1O3NA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA02
1O5FH 5SGAE 3Q76A 5E0GA 2D8WA 2YNAA 3IITA 5H4IB 1C5RA 3LU9B 2GCHF 1GBCA 1FAKH 3A89A 2KAIB 3M5OA 2HPPH 3C27B 3QX5H 1NRNH 1HPGA 2CXVA 3LH3A 2FM2A 1CA8B 3F68H 1K1PA 2GMTC 2BY8X 1AKSA 4XBCA 3UNSA 1UO6A 4K69A 3SV9A 1BHXB 1O3JA 3PB1E 1EATA 2ZDMA 1CVWH 1WV7H 1ZGIA 5GCHF 1EB1H 1FY3A 2ZGBH 1BDAA 5JB8S 1CO7E 1OP0A 1O2ZA 5FBEA 1ZPCA 3NPSA 3MO3A 4K60A 1LPGB 5IDKA 1C5QA 1YCPM 1PYTC 4X6PA 2AGGX 7LPRA 2PGBB 4IN1A 5FPTA 2GMTB 1VR1H 1YBWA 4UONA 3BTTE 3T62A 3MU5A 1O30A 1SR5C 1TWXB 2ZEBA 2UWOA 3M7TA 4OS6A 3SU1A 1QR3E 2BTCE 1VGCC 2TGTA 3A84A 1P01A 2O8UA 5HXFA 4ZKRU 1KXCA 1TX7A 1XXDA 2STAE 1NTPA 3PLBA 1P09A 1SGFA 1DWBH 2QGRA 1WTGH 3ATMA 1TIOA 4JZ1A 4OS5A 1HDTH 3LDXH 1GI3A 2G00A 2QCYA 2GZ8A 1BHXF 1O0DH 5JBBS 1UCYK 1E36B 1RTFB 2F3CE 3GCTG 3SI4H 5C1UA 1G2MA 1PYTD 1ANCA 2F9NA 5HM2A 3LGWA 5CHAB 3LT3A 2HWLB 2THFB 2Y82A 4BTTB 3U98H 1A4WH 1LKBA 1D6RA 3DUXH 1GHXH 4MG3A 1TNJA 1V2MT 3PWBA 5C2ZA 1K9OE 2O8WA 2AS9A 3DHKH 4M7GA 3S0NA 3TGIE 2ZG0H 4XFQA 5A8ZA 1HYLA 1QBVH 2EI6A 3TNTA 2OTVA 5E2PA 6ESTA 1S5SA 3RXIA 4Y79A 3SUEA 2W26A 4HTCH 3ODFA 1AFEH 1EPTA 1YPHC 1O2XA 3GYLB 4X8VH 1C1PA 1O3DA 3MNCA 1C1MA 1RIWB 2C8YB 1TA6A 1YPJH 2FIRH 2FODA 4X6OA 5EPNA 2Z9LA 1QIXB 2RA0A 3SUDA 1UTQA 1CT2E 1GGDB 4J1YA 1C1SA 4B74A 3SV2H 1C9TA 1QL7A 1TNLA 1BRCE 3LOXA 1O2MA 2Z9IA 1NFWA 4E06H 3M5NA 3TVJB 1NT1A 3PMAB 4UFGH 1O2PA 1ZTLA 2AGEX 2B9LA 2VVCA 1J15A 2J38A 1V2VT 1Y8TA 3QGJA 1OS8A 1HIAB 1K2I1 1GPZA 2QYIA 1P11E 1L2EA 2F9PA 3DA9B 3U69H 1ELTA 1O39A 1A3BH 1O2JA 2QXIA 3KQCA 1K1MA 3STIA 3OSYA 1O2IA 3BTFE 3GY6A 1EAIA 1H9LB 1Y5UT 1SI5H 1ZMLA 2ZIQH 1SQTA 3L3TA 2VH6A 4DY7B 3CS7A 1C5OH 2J34A 2ZDKA 4I31A 1GJ7B 1EP5A 1MAXA 2XC5A 1FLEE 1MD7A 4I8KA 5HM9A 3E0PB 2G81E 4RN6A 1KLTA 3S9BA 2OQ5A 4B1TA 1GBDA 1GHZA 3SGAE 1DS2E 5EQQA 2VIOA 2BVXH 1Y3YA 3RLWH 1GI6A 2WV5A 4DGJA 4B76A 1T8NA 3TH4H 5EW2H 5AFYH 4AB8A 1JXPA 5LH8A 2XC0A 1UTJA 3KN2A 1ELBA 4IMZA 2B0FA 3UR6A 2H6MA 2QA9E 4LK4A 3VB3A 1HAYB 4BAKB 1XUIA 1IHTH 1TGCA 4TYDA 1Z8IB 3RXEA 1DDJA 4Q7YA 1EJMA 2FXRA 2ZFQH 1MBQA 1HLTH 4A5TS 2AIPA 1O3IA 1H8IH 2G4TA 1NRSH 2DE9A 1UVOA 4O9VA 1H9HE 2ZPQA 1LVBA 6GCHG 1TAWA 2XCNA 2BD2A 1O2RA 3SOSA 1ELEE 1GWAA 3RMOH 3RM2H 2A4OA 2ZCLP 9ESTA 4I8LA 4U2WA 1YYY1 1BTYA 4OS2A 3SU4A 2R9PA 1N8OB 2GT8A 4K1EA 2GT7A 1O37A 2SGFE 4IN2A 3AAVA 1B0FA 1DITH 2SGDE 3SNAA 1ZPZA 1ELCA 4BANB 3ATIA 4CREA 1RGQA 1T7CA 1C1QA 2ZCKP 1SOTA 4H4FA 1QB1A 3NKKA 1ETRH 1A5IA 1GMHF 1FJSA 2P94A 3EAJA 3K65B 3SNDA 1S0QA 4ZXXH 1Z8GA 3V12A 2ZWLH 2OCVB 4AX9H 4ZROA 1ARBA 1TALA 3SU2A 3NWUA 4BAQB 1AFQB 1N1LA 1BITA 2Q6GA 1AQ7A 3ZVDA 1GHBG 1G3BA 3SU3A 1C2EA 3GCOA 1FQ3A 1KTTB 2BB4A 2BLQA 3QTOH 1SMFE 2V6NA 3SBKA 3UFAA 2C90B 3RXTA 2VGCC 5BPEA 2CN0H 2AMQA 5JDUB 3VFEA 1TYNA 2ZHDA 5FPSA 3NXPA 5JBCS 2IJOB 5FX6A 2XBWA 4DG4A 3M3VA 4AG1A 2C8WB 1GI8B 1WBGB 1G9IE 4X1PU 1UVUH 2FZZA 1RIWC 3Q3KA 3A8AA 4ABHA 5I46H 3LJJA 3ZVEA 1GJAB 3U8RH 4F4OC 1V2UT 1DY9A 1CE5A 4ZHLU 1CQQA 1PFXC 1ZR0A 4X2VA 3T29A 5AF9H 4SGAE 1GHAG 2YNBA 2W3KA 3SHCH 5DP9A 2FOGA 2G51A 1OOKB 4FUJA 1YLDA 1V2WT 3RXBA 1F0UA 2FLRH 1YGCH 4MNVA 3DFLA 2YOLA 2PGQB 2ZA5A 3O8CA 1SLWB 1BTWA 1CT4E 2HLCA 4TWYA 4FVBA 4A1VA 3UTUH 2BX4A 3RXDA 2ZO3H 1L4ZA 2XC4A 1CHGA 1C5XB 2XRCA 4MNXA 1ID5H 4CH2B 1PQ7A 1FY8E 1SGPE 1ZLRA 3CS0A 1GMDF 1UTPA 2W7SA 2Z7FE 3MMGA 1W0YH 1IQHA 1TQ7B 4AB9A 1A61H 2Q6DA 3TJUA 4ABGA 1NU9A 1KDQB 2I6QA 2IPHA 3HGNA 1UVSH 1W0ZU 3OU0A 4CR9A 3KF2A 2O8LA 4AYVB 1YP9A 3O8RA 2ALVA 1O2KA 4DW2U 2W3IA 3SNEA 2GCHG 1W7GH 4XSKU 1C5LH 4WMFA 1HIAA 3R0FA 1P2MA 1OWDA 2ZI2H 5T3HA 1PPEE 4THNH 1BT7A 1ZHRA 1XX9A 2A7CA 5DP8A 1BTUA 1TB6H 5EXNA 5BRRE 1WOFA 2ZTYA 1C1RA 5FAHA 1D3TB 3OX7U 1TE0A 1VITG 4IGDA 3QTVH 1Y5AT 1C5TA 5TCAA 3ZZ6A 2FOBA 1SGEE 1UK2A 3C1KA 1O2YA 4INHA 4KTSA 3HKIB 1UTOA 2AIQA 4K1TA 3MH6A 3T27A 1Q3XA 2Z9JA 3U9AH 3UOUA 3T28A 3M3SA 1ABJH 3TK5A 2O8MA 1RTKA 4B73A 2H9EH 1BOQA 2ANMH 4MPXA 3FP7E 4GPGA 3NUMA 1GBHA 1W11U 2FYRA 3KGPA 3A8CA 3BG4C 4GSOA 3RU4E 2ZGXH 1OWJA 3GCTF 4MTBA 2ZFTA 1F92A 1NRRH 3KIDU 1Z6EA 1OXGA 4NA7A 4XOJA 5AHGH 3AW0A 1QQ4A 2WINI 1HJ8A 5LPRA 3FAOA 3GY4A 1GCDA 1YC0A 1GHWH 1RJXB 1TRYA 5T6DA 2FOHA 1K1OA 2NU0E 2R2MB 4BAHB 6LPRA 1IOEA 3BTWE 2BQ7B 1MTSA 3EGKH 1FPHH 1MTNB 1K1LA 1ZRKA 4ZUHA 3UR9A 1AI8H 3ZZCA 2QV1A 5HMAA 4OGYA 2PFEA 3V3MA 4CBNA 2H9HA 1UK4A 1C5YB 2J2UA 4ABEA 4UDWH 4NIWA 5EXLA 1AMHA 1ZJKA 4K5ZA 5DGJA 3V13A 1HAPH 4AGJA 3LONA 4ZKSU 4X2YA 3U8OH 3A83A 1O34A 4JYTA 2XNIA 1KXEA 1Z7KA 1V6DA 2ESTE 4WXIA 3KHVA 4NZLA 2ZPSA 1PPBH 4JYUH 4NCYA 2XBYA 2KAIA 1AU8A 1O35A 5C20A 1JWTA 1O3CA 1O3KA 4BAMB 1YPMH 1HJ9A 1QA0A 2OXSA 3BTKE 5EU8A 3ZZDA 1IQGA 3TK6A 1UTNA 3Q3YA 1VGCB 3P6ZB 3RXKA 1TOCB 2Z3EA 1LHCH 1ZGVA 3RXRA 1NFXA 1DXPA 1BB0B 2A0QB 1MMJN 3K6ZA 5GDSH 3RXLA 2XBVA 1H9IE 8GCHG 4YOIA 4LOYH 1S0RA 1P9UA 1C4Y2 3VEQB 1O2VA 3MO9A 4I8HA 1DWDH 4D7GA 1C2IA 4U01A 4Z0KA 1RXPA 6CHAC 1HUTH 1O3LA 1YKTA 1G3EA 1H1BA 2BQWB 1Y59T 3UWIA 1UVPA 1M9UA 5B6OA 3MOCA 1C1TA 2BDAA 4Q80A 4Y7BA 1DSTA 4YOJA 1WAYB 2F91A 3ENSB 3PO1B 1RD3B 2V0BA 2QXJA 4NGAH 