3LKWA

Crystal structure of dengue virus 1 ns2b/ns3 protease active site mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
211
Chain Sequence
HMADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKVLWDTPSPGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWASVKKDLISYGGGWRFQGSWNAGEEVQVIAVEPGKNPKNVQTAPGTFKTPEGEVGAIALDFKPGTAGSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serotype-specific structural differences in the protease-cofactor complexes of the dengue virus family.
pubmed doi rcsb
source organism Dengue virus type 1 (strain singapore/s275/1990)
molecule tags Viral protein,hydrolase
molecule keywords fusion protein of nonstructural protein 2B and nonstructural
total genus 32
structure length 211
sequence length 230
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lkwA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3lkwA01
3M3TA 1N8OB 1P9SA 2GZ9A 3MU8A 5GDSH 4I31A 2F3CE 1A5HA 1ZJKA 1SGEE 5T6DA 5LPEA 2A7CA 2B9LA 2G81E 4FU9A 4JYVH 4B74A 1ZPCA 3NWUA 3URDA 5J4QA 2Y81A 1L1NA 1MU8B 2ZG0H 1Z1JA 1IHTH 3KN2A 4DIHH 2QCYA 1CU1A 2FLBH 1J9CH 2Y80A 1BOQA 2JH5D 1S5SA 2QXGA 1P8VC 2BD2A 4DG4A 1VCPA 1A61H 3KQDA 1IQEA 3E8LA 4GPGA 2ZGCA 1MAYA 3SJ9A 1F0UA 1C5ZB 1W0YH 3A84A 3PTBA 2BY5X 1D3QB 1O38A 2ANWA 2GZ8A 3GY3A 4Q80A 1EAXA 3BTFE 5EODA 2BD7A 1W3CA 2Y6TA 2ZGJA 1TGTA 3SNCA 1GI7B 1Q2WA 4JK6A 1RIWB 3DUXH 3RXDA 1W0ZU 4TYDA 5F03A 3BTDE 4NIVA 1C5UA 3O8DA 1EJMA 4IMQA 1AVWA 1UMAH 1W10U 1P01A 3A89A 1TE0A 4KTSA 3S9AA 3TK6A 2ALPA 3RXOA 1EP6A 5E2PA 2YNAA 3R0FA 2Q1JA 2XBVA 1A0HB 1TFXA 1E36B 1Y5UT 2GT7A 3SNEA 3EQ0H 1TMTH 4ZAEA 4O03A 1MTUA 3ZZ6A 3SU2A 4JZIA 4XBBA 4LK4A 1IQKA 4F4OC 1ESBA 3ZYDA 1OWHA 1NFWA 3SJKA 4D76A 1QB1A 5F6MA 3RDZA 2ZTZA 1VR1H 1ZLRA 1B5GH 1P11E 5ESBA 1NFYA 1C1NA 1VITF 1Y3VA 1O2GH 4E06H 1TOCB 1L4DA 1FY3A 5TJXA 1IQMA 1UTQA 1UCYK 4Z6AH 3RXIA 4I8HA 1BMNH 1ZMNA 1W13U 1DT2A 2HALA 1LCYA 4A1XA 2ZTYA 3ATWA 3DFLA 1MCVA 3UNQA 1V2OT 2BLOA 4RKJB 1SR5C 1BTYA 3KIDU 1GCTC 5JBCS 1GPZA 1H9HE 1MKWH 5DP4A 2SNVA 4HFPB 3L33A 2C8ZB 2J9NA 5CMXH 4A7IB 1O37A 4Y76A 3LIWA 3LGWA 4UEHH 3RXPA 1VGCB 2JKHA 1EPTB 2UUYA 1VCWA 4GVUA 2ANYA 2ZU5A 4B2CA 1NPMA 3M5MA 4K60A 2H9EH 1RS0A 2FOEA 3A83A 1QFKH 1AGJA 5HMAA 7KMEH 1ABIH 1MMJN 1V2RT 2H5DA 1O2OA 1GI4A 3LT3A 4OGYA 1GG6B 1O5DH 2FTMA 3RXBA 1EZQA 2D2DA 4CBNA 1G3DA 4LZ1H 4ZHLU 2A1DB 2G55A 3S9CA 1ACBE 1ANBA 1AO5A 1TNIA 1O3MA 2QF3A 3VXFH 2O8WA 1TRMA 1GHVH 3C1KA 1CGIE 1IQLA 1ESTA 2WV5A 1LO6A 1O2VA 4NA7A 2NU2E 1PQ7A 9ESTA 1OS8A 2ZTXA 2FTLE 1A2CH 1VITH 3TH3H 1S0QA 5DPAA 1P02A 1NFUA 4WXIA 3AW0A 1P2QA 1GBLA 2P8OB 1W7GH 1LTOA 1F2SE 4AOQA 3ZYEA 3SUGA 5F8TA 1TGBA 5GWZA 2OQ5A 1GDUA 2DUCA 2FM2A 4VGCC 1DFPA 2Y5GA 2OC7A 1RJXB 3SOSA 5J4SA 3PYHA 2O8TA 2G51A 1FV9A 1C5TA 1GI6A 1BJUA 2CJIA 1GJ4H 1NRNH 1UHBB 1EQ9A 2AMPA 5FCKA 1O5GH 4IN2A 1K9OE 3O8CA 1L0ZA 1ZHPA 1NTPA 4I8LA 4GHQA 1T8OA 3V13A 1C2LA 1QTFA 5B6OA 1G30B 3TH2H 3EE0B 2B8OH 2EA3A 3UWIA 1NY22 3PMBB 3VB4A 2TGTA 1A7SA 5JB8S 1UK2A 2PUXB 1TRYA 1C5MD 2FS8A 3F1SB 1G3EA 4CHAB 1NU7B 1QJ1B 2SGEE 3VEQB 3ATKA 3TGJE 2BZAA 3Q3XA 4Y6DA 3OYPA 1IQGA 1GBIA 5FBIA 1INCA 4CRAA 5LH8A 1CBWC 1DWDH 2PGQB 2UUJB 4FUEA 4RSPA 4A1VA 2V0BA 6CHAC 1KXCA 1TPSA 1Y3YA 1S81A 5DP3A 1ZRKA 1T31A 3SN8A 3BTME 1OOKB 4XBDA 3RU4D 4BTTB 1GHAF 1XUJA 3KEEA 1SGTA 3NKKA 2V3HH 2QF0A 5HGGA 2BOKA 3UTUH 2UWLA 3ZZCA 2QYIA 4X2VA 2NU3E 1MTWA 2WUCA 1GBEA 1HAOH 3ESTA 5CHAC 4ASHA 1QBNA 3TNSA 4KKDA 1SMFE 2F4LA 3O8RA 2QIQA 1KLTA 1O2QA 1CA8B 1O2PA 1K1PA 1HAHH 1YCPK 1JRSA 2I6SA 1RD3B 2ZIQH 2OUAA 4X2WA 3RXMA 1TGCA 3PMAB 3F6UH 2O8UA 1TBRH 1TPAE 2VBCA 1TNJA 2G00A 1J17T 4KTUA 3TITA 2ZFQH 2ZGXH 3A7VA 4JZDH 1ELAA 1AFQC 5LPFA 4Q7ZA 1TBZH 2JH6D 1ZZZA 1N6YA 1BRBE 3AK5A 5DKMA 3KQCA 3TNTA 4JZFH 2LNCA 1HJAC 4X6PA 4NZLA 2FPZA 3M36A 4THNH 3OTPA 5C1YA 4H42U 3MO6A 5EPNA 1AU8A 3D65E 2ZU3A 1ELFA 1O3LA 4AZ2B 4I33A 2ODPA 1V2ST 3QDZB 4FVDA 5L2YH 1V2NT 3SUDA 1MKWK 1RFNA 2ZWLH 3A7WA 3W94A 4ZHMU 4X1SU 1ZTLA 1O3HA 4XOJA 3ZZ5A 2CN0H 2R2WU 1GJAB 4J2YB 1QJ7B 2HGTH 4MTBA 3MNSA 4J1YA 1MKXH 2ZC9H 1BRUP 3SV6A 2VVCA 1HAXB 4DIIH 2AS9A 4JZ1A 1UCYH 3DD2H 3QLPH 3EA7A 2F9VA 5AFZH 8GCHF 3UQVA 2Q6GA 1C1RA 1PJPA 5C5NA 2CV3A 4U01A 4NFEA 5A0BA 1OWJA 4U30A 4UFEH 4OM9A 2Z9GA 1K21H 4A5TS 2A45B 3GOVB 4MPUA 1O3BA 4M9FA 4AFSA 2VGCB 5EXNA 4YOJA 5PTPA 2GCHF 3SQHE 1P2OA 2GP9B 4OS4A 2DE8A 1QL9A 1C5PA 5EQQA 3A7XA 5C20A 1XX9A 3RXFA 3BN9A 4X1PU 3TGKE 4DCDA 1GHYH 2BLWA 3GCOA 3ZZ9A 4GLYA 4MQAA 3VB3A 3TJNA 2GT8A 1BTUA 4YOIA 1AZ8A 1ANCA 3FAOA 1EOJA 2RDLA 2Z3CA 4TPYA 2R0KA 1AHTH 4K3JA 5JDUB 1EX3A 1GHBF 5EXMA 1UTPA 1KDQA 2PV9B 2OC1A 1O33A 1C5QA 2NU1E 3M3SA 3F9GA 4Q7YA 3MI4A 2PGBB 2VGCC 1A1RA 1ARCA 1HPGA 2G5NA 1HBTH 2VH6A 3OSYA 1F0SA 2I6QA 1O3AA 3VGCC 1Z71A 2PSYA 2QXJA 1AE8H 3UOPA 4AORA 1GJ5H 1VITG 2J2UA 1AUJA 1C2FA 5JBTA 2ZU4A 2G5VA 3LGTA 1FN8A 3P92A 1B7XB 4O3UA 4WH8A 3RXCA 4YOGA 1C4U2 4FUGA 1NZQH 1DICA 4AFQA 1SL3A 1RTFB 1XUIA 3PLPA 4B6FA 1GBDA 3OY6U 1FAKH 1O3CA 2ZU1A 2FS9A 1TABE 4MG3A 2WYGA 4OS2A 1W14U 1KXAA 3ZZ4A 1CVWH 1H8IH 4UD9H 3LGYA 4BNRA 2OCVB 1QURH 1T4VH 1WQVH 5C1XA 1SQTA 1ID5H 2AFQB 1D9IA 1MUEB 5DJ7A 2CF9H 3A8BA 3BIVH 1P57B 1HJAB 