 3AK5A 1BZXE 4B1TA 1NT1A 1HNEE 1DITH 3MNSA 3KCGH 3UWJH 1P09A 2OBOA 2ZDLA 4I32A 3A82A 3CP7A 3P8NA 3KHVA 4Y8ZA 4KP0A 1GBAA 2QAAA 5TCCA 3RMNH 1QY6A 1T8MA 1HIAA 4X2YA 1BTHH 1TGTA 2IN2A 1DS2E 1G9IE 3RLWH 2DE9A 2D1JA 1UTPA 1WOFA 2BY5X 2P95A 3LT3A 4H6SB 5HYOA 1TGBA 2Z3DA 2GV7A 4OGYA 1F0TA 2SNVA 1OWHA 1C4U2 2QF3A 3SNAA 1YF4A 3FFGA 1ZZZA 2VGCC 5EJLA 1AFQB 2SGPE 3U28C 2P3FH 4GLYA 3NUMA 1OYTH 1A61H 5GWZA 1KMHB 6GCHF 1BDAA 1RTKA 1WYKA 2AIPA 1H1BA 2AMQA 1C9TA 8KME2 1FUJA 1UW7A 1ZSLA 2AH4X 1G3CA 4OS6A 2A5IA 1H9LB 1HAYB 2BQWB 4YXWD 4O3UA 1HPGA 1C2IA 2Y5FA 4JZDH 5FX6A 1LHEH 1EPTA 5AHGH 1ANCA 3UR6A 1N1LA 2QCYA 2ANWA 3CS7A 5JPMH 2YNBA 5LPRA 1BIOA 1V2QT 1WCZA 1THRH 1ELBA 4X8VH 3FOAA 1E36B 2SGQE 5EODA 3M5NA 1KXCA 5EXMA 4X8TH 1D3PB 1TGCA 5ETXA 4RI0A 2Z9GA 4Z1MD 3MOCA 2KAIA 1DOJA 2FTMA 1SR5C 2HPPH 4IS5A 3SU4A 1ELGA 3C1KA 1GG6C 2VJ1A 1P06A 2EI6A 3SGQE 2KX4A 3SU0A 1ZHPA 1NC6A 3FAOA 5GNDA 3TH3H 3ZVEA 4ZROA 1MKXH 1A3EH 3RXTA 3SI3H 1AKSB 3RUOA 2LNCA 1B7XB 1FN6A 1RD3B 1K28D 1K9OE 4K1TA 1GDNA 1TMBH 1BTPA 3RXVA 1PPBH 5E8EH 3MYWA 1O3PB 1NRRH 3HKJB 5C1XA 1OWEA 1GJAB 2B8OH 2ZI2H 1T8OA 1OPHB 1TNLA 1ZYOA 3DFJA 3SOSA 4IC5A 3D23A 3GCNA 2AIQA 1O3IA 3T27A 3SV6A 4FUBA 2GCHF 5C67A 1C1UH 1EOLA 1GHXH 1FONA 4XE4A 1SQRA 1ZJDA 3SHAH 3TGJE 1AWFH 3KQDA 4CHAB 1KXBA 1A7SA 1ELDE 4WXIA 3SQHE 1P9SA 1FLEE 1EZSC 1MAYA 2WPLS 3Q3XA 1XUKA 1GHBF 1FAKH 3GY7A 2CMYA 2HVXA 1GJ4H 3IWMA 3M7UA 2XW9A 3M35A 1K1LA 3E16B 1Z7KA 2Q6DA 3RXAA 1SLVB 2BLVA 1MMJN 1MBMA 1TABE 3KYFA 3OEHD 1COWD 4JZ1A 3ZZ4A 4CRBA 4D7FA 4XOJA 3N99A 4K69A 3EGKH 1SGPE 4UDWH 3STJA 2RDLA 1ACBE 2Z3CA 4B6FA 3S0NA 4Y11E 1DM4B 2WV4A 1C5ZB 1T32A 2FOHA 4DOQA 1TAWA 1HJAB 2PGBB 1NROH 5BRRE 1RIWC 4GHQA 1GMCG 1TRMA 1ANBA 1KLJH 3OY5U 3UREA 2AYWA 2XOKD 1ELVA 3GY2A 1TLDA 3GYLB 3R0FA 3RC4A 3RXMA 1DY8A 1KTTB 1NESE 8ESTE 1ESBA 3BTDE 1PPZA 1W11U 2BVXH 5HM2A 1WBGB 1HDTH 3VXEH 4CR5A 1MAXA 3K2UA 2RG3A 3S9AA 1DUEA 3UUZA 2VIVA 3ELAH 3F0PA 1O5GH 1OWIA 3DHKH 1L1GA 2QV1A 2VH0A 5CHAC 5EXNA 1KSNA 4ABBA 3DD2H 3P8OA 3BTHE 3Q76A 1Y5UT 1GVLA 2W3IA 3GYMA 4DGJA 2G8TA 2V3MA 4ACBA 3SV7A 2M2AA 1O2WA 1FAXA 1HLTH 1ANDA 2ZU1A 2ASUB 2VWNA 7GCHF 1O2KA 1YPHE 3ODDA 1SQAA 1AD8H 5LPFA 1NU9A 4BOHA 1IOEA 1O32A 2BDBA 3T5FH 1P2JA 5T3HA 1P3CA 1BB0B 2ZGXH 4ISNA 1PQ5A 2TRMA 3URCA 3GS9A 4WVPE 1ZPZA 3G01A 4NA9H 2NU4E 1YC0A 2ZG0H 1MD7A 3RXPA 1K2I1 3KQBA 5F8XA 2AGEX 5JBBS 3TU7H 1GVKB 3A87A 3LGTA 1M9UA 1CVWH 1GGDC 2ZP0H 1QB1A 1Y59T 1O3GA 2ZFPH 4Y79A 4PROA 3VB5A 3UB0A 1NO9H 4BTTB 1GJ7B 3D49H 2Z3EA 1PYTC 4SGAE 4X2VA 1LVBA 1P10A 1Y3UA 8GCHF 2XYAA 1UHBB 1DICA 1MTNB 1GMDG 1GI2A 1AY6H 2KFWA 2W3KA 2GZ9A 4KKDA 2KR7A 2O8LA 1XUGA 3ATMA 4ABFA 2GX4A 4THNH 1ARCA 3PMHB 1FI8A 1Q2WA 2OUAA 3F6UH 1TX8A 3VB4A 4B71A 2D2DA 5DK1A 5JB8S 