1MU6B 3KL6A 1MD8A 3RXVA 4HZHA 1EQ9A 4QT8C 3STJA 1BCUH 8LPRA 3KEEA 1W3CA 4A7IB 4DT7B 3SV8A 3UUZA 1SGDE 4GHTA 1TNHA 2ZU2A 4D8NA 2SNWA 3I78A 1MAYA 1GL1A 1O2UA 3BEFB 1O38A 7GCHG 3MNSA 1C1OA 2G55A 2VWLA 3FANA 4AFUA 1C4U2 1H8DH 1RS0A 4UFEH 1P8VC 5F8ZA 3EA7A 4GAWA 3RMMH 4FUIA 4MNWA 2ZU4A 2UWLA 1O5CB 2ZF0H 2TIOA 2P3TB 2VU8E 1PPZA 3F6UH 4UD9H 1BTZA 1G3DA 2JH6D 2GZ9A 4ISNA 4BTIB 1ESAA 1THRH 3BTDE 3RDZA 1TPAE 4AN7A 1GBMA 4MDSA 4B71A 1ZYOA 3M3TA 1AUTC 2GCTB 3HPTB 1EB2A 1L0ZA 3RXSA 4AFQA 4NWKA 3A80A 4NFFA 3TJNA 3AASA 2FLBH 2XBXA 1QJ6B 3BTHE 4X2XA 2PKSC 3BTGE 2UUYA 3BEIB 2DUCA 1UK3A 2SGPE 4GUXA 5JB9S 1O2GH 2ULLA 1WQVH 2ZGJA 1O2WA 3Q77A 3LGUA 4CRFA 3A7VA 4OS4A 4NZQA 3OTJE 4D9RA 4I33A 2JH0D 1LHDH 2ZHQH 2FPZA 3K9XB 3SW2B 2AH4X 1F0SA 3TGKE 3F9HA 4X1RU 2P59A 1EKBB 1VCQA 1NO9H 1GJ6A 1A0JA 1S84A 2ZHEH 4Y10E 2ZHFH 2XW9A 3BF6H 1ZMJA 3M61U 2WYGA 1YCPK 1ZSLA 3RC4A 1O5DH 2IN2A 3EQ0H 3T26A 2P3UB 2Y5HA 3BIUH 4KTCA 2P16A 2WPJS 2FX4A 1Z6JH 1Z1JA 1GI9B 2RG3A 2FS8A 4BTUB 1GDNA 3SGBE 4D76A 1ELFA 1O36A 4TPIZ 4B2CA 1GMDG 1C5NH 1AKSB 3EDXB 1YF4A 2FEQH 1T8LA 2GVFA 2VIDA 3A7TA 4Z6AH 4O3UA 5EW1H 2A5AA 1ZHMA 2J95A 1KIGH 4ABBA 2FYQA 3LPRA 1A1RA 1TNGA 1GHBF 3FP6E 4B2AA 2GTBA 1HAGE 1HAZB 1ZRBA 4ISOA 4X1NU 4K2YA 1P2IA 2Z9GA 1AVGH 1TMTH 2VJ1A 4ZKNU 4AG2A 1HAVA 3UREA 5C5NA 3D23A 2K1QA 4K1SA 2A45B 3JZ2B 1A7SA 4AGKA 4KTUA 2ZFFH 5FPYA 3DFJA 3QO6A 1T4UH 3EA8A 1ZHPA 4SGBE 1CSOE 1GBLA 1JBUH 1O5GH 1MQ5A 1BMLA 1S6HA 1DLEA 4BNRA 3SZNA 1HJAB 2FI3E 3ZV9A 2STBE 3VB6A 3OY6U 1FY1A 4Y6DA 5DO4H 5GXPA 2VNTA 1D6WA 1GJCB 1F5RA 3PLKA 4B75A 5T6FA 3QK1A 2H9TH 1XUHA 1NRPH 3MI4A 3PTNA 1V2PT 3ZZ5A 5CMXH 3URCA 1EZQA 1ELDE 3ELAH 1TABE 3MFJA 4NIYA 2WPHS 1UHBA 2FI4E 2ZGHA 4O97A 4DIHH 1ORFA 3LGTA 1C2DA 4KKDA 6GCHF 1FZZA 4HGCA 2BY9X 2ZP0H 2PW8H 1CBWB 1P2OA 3TK9A 3O8DA 3Q00A 3GDSA 5FHTA 3G01A 4AFSA 2WPIS 1MQ6A 1T4VH 3GYMA 2A4QA 4MPVA 3ZZ9A 1HAHH 1TNKA 1O3PB 5T6GA 2ZQ1A 1SGTA 1BTPA 3RXGA 1UTKA 3ZYDA 2P95A 1GDUA 2G8TA 2HALA 3BG4B 1NN6A 2PUXB 2V3OH 3B8JA 3PROA 1SC8U 1W14U 3ZYEA 4VGCC 3A7YA 3TH3H 3RXAA 1FIZA 3ODDA 4DOQA 1B0EA 1FPCH 2ANYA 1Z8JB 1QHRB 2HOBA 2CF8H 5C5OA 1EPTB 1Y3UA 1LDTT 2TGDA 1AE5A 1G2LA 1JRTA 4UEHH 4Y8YA 2G5NA 1BMAA 1CA0C 5EGMA 4NFEA 4CRGA 4DURA 1GJ9B 2NU4E 2XTTB 4INLA 1V2KT 1GI7B 1P3EA 1XUFA 2BLOA 1E34B 2AYWA 2R3UA 4PROA 1MKWH 1V2LT 3FP8E 3TIUA 1KLIH 1NC6A 2G5VA 2XXLA 3VXEH 3BTME 4ABJA 3M37A 3MU1A 4E7NA 4ZHMU 1FIWA 3BSQA 4X8SH 4A1TA 2H5CA 2PV9B 2RA3A 1UTMA 1PPFE 4WJG2 1G37A 2C8ZB 2HRVA 3M35A 2ODYB 1TRNA 2OUAA 1QB9A 1P12E 2QF3A 3GCHC 3M5LA 1WSSH 4Y71A 4O3TA 1XMNB 1P10A 4IC6A 1CGJE 1N6YA 1KXDA 5E2OA 5GPIB 2SGAA 3ITIA 1WUNH 1C1VH 4MPWA 4ABIA 3PTBA 2J9NA 1FY5A 2BD7A 3VB7A 3DD2H 1LHGH 2PKAB 3TJVA 1LKAA 2UUJB 2ZU3A 1VITF 2C93B 2A5KA 2FESH 5F6MA 3ZZ7A 5PTPA 2BY5X 2FTLE 3HKJB 2PKSB 1BMMH 2Q1JA 1QRZA 3D49H 3U8TH 8KME2 1NROH 1XUGA 4GCHG 5JYIA 3TGJE 1GBJA 3RXJA 3ZVGA 1C5MD 1S85A 2D1JA 5GJ4B 1SG8B 3A7ZA 2UWPA 1SQOA 2Y7ZA 1QRXA 5GWZA 1C5SA 2OQUA 3ZZ8A 4WH6A 2OC1A 2GV7A 1C5PA 4X2WA 4FU8A 2PHBA 5HYOA 1IQJA 4AORA 1GI5A 1SHHB 2FOEA 5J4QA 2HNTC 3TNSA 1Z8RA 1IQFA 3EYDA 1MKXH 1TA2A 2ZFSA 3BTQE 1AGJA 3QZRA 3A8BA 1QJ1B 4NIXA 1ZSJA 2BY7X 4IC5A 4MVNA 1C2HA 3RLYH 2CMYA 1BTHH 1TX8A 4I8JA 3VPKA 1GI4A 4YT6H 5L30H 5FBIA 1INCA 1BRBE 1NY22 2FOAA 4WY3A 1GMCF 8GCHF 5CHAC 2HVXA 5L2YH 3UQOA 1GG6C 1QFKH 2BDGA 3FFGA 4KP0A 2W5EA 5ESTE 1XUJA 3LJOA 3ZZ4A 3ZZAA 4Y8XA 3LGYA 1VCPA 2VWOA 2SNVA 2PR3A 1GMCG 2ZU5A 3QUMP 3T5FH 1AO5A 4K3JA 1DWEH 3UWJH 4X8UH 2HPQH 1AZ8A 3W95A 4R8TB 2C3SA 3BV9B 2BX3A 1MUEB 1C2JA 2D26C 3GY5A 2FOCA 1C1NA 3PO1C 1NS3A 3BTEE 4FVDA 1QBNA 3QWCH 1HXEH 2Y7XA 1PPCE 1WQSA 1HAVB 2PLXA 4Y0ZE 2EI8A 1O3EA 2BD3A 4JYVH 1KXFA 1P0SH 4X1SU 3RUOA 3HK6B 1ANDA 2PWXA 1TMBH 1NM6A 1C2LA 2GDEH 1O3FA 4ESTE 4ABFA 1O2LA 4JZFH 3T2NA 3P8NA 4DCDA 1W13U 3SN8A 2PTNA 1V3XA 3UNQA 4NG9H 5C1XA 2GD4B 3P17H 2ZC9H 2P93A 1A2CH 3NK8A 2XWAA 3MU4A 1LVOA 1F0RA 2ZTZA 3SUFA 1FMGA 1CGHA 3A87A 4ISIH 3SJIA 1LQDB 4NA8A 2W7UA 2CHAC 1RFNA 2ASUB 3MU8A 2VIWA 1UHBB 4Y11E 3ZV8A 2BM2A 1MBMA 3B23B 2OD3B 3UOPA 5E8EH 4WH8A 4NWLA 1SBWA 1K1IA 1KTSB 1NZQH 1DOJA 1Q31A 2A7JA 1AHTH 1ANBA 1H4WA 4CR5A 2CJIA 1HNEE 3MWIU 2VIQA 4X6NA 1LVYA 1P57B 1T8OA 1C2GA 2GZ7A 2NU3E 3GDUA 1DPOA 1HB0B 2VH0A 2OC7A 2OLGA 1JIRA 2BDBA 1T8MA 2F83A 2BXUH 1MTNC 3K2UA 3SO3A 2VVUA 1U6QA 3FZDA 4FUFA 3KQEA 2CGAA 1C2FA 2BDCA 2Z9KA 4BOHA 1AWFH 2AGIX 1PQAA 2BLVA 2BOKA 2CHAB 1MZDA 1FN6A 4O03A 3UY9A 3H7TA 1GBEA 3MYWA 4ABAA 2SFAA 1DX5M 1VCWA 1LTOA 1O2SA 1C1WH 1F0TA 1TRMA 4Q2KA 1O3HA 4D7FA 3BN9A 1TPPA 1GBFA 3ATKA 3L6PA 2OINA 3CP7A 3RP2A 3RXMA 2ZDAH 4ASHA 3ESTA 1A46H 3GOVB 3SU5A 2ZDVH 3D65E 1OP8A 1K1NA 1Y3XA 3UQVA 3IWMA 4HFPB 1BZXE 3RC6A 1TLDA 1WYKA 3RXHA 3TU7H 5C1YA 1SGRE 4A1XA 5TJXA 1Q2WA 1O32A 1PQ8A 1UCYE 1O3OA 4WF8A 1L1GA 1SLVB 2ZTXA 1YPKH 2Q6FA 3E16B 2QIQA 1EP6A 3LKWA 3TH2H 1DWCH 1CHOF 4CH8B 4JMYA 2Z6BD 1FY4A 2XYAA 3PV4A 7ESTE 4TWWA 1TQ0B 2FX6A 1OYQA 1XVOA 1TOMH 2AERH 4LXBH 3TJOA 5DG6A 3OYPA 3RMNH 1FN8A 1ESBA 2ZECA 4RKJB 2BOHB 2QXGA 5CE1A 5FCKA 1JRSA 