3QUMP 5DP7A 1ZHMA 3NZIA 1GBAA 3ZVCA 4DURA 4K1EA 2HVXA 3PO1B 3ITIA 1EAIA 1ZRBA 2C4FH 5BPEA 3GY8A 2QN5T 3K9XB 5JBBS 2LPRA 1JOUB 2J95A 1S0RA 2SGPE 4ABGA 1YGCH 4FUCA 1T8LA 1MD7A 1DE7H 3V12A 2OC0A 1T8MA 2VIQA 1FNIA 2W3KA 2ZEBA 1TNGA 1RTLA 1F7ZA 1W12U 3ZV8A 1W2KH 3M3VA 3M7UA 2WYJA 2FYRA 4MPWA 3UPEA 3FANA 1DOJA 3GY2A 5CHAB 5JB9S 3RC5A 1TQ0B 2A32A 2VINA 1EXFA 1LPKB 1P3EA 2FXRA 1OP2A 2PKSB 1WV7H 4WH6A 4ABJA 1TOMH 5C1UA 1Y3UA 4K5ZA 4A6LA 3U8OH 1H4WA 2FZZA 4WY3A 4RN6A 5FBEA 1SGFG 2B5TB 4BAOB 1ZSJA 3ZVGA 2ZFSA 4ABHA 1D6WA 2D8WA 1CBWB 2BDIA 2P59A 1GJDB 2K1QA 2XC5A 2ZNKH 4CR9A 5HM9A 1GJ7B 1PPZA 4MNXA 4MDSA 5JBAS 1TMBH 1GVKB 2FOCA 4CH8B 1XUFA 1BBRE 1TGSZ 4CHAC 3B23B 1GMHF 3RXEA 4K2YA 2IOTA 1EAUA 1C1QA 1SGIB 3M7QA 1UO6A 1XXDA 3A88A 3A7YA 1UCYE 3UFAA 3P8NA 2IJD1 1GHBG 3T26A 1IQIA 1LQDB 1HAIH 1C5NH 3KNXA 1GMDF 1O3DA 1BDAA 2Q6FA 1UJ1A 2F83A 1F5LA 5TCAA 1BJVA 3OTJE 1GDNA 1PYTD 1ZR0A 1S85A 2XBYA 1OYQA 3UR6A 2F9NA 3E90B 3F9EA 1H8DH 2EI6A 3QZQA 2GV7A 1SQAA 1EKBB 6ESTA 4OS7A 2Y82A 3MMGA 2O9QA 3RXTA 4VGCB 1YM0A 3AVZA 4Y0ZE 2V35A 3QX5H 1OWEA 3MH4A 2XTTB 3CS0A 1BTXA 4NWKA 1FPHH 1K1OA 1K2I1 2ESTE 1ZOMA 1CHGA 3GYLB 3FZDA 4INKA 2CHAB 4D7GA 2P8OC 1C1SA 1SGPE 2O8MA 2XWBI 1GBHA 3SI4H 2OQUA 1A5GH 3SU0A 3IITA 1SGYE 3LC5A 2FODA 4OS1A 2BDYA 3QTVH 5JPMH 1DVAH 3W95A 1SGRE 2CF8H 1SFQB 4RKOB 3M5NA 3EA8A 1GL1A 2TRMA 1KY9A 5A2MH 2IN2A 1E37B 1V2TT 1YPEH 1THSH 2FEQH 5ABWA 1MH0A 1BHXF 1AMHA 1SOTA 3PV2A 1SQOA 1GI8B 1CSOE 4ZHAA 1GG6C 2CGAA 3S0NA 2VWMA 3TK5A 4IC5A 1HNEE 6GCHG 2C90B 4ISNA 3GICB 3E3TA 1A0JA 2NU4E 3VXEH 2TGAA 2F9BH 1C4V2 2EI8A 2FLRH 1TX7A 4ZXXH 1GGDC 2ZDLA 1WQSA 2IJOB 5A0CA 3ZVBA 3NXPA 5E8EH 1V2QT 1TAWA 3MU5A 1K28D 3PWBA 2ZHDA 1NRPH 2GTBA 2PHBA 3SNBA 1B0EA 3ZZBA 4Q7XA 5IDKA 4B2AA 5E0JA 3LC3A 1KTTB 2ZGHA 4AGKA 1GCTB 2BVXH 5E0HA 1QNJA 4IS5A 2YOLA 1FMGA 4WF8A 2ZFRH 3HATH 3P8OA 2AGIX 1WOFA 4NG9H 2QA9E 3LGIA 1H1BA 4X1RU 5LGOA 2XC4A 2VIOA 1V2JT 1EB2A 3I77A 4NA8A 1DSTA 3PWCA 4AG1A 3VB5A 4K8YA 5HXFA 3R3GB 4B2BA 2WPLS 4ABIA 1QA0A 1XVMA 2H9TH 3RLWH 2A7HA 1H9IE 4ZKSU 1DWCH 5C67A 2HOBA 3RM0H 5T1VA 1YCPM 1L1GA 2BLVA 3GY4A 3P17H 1YPLH 4NSYA 2FOBA 1V3XA 1XUHA 2P3TB 2RA3A 1GI1A 1RXPA 2W7UA 3SU6A 2A31A 1FI8A 2A4OA 3NPSA 3U9AH 3QWCH 2TGDA 4M7GA 1Y5BT 1X7AC 2TBSA 5LPRA 1SLVB 2FP7B 5DP5A 3LONA 1BRCE 1OX1A 1NO9H 4ISIH 2OTVA 2Y7ZA 1S83A 1JWTA 1L4ZA 1HGTH 1FY8E 3GDVA 2R3UA 4A92A 1O31A 2WPMS 1MCTA 2W3IA 3NCLA 3BEFB 2V6NA 3F9HA 5EW2H 5L6NH 1C9PA 2GDDA 1G3BA 1T7CA 5FCRA 2XBWA 1O3JA 2WPKS 3P6ZB 4X8UH 2BTCE 3SNAA 1O2IA 3ZZ8A 1TQ7B 1P0SH 1FQ3A 1AD8H 1Y3XA 3U8TH 1WXRA 5I46H 3A80A 4CR5A 1P06A 4NWLA 2VH0A 2BXUH 1FUJA 3T5FH 2AMQA 2A2QH 1ETSH 2BD5A 3EA9A 2ZHWH 1QQ4A 4XDEA 5T6FA 3ZV9A 2W5EA 5DO4H 2C93B 1C2GA 1SFIA 4BAQB 1PPGE 2C8XB 5GNDA 5C5OA 2AERH 1PQ8A 3GY6A 3OY5U 1YPMH 1G2MA 2FX4A 2G4TA 1CQQA 1QL8A 2BHGA 2TIOA 3BTTE 1AE5A 4U2WA 1NRSH 1K1IA 3A8DA 3MTYA 1FY4A 1BT7A 4ZMAH 5E0GA 2HPPH 1GGDB 3BTKE 4H6SB 4ZH8A 3U98H 3RMMH 1NC6A 1EZUC 1F0RA 3RC6A 3CP7A 4FUJA 1YPHC 3LH3A 5F8ZA 1Y8TA 5AVDA 1A3EH 4UFFH 1U6QA 1XXFA 1EATA 1NRRH 5FAHA 4JCNA 2HPQH 1AKSA 2ZF0H 2A4RA 4UDWH 3KQBA 1HDTH 4YO9A 4YTAA 1LVBA 1TNLA 1UVOA 2XWAA 4RI0A 3CS7A 3RXRA 5A8ZA 3JZ2B 2F91A 1P2IA 1Y59T 2PFEA 3H7TA 3NK8A 1KXEA 1FN6A 3EDXB 2QAAA 1YPGH 2XNIA 4X6OA 4B6EA 2SGDE 1BTWA 1WU1A 1DUEA 1V2WT 4K8BA 1O35A 4MVNA 3LGVA 5GJ4B 4BAMB 3HPTB 1V2PT 3FP8E 1HAPH 1KYNA 1SPJA 2UWOA 3BTWE 3LJOA 4LXBH 5AFYH 1Z7KA 1LKAA 4MNWA 1A5IA 1GMCG 3ENSB 1ORFA 3DFJA 3SU4A 2CHAC 5EG4A 3K6ZA 1GI5A 2BM2A 4DT7B 3SU3A 1QCPA 3P8GA 3RXSA 1W11U 3RXVA 1E35B 3TIUA 1ZYOA 2AIQA 1IQFA 1O2SA 1HJ9A 1C1TA 1ELVA 3E6PH 1C2KA 1Q31A 5A8XA 1Y5AT 1DXPA 1WYKA 2WPHS 3ATLA 1QBOA 4TPIZ 1S84A 2FX6A 1TONA 1C2EA 4YM9A 1TBQH 4Y7BA 2G52A 4FUDA 4MLFB 4ZXYH 5AF9H 1C2MA 4X1QU 2Y5FA 3PV5A 1AUTC 2HNTE 3STIA 2XW9A 3FP7E 3FVFB 2XBXA 4X6NA 3RXGA 1TNHA 3MWIU 4BANB 1A3BH 5FX6A 3TVJB 4OS5A 1GBCA 1OKXA 3SUFA 1AZZA 2BVRH 1SSXA 4WVPE 5TCCA 1HUTH 5DK1A 3K6YA 1JRTA 1KXBA 2J38A 1CT0E 2KAIA 4B76A 3UR9A 3GY7A 3P8FA 1ELCA 3MHWU 3H09A 4B75A 1DSUA 1DY8A 4LZ4B 1P2KA 3GDUA 4FUHA 3SW2B 3GY5A 2ZPQA 4F49A 3F9FA 1BTHH 4TY7A 4Y10E 1FIWA 1K1NA 1GI9B 1TLDA 2VWNA 3S9BA 1GBKA 3M5OA 3K2UA 2EI7A 1ELBA 1ZGVA 2FOGA 1EP5A 3L3TA 3BTEE 1MD8A 2C8WB 3AAVA 2O8LA 2FIRH 1UVSH 4WMDA 2BD3A 2PKSC 1TPOA 2VNTA 3BG4B 1ABJH 3H7OA 5HYOA 4FUBA 4QT8C 1GJBB 2Z9LA 3AW1A 1SGFA 4JYUH 5B6LA 2BQ7B 2R9PA 2WHXA 1LQEA 3RXHA 3BEUA 1AB9B 1SGQE 5HM2A 2BY8X 4Y8XA 2BYAX 3BF6H 4UE7H 1ZHRA 2FI5E 1CGJE 3ELAH 1IAUA 1BRAA 1IHSH 3RXJA 3RXLA 3PLKA 4GSOA 1A0LA 4ZROA 4AB8A 4ISOA 1LHDH 1MU6B 1NROH 4BAHB 5IYTA 4X0WU 1UTLM 1Y3WA 3SUEA 1BCUH 2A0QB 4D8NA 1HYLA 4Y71A 2BVSH 3MH5A 1B0FA 1GJ8B 5FPTA 1ZJDA 1J16A 3PO1C 5GCHF 4B1TA 2SNWA 2ZFTA 4HZHA 4FU8A 3KQEA 4Y8ZA 2FI3E 4NGAH 3IG6B 2QY0B 1HFDA 3UNRA 1MZAA 3GYMA 4ZUHA 1QRXA 2BD8A 3T27A 1O2TA 3SZEA 2ZZUH 1MAXA 1DXWA 2STAE 4UFGH 2STBE 2SFAA 1LHEH 4NCYA 2WV9A 1O5FH 1GI3A 5E2OA 4UONA 3M7TA 3UOUA 3DHKH 3TLOA 1MTNC 4ESTE 2ZHQH 3M5LA 2PKAA 1SGDE 4ZKNU 3T62A 3P70B 4SGAE 1C1PA 3S7HB 1HAGE 1O2HA 4X6MA 1O3IA 1AI8H 3A81A 4E7NA 2SGAA 3D62A 1LMWB 3LOXA 3GCTG 2H6MA 2NU0E 4ZKRU 1O5BB 2ILNA 1QR3E 