1S6HA 1Z8IB 2C4FH 2WSSD 3LIWA 3LGUA 4LZ1H 1UTNA 2F4LA 1YLCA 1FXYA 1O2ZA 2ODPA 5FXLA 3DSOA 1SQOA 2PP6A 1LO6A 1CA8B 1Y5AT 4I8HA 1SGFA 3FANA 3I78A 3NKKA 2HVYB 4NIYA 1C2JA 1EQ9A 1Y3YA 1NFYA 2GDDA 1AU8A 1S82A 5DP5A 2PKSB 3GCHC 3V13A 3ZZCA 3P8FA 1CA0C 1KDQB 1PPGE 2F9BH 5DP8A 1O36A 3LDXH 4TSFD 1C4Y2 2QXIA 3BTGE 4X1NU 2WZQA 2H9HA 1D6WA 1K1IA 3LJOA 2EC9H 3RC5A 1OP8A 4E7NA 2YOLA 1GVZA 3RXKA 4ABEA 4CBOA 4A1VA 1XUFA 3F2GA 1YKTA 4ZH8A 3QZQA 1O3OA 3OSYA 5C5OA 2BXUH 1ESTA 2ZCHP 1MKWH 2WUCA 1B0EA 2LP6A 4B76A 1FJSA 2XC0A 1BMNH 1FQ3A 1LQDB 2YMSC 1Y5BT 2GTBA 1H4WA 2QA9E 1GJDB 4B2BA 2IJOB 2ZHWH 3L3TA 1OOKB 6CHAC 1P01A 1VCWA 1P2IA 3V3MA 1BRUP 1GJ5H 3OAAD 4K1EA 4Q80A 1A2CH 1GI6A 2QYIA 2ZECA 1SPJA 4U2WA 3RLYH 1O3MA 4ABDA 1BTYA 2ANKH 2F83A 5FBIA 5EJZA 2QC2A 2SGFE 3LGIA 1O2HA 1SGRE 1P9UA 1C5SA 5GCHG 4UE7H 4FUFA 3SJIA 2RCEA 3ATWA 1C2MA 1O2VA 1PYTD 1YLDA 2BB4A 1ETTH 2QGRA 2C3SA 1GHAF 3AW0A 4DIIH 1A5HA 4J2YB 2SFAA 1VR1H 1O3BA 4X6NA 3ZZDA 2AFQB 4XRNA 4D7GA 2ZTXA 2P94A 2FYRA 4BAKB 1AE8H 1SG8B 4NA7A 4R8TB 3ZZ9A 1QZ8A 1GJBB 1C5TA 3HGNA 1W8BH 3PMJA 3ZZ5A 2ZHDA 3WWFA 4ISIH 3MU5A 1NFWA 4TPIZ 1TNIA 1KLIH 2WPKS 1O2TA 2ZA5A 2K0QA 4YO9A 2A31A 2Z9KA 2ZDNA 3SU2A 4GAWA 5AF9H 1C1NA 1LVMA 4XD7D 5AFZH 5G4BA 2HNTC 1JIRA 2C8YB 2C8ZB 2ZHEH 1BUIA 2R2MB 3BEUA 4Y0ZE 3LKWA 1SMFE 2NU2E 5ESTE 1MTNC 1C5VA 2FOFA 1F0SA 1JWTA 2BD3A 3DA9B 4H42U 2Y7XA 3BIVH 4AZ2B 2ANYA 1C2FA 4X0WU 2W7SA 1VITG 1YPHC 2D8WA 4HTCH 2BDCA 4ABHA 4AB9A 3U69H 4CR9A 2VIWA 1F7ZA 1GBMA 2GT8A 4MLFB 3AAVA 4CRGA 2FEQH 1V2TT 4MPXA 1C1OA 3ZZBA 1NU7B 2ZWLH 4WXVA 2YMSD 3H5CB 1EAXA 1GCDA 4CRAA 1NRNH 3U1JB 1FY8E 1S83A 2H2ZA 2AERH 1C1RA 3UNSA 3W94A 1DLKB 1P05A 1D3TB 2WHXA 3RXHA 1RRKA 2A4OA 1EJNA 1SOTA 3SNCA 1XXFA 5C17A 5FPSA 2J9NA 4RN6A 2VNTA 2A1DB 3LONA 4A92A 2V6NA 4A6LA 3F9FA 3RU4T 3MO3A 3A80A 1UTOA 3SJKA 1SHHB 2FI4E 2YNAA 2PUQH 2G52A 1BJVA 4ZKNU 3O8CA 3C27B 1V2MT 3E0PB 2XCNA 3K65B 4AG2A 2OINA 2Z94A 2D26C 5K7RA 1DX5M 3MH5A 3UNQA 5FL7D 1EATA 4FUDA 3GDUA 2P59A 2VINA 2EEKA 5HGGA 1DANH 3CS0A 1GG6B 2BD2A 2OD3B 2R0LA 2OXSA 3SUDA 1GBCA 3GCTG 1QBNA 5HMAA 3RDZA 2F9UA 5HIYA 4NFEA 1Z1JA 4BAMB 1P04A 3LH1A 5T1VA 3RXJA 4MPWA 3RXBA 1TPAE 2DE8A 4YM9A 4U32A 4GPGA 3TK9A 1SGTA 2A2QH 2F3CE 1BRCE 2AGIX 3A86A 3TH4H 4BANB 2OC7A 3GY6A 3E8LA 1JOUB 2CF9H 5EQRA 3VFEA 1AZ8A 1TGSZ 4D9RA 4GCHF 1AUJA 2UUJB 2ZKSA 3P17H 1ELFA 3WY8A 1ABIH 3BG4C 1ZTJA 4ZMAH 4INLA 1O31A 1HFDA 4Y8XA 2HLCA 3T29A 1LKBA 1O34A 1O5AB 3QGNB 3RMLH 1S0QA 2A0QB 2PGQB 3MH7A 1P2MA 2RA0A 2J95A 3MU1A 3MWIU 3UAIC 1GBLA 4XBCA 1GDUA 3E91A 3T62A 1CGHA 4FUHA 2FZZA 6ESTA 1C5OH 1YPLH 2OK5A 2EQNA 1G36A 3BN9A 4MPUA 4B6EA 1DSUA 3A7ZA 3OU0A 1DWDH 1H8HD 1C5MD 3PLKA 2GZ8A 1ZSJA 2ALPA 2ZNKH 1DT2A 2XXLA 1UCYH 3SNEA 1S84A 3FVFB 1Z6EA 