3LKWA

Crystal structure of dengue virus 1 ns2b/ns3 protease active site mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
230
structure length
211
Chain Sequence
HMADLSLEKAAEVSWEEEAEHSGASHNILVEVQDDGTMKIKVLWDTPSPGIYRILQRGLLGRSQVGVGVFQEGVFHTMWHVTRGAVLMYQGKRLEPSWASVKKDLISYGGGWRFQGSWNAGEEVQVIAVEPGKNPKNVQTAPGTFKTPEGEVGAIALDFKPGTAGSPIVNREGKIVGLYGNGVVTTSGTYVSAIAQAKASQEGPLPEIEDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fusion protein of nonstructural protein 2B and nonstructural
publication title Serotype-specific structural differences in the protease-cofactor complexes of the dengue virus family.
pubmed doi rcsb
source organism Dengue virus type 1 (strain singapore/s275/1990)
molecule tags Viral protein,hydrolase
total genus 32
structure length 211
sequence length 230
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2010-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3lkwA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3lkwA01
3U1JB 5T6FA 1TYNA 3GCHC 5EG4A 4FUCA 1DSUA 2WHXA 2VINA 5HGGA 1UVOA 2ODYB 3LDXH 4HZHA 1O3PB 4I33A 4WMDA 1G3DA 3SU6A 2BB4A 1AKSB 1AQ7A 4O3UA 3RXGA 5CMXH 4OS7A 1YC0A 4K2YA 4HI3A 2OC7A 5A0CA 1YLDA 3ZVEA 5A2MH 1H9HE 4D9RA 1NZQH 1VCWA 1O3KA 4JK5A 3SU4A 5AF9H 1QRWA 1RTKA 1TNHA 3ZVAA 1BITA 4O03A 1F0SA 3BTQE 1QIXB 2SNWA 1LKAA 1KLJH 3TH4H 4AFQA 2A4OA 1SGPE 4UFDH 6GCHF 3S0NA 4NGAH 3U8RH 1O2YA 1RIWB 1TRYA 2BOHB 2WINI 1ZPZA 3M7QA 4X2VA 2VB0A 1D3QB 3BIUH 1LQDB 3LGTA 1AU8A 2BM2A 1O2HA 5I46H 1QHRB 4Y7BA 2WPLS 4VGCB 1O2IA 2ZGBH 2OINA 1O38A 2ZFPH 4XSKU 2ALPA 8GCHG 3RXJA 4Y71A 5F8ZA 1B7XB 3KQEA 1Z1JA 1CA0B 5EW2H 1V2PT 5K7RA 2FOGA 2BDYA 1QBOA 1Y3VA 3EE0B 1C5OH 1GJBB 3WY8A 4AB9A 1CBWB 2FO9A 4NFFA 1SSXA 1KXCA 1QA7A 1TGCA 3ZYEA 1EP6A 5AHGH 3SUEA 1MTVA 2OD3B 2GTBA 1ANBA 2H1UA 1EZUC 3VPKA 2QYIA 1TQ0B 3PMHB 4JYTA 3NZIA 2H6MA 3SN8A 3TNTA 1TOMH 4Y8ZA 4ZHMU 1P01A 1SGRE 4DT7B 2GCHG 5FPSA 1O2QA 3PB1E 4X1NU 1AVWA 1C1MA 1ELDE 1VITF 4I8LA 2ZFFH 3I77A 2GV6A 2B0FA 1IQEA 1VGCB 1EZXC 1FZZA 1WTHD 2D26C 4AORA 1K22H 1XMNB 2J9NA 2STBE 3SJIA 2GZ8A 4Y10E 5EXMA 2BVXH 2VH6A 3SUGA 2BVRH 1F5RA 2H9EH 1TE0A 3KQBA 3VXEH 3ZVDA 2FPZA 2GKVE 3BEUA 2FOFA 4I31A 1OWHA 6CHAB 1YLCA 3HPTB 1DICA 1C5WB 5GIBA 3V13A 1V2VT 4XBBA 1RIWC 1XXDA 2I6SA 2PGQB 3QN7A 3KIDU 1TPSA 1P2OA 5DO4H 4ZKSU 1TRNA 3ZZ8A 1PPGE 1QFKH 1TFXA 3ZZCA 2Z3EA 4K1EA 2ZA5A 2CN0H 4MNWA 4DOQA 3K2UA 2QXHA 3GISB 3A8CA 3M3VA 3M5MA 4D7GA 1C1SA 2RA0A 1TQ7B 1MUEB 3PROA 1MTSA 1AFEH 4CRGA 1JXPA 4GVUA 1CA0C 2OK5A 1UK3A 1FIZA 3SNCA 4ABIA 1C5TA 3PO1C 1CBWC 1AGJA 1ANDA 3GY5A 4NZQA 1C2DA 1A5IA 4CRFA 3FP6E 4ZKRU 2AEIH 2FYRA 1C5SA 1A0HB 2Y5FA 1ZZZA 1RD3B 1DS2E 1BRCE 1P12E 1S5SA 1BZXE 4O9VA 2FS9A 1LHDH 2VIWA 1OWDA 1G9IE 2XC4A 1EXFA 1TA2A 1O33A 2CF9H 3U8TH 1D3PB 1G32B 1PPCE 1H8DH 3H7TA 1UTLM 3H09A 1X7AC 3D49H 1W0ZU 2WPHS 5J4QA 2FODA 2HALA 1VGCC 2CJIA 1HAYB 4E06H 4AN7A 5FAHA 3UQVA 1AFQB 1GBBA 5DKMA 7KMEH 1SQOA 1K1PA 1D3DB 4INHA 2FI3E 3QZQA 3GCOA 3W95A 2NU2E 2GZ7A 1P9UA 3JZ2B 2IPHA 3E90B 4WXIA 1O3MA 3F9EA 1NRSH 1LHGH 2BVSH 1C2KA 2ZGCA 3CS0A 4BXWA 2WPJS 2ZDVH 2ZGXH 5LPEA 1SBWA 2Z7FE 1UJ1A 2FLBH 1QL8A 4IN1A 5HYOA 3UR9A 4FU7A 1NM6A 4MPVA 2GMTB 2G8TA 5K0HA 1Y3YA 5DPAA 4Y79A 4Y0YE 1EASA 1GHAF 4LZ4B 1DFPA 3SNAA 3MNSA 1W11U 2V3OH 2A5IA 4HFPB 4FUHA 1W3CA 1P8VC 4KTSA 4X6MA 3N7OA 1GBMA 2QN5T 1J9CH 3MNCA 1C2JA 4JZ1A 4WH8A 1OPHB 4IGDA 1U6QA 2W3IA 3FVFB 1BUIA 4ZHAA 3M5LA 1C4V2 5GDSH 5E0GA 3E3TA 1D6WA 1BBRE 2W5EA 2Z9KA 1P9SA 4I8GA 1W7XH 1GHBG 4B1TA 1ZMNA 1E38B 3MYWA 4THNH 1UVUH 1BTPA 2BXUH 2AGEX 1TNKA 2D8WA 1TX7A 5DP6A 4B2CA 2Z6BD 2ZU2A 7GCHG 3LT3A 4K69A 2SFAA 4BXSA 1T8MA 3HK3B 4XFQA 1WBGB 3SV7A 2Y7XA 1F7ZA 1V2NT 1O3CA 3ZZ4A 2R9PA 1FY5A 1MKWH 3A7WA 1QB9A 2NU3E 2VVUA 1MCTA 3A84A 1HAOH 2XWBI 1WTGH 4FUBA 3EA8A 1Y8TA 2JETB 1AFQC 1Z6JH 2BTCE 3BSQA 4ASHA 2BY7X 3AAVA 1ZRBA 1J8AA 1F5KU 1TABE 1G3BA 3GDVA 3QGNB 4YESB 3QX5H 1ZSJA 2XBVA 1FAKH 1RJXB 1DY9A 2QF0A 1P06A 3RM2H 4NCYA 1HAZB 1M9UA 1YPGH 2BZ6H 1O2JA 1XUHA 1O5EH 2C8ZB 1KTSB 4IBLH 3VB4A 2ZTZA 1TGTA 3MTYA 4DGJA 1A1RA 2TGPZ 1EOJA 1LHCH 2GMTC 1O35A 4KTUA 5E0JA 1YPMH 2Z9GA 3L6PA 1GCTC 1C1QA 2Y81A 1P11E 2JH5D 3UUZA 2RDLA 5T6GA 4UEHH 1Y3WA 2TGAA 2IJOB 2XXLA 3BTEE 1WU1A 1Y5UT 3SQHE 1Z6EA 2C8XB 1J17T 5J4SA 1D6RA 1UCYH 2FOAA 2FEQH 2P94A 3SZNA 5JBAS 1GBHA 1OX1A 1TLDA 4JZEH 4BAKB 2Q6DA 4FUIA 1KTTB 1SQAA 2BHGA 3GY7A 2XYAA 3OY6U 1C5ZB 1HPGA 1D9IA 1ACBE 2ZI2H 1F5LA 1HJ9A 5HM2A 3TITA 1A2CH 1C4U2 2F9OA 1O2UA 1C5VA 4BAMB 1GI3A 2QF3A 2Z9LA 2GDEH 3HKIB 1MKWK 2WPMS 1W10U 1EB1H 5JDUB 1MZAA 5EXLA 1FUJA 2F4LA 1SC8U 5T3HA 4UFEH 1Q3XA 4ZROA 2GV7A 1MU8B 2AYWA 1TPAE 1VJ9U 2ZF0H 4IC5A 3A8DA 1GI6A 3ITIA 3KQDA 1CT0E 1O30A 1SPJA 1KXAA 5DP3A 4AGJA 5JPMH 2O8UA 4JZIA 4WMFA 2YOLA 2JETC 4BTTB 5C67A 1DDJA 2H5DA 2Y7ZA 3ENSB 3VEQB 1Z8RA 3URDA 3BG4B 3ODFA 3QO6A 4PROA 1G2MA 4CRDA 1ZJDA 1GI7B 2AMDA 1Z1IA 3PM3A 2PW8H 4CREA 1AWFH 1DLKB 4HTCH 5EQRA 4ZXXH 1UCYK 1K1LA 1C5LH 3SI3H 4D7FA 3RXHA 1GMCG 1HXEH 3AW1A 2VIVA 2J94A 2LPRA 3P17H 1W8BH 3P8FA 1KXDA 4CBOA 1ELEE 1P10A 1MU6B 1O3DA 2DE9A 3TK6A 1O2GH 3RXCA 3I29A 3MU1A 2BDHA 2VVCA 2F9VA 3EQ0H 5DGJA 3UQOA 3LGYA 3RXUA 2CHAB 5DJ7A 