3VGCB 1MBMA 1DM4B 2HNTF 2PW8H 1FY1A 1P2MA 4IW4E 1HAVA 4LOYH 3UNSA 4ABEA 1ELEE 4CRFA 2BQ6B 2ZA5A 4I8KA 4Y11E 3U1JB 1GHXH 3ZVFA 5L2ZH 1QRWA 4IMZA 3LPRA 2SGFE 1FZZA 1GJCB 1NT1A 1C2IA 4NIYA 3S7KB 3TJOA 3BG8A 2A7JA 3MYWA 3TJUA 3EAJA 4UFDH 5EQRA 5F8XA 1O2XA 2PKAB 3QGNB 1K1MA 1ELDE 1ZSLA 2BDGA 3BIUH 4FVBA 1F5RA 1TA6A 3GCHB 2AGEX 3RXAA 2VWOA 2Z94A 1C1WH 1YPHE 2EEKA 3U8RH 1ARBA 1OWIA 2A4GA 4K69A 1P3CA 2FESH 1O5EH 3TU7H 4ZKOU 2V3OH 1DWEH 1XMNB 1L1JA 1SC8U 4Y0YE 3U69H 3QN7A 1GCDA 3OU0A 2C3SA 4CH2B 2AEIH 3PROA 1YLDA 1JMOH 1AWFH 1HIAB 1LPGB 4NA9H 2JETC 4K1TA 2A5KA 3L6PA 1P05A 3MNBA 1SOZA 2THFB 3PTNA 3HKJB 5K0HA 2BOHB 2BX4A 1D3DB 4NSVA 3UY9A 1J15A 1ZSKA 1O2UA 1FLEE 2VJ1A 1XUKA 1QL7A 4AFUA 1C4Y2 1KDQB 1N1LA 2HWLB 2PTNA 1GI2A 3GDSA 2FO9A 3MH7A 2WZQA 2BZ6H 5EW1H 1ZTJA 1SG8B 2J4IA 3QTOH 3T25A 1Q3XA 1MQ5A 1F92A 1UTKA 1QHRB 2BLQA 4MPXA 1C5VA 3E91A 4CRCA 1GJ6A 2AYWA 1CA0B 4WWYA 1V2KT 1QB9A 1GBBA 2ZCKP 2ZDMA 2J92A 1QY6A 1O3PB 1KXDA 3STJA 1YBWA 2R0LA 8ESTE 2GGVB 4HTCH 3RM2H 2C8YB 1ZPZA 1OXGA 1O0DH 1TMUH 2F9UA 1GVLA 2QXIA 4NZQA 1AFQB 1QA7A 4I32A 1RRKA 2KAIB 3LU9B 1WUNH 4YZUA 1RGQA 3SV7A 2CMYA 2ANMH 3D49H 4DOQA 1C1MA 1CHOF 1D6RA 2GX4A 9LPRA 2BDBA 1C5RA 1P2NA 3V0XA 4SGBE 2BQWB 3TJVA 4D7FA 4AYYB 4X2XA 2F9PA 3OX7U 4YT6H 1O2MA 2QXHA 3MU1A 1OP0A 4BOHA 4XFQA 5ESTE 1O2RA 1QBVH 1YPKH 4GAWA 4MNYA 2Z9IA 3A7TA 1PFXC 3V3MA 3IWMA 4AFZA 2BDCA 2ULLA 1UK4A 1JIRA 3RU4T 3Q76A 4MPVA 4KELA 3M35A 3SJ8A 3T2NA 3RC4A 2BMGB 2FOFA 4GHTA 4D9QA 1V2LT 1BB0B 2NWNA 2OD3B 1DX5M 4JMYA 2DE9A 3Q77A 1S6HA 1C2HA 1O5AB 3U1IB 2ASUB 3URCA 1FJSA 5GXPA 3BTQE 2G4UA 1E38B 6CHAB 1BTZA 2OBQA 2BB4A 3SO3A 4OGXA 1TWXB 1P09A 2FDAA 1CT4E 3H5CB 4ABFA 2B7DH 4NIWA 3RLYH 3PB1E 1WBGB 2VIPA 1GHZA 1LPZB 4CBOA 1O3FA 3ATIA 3MOCA 1KLIH 5T3HA 4ISLA 1PQAA 2ZFPH 2WPIS 2FOMB 1EZXC 2H2ZA 1KTSB 2ZPSA 1PPHE 4PROA 3LJJA 2XXLA 1NRQH 3RXKA 1O3KA 2EC9H 1C5LH 1NFXA 1WCZA 1V6DA 2VIWA 3TH4H 1EASA 2ZQ2A 3QO6A 3ZZDA 3A87A 1P04A 2BY9X 1G9IE 3K65B 1AKSB 1UTJA 3PMHB 2ZDKA 1O36A 1TALA 1G37A 3KF2A 1CGHA 1P10A 1ZGIA 1CO7E 1AFEH 1AY6H 1G3CA 2ALVA 3KL6A 1GJ9B 1ZMJA 5ETXA 2J34A 2ZCLP 3HK3B 1V2MT 1DUAA 2Z3EA 1BZXE 4Y79A 1PPFE 1O32A 2ZKSA 4IN1A 5C2ZA 1BTPA 1GWAA 1C5OH 3MU4A 2W26A 2OP9A 1C1VH 3FZZA 3SNDA 2ODYB 4JZEH 1K1LA 1XKBC 4K1SA 3M61U 3GCTF 2ANKH 1QRZA 2M5TA 4XSKU 4MNVA 4U32A 2R2MB 1CE5A 1K22H 1KXFA 1LHCH 5EPYA 2TGPZ 1AQ7A 3G01A 1MTSA 1W7XH 4AX9H 4WJG2 4ABBA 3SZNA 1Z8GA 3SU5A 1S6FA 1FDPA 1OP8A 4AGJA 3I29A 1T4UH 1FXYA 1AVXA 2A2XH 4JYTA 5GPIB 1HRTH 1DS2E 1AVGH 4YLUA 4D9RA 3SU1A 1BUIA 3T28A 1IOEA 2B0FA 2BY6X 3VB7A 5AHGH 1DWBH 2H9HA 2QGRA 1EPTC 7GCHF 1SBWA 4FXGH 2PWXA 1IQJA 3QGJA 3RXQA 1VGCC 3VB6A 1ELTA 3T29A 1CHOG 2UUKB 3SI3H 3MU0A 1SVPA 3BTGE 2AMDA 4B73A 2VVUA 2ZHFH 4KTCA 4ABAA 5GIBA 2BDHA 5FXLA 3RMNH 4INHA 7ESTE 2XC0A 4TWWA 1C5YB 2RG3A 3LH1A 1F5KU 1NU9A 1ESAA 1GMDG 2Y5HA 4WMFA 1HLTH 1QQUA 3BEIB 4YESB 3ODDA 2PLXA 4DY7B 1MTVA 1IQHA 2R3YA 3Q00A 3TGIE 2UUFB 1HB0B 3B9FH 2VIVA 1D4PB 1YP9A 2ZU2A 4XE4A 3Q3YA 1KIGH 1MBQA 4E7RG 1WTHD 2FI4E 3ZZ3A 4R8TB 1DDJA 5FHTA 4NFFA 1TGNA 5A8YA 1ZTKA 1SLXB 3MFJA 1THPB 5JYIA 1EJNA 5I25A 1QIXB 1EAWA 3MNXA 3A8AA 3SQEE 1A4WH 1HCGA 1CA0C 4H6TA 3B8JA 1BMLA 2BX3A 1AN1E 1G32B 5FPSA 4HGCA 1XKAC 1O3OA 3CENA 4DVAU 1TA2A 2GKVE 3C27B 3AAUA 1SB1H 1YLCA 2RA0A 1GHAG 5DG6A 2XCFA 7GCHG 3F68H 3MO9A 1G2LA 2PSXA 1VJAU 3A86A 4CRBA 3PV4A 2F9OA 1SLUB 2ZPRA 1LKBA 3A8CA 1V2UT 1KSNA 2P95A 3KCGH 1FPCH 1C5XB 4AG2A 1O2WA 5FPYA 3ZVAA 1RIWC 1C1OA 1P9UA 2G8TA 6LPRA 2HRVA 4CRDA 1ANDA 2JETB 3SV9A 4Z0KA 1C2DA 1TIOA 1UK3A 4O3TA 5H4IB 2FWWA 5K7RA 1O2ZA 6GCHF 1HJ8A 1XUGA 2P93A 1UTOA 4GCHF 4DW2U 8LPRA 2CXVA 1O2NA 1F0TA 4WXVA 1N6XA 1C9TA 1BBRH 2FOAA 2Y7XA 2A4QA 1BQYA 2Z6BD 2W7SA 4X8SH 1XVOA 1JBUH 3DT0H 7LPRA 1MZDA 1VZQH 1UTNA 3SYJA 4XBCA 4I8GA 4KGAA 4O97A 1HV7A 3GCHC 1T32A 1Z8JB 2WINI 1DLEA 1NN6A 2Q6DA 4E05H 1QB6A 3GCNA 4INLA 2FOHA 4BAKB 1ZPBA 1MKXK 1O39A 2OLGA 4GCHG 1SHHB 3MNCA 3VFEA 1SHYA 2OK5A 3A82A 3PMJA 5DGJA 1LVYA 2H5CA 1NS3A 2D26C 2QC2A 2XYAA 4BTIB 3SV8A 4TWYA 2GV6A 4X1NU 4Y8YA 1N8OC 2QV1A 3UREA 8GCHG 1BMMH 1HIAA 1DANH 1TX8A 1LVOA 2BDAA 1GBTA 4NIXA 3TPIZ 3MO3A 4CREA 2GCTB 1O3NA 1YF4A 2Z7FE 1HAZB 2TPIZ 2A5AA 1CT2E 1TX6A 2ZDNA 1P12E 1QJ6B 4A1TA 1HAYB 1E0FD 1M9UA 2GMTB 3E16B 4AB9A 4KP0A 3BSQA 2P16A 1J14A 1LHFH 5EXLA 1UTMA 2ZCHP 5EGMA 4I8JA 1OYTH 3SHCH 1ANEA 1OWKA 3I78A 2UWPA 3E0PB 1DITH 1ELGA 1BA8B 3BV9B 3KHVA 3RMOH 5A09A 3NUMA 3QK1A 1MTNB 4AYVB 1O3EA 5A0AE 1YCPH 1DPOA 2VB0A 2ZI2H 3DA9B 5T6GA 4O9VA 1P03A 2OC8A 1PPBH 3VPKA 5EQSA 1TB6H 1W8BH 1T8NA 3SJOA 2VU8E 1HXFH 1OPHB 1P2JA 1FIZA 3HGPA 1V2VT 1NM6A 1NESE 4BXSA 1BIOA 1EUFA 3QZRA 3RXUA 3UQOA 3ZVEA 2Z3DA 2FYQA 2RCEA 1WSSH 3JZ1B 2ZHEH 4X8VH 2P3UB 5EU8A 5SGAE 4ISHH 8KME2 3LDXH 3O8BA 1QGFA 2A5IA 4X2YA 2ZO3H 1MQ6A 1XM1A 4TY6A 1YC0A 1GMCF 1PQ5A 3EGKH 2GVFA 1C5SA 4JK5A 1HXEH 3EYDA 4BXWA 3E0NB 1EZSC 1GBJA 3HGNA 1AWHB 1Z6JH 1UVPA 1O2LA 4YT7H 3KGPA 3SBKA 1AIXH 3UUZA 1TYNA 1VCQA 1C2JA 4X8TH 2GZ7A 1BHXB 1BMAA 1GHWH 1OWDA 4HI3A 1YYY1 4ABDA 3RU4E 1J8AA 5EOKA 2HLCA 2PUQH 1AB9C 2XCNA 5BRRE 3SORA 2ZDAH 3HKIB 1PPCE 1SGCA 4FUIA 1O30A 3ZVDA 1PPEE 2D1JA 3BG4C 1TRNA 