1YPLH 2XWBI 1MH0A 4I7YH 2Y6TA 2CF9H 2JH5D 3SV7A 1FNIA 3ZVAA 1O5AB 2BZAA 3M5MA 4ZKOU 2B5TB 4I8GA 4U32A 1GVKB 1MKXK 2HNTF 2PTCE 3BG8A 5AVDA 5DP6A 5A0AE 1V2TT 1W7XH 2H2ZA 2JKHA 2FWWA 1PJPA 1QURH 1SQAA 2HNTE 4UFDH 1OKXA 4Q7ZA 2EEKA 3HGPA 3MNXA 4ZAEA 1C9PA 3UIRA 1SL3A 2P3FH 3AVZA 4OS7A 5FXLA 3FZZA 1A0HB 1ZTKA 2Y5FA 4RKOB 3SHAH 2AEIH 2GGVB 1SFIA 2ZZUH 3QGNB 4IW4E 5F03A 1ESTA 1Z1IA 1JOUB 1C1UH 1C2MA 3RU4T 2F9BH 1WCZA 1QY6A 1YPHE 1SOZA 9LPRA 1MTUA 1BTXA 1GBBA 1O33A 3MU0A 1LHFH 8ESTE 3E0NB 4Y7AA 3HATH 4JZIA 3ZVBA 3S7HB 4GLYA 4CHAB 1FXYA 3ZVFA 2ZFRH 5DK1A 1LPKB 1P04A 1SGIB 4AFZA 1GMHG 5ABWA 1Y3WA 3MO6A 1EAWA 2A1DB 4E05H 2ANWA 3B9FH 1GBIA 1WU1A 1IQLA 4CRAA 1CT0E 1QL8A 2ZNKH 3P92A 1AD8H 2FS9A 1DUEA 4CBOA 4R0IA 1O2HA 1YPEH 4Q7XA 1P2QA 1EUFA 4LZ4B 2BDYA 5K0HA 2EC9H 4XE4A 4Y0YE 3AW1A 1D3QB 2Z3DA 3RC5A 1UJ1A 1ZMNA 1HV7A 1S82A 1V2ST 4GHQA 4DIIH 1IAUA 3RXCA 2VWMA 1L4DA 1TPSA 1D9IA 2ZKSA 1E37B 1GI2A 4OS1A 1F5KU 4NA9H 2OP9A 3FVFB 3E91A 1LCYA 2BLWA 1ANEA 1O2OA 4A92A 1TONA 1W12U 1GJDB 4WVPE 5DP7A 1GG6B 1GCTC 3U1IB 5F8TA 2A7HA 4YZUA 5TCCA 3GY3A 4MLFB 4U30A 5DJ7A 1SLXB 3RM0H 5EPYA 2H1UA 3P8FA 2VIPA 1SPJA 1TBQH 3NZIA 3E1XB 1VJAU 1J14A 1V2NT 2V35A 3ZZBA 4AZ2B 2ALPA 1LPZB 2G4UA 1J17T 2BZ6H 4X8TH 1XVMA 5FCRA 1SVPA 1MTVA 1TNIA 5EQRA 5A0BA 1MTWA 1UVTH 1FAXA 1SGCA 1T32A 2WUBA 2P8OB 1B5GH 3GCNA 2VGCB 1GJ5H 5JBAS 3LC5A 1D3DB 1LQEA 2V3HH 1E0FD 4ZHAA 3A7XA 2OC0A 1ABIH 2UUKB 2R0LA 3UNRA 1E35B 4JZDH 1DICA 2WPMS 6CHAB 4NIVA 2F9OA 2FOMB 1HXFH 4TPYA 1N8OC 2AMPA 2WPLS 4BXSA 2ZDLA 4RSPA 4ZH8A 2BD8A 1O31A 1ETSH 2B8OH 2BD4A 3S9CA 4UFFH 1V2RT 3GY2A 1ZPBA 3Q3XA 3A8DA 2A2QH 5DKMA 1DXWA 3MTYA 2J4IA 1DUAA 1EZSC 4WXVA 1EAXA 3SGQE 1AVWA 3ZZ3A 2LPRA 2J92A 4JK5A 4YTAA 1MZAA 1GHAF 4H6TA 5EOKA 5L6NH 1LHEH 1KYNA 1O2NA 1GBKA 1SFQB 3LH1A 2VB0A 3A81A 1OX1A 3E8LA 3RXPA 4YLQH 2OC8A 3GCHB 2AFQB 1AZZA 1KXAA 1P02A 1JIMA 1VJ9U 1CGIE 1P2KA 1OYTH 3PYHA 3LC3A 2ZGCA 3S9AA 5FX5A 3GISB 3PWCA 1OWIA 5DP3A 2B7DH 1P3CA 3H7OA 1DANH 5HGGA 1TX6A 5L2ZH 3KNXA 1GHVH 2QF0A 3R3GB 2ILNA 4X6MA 2TGPZ 1HAXB 4KELA 5EQSA 4ISHH 4X1QU 1O3BA 2D2DA 1TGTA 2FMJA 2QXHA 1J8AA 1O5EH 1YPGH 1F7ZA 3RXUA 4B2BA 1AUJA 1QJ7B 2OBQA 1SGNE 1SGFG 3SORA 3LGVA 1FI8A 1BRUP 4FUDA 2GV6A 3GY8A 2FI5E 1IQKA 1AB9C 5JPMH 1K28D 1CA0B 4Y76A 1K21H 3SU0A 3M7QA 1O5BB 1O2QA 1UTLM 2FOFA 5DP4A 2C4FH 5EXMA 3KQDA 1EPTC 2GP9B 3SQHE 1DY8A 1GVZA 1GBAA 1ELAA 3P8OA 4GCHF 1QTFA 4FXGH 2TRMA 4CRDA 5LPEA 1TGBA 3SJOA 1GVLA 2OBOA 1Y3VA 2SGEE 4DVAU 2VINA 1PQ5A 1YM0A 1QA7A 2A31A 2PSXA 2H5DA 1C5ZB 1EZXC 4MQAA 5DP5A 2HGTH 2WPKS 1BBRK 4YO9A 1ZOMA 2PKAA 3VB4A 2QY0B 1J16A 1KLJH 3SI3H 1GI0A 2ZHWH 1EZUC 1TPOA 1XKAC 2FDAA 3E90B 1A0LA 3A88A 3H5CB 3KCGH 2ZFPH 1NU7B 3F9GA 1ETTH 4BXWA 1W8BH 1P9SA 3E3TA 2WYJA 1CU1A 4YLUA 1ACBE 1UMAH 1KXBA 2TBSA 1O3AA 1G3CA 1OSSA 4OGXA 3V0XA 5F8XA 1IQMA 1J9CH 3O8BA 3F9EA 1O3GA 1XM1A 4NSYA 2I6SA 3NCLA 5A8XA 4FUGA 1GHYH 5C3NA 1P03A 2TGAA 2ZQ2A 2SGQE 4UE7H 1DVAH 2R3YA 2GCTC 1CHOG 1P2JA 2TPIZ 3MNBA 1FV9A 1KDQA 5G4BA 4K8YA 1MKWK 2EA3A 1ELGA 1V2JT 2QN5T 1CBWC 1GJBB 3OY5U 4ISLA 1W10U 5I25A 5J4SA 3ZVCA 1NRQH 4IS5A 2A4GA 3S7KB 1BRAA 1L1JA 1IQEA 1SB1H 5DPAA 1SSXA 2FO9A 4I32A 4IMQA 1EASA 1QNJA 1NESE 5A2MH 2M5TA 4X0WU 1K22H 1GBTA 4TY7A 4A6LA 3SNBA 4FU7A 5C67A 1FONA 3IG6B 3VXFH 1IQNA 1XUKA 3VB5A 1GJ4H 1TMUH 1O2TA 1JMOH 1A5HA 4JCNA 1EOJA 1OPHB 1GCTB 4AYYB 4KGAA 4H6SB 3JZ1B 2Z3CA 1N6XA 1S83A 1L1NA 2G52A 1LVMA 2ZCHP 3ATLA 1F5LA 1KY9A 1XXFA 2F9VA 1X7AC 3TLOA 2BMGB 3DT0H 1TBZH 4YT7H 3U1JB 1AIXH 1NPMA 5ESBA 2Z94A 4FUCA 3W94A 5LPFA 1SGQE 1V2OT 4XBDA 4ZXYH 2WV4A 3F9FA 3QZQA 1S6FA 1XKBC 3PLPA 3N7OA 1SHYA 1MCVA 3PMJA 5IYTA 1ZSKA 3ATWA 1HRTH 1G30B 3P8GA 1C5WB 3S69A 3UPEA 1THSH 2GKVE 2J94A 3GY7A 2A4RA 4YM9A 1TFXA 2NU1E 5E0HA 2RCEA 2F9UA 2ODQA 1BJUA 1AY6H 1BQYA 2BVSH 4ABDA 3TITA 1QRWA 4FUBA 4F49A 2DE8A 1HGTH 4XDEA 3PMHB 1QBOA 4FUEA 1TBRH 3RXFA 1BJVA 2BHGA 2BQ6B 2C8XB 2Y80A 1YCPH 2FP7B 2O9QA 3P95A 2NU2E 1HBTH 1QGFA 3D62A 1AE8H 1PPGE 1AFQC 3QLPH 2RDLA 2ZU1A 2QAAA 1TGSZ 1RRKA 1BMNH 1HAIH 1BUIA 1OWHA 5K7RA 3A85A 3MH5A 3A86A 1AWHB 1HAOH 2JETC 1ZJDA 5E0JA 5GIBA 1IQIA 1NFUA 2A32A 2AMDA 1UCYH 1HCGA 3RMLH 1Z71A 1ZZZA 1DSUA 2R2WU 3EA9A 4BAOB 1W2KH 1VITH 4INKA 4CHAC 4AOQA 3M7UA 1IHSH 2ZDNA 3L33A 3MH4A 4E7RG 1P06A 3CENA 3KQBA 2CV3A 4MNYA 1EJAA 1C5VA 1LO6A 4WMDA 1MU8B 1P05A 4D9QA 1C5UA 5AFZH 3URDA 1EOLA 3P70B 4FUHA 3AAUA 2GX4A 3LIWA 1GJ8B 1D3PB 5A8YA 1A3EH 4JZEH 4YOGA 1MCTA 1OWKA 2ANKH 3RXOA 3F1SB 2PUQH 7GCHF 2GDDA 2BDHA 1FDPA 2FTMA 3RXQA 2ODPA 4LZ1H 5A09A 2BDIA 3RU4D 1QB6A 4DJZB 4ZMAH 3BIVH 1G32B 2O8TA 4CRBA 1BBRH 1SLUB 1FUJA 1D4PB 1V2QT 3MH7A 3EE0B 3VGCB 2BYAX 3A7WA 1AVXA 5GCHG 1DM4B 4CRCA 1LMWB 1EAUA 3QDZB 5ETXA 3SJ8A 3GICB 2BY6X 3K6YA 2Y81A 1GI1A 1KSNA 2VVVA 1DLKB 3QN7A 5JBTA 3T25A 2PSYA 3LGIA 3SNCA 2WUCA 1OP2A 2QC2A 2VWNA 1NFYA 2NWNA 3A82A 5EG4A 3VGCC 1E38B 1TGNA 1C2KA 1K1JA 7KMEH 1VZQH 1C4V2 2A2XH 5LGOA 4Y8ZA 2UUFB 1EX3A 1F2SE 1G36A 1OWEA 1SGYE 1AB9B 2BD9A 3BEUA 2VIVA 5A0CA 3PMBB 1DFPA 1P2NA 1GDQA 3SU6A 1T31A 1ARCA 4MPUA 4YESB 4J2YB 4WMEA 3SJKA 1DT2A 3SUGA 4HI3A 1O3NA 3PM3A 1S81A 4TY6A 4K8BA 1GL0E 1YLCA 4IBLH 1RTLA 1PPHE 2R0KA 3MHWU 3I29A 2LNCA 4VGCB 4NSVA 2BVRH 2EI7A 3I77A 1O3MA 3SQEE 2IOTA 3M36A 1GGDC 1QQUA 1B7XB 1WTHD 3GDVA 1THPB 2Y5GA 5EODA 2JETB 1EXFA 1HFDA 1AN1E 2BD5A 2XCFA 4FU9A 1ELVA 1ZTJA 2BXTH 1QL9A 2ZPRA 4JK6A 1EJNA 4GVUA 1HJAC 4WWYA 3WY8A 1BIOA 3HK3B 1DE7H 1Y5BT 1A5GH 4H42U 3V7TA 3E6PH 1BA8B 2P8OC 2A5IA 3SV6A 4XBBA 3TPIZ 1QCPA 1BBRE 3SJ9A