1MKXK 1XKAC 2ZHQH 4WF8A 1HXFH 4E05H 3FZDA 3WW7A 3QDZB 2FOAA 4NZLA 1SKYE 4WMFA 4A1TA 4I31A 2Z9IA 4WH6A 3UTUH 5DP3A 2ZCKP 3PRDA 2XBYA 1G37A 1QR3E 1WXRA 1GMHG 1QHRB 3PWCA 1GL0E 1UVTH 4NCYA 2ZFQH 1NZQH 1O5EH 1BA8B 4MVNA 1BMAA 1RIWB 4JK6A 4XBBA 3LC3A 1ZMLA 2HGTH 4NGAH 3ZZAA 2WPHS 1YCPH 4M9FA 5HIZA 1Z8JB 3QN7A 2J94A 2V3OH 3A84A 5C20A 3PTNA 4Q63A 2H5DA 2V3HH 5DSFA 3CNRA 5GDSH 3RXIA 3MQKC 1WTHD 5F53A 1DXWA 4FVBA 1MBQA 1Z1IA 4A7IB 1AE5A 1TNKA 2QXHA 4IMZA 2A5AA 5H4IB 2P8OC 5JBTA 3STIA 3QK1A 3GY8A 4FU7A 4U30A 2GMTC 4OM9A 3T28A 1QL7A 3KL6A 1LVOA 1YPGH 2VIPA 5CHAB 1C5QA 2ULLA 3TJVA 2ILNA 3PRBA 2H9EH 1QCPA 1LQEA 1GHWH 2PR3A 1P2QA 2OTVA 4WY3A 1W7XH 1QL8A 3A88A 3OTPA 4X8SH 2QF5A 4Y8YA 1SGQE 2ZFRH 3P95A 2ZU4A 3OFND 1RGQA 5EU8A 1NN6A 1SBWA 1QA0A 1EPTC 1CGIE 2O8UA 4ZAEA 1UVOA 4BAOB 2XC5A 1C9PA 1HAPH 4FVDA 1YP9A 3RXDA 4F49A 1MABB 2QXJA 1CGJE 1KXFA 4YESB 3SUEA 2XNDD 1OP0A 2UWOA 3KN2A 1JIMA 1CBWC 1TOMH 1QA7A 1INCA 1XVMA 4F55A 4INHA 1HRTH 1GGDB 3P70B 1QQUA 3AVZA 4ASUD 1RJXB 1P0SH 4D9QA 1JMOH 2J97A 3U8TH 2FOMB 3JZ1B 4IN1A 4X6OA 5B6OA 1QBVH 7LPRA 1E1QD 1IQMA 4ZXYH 3TK5A 1GCTC 2A2XH 1CE5A 1SGDE 3NWUA 1P2NA 2RDEA 1DFPA 1A4WH 4B75A 3FKSD 1FPCH 2H6MA 4E06H 2K8IA 4DVAU 2B0FA 1O37A 5E0GA 4NSVA 1O3LA 1IQKA 1UK4A 2CJIA 3VB3A 1ZLRA 2BY8X 3BTTE 4MPVA 2NU0E 1PQAA 4O03A 2A32A 4XDEA 3QLPH 4ASHA 3BV9B 2OBQA 1B5GH 2FYQA 4OS1A 3U8OH 3VB7A 1XVOA 3BEIB 1VJAU 2QXGA 1ARBA 4JZEH 4I7YH 1EJMA 1C2GA 2ZGBH 3FP7E 2BOHB 2BDHA 3TJUA 1YPEH 3UNRA 1RS0A 2ODYB 1FDPA 3GCHB 1TNGA 2EI8A 2XC4A 1E34B 1O2LA 1O5BB 1CA0B 3UOPA 4NWKA 1TRYA 2F9NA 3EA7A 1V3XA 3LPRA 2UUFB 4Y76A 2JH6D 5C94A 3A8CA 3TJNA 1ZGIA 2FS8A 3EA9A 3K6YA 4NA8A 1C1TA 1C5LH 4IGDA 2A7HA 3A8DA 3BTME 3MO9A 1IQEA 2ZFTA 2STBE 1SOZA 1G2LA 4HI3A 2BVRH 3LH3A 4HZHA 5IDKA 2ZIQH 1HAVA 5L2YH 2FP7B 2YMSB 3S9BA 2G5NA 2AMPA 1WAYB 1J14A 1TNHA 6CHAB 1OS8A 3F2HA 1ESAA 3E6PH 3TK6A 3MU4A 1OSSA 1V2NT 2VIDA 2ZGHA 3F0OA 1LMWB 5CDFE 5C0TA 1O2YA 1O2PA 5LGOA 1XX9A 1AFEH 2AHME 3LC5A 1TONA 1A1RA 2RA3A 2PWXA 3ATLA 3F9EA 1CT2E 2BTCE 5F03A 3ZZ8A 2ZQ1A 4TWWA 2FOCA 1VZQH 2QF4A 1V2KT 1T7CA 4ZUHA 4AFZA 4ZKRU 3RU4E 2FXRA 4HFPB 1XMNB 1BBRE 2NU1E 2V7QD 4UFEH 1O3JA 1NRPH 1OP2A 1V2LT 2AEIH 4O9VA 1BBRH 1GMHF 2NWNA 1W0ZU 4JYVH 3QTOH 5AFYH 2Y81A 2TGPZ 1AZZA 5T6DA 1NBME 3P8GA 3A7YA 1UTJA 2OC1A 1CO7E 4GHTA 1C2DA 1IAUA 3SUFA 4FU8A 2FLRH 1P3EA 3K6ZA 3WWBA 2ZEBA 1DDJA 1WQVH 1C2HA 1O2QA 1ZJKA 1MKWK 1AIXH 5A0AE 2IPHA 1C5PA 1SVPA 1DWBH 4I8KA 2Y82A 4QT8C 5DP9A 4Y7BA 1Z8RA 2A7JA 1HGTH 3MFJA 1V2UT 1G32B 4IBLH 4CRFA 3PM3A 4YOGA 1K1OA 1NPMA 1TA2A 2PTNA 1EUFA 1OXGA 1J16A 1HAZB 2CV3A 2FPZA 2VWLA 2WPMS 9ESTA 1O3AA 4NSYA 1F5RA 1EZXC 2FIRH 5FX5A 4CH8B 5A8ZA 1DSTA 2BQ6B 8LPRA 1YWUA 5I25A 1TIOA 1JRSA 3ITIA 4UFDH 2THFB 5EQQA 