2AGGX 5FX5A 1S82A 1GDQA 2ZFFH 3D23A 1GBFA 2FMJA 3S69A 3HK6B 4GUXA 1L2EA 1Z8IB 4CRGA 4H4FA 1E34B 2WUBA 1BBRK 2ZQ1A 3ZZ7A 2GCHG 1GMHG 3M37A 3RUOA 2SGQE 1BITA 1H9LB 4DGJA 2H1UA 1PYTC 3A7ZA 1C5WB 1IQNA 1O34A 1GL0E 1A46H 3WY8A 2XRCA 3TK9A 1ETRH 1SI5H 2ZDVH 1DY9A 1O3GA 3E1XB 1WAYB 3SGAE 1GBMA 1JIMA 2BD9A 1FONA 1RTKA 3SJIA 2BXTH 2JH0D 1FAXA 2P3FH 1Z8RA 3BTHE 2IPHA 1OSSA 1TNKA 2AIPA 3RMLH 2BY7X 2P94A 3P95A 4FU7A 1O5CB 2VIDA 2WPJS 5DP8A 2VVVA 1FY5A 2ODQA 1UVTH 3PM3A 1O2KA 1D3TB 1D3PB 1EOLA 1O2JA 4IBLH 3FFGA 5CE1A 1SGNE 3SGBE 3FP6E 3ZZAA 2PTCE 5L30H 4R0IA 1THRH 1EJAA 4Q2KA 1JXPA 3AASA 3SV2H 2GDEH 2OBOA 2PR3A 3N7OA 1HAVB 3A85A 1SLWB 5DP6A 4AN7A 1VJ9U 3MH6A 2YNBA 1KLJH 2ZP0H 1LVMA 5C3NA 1GVZA 2Z9JA 1LDTT 3UWJH 3SHAH 1ETTH 2Z9KA 2GD4B 2VWLA 4OS6A 3RP2A 3Q3KA 1EPTA 2HNTC 3SGQE 4B71A 1WTGH 1ZMLA 4BTUB 3LKWA 5GCHG 1Z1IA 4I7YH 3ATMA 1YPJH 4Y7AA 4YLQH 2J94A 1UVUH 1GI0A 1O2YA 1C1UH 1EB1H 4IGDA 1TPPA 2WV4A 4IC6A 2ZECA 3ODFA 5G4BA 2GMTC 2BD4A 3UIRA 1UHBA 2OINA 4WMEA 3GISB 5DP9A 2OXSA 4FUFA 2GCTC 1Z6EA 3PLBA 3LGUA 4DJZB 2ZGBH 1G36A 1YKTA 2AH4X 1DLKB 1LHGH 1K1JA 3V7TA
chains in the Genus database with same CATH superfamily
3M3TA 1N8OB 1P9SA 2GZ9A 3MU8A 5GDSH 4I31A 2F3CE 1A5HA 1ZJKA 1SGEE 5T6DA 3W1EA 5LPEA 2A7CA 2B9LA 2G81E 4FU9A 4JYVH 4B74A 1ZPCA 3NWUA 3URDA 5J4QA 2Y81A 1L1NA 1MU8B 2ZG0H 1Z1JA 2V7QD 1IHTH 3KN2A 4DIHH 2QCYA 1CU1A 2FLBH 1J9CH 2Y80A 1BOQA 2JH5D 1S5SA 2QXGA 5DN6D 1P8VC 2BD2A 4DG4A 3KYFA 1VCPA 1A61H 3KQDA 2KFWA 1IQEA 3E8LA 1SKYE 4GPGA 2ZGCA 1MAYA 3SJ9A 1F0UA 1C5ZB 1W0YH 3A84A 3PTBA 2BY5X 1D3QB 1O38A 2ANWA 2GZ8A 3GY3A 4Q80A 3F2FA 1EAXA 3BTFE 5EODA 2BD7A 1W3CA 2Y6TA 2ZGJA 1TGTA 3SNCA 1GI7B 1Q2WA 4JK6A 1RIWB 3DUXH 3RXDA 1W0ZU 4TYDA 5F03A 3BTDE 4NIVA 1C5UA 3O8DA 1EJMA 4IMQA 1AVWA 1UMAH 1W10U 1P01A 3A89A 1TE0A 4KTSA 3S9AA 3TK6A 2ALPA 3RXOA 1EP6A 5E2PA 2YNAA 3KYGA 3R0FA 2Q1JA 2XBVA 1A0HB 1TFXA 1E36B 1Y5UT 2GT7A 3SNEA 3EQ0H 1TMTH 4ZAEA 4O03A 1MTUA 3ZZ6A 3SU2A 4JZIA 4XBBA 4LK4A 1IQKA 4F4OC 1ESBA 3ZYDA 1OWHA 1NFWA 3SJKA 4D76A 1QB1A 5F6MA 3RDZA 2ZTZA 1VR1H 1ZLRA 1B5GH 1P11E 5ESBA 1NFYA 1C1NA 1VITF 1Y3VA 1O2GH 3FKSD 4E06H 1TOCB 1L4DA 1FY3A 5TJXA 4YXWD 1IQMA 1UTQA 1UCYK 4Z6AH 3RXIA 4I8HA 1BMNH 1ZMNA 1W13U 1DT2A 2HALA 1LCYA 4A1XA 2ZTYA 1EFRD 3ATWA 3DFLA 1MCVA 3UNQA 1V2OT 3PRDA 2BLOA 4RKJB 1SR5C 1BTYA 3KIDU 1GCTC 5JBCS 1GPZA 1H9HE 1MKWH 5DP4A 2KCYA 2SNVA 4HFPB 3L33A 2C8ZB 2J9NA 5CMXH 4A7IB 1O37A 4Y76A 3LIWA 3LGWA 4UEHH 3RXPA 1VGCB 2JKHA 1EPTB 2UUYA 1VCWA 4GVUA 2ANYA 1E1QD 2ZU5A 4B2CA 1NPMA 3M5MA 4K60A 2H9EH 1RS0A 2FOEA 3A83A 1QFKH 1AGJA 5HMAA 7KMEH 1ABIH 1MMJN 1V2RT 2H5DA 1O2OA 1GI4A 3LT3A 4OGYA 1GG6B 1O5DH 2FTMA 3RXBA 1EZQA 2D2DA 4CBNA 1G3DA 4LZ1H 4ZHLU 2A1DB 2G55A 3S9CA 2LELA 1ACBE 1ANBA 1AO5A 1TNIA 1O3MA 2QF3A 3VXFH 2O8WA 1TRMA 1GHVH 3C1KA 1CGIE 1IQLA 1ESTA 2WV5A 1LO6A 1O2VA 4NA7A 2NU2E 1PQ7A 9ESTA 1OS8A 2ZTXA 2FTLE 1A2CH 3U28C 1VITH 3TH3H 1S0QA 5DPAA 1P02A 1NFUA 4WXIA 3AW0A 1P2QA 1GBLA 1W0JD 2P8OB 1W7GH 1LTOA 1F2SE 4AOQA 3ZYEA 3SUGA 5F8TA 1TGBA 5GWZA 2OQ5A 1GDUA 2DUCA 2FM2A 4VGCC 1DFPA 2Y5GA 2OC7A 1RJXB 3SOSA 5J4SA 3PYHA 2O8TA 2G51A 1FV9A 1C5TA 1GI6A 1BJUA 2CJIA 1GJ4H 1NRNH 1UHBB 1EQ9A 2AMPA 5FCKA 1O5GH 4IN2A 1K9OE 3O8CA 1L0ZA 1ZHPA 1NTPA 4FOUC 4I8LA 4GHQA 1T8OA 3V13A 1C2LA 1QTFA 5B6OA 1G30B 3TH2H 4HG6A 3EE0B 2B8OH 2EA3A 1YY3A 3UWIA 1NY22 3PMBB 3VB4A 2TGTA 1A7SA 5JB8S 1UK2A 2PUXB 1TRYA 1C5MD 2FS8A 3F1SB 1G3EA 4CHAB 1NU7B 1QJ1B 2SGEE 3VEQB 3ATKA 3TGJE 2BZAA 3Q3XA 4Y6DA 3OYPA 1IQGA 1GBIA 5FBIA 1INCA 4CRAA 5LH8A 1CBWC 1DWDH 2PGQB 2UUJB 4FUEA 4RSPA 1KMHB 4A1VA 2V0BA 6CHAC 1KXCA 1TPSA 1Y3YA 1S81A 5DP3A 5HKKD 1ZRKA 1T31A 3SN8A 3BTME 1OOKB 4XBDA 3DCLA 3RU4D 4BTTB 2KR7A 1GHAF 1XUJA 5HIYA 3KEEA 1SGTA 3NKKA 2V3HH 2QF0A 5HGGA 2BOKA 3UTUH 2UWLA 3ZZCA 2QYIA 4XD7D 4X2VA 2NU3E 2JDID 1MTWA 2WUCA 1FX0B 1GBEA 1HAOH 3ESTA 5CHAC 4ASHA 1QBNA 3TNSA 4KKDA 2PP6A 1SMFE 2F4LA 3O8RA 2QIQA 1KLTA 1O2QA 1CA8B 1O2PA 1K1PA 1HAHH 1YCPK 1JRSA 2I6SA 1RD3B 2ZIQH 2OUAA 4X2WA 3RXMA 1TGCA 3PMAB 3F6UH 2O8UA 1TBRH 1TPAE 2VBCA 1TNJA 2G00A 1J17T 4KTUA 3TITA 2ZFQH 2ZGXH 3A7VA 4JZDH 1ELAA 1AFQC 5LPFA 4Q7ZA 1TBZH 2JH6D 1ZZZA 1N6YA 1BRBE 3AK5A 5DKMA 1WDIA 3KQCA 3TNTA 2XNDD 2LNCA 4JZFH 1HJAC 4X6PA 4NZLA 2FPZA 3M36A 4THNH 3OTPA 5C1YA 4H42U 3MO6A 5EPNA 1AU8A 3D65E 2ZU3A 1ELFA 1O3LA 4AZ2B 4I33A 2ODPA 1V2ST 3QDZB 4FVDA 5L2YH 1V2NT 3SUDA 1MKWK 1RFNA 2ZWLH 3A7WA 3W94A 4ZHMU 4X1SU 1ZTLA 1O3HA 4XOJA 3ZZ5A 2CN0H 2R2WU 1GJAB 4J2YB 1QJ7B 2HGTH 2KZ4A 4MTBA 3MNSA 4J1YA 1MKXH 2ZC9H 1BRUP 3SV6A 2VVCA 1HAXB 4DIIH 2AS9A 4JZ1A 1UCYH 3DD2H 3QLPH 3EA7A 2F9VA 5AFZH 8GCHF 3UQVA 2Q6GA 1C1RA 1PJPA 5C5NA 5EJ1A 2CV3A 4U01A 4NFEA 5A0BA 1OWJA 4OM9A 4U30A 4UFEH 2Z9GA 1K21H 4A5TS 4Z1MD 2A45B 3GOVB 4MPUA 1O3BA 4M9FA 4AFSA 2VGCB 5CHBA 5EXNA 4YOJA 5PTPA 2GCHF 3SQHE 1P2OA 2GP9B 4OS4A 4P00A 2DE8A 1QL9A 1C5PA 5EQQA 3A7XA 5C20A 1XX9A 3RXFA 3BN9A 4X1PU 3TGKE 4DCDA 1GHYH 2BLWA 3GCOA 3ZZ9A 2L74A 4GLYA 4MQAA 3VB3A 3TJNA 2GT8A 1H8HD 1BTUA 4YOIA 1AZ8A 1ANCA 3FAOA 1EOJA 2RDLA 2Z3CA 4TPYA 1NBMD 2R0KA 1AHTH 4K3JA 5JDUB 1BMFD 5C0UA 1EX3A 1GHBF 5EXMA 1UTPA 1KDQA 2PV9B 2OC1A 1O33A 1C5QA 