chains in the Genus database with same CATH superfamily
4P00A 1O5FH 5SGAE 3Q76A 5E0GA 4Q63A 2D8WA 2YNAA 3IITA 5H4IB 1C5RA 3LU9B 2GCHF 1GBCA 1FAKH 3A89A 2KAIB 3M5OA 3F2GA 2HPPH 3C27B 3F2FA 3QX5H 1NRNH 1HPGA 2CXVA 3LH3A 2FM2A 1CA8B 3F68H 3KYFA 1K1PA 2GMTC 2BY8X 1AKSA 3OTPA 4XBCA 3UNSA 1UO6A 4K69A 3SV9A 3OAAD 1BHXB 1O3JA 3PB1E 1EATA 2ZDMA 1CVWH 1WV7H 1ZGIA 5GCHF 1EB1H 1FY3A 2ZGBH 4Q4LA 1BDAA 5JB8S 1CO7E 1OP0A 1O2ZA 5FBEA 1ZPCA 3NPSA 3MO3A 4K60A 1LPGB 5IDKA 1C5QA 1YCPM 1PYTC 4X6PA 4ACBA 2AGGX 7LPRA 2PGBB 3OEED 4IN1A 5FPTA 2GMTB 1VR1H 1YBWA 4UONA 3BTTE 3T62A 5C17A 3MU5A 1O30A 1SR5C 1TWXB 2ZEBA 1YLNA 2UWOA 3M7TA 4OS6A 3SU1A 3FO8D 1QR3E 2BTCE 1VGCC 2TGTA 3A84A 1P01A 2O8UA 5HXFA 4ZKRU 1KXCA 1TX7A 1XXDA 3F0PA 2STAE 1NTPA 3PLBA 1P09A 1SGFA 1DWBH 2QGRA 1WTGH 3ATMA 1TIOA 4JZ1A 4OS5A 1HDTH 3LDXH 1GI3A 2G00A 2QCYA 2GZ8A 1BHXF 1O0DH 5JBBS 1UCYK 1E36B 1RTFB 2F3CE 3GCTG 3SI4H 5C1UA 1G2MA 1PYTD 1ANCA 2F9NA 5HM2A 3LGWA 5CHAB 3LT3A 2IJD1 2HWLB 2THFB 2Y82A 4BTTB 3U98H 1A4WH 1LKBA 1D6RA 3DUXH 1GHXH 4MG3A 1TNJA 1V2MT 3PWBA 5C2ZA 1K9OE 2O8WA 2AS9A 3DHKH 4M7GA 3S0NA 3TGIE 2ZG0H 4XFQA 5A8ZA 1HYLA 1QBVH 2EI6A 3TNTA 2OTVA 5E2PA 6ESTA 1S5SA 3RXIA 4Y79A 3SUEA 2W26A 4HTCH 3ODFA 1AFEH 1EPTA 1YPHC 4B6FA 1O2XA 3GYLB 4X8VH 1C1PA 1O3DA 3MNCA 1C1MA 1RIWB 2C8YB 1TA6A 1YPJH 2FIRH 2FODA 2YMSB 4X6OA 5EPNA 2Z9LA 1QIXB 2RA0A 3SUDA 1UTQA 1CT2E 1GGDB 2WSSD 4J1YA 1C1SA 4B74A 3SV2H 1C9TA 1QL7A 1TNLA 1BRCE 3LOXA 1O2MA 2Z9IA 1NFWA 4E06H 3M5NA 3TVJB 1NT1A 3PMAB 3N7EA 4UFGH 1O2PA 1ZTLA 2AGEX 2B9LA 2VVCA 1J15A 2J38A 1V2VT 1Y8TA 3QGJA 1OS8A 1HIAB 1K2I1 1GPZA 2QYIA 3ZIAD 3FOAA 1P11E 1L2EA 2F9PA 3DA9B 3U69H 1ELTA 1O39A 1A3BH 1O2JA 2QXIA 3KQCA 1K1MA 3STIA 3OSYA 1O2IA 3BTFE 3GY6A 1EAIA 1H9LB 1Y5UT 1SI5H 1ZMLA 2ZIQH 1SQTA 3L3TA 2VH6A 4DY7B 5EJZA 3CS7A 1C5OH 2J34A 2ZDKA 4I31A 1GJ7B 1EP5A 1MAXA 2XC5A 1FLEE 1MD7A 4I8KA 5HM9A 3E0PB 2G81E 4RN6A 1KLTA 3S9BA 2OQ5A 4B1TA 1GBDA 1GHZA 3SGAE 1DS2E 5EQQA 2VIOA 2BVXH 1Y3YA 3RLWH 1GI6A 2WV5A 4DGJA 4B76A 1T8NA 3GS9A 3TH4H 5EW2H 5AFYH 5C0UA 1FX0B 4AB8A 1JXPA 5LH8A 2XC0A 1UTJA 3KN2A 1ELBA 3KQ5A 4IMZA 2B0FA 3UR6A 2H6MA 2QA9E 4LK4A 3VB3A 1HAYB 4BAKB 1XUIA 1IHTH 1TGCA 4TYDA 1Z8IB 3RXEA 1DDJA 4Q7YA 1EJMA 2FXRA 2HVYB 2ZFQH 1MBQA 1HLTH 5CHBA 4A5TS 2AIPA 1O3IA 1H8IH 2G4TA 1NRSH 2DE9A 1UVOA 4O9VA 1H9HE 2ZPQA 3W1EA 1LVBA 6GCHG 1TAWA 2XCNA 2BD2A 1O2RA 3SOSA 1ELEE 1GWAA 3RMOH 3RM2H 2A4OA 2ZCLP 9ESTA 4I8LA 4U2WA 1YYY1 1BTYA 4OS2A 3SU4A 2R9PA 1N8OB 2GT8A 4K1EA 2GT7A 1O37A 2SGFE 4IN2A 3AAVA 1B0FA 1DITH 2SGDE 3SNAA 1ZPZA 1ELCA 4BANB 3ATIA 4CREA 1RGQA 1T7CA 1C1QA 2ZCKP 1SOTA 4H4FA 1QB1A 3NKKA 1ETRH 1A5IA 1GMHF 1FJSA 2P94A 3EAJA 3K65B 3SNDA 1S0QA 4ZXXH 1Z8GA 4ASUD 3V12A 2ZWLH 2OCVB 4AX9H 4ZROA 1ARBA 1TALA 3SU2A 3NWUA 4BAQB 1AFQB 1N1LA 1BITA 2Q6GA 1AQ7A 3ZVDA 1GHBG 1G3BA 3SU3A 1C2EA 3GCOA 1FQ3A 1KTTB 2BB4A 2BLQA 3QTOH 1SMFE 2V6NA 5FL7D 3SBKA 1MABB 3UFAA 2C90B 3RXTA 2VGCC 5BPEA 2CN0H 2AMQA 5JDUB 3VFEA 1TYNA 2ZHDA 5FPSA 3NXPA 5JBCS 2IJOB 5FX6A 2XBWA 4DG4A 3M3VA 4AG1A 2C8WB 1GI8B 1WBGB 1G9IE 2M2AA 4X1PU 1UVUH 2FZZA 1RIWC 3Q3KA 3A8AA 4ABHA 5I46H 3LJJA 3ZVEA 1GJAB 3U8RH 4F4OC 1V2UT 1DY9A 5KECA 1CE5A 4ZHLU 1CQQA 1PFXC 1W0JD 1ZR0A 4X2VA 3T29A 5AF9H 4SGAE 1GHAG 2YNBA 2W3KA 3SHCH 5DP9A 2FOGA 2G51A 1OOKB 4FUJA 1YLDA 1V2WT 3RXBA 1F0UA 2FLRH 1YGCH 4MNVA 3DFLA 2YOLA 2PGQB 2ZA5A 3O8CA 1UW7A 1SLWB 1BTWA 1CT4E 2HLCA 4TWYA 4FVBA 4A1VA 3UTUH 2BX4A 3RXDA 2ZO3H 1L4ZA 2XC4A 1CHGA 1C5XB 2XRCA 4MNXA 3PV2A 1ID5H 4CH2B 4AC9A 1PQ7A 1FY8E 1SGPE 4ZCNA 1ZLRA 3CS0A 1GMDF 1UTPA 2W7SA 2Z7FE 3MMGA 1W0YH 1IQHA 1TQ7B 4AB9A 1A61H 2Q6DA 3TJUA 4ABGA 1NU9A 1KDQB 2I6QA 2WV9A 2IPHA 3HGNA 1UVSH 1W0ZU 3OU0A 4CR9A 3KF2A 2O8LA 4AYVB 1YP9A 3O8RA 2ALVA 1O2KA 4DW2U 2W3IA 3SNEA 2GCHG 1W7GH 4XSKU 1C5LH 4WMFA 1HIAA 3R0FA 1P2MA 1OWDA 2ZI2H 4B6EA 5T3HA 1PPEE 4THNH 1BT7A 1ZHRA 1XX9A 2A7CA 5DP8A 1BTUA 1TB6H 5EXNA 5BRRE 1WOFA 2ZTYA 1C1RA 5FAHA 1D3TB 3OX7U 1TE0A 1VITG 4IGDA 3QTVH 1Y5AT 1C5TA 5TCAA 3ZZ6A 2FOBA 4ACAA 1SGEE 1UK2A 3C1KA 1O2YA 4INHA 4KTSA 3HKIB 1UTOA 2AIQA 4K1TA 3MH6A 3T27A 1Q3XA 2Z9JA 3U9AH 3UOUA 3T28A 3M3SA 1ABJH 3TK5A 2O8MA 1RTKA 1QZ8A 4B73A 2J98B 2H9EH 5GNDA 1BOQA 2ANMH 4MPXA 3FP7E 4GPGA 5C0TA 3NUMA 3H09A 1GBHA 1W11U 2FYRA 3KGPA 3A8CA 3BG4C 4GSOA 3RU4E 2ZGXH 1OWJA 3GCTF 4MTBA 2ZFTA 1F92A 1NRRH 2XNDD 3KIDU 1Z6EA 1OXGA 4NA7A 4XOJA 5AHGH 3AW0A 1QQ4A 2WINI 1YY3A 1HJ8A 5LPRA 3FAOA 3GY4A 1GCDA 1YC0A 1GHWH 1RJXB 1TRYA 5T6DA 2FOHA 1K1OA 2NU0E 2XOKD 2R2MB 4BAHB 6LPRA 1IOEA 3BTWE 2BQ7B 1MTSA 3EGKH 1FPHH 1MTNB 1K1LA 1ZRKA 4ZUHA 3UR9A 1AI8H 3ZZCA 