4K8YA 3P8NA 1CHOG 5TJXA 2PLXA 1GBCA 3SNBA 2G5VA 2AH4X 1J14A 2BX3A 1T32A 2OCVB 3VFEA 4CH8B 3GOVB 1INCA 1HFDA 1PQAA 1IQMA 2O8WA 1SR5C 3QUMP 4IS5A 3MO9A 2DE8A 1PYTD 1F92A 4NIYA 2FTLE 4JK6A 3SGAE 1VZQH 1Q31A 5FPYA 1SGTA 1O3OA 1T8LA 3ZZDA 1PPFE 5GCHF 2WUCA 4IN2A 2RG3A 3BG8A 4DCDA 1UCYE 2XC0A 2PR3A 3ZZ6A 1OP2A 5GWZA 1GBLA 4ABJA 2QAAA 1GI4A 3RC6A 5ETXA 5G4BA 5A0AE 5HM9A 1MQ6A 1C1TA 4DVAU 3DHKH 3BG4C 4NWLA 2GT8A 1C9PA 3O8DA 3IWMA 3HKJB 4Y0ZE 2PTNA 3G01A 3TGKE 1EX3A 1MZDA 1ELFA 4A1TA 1FIWA 2FX6A 2FP7B 3TK5A 1K1OA 1O3BA 1FMGA 1P57B 2LNCA 3NKKA 2A45B 1CSOE 1BHXB 1XXFA 1P05A 1P03A 2Y5HA 5DP8A 3BTFE 5TCCA 2WPIS 1DXWA 1HAVA 1HIAB 1DLEA 4YT6H 2ZHWH 1O5BB 3M5OA 3A7TA 3E6PH 4DW2U 1H9IE 1IQLA 4IMQA 3VGCC 1IOEA 5FCRA 5T1VA 1BMNH 5LPRA 1GMHG 1QJ6B 3MO6A 2CHAC 3NPSA 1DOJA 1MH0A 1V6DA 2F3CE 4U30A 2EI8A 5EXNA 5BPEA 4A6LA 1IQNA 1YCPM 1ELBA 1ANEA 1EUFA 3UWJH 1KDQA 1TNIA 1GJAB 2ZECA 1V2LT 1C5MD 1P2IA 1AZZA 1GJ6A 1EAXA 4GPGA 2YNBA 3SU3A 3RXLA 2UUFB 1SLWB 3LH3A 4B2BA 1UK4A 1V2WT 3LJJA 1RGQA 1V2UT 1C1NA 2ZPQA 7LPRA 3BIVH 1KLIH 1GHWH 2PUXB 2XCNA 4JYUH 1GJ5H 3MO3A 3FZZA 2ZZUH 2FTMA 1LHFH 3PV5A 4MVNA 1QNJA 1T8NA 3T25A 1YGCH 2OQ5A 2ODPA 3Q3YA 8GCHF 1ARCA 1GBKA 1W2KH 4MPXA 3O8BA 3V0XA 1LVMA 1EAUA 3F1SB 1SFIA 2F9PA 1SGQE 1WQSA 3A8AA 2B5TB 3VB5A 1P3CA 2BQ7B 1HBTH 1EP5A 3D65E 1ZHRA 3ODDA 3OU0A 5F8TA 1SOZA 3UFAA 1BTXA 1ZR0A 2ZU1A 3ATIA 1EPTA 1HJ8A 1KSNA 4ISNA 2EI7A 4A5TS 5ESBA 1DWEH 3SQEE 5GXPA 2XBXA 5HMAA 3PLKA 2ANYA 2GCHF 3M61U 5DG6A 1Z8GA 1GHZA 2J95A 1TGSZ 1BQYA 1Y5AT 2ZHEH 4WF8A 1FN6A 1QCPA 3ZVBA 1AWHB 2OP9A 1S82A 1A5GH 3Q3XA 2RA3A 1DPOA 2PFEA 3A87A 1V2QT 2GVFA 5EQSA 1HLTH 1TGBA 1AE5A 1GJ9B 4Y11E 1IQGA 1RTLA 1NFYA 1OYTH 4OGXA 2ZQ1A 3PWBA 2XW9A 2GD4B 2A5AA 1MCVA 1GL1A 4ISHH 4MTBA 4FVBA 3AW0A 1L1JA 6GCHG 3LONA 1BTHH 1GI5A 3ZZ9A 4X2YA 4YOJA 1IAUA 3MH5A 3SNEA 4XOJA 4A1XA 1PFXC 3EA9A 1GBTA 3TH2H 4CRCA 3PMJA 4AFZA 5FCKA 3A83A 5B6OA 1HRTH 1UTMA 1PQ7A 1SLXB 1Q2WA 1O2OA 2P3FH 4M9FA 1N6YA 1VCQA 1UVSH 1BBRH 3RXKA 3URCA 4ZAEA 1SVPA 1YCPH 3D62A 3QGJA 2SGFE 2UWPA 3M3TA 2STAE 1A0LA 4H4FA 4H6SB 3OTPA 1SGNE 2P8OB 2VBCA 1KYNA 2Z9JA 2H9HA 5GPIB 3UR6A 2F91A 1NC6A 4OGYA 1EJMA 3AK5A 1K1IA 3M7TA 3EDXB 2VWOA 2V35A 1GJCB 2EC9H 1C5XB 5EQQA 4FVDA 2BQ6B 4X1QU 2R2MB 2C8WB 1ZTLA 4VGCC 1PYTC 4SGAE 3VB6A 1LDTT 2HLCA 3GCTG 5F8XA 3U69H 1E0FD 2SGEE 4KP0A 1VITG 1P02A 1EZSC 3RXFA 4B73A 2BD3A 4BTIB 2QXIA 4NWKA 3L3TA 2VGCB 3RU4E 1QL7A 1GBFA 1IHTH 2BD9A 4WVPE 3EYDA 1BMMH 3MNXA 3UWIA 1QL9A 2BXTH 4ZKNU 2NWNA 1WAYB 3A7VA 2AGGX 2VWLA 3GY2A 1AKSA 2XRCA 1NRNH 1IQKA 1FNIA 3AVZA 1SGCA 1NU9A 4X6OA 1BHXF 1C2MA 1NS3A 1EAWA 8ESTE 2ZPRA 9LPRA 3F9GA 1UHBB 2A0QB 2A2QH 1DITH 3LKWA 3GDSA 1CA8B 1Y3XA 4ABBA 5F6MA 1BBRK 1SLVB 1YF4A 1CE5A 1QA0A 1TA6A 1QURH 1YCPK 2O9QA 3TIUA 2SNVA 1DWBH 1O31A 4GHTA 4B74A 2TIOA 1AUJA 5ESTE 3TGJE 2C4FH 3A86A 5H4IB 2PHBA 1A0JA 1DUEA 3SV2H 4A7IB 2XC5A 2JKHA 1BOQA 4Y7AA 2ASUB 4ABAA 1HV7A 1L4DA 3QK1A 2BD8A 1SB1H 1GHVH 1O0DH 1BCUH 1EB2A 1RRKA 2R3YA 4CRAA 3M36A 3TLOA 2BQWB 2J4IA 4LOYH 2YNAA 4AFSA 3ZVCA 1TRMA 1LTOA 2QXJA 1XUKA 6CHAC 3T27A 1FXYA 3Q00A 1S81A 2IJD1 3SU5A 3PWCA 1JIRA 3A81A 4LK4A 1GMDG 1NTPA 1GBAA 3M3SA 2HRVA 3O8RA 4R0IA 1NT1A 1GHBF 1XM1A 3UNQA 1NFXA 1QR3E 3SU1A 1O2ZA 4RI0A 2P3TB 3LIWA 2ZU4A 4I32A 1P0SH 4NA7A 3H7OA 7GCHF 2UWLA 1G37A 2BX4A 5L2YH 1MAYA 5BRRE 3CP7A 3P70B 3U8OH 1MTUA 4ZHLU 1ETRH 1NFWA 2PSYA 4Q80A 1MBMA 5EU8A 2V0BA 3S7KB 4BNRA 1C2GA 1BJUA 4A92A 5E8EH 5A0BA 1QGFA 1QTFA 1K28D 3UPEA 1IQFA 3A7XA 3E8LA 1W14U 1MKXH 1TIOA 1THSH 1HB0B 1YYY1 3TGIE 4YT7H 1ELVA 4U01A 1GBJA 4ABHA 3A7ZA 3B8JA 2Y80A 1NY22 4AYYB 2ZTYA 1FLEE 3BF6H 1MAXA 1OSSA 1J16A 2FLRH 3SU2A 2ZQ2A 1O5DH 4DURA 3GICB 2ANKH 3O8CA 1ESTA 1O3JA 4AG1A 2BDGA 4FUEA 2FWWA 4Y8XA 3SGQE 4XDEA 1TBQH 1GGDB 1Y59T 1ELCA 2G81E 3KN2A 3M37A 1O2TA 2ZG0H 4K60A 4K1SA 2HPQH 1ARBA 1XKBC 3ATLA 4DIHH 3A85A 1O3IA 3PMBB 1WYKA 1CHGA 9ESTA 2VWMA 1TPOA 2BDCA 1CU1A 1OS8A 1HNEE 1XUFA 3M5NA 3UTUH 5DP9A 1WV7H 3V3MA 1NU7B 1OWIA 1QB6A 3RC5A 2FMJA 1Z8JB 4X0WU 3C27B 5C3NA 2AIPA 1O39A 1ZMLA 5T6DA 1L1GA 3NCLA 1GG6B 1C1OA 2WYJA 1MKXK 1J15A 3Q76A 2P93A 3S9BA 3K65B 4MG3A 4JMYA 1S83A 2GX4A 5E2OA 4FUFA 3LGVA 2XTTB 3LOXA 4YLUA 2WV9A 4Q7XA 2SGQE 1WUNH 1O5CB 1Y3UA 4ISOA 4ZUHA 3LC3A 1PPHE 4WWYA 1AIXH 1XVMA 3RXSA 1ZYOA 1P2MA 1BTWA 3L33A 1O2SA 2GDDA 1XUIA 1P2NA 1DXPA 2FM2A 4OM9A 1SL3A 4YO9A 1ZSLA 1AN1E 2M5TA 4GAWA 2A7JA 1BRUP 2ULLA 1HAVB 1O3LA 5DP5A 1PJPA 4B2AA 1ABIH 3FANA 4FU8A 1GMCF 2BDAA 2DUCA 1C4Y2 1AUTC 3GCNA 2FOBA 2ZCHP 5CHAB 2G00A 1O2MA 4Y6DA 3NUMA 1JIMA 1O2KA 1HCGA 1C5UA 2K1QA 1LVBA 1QJ7B 3EAJA 1N6XA 3RXQA 5EGMA 3TU7H 1C5YB 1KDQB 3MU8A 1NRQH 1O2VA 4CH2B 1MMJN 3SV9A 1GHXH 3ZZ7A 1CHOF 2PV9B 3MH6A 1S6FA 4AX9H 4GCHG 1TBRH 3PV2A 1SHHB 2BY9X 2O8TA 2GCTB 2VH0A 1DWCH 1V2TT 2BMGB 4KTCA 5JYIA 2ZIQH 3QZRA 3UOPA 5AVDA 2PKSB 3K6YA 1O2NA 4Q2KA 2BY6X 1AD8H 1TMBH 1ELAA 4RSPA 4HGCA 2W26A 4ISLA 4D76A 3RC4A 1A7SA 2ZDLA 1YP9A 5IYTA 2F9UA 1MQ5A 1DVAH 4ZMAH 5C1UA 3BTTE 3F9FA 1LQEA 3ZVGA 4ZH8A 3T5FH 3FP7E 2BZAA 3OY5U 4B76A 5A09A 2OBQA 2R3UA 1L1NA 2QV1A 5B6LA 3SBKA 2BYAX 5F03A 3I78A 1E37B 3EA7A 1Z71A 1LKBA 1KLTA 1O3EA 1NROH 2FZZA 4F4OC 1EZQA 1EPTB 