2NU1E 3M3SA 3F9GA 4Q7YA 3MI4A 2PGBB 2VGCC 1A1RA 1ARCA 1HPGA 2G5NA 1HBTH 2VH6A 3OSYA 2J97A 1F0SA 2I6QA 1O3AA 3VGCC 1Z71A 2PSYA 2QXJA 1AE8H 3UOPA 4AORA 1GJ5H 1VITG 2J2UA 1AUJA 1C2FA 5JBTA 2ZU4A 2G5VA 3LGTA 1FN8A 3P92A 1B7XB 4O3UA 4WH8A 3RXCA 4YOGA 1C4U2 4FUGA 1NZQH 1DICA 4AFQA 1SL3A 1RTFB 1XUIA 3PLPA 4B6FA 1GBDA 3OY6U 4DT4A 1FAKH 1O3CA 2ZU1A 2FS9A 1TABE 4MG3A 2WYGA 4OS2A 1W14U 1KXAA 3ZZ4A 1CVWH 1H8IH 4UD9H 3LGYA 4BNRA 2OCVB 1QURH 1T4VH 1WQVH 5C1XA 3N7DA 1SQTA 3WWBA 1ID5H 2AFQB 1D9IA 1MUEB 5DJ7A 2CF9H 3A8BA 3BIVH 1P57B 1HJAB 3QUMP 5DP7A 1ZHMA 3NZIA 3N7EA 1GBAA 3ZVCA 4DURA 4K1EA 2HVXA 3DSPA 3PO1B 3ITIA 1EAIA 1ZRBA 2C4FH 5BPEA 3GY8A 2QN5T 3K9XB 5JBBS 2LPRA 1JOUB 2J95A 1S0RA 2SGPE 4ABGA 1YGCH 4FUCA 1T8LA 1MD7A 1DE7H 3V12A 2OC0A 1T8MA 2VIQA 1FNIA 2W3KA 2ZEBA 1TNGA 1RTLA 1F7ZA 1W12U 3ZV8A 1W2KH 3M3VA 3M7UA 2WYJA 2FYRA 4MPWA 3UPEA 3FANA 1DOJA 3GY2A 5CHAB 5JB9S 3RC5A 1TQ0B 2A32A 2VINA 1EXFA 1LPKB 1P3EA 3VG8A 2FXRA 1OP2A 2PKSB 3OEHD 1WV7H 4WH6A 4ABJA 3OE7D 1TOMH 5C1UA 1Y3UA 4K5ZA 3ZIAD 4A6LA 3U8OH 1H4WA 2FZZA 4WY3A 4RN6A 5FBEA 1SGFG 2B5TB 4BAOB 1ZSJA 3ZVGA 2ZFSA 4ABHA 1D6WA 2D8WA 3DSGA 2WSSD 1CBWB 2BDIA 2P59A 1GJDB 2K1QA 2XC5A 2ZNKH 4CR9A 5HM9A 1GJ7B 1PPZA 4MNXA 4MDSA 5JBAS 1TMBH 1GVKB 2FOCA 4CH8B 1XUFA 1BBRE 1TGSZ 4CHAC 3B23B 1GMHF 2EQNA 3RXEA 4K2YA 4ZCNA 2IOTA 1EAUA 1C1QA 1SGIB 4F48B 3M7QA 1UO6A 1XXDA 3A88A 3A7YA 1UCYE 3UFAA 3P8NA 2IJD1 1GHBG 3T26A 1IQIA 1LQDB 1HAIH 1VKYA 1C5NH 3KNXA 1GMDF 1O3DA 1BDAA 2Q6FA 1UJ1A 1K0HA 2F83A 1F5LA 5TCAA 1BJVA 3OTJE 1GDNA 1PYTD 1ZR0A 1S85A 2XBYA 5C94A 1OYQA 3UR6A 2F9NA 3E90B 2JJ2D 3F9EA 1H8DH 2EI6A 3QZQA 2GV7A 1SQAA 1EKBB 6ESTA 4OS7A 2Y82A 3MMGA 2O9QA 3RXTA 4VGCB 1YM0A 3AVZA 4Y0ZE 2V35A 3QX5H 1OWEA 3MH4A 2XTTB 3CS0A 1BTXA 4NWKA 1FPHH 1K1OA 1K2I1 2ESTE 1ZOMA 1CHGA 3GYLB 3FZDA 4INKA 2CHAB 4TT3D 4D7GA 2P8OC 1C1SA 1SGPE 2O8MA 2XWBI 1GBHA 3SI4H 2OQUA 1A5GH 3SU0A 3IITA 1SGYE 3LC5A 2FODA 2YMSC 4OS1A 2BDYA 3QTVH 5JPMH 1DVAH 3W95A 3GS9A 1SGRE 2CF8H 1SFQB 4RKOB 3M5NA 3EA8A 1GL1A 2TRMA 1KY9A 5A2MH 2IN2A 1E37B 2WPDD 1V2TT 1YPEH 1THSH 2FEQH 5ABWA 1MH0A 4RT1A 1BHXF 1AMHA 1SOTA 3PV2A 1SQOA 1GI8B 1CSOE 4ZHAA 1GG6C 2CGAA 3S0NA 2VWMA 3TK5A 4IC5A 1HNEE 6GCHG 2C90B 4ISNA 3GICB 3E3TA 1A0JA 2NU4E 3VXEH 5CDFE 2TGAA 2F9BH 1C4V2 2FLRH 2EI8A 1TX7A 4ZXXH 1GGDC 2ZDLA 1WQSA 2IJOB 5A0CA 3ZVBA 3NXPA 5E8EH 1V2QT 1TAWA 3MU5A 1K28D 3PWBA 2ZHDA 1NRPH 2GTBA 2PHBA 3SNBA 1B0EA 3ZZBA 4Q7XA 4F55A 5IDKA 4B2AA 5E0JA 3LC3A 1KTTB 2ZGHA 4AGKA 1GCTB 2BVXH 5KEDA 5E0HA 1QNJA 4IS5A 2YOLA 1FMGA 4WF8A 2ZFRH 3HATH 3P8OA 2AGIX 1WOFA 4NG9H 2QA9E 3LGIA 1H1BA 4X1RU 5LGOA 2XC4A 2VIOA 1V2JT 1EB2A 3I77A 4NA8A 1DSTA 3PWCA 4AG1A 3VB5A 5KECA 4K8YA 5HXFA 2QE7D 3R3GB 2WPLS 4B2BA 4ABIA 1QA0A 1XVMA 2H9TH 3RLWH 2A7HA 1H9IE 4ZKSU 4RT0A 1DWCH 5C67A 2HOBA 2K8IA 5T1VA 1YCPM 1L1GA 3RM0H 2BLVA 3GY4A 2KCAA 3P17H 1YPLH 2AHME 2FOBA 4NSYA 1V3XA 1XUHA 2P3TB 2RA3A 1GI1A 1RXPA 2W7UA 3SU6A 2A31A 1FI8A 2A4OA 3NPSA 3U9AH 3QWCH 2TGDA 4M7GA 2XOKD 1Y5BT 1X7AC 2TBSA 5LPRA 1SLVB 2FP7B 5DP5A 3LONA 1BRCE 1OX1A 1NO9H 2L6OA 4ISIH 2OTVA 2Y7ZA 1S83A 1JWTA 1L4ZA 1HGTH 1FY8E 3GDVA 2R3UA 4A92A 1O31A 2WPMS 1MCTA 2W3IA 3NCLA 3BEFB 2V6NA 3F9HA 5EW2H 5DSFA 5L6NH 1C9PA 2GDDA 1G3BA 1T7CA 5FCRA 1S6LA 2XBWA 1O3JA 2WPKS 3P6ZB 4X8UH 2BTCE 3SNAA 1O2IA 3ZZ8A 3PRBA 1TQ7B 1P0SH 1FQ3A 1AD8H 1Y3XA 3U8TH 1WXRA 5I46H 1YWUA 3A80A 4CR5A 2F43B 1P06A 4NWLA 2VH0A 2BXUH 1FUJA 3T5FH 2AMQA 2A2QH 1ETSH 2BD5A 3EA9A 2ZHWH 1QQ4A 4XDEA 5T6FA 3ZV9A 2W5EA 5DO4H 2C93B 1C2GA 1SFIA 4BAQB 2W6ID 1PPGE 2C8XB 5GNDA 5C5OA 2AERH 1PQ8A 3GY6A 3OY5U 1YPMH 4XRNA 1G2MA 2FX4A 2G4TA 1CQQA 1QL8A 2BHGA 2TIOA 3BTTE 1AE5A 4U2WA 1NRSH 1SQRA 1K1IA 3A8DA 3MTYA 1FY4A 1BT7A 4ZMAH 5E0GA 2HPPH 1GGDB 3BTKE 4H6SB 4ZH8A 3U98H 3RMMH 1NC6A 1EZUC 1F0RA 3RC6A 3CP7A 4FUJA 1YPHC 3LH3A 4Q4LA 5F8ZA 1Y8TA 5AVDA 1A3EH 4UFFH 1U6QA 1XXFA 1EATA 1NRRH 5FAHA 4JCNA 2HPQH 1AKSA 1W0KD 2ZF0H 4ACBA 2A4RA 4UDWH 3KQBA 1HDTH 4YO9A 4YTAA 1LVBA 1TNLA 1UVOA 2XWAA 4RI0A 3CS7A 3RXRA 5A8ZA 3JZ2B 2F91A 1P2IA 1Y59T 2PFEA 3H7TA 3NK8A 1KXEA 1FN6A 3EDXB 2QAAA 1YPGH 2XNIA 4X6OA 4B6EA 2SGDE 1BTWA 1WU1A 1DUEA 1V2WT 4K8BA 2YMSB 1O35A 4MVNA 3LGVA 5GJ4B 4BAMB 3HPTB 1V2PT 3FP8E 1HAPH 1KYNA 1SPJA 2UWOA 3BTWE 3LJOA 4LXBH 5AFYH 1Z7KA 1LKAA 4MNWA 1A5IA 1GMCG 3ENSB 1ORFA 3DFJA 3SU4A 2CHAC 5EG4A 3K6ZA 5EJZA 1GI5A 2BM2A 2GJGA 4DT7B 3SU3A 1QCPA 3P8GA 3UB0A 3RXSA 1W11U 3RXVA 1E35B 3TIUA 1ZYOA 2AIQA 1IQFA 1O2SA 1HJ9A 1C1TA 1ELVA 3E6PH 1C2KA 1Q31A 5A8XA 1Y5AT 1DXPA 1WYKA 2WPHS 3ATLA 1QBOA 4TPIZ 1S84A 2FX6A 1TONA 1C2EA 4YM9A 1TBQH 4Y7BA 2G52A 4FUDA 4MLFB 4ZXYH 5AF9H 1C2MA 4X1QU 2Y5FA 3PV5A 1AUTC 2HNTE 3STIA 2XW9A 3FP7E 5HIZA 3FVFB 2XBXA 4X6NA 3RXGA 1TNHA 3MWIU 4BANB 1A3BH 5FX6A 3TVJB 4OS5A 1GBCA 1OKXA 3SUFA 1AZZA 2BVRH 1SSXA 4WVPE 5TCCA 1HUTH 5DK1A 3K6YA 1JRTA 1KXBA 2J38A 1CT0E 2KAIA 4B76A 3UR9A 3GY7A 3P8FA 1ELCA 3H09A 3MHWU 4B75A 1DSUA 1DY8A 4LZ4B 1P2KA 3GDUA 4FUHA 3SW2B 3GY5A 2ZPQA 4F49A 3F9FA 1BTHH 4TY7A 4Y10E 1FIWA 1K1NA 1GI9B 1TLDA 2VWNA 3S9BA 1GBKA 3M5OA 3K2UA 2EI7A 1ELBA 1ZGVA 2FOGA 1EP5A 3L3TA 3BTEE 1MD8A 2C8WB 3AAVA 2O8LA 2FIRH 1UVSH 4WMDA 2BD3A 2PKSC 