2QV1A 5HMAA 4OGYA 2PFEA 3V3MA 4CBNA 2H9HA 1UK4A 1C5YB 2J2UA 4ABEA 4UDWH 4NIWA 5EXLA 1AMHA 1ZJKA 4K5ZA 5DGJA 3V13A 1HAPH 4AGJA 3LONA 4ZKSU 4X2YA 3U8OH 3A83A 1O34A 2QE7D 4JYTA 2XNIA 1KXEA 1Z7KA 3SYJA 1V6DA 2ESTE 4WXIA 3KHVA 4NZLA 2ZPSA 1PPBH 4JYUH 4NCYA 2XBYA 2KAIA 1AU8A 1O35A 5C20A 1JWTA 2V7QD 2GJGA 1O3CA 1O3KA 4BAMB 1YPMH 1HJ9A 1QA0A 2OXSA 3BTKE 5EU8A 3ZZDA 1IQGA 3TK6A 1UTNA 3Q3YA 1VGCB 3P6ZB 3RXKA 1TOCB 2Z3EA 1LHCH 1ZGVA 3RXRA 1NFXA 1DXPA 1BB0B 2A0QB 1MMJN 3K6ZA 5GDSH 3RXLA 2XBVA 1H9IE 8GCHG 4YOIA 4LOYH 1S0RA 1P9UA 1C4Y2 3VEQB 5IK2D 1O2VA 3MO9A 4I8HA 1DWDH 4D7GA 1C2IA 4U01A 4Z0KA 1RXPA 6CHAC 1HUTH 1O3LA 1YKTA 1G3EA 1H1BA 2BQWB 1Y59T 3UWIA 1UVPA 1M9UA 3SZEA 5B6OA 3MOCA 1C1TA 2BDAA 4Q80A 4Y7BA 1DSTA 4YOJA 1WAYB 2F91A 3ENSB 3PO1B 1RD3B 2V0BA 2QXJA 4NGAH 1MU6B 3KL6A 1MD8A 2RDEA 3RXVA 4HZHA 1EQ9A 4QT8C 3STJA 1BCUH 8LPRA 3KEEA 1W3CA 4A7IB 4DT7B 3SV8A 3PRDA 3UUZA 1SGDE 4GHTA 2AHME 1TNHA 2KFWA 2ZU2A 4D8NA 3DSPA 2SNWA 3I78A 1MAYA 1GL1A 1O2UA 3BEFB 1O38A 7GCHG 2EY4C 3MNSA 1C1OA 2G55A 2VWLA 3FANA 4AFUA 1C4U2 1H8DH 1RS0A 4UFEH 3PRBA 1P8VC 5F8ZA 3EA7A 2K0QA 4GAWA 3F2HA 3RMMH 4FUIA 4MNWA 2ZU4A 2UWLA 1O5CB 2YMSC 2ZF0H 2TIOA 2P3TB 4TT3D 4XD7D 2VU8E 1PPZA 3F6UH 4UD9H 1BTZA 1G3DA 2JH6D 2GZ9A 4ISNA 4BTIB 1ESAA 1THRH 3BTDE 3RDZA 1TPAE 4AN7A 1GBMA 2EQNA 4MDSA 4B71A 1ZYOA 3M3TA 1AUTC 2GCTB 3HPTB 1EB2A 1L0ZA 3RXSA 4AFQA 4NWKA 3A80A 4NFFA 3TJNA 3AASA 2FLBH 2XBXA 1QJ6B 3BTHE 4X2XA 2PKSC 3BTGE 4YXWD 2UUYA 3BEIB 2DUCA 4TSFD 1UK3A 2SGPE 4GUXA 5JB9S 1O2GH 2ULLA 1WQVH 2ZGJA 3OFND 1O2WA 2PP6A 3Q77A 3LGUA 4CRFA 3A7VA 4OS4A 4NZQA 3OTJE 2J5UA 4D9RA 4I33A 2JH0D 1LHDH 2ZHQH 2FPZA 3K9XB 3SW2B 2AH4X 4M9FA 2JJ1D 1F0SA 3TGKE 3F9HA 4X1RU 2P59A 1EKBB 1VCQA 1NO9H 2W6ID 1GJ6A 3F0OA 1A0JA 2HLDD 1S84A 2ZHEH 4Y10E 2L6OA 5F53A 2ZHFH 2XW9A 3BF6H 1ZMJA 3M61U 2WYGA 1YCPK 1ZSLA 3RC4A 1O5DH 2IN2A 3EQ0H 5HIYA 3T26A 2P3UB 2Y5HA 3BIUH 4KTCA 2P16A 2WPJS 2FX4A 3WWBA 1Z6JH 1Z1JA 2J97A 1GI9B 1K0HA 2RG3A 2FS8A 4BTUB 1GDNA 3SGBE 4D76A 1ELFA 1O36A 4TPIZ 4B2CA 1GMDG 1C5NH 1AKSB 3EDXB 1YF4A 2FEQH 1T8LA 2GVFA 2VIDA 3A7TA 4Z6AH 4O3UA 5EW1H 2A5AA 1ZHMA 2J95A 1KIGH 4ABBA 2FYQA 3LPRA 1A1RA 1TNGA 1GHBF 2F43B 3FP6E 4B2AA 2GTBA 1HAGE 1HAZB 1ZRBA 4ISOA 4X1NU 4K2YA 1P2IA 2Z9GA 1AVGH 1TMTH 2VJ1A 4ZKNU 4AG2A 1HAVA 3UREA 5C5NA 3D23A 2K1QA 3F3BA 1NBMD 4K1SA 2A45B 3JZ2B 1A7SA 4AGKA 4KTUA 2ZFFH 5FPYA 3DFJA 3QO6A 1T4UH 3EA8A 1ZHPA 4SGBE 1CSOE 1GBLA 1JBUH 1O5GH 1MQ5A 1BMLA 4RI0A 1S6HA 1DLEA 4BNRA 3SZNA 1HJAB 2FI3E 3ZV9A 2STBE 3VB6A 3OY6U 1FY1A 2VBCA 4Y6DA 5DO4H 5GXPA 1D6WA 2VNTA 1GJCB 1F5RA 3PLKA 4B75A 5T6FA 3QK1A 2H9TH 1XUHA 1NRPH 3MI4A 3PTNA 1V2PT 3ZZ5A 5CMXH 3URCA 1EZQA 1ELDE 3ELAH 1TABE 3MFJA 4NIYA 2WPHS 1UHBA 2FI4E 2ZGHA 4O97A 4DIHH 1ORFA 3LGTA 1C2DA 4KKDA 6GCHF 1FZZA 5HIZA 4HGCA 1H8HD 5DSFA 2BY9X 2ZP0H 2PW8H 1CBWB 1P2OA 3TK9A 3O8DA 3Q00A 3GDSA 5FHTA 3G01A 4AFSA 2WPIS 1MQ6A 1T4VH 3GYMA 2A4QA 4MPVA 3ZZ9A 1HAHH 1TNKA 1O3PB 5T6GA 2ZQ1A 1SGTA 1BTPA 3RXGA 1UTKA 3ZYDA 2P95A 1GDUA 2G8TA 2HALA 3BG4B 1NN6A 2PUXB 2V3OH 3B8JA 3PROA 1SC8U 1W14U 3ZYEA 4VGCC 3A7YA 3TH3H 3RXAA 1FIZA 3ODDA 4DOQA 1B0EA 1FPCH 2ANYA 1Z8JB 1QHRB 2HOBA 2CF8H 5C5OA 1EPTB 1Y3UA 1LDTT 2TGDA 1AE5A 1G2LA 1JRTA 4UEHH 4Y8YA 2G5NA 3N99A 1BMAA 1CA0C 5EGMA 4NFEA 4CRGA 4DURA 1GJ9B 2NU4E 2XTTB 4INLA 1V2KT 1GI7B 1P3EA 1XUFA 2BLOA 1E34B 2AYWA 2R3UA 4PROA 1MKWH 1V2LT 3FP8E 3TIUA 1KLIH 1NC6A 2G5VA 2XXLA 3VXEH 3BTME 4ABJA 3M37A 3MU1A 4E7NA 4ZHMU 1FIWA 3BSQA 4X8SH 4A1TA 2H5CA 2PV9B 2RA3A 1UTMA 3N7DA 1PPFE 2LELA 4WJG2 1G37A 2C8ZB 2HRVA 3M35A 2ODYB 1TRNA 2OUAA 1QB9A 1P12E 2QF3A 3GCHC 3M5LA 1WSSH 4Y71A 4O3TA 1XMNB 1S6LA 1P10A 4IC6A 1CGJE 1N6YA 1KXDA 5E2OA 5GPIB 2SGAA 3ITIA 1WUNH 3CNRA 2LP6A 1C1VH 4MPWA 4ABIA 3PTBA 2J9NA 4F48B 1FY5A 2BD7A 3VB7A 3DD2H 1LHGH 2PKAB 3TJVA 1LKAA 2UUJB 2ZU3A 1VITF 2C93B 2A5KA 2FESH 5F6MA 3ZZ7A 5PTPA 1WXRA 2BY5X 2FTLE 3HKJB 2PKSB 1BMMH 2Q1JA 1QRZA 3D49H 3U8TH 8KME2 1NROH 1XUGA 4GCHG 5JYIA 3TGJE 1GBJA 3RXJA 3ZVGA 1C5MD 1S85A 2D1JA 5GJ4B 1SG8B 1W0KD 3A7ZA 2UWPA 1SQOA 2Y7ZA 1QRXA 5GWZA 1C5SA 2OQUA 3ZZ8A 4WH6A 2OC1A 2GV7A 1C5PA 4X2WA 4FU8A 2PHBA 5HYOA 1IQJA 4AORA 1GI5A 1SHHB 2FOEA 5J4QA 2HNTC 3TNSA 1Z8RA 1IQFA 3EYDA 1MKXH 1TA2A 2ZFSA 3BTQE 1AGJA 3QZRA 3A8BA 1QJ1B 4NIXA 1ZSJA 2BY7X 4IC5A 4MVNA 1C2HA 3RLYH 2CMYA 1BTHH 1TX8A 4I8JA 3MQKC 3VPKA 1GI4A 4YT6H 5L30H 5FBIA 1INCA 1BRBE 1NY22 2FOAA 4WY3A 1GMCF 8GCHF 5CHAC 2HVXA 5L2YH 3UQOA 1GG6C 1QFKH 2BDGA 3FFGA 4KP0A 2W5EA 5ESTE 1XUJA 3LJOA 3ZZ4A 3ZZAA 4Y8XA 3LGYA 1VCPA 4RT1A 2SNVA 2PR3A 2VWOA 1GMCG 2ZU5A 3QUMP 3T5FH 1AO5A 4K3JA 1DWEH 3UWJH 4X8UH 2HPQH 1AZ8A 3W95A 4R8TB 2C3SA 3BV9B 2BX3A 1MUEB 1C2JA 2D26C 3GY5A 2FOCA 1C1NA 3PO1C 1NS3A 3BTEE 4FVDA 1QBNA 3QWCH 1HXEH 2Y7XA 1PPCE 1WQSA 1HAVB 2PLXA 4Y0ZE 2EI8A 1O3EA 2BD3A 2F4LA 4JYVH 1KXFA 1P0SH 4X1SU 3RUOA 3HK6B 1ANDA 2PWXA 1TMBH 1NM6A 1C2LA 2GDEH 1O3FA 4ESTE 4ABFA 1O2LA 4JZFH 3T2NA 3P8NA 2QF5A 4DCDA 1W13U 3SN8A 2PTNA 1V3XA 3UNQA 4NG9H 5C1XA 2GD4B 3P17H 2ZC9H 2P93A 5EIYA 1A2CH 3NK8A 2XWAA 3MU4A 1LVOA 