3GY8A 3OSYA 1PPZA 1CGJE 3ZV9A 1GBDA 3TJNA 1C2EA 3B9FH 1OKXA 3FZDA 2UUJB 1C2IA 3ZZ5A 4DIIH 4E05H 4OS4A 1O2LA 4YZUA 3BEIB 1V2MT 1O2WA 1OYQA 2ZNKH 3OX7U 3FFGA 2ZC9H 3MNBA 1GJDB 2BLVA 5JBBS 1T4VH 1XKAC 3PTNA 2KAIA 2ZCKP 1ELTA 1G30B 3RXRA 1SGFA 3RXVA 3E0NB 1BRAA 4DJZB 3NXPA 2HVXA 2ESTE 3BTKE 1UMAH 2VNTA 2OC1A 4AYVB 2D1JA 1BMLA 3GY6A 1GMHF 5LH8A 6ESTA 2JH6D 1LMWB 4ABEA 1LCYA 1W12U 2BD7A 1YKTA 4Z6AH 1E35B 1CGHA 5AFYH 3DFJA 2GCTC 1GI8B 3KHVA 4LXBH 1UO6A 1TONA 1BTZA 3A8BA 1HUTH 2PKSC 4B6FA 2C93B 3RMNH 4O3TA 4KELA 1RXPA 2W7UA 5L6NH 4CR9A 2CV3A 4NIVA 1O3NA 2BOKA 2ANMH 1SGEE 5HXFA 1AVXA 2PKAA 2ZPSA 1VJAU 1SGDE 2A4GA 4KKDA 5FX6A 1GVLA 3VXFH 1KXBA 2BDBA 1C1RA 1SMFE 4U32A 1FPCH 3RMMH 5C1XA 4X8UH 3E16B 2ZU5A 5ABWA 1QRXA 2SGAA 2R0KA 4TPIZ 2PGBB 1OXGA 3HATH 1W13U 4FXGH 2B9LA 1ZSKA 4JZDH 5EODA 4FU9A 2QA9E 2ZEBA 1IQHA 3MHWU 2TGTA 2BDIA 4INLA 3RXOA 1G3CA 1AE8H 1UTOA 1ZOMA 2ODQA 4JCNA 4Z0KA 1O5GH 1SHYA 2OTVA 2XCFA 4YOIA 4CBNA 2AGIX 3P8GA 1NO9H 3MU4A 1TAWA 1T31A 2IOTA 5CE1A 3CENA 1Z8IB 1P3EA 4FUGA 5JB8S 3SJKA 2G4UA 3LC5A 3SO3A 1FQ3A 3QWCH 2ZFRH 3T62A 2V6NA 2UUYA 1C1VH 3MOCA 4CRBA 3K9XB 3SJ8A 1IHSH 1ESAA 2ZWLH 4ABFA 3R3GB 1TNJA 4INKA 3FAOA 3TJOA 1MTNB 4AB8A 1S0QA 2R0LA 2GGVB 5DK1A 4MPUA 1GHYH 5TCAA 1WXRA 1TB6H 4MNVA 4X8SH 1SGFG 1AMHA 4NIWA 1B0FA 3TJVA 2ZKSA 3ESTA 4GHQA 1C5RA 3ATKA 4BANB 3ATWA 4H42U 1GVZA 1ID5H 1YPHE 5FBIA 1GI2A 1O34A 5FBEA 2Q6GA 4UFGH 5JBTA 2ALVA 3DUXH 1JMOH 1FY1A 1DY8A 3V12A 1YPHC 2IN2A 4WH6A 1CQQA 2AERH 1FDPA 1UK2A 1UVPA 3T28A 2TRMA 5GNDA 1GDNA 1BIOA 3LJOA 1FN8A 1ETSH 4X6PA 4NSYA 4AGKA 1K1NA 3E1XB 2WV5A 3PLPA 4M7GA 1OOKB 3RLYH 2QIQA 1GBIA 1TMUH 1TX8A 1AB9B 3ZZ3A 3SJ9A 1ZGVA 3SV8A 2C90B 1GI9B 2UUKB 3RU4T 4YM9A 1GPZA 2OQUA 4ZKOU 5C2ZA 1W7GH 2TGDA 1THPB 1T8OA 4Q7YA 1S85A 1H1BA 1TNLA 3PO1B 1ZHMA 2AFQB 2GP9B 2C3SA 4D9QA 5FX5A 2EA3A 4WXVA 5L2ZH 4YLQH 1Z7KA 4NZLA 4X1RU 2WUBA 1DE7H 4SGBE 3ZZBA 2ZFQH 1HGTH 2ZDAH 1V2RT 3GDUA 3SYJA 2BY5X 1LPKB 4UDWH 1HAGE 2HPPH 1K9OE 2QCYA 3Q77A 1O32A 3RXEA 1EQ9A 4H6TA 2BLOA 2F9NA 2ZP0H 3R0FA 3SHAH 4UFFH 3GCTF 1FAXA 2WV4A 3QTOH 1C2LA 1KY9A 1MTNC 4QT8C 4E7RG 3KNXA 2FIRH 1HJAB 1EAIA 1ZMJA 2A5KA 2VIDA 1BDAA 3SW2B 2J34A 4B71A 2VJ1A 1IQJA 1D3TB 1DWDH 4BOHA 3E91A 7ESTE 2OBOA 1GWAA 3BN9A 3ZVFA 2ZFTA 4UE7H 1HIAA 1NRRH 1BB0B 1CVWH 2P3UB 3T26A 1RFNA 3C1KA 3TJUA 4X2XA 1A4WH 3AAUA 3SNDA 2FOMB 3OYPA 1D4PB 1GCDA 4NIXA 1K2I1 2VIOA 2H5CA 2J2UA 1WCZA 2PWXA 2B7DH 3SUDA 3GY3A 2NU4E 3NK8A 4MPWA 3K6ZA 1NPMA 1PPEE 1LVYA 4NG9H 1KIGH 4IMZA 5GJ4B 1EJAA 1ETTH 4ESTE 1YM0A 2XWAA 1AB9C 3KQCA 2W7SA 3EGKH 1GDQA 1K21H 1B0EA 4I8HA 1TNGA 5EOKA 1UTNA 2ZDMA 3RXIA 3U98H 3GY4A 1SLUB 4JZFH 4MLFB 2A31A 2VIPA 5IDKA 5LPFA 1OP8A 1QBVH 2H2ZA 1AHTH 1P2JA 5DP4A 1JWTA 3SHCH 1FJSA 5I25A 2ANWA 1SGYE 4X1SU 4MNYA 3SI4H 2FI4E 3F9HA 3TK9A 1GMDF 1MD8A 1WOFA 4ABDA 1O3AA 3ELAH 3A88A 4XBDA 3M7UA 1SI5H 2ZU3A 1NRPH 5FHTA 2V3HH 1CT2E 8LPRA 4MDSA 1P2KA 1PQ5A 3VB3A 4XE4A 1A5HA 2AS9A 1P09A 3PYHA 4X8VH 3A80A 2QXGA 1OP0A 1YBWA 4A1VA 1T4UH 2OC0A 4Q7ZA 2A4QA 3P6ZB 1A61H 3MI4A 1GJ8B 4TYDA 1HJAC 2QC2A 1C5PA 1JBUH 3KF2A 1OWKA 1V2OT 3JZ1B 2P8OC 3QDZB 4J1YA 1WSSH 5JBCS 1O5AB 1ZPCA 1NN6A 5E2PA 2AIQA 1EATA 2Z3DA 2BD2A 1ZTKA 1LO6A 3F68H 4ISIH 1HYLA 2CGAA 3DT0H 2G5NA 2A1DB 2R2WU 4B6EA 1K1JA 2NU0E 3DFLA 1EKBB 3IG6B 3KEEA 3H5CB 1O3HA 4RKJB 2BY8X 3PTBA 1BT7A 2VGCC 3QLPH 1O2XA 2FS8A 3Q3KA 1EJNA 2FX4A 3OTJE 1GCTB 4ZXYH 1S0RA 2WYGA 4MQAA 2F83A 3U9AH 3DD2H 4BTUB 1XUGA 3UNSA 3UIRA 4TWWA 1ZPBA 2A7HA 4TWYA 2ZDNA 1V3XA 2C8YB 2XBYA 4DG4A 3HK6B 1BRBE 3BTME 4X6NA 4IW4E 1HAHH 1DT2A 4OS5A 4BAQB 3RMLH 2VIQA 2G55A 1TGNA 1KXEA 1OWEA 1H4WA 1N8OB 2Y5GA 3AASA 1BMAA 3PV4A 1MBQA 4UD9H 2BLQA 4AOQA 2GZ9A 2B8OH 1P04A 3HGNA 1CT4E 4K8BA 2NU1E 1L2EA 1BTUA 1UTJA 2CXVA 3TVJB 3MFJA 3ZV8A 1ZTJA 3SJOA 4OS6A 1C9TA 2J38A 1L4ZA 1GHAG 2EI6A 4IC6A 4CHAB 5L30H 3MU0A 5JB9S 2OUAA 3RUOA 3BV9B 1FY8E 2Z9IA 5C5NA 1XUJA 1W0YH 1AO5A 4YOGA 2QY0B 1TX6A 1HDTH 1YPLH 3VB7A 4JYVH 4BAOB 3A7YA 2AMQA 5FXLA 1ZLRA 4GUXA 2GT7A 3RLWH 1C5QA 3S9AA 2JH0D 1E36B 4GLYA 2I6QA 2ZHQH 2FXRA 2KAIB 2OXSA 2O8MA 5EPNA 4E7NA 4XBCA 4BAHB 1LVOA 4Y76A 1A3EH 1AI8H 3F6UH 1UTQA 3SGBE 4OS1A 1HAIH 1G36A 1BA8B 5DP7A 1XVOA 2Z3CA 4OS2A 3DA9B 4D8NA 3ZZAA 1GJ7B 1AZ8A 1FY3A 1ZJKA 2J92A 1V2ST 1ABJH 3P95A 1C1PA 3BTGE 3W94A 1IQIA 1A3BH 1TPPA 1UHBA 2VU8E 2BLWA 3S7HB 4X8TH 3GYLB 3S9CA 1BTYA 1PPBH 1HAXB 2ZHDA 1O3GA 1WQVH 1FY4A 1DM4B 5SGAE 3BTWE 2WZQA 1N8OC 1AY6H 4R8TB 1V2JT 1XX9A 4MNXA 4GCHF 1JRSA 2FESH 3PMAB 1G3EA 5C1YA 2PSXA 2PKAB 2ZGHA 3P92A 3RM0H 4TY6A 1TBZH 4WMEA 1GJ4H 1AVGH 3BEFB 5A8XA 3RXBA 1GGDC 3GYMA 3BTHE 2FOEA 1F0UA 1G2LA 2HOBA 1F2SE 3M35A 1VCPA 4NA9H 3TNSA 1FONA 1ZGIA 3RXDA 4CHAC 3BTDE 4KGAA 4AG2A 4Y8YA 2HNTE 2G52A 2ZDKA 2ZCLP 2ZHFH 1VITH 3E0PB 2SGPE 2XNIA 1QY6A 2HNTC 3RXPA 2P16A 4WJG2 4I7YH 4O97A 3KGPA 4NA8A 2QGRA 3A82A 4TY7A 2FYQA 1YPKH 4FUJA 1SOTA 3KCGH 1FPHH 1QB1A 3RDZA 1NESE 1H9LB 1TWXB 1GG6C 2OLGA 3MU5A 4WY3A 1N1LA 1K1MA 1O3FA 2W3KA 2H9TH 4U2WA 3MH7A 4YTAA 3SU0A 6LPRA 1UTKA 1GVKB 3SORA 5LGOA 2VWNA 4TPYA 1MD7A 3HGPA 3SOSA 2AMPA 1O5FH 4K1TA 1SQTA 1O36A 3NWUA 4J2YB 1B5GH 1C2FA 2A2XH 1OWJA 1C2HA 3LGWA 1JOUB 4K5ZA 3STJA 2TPIZ 