1TPOA 2VNTA 3BG4B 1ABJH 3H7OA 5HYOA 4FUBA 4QT8C 1GJBB 2Z9LA 3AW1A 1SGFA 4JYUH 3OEED 5B6LA 2BQ7B 2R9PA 2WHXA 1LQEA 3RXHA 3BEUA 1AB9B 1SGQE 5HM2A 2BY8X 4Y8XA 2BYAX 3BF6H 4UE7H 1ZHRA 2FI5E 1CGJE 3ELAH 1IAUA 1BRAA 1IHSH 3RXJA 3RXLA 3PLKA 4GSOA 1A0LA 4ZROA 4AB8A 4ISOA 1LHDH 1MU6B 1NROH 4BAHB 5IYTA 4X0WU 1UTLM 1Y3WA 3SUEA 5FL7D 1BCUH 2A0QB 4D8NA 1HYLA 4Y71A 2BVSH 3MH5A 1B0FA 5EJLA 1GJ8B 5FPTA 1ZJDA 1J16A 3PO1C 5GCHF 5C17A 4B1TA 2SNWA 2ZFTA 4HZHA 4FU8A 3KQEA 4Y8ZA 2FI3E 4NGAH 3IG6B 2QY0B 1HFDA 3UNRA 1MZAA 3GYMA 4ZUHA 1QRXA 2BD8A 3T27A 1O2TA 3SZEA 2ZZUH 5EIYA 1MAXA 1DXWA 2STAE 4UFGH 2STBE 2SFAA 1LHEH 4NCYA 2WV9A 1O5FH 1GI3A 5E2OA 4UONA 3M7TA 3UOUA 2K0QA 3DHKH 3TLOA 1MTNC 4ESTE 2ZHQH 3M5LA 2PKAA 2RFKC 1SGDE 4ZKNU 3T62A 3P70B 4SGAE 1C1PA 3S7HB 1HAGE 1O2HA 4X6MA 1O3IA 1AI8H 3A81A 4E7NA 2SGAA 3D62A 1LMWB 3LOXA 3GCTG 2H6MA 3KQ5A 2NU0E 4ZKRU 1O5BB 2ILNA 1QR3E 3DSOA 3VGCB 1MBMA 1DM4B 2HNTF 2PW8H 1FY1A 1P2MA 4IW4E 1HAVA 4LOYH 3UNSA 4ABEA 1ELEE 4CRFA 2BQ6B 2ZA5A 4I8KA 4Y11E 3U1JB 1GHXH 3ZVFA 5L2ZH 1QRWA 4IMZA 3LPRA 2SGFE 2YMSD 1FZZA 1GJCB 1NT1A 1C2IA 4NIYA 3S7KB 3TJOA 3BG8A 2A7JA 3MYWA 3TJUA 3EAJA 4UFDH 5EQRA 5F8XA 1O2XA 2PKAB 4P02A 3QGNB 1K1MA 1ELDE 1ZSLA 2BDGA 3BIUH 4FVBA 1F5RA 1TA6A 3GCHB 2AGEX 3RXAA 2VWOA 2Z94A 1C1WH 1YPHE 2EEKA 3U8RH 1ARBA 1OWIA 2A4GA 4K69A 1P3CA 2FESH 1O5EH 3TU7H 4ZKOU 2V3OH 1DWEH 1XMNB 3UAIC 1L1JA 3F0OA 1SC8U 4Y0YE 3U69H 4ACAA 3QN7A 1GCDA 3OU0A 2C3SA 4CH2B 2AEIH 3PROA 1YLDA 2J5UA 1JMOH 1AWFH 1HIAB 1LPGB 4NA9H 2JETC 4K1TA 2A5KA 3F3BA 3L6PA 1P05A 3MNBA 1SOZA 2THFB 3PTNA 3HKJB 4ASUD 5K0HA 2BOHB 2BX4A 1D3DB 4NSVA 3UY9A 1J15A 1ZSKA 1O2UA 1FLEE 2VJ1A 1XUKA 1QL7A 4AFUA 1C4Y2 1KDQB 1N1LA 2HWLB 2PTNA 2V3MA 1GI2A 2WZQA 2FO9A 3GDSA 3MH7A 2BZ6H 5F53A 5EW1H 1ZTJA 1SG8B 2J4IA 3QTOH 3T25A 1Q3XA 1MQ5A 1F92A 1UTKA 1QHRB 2BLQA 4MPXA 1C5VA 3E91A 4CRCA 1GJ6A 2AYWA 1CA0B 1COWD 4WWYA 1V2KT 1QB9A 1GBBA 2ZCKP 2ZDMA 2J92A 1QY6A 1O3PB 1KXDA 3STJA 1YBWA 2R0LA 8ESTE 2GGVB 4HTCH 3RM2H 2C8YB 1YLNA 1ZPZA 1OXGA 1O0DH 1TMUH 2F9UA 1GVLA 2QXIA 4NZQA 1AFQB 1QA7A 4I32A 1RRKA 2KAIB 3LU9B 1WUNH 4YZUA 1RGQA 3SV7A 2CMYA 2ANMH 3D49H 4DOQA 1C1MA 1CHOF 1D6RA 2GX4A 9LPRA 2BDBA 1C5RA 1P2NA 3V0XA 4SGBE 2BQWB 3TJVA 4D7FA 4AYYB 4X2XA 2F9PA 3OX7U 4YT6H 1O2MA 2QXHA 3MU1A 3CNRA 1OP0A 4BOHA 4XFQA 5ESTE 1O2RA 1QBVH 1YPKH 4GAWA 4MNYA 2Z9IA 3A7TA 1PFXC 3V3MA 3IWMA 4AFZA 2BDCA 2ULLA 1UK4A 1JIRA 3RU4T 3Q76A 4MPVA 4KELA 3M35A 3EE7A 3SJ8A 3T2NA 3RC4A 2BMGB 4TSFD 2FOFA 4GHTA 4D9QA 1V2LT 1BB0B 2NWNA 2OD3B 1DX5M 4JMYA 2DE9A 3Q77A 1S6HA 1C2HA 1O5AB 3U1IB 2ASUB 3URCA 1FJSA 5GXPA 3BTQE 2G4UA 1E38B 6CHAB 1BTZA 2OBQA 2BB4A 3SO3A 3F2HA 4OGXA 2HVYB 1TWXB 1P09A 2FDAA 1CT4E 3H5CB 4ABFA 2B7DH 4NIWA 3RLYH 3PB1E 1WBGB 2VIPA 1GHZA 1LPZB 4CBOA 1O3FA 3ATIA 3MOCA 1KLIH 5T3HA 4ISLA 1PQAA 2ZFPH 3N99A 2WPIS 2FOMB 1EZXC 2H2ZA 1KTSB 3NRLA 2ZPSA 2KCOA 1PPHE 4PROA 3LJJA 2XXLA 1NRQH 3RXKA 1O3KA 2EC9H 1C5LH 1NFXA 1WCZA 1V6DA 2VIWA 3TH4H 1EASA 2ZQ2A 3QO6A 3ZZDA 3A87A 1P04A 2BY9X 1G9IE 3K65B 1AKSB 1UTJA 3PMHB 2ZDKA 1O36A 1TALA 1G37A 3KF2A 1CGHA 1P10A 1ZGIA 1CO7E 1AFEH 1AY6H 1G3CA 2ALVA 3KL6A 1GJ9B 1ZMJA 5ETXA 2J34A 2ZCLP 3HK3B 1V2MT 1DUAA 2Z3EA 1BZXE 4Y79A 1PPFE 1O32A 2ZKSA 4IN1A 5C2ZA 1BTPA 1GWAA 1C5OH 1H8ED 3MU4A 2W26A 2OP9A 1C1VH 3FZZA 3SNDA 2ODYB 4JZEH 2J98A 1K1LA 1XKBC 4K1SA 2HLDD 3M61U 3GCTF 2ANKH 1QRZA 2M5TA 4XSKU 4MNVA 4U32A 2R2MB 1CE5A 1K22H 1KXFA 1LHCH 5EPYA 2TGPZ 1AQ7A 3G01A 1MTSA 1W7XH 4AX9H 4WJG2 4ABBA 3SZNA 1Z8GA 3SU5A 1S6FA 1FDPA 1OP8A 4AGJA 3I29A 1T4UH 1FXYA 1AVXA 2A2XH 4JYTA 5GPIB 1HRTH 1DS2E 1AVGH 4YLUA 4D9RA 1UW7A 3SU1A 1BUIA 1MABB 3T28A 1IOEA 2B0FA 2BY6X 2IPQX 1E1RD 3VB7A 5AHGH 1DWBH 2H9HA 2QGRA 1EPTC 7GCHF 1SBWA 4FXGH 2PWXA 1IQJA 3QGJA 3RXQA 1VGCC 3VB6A 1ELTA 3T29A 1CHOG 2UUKB 3SI3H 3MU0A 1SVPA 3BTGE 2AMDA 4B73A 2VVUA 2ZHFH 4KTCA 4ABAA 5GIBA 2BDHA 5FXLA 3RMNH 4INHA 7ESTE 2XC0A 4TWWA 1C5YB 2RG3A 3LH1A 1F5KU 3WW7A 1NU9A 1ESAA 1GMDG 2Y5HA 4WMFA 1HLTH 1QQUA 3BEIB 4YESB 3ODDA 2PLXA 4DY7B 1MTVA 1IQHA 2R3YA 3Q00A 3TGIE 2UUFB 1HB0B 3B9FH 2VIVA 1D4PB 1YP9A 2ZU2A 4XE4A 3Q3YA 1KIGH 1MBQA 4E7RG 1WTHD 2FI4E 3ZZ3A 4R8TB 1DDJA 5FHTA 4NFFA 1TGNA 5A8YA 1ZTKA 1SLXB 3MFJA 1THPB 5JYIA 1EJNA 5I25A 1QIXB 1EAWA 3MNXA 3A8AA 3SQEE 1A4WH 1HCGA 1CA0C 4H6TA 3B8JA 1BMLA 2BX3A 1AN1E 1G32B 2LP6A 5FPSA 4HGCA 1XKAC 1O3OA 3CENA 5C0TA 4DVAU 1TA2A 2GKVE 3C27B 3AAUA 1SB1H 1YLCA 2RA0A 1GHAG 5DG6A 2XCFA 7GCHG 3F68H 3MO9A 1G2LA 2PSXA 1VJAU 3A86A 4CRBA 3PV4A 2F9OA 1SLUB 2ZPRA 1LKBA 3F0PA 3A8CA 1V2UT 1KSNA 2P95A 3KCGH 1FPCH 1C5XB 4AG2A 1O2WA 5FPYA 3ZVAA 1RIWC 1C1OA 1P9UA 2G8TA 6LPRA 2HRVA 4CRDA 1ANDA 2JETB 3SV9A 4Z0KA 1NBME 1C2DA 1TIOA 1UK3A 4O3TA 5H4IB 2FWWA 3FO8D 5K7RA 1O2ZA 6GCHF 1HJ8A 1XUGA 2P93A 1UTOA 4GCHF 4DW2U 8LPRA 2CXVA 1O2NA 1F0TA 4WXVA 1N6XA 1C9TA 1BBRH 2FOAA 2Y7XA 2A4QA 1BQYA 2Z6BD 2W7SA 4X8SH 1XVOA 1JBUH 3DT0H 7LPRA 1MZDA 1VZQH 1UTNA 3SYJA 4XBCA 4I8GA 4KGAA 4O97A 1HV7A 3GCHC 1T32A 1Z8JB 2WINI 1DLEA 3OAAD 1NN6A 2Q6DA 4E05H 1QB6A 3GCNA 4INLA 2FOHA 4BAKB 1ZPBA 1MKXK 1O39A 2OLGA 4GCHG 1SHHB 3MNCA 3VFEA 1SHYA 2OK5A 3A82A 3PMJA 5DGJA 1LVYA 2H5CA 1NS3A 2D26C 2QC2A 2XYAA 