1F0RA 2ZTZA 3SUFA 1FMGA 2WZQA 1CGHA 3A87A 4ISIH 3SJIA 1LQDB 4NA8A 2W7UA 2CHAC 1RFNA 2ASUB 3MU8A 2VIWA 1UHBB 4Y11E 3ZV8A 3NRLA 2BM2A 1MBMA 3B23B 2OD3B 3UOPA 5E8EH 4WH8A 4NWLA 1SBWA 1K1IA 1KTSB 1NZQH 1DOJA 1Q31A 2A7JA 1AHTH 1ANBA 1H4WA 4CR5A 2CJIA 1HNEE 3MWIU 2VIQA 4X6NA 1LVYA 1P57B 1T8OA 1C2GA 2GZ7A 2NU3E 3UB0A 3GDUA 4P02A 1DPOA 1HB0B 2VH0A 2OC7A 2OLGA 4I86A 1JIRA 2BDBA 1T8MA 2F83A 2KCYA 2BXUH 1MTNC 3K2UA 3SO3A 2VVUA 1U6QA 3FZDA 4FUFA 3KQEA 2CGAA 1C2FA 2BDCA 2Z9KA 4BOHA 1AWFH 2AGIX 1PQAA 2BLVA 2BOKA 2CHAB 1MZDA 1FN6A 4O03A 3UY9A 3H7TA 1GBEA 3MYWA 4ABAA 2SFAA 1DX5M 1VCWA 1LTOA 1O2SA 1C1WH 1F0TA 1TRMA 4Q2KA 1O3HA 4D7FA 3BN9A 1TPPA 1GBFA 3ATKA 3L6PA 2OINA 3CP7A 3RP2A 3RXMA 2ZDAH 4ASHA 3ESTA 1A46H 3GOVB 3SU5A 3WWFA 2ZDVH 3D65E 1OP8A 3VG8A 1K1NA 1Y3XA 3UQVA 3IWMA 4HFPB 1BZXE 3RC6A 1TLDA 1WYKA 3RXHA 1EFRD 2IPQX 3TU7H 1NBME 5C1YA 1SGRE 3OEHD 4A1XA 5TJXA 1Q2WA 1O32A 1PQ8A 1UCYE 1O3OA 4WF8A 1L1GA 1SLVB 2ZTXA 1YPKH 2Q6FA 3E16B 2QIQA 1EP6A 3LKWA 3TH2H 1DWCH 1CHOF 4CH8B 4JMYA 2Z6BD 1FY4A 2XYAA 3PV4A 7ESTE 4TWWA 1TQ0B 2FX6A 1OYQA 1XVOA 1TOMH 2AERH 4LXBH 3TJOA 5DG6A 2K8IA 3OYPA 4HG6A 1OHHD 3RMNH 1FN8A 1ESBA 2ZECA 4RKJB 2BOHB 2QXGA 5CE1A 5FCKA 1JRSA 1YPLH 2XWBI 1MH0A 4I7YH 2J98A 2Y6TA 2CF9H 2JH5D 3SV7A 1FNIA 3ZVAA 1YWUA 1O5AB 2BZAA 3M5MA 4ZKOU 2B5TB 4I8GA 4U32A 1GVKB 1MKXK 2HNTF 3OE7D 2PTCE 3BG8A 5AVDA 5DP6A 2KCPA 5A0AE 1V2TT 1W7XH 2H2ZA 2JKHA 2FWWA 1PJPA 1QURH 1SQAA 2HNTE 4UFDH 1OKXA 4Q7ZA 2EEKA 3HGPA 3MNXA 4ZAEA 1C9PA 3UIRA 5KEDA 1SL3A 2P3FH 3AVZA 4OS7A 5FXLA 3FZZA 1A0HB 1ZTKA 2Y5FA 4RKOB 3SHAH 2AEIH 2GGVB 1SKYE 1SFIA 2ZZUH 3QGNB 4IW4E 5F03A 1ESTA 1Z1IA 1JOUB 1C1UH 1C2MA 3RU4T 2F9BH 1WCZA 1QY6A 1YPHE 1SOZA 9LPRA 1MTUA 1BTXA 1GBBA 1O33A 3MU0A 1LHFH 8ESTE 3E0NB 4Y7AA 3HATH 4JZIA 3ZVBA 3S7HB 4GLYA 4CHAB 1FXYA 3ZVFA 2ZFRH 5DK1A 1LPKB 1P04A 1SGIB 2L74A 4AFZA 1GMHG 5ABWA 1Y3WA 3MO6A 1EAWA 2A1DB 4E05H 2ANWA 3B9FH 1GBIA 1WU1A 1IQLA 4CRAA 1CT0E 1QL8A 2ZNKH 3P92A 1AD8H 2FS9A 1DUEA 4CBOA 4R0IA 2CK3D 1O2HA 1YPEH 4Q7XA 2OK5A 1P2QA 1EUFA 4LZ4B 2BDYA 5K0HA 2EC9H 4XE4A 4Y0YE 3AW1A 1D3QB 2Z3DA 3RC5A 1UJ1A 1ZMNA 1HV7A 1S82A 1V2ST 4GHQA 4DIIH 1IAUA 3RXCA 2VWMA 1L4DA 1TPSA 1SQRA 1D9IA 2ZKSA 1E37B 1GI2A 4OS1A 1F5KU 4NA9H 2OP9A 3FVFB 3E91A 1LCYA 2BLWA 1ANEA 1O2OA 1COWD 4A92A 1TONA 1W12U 1GJDB 4WVPE 5DP7A 5EJ1A 1GG6B 1GCTC 1VKYA 3U1IB 5F8TA 2A7HA 4YZUA 5TCCA 3GY3A 4MLFB 4U30A 5DJ7A 1SLXB 3RM0H 5EPYA 2H1UA 3P8FA 2VIPA 1SPJA 1TBQH 3NZIA 3E1XB 1VJAU 1J14A 1V2NT 2V35A 3ZZBA 4AZ2B 2ALPA 1LPZB 2G4UA 1J17T 2BZ6H 4X8TH 1XVMA 2WPDD 2JJ2D 2KCOA 1SVPA 5FCRA 1MTVA 1TNIA 5EQRA 5A0BA 1MTWA 1UVTH 1FAXA 1SGCA 1T32A 2WUBA 2P8OB 1B5GH 3GCNA 2KX4A 2VGCB 1GJ5H 3DSGA 5JBAS 3LC5A 1D3DB 1LQEA 2V3HH 1E0FD 4ZHAA 3A7XA 2OC0A 1ABIH 2UUKB 2R0LA 3UNRA 1E35B 4JZDH 1DICA 2WPMS 4OM9A 6CHAB 4NIVA 2F9OA 2FOMB 1HXFH 4TPYA 1N8OC 4Z1MD 2AMPA 2WPLS 4BXSA 2ZDLA 4RSPA 4ZH8A 2BD8A 1O31A 1ETSH 2B8OH 2BD4A 3S9CA 5DN6D 4UFFH 1V2RT 3GY2A 1ZPBA 3Q3XA 3A8DA 4FOUC 2A2QH 5DKMA 1DXWA 3MTYA 2J4IA 1DUAA 1EZSC 4WXVA 1EAXA 3SGQE 1AVWA 3ZZ3A 2LPRA 2J92A 4JK5A 4YTAA 3PV5A 1MZAA 1GHAF 4H6TA 5EOKA 5L6NH 1LHEH 1KYNA 1O2NA 1GBKA 1SFQB 5HKKD 4F55A 3LH1A 2VB0A 3A81A 1OX1A 3E8LA 3RXPA 4YLQH 2OC8A 2QF4A 3GCHB 2AFQB 1AZZA 1KXAA 1P02A 1JIMA 3UAIC 1VJ9U 1CGIE 1P2KA 1OYTH 3PYHA 3LC3A 1H8ED 2ZGCA 3S9AA 5FX5A 3GISB 3PWCA 1OWIA 5DP3A 2B7DH 1P3CA 3H7OA 1DANH 5HGGA 1TX6A 5L2ZH 3KNXA 1GHVH 2QF0A 3R3GB 2ILNA 4X6MA 2TGPZ 3FN8A 1HAXB 4KELA 5EQSA 2YMSD 4ISHH 4X1QU 1O3BA 2D2DA 1TGTA 2FMJA 2QXHA 1J8AA 1O5EH 1YPGH 1F7ZA 3RXUA 4B2BA 1AUJA 1QJ7B 2OBQA 1SGNE 1SGFG 3SORA 3LGVA 1FI8A 1BRUP 4FUDA 2GV6A 3GY8A 2FI5E 1IQKA 1AB9C 5JPMH 3DCLA 1K28D 1CA0B 4Y76A 1K21H 3SU0A 3M7QA 1O5BB 1O2QA 1UTLM 2FOFA 5DP4A 2C4FH 5EXMA 3KQDA 1EPTC 2GP9B 3SQHE 1DY8A 1GVZA 1GBAA 1ELAA 3P8OA 4GCHF 1QTFA 4FXGH 2TRMA 4CRDA 5LPEA 1TGBA 3SJOA 1GVLA 2OBOA 1Y3VA 2SGEE 4DVAU 2VINA 1PQ5A 1YM0A 1QA7A 2A31A 2PSXA 2H5DA 1C5ZB 1EZXC 4MQAA 5DP5A 2HGTH 2WPKS 1BBRK 4YO9A 1ZOMA 2PKAA 3VB4A 2QY0B 1J16A 1KLJH 3SI3H 1GI0A 2ZHWH 1EZUC 1TPOA 1XKAC 2FDAA 3E90B 1A0LA 3A88A 3H5CB 3KCGH 1E1QD 2ZFPH 1NU7B 3F9GA 1ETTH 4BXWA 1W8BH 1P9SA 3E3TA 2WYJA 1CU1A 4YLUA 1ACBE 1UMAH 1KXBA 2TBSA 1O3AA 1G3CA 1OSSA 4OGXA 3V0XA 5F8XA 1IQMA 1J9CH 3O8BA 3F9EA 1O3GA 1XM1A 4NSYA 2I6SA 3NCLA 5A8XA 4FUGA 2WHXA 1GHYH 5C3NA 1P03A 2TGAA 2ZQ2A 2SGQE 4UE7H 1DVAH 2R3YA 3EE7A 2GCTC 1CHOG 1P2JA 2TPIZ 1E79D 3MNBA 1FV9A 1KDQA 5G4BA 4K8YA 1MKWK 2EA3A 1ELGA 1V2JT 2QN5T 1CBWC 1GJBB 3OY5U 4ISLA 1W10U 5I25A 5J4SA 3ZVCA 1NRQH 4IS5A 2A4GA 3S7KB 1BRAA 1L1JA 1IQEA 1SB1H 5DPAA 1SSXA 2FO9A 4I32A 5CDFE 4IMQA 1EASA 1QNJA 1NESE 5A2MH 2M5TA 4X0WU 1K22H 1GBTA 4TY7A 4A6LA 3SNBA 4FU7A 3WW7A 5C67A 1FONA 3IG6B 3VXFH 1IQNA 1WDIA 1XUKA 3VB5A 1GJ4H 1TMUH 1O2TA 1JMOH 1A5HA 4JCNA 1EOJA 1OPHB 1GCTB 4AYYB 4KGAA 4H6SB 3JZ1B 2Z3CA 1N6XA 1S83A 1L1NA 2G52A 1LVMA 2ZCHP 3ATLA 1F5LA 1KY9A 1XXFA 2F9VA 1X7AC 2JIZD 3TLOA 2BMGB 3DT0H 1TBZH 4YT7H 2JDID 3U1JB 1AIXH 1NPMA 5ESBA 2Z94A 4FUCA 4XRNA 3W94A 5LPFA 1SGQE 1V2OT 