1PQ8A 3LGUA 3LU9B 4AZ2B 1JRTA 3RMOH 2ZGJA 3RP2A 4B75A 1Y5BT 1DSTA 1ZHPA 1QQ4A 1GI0A 3LGIA 2A4RA 3A89A 1KXFA 1QQUA 1ELGA 1H8IH 1O2RA 1C5NH 3VGCB 1O37A 3V7TA 3T2NA 3TPIZ 1T7CA 1O2PA 1TOCB 2EEKA 1VR1H 5EW1H 5A8ZA 2P95A 4X2WA 3RXMA 3D23A 8KME2 3MMGA 3S69A 2O8LA 4DY7B 1SFQB 3SZEA 4I8JA 4K3JA 3MH4A 2BD5A 1ANCA 1TALA 2FOHA 2FDAA 2Q6FA 3TH3H 2Q1JA 2G4TA 2XBWA 2A7CA 5CHAC 2Z94A 1RS0A 3B23B 4NSVA 4NFEA 1YPJH 3STIA 3GCHB 1FI8A 1THRH 2ZO3H 4GSOA 1NFUA 3U1IB 1LPGB 3ATMA 3RXAA 5C5OA 4RKOB 1GBEA 1FV9A 1C1WH 2PUQH 3MWIU 5FPTA 1LPZB 2D2DA 3ZYDA 3LH1A 1F0TA 2WPKS 1GL0E 2OC8A 2VVVA 4F49A 5PTPA 5A8YA 2P59A 1TMTH 1E34B 2SGDE 3RU4D 2UWOA 1BJVA 1L0ZA 2Y6TA 2HGTH 2PTCE 2TBSA 4X1PU 1EOLA 1GDUA 4FUDA 1QBNA 1ZRKA 1UTPA 3RXTA 3P8OA 1UVTH 1V2KT 5E0HA 4RN6A 3T29A 1CGIE 3FP8E 1DX5M 2HWLB 2RCEA 1SG8B 3QTVH 1MTWA 2ZTXA 4LZ1H 1LHEH 1SGIB 2HNTF 1DANH 1A46H 2A32A 1GI1A 2ZFSA 3CS7A 3IITA 2THFB 3KL6A 4CR5A 1HXFH 4UONA 1RTFB 3SUFA 5GCHG 1QJ1B 2FOCA 4I8KA 1DUAA 2CF8H 2ILNA 2CMYA 1F0RA 1ORFA 2Y82A 3PLBA 1EPTC 1C1UH 1CO7E 3UREA 3LPRA 1HAPH 3SV6A 2BD4A 5C20A 3UNRA 2F9BH 3UOUA 1YPEH 1P2QA 1ESBA 5AFZH 2G51A 4ABGA 1QRZA 2FI5E 1S84A 3UY9A 1S6HA 5EPYA 4AFUA
chains in the Genus database with same CATH superfamily
3U1JB 5T6FA 1TYNA 3GCHC 5EG4A 2WHXA 1DSUA 4FUCA 2VINA 5HGGA 1UVOA 2ODYB 3LDXH 4HZHA 1O3PB 4I33A 4WMDA 1G3DA 3SU6A 2BB4A 1AKSB 1AQ7A 4O3UA 3RXGA 5CMXH 4OS7A 1OHHD 1YC0A 4K2YA 4HI3A 2OC7A 2LP6A 5A0CA 2QF5A 1YLDA 3ZVEA 5CDFE 5A2MH 3PRBA 1H9HE 4D9RA 1NZQH 1VCWA 1O3KA 4JK5A 3SU4A 5AF9H 1QRWA 1RTKA 1TNHA 3ZVAA 1BITA 4O03A 1F0SA 3BTQE 1QIXB 2SNWA 1LKAA 1KLJH 3EE7A 3TH4H 4AFQA 2A4OA 1SGPE 4UFDH 6GCHF 3S0NA 4NGAH 3U8RH 1O2YA 1RIWB 1TRYA 2BOHB 2WINI 1ZPZA 3M7QA 4X2VA 2VB0A 1D3QB 1EFRD 3BIUH 1LQDB 3LGTA 1AU8A 2BM2A 4FETA 1O2HA 5I46H 1QHRB 4Y7BA 2WPLS 4VGCB 1O2IA 2ZGBH 2OINA 1O38A 2ZFPH 4XSKU 2ALPA 8GCHG 3RXJA 4Y71A 5F8ZA 1B7XB 3KQEA 1Z1JA 1CA0B 5EW2H 1V2PT 5K7RA 2FOGA 2BDYA 1QBOA 1Y3VA 3EE0B 1C5OH 1GJBB 3WY8A 4AB9A 1CBWB 2FO9A 4NFFA 1SSXA 1KXCA 1QA7A 1TGCA 3ZYEA 1EP6A 5AHGH 3SUEA 1MTVA 3VG8A 2OD3B 2GTBA 5C94A 1ANBA 2H1UA 1EZUC 3VPKA 2QYIA 1TQ0B 3PMHB 4JYTA 3NZIA 2H6MA 3SN8A 3TNTA 1TOMH 4Y8ZA 4ZHMU 1P01A 5C0UA 1SGRE 4DT7B 2GCHG 5FPSA 1O2QA 3PB1E 4X1NU 1AVWA 1C1MA 1ELDE 1VITF 4I8LA 2ZFFH 3I77A 2GV6A 2B0FA 1IQEA 1VGCB 1EZXC 1FZZA 1WTHD 2D26C 4AORA 1K22H 1E1RD 1XMNB 2J9NA 2STBE 3SJIA 2GZ8A 4Y10E 5EXMA 2BVXH 2VH6A 2YMSB 3SUGA 2BVRH 1F5RA 2H9EH 5KGOA 1BMFD 1TE0A 3KQBA 3VXEH 3ZVDA 2FPZA 2GKVE 3BEUA 2FOFA 4I31A 1OWHA 6CHAB 1YLCA 3HPTB 1DICA 1C5WB 5GIBA 3V13A 1V2VT 4XBBA 1RIWC 1XXDA 2I6SA 2PGQB 3QN7A 2J97A 3KIDU 1TPSA 1P2OA 5DO4H 4ZKSU 1TRNA 3ZZ8A 1PPGE 1QFKH 1TFXA 4HG6A 3ZZCA 2Z3EA 4K1EA 2ZA5A 2CN0H 2KX4A 4MNWA 4DOQA 3K2UA 2QXHA 3GISB 3A8CA 3M3VA 3M5MA 4D7GA 1C1SA 2RA0A 1TQ7B 1MUEB 3PROA 1MTSA 1AFEH 4CRGA 1JXPA 4GVUA 2W6ID 1CA0C 2OK5A 1UK3A 1FIZA 3SNCA 4ABIA 1C5TA 3PO1C 1CBWC 1AGJA 1ANDA 3GY5A 4NZQA 1C2DA 1A5IA 4CRFA 3FP6E 4ZKRU 2AEIH 2FYRA 1C5SA 1A0HB 2Y5FA 1ZZZA 1RD3B 1DS2E 1BRCE 1P12E 1S5SA 1BZXE 4O9VA 2FS9A 4I86A 1LHDH 2VIWA 1OWDA 1G9IE 2XC4A 1EXFA 1TA2A 1O33A 2CF9H 3U8TH 1D3PB 1G32B 1PPCE 1H8DH 3H7TA 1UTLM 3H09A 4AC9A 1X7AC 3D49H 1W0ZU 2WPHS 5J4QA 2FODA 2HALA 1VGCC 2CJIA 1HAYB 4E06H 4AN7A 5FAHA 3UQVA 1AFQB 1GBBA 5DKMA 7KMEH 1SQOA 1K1PA 3F2HA 1D3DB 4INHA 2FI3E 2YMSC 3QZQA 3GCOA 3W95A 2GZ7A 2NU2E 1P9UA 3JZ2B 2IPHA 3E90B 4WXIA 1O3MA 3F9EA 1NRSH 1LHGH 2BVSH 1C2KA 2ZGCA 2AHME 3CS0A 4BXWA 2WPJS 2ZDVH 2ZGXH 5LPEA 1SBWA 2Z7FE 4ACBA 1UJ1A 2FLBH 1QL8A 4IN1A 5HYOA 3UR9A 4FU7A 4TSFD 1NM6A 4MPVA 2GMTB 2G8TA 5K0HA 4YXWD 1Y3YA 5DPAA 4Y79A 4Y0YE 1EASA 1GHAF 4LZ4B 1DFPA 3SNAA 3MNSA 1W11U 2V3OH 2A5IA 4HFPB 4FUHA 1W3CA 1P8VC 4KTSA 4X6MA 3N7OA 1GBMA 2QN5T 1J9CH 3MNCA 1C2JA 3N7EA 4JZ1A 4WH8A 1OPHB 4IGDA 1U6QA 2W3IA 3FVFB 3F2GA 1BUIA 4ZHAA 3M5LA 1C4V2 5GDSH 5E0GA 3E3TA 1D6WA 1BBRE 3FKSD 2W5EA 2Z9KA 1P9SA 4I8GA 1W7XH 1GHBG 4B1TA 1ZMNA 1E38B 3MYWA 4THNH 1UVUH 1BTPA 2PP6A 2BXUH 2AGEX 2K0QA 1TNKA 2D8WA 1TX7A 5DP6A 4B2CA 2Z6BD 2ZU2A 7GCHG 3LT3A 4K69A 2SFAA 4BXSA 1T8MA 3HK3B 4XFQA 1WBGB 3SV7A 2Y7XA 1F7ZA 1V2NT 1O3CA 3MQKC 3ZZ4A 2R9PA 1FY5A 1MKWH 3A7WA 1QB9A 2NU3E 2VVUA 1MCTA 3A84A 1HAOH 2XWBI 1WTGH 4FUBA 3EA8A 1Y8TA 2JETB 1AFQC 1Z6JH 2BTCE 3BSQA 4ASHA 2BY7X 3AAVA 1ZRBA 1J8AA 1F5KU 1TABE 1G3BA 3GDVA 3QGNB 2J5UA 4YESB 3QX5H 1ZSJA 2XBVA 1FAKH 1RJXB 1DY9A 2QF0A 1P06A 3RM2H 4NCYA 1HAZB 1M9UA 1YPGH 2BZ6H 1O2JA 1XUHA 1O5EH 2C8ZB 1KTSB 4IBLH 3VB4A 2ZTZA 2J98B 1TGTA 3MTYA 4DGJA 1A1RA 2TGPZ 1EOJA 1LHCH 2GMTC 1O35A 4KTUA 5E0JA 1YPMH 2JIZD 2Z9GA 1GCTC 3L6PA 1C1QA 2Y81A 1P11E 2JH5D 3UUZA 2RDLA 5T6GA 1H8HD 4UEHH 1Y3WA 2TGAA 2IJOB 2XXLA 3BTEE 1WU1A 1Y5UT 3SQHE 1Z6EA 2C8XB 1J17T 5J4SA 1D6RA 1UCYH 2FOAA 2FEQH 2P94A 3SZNA 5JBAS 1GBHA 1OX1A 1TLDA 4JZEH 4BAKB 2Q6DA 4FUIA 1KTTB 1SQAA 2BHGA 3GY7A 2XYAA 3OY6U 1C5ZB 1HPGA 5FL7D 1D9IA 1ACBE 2ZI2H 1F5LA 1HJ9A 5HM2A 3TITA 2KCAA 1A2CH 1C4U2 2F9OA 1O2UA 1C5VA 4BAMB 1GI3A 2QF3A 2Z9LA 2GDEH 3HKIB 1MKWK 2WPMS 1W10U 1EB1H 5JDUB 1MZAA 5EXLA 1FUJA 2F4LA 1SC8U 5T3HA 4UFEH 1Q3XA 4ZROA 2GV7A 1MU8B 2AYWA 1TPAE 1VJ9U 2ZF0H 4IC5A 3A8DA 1GI6A 3ITIA 1W0KD 3KQDA 