5L2ZH 1ORFA 2FMJA 4MQAA 1TMUH 1VCQA 4ACAA 2BZ6H 4X1QU 1PQ8A 1J9CH 1E0FD 3FP8E 2P93A 1CT0E 1AKSA 2A5KA 2R3UA 1ZRKA 3NXPA 4UFGH 3V12A 4NIXA 1DWEH 3VGCC 3NPSA 2HWLB 3GDSA 1C2EA 2UUYA 2A45B 4Y7AA 3RMMH 5E2OA 1PPCE 1IQLA 1AN1E 1ZMJA 2TIOA 2Z9JA 4MNYA 4FUIA 2VIOA 3EE7A 1ZPCA 1UVUH 5EIYA 1DY9A 3CENA 4GSOA 3OTJE 1MCVA 1O3DA 4X2WA 1AB9C 1V2JT 2J2UA 1TQ0B 3ODFA 4K60A 1AWHB 2BD9A 1IHSH 1O33A 3DUXH 5IYTA 4ABJA 1ZMNA 2VVUA 1ZTKA 1TX6A 3NZIA 3NRLA 2RFKC 2AS9A 3A8BA 2PKAB 1G3BA 4UONA 1SFIA 2XNIA 5E0JA 5EOKA 2I6SA 1UTQA 4NZQA 1MTSA 3ATIA 1O38A 1LPZB 3GY5A 1OWDA 1ZHRA 2OC8A 4BXSA 1O3EA 2K1QA 4FUEA 4NG9H 5KGOA 1THSH 3EE0B 3KQEA 1Z8GA 2XBVA 2AGGX 1GI4A 1UK2A 2BX3A 1O35A 4K2YA 1PFXC 3ZYDA 3BG4B 4D8NA 1BMFD 1W13U 1GJ6A 1W10U 5DP6A 4AB8A 3MNBA 1C1VH 1ID5H 4JCNA 2ZDAH 5A0CA 3S9CA 1XUHA 3D62A 4LOYH 3SV8A 1LHFH 5EPYA 5LH8A 1ELEE 1O2SA 1NTPA 3MTYA 3SQEE 1KTSB 1TMTH 4DY7B 2BDIA 4OGXA 4ISOA 1K0HA 1GMCF 2O8TA 2FWWA 1MH0A 3SUGA 1W0JD 1QB6A 4BAQB 4B74A 1LTOA 2WPJS 3LGYA 1EAUA 4CBNA 1AUTC 1WSSH 4ABIA 1BHXB 2KZ4A 2JKHA 3SZNA 2HNTF 2XBWA 3DCLA 5CE1A 1N8OC 1ZSKA 1VGCC 1JBUH 2HPQH 3RXFA 2I6QA 1DPOA 1QURH 2WYJA 3SU5A 3NCLA 4FXGH 3VB6A 1VCPA 2BYAX 5DG6A 2B7DH 5GXPA 4CRDA 2A4RA 1V2WT 5EW2H 3RXQA 4BAHB 4YT6H 2GKVE 1FY4A 2F43B 1UTMA 3ATKA 1HIAB 3A85A 3TJOA 2BD4A 2P3UB 1MTWA 1O3HA 2HLDD 3ZYEA 2UWLA 2Q1JA 4NFFA 4I33A 4NIWA 3LGWA 1KIGH 2JH0D 3I77A 5A8YA 1C5YB 4GUXA 3OYPA 5FHTA 1UHBA 1JXPA 3U9AH 2SGDE 2ZPQA 4AG1A 4Q2KA 1S6FA 2P8OB 3EA8A 4A5TS 5JDUB 1W12U 3SBKA 5A09A 3MI4A 2J38A 3Q00A 5EGMA 2GMTB 3M61U 3U98H 1MCTA 1UCYK 3MHWU 1FZZA 1Z71A 1SL3A 1TNJA 1YYY1 2PW8H 1O3CA 3QGJA 5C0UA 4X6MA 3FN8A 3GY3A 3OE7D 4Y71A 1WU1A 3AW1A 1GMDF 1GJ8B 2Y7ZA 3SJ8A 3GCOA 1WUNH 4I8LA 2H9TH 5KEDA 1EPTB 2JIZD 2GCTC 4TY7A 4ZHLU 3KQCA 5E2PA 4UEHH 2PHBA 3RP2A 3UQOA 1TRNA 2FO9A 1E1RD 1TBRH 1EP6A 1GI0A 2OLGA 1CBWB 3LU9B 3P6ZB 1XXDA 1ZPBA 4X2XA 2PTCE 2J98A 3GY4A 3UOUA 1KDQA 1RFNA 1T4VH 1TBZH 2SGEE 3F9HA 3PO1C 3PV2A 2KAIB 4TYDA 1SGCA 3SHCH 3RXSA 1SGNE 1XM1A 3SU3A 3B8JA 3DSPA 3PTBA 1MZAA 1TA6A 1BTWA 3OEED 1LVYA 1YPJH 2STAE 1KYNA 4I86A 5FPTA 4DIHH 2BD5A 3TNSA 1S81A 4Q7YA 1HAXB 1GCTB 3SYJA 1SGYE 2ZGCA 1GBHA 2GD4B 2GCHG 3HATH 4GVUA 1GBFA 4X8UH 2GZ7A 3DSGA 1YY3A 1E35B 3OX7U 2H1UA 2H5CA 4I8JA 4RSPA 1O2RA 3PB1E 3D65E 1L0ZA 3QZRA 1ELCA 2R3YA 1GHBG 5DGJA 4O97A 1U6QA 4YLUA 1K1NA 1FV9A 3BG8A 1BJUA 1O5CB 2BHGA 2PSXA 3RC6A 3UQVA 1FY3A 1MTUA 1S85A 2KM0A 2BOKA 1HBTH 3B9FH 3UFAA 2BD7A 1H8IH 1GHYH 3EYDA 4YLQH 3V7TA 1IQIA 5DJ7A 1F2SE 2VIQA 1OYQA 1ELAA 4UFFH 4M7GA 2FDAA 2G55A 2J5UA 3SGAE 2BDAA 1V2RT 2GDEH 3O8RA 1EOJA 3LOXA 4Y10E 5GJ4B 1UTKA 1D3DB 2C93B 5GCHF 2ZC9H 2ANMH 2Y5GA 1D9IA 4CREA 1K1JA 4A1XA 2CXVA 5C1UA 4WMEA 4CH2B 2VU8E 4F4OC 4TPYA 1BT7A 4DT7B 