4XBDA 4ZXYH 2WV4A 3F9FA 3QZQA 1S6FA 1XKBC 3PLPA 2KM0A 3N7OA 1SHYA 1MCVA 3PMJA 5IYTA 1ZSKA 3ATWA 1HRTH 1G30B 3P8GA 1C5WB 3S69A 3UPEA 1THSH 2GKVE 2J94A 3GY7A 2A4RA 4YM9A 1TFXA 2NU1E 5E0HA 2RCEA 2F9UA 2ODQA 1BJUA 1AY6H 1BQYA 2BVSH 4ABDA 3TITA 1QRWA 4FUBA 4F49A 2DE8A 1HGTH 4XDEA 3PMHB 2KCAA 1QBOA 4FUEA 1TBRH 3RXFA 1BJVA 2BHGA 2BQ6B 2C8XB 2Y80A 1YCPH 2FP7B 2O9QA 3P95A 2NU2E 1HBTH 1QGFA 2KZ4A 3D62A 1AE8H 1PPGE 1AFQC 5EJLA 3QLPH 2RDLA 2ZU1A 2QAAA 1TGSZ 1RRKA 1BMNH 1HAIH 3AK5A 1BUIA 1OWHA 4DT4A 5K7RA 3A85A 3MH5A 3A86A 1AWHB 1HAOH 2JETC 1BMFD 1ZJDA 5E0JA 5GIBA 3DSOA 1IQIA 1NFUA 2A32A 2AMDA 1UCYH 1HCGA 3RMLH 1Z71A 1ZZZA 1DSUA 2V3MA 2R2WU 3EA9A 4BAOB 1W2KH 1VITH 4INKA 4CHAC 4AOQA 3M7UA 1IHSH 2ZDNA 3L33A 3MH4A 4E7RG 1P06A 3CENA 3KQBA 2CV3A 4MNYA 1EJAA 1C5VA 1LO6A 4WMDA 1MU8B 1P05A 4D9QA 1C5UA 5T1VA 5AFZH 3URDA 1EOLA 3P70B 4FUHA 3AAUA 1KMHB 2GX4A 3LIWA 1GJ8B 1D3PB 5A8YA 1A3EH 4JZEH 4YOGA 1MCTA 1OWKA 2ANKH 3RXOA 3F1SB 4FETA 2PUQH 7GCHF 2GDDA 5KGOA 2BDHA 1FDPA 2FTMA 3RXQA 2ODPA 4LZ1H 5A09A 2BDIA 3RU4D 1QB6A 4DJZB 4ZMAH 3BIVH 1G32B 2O8TA 4CRBA 1BBRH 1SLUB 1FUJA 1D4PB 1V2QT 3MH7A 3EE0B 3VGCB 2BYAX 3A7WA 1AVXA 5GCHG 1DM4B 4CRCA 1LMWB 1EAUA 3QDZB 5ETXA 3SJ8A 3GICB 4RT0A 2BY6X 3K6YA 2Y81A 1GI1A 1KSNA 2VVVA 1DLKB 3QN7A 5JBTA 3T25A 2PSYA 3LGIA 3SNCA 2WUCA 1OP2A 2QC2A 2VWNA 1NFYA 2NWNA 3A82A 5EG4A 3VGCC 1E38B 1TGNA 3U28C 1C2KA 1K1JA 7KMEH 1VZQH 3FKSD 1C4V2 2A2XH 5LGOA 4Y8ZA 2UUFB 1EX3A 1F2SE 1G36A 1OWEA 1SGYE 1AB9B 2BD9A 3BEUA 2VIVA 5A0CA 3PMBB 1DFPA 1P2NA 1GDQA 3SU6A 1T31A 1ARCA 4MPUA 4YESB 4J2YB 4WMEA 3SJKA 1DT2A 3SUGA 4HI3A 1O3NA 3PM3A 1S81A 4TY6A 4K8BA 1GL0E 1YLCA 4IBLH 1RTLA 1PPHE 2R0KA 3MHWU 3I29A 2LNCA 4VGCB 4NSVA 2BVRH 2KR7A 2EI7A 3I77A 1O3MA 3SQEE 2IOTA 3M36A 1GGDC 1QQUA 1B7XB 1WTHD 3GDVA 1THPB 2Y5GA 5EODA 2JETB 1EXFA 1HFDA 1AN1E 2BD5A 2XCFA 4FU9A 1ELVA 1ZTJA 2BXTH 1QL9A 2ZPRA 4JK6A 1EJNA 4GVUA 3KYGA 1HJAC 4WWYA 3WY8A 1BIOA 3HK3B 1DE7H 1Y5BT 1A5GH 1E1RD 5B6LA 4H42U 3V7TA 3E6PH 1BA8B 2P8OC 2A5IA 3SV6A 4XBBA 3TPIZ 5C94A 1QCPA 1BBRE 3SJ9A 2W6JD 2RFKC
chains in the Genus database with same CATH topology
1O5FH 5SGAE 3Q76A 5E0GA 2D8WA 2YNAA 3IITA 5H4IB 1C5RA 3LU9B 2GCHF 1GBCA 1FAKH 3A89A 2KAIB 3M5OA 2HPPH 3C27B 3QX5H 1NRNH 1HPGA 2CXVA 3LH3A 2FM2A 1CA8B 3F68H 1K1PA 2GMTC 2BY8X 1AKSA 4XBCA 3UNSA 1UO6A 4K69A 3SV9A 1BHXB 1O3JA 3PB1E 1EATA 2ZDMA 1CVWH 1WV7H 1ZGIA 5GCHF 1EB1H 1FY3A 2ZGBH 1BDAA 5JB8S 1CO7E 1OP0A 1O2ZA 5FBEA 1ZPCA 3NPSA 3MO3A 4K60A 1LPGB 5IDKA 1C5QA 1YCPM 1PYTC 4X6PA 2AGGX 7LPRA 2PGBB 4IN1A 5FPTA 2GMTB 1VR1H 1YBWA 4UONA 3BTTE 3T62A 3MU5A 1O30A 1SR5C 1TWXB 2ZEBA 2UWOA 3M7TA 4OS6A 3SU1A 1QR3E 2BTCE 1VGCC 2TGTA 3A84A 1P01A 2O8UA 5HXFA 4ZKRU 1KXCA 1TX7A 1XXDA 2STAE 1NTPA 3PLBA 1P09A 1SGFA 1DWBH 2QGRA 1WTGH 3ATMA 1TIOA 4JZ1A 4OS5A 1HDTH 3LDXH 1GI3A 2G00A 2QCYA 2GZ8A 1BHXF 1O0DH 5JBBS 1UCYK 1E36B 1RTFB 2F3CE 3GCTG 3SI4H 5C1UA 1G2MA 1PYTD 1ANCA 2F9NA 5HM2A 3LGWA 5CHAB 3LT3A 2HWLB 2THFB 2Y82A 4BTTB 3U98H 1A4WH 1LKBA 1D6RA 3DUXH 1GHXH 4MG3A 1TNJA 1V2MT 3PWBA 5C2ZA 1K9OE 2O8WA 2AS9A 3DHKH 4M7GA 3S0NA 3TGIE 2ZG0H 4XFQA 5A8ZA 1HYLA 1QBVH 2EI6A 3TNTA 2OTVA 5E2PA 6ESTA 1S5SA 3RXIA 4Y79A 3SUEA 2W26A 4HTCH 3ODFA 1AFEH 1EPTA 1YPHC 1O2XA 3GYLB 4X8VH 1C1PA 1O3DA 3MNCA 1C1MA 1RIWB 2C8YB 1TA6A 1YPJH 2FIRH 2FODA 4X6OA 5EPNA 2Z9LA 1QIXB 2RA0A 3SUDA 1UTQA 1CT2E 1GGDB 4J1YA 1C1SA 4B74A 3SV2H 1C9TA 1QL7A 1TNLA 1BRCE 3LOXA 1O2MA 2Z9IA 1NFWA 4E06H 3M5NA 3TVJB 1NT1A 3PMAB 4UFGH 1O2PA 1ZTLA 2AGEX 2B9LA 2VVCA 1J15A 2J38A 1V2VT 1Y8TA 3QGJA 1OS8A 1HIAB 1K2I1 1GPZA 2QYIA 1P11E 1L2EA 2F9PA 3DA9B 3U69H 1ELTA 1O39A 1A3BH 1O2JA 2QXIA 3KQCA 1K1MA 3STIA 3OSYA 1O2IA 3BTFE 3GY6A 1EAIA 1H9LB 1Y5UT 1SI5H 1ZMLA 2ZIQH 1SQTA 3L3TA 2VH6A 4DY7B 3CS7A 1C5OH 2J34A 2ZDKA 4I31A 1GJ7B 1EP5A 1MAXA 2XC5A 1FLEE 1MD7A 4I8KA 5HM9A 3E0PB 2G81E 4RN6A 1KLTA 3S9BA 2OQ5A 4B1TA 1GBDA 1GHZA 3SGAE 1DS2E 5EQQA 2VIOA 2BVXH 1Y3YA 3RLWH 1GI6A 2WV5A 4DGJA 4B76A 1T8NA 3TH4H 5EW2H 5AFYH 4AB8A 1JXPA 5LH8A 2XC0A 1UTJA 3KN2A 1ELBA 4IMZA 2B0FA 3UR6A 2H6MA 2QA9E 4LK4A 3VB3A 1HAYB 4BAKB 1XUIA 1IHTH 1TGCA 4TYDA 1Z8IB 3RXEA 1DDJA 4Q7YA 1EJMA 2FXRA 2ZFQH 1MBQA 1HLTH 4A5TS 2AIPA 1O3IA 1H8IH 2G4TA 1NRSH 2DE9A 1UVOA 4O9VA 1H9HE 2ZPQA 1LVBA 6GCHG 1TAWA 2XCNA 2BD2A 1O2RA 3SOSA 1ELEE 1GWAA 3RMOH 3RM2H 2A4OA 2ZCLP 9ESTA 4I8LA 4U2WA 1YYY1 1BTYA 4OS2A 3SU4A 2R9PA 1N8OB 2GT8A 4K1EA 2GT7A 1O37A 2SGFE 4IN2A 3AAVA 1B0FA 1DITH 2SGDE 3SNAA 1ZPZA 1ELCA 4BANB 3ATIA 4CREA 1RGQA 1T7CA 1C1QA 2ZCKP 1SOTA 4H4FA 1QB1A 3NKKA 1ETRH 1A5IA 1GMHF 1FJSA 2P94A 3EAJA 3K65B 3SNDA 1S0QA 4ZXXH 1Z8GA 3V12A 2ZWLH 2OCVB 4AX9H 4ZROA 1ARBA 1TALA 3SU2A 3NWUA 4BAQB 1AFQB 1N1LA 1BITA 2Q6GA 1AQ7A 3ZVDA 1GHBG 1G3BA 3SU3A 1C2EA 3GCOA 1FQ3A 1KTTB 2BB4A 2BLQA 3QTOH 1SMFE 2V6NA 3SBKA 3UFAA 2C90B 3RXTA 2VGCC 5BPEA 2CN0H 2AMQA 5JDUB 3VFEA 1TYNA 2ZHDA 5FPSA 3NXPA 5JBCS 2IJOB 5FX6A 2XBWA 4DG4A 3M3VA 4AG1A 2C8WB 1GI8B 1WBGB 1G9IE 4X1PU 1UVUH 2FZZA 1RIWC 3Q3KA 3A8AA 4ABHA 5I46H 3LJJA 3ZVEA 1GJAB 3U8RH 4F4OC 1V2UT 1DY9A 