2J98B 3SV8A 4BTIB 1E79D 4TWYA 2GV6A 4X1NU 4Y8YA 1N8OC 2QV1A 3UREA 8GCHG 1BMMH 1HIAA 2M2AA 1DANH 1TX8A 1LVOA 2BDAA 2KM0A 1GBTA 2JIZD 4NIXA 3TPIZ 3MO3A 4CREA 2GCTB 1O3NA 1YF4A 2JJ1D 2Z7FE 1HAZB 2TPIZ 2A5AA 1CT2E 1TX6A 2ZDNA 1P12E 1QJ6B 4A1TA 1HAYB 1E0FD 3FOAA 1M9UA 2GMTB 3E16B 4AB9A 4KP0A 3BSQA 2P16A 1J14A 1LHFH 5EXLA 1UTMA 2ZCHP 5EGMA 4I8JA 1OYTH 3SHCH 1ANEA 1OWKA 3I78A 2UWPA 2EY4C 3E0PB 1DITH 1ELGA 1BA8B 3BV9B 3KHVA 3RMOH 5A09A 3NUMA 3QK1A 1MTNB 4I86A 4AYVB 1O3EA 5A0AE 1YCPH 1DPOA 2VB0A 2ZI2H 3DA9B 5T6GA 4O9VA 1P03A 2OC8A 1PPBH 3VPKA 5EQSA 1TB6H 1W8BH 1T8NA 3SJOA 2VU8E 1HXFH 1OPHB 1P2JA 1FIZA 3HGPA 2CK3D 1V2VT 1NM6A 1NESE 4BXSA 1BIOA 1EUFA 3QZRA 3RXUA 3UQOA 3ZVEA 2Z3DA 2FYQA 2RCEA 1WSSH 3JZ1B 2ZHEH 4X8VH 2P3UB 5EU8A 1QZ8A 5SGAE 4ISHH 8KME2 3LDXH 3O8BA 1QGFA 2A5IA 4X2YA 2ZO3H 1MQ6A 1XM1A 4TY6A 1YC0A 1GMCF 1PQ5A 3EGKH 2GVFA 1C5SA 4JK5A 1HXEH 3EYDA 4BXWA 2RDEA 2QF4A 3E0NB 1EZSC 1GBJA 3HGNA 1AWHB 1Z6JH 1UVPA 1O2LA 4YT7H 3KGPA 3MQKC 3SBKA 1AIXH 3UUZA 1TYNA 1VCQA 1C2JA 4X8TH 2GZ7A 1BHXB 1BMAA 1GHWH 1OWDA 4HI3A 1YYY1 4ABDA 3RU4E 1J8AA 5EOKA 2HLCA 2PUQH 1AB9C 2XCNA 5BRRE 3SORA 2ZDAH 3HKIB 1PPCE 1SGCA 4FUIA 1O30A 3ZVDA 1PPEE 2D1JA 3BG4C 1TRNA 2AGGX 5FX5A 1S82A 1GDQA 2ZFFH 3D23A 1GBFA 2FMJA 3S69A 3HK6B 4GUXA 1L2EA 1Z8IB 4CRGA 4H4FA 5KGOA 1E34B 2WUBA 1BBRK 2ZQ1A 3ZZ7A 2GCHG 1GMHG 3M37A 3RUOA 2SGQE 1BITA 1H9LB 4DGJA 2H1UA 1PYTC 3A7ZA 1C5WB 4Q63A 1IQNA 1O34A 1GL0E 1A46H 2KX4A 3WY8A 2XRCA 3TK9A 1ETRH 1SI5H 2ZDVH 1DY9A 1O3GA 3E1XB 1WAYB 3SGAE 1GBMA 1JIMA 2QF5A 2BD9A 1FONA 1RTKA 3SJIA 2BXTH 2JH0D 1FAXA 2P3FH 4FETA 1Z8RA 3BTHE 2IPHA 1OSSA 1TNKA 2AIPA 3RMLH 2BY7X 2P94A 3P95A 4FU7A 1O5CB 2VIDA 2WPJS 2W6JD 5DP8A 2VVVA 1FY5A 1OHHD 2KCPA 2ODQA 1UVTH 3PM3A 1O2KA 1D3TB 1D3PB 1EOLA 1O2JA 4IBLH 3FFGA 5CE1A 1SGNE 3SGBE 3FP6E 3ZZAA 2PTCE 5L30H 4R0IA 1THRH 1EJAA 4Q2KA 1JXPA 3AASA 3F2GA 3SV2H 2GDEH 2OBOA 2PR3A 3N7OA 1HAVB 3A85A 1SLWB 5DP6A 4AN7A 1VJ9U 3MH6A 2YNBA 1KLJH 2ZP0H 1LVMA 5C3NA 1GVZA 2Z9JA 1LDTT 3UWJH 3SHAH 1ETTH 2Z9KA 2GD4B 2VWLA 4OS6A 3RP2A 3Q3KA 1EPTA 2HNTC 3SGQE 4AC9A 4B71A 1WTGH 1ZMLA 3FN8A 4BTUB 3LKWA 5GCHG 1Z1IA 4I7YH 3ATMA 1YPJH 4Y7AA 4YLQH 2J94A 1UVUH 1GI0A 1O2YA 1C1UH 1EB1H 4IGDA 1TPPA 2WV4A 4IC6A 2ZECA 3ODFA 5G4BA 2GMTC 2BD4A 3UIRA 1UHBA 2OINA 3WWFA 3OFND 4WMEA 3GISB 5IK2D 5DP9A 2OXSA 4FUFA 2GCTC 1Z6EA 3PLBA 3LGUA 4DJZB 2ZGBH 1G36A 1YKTA 2AH4X 1DLKB 1LHGH 1K1JA 3V7TA
chains in the Genus database with same CATH topology
3M3TA 1N8OB 1P9SA 2GZ9A 3MU8A 5GDSH 4I31A 2F3CE 1A5HA 1ZJKA 1SGEE 5T6DA 5LPEA 3W1EA 2A7CA 2B9LA 2G81E 4FU9A 4JYVH 4B74A 1ZPCA 3NWUA 3URDA 5J4QA 2Y81A 1L1NA 1MU8B 2ZG0H 1Z1JA 2V7QD 1IHTH 3KN2A 4DIHH 2QCYA 1CU1A 2FLBH 1J9CH 2Y80A 1BOQA 2JH5D 1S5SA 2QXGA 5DN6D 1P8VC 2BD2A 4DG4A 1VCPA 1A61H 3KQDA 2KFWA 1IQEA 3E8LA 1SKYE 4GPGA 2ZGCA 1MAYA 3SJ9A 1F0UA 1C5ZB 1W0YH 3A84A 3PTBA 2BY5X 1D3QB 1O38A 2ANWA 2GZ8A 3GY3A 4Q80A 3F2FA 1EAXA 3BTFE 5EODA 2BD7A 1W3CA 2Y6TA 2ZGJA 1TGTA 3SNCA 1GI7B 1Q2WA 4JK6A 1RIWB 3DUXH 3RXDA 1W0ZU 4TYDA 5F03A 3BTDE 4NIVA 1C5UA 3O8DA 1EJMA 4IMQA 1AVWA 1UMAH 1W10U 1P01A 3A89A 1TE0A 4KTSA 3S9AA 3TK6A 2ALPA 3RXOA 1EP6A 5E2PA 2YNAA 3R0FA 2Q1JA 2XBVA 1A0HB 1TFXA 1E36B 1Y5UT 2GT7A 3SNEA 3EQ0H 1TMTH 4ZAEA 4O03A 1MTUA 3ZZ6A 3SU2A 4JZIA 4XBBA 4LK4A 1IQKA 4F4OC 1ESBA 3ZYDA 1OWHA 1NFWA 3SJKA 4D76A 1QB1A 5F6MA 3RDZA 2ZTZA 1VR1H 1ZLRA 1B5GH 1P11E 5ESBA 1NFYA 1C1NA 1VITF 1Y3VA 1O2GH 3FKSD 4E06H 1TOCB 1L4DA 1FY3A 5TJXA 4YXWD 1IQMA 1UTQA 1UCYK 4Z6AH 3RXIA 4I8HA 1BMNH 1ZMNA 1W13U 1DT2A 2HALA 1LCYA 4A1XA 2ZTYA 1EFRD 3ATWA 3DFLA 1MCVA 3UNQA 1V2OT 3PRDA 2BLOA 4RKJB 1SR5C 1BTYA 3KIDU 1GCTC 5JBCS 1GPZA 1H9HE 1MKWH 5DP4A 2SNVA 2KCYA 4HFPB 3L33A 2C8ZB 2J9NA 5CMXH 4A7IB 1O37A 4Y76A 3LIWA 3LGWA 4UEHH 3RXPA 1VGCB 2JKHA 1EPTB 2UUYA 1VCWA 4GVUA 2ANYA 1E1QD 2ZU5A 4B2CA 1NPMA 3M5MA 4K60A 2H9EH 1RS0A 2FOEA 3A83A 1QFKH 1AGJA 5HMAA 7KMEH 1ABIH 1MMJN 1V2RT 2H5DA 1O2OA 1GI4A 3LT3A 4OGYA 1GG6B 1O5DH 2FTMA 3RXBA 1EZQA 2D2DA 4CBNA 1G3DA 4LZ1H 4ZHLU 2A1DB 2G55A 3S9CA 2LELA 1ACBE 1ANBA 1AO5A 1TNIA 1O3MA 2QF3A 3VXFH 2O8WA 1TRMA 1GHVH 3C1KA 1CGIE 1IQLA 1ESTA 2WV5A 1LO6A 1O2VA 4NA7A 2NU2E 1PQ7A 9ESTA 1OS8A 2ZTXA 2FTLE 1A2CH 1VITH 3TH3H 1S0QA 5DPAA 1P02A 1NFUA 4WXIA 3AW0A 1P2QA 1GBLA 1W0JD 2P8OB 1W7GH 1LTOA 1F2SE 4AOQA 3ZYEA 3SUGA 5F8TA 1TGBA 5GWZA 2OQ5A 1GDUA 2DUCA 2FM2A 4VGCC 1DFPA 2Y5GA 2OC7A 1RJXB 3SOSA 5J4SA 3PYHA 2O8TA 2G51A 1FV9A 1C5TA 1GI6A 1BJUA 2CJIA 1GJ4H 1NRNH 1UHBB 1EQ9A 2AMPA 5FCKA 1O5GH 4IN2A 1K9OE 3O8CA 1L0ZA 1ZHPA 1NTPA 4I8LA 4GHQA 1T8OA 3V13A 1C2LA 1QTFA 5B6OA 1G30B 3TH2H 3EE0B 2B8OH 2EA3A 3UWIA 1NY22 3PMBB 3VB4A 2TGTA 1A7SA 5JB8S 1UK2A 2PUXB 1TRYA 1C5MD 2FS8A 3F1SB 1G3EA 4CHAB 1NU7B 1QJ1B 2SGEE 3VEQB 3ATKA 3TGJE 2BZAA 3Q3XA 4Y6DA 3OYPA 1IQGA 1GBIA 5FBIA 1INCA 4CRAA 5LH8A 1CBWC 1DWDH 2PGQB 2UUJB 4FUEA 4RSPA 1KMHB 4A1VA 2V0BA 6CHAC 1KXCA 1TPSA 1Y3YA 1S81A 5DP3A 5HKKD 1ZRKA 1T31A 3SN8A 3BTME 1OOKB 4XBDA 3DCLA 3RU4D 4BTTB 2KR7A 1GHAF 1XUJA 3KEEA 1SGTA 3NKKA 2V3HH 2QF0A 5HGGA 2BOKA 3UTUH 2UWLA 3ZZCA 2QYIA 4XD7D 4X2VA 2NU3E 2JDID 1MTWA 2WUCA 1GBEA 1FX0B 1HAOH 3ESTA 5CHAC 4ASHA 1QBNA 3TNSA 