3TITA 1GJCB 1C5NH 1LHCH 1MZDA 2CHAC 2VVCA 2F9OA 1W0YH 1NRSH 1CHGA 2BY7X 3ZIAD 1A5IA 3PYHA 4UD9H 2ZZUH 2Q6FA 1Y8TA 2ZFFH 1FY1A 1O2MA 2C90B 3JZ2B 1QJ7B 5HXFA 2UUKB 1T8NA 1K22H 4KTSA 1EFRD 1P12E 3GOVB 1P2OA 4K8BA 4DG4A 3HK3B 1IQNA 3MNXA 4D76A 4E7RG 3S7KB 5SGAE 1DWCH 5F8TA 1D6RA 7GCHG 1GHVH 2QF0A 1PPHE 1G30B 1ZGVA 2JETC 2WUBA 4KTUA 1A0LA 1LPKB 5FPYA 3T26A 5FCKA 2ZDKA 4RKJB 4MNXA 3SJOA 3ZVCA 2DUCA 1W7GH 4Y6DA 3RMOH 3IITA 1SHYA 4DJZB 1EB2A 2BQ7B 1HV7A 1EKBB 1HYLA 3A7XA 2BLOA 4H4FA 1BTUA 2O8MA 4ISLA 1RTLA 4AFSA 2CGAA 2XRCA 1VITF 3KQ5A 2CF8H 2OCVB 1V2PT 3SV2H 3BIUH 3PLPA 2W7UA 3PV4A 3ZVBA 5TJXA 2VWOA 3BSQA 3URDA 4OS4A 1O0DH 1OX1A 2BMGB 1FIZA 1SGFG 2QY0B 4Z0KA 2LPRA 3A7VA 8GCHG 2VVVA 1XUJA 3RXUA 1NS3A 5K0HA 1J17T 5DP7A 4BTUB 4OS5A 5IK2D 1TBQH 2ZPSA 1O3FA 1PQ7A 5TCAA 1SLUB 1YLNA 2A4GA 4ZHAA 2SGAA 1AVXA 1TB6H 3AAUA 3A89A 2Y6TA 2G51A 1GI1A 4CRCA 2HALA 1QRWA 2SNWA 4Q4LA 1KY9A 3H7TA 3RXRA 2TBSA 3DFLA 1LDTT 1WDIA 2R0KA 1BBRK 4AC9A 1TWXB 2ZU2A 2GJGA 3UWIA 2FI5E 3MH6A 1V6DA 1W3CA 1THPB 1E79D 3TGIE 1QRXA 1GI3A 2Z6BD 4J1YA 1O2IA 3TGKE 1C5UA 5DKMA 4MNVA 1EXFA 1QJ6B 3ZZ7A 4VGCC 1SLWB 3SO3A 3VGCB 1P57B 1YCPM 2PV9B 3ZVGA 4FUJA 3PROA 3KYGA 1AHTH 1WTGH 2XTTB 3F3BA 3GCTF 4AFUA 4AGKA 2OQUA 4TY6A 4LZ4B 3T2NA 1P02A 1ETSH 1HAHH 1O2UA 5F8ZA 2VWMA 4AYVB 4FOUC 3M36A 1L4DA 2TPIZ 1GI8B 1Z6JH 1C5WB 3BTQE 1GDQA 4SGBE 4O3TA 3QO6A 3PWBA 1AB9B 1BMMH 1AVGH 1AI8H 1O30A 5C5NA 4WJG2 1VKYA 2IOTA 2TGDA 1EZQA 1F0UA 1A0JA 2VBCA 1A0HB 5ESBA 2ZO3H 2KCYA 1QL9A 4FETA 2V0BA 1T31A 2B5TB 1NY22 3RXGA 1H8ED 1PPEE 4WH8A 5EG4A 1LHDH 5JBAS 2AMDA 4Z6AH 2VH6A 4WWYA 1IQGA 1UK3A 3L6PA 1GI9B 5A2MH 2FX6A 1O2JA 1UVSH 3EDXB 4HG6A 1C4V2 1NM6A 1EP5A 3RXCA 1A46H 2HOBA 4B2AA 1SC8U 2B9LA 1QIXB 1TPPA 1UJ1A 1KXEA 1AQ7A 2LELA 3E90B 5DN6D 4P02A 1G3DA 2Y5HA 4FUGA 1GHAG 4JMYA 1GBIA 4KELA 5L30H 3O8BA 2QE7D 3RM2H 1IQJA 3MH4A 4FUCA 3M5MA 1L4ZA 4BXWA 5EJ1A 1DUAA 3W1EA 1TGNA 3ZZ3A 5KECA 5EQSA 3Q77A 9LPRA 1PPFE 4Q7XA 2NU3E 3TNTA 1OWJA 3EAJA 3W95A 2P3TB 1RXPA 1MU8B 2ODQA 3E1XB 1AFQC 4X1RU 1E38B 3SV9A 3KEEA 2HNTE 3M3SA 3FZZA 5T6GA 4RT1A 1DXPA 2J4IA 1HAIH 3UIRA 5GIBA 5A8XA 3ZV9A 3VPKA 2ZDMA 3A7TA 4LK4A 1F92A 3ZVFA 1KXAA 2HRVA 1HJ9A 1F5LA 1WV7H 1N8OB 1VGCB 4R0IA 3ENSB 1TFXA 5ABWA 1BMLA 1IQHA 4X1SU 4P00A 4B2CA 1C1QA 1V2OT 2GP9B 2WV5A 4TWYA 1TOCB 3F9GA 5B6LA 3VG8A 1T4UH 1LPGB 4TT3D 1ABJH 1SB1H 1SFQB 3BF6H 1OHHD 1SSXA 1GWAA 2KCPA 1O5FH 3QTVH 2PSYA 3BTEE 1ELTA 2ZPRA 1TQ7B 1AO5A 3N7OA 5J4SA 3SW2B 2UWPA 1C2KA 1NRQH 3KF2A 2FX4A 1C5RA 3SGBE 2G5VA 1QB9A 1K1PA 3H09A 1Y3WA 2EA3A 3ZVDA 1QFKH 2A4QA 3MNCA 3N7EA 4X1PU 1EASA 1MQ6A 2R9PA 1O3NA 1SGIB 3N7DA 1FX0B 2J92A 1BITA 2Q6GA 3BTKE 1C5XB 3SNDA 1CHOG 1XUIA 3ZV8A 1H9HE 2ESTE 4AN7A 1UTLM 3TIUA 1VJ9U 4K8YA 3RXOA 1CT4E 2ZFSA 5GPIB 1HB0B 1O2GH 1H8DH 3BTWE 4HGCA 1S0RA 2L74A 1HXEH 3LJJA 3HKIB 4IW4E 1T8LA 3P92A 1Q3XA 5T6FA 4Q7ZA 2PLXA 3RXEA 1AVWA 3BEFB 2JH5D 2Y80A 2GCTB 2ZF0H 3U1IB 2F9PA 3PV5A 1BRBE 3TPIZ 4CHAC 1C2LA 1BRAA 1GI5A 2R2WU 2G4UA 1P03A 1ETRH 2GT7A 4IC6A 1ANEA 2XWAA 3PO1B 2W6JD 2A7CA 2J98B 1GBDA 2TGTA 3A81A 7KMEH 4KTCA 1FPHH 3M37A 2VB0A 2ZTZA 3FP6E 3HK6B 1UVPA 1HCGA 4GCHG 1N6YA 4JYUH