1CE5A 4ZHLU 1CQQA 1PFXC 1ZR0A 4X2VA 3T29A 5AF9H 4SGAE 1GHAG 2YNBA 2W3KA 3SHCH 5DP9A 2FOGA 2G51A 1OOKB 4FUJA 1YLDA 1V2WT 3RXBA 1F0UA 2FLRH 1YGCH 4MNVA 3DFLA 2YOLA 2PGQB 2ZA5A 3O8CA 1SLWB 1BTWA 1CT4E 2HLCA 4TWYA 4FVBA 4A1VA 3UTUH 2BX4A 3RXDA 2ZO3H 1L4ZA 2XC4A 1CHGA 1C5XB 2XRCA 4MNXA 1ID5H 4CH2B 1PQ7A 1FY8E 1SGPE 1ZLRA 3CS0A 1GMDF 1UTPA 2W7SA 2Z7FE 3MMGA 1W0YH 1IQHA 1TQ7B 4AB9A 1A61H 2Q6DA 3TJUA 4ABGA 1NU9A 1KDQB 2I6QA 2IPHA 3HGNA 1UVSH 1W0ZU 3OU0A 4CR9A 3KF2A 2O8LA 4AYVB 1YP9A 3O8RA 2ALVA 1O2KA 4DW2U 2W3IA 3SNEA 2GCHG 1W7GH 4XSKU 1C5LH 4WMFA 1HIAA 3R0FA 1P2MA 1OWDA 2ZI2H 5T3HA 1PPEE 4THNH 1BT7A 1ZHRA 1XX9A 2A7CA 5DP8A 1BTUA 1TB6H 5EXNA 5BRRE 1WOFA 2ZTYA 1C1RA 5FAHA 1D3TB 3OX7U 1TE0A 1VITG 4IGDA 3QTVH 1Y5AT 1C5TA 5TCAA 3ZZ6A 2FOBA 1SGEE 1UK2A 3C1KA 1O2YA 4INHA 4KTSA 3HKIB 1UTOA 2AIQA 4K1TA 3MH6A 3T27A 1Q3XA 2Z9JA 3U9AH 3UOUA 3T28A 3M3SA 1ABJH 3TK5A 2O8MA 1RTKA 4B73A 2H9EH 1BOQA 2ANMH 4MPXA 3FP7E 4GPGA 3NUMA 1GBHA 1W11U 2FYRA 3KGPA 3A8CA 3BG4C 4GSOA 3RU4E 2ZGXH 1OWJA 3GCTF 4MTBA 2ZFTA 1F92A 1NRRH 3KIDU 1Z6EA 1OXGA 4NA7A 4XOJA 5AHGH 3AW0A 1QQ4A 2WINI 1HJ8A 5LPRA 3FAOA 3GY4A 1GCDA 1YC0A 1GHWH 1RJXB 1TRYA 5T6DA 2FOHA 1K1OA 2NU0E 2R2MB 4BAHB 6LPRA 1IOEA 3BTWE 2BQ7B 1MTSA 3EGKH 1FPHH 1MTNB 1K1LA 1ZRKA 4ZUHA 3UR9A 1AI8H 3ZZCA 2QV1A 5HMAA 4OGYA 2PFEA 3V3MA 4CBNA 2H9HA 1UK4A 1C5YB 2J2UA 4ABEA 4UDWH 4NIWA 5EXLA 1AMHA 1ZJKA 4K5ZA 5DGJA 3V13A 1HAPH 4AGJA 3LONA 4ZKSU 4X2YA 3U8OH 3A83A 1O34A 4JYTA 2XNIA 1KXEA 1Z7KA 1V6DA 2ESTE 4WXIA 3KHVA 4NZLA 2ZPSA 1PPBH 4JYUH 4NCYA 2XBYA 2KAIA 1AU8A 1O35A 5C20A 1JWTA 1O3CA 1O3KA 4BAMB 1YPMH 1HJ9A 1QA0A 2OXSA 3BTKE 5EU8A 3ZZDA 1IQGA 3TK6A 1UTNA 3Q3YA 1VGCB 3P6ZB 3RXKA 1TOCB 2Z3EA 1LHCH 1ZGVA 3RXRA 1NFXA 1DXPA 1BB0B 2A0QB 1MMJN 3K6ZA 5GDSH 3RXLA 2XBVA 1H9IE 8GCHG 4YOIA 4LOYH 1S0RA 1P9UA 1C4Y2 3VEQB 1O2VA 3MO9A 4I8HA 1DWDH 4D7GA 1C2IA 4U01A 4Z0KA 1RXPA 6CHAC 1HUTH 1O3LA 1YKTA 1G3EA 1H1BA 2BQWB 1Y59T 3UWIA 1UVPA 1M9UA 5B6OA 3MOCA 1C1TA 2BDAA 4Q80A 4Y7BA 1DSTA 4YOJA 1WAYB 2F91A 3ENSB 3PO1B 1RD3B 2V0BA 2QXJA 4NGAH 1MU6B 3KL6A 1MD8A 3RXVA 4HZHA 1EQ9A 4QT8C 3STJA 1BCUH 8LPRA 3KEEA 1W3CA 4A7IB 4DT7B 3SV8A 3UUZA 1SGDE 4GHTA 1TNHA 2ZU2A 4D8NA 2SNWA 3I78A 1MAYA 1GL1A 1O2UA 3BEFB 1O38A 7GCHG 3MNSA 1C1OA 2G55A 2VWLA 3FANA 4AFUA 1C4U2 1H8DH 1RS0A 4UFEH 1P8VC 5F8ZA 3EA7A 4GAWA 3RMMH 4FUIA 4MNWA 2ZU4A 2UWLA 1O5CB 2ZF0H 2TIOA 2P3TB 2VU8E 1PPZA 3F6UH 4UD9H 1BTZA 1G3DA 2JH6D 2GZ9A 4ISNA 4BTIB 1ESAA 1THRH 3BTDE 3RDZA 1TPAE 4AN7A 1GBMA 4MDSA 4B71A 1ZYOA 3M3TA 1AUTC 2GCTB 3HPTB 1EB2A 1L0ZA 3RXSA 4AFQA 4NWKA 3A80A 4NFFA 3TJNA 3AASA 2FLBH 2XBXA 1QJ6B 3BTHE 4X2XA 2PKSC 3BTGE 2UUYA 3BEIB 2DUCA 1UK3A 2SGPE 4GUXA 5JB9S 1O2GH 2ULLA 1WQVH 2ZGJA 1O2WA 3Q77A 3LGUA 4CRFA 3A7VA 4OS4A 4NZQA 3OTJE 4D9RA 4I33A 2JH0D 1LHDH 2ZHQH 2FPZA 3K9XB 3SW2B 2AH4X 1F0SA 3TGKE 3F9HA 4X1RU 2P59A 1EKBB 1VCQA 1NO9H 1GJ6A 1A0JA 1S84A 2ZHEH 4Y10E 2ZHFH 2XW9A 3BF6H 1ZMJA 3M61U 2WYGA 1YCPK 1ZSLA 3RC4A 1O5DH 2IN2A 3EQ0H 3T26A 2P3UB 2Y5HA 3BIUH 4KTCA 2P16A 2WPJS 2FX4A 1Z6JH 1Z1JA 1GI9B 2RG3A 2FS8A 4BTUB 1GDNA 3SGBE 4D76A 1ELFA 1O36A 4TPIZ 4B2CA 1GMDG 1C5NH 1AKSB 3EDXB 1YF4A 2FEQH 1T8LA 2GVFA 2VIDA 3A7TA 4Z6AH 4O3UA 5EW1H 2A5AA 1ZHMA 2J95A 1KIGH 4ABBA 2FYQA 3LPRA 1A1RA 1TNGA 1GHBF 3FP6E 4B2AA 2GTBA 1HAGE 1HAZB 1ZRBA 4ISOA 4X1NU 4K2YA 1P2IA 2Z9GA 1AVGH 1TMTH 2VJ1A 4ZKNU 4AG2A 1HAVA 3UREA 5C5NA 3D23A 2K1QA 4K1SA 2A45B 3JZ2B 1A7SA 4AGKA 4KTUA 2ZFFH 5FPYA 3DFJA 3QO6A 1T4UH 3EA8A 1ZHPA 4SGBE 1CSOE 1GBLA 1JBUH 1O5GH 1MQ5A 1BMLA 1S6HA 1DLEA 4BNRA 3SZNA 1HJAB 2FI3E 3ZV9A 2STBE 3VB6A 3OY6U 1FY1A 4Y6DA 5DO4H 5GXPA 2VNTA 1D6WA 1GJCB 1F5RA 3PLKA 4B75A 5T6FA 3QK1A 2H9TH 1XUHA 1NRPH 3MI4A 3PTNA 1V2PT 3ZZ5A 5CMXH 3URCA 1EZQA 1ELDE 3ELAH 1TABE 3MFJA 4NIYA 2WPHS 1UHBA 2FI4E 2ZGHA 4O97A 4DIHH 1ORFA 3LGTA 1C2DA 4KKDA 6GCHF 1FZZA 4HGCA 2BY9X 2ZP0H 2PW8H 1CBWB 1P2OA 3TK9A 3O8DA 3Q00A 3GDSA 5FHTA 3G01A 4AFSA 2WPIS 1MQ6A 1T4VH 3GYMA 2A4QA 4MPVA 3ZZ9A 1HAHH 1TNKA 1O3PB 5T6GA 2ZQ1A 1SGTA 1BTPA 3RXGA 1UTKA 3ZYDA 2P95A 1GDUA 2G8TA 2HALA 3BG4B 1NN6A 2PUXB 2V3OH 3B8JA 3PROA 1SC8U 1W14U 3ZYEA 4VGCC 3A7YA 3TH3H 3RXAA 1FIZA 3ODDA 4DOQA 1B0EA 1FPCH 2ANYA 1Z8JB 1QHRB 2HOBA 2CF8H 5C5OA 1EPTB 1Y3UA 1LDTT 2TGDA 1AE5A 1G2LA 1JRTA 4UEHH 4Y8YA 2G5NA 1BMAA 1CA0C 5EGMA 4NFEA 4CRGA 4DURA 1GJ9B 2NU4E 2XTTB 4INLA 1V2KT 1GI7B 1P3EA 1XUFA 2BLOA 1E34B 2AYWA 2R3UA 4PROA 1MKWH 1V2LT 3FP8E 3TIUA 1KLIH 1NC6A 2G5VA 2XXLA 3VXEH 3BTME 4ABJA 3M37A 3MU1A 4E7NA 4ZHMU 1FIWA 3BSQA 4X8SH 4A1TA 2H5CA 2PV9B 2RA3A 1UTMA 1PPFE 4WJG2 1G37A 2C8ZB 2HRVA 3M35A 2ODYB 1TRNA 2OUAA 1QB9A 1P12E 2QF3A 3GCHC 3M5LA 1WSSH 4Y71A 4O3TA 1XMNB 1P10A 4IC6A 1CGJE 1N6YA 1KXDA 5E2OA 5GPIB 2SGAA 3ITIA 1WUNH 1C1VH 4MPWA 4ABIA 3PTBA 2J9NA 1FY5A 2BD7A 3VB7A 3DD2H 1LHGH 2PKAB 3TJVA 1LKAA 2UUJB 2ZU3A 1VITF 2C93B 2A5KA 2FESH 5F6MA 3ZZ7A 5PTPA 2BY5X 2FTLE 3HKJB 2PKSB 1BMMH 2Q1JA 1QRZA 3D49H 3U8TH 8KME2 1NROH 1XUGA 4GCHG 5JYIA 3TGJE 1GBJA 3RXJA 3ZVGA 1C5MD 1S85A 2D1JA 5GJ4B 1SG8B 3A7ZA 2UWPA 1SQOA 2Y7ZA 1QRXA