1CT0E 1O30A 1SPJA 2KZ4A 1KXAA 5DP3A 4AGJA 5JPMH 2O8UA 4JZIA 4WMFA 2YOLA 2JETC 4BTTB 5C67A 1DDJA 2H5DA 2Y7ZA 3ENSB 3VEQB 1Z8RA 3URDA 3BG4B 3ODFA 3QO6A 4PROA 1G2MA 5DSFA 4CRDA 1ZJDA 1GI7B 2AMDA 1Z1IA 3PM3A 2PW8H 4CREA 1AWFH 1DLKB 4HTCH 5EQRA 4ZXXH 1UCYK 1K1LA 1C5LH 3SI3H 4D7FA 3RXHA 1GMCG 1HXEH 3AW1A 2VIVA 2J94A 2LPRA 3P17H 1W8BH 3P8FA 1KXDA 4CBOA 1ELEE 1P10A 2QF4A 1MU6B 1O3DA 1YY3A 2DE9A 3TK6A 1O2GH 3RXCA 2EY4C 3I29A 3MU1A 2BDHA 2VVCA 2F9VA 3EQ0H 5DGJA 3UQOA 3LGYA 3RXUA 2CHAB 5C17A 5DJ7A 2V3MA 4K8YA 3P8NA 1CHOG 5TJXA 2PLXA 1GBCA 3SNBA 2G5VA 2AH4X 1J14A 5HIYA 2BX3A 1T32A 2OCVB 3VFEA 4CH8B 3GOVB 1INCA 1HFDA 1PQAA 5EIYA 1IQMA 2O8WA 1SR5C 3QUMP 4IS5A 3MO9A 2DE8A 1PYTD 1F92A 4NIYA 2FTLE 4JK6A 3SGAE 1VZQH 1Q31A 5FPYA 1SGTA 1O3OA 1T8LA 3ZZDA 5KECA 1PPFE 5GCHF 2WUCA 1KMHB 2RG3A 3BG8A 4IN2A 4DCDA 1UCYE 2XC0A 2PR3A 3ZZ6A 5KEDA 1OP2A 5GWZA 1VKYA 1GBLA 4ABJA 2QAAA 1GI4A 3RC6A 5ETXA 5G4BA 5A0AE 5HM9A 1MQ6A 1C1TA 4DVAU 3DHKH 3BG4C 4NWLA 2GT8A 5EJZA 1C9PA 3O8DA 3IWMA 3HKJB 4Y0ZE 2PTNA 3OEED 3G01A 3TGKE 1EX3A 1MZDA 1ELFA 4A1TA 1FIWA 2FX6A 2FP7B 2HVYB 3TK5A 1K1OA 1O3BA 1FMGA 1P57B 2LNCA 3NKKA 2A45B 1CSOE 1BHXB 1XXFA 1P05A 1P03A 2Y5HA 5DP8A 3BTFE 5TCCA 2WPIS 1DXWA 1HAVA 1HIAB 1DLEA 4YT6H 2ZHWH 1O5BB 3M5OA 3A7TA 3E6PH 4DW2U 1H9IE 1IQLA 4IMQA 3VGCC 1IOEA 5FCRA 5T1VA 1BMNH 5LPRA 1GMHG 1QJ6B 3MO6A 2CHAC 3NPSA 1DOJA 1MH0A 1V6DA 2F3CE 4U30A 1YLNA 2EI8A 5EXNA 5BPEA 4A6LA 1IQNA 1YCPM 1E1QD 1ELBA 1ANEA 1EUFA 3UWJH 1KDQA 1TNIA 1GJAB 2ZECA 1V2LT 1C5MD 1P2IA 2QE7D 1AZZA 1GJ6A 1EAXA 4GPGA 2YNBA 3SU3A 3RXLA 2UUFB 1SLWB 3LH3A 4B2BA 5C0TA 1UK4A 1V2WT 3LJJA 1RGQA 1V2UT 1C1NA 2ZPQA 7LPRA 3BIVH 1KLIH 1GHWH 2PUXB 2XCNA 4JYUH 1GJ5H 3MO3A 3FZZA 2ZZUH 2FTMA 1LHFH 3PV5A 4MVNA 1QNJA 1T8NA 3T25A 1YGCH 2OQ5A 2ODPA 3Q3YA 8GCHF 1ARCA 1GBKA 1W2KH 4MPXA 3O8BA 3V0XA 1LVMA 1EAUA 3F1SB 1SFIA 2F9PA 1SGQE 1WQSA 3A8AA 4P02A 1SQRA 2B5TB 3VB5A 1P3CA 2BQ7B 1HBTH 1EP5A 3D65E 1ZHRA 3ODDA 3OU0A 5F8TA 1SOZA 3UFAA 5CHBA 1BTXA 1ZR0A 2ZU1A 3ATIA 1EPTA 1HJ8A 1KSNA 4ISNA 2EI7A 4A5TS 5ESBA 1DWEH 3SQEE 5GXPA 2XBXA 5HMAA 3PLKA 2ANYA 2GCHF 3M61U 5DG6A 1Z8GA 1GHZA 2J95A 1TGSZ 1BQYA 1Y5AT 2ZHEH 4WF8A 1FN6A 3N7DA 1QCPA 3ZVBA 1AWHB 2OP9A 1S82A 1A5GH 3Q3XA 2RA3A 1DPOA 2PFEA 3A87A 1V2QT 2GVFA 5EQSA 1HLTH 1TGBA 1AE5A 2WSSD 1GJ9B 4Y11E 1IQGA 1RTLA 5HIZA 1NFYA 1OYTH 4OGXA 2ZQ1A 3PWBA 2XW9A 2GD4B 2A5AA 1MCVA 1GL1A 4ISHH 4XRNA 4MTBA 4FVBA 3AW0A 1L1JA 6GCHG 3LONA 1BTHH 1GI5A 3ZZ9A 4X2YA 4YOJA 1IAUA 3MH5A 3SNEA 3PRDA 4XOJA 4A1XA 1PFXC 3EA9A 1GBTA 3TH2H 3U28C 4CRCA 3PMJA 4TT3D 4AFZA 5FCKA 3A83A 5B6OA 1HRTH 4ACAA 1UTMA 1PQ7A 1SLXB 1Q2WA 1O2OA 2P3FH 4M9FA 1N6YA 1VCQA 1UVSH 1BBRH 3RXKA 3URCA 4ZAEA 1SVPA 1YCPH 3D62A 3OE7D 3QGJA 2SGFE 2UWPA 3M3TA 2STAE 1A0LA 4H4FA 4H6SB 3OTPA 1SGNE 2P8OB 2VBCA 3FN8A 1KYNA 2Z9JA 1MABB 2H9HA 5GPIB 3UR6A 2F91A 1NC6A 4OGYA 1EJMA 3AK5A 1K1IA 3M7TA 3EDXB 2VWOA 2V35A 1GJCB 2EC9H 1C5XB 5EQQA 4FVDA 2BQ6B 4X1QU 2R2MB 2C8WB 1ZTLA 4VGCC 1PYTC 4SGAE 3VB6A 1LDTT 2HLCA 3GCTG 5F8XA 3U69H 1E0FD 2SGEE 4KP0A 1VITG 1P02A 1EZSC 3RXFA 4B73A 2BD3A 4BTIB 2QXIA 4NWKA 3L3TA 2VGCB 3RU4E 1QL7A 4FOUC 1GBFA 1IHTH 2BD9A 4WVPE 2JJ2D 3EYDA 1BMMH 3MNXA 1W0JD 3UWIA 1QL9A 2BXTH 4ZKNU 2NWNA 1WAYB 3A7VA 2AGGX 2VWLA 3GY2A 1AKSA 2XRCA 1NRNH 1IQKA 1FNIA 3AVZA 1SGCA 1NU9A 4X6OA 1BHXF 1C2MA 1NS3A 1EAWA 8ESTE 2ZPRA 9LPRA 1YWUA 3F9GA 1UHBB 2A0QB 2A2QH 1DITH 3LKWA 3GDSA 1CA8B 1Y3XA 4ABBA 5F6MA 1BBRK 1SLVB 1YF4A 1CE5A 1QA0A 1TA6A 3F0OA 1QURH 1YCPK 2O9QA 3TIUA 2SNVA 1DWBH 3F3BA 1O31A 4GHTA 4B74A 2TIOA 1AUJA 5ESTE 3TGJE 3KYFA 2C4FH 3A86A 5H4IB 2PHBA 1A0JA 1DUEA 3SV2H 4A7IB 2XC5A 2JKHA 1BOQA 4Y7AA 2ASUB 4ABAA 1HV7A 1L4DA 3QK1A 2BD8A 1SB1H 1GHVH 1O0DH 1BCUH 1EB2A 1RRKA 2R3YA 4CRAA 3M36A 3TLOA 2BQWB 2J4IA 4LOYH 3OAAD 2YNAA 4AFSA 3ZVCA 1TRMA 1LTOA 2QXJA 1XUKA 6CHAC 3T27A 3KQ5A 1FXYA 3NRLA 3Q00A 1S81A 2IJD1 3SU5A 3PWCA 1JIRA 3A81A 4LK4A 1GMDG 1NTPA 2KR7A 1GBAA 3M3SA 2HRVA 3O8RA 4R0IA 1NT1A 1GHBF 1XM1A 3UNQA 1NFXA 1QR3E 3SU1A 1O2ZA 4RI0A 2P3TB 3LIWA 2ZU4A 4I32A 1P0SH 4NA7A 3H7OA 2M2AA 7GCHF 2UWLA 1G37A 2BX4A 5L2YH 1MAYA 5BRRE 3CP7A 3P70B 3U8OH 1MTUA 4ZHLU 1ETRH 1NFWA 2PSYA 4Q80A 1MBMA 5EU8A 2V0BA 3S7KB 4BNRA 1C2GA 1BJUA 4A92A 4P00A 5E8EH 5A0BA 1QGFA 1QTFA 1K28D 3FOAA 3UPEA 1IQFA 3A7XA 1SKYE 3E8LA 1W14U 1MKXH 1TIOA 1THSH 1HB0B 1YYY1 3TGIE 4YT7H 1ELVA 4U01A 1GBJA 4ABHA 3A7ZA 3B8JA 2Y80A 1NY22 4AYYB 2ZTYA 1FLEE 3BF6H 1MAXA 1FX0B 1OSSA 1J16A 2FLRH 3SU2A 2ZQ2A 5EJ1A 1O5DH 4DURA 3GICB 2ANKH 3O8CA 1ESTA 1O3JA 4AG1A 5EJLA 2BDGA 4FUEA 2FWWA 4Y8XA 3SGQE 2KM0A 4XDEA 1TBQH 1GGDB 1Y59T 1ELCA 2G81E 3KN2A 3ZIAD 3M37A 1O2TA 2ZG0H 4K60A 4K1SA 2HPQH 1ARBA 1XKBC 3ATLA 4DIHH 3A85A 1O3IA 3PMBB 1WYKA 1CHGA 9ESTA 2VWMA 1TPOA 2BDCA 1CU1A 1OS8A 1HNEE 2GJGA 1XUFA 3M5NA 3UTUH 5DP9A 1WV7H 3V3MA 1NU7B 1OWIA 1QB6A 3RC5A 5HKKD 2FMJA 1Z8JB 4X0WU 3C27B 1E79D 5C3NA 2AIPA 1O39A 1ZMLA 5T6DA 2KCYA 1L1GA 3NCLA 1GG6B 1C1OA 2L6OA 2WYJA 1MKXK 1J15A 3Q76A 2P93A 3S9BA 3K65B 4MG3A 4JMYA 1S83A 2GX4A 5E2OA 4FUFA 3LGVA 2XTTB 3LOXA 4YLUA 2WV9A 4Q7XA 2SGQE 1H8ED 2XOKD 1WUNH 1O5CB 1Y3UA 4ISOA 4ZUHA 3LC3A 1PPHE 4WWYA 1AIXH 1XVMA 3RXSA 1ZYOA 1P2MA 