chains in the Genus database with same CATH topology
1W2KH 5FCRA 1GBEA 2BZAA 2QN5T 1K21H 5C1YA 3PMAB 1C1PA 1FNIA 2CK3D 4ABGA 3S7HB 1EZUC 1GL1A 3KNXA 1QBOA 1GBJA 1D4PB 3PMBB 3UY9A 1J15A 1HJAC 2ZTYA 3H7OA 1UMAH 2F91A 2OQ5A 2XBXA 1MD8A 2WPDD 3A7WA 2FS9A 2QIQA 2ZGJA 4ISHH 4OS7A 4DCDA 5FAHA 1C1WH 5JYIA 3FO8D 5EW1H 2O8WA 3L33A 1FN8A 1O3KA 2FOEA 1PJPA 2BY6X 2FODA 4INKA 3SJ9A 1EAWA 1QNJA 1GBKA 1FMGA 1BTZA 2OP9A 1GPZA 3GICB 1HUTH 4YOJA 5AVDA 4NIVA 2P16A 5DPAA 1QTFA 2XCFA 5HM9A 2W6ID 2BX4A 3SU1A 3Q3KA 1A5GH 4XSKU 2WPIS 3QUMP 1BOQA 1TPOA 2FI3E 2Z7FE 2Z9LA 1FIWA 2WINI 1Y3XA 3I29A 1LKAA 2ALVA 1ZTLA 2ZDVH 4YZUA 4LXBH 1TPSA 2JDID 3MU0A 1V2ST 3SZEA 4JZFH 5CHBA 3ESTA 3SN8A 1LCYA 4U01A 3T25A 3TVJB 7ESTE 5BPEA 3UR9A 1F0RA 2GGVB 4AYYB 1J8AA 4H6TA 1H9IE 3ZVAA 2XWBI 4DT4A 1RTFB 5E0HA 2CHAB 4AOQA 3GISB 3TH2H 4K5ZA 4YT7H 3SI4H 3E3TA 3KIDU 3BTFE 3E0NB 3MU8A 4MDSA 3F1SB 1DVAH 1O2XA 6GCHG 1K1MA 3HGPA 5HKKD 2BM2A 3HPTB 3IG6B 3A83A 2BXTH 4MTBA 3LGVA 1EJAA 3SORA 1NFUA 4ZKSU 1S6LA 1HAOH 1L1NA 1C1SA 5PTPA 4I8GA 1EX3A 4ZCNA 2GVFA 2G81E 1SI5H 1Q31A 2OC0A 1FY5A 5CMXH 1P11E 1TYNA 1YGCH 1DLEA 2M5TA 3R3GB 2BD8A 1G3EA 1GI7B 1YPMH 2JETB 2FTLE 3MMGA 1LHGH 3UPEA 2FOGA 2KCAA 1MUEB 2EI7A 1W14U 1QQ4A 3TLOA 5JB9S 4IMQA 4ABAA 2BY9X 5L6NH 1ZRBA 2BDGA 4K3JA 1TE0A 2VGCB 4AGJA 3SU6A 5JBCS 5EPNA 2TGAA 1VITH 4ESTE 1QRZA 4AFQA 1YBWA 4B73A 2GV6A 1AGJA 2WYGA 2ZQ2A 3SNBA 1N6XA 3KGPA 2L6OA 1B0FA 1P2KA 1SQTA 3DT0H 4NWLA 3K9XB 2ZCLP 1GJ9B 2G4TA 4FU9A 4RKOB 4KGAA 5EXLA 3VEQB 3EQ0H 2C8WB 4ZXXH 1ZR0A 4BNRA 1YCPK 1TX7A 4ZHMU 2BVSH 1QJ1B 3F68H 2PKSC 1O5DH 1EB1H 1MQ5A 2CN0H 5I46H 1CHOF 1G2MA 1OWKA 3M5LA 4XBDA 4DW2U 2FM2A 3F2FA 1L2EA 3AASA 3QWCH 1IHTH 4X6PA 5F6MA 2F9VA 1MU6B 1V2VT 1A3BH 4MG3A 2G00A 4YOIA 1IQFA 1YM0A 1GBTA 1C1MA 1OKXA 1X7AC 4JK5A 2PKAA 3ZZ6A 1CU1A 4YTAA 1CQQA 4Y0YE 3S69A 2O9QA 1S5SA 1YPKH 3A8AA 1GHZA 3PLBA 4MNWA 3O8DA 5FBEA 1MTVA 3NK8A 5LPEA 1O2NA 2JJ1D 2WV9A 1ZHMA 3QX5H 1GBBA 4IN2A 3RU4D 2C8XB 1W0KD 4VGCB 1KLTA 5C3NA 1AMHA 3OY6U 1HAGE 3M7QA 2BLQA 3Q3YA 2FESH 4K1SA 2KCOA 3RM0H 1NBMD 1BQYA 4BTIB 2FLBH 1TALA 3MO6A 3RXLA 5DP4A 4ZKOU 1L1JA 1UO6A 2ZU5A 3M3VA 1BHXF 4JYTA 2JJ2D 2PUXB 3VXFH 1NFXA 1BTXA 1BCUH 5A0BA 1O2OA 1QGFA 1HJ8A 1D3QB 1WQSA 2BLWA 2ZU3A 2J34A 1F5KU 2ZHFH 4OS2A 1EAIA 1O39A 1Y3VA 1SGEE 4DURA 2V35A 3B23B 5J4QA 6LPRA 1JRTA 2W26A 