4KKDA 1SMFE 2F4LA 3O8RA 2QIQA 1KLTA 1O2QA 1CA8B 1O2PA 1K1PA 1HAHH 1YCPK 1JRSA 2I6SA 1RD3B 2ZIQH 2OUAA 4X2WA 3RXMA 1TGCA 3PMAB 3F6UH 2O8UA 1TBRH 1TPAE 2VBCA 1TNJA 2G00A 1J17T 4KTUA 3TITA 2ZFQH 2ZGXH 3A7VA 4JZDH 1ELAA 1AFQC 5LPFA 4Q7ZA 1TBZH 2JH6D 1ZZZA 1N6YA 1BRBE 3AK5A 5DKMA 3KQCA 3TNTA 4JZFH 2LNCA 2XNDD 1HJAC 4X6PA 4NZLA 2FPZA 3M36A 4THNH 3OTPA 5C1YA 4H42U 3MO6A 5EPNA 1AU8A 3D65E 2ZU3A 1ELFA 1O3LA 4AZ2B 4I33A 2ODPA 1V2ST 3QDZB 4FVDA 5L2YH 1V2NT 3SUDA 1MKWK 1RFNA 2ZWLH 3A7WA 3W94A 4ZHMU 4X1SU 1ZTLA 1O3HA 4XOJA 3ZZ5A 2CN0H 2R2WU 1GJAB 4J2YB 1QJ7B 2HGTH 2KZ4A 4MTBA 3MNSA 4J1YA 1MKXH 2ZC9H 1BRUP 3SV6A 2VVCA 1HAXB 4DIIH 2AS9A 4JZ1A 1UCYH 3DD2H 3QLPH 3EA7A 2F9VA 5AFZH 8GCHF 3UQVA 2Q6GA 1C1RA 1PJPA 5C5NA 2CV3A 4U01A 4NFEA 5A0BA 1OWJA 4U30A 4UFEH 4OM9A 2Z9GA 1K21H 4A5TS 4Z1MD 2A45B 3GOVB 4MPUA 1O3BA 4M9FA 4AFSA 2VGCB 5CHBA 5EXNA 4YOJA 5PTPA 2GCHF 3SQHE 1P2OA 2GP9B 4OS4A 2DE8A 1QL9A 1C5PA 5EQQA 3A7XA 5C20A 1XX9A 3RXFA 3BN9A 4X1PU 3TGKE 4DCDA 1GHYH 2BLWA 3GCOA 3ZZ9A 4GLYA 4MQAA 3VB3A 3TJNA 2GT8A 1H8HD 1BTUA 4YOIA 1AZ8A 1ANCA 3FAOA 1EOJA 2RDLA 2Z3CA 4TPYA 1NBMD 2R0KA 1AHTH 4K3JA 5JDUB 1BMFD 5C0UA 1EX3A 1GHBF 5EXMA 1UTPA 1KDQA 2PV9B 2OC1A 1O33A 1C5QA 2NU1E 3M3SA 3F9GA 4Q7YA 3MI4A 2PGBB 2VGCC 1A1RA 1ARCA 1HPGA 2G5NA 1HBTH 2VH6A 3OSYA 1F0SA 2I6QA 1O3AA 3VGCC 1Z71A 2PSYA 2QXJA 1AE8H 3UOPA 4AORA 1GJ5H 1VITG 2J2UA 1AUJA 1C2FA 5JBTA 2ZU4A 2G5VA 3LGTA 1FN8A 3P92A 1B7XB 4O3UA 4WH8A 3RXCA 4YOGA 1C4U2 4FUGA 1NZQH 1DICA 4AFQA 1SL3A 1RTFB 1XUIA 3PLPA 4B6FA 1GBDA 3OY6U 4DT4A 1FAKH 1O3CA 2ZU1A 2FS9A 1TABE 4MG3A 2WYGA 4OS2A 1W14U 1KXAA 3ZZ4A 1CVWH 1H8IH 4UD9H 3LGYA 4BNRA 2OCVB 1QURH 1T4VH 1WQVH 5C1XA 3N7DA 1SQTA 3WWBA 1ID5H 2AFQB 1D9IA 1MUEB 5DJ7A 2CF9H 3A8BA 3BIVH 1P57B 1HJAB 3QUMP 5DP7A 1ZHMA 3NZIA 3N7EA 1GBAA 3ZVCA 4DURA 4K1EA 2HVXA 3DSPA 3PO1B 3ITIA 1EAIA 1ZRBA 2C4FH 5BPEA 3GY8A 2QN5T 3K9XB 5JBBS 2LPRA 1JOUB 2J95A 1S0RA 2SGPE 4ABGA 1YGCH 4FUCA 1T8LA 1MD7A 1DE7H 3V12A 2OC0A 1T8MA 2VIQA 1FNIA 2W3KA 2ZEBA 1TNGA 1RTLA 1F7ZA 1W12U 3ZV8A 1W2KH 3M3VA 3M7UA 2WYJA 2FYRA 4MPWA 3UPEA 3FANA 1DOJA 3GY2A 5CHAB 5JB9S 3RC5A 1TQ0B 2A32A 2VINA 1EXFA 1LPKB 1P3EA 3VG8A 2FXRA 1OP2A 2PKSB 3OEHD 1WV7H 4WH6A 4ABJA 3OE7D 1TOMH 5C1UA 1Y3UA 4K5ZA 4A6LA 3ZIAD 3U8OH 1H4WA 2FZZA 4WY3A 4RN6A 5FBEA 1SGFG 2B5TB 4BAOB 1ZSJA 3ZVGA 2ZFSA 4ABHA 1D6WA 2D8WA 2WSSD 1CBWB 2BDIA 2P59A 1GJDB 2K1QA 2XC5A 2ZNKH 4CR9A 5HM9A 1GJ7B 1PPZA 4MNXA 4MDSA 5JBAS 1TMBH 1GVKB 2FOCA 4CH8B 1XUFA 1BBRE 1TGSZ 4CHAC 3B23B 1GMHF 3RXEA 4K2YA 4ZCNA 2IOTA 1EAUA 1C1QA 1SGIB 3M7QA 1UO6A 1XXDA 3A88A 3A7YA 1UCYE 3UFAA 3P8NA 2IJD1 1GHBG 3T26A 1IQIA 1LQDB 1HAIH 1C5NH 3KNXA 1GMDF 1O3DA 1BDAA 2Q6FA 1UJ1A 2F83A 1F5LA 5TCAA 1BJVA 3OTJE 1GDNA 1PYTD 1ZR0A 1S85A 2XBYA 1OYQA 3UR6A 2F9NA 3E90B 3F9EA 2JJ2D 1H8DH 2EI6A 3QZQA 2GV7A 1SQAA 1EKBB 6ESTA 4OS7A 2Y82A 3MMGA 2O9QA 3RXTA 4VGCB 1YM0A 3AVZA 4Y0ZE 2V35A 3QX5H 1OWEA 3MH4A 2XTTB 3CS0A 1BTXA 4NWKA 1FPHH 1K1OA 1K2I1 2ESTE 1ZOMA 1CHGA 3GYLB 3FZDA 4INKA 2CHAB 4TT3D 4D7GA 2P8OC 1C1SA 1SGPE 2O8MA 2XWBI 1GBHA 3SI4H 2OQUA 1A5GH 3SU0A 3IITA 1SGYE 3LC5A 2FODA 4OS1A 2YMSC 2BDYA 3QTVH 5JPMH 1DVAH 3W95A 3GS9A 1SGRE 2CF8H 1SFQB 4RKOB 3M5NA 3EA8A 1GL1A 2TRMA 1KY9A 5A2MH 2IN2A 1E37B 2WPDD 1V2TT 1YPEH 1THSH 2FEQH 5ABWA 1MH0A 1BHXF 1AMHA 1SOTA 3PV2A 1SQOA 1GI8B 1CSOE 4ZHAA 1GG6C 2CGAA 3S0NA 2VWMA 3TK5A 4IC5A 1HNEE 6GCHG 2C90B 4ISNA 3GICB 3E3TA 1A0JA 2NU4E 3VXEH 5CDFE 2TGAA 2F9BH 1C4V2 2EI8A 2FLRH 1TX7A 4ZXXH 1GGDC 2ZDLA 1WQSA 2IJOB 5A0CA 3ZVBA 3NXPA 5E8EH 1V2QT 1TAWA 3MU5A 1K28D 3PWBA 2ZHDA 1NRPH 2GTBA 2PHBA 3SNBA 1B0EA 3ZZBA 4Q7XA 4F55A 5IDKA 4B2AA 5E0JA 3LC3A 1KTTB 2ZGHA 4AGKA 1GCTB 2BVXH 5E0HA 1QNJA 4IS5A 2YOLA 1FMGA 4WF8A 2ZFRH 3HATH 3P8OA 2AGIX 1WOFA 4NG9H 2QA9E 3LGIA 1H1BA 4X1RU 5LGOA 2XC4A 2VIOA 1V2JT 1EB2A 3I77A 4NA8A 1DSTA 3PWCA 4AG1A 3VB5A 4K8YA 5HXFA 3R3GB 4B2BA 2WPLS 2QE7D 4ABIA 1QA0A 1XVMA 2H9TH 3RLWH 2A7HA 1H9IE 4ZKSU 1DWCH 5C67A 2HOBA 3RM0H 2K8IA 1YCPM 1L1GA 5T1VA 2BLVA 3GY4A 2KCAA 3P17H 1YPLH 4NSYA 2FOBA 2AHME 1V3XA 1XUHA 2P3TB 2RA3A 1GI1A 1RXPA 2W7UA 3SU6A 2A31A 1FI8A 2A4OA 3NPSA 3U9AH 3QWCH 2TGDA 4M7GA 2XOKD 1Y5BT 1X7AC 2TBSA 5LPRA 1SLVB 2FP7B 5DP5A 3LONA 1BRCE 1OX1A 1NO9H 2L6OA 4ISIH 2OTVA 2Y7ZA 1S83A 1JWTA 1L4ZA 1HGTH 1FY8E 3GDVA 2R3UA 4A92A 1O31A 2WPMS 1MCTA 2W3IA 3NCLA 3BEFB 2V6NA 3F9HA 5EW2H 5DSFA 5L6NH 1C9PA 2GDDA 1G3BA 1T7CA 5FCRA 1S6LA 2XBWA 1O3JA 2WPKS 3P6ZB 4X8UH 2BTCE 3SNAA 1O2IA 3ZZ8A 3PRBA 1TQ7B 1P0SH 1FQ3A 1AD8H 1Y3XA 3U8TH 1WXRA 5I46H 3A80A 4CR5A 2F43B 1P06A 4NWLA 2VH0A 2BXUH 1FUJA 3T5FH 2AMQA 2A2QH 1ETSH 2BD5A 3EA9A 2ZHWH 1QQ4A 4XDEA 5T6FA 3ZV9A 2W5EA 5DO4H 2C93B 1C2GA 1SFIA 4BAQB 2W6ID 1PPGE 2C8XB 5GNDA 5C5OA 2AERH 1PQ8A 3GY6A 3OY5U 1YPMH 1G2MA 2FX4A 2G4TA 1CQQA 1QL8A 2BHGA 2TIOA 3BTTE 1AE5A 4U2WA 1NRSH 1K1IA 3A8DA 3MTYA 1FY4A 1BT7A 4ZMAH 5E0GA 2HPPH 1GGDB 3BTKE 4H6SB 4ZH8A 3U98H 3RMMH 1NC6A 1EZUC 1F0RA 3RC6A 3CP7A 4FUJA 1YPHC 3LH3A 4Q4LA 5F8ZA 1Y8TA 5AVDA 1A3EH 4UFFH 1U6QA 1XXFA 1EATA 1NRRH 5FAHA 4JCNA 2HPQH 1AKSA 1W0KD 2ZF0H 2A4RA 4UDWH 3KQBA 1HDTH 4YO9A 4YTAA 1LVBA 1TNLA 1UVOA 2XWAA 4RI0A 3CS7A 3RXRA 5A8ZA