1BTWA 3L33A 1O2SA 2GDDA 1XUIA 1P2NA 1DXPA 2FM2A 4OM9A 1SL3A 4YO9A 1ZSLA 1AN1E 2M5TA 4GAWA 2A7JA 1BRUP 2ULLA 1HAVB 1O3LA 5DP5A 1PJPA 4B2AA 1ABIH 3DSPA 3FANA 4FU8A 1GMCF 2BDAA 2DUCA 1C4Y2 1AUTC 3GCNA 2FOBA 2ZCHP 5CHAB 2G00A 1O2MA 4Y6DA 3NUMA 1JIMA 1O2KA 2CK3D 1HCGA 1C5UA 2K1QA 1LVBA 1QJ7B 3EAJA 1N6XA 3RXQA 5EGMA 3TU7H 1C5YB 1KDQB 3MU8A 1NRQH 1O2VA 4CH2B 1MMJN 3SV9A 1GHXH 3ZZ7A 1CHOF 2PV9B 3MH6A 1S6FA 4AX9H 4GCHG 1TBRH 3PV2A 1SHHB 2BY9X 2O8TA 2GCTB 2VH0A 1DWCH 1V2TT 2BMGB 4F55A 4KTCA 5JYIA 2ZIQH 3QZRA 3UOPA 5AVDA 2PKSB 3K6YA 1O2NA 4Q2KA 2BY6X 1AD8H 1TMBH 1ELAA 4RSPA 4HGCA 2W26A 4ISLA 4D76A 3RC4A 1A7SA 2ZDLA 1YP9A 5IYTA 2F9UA 1MQ5A 1DVAH 4ZMAH 5C1UA 3BTTE 3F9FA 1LQEA 3ZVGA 4ZH8A 3T5FH 3FP7E 2BZAA 3OY5U 4B76A 5A09A 2OBQA 2R3UA 1L1NA 2QV1A 5B6LA 3SBKA 2BYAX 5F03A 3I78A 1E37B 3EA7A 1Z71A 1LKBA 1KLTA 1O3EA 1NROH 2FZZA 4F4OC 1EZQA 1EPTB 3GY8A 3OSYA 1PPZA 1CGJE 3ZV9A 1GBDA 3TJNA 1C2EA 3B9FH 1OKXA 3FZDA 2UUJB 1C2IA 3ZZ5A 4DIIH 4E05H 4OS4A 1O2LA 4YZUA 2KCPA 3BEIB 1V2MT 1O2WA 1OYQA 2ZNKH 3OX7U 3FFGA 2ZC9H 3MNBA 1GJDB 2BLVA 5JBBS 1T4VH 1XKAC 3PTNA 2KAIA 2ZCKP 1ELTA 1G30B 3RXRA 1SGFA 3RXVA 3E0NB 1BRAA 4DJZB 3NXPA 2HVXA 2ESTE 3BTKE 1UMAH 2VNTA 2OC1A 4AYVB 2D1JA 1BMLA 3GY6A 1GMHF 5LH8A 6ESTA 2JH6D 1LMWB 4ABEA 1LCYA 1W12U 2BD7A 1YKTA 4Z6AH 1E35B 1CGHA 5AFYH 3DFJA 2GCTC 1GI8B 3KHVA 4LXBH 1UO6A 5IK2D 1TONA 1BTZA 3A8BA 1HUTH 2PKSC 4B6FA 2C93B 3RMNH 4O3TA 4KELA 1RXPA 2W7UA 5L6NH 4CR9A 2CV3A 4NIVA 1O3NA 2BOKA 2ANMH 1SGEE 3FO8D 5HXFA 1AVXA 2PKAA 2ZPSA 1VJAU 1SGDE 2A4GA 4KKDA 5FX6A 1GVLA 3VXFH 1KXBA 2BDBA 1C1RA 1SMFE 4U32A 1FPCH 3RMMH 5C1XA 4X8UH 3E16B 2ZU5A 5ABWA 1QRXA 2SGAA 2R0KA 4TPIZ 2PGBB 1OXGA 3HATH 2YMSD 1W13U 4FXGH 2B9LA 1ZSKA 4JZDH 5EODA 4FU9A 2KCOA 2QA9E 2ZEBA 1IQHA 3MHWU 2TGTA 2BDIA 4INLA 3RXOA 1G3CA 1AE8H 1UTOA 1ZOMA 2ODQA 4JCNA 4Z0KA 1O5GH 1SHYA 2OTVA 2XCFA 4YOIA 4CBNA 2AGIX 3P8GA 1NO9H 3MU4A 1TAWA 1T31A 2IOTA 5CE1A 3N99A 3CENA 1Z8IB 1P3EA 4FUGA 5JB8S 3SJKA 2G4UA 3LC5A 3SO3A 1FQ3A 3QWCH 2ZFRH 4RT0A 3T62A 2V6NA 2UUYA 1C1VH 3MOCA 4CRBA 3K9XB 3SJ8A 1IHSH 1ESAA 2ZWLH 3WW7A 4ABFA 3R3GB 1TNJA 2V7QD 4INKA 3FAOA 3TJOA 1MTNB 4AB8A 1S0QA 2R0LA 2GGVB 5DK1A 4MPUA 1GHYH 5TCAA 1WXRA 1TB6H 4MNVA 4X8SH 1SGFG 1AMHA 4NIWA 1B0FA 3TJVA 2ZKSA 3ESTA 4GHQA 1C5RA 3ATKA 4BANB 3ATWA 4H42U 1GVZA 1ID5H 1YPHE 5FBIA 1GI2A 1O34A 3F0PA 5FBEA 4UFGH 2Q6GA 5JBTA 2ALVA 3DUXH 1JMOH 1FY1A 1DY8A 3V12A 1YPHC 2IN2A 2EQNA 4WH6A 1CQQA 2AERH 1FDPA 1UK2A 1UVPA 3T28A 2TRMA 5GNDA 1GDNA 1BIOA 3LJOA 1FN8A 1ETSH 4X6PA 4NSYA 4AGKA 1K1NA 3E1XB 2WV5A 3PLPA 4M7GA 1OOKB 3RLYH 2QIQA 1GBIA 1TMUH 1TX8A 1AB9B 3ZZ3A 3SJ9A 1ZGVA 4DT4A 3SV8A 2C90B 1GI9B 2UUKB 3RU4T 4YM9A 1GPZA 2OQUA 4ZKOU 5C2ZA 1W7GH 2TGDA 1THPB 3W1EA 1T8OA 4Q7YA 1S85A 1H1BA 1TNLA 3PO1B 1ZHMA 2AFQB 2GP9B 2C3SA 4D9QA 5FX5A 2EA3A 4WXVA 5L2ZH 4YLQH 1Z7KA 4NZLA 4X1RU 2WUBA 1DE7H 4SGBE 3ZZBA 2ZFQH 1HGTH 5F53A 2ZDAH 1V2RT 3GDUA 3SYJA 2BY5X 1LPKB 2KFWA 4UDWH 1HAGE 2HPPH 1K9OE 2QCYA 3Q77A 1O32A 3RXEA 1EQ9A 4H6TA 2BLOA 1COWD 2F9NA 2ZP0H 3R0FA 3SHAH 4UFFH 3GCTF 1FAXA 2WV4A 3QTOH 1C2LA 1KY9A 1MTNC 4QT8C 4E7RG 3KNXA 2FIRH 1HJAB 1EAIA 1ZMJA 2A5KA 2VIDA 1BDAA 3SW2B 2J34A 4B71A 2VJ1A 1IQJA 1D3TB 1DWDH 4BOHA 3E91A 7ESTE 2OBOA 1GWAA 3BN9A 3ZVFA 2ZFTA 4UE7H 1HIAA 1NRRH 1BB0B 1CVWH 2P3UB 3T26A 1RFNA 3C1KA 3TJUA 4X2XA 1A4WH 3AAUA 3SNDA 2FOMB 3OYPA 1D4PB 1GCDA 4NIXA 3DSOA 1K2I1 2VIOA 2H5CA 2J2UA 1WCZA 2PWXA 2B7DH 3SUDA 2K8IA 3GY3A 2NU4E 3KYGA 3NK8A 3F2FA 3K6ZA 4MPWA 1NPMA 1PPEE 1LVYA 4NG9H 1KIGH 4IMZA 5GJ4B 1EJAA 1ETTH 4ESTE 1YM0A 2XWAA 1WDIA 1AB9C 3KQCA 2W7SA 3EGKH 1GDQA 1K21H 1B0EA 4I8HA 1TNGA 5EOKA 1UTNA 2ZDMA 3RXIA 3U98H 3GY4A 1SLUB 4JZFH 4RT1A 4MLFB 2A31A 2VIPA 5IDKA 5LPFA 1OP8A 1QBVH 2JJ1D 2H2ZA 1AHTH 1P2JA 5DP4A 1JWTA 4Q63A 3SHCH 1FJSA 5I25A 2ANWA 1SGYE 4X1SU 4MNYA 3SI4H 2FI4E 3F9HA 2LELA 3TK9A 1NBMD 1GMDF 1MD8A 1WOFA 4ABDA 1O3AA 3ELAH 3A88A 4XBDA 3M7UA 1SI5H 3DSGA 2ZU3A 1NRPH 5FHTA 2V3HH 1CT2E 8LPRA 4MDSA 1P2KA 1PQ5A 3GS9A 3VB3A 4XE4A 1A5HA 2AS9A 1P09A 3PYHA 4X8VH 3A80A 2QXGA 1OP0A 1YBWA 4A1VA 1T4UH 2OC0A 4Q7ZA 2A4QA 3P6ZB 1A61H 3MI4A 1GJ8B 4TYDA 1HJAC 2QC2A 1UW7A 1C5PA 1JBUH 3KF2A 1OWKA 1V2OT 2F43B 3JZ1B 2P8OC 3QDZB 4J1YA 1WSSH 5JBCS 1O5AB 1ZPCA 2WPDD 1NN6A 5E2PA 2AIQA 2HLDD 1EATA 2Z3DA 2BD2A 1ZTKA 1LO6A 3F68H 4ISIH 1HYLA 2CGAA 3DT0H 2G5NA 2A1DB 2R2WU 4B6EA 1K1JA 2NU0E 3DFLA 1EKBB 3IG6B 3KEEA 4XD7D 3H5CB 1O3HA 4RKJB 2BY8X 3PTBA 1BT7A 2VGCC 3WWFA 3QLPH 1O2XA 2FS8A 3Q3KA 1EJNA 2FX4A 3OTJE 1GCTB 4ZXYH 1S0RA 2WYGA 4MQAA 2F83A 3U9AH 3DD2H 4BTUB 1XUGA 3UNSA 3UIRA 4TWWA 1ZPBA 2A7HA 4TWYA 2ZDNA 1V3XA 2C8YB 2XBYA 4DG4A 3HK6B 1BRBE 1QZ8A 3BTME 4IW4E 1HAHH 4X6NA 1DT2A 4OS5A 4BAQB 3RMLH 2VIQA 2G55A 1TGNA 1KXEA 1OWEA 1H4WA 1N8OB 2Y5GA 3OEHD 3AASA 1BMAA 3PV4A 1MBQA 4UD9H 2BLQA 4AOQA 2GZ9A 2B8OH 1P04A 3HGNA 1CT4E 4K8BA 2NU1E 1L2EA 1BTUA 1UTJA 2CXVA 3TVJB 3MFJA 3ZV8A 3UAIC 1ZTJA 3SJOA 4OS6A 1C9TA 2J38A 1L4ZA 1GHAG 2EI6A 4IC6A 4CHAB 5L30H 3MU0A 5JB9S 2OUAA 3RUOA 3BV9B 1FY8E 2Z9IA 5C5NA 1XUJA 1W0YH 1AO5A 4YOGA 2QY0B 1TX6A 1HDTH 1YPLH 3VB7A 4JYVH 4BAOB 3A7YA 1K0HA 2AMQA 5FXLA 1ZLRA 4GUXA 2GT7A 3RLWH 1C5QA 3S9AA 2JH0D 1E36B 