2FOBA 1E37B 1SLXB 3GDVA 5DO4H 1P8VC 2W5EA 1ZOMA 1UCYE 4WMDA 3U8RH 2BDYA 3M5OA 3M7TA 4AORA 3V0XA 5C2ZA 2PFEA 1HAVB 1DE7H 4XFQA 2IJD1 1KXDA 3M3TA 4AX9H 1XKBC 4JZIA 1CSOE 3AK5A 1BZXE 4B1TA 1NT1A 1HNEE 1DITH 3MNSA 3KCGH 3UWJH 1P09A 2OBOA 2ZDLA 4I32A 3A82A 3CP7A 3P8NA 3KHVA 4Y8ZA 4KP0A 1GBAA 2QAAA 5TCCA 3RMNH 1QY6A 1T8MA 1HIAA 4X2YA 1BTHH 1TGTA 2IN2A 1DS2E 1G9IE 3RLWH 2DE9A 2D1JA 1UTPA 1WOFA 2BY5X 2P95A 3LT3A 4H6SB 5HYOA 1TGBA 2Z3DA 2GV7A 4OGYA 1F0TA 2SNVA 1OWHA 1C4U2 2QF3A 3SNAA 1YF4A 3FFGA 1ZZZA 2VGCC 1AFQB 2SGPE 2P3FH 4GLYA 3NUMA 1OYTH 1A61H 5GWZA 1KMHB 6GCHF 1BDAA 1RTKA 1WYKA 2AIPA 1H1BA 2AMQA 1C9TA 8KME2 1FUJA 1ZSLA 2AH4X 1G3CA 4OS6A 2A5IA 1H9LB 1HAYB 2BQWB 4YXWD 4O3UA 1HPGA 1C2IA 2Y5FA 4JZDH 5FX6A 1LHEH 1EPTA 5AHGH 1ANCA 3UR6A 1N1LA 2QCYA 2ANWA 3CS7A 5JPMH 2YNBA 5LPRA 1BIOA 1V2QT 1WCZA 1THRH 1ELBA 4X8VH 3FOAA 1E36B 2SGQE 5EODA 3M5NA 1KXCA 5EXMA 4X8TH 1D3PB 1TGCA 5ETXA 4RI0A 2Z9GA 4Z1MD 3MOCA 2KAIA 1DOJA 2FTMA 1SR5C 2HPPH 4IS5A 3SU4A 1ELGA 3C1KA 1GG6C 2VJ1A 1P06A 2EI6A 3SGQE 3SU0A 1ZHPA 1NC6A 3FAOA 5GNDA 3TH3H 3ZVEA 4ZROA 1MKXH 1A3EH 3RXTA 3SI3H 1AKSB 3RUOA 2LNCA 1B7XB 1FN6A 1RD3B 1K28D 1K9OE 4K1TA 1GDNA 1TMBH 1BTPA 3RXVA 1PPBH 5E8EH 3MYWA 1O3PB 1NRRH 3HKJB 5C1XA 1OWEA 1GJAB 2B8OH 2ZI2H 1T8OA 1OPHB 1TNLA 1ZYOA 3DFJA 3SOSA 4IC5A 3D23A 3GCNA 2AIQA 1O3IA 3T27A 3SV6A 4FUBA 2GCHF 5C67A 1C1UH 1EOLA 1GHXH 1FONA 4XE4A 1ZJDA 3SHAH 3TGJE 1AWFH 3KQDA 4CHAB 1KXBA 1A7SA 1ELDE 4WXIA 3SQHE 1P9SA 1FLEE 1EZSC 1MAYA 2WPLS 3Q3XA 1XUKA 1GHBF 1FAKH 3GY7A 2CMYA 2HVXA 1GJ4H 3IWMA 3M7UA 2XW9A 3M35A 1K1LA 3E16B 1Z7KA 2Q6DA 3RXAA 1SLVB 2BLVA 1MMJN 1MBMA 1TABE 3OEHD 4JZ1A 3ZZ4A 1COWD 4CRBA 4D7FA 4XOJA 3N99A 4K69A 3EGKH 1SGPE 4UDWH 3STJA 2RDLA 1ACBE 2Z3CA 4B6FA 3S0NA 4Y11E 1DM4B 2WV4A 1C5ZB 1T32A 2FOHA 4DOQA 1TAWA 1HJAB 2PGBB 1NROH 5BRRE 1RIWC 4GHQA 1GMCG 1TRMA 1ANBA 1KLJH 3OY5U 3UREA 2AYWA 2XOKD 1ELVA 3GY2A 1TLDA 3GYLB 3R0FA 3RC4A 3RXMA 1DY8A 1KTTB 1NESE 8ESTE 1ESBA 3BTDE 1PPZA 1W11U 2BVXH 5HM2A 1WBGB 1HDTH 3VXEH 4CR5A 1MAXA 3K2UA 2RG3A 3S9AA 1DUEA 3UUZA 2VIVA 3ELAH 3F0PA 1O5GH 1OWIA 3DHKH 1L1GA 2QV1A 2VH0A 5CHAC 5EXNA 1KSNA 4ABBA 3DD2H 3P8OA 3BTHE 3Q76A 1Y5UT 1GVLA 2W3IA 3GYMA 4DGJA 2G8TA 3SV7A 2M2AA 1O2WA 1FAXA 1HLTH 1ANDA 2ZU1A 2ASUB 2VWNA 7GCHF 1O2KA 1YPHE 3ODDA 1SQAA 1AD8H 5LPFA 1NU9A 4BOHA 1IOEA 1O32A 2BDBA 3T5FH 1P2JA 5T3HA 1P3CA 1BB0B 2ZGXH 4ISNA 1PQ5A 2TRMA 3URCA 4WVPE 3GS9A 1ZPZA 3G01A 4NA9H 2NU4E 1YC0A 2ZG0H 1MD7A 3RXPA 1K2I1 3KQBA 5F8XA 2AGEX 5JBBS 3TU7H 1GVKB 3A87A 3LGTA 1M9UA 1CVWH 1GGDC 2ZP0H 1QB1A 1Y59T 1O3GA 2ZFPH 4Y79A 4PROA 3VB5A 3UB0A 1NO9H 4BTTB 1GJ7B 3D49H 2Z3EA 1PYTC 4SGAE 4X2VA 1LVBA 1P10A 1Y3UA 8GCHF 2XYAA 1UHBB 1DICA 1MTNB 1GMDG 1GI2A 1AY6H 2KFWA 2W3KA 2GZ9A 4KKDA 2KR7A 2O8LA 1XUGA 3ATMA 4ABFA 2GX4A 4THNH 1ARCA 3PMHB 1FI8A 1Q2WA 2OUAA 3F6UH 1TX8A 3VB4A 4B71A 2D2DA 5DK1A 5JB8S 1S6HA 1Z8IB 2C4FH 2WSSD 3LIWA 3LGUA 4LZ1H 1UTNA 2F4LA 1YLCA 1FXYA 1O2ZA 2ODPA 5FXLA 3DSOA 1SQOA 1LO6A 1CA8B 1Y5AT 4I8HA 1SGFA 3FANA 3I78A 3NKKA 4NIYA 1C2JA 1EQ9A 1Y3YA 1NFYA 2GDDA 1AU8A 1S82A 5DP5A 2PKSB 3GCHC 3V13A 3ZZCA 3P8FA 1CA0C 1KDQB 1PPGE 2F9BH 5DP8A 1O36A 3LDXH 4TSFD 1C4Y2 2QXIA 3BTGE 4X1NU 2WZQA 2H9HA 1D6WA 1K1IA 3LJOA 2EC9H 3RC5A 1OP8A 4E7NA 2YOLA 1GVZA 3RXKA 4ABEA 4CBOA 4A1VA 1XUFA 3F2GA 1YKTA 4ZH8A 3QZQA 1O3OA 3OSYA 5C5OA 2BXUH 1ESTA 2ZCHP 1MKWH 2WUCA 1B0EA 4B76A 1FJSA 2XC0A 1BMNH 1FQ3A 1LQDB 2YMSC 1Y5BT 2GTBA 1H4WA 2QA9E 1GJDB 4B2BA 2IJOB 2ZHWH 3L3TA 1OOKB 6CHAC 1P01A 1VCWA 1P2IA 3V3MA 1BRUP 1GJ5H 3OAAD 4K1EA 4Q80A 1A2CH 1GI6A 2QYIA 2ZECA 1SPJA 4U2WA 3RLYH 1O3MA 4ABDA 1BTYA 2ANKH 2F83A 5FBIA 2QC2A 2SGFE 3LGIA 1O2HA 1SGRE 1P9UA 1C5SA 5GCHG 4UE7H 4FUFA 3SJIA 2RCEA 3ATWA 1C2MA 1O2VA 1PYTD 1YLDA 2BB4A 1ETTH 2QGRA 2C3SA 1GHAF 3AW0A 4DIIH 1A5HA 4J2YB 2SFAA 1VR1H 1O3BA 4X6NA 3ZZDA 2AFQB 4D7GA 2ZTXA 2P94A 2FYRA 4BAKB 1AE8H 1SG8B 4NA7A 4R8TB 3ZZ9A 1GJBB 1C5TA 3HGNA 1W8BH 3PMJA 3ZZ5A 2ZHDA 3WWFA 4ISIH 3MU5A 1NFWA 4TPIZ 1TNIA 1KLIH 2WPKS 1O2TA 2ZA5A 2K0QA 4YO9A 2A31A 2Z9KA 2ZDNA 3SU2A 4GAWA 5AF9H 1C1NA 1LVMA 4XD7D 5AFZH 5G4BA 2HNTC 1JIRA 2C8YB 2C8ZB 2ZHEH 1BUIA 2R2MB 3BEUA 4Y0ZE 3LKWA 1SMFE 2NU2E 5ESTE 1MTNC 1C5VA 2FOFA 1F0SA 1JWTA 2BD3A 3DA9B 4H42U 2Y7XA 3BIVH 4AZ2B 2ANYA 1C2FA 4X0WU 2W7SA 1VITG 1YPHC 2D8WA 4HTCH 2BDCA 4ABHA 4AB9A 3U69H 4CR9A 2VIWA 1F7ZA 1GBMA 2GT8A 4MLFB 3AAVA 4CRGA 2FEQH 1V2TT 4MPXA 1C1OA 3ZZBA 1NU7B 2ZWLH 4WXVA 2YMSD 3H5CB 1EAXA 1GCDA 4CRAA 1NRNH 3U1JB 1FY8E 1S83A 2H2ZA 2AERH 1C1RA 3UNSA 3W94A 1DLKB 1P05A 1D3TB 3RXHA 2WHXA 1RRKA 2A4OA 1EJNA 1SOTA 3SNCA 1XXFA 5C17A 5FPSA 2J9NA 4RN6A 2VNTA 2A1DB 3LONA 4A92A 2V6NA 4A6LA 3F9FA 3RU4T 3MO3A 3A80A 1UTOA 3SJKA 1SHHB 2FI4E 2YNAA 2PUQH 2G52A 1BJVA 4ZKNU 3O8CA 3C27B 1V2MT 3E0PB 2XCNA 3K65B 4AG2A 2OINA 2Z94A 2D26C 5K7RA 1DX5M 3MH5A 3UNQA 5FL7D 1EATA 4FUDA 3GDUA 2P59A 2VINA 2EEKA 5HGGA 1DANH 3CS0A 1GG6B 2BD2A 2OD3B 2R0LA 2OXSA 3SUDA 1GBCA 3GCTG 1QBNA 5HMAA 3RDZA 2F9UA 4NFEA 1Z1JA 4BAMB 1P04A 3LH1A 3RXJA 3RXBA 4MPWA 5T1VA 1TPAE 2DE8A 4YM9A 4U32A 4GPGA 3TK9A 1SGTA 2A2QH 2F3CE 1BRCE 2AGIX 3A86A 3TH4H 4BANB 2OC7A 3GY6A 3E8LA 1JOUB 2CF9H 5EQRA 3VFEA 1AZ8A 1TGSZ 4D9RA 4GCHF 1AUJA 2UUJB 2ZKSA 3P17H 1ELFA 3WY8A 1ABIH 3BG4C 1ZTJA 4ZMAH 4INLA 1O31A 1HFDA 4Y8XA 2HLCA 3T29A 1LKBA 1O34A 1O5AB 3QGNB 3RMLH 1S0QA 2A0QB 2PGQB 3MH7A 1P2MA 2RA0A 2J95A 3MU1A 3MWIU 1GBLA 4XBCA 1GDUA 3E91A 3T62A 1CGHA 4FUHA 2FZZA 6ESTA 1C5OH 1YPLH 2OK5A 1G36A 3BN9A 4MPUA 4B6EA 1DSUA 3A7ZA 3OU0A 1DWDH 1H8HD 1C5MD 3PLKA <