4GLYA 2I6QA 2ZHQH 2FXRA 2KAIB 2OXSA 2O8MA 5EPNA 4E7NA 4XBCA 4BAHB 1LVOA 4Y76A 1A3EH 1AI8H 3F6UH 1UTQA 3SGBE 4OS1A 1HAIH 1G36A 1BA8B 5DP7A 1XVOA 2Z3CA 4OS2A 3DA9B 4D8NA 3ZZAA 1GJ7B 1AZ8A 1FY3A 1ZJKA 2J92A 1V2ST 1ABJH 3P95A 1C1PA 3BTGE 3W94A 1IQIA 1A3BH 1TPPA 1UHBA 2VU8E 2BLWA 3S7HB 4X8TH 3GYLB 3S9CA 1BTYA 1PPBH 1HAXB 2ZHDA 1O3GA 1WQVH 1FY4A 1DM4B 2WZQA 3BTWE 5SGAE 1N8OC 1AY6H 3DCLA 4R8TB 1V2JT 1XX9A 4MNXA 4GCHF 1JRSA 2FESH 3PMAB 1G3EA 5C1YA 2PSXA 2PKAB 2ZGHA 3P92A 3RM0H 4TY6A 1TBZH 4WMEA 1GJ4H 1AVGH 2IPQX 3BEFB 5A8XA 3RXBA 1GGDC 3GYMA 3BTHE 4Z1MD 2FOEA 1F0UA 1G2LA 2HOBA 1F2SE 3M35A 2L74A 1VCPA 4NA9H 3TNSA 1FONA 1ZGIA 3RXDA 4CHAC 3BTDE 4KGAA 4AG2A 4Y8YA 2HNTE 2G52A 2ZDKA 2ZCLP 2ZHFH 1VITH 3E0PB 2RDEA 2SGPE 3OFND 2XNIA 1QY6A 2HNTC 3RXPA 2P16A 4WJG2 4I7YH 4O97A 3KGPA 4NA8A 2QGRA 3A82A 4TY7A 2FYQA 1YPKH 4Q4LA 4FUJA 1SOTA 3KCGH 1FPHH 1QB1A 3RDZA 1NESE 1H9LB 1TWXB 1GG6C 2OLGA 3MU5A 4WY3A 1N1LA 1K1MA 1O3FA 2W3KA 2H9TH 4U2WA 3MH7A 4YTAA 3SU0A 6LPRA 1NBME 1UTKA 1GVKB 3SORA 5LGOA 2VWNA 4TPYA 1MD7A 3HGPA 3SOSA 2AMPA 1O5FH 4K1TA 1SQTA 1O36A 3NWUA 4J2YB 1B5GH 1C2FA 2A2XH 1OWJA 1C2HA 3LGWA 1JOUB 4K5ZA 3STJA 2TPIZ 1PQ8A 3LGUA 3LU9B 4AZ2B 1JRTA 3RMOH 2ZGJA 3RP2A 4B75A 1Y5BT 1DSTA 1ZHPA 2XNDD 1QQ4A 1GI0A 3LGIA 2A4RA 3A89A 1KXFA 1QQUA 1ELGA 1H8IH 1O2RA 1C5NH 3VGCB 1O37A 3V7TA 3T2NA 3TPIZ 1T7CA 1O2PA 1TOCB 2EEKA 3WWBA 1VR1H 5EW1H 5A8ZA 2P95A 4X2WA 3RXMA 3D23A 8KME2 3MMGA 3S69A 2O8LA 4DY7B 1SFQB 3SZEA 4I8JA 4K3JA 3MH4A 2BD5A 1ANCA 1TALA 2FOHA 2FDAA 2Q6FA 3TH3H 2Q1JA 2G4TA 2XBWA 2A7CA 5CHAC 2Z94A 1RS0A 3B23B 4NSVA 4NFEA 1YPJH 3STIA 3GCHB 2JDID 1FI8A 1THRH 2ZO3H 4GSOA 1NFUA 3U1IB 1LPGB 3ATMA 3RXAA 5C5OA 4RKOB 1GBEA 1FV9A 1C1WH 2PUQH 3MWIU 2J98A 5FPTA 1LPZB 2D2DA 3ZYDA 4ASUD 3LH1A 1F0TA 2W6JD 2WPKS 1GL0E 2OC8A 2VVVA 4F49A 5PTPA 5A8YA 2P59A 1TMTH 1E34B 2SGDE 3RU4D 2UWOA 5DN6D 1BJVA 1L0ZA 1S6LA 2HGTH 2Y6TA 2PTCE 2TBSA 4X1PU 1EOLA 1GDUA 4FUDA 1QBNA 1ZRKA 1UTPA 4F48B 3RXTA 3P8OA 1UVTH 1V2KT 5E0HA 4RN6A 3T29A 1CGIE 3FP8E 1DX5M 2HWLB 2RCEA 1SG8B 3QTVH 1MTWA 2ZTXA 3UB0A 4LZ1H 1LHEH 1SGIB 2HNTF 1DANH 1A46H 2A32A 1GI1A 2ZFSA 3CS7A 3IITA 2THFB 3KL6A 4CR5A 1HXFH 4UONA 1RTFB 3SUFA 5GCHG 4ZCNA 1QJ1B 2FOCA 4I8KA 1DUAA 2CF8H 2ILNA 2CMYA 1F0RA 1ORFA 2Y82A 3PLBA 1EPTC 1C1UH 1CO7E 3UREA 3LPRA 1HAPH 3SV6A 2BD4A 5C20A 3UNRA 2F9BH 3UOUA 1YPEH 1P2QA 1ESBA 5AFZH 3CNRA 2G51A 2RFKC 4ABGA 1QRZA 2FI5E 1S84A 3UY9A 1S6HA 5EPYA 4AFUA
chains in the Genus database with same CATH topology
3U1JB 5T6FA 1TYNA 3GCHC 5EG4A 4FUCA 1DSUA 2WHXA 2VINA 5HGGA 1UVOA 2ODYB 3LDXH 4HZHA 1O3PB 4I33A 4WMDA 1G3DA 3SU6A 2BB4A 1AKSB 1AQ7A 4O3UA 3RXGA 5CMXH 4OS7A 1OHHD 1YC0A 4K2YA 4HI3A 2OC7A 5A0CA 2QF5A 1YLDA 3ZVEA 5CDFE 5A2MH 3PRBA 1H9HE 4D9RA 1NZQH 1VCWA 1O3KA 4JK5A 3SU4A 5AF9H 1QRWA 1RTKA 1TNHA 3ZVAA 1BITA 4O03A 1F0SA 3BTQE 1QIXB 2SNWA 1LKAA 1KLJH 3TH4H 4AFQA 2A4OA 1SGPE 4UFDH 6GCHF 3S0NA 4NGAH 3U8RH 1O2YA 1RIWB 1TRYA 2BOHB 2WINI 1ZPZA 3M7QA 4X2VA 2VB0A 1D3QB 1EFRD 3BIUH 1LQDB 3LGTA 1AU8A 2BM2A 4FETA 1O2HA 5I46H 1QHRB 4Y7BA 2WPLS 4VGCB 1O2IA 2ZGBH 2OINA 1O38A 2ZFPH 4XSKU 2ALPA 8GCHG 3RXJA 4Y71A 5F8ZA 1B7XB 3KQEA 1Z1JA 1CA0B 5EW2H 1V2PT 5K7RA 2FOGA 2BDYA 1QBOA 1Y3VA 3EE0B 1C5OH 1GJBB 3WY8A 4AB9A 1CBWB 2FO9A 4NFFA 1SSXA 1KXCA 1QA7A 1TGCA 3ZYEA 1EP6A 5AHGH 3SUEA 1MTVA 3VG8A 2OD3B 2GTBA 1ANBA 2H1UA 1EZUC 3VPKA 2QYIA 1TQ0B 3PMHB 4JYTA 3NZIA 2H6MA 3SN8A 3TNTA 1TOMH 4Y8ZA 4ZHMU 1P01A 5C0UA 1SGRE 4DT7B 2GCHG 5FPSA 1O2QA 3PB1E 4X1NU 1AVWA 1C1MA 1ELDE 1VITF 4I8LA 2ZFFH 3I77A 2GV6A 2B0FA 1IQEA 1VGCB 1EZXC 1FZZA 1WTHD 2D26C 4AORA 1K22H 1XMNB 2J9NA 2STBE 1E1RD 3SJIA 2GZ8A 4Y10E 5EXMA 2BVXH 2VH6A 3SUGA 2YMSB 2BVRH 1F5RA 2H9EH 1TE0A 3KQBA 3VXEH 3ZVDA 1BMFD 2FPZA 2GKVE 3BEUA 2FOFA 4I31A 1OWHA 6CHAB 1YLCA 3HPTB 1DICA 1C5WB 5GIBA 3V13A 1V2VT 4XBBA 1RIWC 1XXDA 2I6SA 2PGQB 3QN7A 3KIDU 1TPSA 1P2OA 5DO4H 4ZKSU 1TRNA 3ZZ8A 1PPGE 1QFKH 1TFXA 3ZZCA 2Z3EA 4K1EA 2ZA5A 2CN0H 4MNWA 4DOQA 3K2UA 2QXHA 3GISB 3A8CA 3M3VA 3M5MA 4D7GA 1C1SA 2RA0A 1TQ7B 1MUEB 3PROA 1MTSA 1AFEH 4CRGA 1JXPA 4GVUA 2W6ID 1CA0C 2OK5A 1UK3A 1FIZA 3SNCA 4ABIA 1C5TA 3PO1C 1CBWC 1AGJA 1ANDA 3GY5A 4NZQA 1C2DA 1A5IA 4CRFA 3FP6E 4ZKRU 2AEIH 2FYRA 1C5SA 1A0HB 2Y5FA 1ZZZA 1RD3B 1DS2E 1BRCE 1P12E 1S5SA 1BZXE 4O9VA 2FS9A 1LHDH 2VIWA 1OWDA 1G9IE 2XC4A 1EXFA 1TA2A 1O33A 2CF9H 3U8TH 1D3PB 1G32B 1PPCE 1H8DH 3H7TA 1UTLM 3H09A 1X7AC 3D49H 1W0ZU 2WPHS 5J4QA 2FODA 2HALA 1VGCC 2CJIA 1HAYB 4E06H 4AN7A 5FAHA 3UQVA 1AFQB 1GBBA 5DKMA 7KMEH 1SQOA 1K1PA 3F2HA 1D3DB 4INHA 2FI3E 2YMSC 3QZQA 3GCOA 3W95A 2NU2E 2GZ7A 1P9UA 3JZ2B 2IPHA 3E90B 4WXIA 1O3MA 3F9EA 1NRSH 1LHGH 2BVSH 1C2KA 2ZGCA 3CS0A 4BXWA 2AHME 2WPJS 2ZDVH 2ZGXH 5LPEA 1SBWA 2Z7FE 1UJ1A 2FLBH 1QL8A 4IN1A 5HYOA 3UR9A 4FU7A 4TSFD 1NM6A 4MPVA 2GMTB 2G8TA 5K0HA 4YXWD 1Y3YA 5DPAA 4Y79A 4Y0YE 1EASA 1GHAF 4LZ4B 1DFPA 3SNAA 3MNSA 1W11U 2V3OH 2A5IA 4HFPB 4FUHA 1W3CA 1P8VC 4KTSA 4X6MA 3N7OA 1GBMA 2QN5T 1J9CH 3MNCA 1C2JA 3N7EA 4JZ1A 4WH8A 1OPHB 4IGDA 1U6QA 2W3IA 3FVFB 3F2GA 1BUIA 4ZHAA 3M5LA 1C4V2 5GDSH 5E0GA 3E3TA 1D6WA 1BBRE 3FKSD 2W5EA 2Z9KA 1P9SA 4I8GA 1W7XH 1GHBG 4B1TA 1ZMNA 1E38B 3MYWA 4THNH 1UVUH 1BTPA 2BXUH 2AGEX 2K0QA 1TNKA 2D8WA 1TX7A 5DP6A 4B2CA 2Z6BD 2ZU2A 7GCHG 3LT3A 4K69A 2SFAA 4BXSA 1T8MA 3HK3B 4XFQA 1WBGB 3SV7A 2Y7XA 1F7ZA 1V2NT 1O3CA 3ZZ4A 2R9PA 1FY5A 1MKWH 3A7WA 1QB9A 2NU3E 2VVUA 1MCTA 3A84A 1HAOH 2XWBI 1WTGH 4FUBA 3EA8A 1Y8TA 2JETB 1AFQC 1Z6JH 2BTCE 3BSQA 4ASHA 2BY7X 3AAVA 1ZRBA 1J8AA 1F5KU 1TABE 1G3BA 3GDVA 3QGNB 2J5UA 4YESB 3QX5H 1ZSJA 2XBVA 1FAKH 1RJXB 1DY9A 2QF0A 1P06A 3RM2H 4NCYA 1HAZB 1M9UA 1YPGH 2BZ6H 1O2JA 1XUHA 1O5EH 2C8ZB 1KTSB 4IBLH 3VB4A 2ZTZA 1TGTA 3MTYA 4DGJA 1A1RA 2TGPZ 1EOJA 1LHCH 2GMTC 1O35A 4KTUA 5E0JA 1YPMH 2Z9GA 3L6PA 1GCTC 2JIZD 1C1QA 2Y81A 1P11E 2JH5D 3UUZA 2RDLA 5T6GA 1H8HD 4UEHH 1Y3WA 2TGAA 2IJOB 2XXLA 3BTEE 1WU1A 1Y5UT 3SQHE 1Z6EA 2C8XB 1J17T 5J4SA 1D6RA 1UCYH 2FOAA 2FEQH 2P94A 3SZNA 5JBAS 1GBHA 1OX1A 1TLDA 4JZEH 4BAKB 2Q6DA 4FUIA 1KTTB 1SQAA 2BHGA 3GY7A 2XYAA 3OY6U 1C5ZB 1HPGA 5FL7D 1D9IA 1ACBE 2ZI2H 1F5LA 1HJ9A 5HM2A 3TITA 1A2CH 2KCAA 1C4U2 2F9OA 1O2UA 1C5VA 4BAMB 1GI3A 2QF3A 2Z9LA 2GDEH 3HKIB 1MKWK 2WPMS 1W10U 1EB1H 5JDUB 1MZAA 5EXLA 1FUJA 2F4LA 1SC8U 5T3HA 4UFEH 1Q3XA 4ZROA 2GV7A 1MU8B 2AYWA 1TPAE 1VJ9U 2ZF0H 4IC5A 3A8DA 1GI6A 3ITIA 1W0KD 3KQDA 1CT0E 1O30A 1SPJA 2KZ4A 1KXAA 5DP3A 4AGJA 5JPMH 2O8UA 4JZIA 4WMFA 2YOLA 2JETC 4BTTB 5C67A 1DDJA 2H5DA 2Y7ZA 3ENSB 3VEQB 1Z8RA 3URDA 3BG4B 3ODFA 3QO6A 4PROA 1G2MA 4CRDA 5DSFA 1ZJDA 1GI7B 2AMDA 1Z1IA 3PM3A 2PW8H 4CREA 1AWFH 1DLKB 4HTCH 5EQRA 4ZXXH 1UCYK 1K1LA 1C5LH 3SI3H 4D7FA 3RXHA 1GMCG 1HXEH 3AW1A 2VIVA 2J94A 2LPRA 3P17H 1W8BH 3P8FA 1KXDA 4CBOA 1ELEE 1P10A 2QF4A 1MU6B 1O3DA 2DE9A 3TK6A 1O2GH 3RXCA 3I29A 3MU1A 2BDHA 2VVCA 2F9VA 3EQ0H 5DGJA 3UQOA 3LGYA 3RXUA 2CHAB 5C17A 5DJ7A 4K8YA 3P8NA 1CHOG 5TJXA 2PLXA 1GBCA 3SNBA 2G5VA 2AH4X 1J14A 2BX3A 1T32A 2OCVB 3VFEA 4CH8B 3GOVB 1INCA 1HFDA 1PQAA 1IQMA 2O8WA 1SR5C 3QUMP 4IS5A 3MO9A 2DE8A 1PYTD 1F92A 4NIYA 2FTLE 4JK6A 3SGAE 1VZQH 1Q31A 5FPYA 1SGTA 1O3OA 1T8LA 3ZZDA 1PPFE 5GCHF 2WUCA 4IN2A 2RG3A 3BG8A 4DCDA 1KMHB 1UCYE 2XC0A 2PR3A 3ZZ6A 1OP2A 5GWZA 1GBLA 4ABJA 2QAAA 1GI4A 3RC6A 5ETXA 5G4BA 5A0AE 5HM9A 1MQ6A 1C1TA 4DVAU 3DHKH 3BG4C 4NWLA 2GT8A 1C9PA 3O8DA 3IWMA 3HKJB 4Y0ZE 2PTNA 3OEED 3G01A 3TGKE 1EX3A 1MZDA 1ELFA 4A1TA 1FIWA 2FX6A 2FP7B 3TK5A 1K1OA 1O3BA 1FMGA 1P57B 2LNCA 3NKKA 2A45B 1CSOE 1BHXB 1XXFA 1P05A 1P03A 2Y5HA 5DP8A 3BTFE 5TCCA 2WPIS 1DXWA 1HAVA 1HIAB 1DLEA 4YT6H 2ZHWH 1O5BB 3M5OA 3A7TA 3E6PH 4DW2U 1H9IE 1IQLA 4IMQA 3VGCC 1IOEA 5FCRA 5T1VA 1BMNH 5LPRA 1GMHG 1QJ6B 3MO6A 2CHAC 3NPSA 1DOJA 1MH0A 1V6DA 2F3CE 4U30A 2EI8A 5EXNA 5BPEA 4A6LA 1IQNA 1YCPM 1E1QD 1ELBA 1ANEA 1EUFA 3UWJH 1KDQA 1TNIA 1GJAB 2ZECA 1V2LT 1C5MD 1P2IA 2QE7D 1AZZA 1GJ6A 1EAXA 4GPGA 2YNBA 3SU3A 3RXLA 2UUFB 1SLWB 3LH3A 4B2BA 5C0TA 1UK4A 1V2WT 3LJJA 1RGQA 1V2UT 1C1NA 2ZPQA 7LPRA 3BIVH 1KLIH 1GHWH 2PUXB 2XCNA 4JYUH 1GJ5H 3MO3A 3FZZA 2ZZUH 2FTMA 1LHFH 3PV5A 4MVNA 1QNJA 1T8NA 3T25A 1YGCH 2OQ5A 2ODPA 3Q3YA 8GCHF 1ARCA 1GBKA 1W2KH 4MPXA 3O8BA 3V0XA 1LVMA 1EAUA 3F1SB 1SFIA 2F9PA 1SGQE 1WQSA 3A8AA 2B5TB 3VB5A 1P3CA 2BQ7B 1HBTH 1EP5A 3D65E 1ZHRA 3ODDA 3OU0A 5F8TA 1SOZA 3UFAA 5CHBA 1BTXA 1ZR0A 2ZU1A 3ATIA 1EPTA 1HJ8A 1KSNA 4ISNA 2EI7A 4A5TS 5ESBA 1DWEH 3SQEE 5GXPA 2XBXA 5HMAA 3PLKA 2ANYA 2GCHF 3M61U 5DG6A 1Z8GA 1GHZA 2J95A 1TGSZ 1BQYA 1Y5AT 2ZHEH 4WF8A 1FN6A 3N7DA 1QCPA 3ZVBA 1AWHB 2OP9A 1S82A 1A5GH 3Q3XA 2RA3A 1DPOA 2PFEA 3A87A 1V2QT 2GVFA 5EQSA 1HLTH 1TGBA 1AE5A 2WSSD 1GJ9B 4Y11E 1IQGA 1RTLA 1NFYA 1OYTH 4OGXA 2ZQ1A 3PWBA 2XW9A 2GD4B 2A5AA 1MCVA 1GL1A 4ISHH 4MTBA 4FVBA 3AW0A 1L1JA 6GCHG 3LONA 1BTHH 1GI5A 3ZZ9A 4X2YA 4YOJA 1IAUA 3MH5A 3SNEA 3PRDA 4XOJA 4A1XA 1PFXC 3EA9A 1GBTA 3TH2H 4CRCA 3PMJA 4TT3D 4AFZA 5FCKA 3A83A 5B6OA 1HRTH 1UTMA 1PQ7A 1SLXB 1Q2WA 1O2OA 2P3FH 4M9FA 1N6YA 1VCQA 1UVSH 1BBRH 3RXKA 3URCA 4ZAEA 1SVPA 1YCPH 3D62A 3OE7D 3QGJA 2SGFE 2UWPA 3M3TA 2STAE 1A0LA 4H4FA 4H6SB 3OTPA 1SGNE 2P8OB 2VBCA 3FN8A 1KYNA 2Z9JA 2H9HA 5GPIB 3UR6A 1MABB 2F91A 1NC6A 4OGYA 1EJMA 3AK5A 1K1IA 3M7TA 3EDXB 2VWOA 2V35A 1GJCB 2EC9H 1C5XB 5EQQA 4FVDA 2BQ6B 4X1QU 2R2MB 2C8WB 1ZTLA 4VGCC 1PYTC 4SGAE 3VB6A 1LDTT 2HLCA 3GCTG 5F8XA 3U69H 1E0FD 2SGEE 4KP0A 1VITG 1P02A 1EZSC 3RXFA 4B73A 2BD3A 4BTIB 2QXIA 4NWKA 3L3TA 2VGCB 3RU4E 1QL7A 1GBFA 1IHTH 2BD9A 4WVPE 2JJ2D 3EYDA 1BMMH 3MNXA 3UWIA 1W0JD 1QL9A 2BXTH 4ZKNU 2NWNA 1WAYB 3A7VA 2AGGX 2VWLA 3GY2A 1AKSA 2XRCA 1NRNH 1IQKA 1FNIA 3AVZA 1SGCA 1NU9A 4X6OA 1BHXF 1C2MA 1NS3A 1EAWA 8ESTE 2ZPRA 9LPRA 3F9GA 1UHBB 2A0QB 2A2QH 1DITH 3LKWA 3GDSA 1CA8B 1Y3XA 4ABBA 5F6MA 1BBRK 1SLVB 1YF4A 1CE5A 1QA0A 1TA6A 3F0OA 1QURH 1YCPK 2O9QA 3TIUA 2SNVA 1DWBH 3F3BA 1O31A 4GHTA 4B74A 2TIOA 1AUJA 5ESTE 3TGJE 2C4FH 3A86A 5H4IB 2PHBA 1A0JA 1DUEA 3SV2H 4A7IB 2XC5A 2JKHA 1BOQA 4Y7AA 2ASUB 4ABAA 1HV7A 1L4DA 3QK1A 2BD8A 1SB1H 1GHVH 1O0DH 1BCUH 1EB2A 1RRKA 2R3YA 4CRAA 3M36A 3TLOA 2BQWB 2J4IA 4LOYH 3OAAD 2YNAA 4AFSA 3ZVCA 1TRMA 1LTOA 2QXJA 1XUKA 6CHAC 3T27A 1FXYA 3NRLA 3Q00A 1S81A 2IJD1 3SU5A 3PWCA 1JIRA 3A81A 4LK4A 1GMDG 1NTPA 2KR7A 1GBAA 3M3SA 2HRVA 3O8RA 4R0IA 1NT1A 1GHBF 1XM1A 3UNQA 1NFXA 1QR3E 3SU1A 1O2ZA 4RI0A 2P3TB 3LIWA 2ZU4A 4I32A 1P0SH 4NA7A 3H7OA 2M2AA 7GCHF 2UWLA 1G37A 2BX4A 5L2YH 1MAYA 5BRRE <