1O3NA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA02
4K1EA 2ANKH 5ESBA 1PQ7A 1C4Y2 1YF4A 1BTPA 1S6HA 1J14A 1BA8B 1GI0A 1TE0A 3KHVA 1QL8A 1C9TA 3VPKA 3SNBA 3P8FA 4BXWA 1O34A 4H6SB 4CREA 1XUKA 4WXIA 3LU9B 2H9HA 2RA3A 3E6PH 3P8NA 1SQOA 3A88A 1LDTT 4I8LA 1THPB 3MH5A 4H42U 2RG3A 1C5QA 1TGCA 3QZRA 1VITF 3NCLA 1QIXB 1ETSH 1CGHA 1QJ7B 4Y8XA 2PTCE 2IJOB 5FPSA 4GAWA 3A84A 1C1RA 3ITIA 1A61H 2ASUB 4WH8A 3PLKA 1VCWA 1O3NA 5J4SA 1GMCF 1SGNE 4I7YH 1GG6C 3GY6A 1Y3UA 4BNRA 2GDEH 1O3JA 5TJXA 2ZPRA 1CBWC 4YTAA 4H4FA 1ELDE 1XKAC 2BZ6H 1LQDB 4IN1A 5DP9A 2R2WU 3EA7A 2BB4A 1NY22 5DP6A 2ZTZA 1UCYE 5K0HA 3Q3XA 1SBWA 2I6SA 1LHCH 2WYGA 1N8OC 1MKWK 4DGJA 4U32A 1UVSH 1GHBF 3GY2A 5DP8A 3A7TA 4BAKB 2ZECA 1IQNA 1O32A 4Q7XA 3TGKE 4CBNA 4DURA 2J92A 2ZGBH 2V0BA 1NU7B 1RD3B 2VH0A 5A8ZA 5HYOA 3S9BA 4XBCA 3A8AA 5CE1A 1OPHB 1V2JT 2BDBA 4MNVA 1TABE 2ZC9H 2W26A 2CV3A 1XM1A 3ATMA 4NWLA 1T4UH 1NFWA 1KXCA 3SJ9A 4RKJB 4X2YA 5F6MA 1F0TA 3P17H 1CVWH 2VIQA 1BT7A 3TH2H 1PPBH 1K1LA 2A4GA 4IBLH 5E2OA 4XOJA 5JDUB 4AX9H 1G2MA 2AIQA 1T32A 2VIWA 2BDYA 1P2JA 3GDSA 3Q77A 3RMNH 2GKVE 4TYDA 1DWEH 1BMLA 2P8OC 2XBXA 1XX9A 3MHWU 5T6DA 1LVBA 1AD8H 1GBEA 1O3DA 3A87A 2UUYA 1FN6A 1ZJDA 1RXPA 3IITA 1YCPM 4ZXYH 1EJMA 4CR5A 4KTCA 2ZFTA 3A89A 1EQ9A 1U6QA 1AUJA 1TLDA 1AI8H 2FTLE 2YOLA 4FU7A 3TH4H 1C5PA 1QR3E 2GD4B 4X2WA 4M7GA 1GMDF 2ZFPH 1O3BA 1BRUP 5T6GA 1WTHD 2ZDAH 1B0EA 2O8LA 1GJAB 1LHDH 1DX5M 1AN1E 1TX8A 3H5CB 4IC5A 3U8TH 1XKBC 1TMTH 1LMWB 2A7HA 2PFEA 1D4PB 2UUJB 3A8CA 3BTGE 3RUOA 3ZVAA 3MH4A 1L1NA 1VGCC 3K9XB 1C2LA 4GVUA 1EJNA 1AVWA 1P3CA 2ALVA 2OC8A 2H5DA 1FIZA 2VJ1A 4NIXA 4AYYB 1S81A 3NKKA 4GHQA 2PWXA 1GJDB 2ZEBA 1NESE 1L1GA 1YLCA 1NZQH 3RMLH 3VB7A 2OINA 1DSUA 1IQHA 1O3GA 4UFDH 1DE7H 1MTNC 4FU9A 4F4OC 5EQRA 3UQVA 2BD9A 5AVDA 1OOKB 1ZRKA 3M5OA 1BMMH 1EP6A 1WUNH 3D49H 1DS2E 3I29A 2F9UA 1O2IA 4MPXA 4FUEA 1ZTLA 3QX5H 5DP3A 3AW1A 3BTHE 1SLXB 4WF8A 3BTDE 1D3QB 2WV5A 3VB3A 5GXPA 4ASHA 1AWHB 2VIDA 4ESTE 2OBQA 1QJ6B 1E35B 2QXGA 1PYTC 3LDXH 3RXPA 3SV9A 1QBVH 1G2LA 4OS1A 4BTTB 4D9QA 1T8NA 5BPEA 1GL0E 4WH6A 3MO3A 4X6OA 4MNYA 1S83A 1P02A 4Z0KA 2ZGJA 1EATA 4I33A 2G8TA 3SU2A 1V6DA 1GMHG 1TQ0B 1GBAA 2XTTB 2HNTE 1TGTA 1G32B 1QA0A 2OLGA 1O39A 2ZU2A 2CN0H 5CHAC 1AB9B 1CHGA 2YNBA 1DFPA 3SUEA 1GBDA 1K1NA 4VGCB 4PROA 3LGIA 3P8OA 2G00A 1TRYA 1ZHMA 1SL3A 3SJKA 2ZFRH 2J94A 1HAHH 5F03A 2VNTA 1F5RA 2QC2A 1K28D 1G3CA 2JH0D 4RKOB 2PUXB 4ISIH 5LH8A 6ESTA 2G4TA 3MWIU 6LPRA 2BLQA 2BVXH 2A32A 1ZLRA 5EXLA 1QNJA 1V2UT 4X8TH 2EI8A 1SQAA 1YCPK 1CT2E 3U98H 1YPHE 1A3BH 3MU0A 4Y7AA 2FLBH 5ESTE 4ZKNU 5JB8S 4ZAEA 1C1WH 2HALA 1ARBA 1ESTA 3SN8A 1C1NA 4DVAU 2JETC 2AFQB 3LH1A 3PMBB 5FBIA 3SHCH 4CHAC 1FPCH 3ZVDA 3F68H 3BTME 4BAOB 3MU4A 3LGWA 1EZXC 1GI5A 1A46H 1T8LA 3SW2B 1O5DH 5IDKA 3RXDA 1P9SA 1QCPA 4OS7A 5HM2A 1TPOA 4SGBE 1O3AA 3RLYH 1O3MA 3SOSA 3RC4A 1AHTH 2H1UA 2OUAA 1N1LA 5C1YA 3TK5A 3ZZAA 3UOUA 2HNTC 5E0HA 1ETRH 1CHOF 4MNWA 5E8EH 4Y8YA 3T29A 1A7SA 2VIOA 2ZTXA 1SLVB 1V2WT 2FO9A 5C5OA 2JKHA 4AB8A 1BITA 1GJ5H 4ABBA 3P95A 2ZFQH 1J9CH 2WPMS 3ODDA 1QBNA 1UTJA 2HPPH 1MBMA 2P95A 1AWFH 2SGQE 1G37A 4HZHA 5GJ4B 4Q7YA 1H9LB 3ZV9A 4ZHMU 1TNKA 1OP0A 4IMZA 1TYNA 2RDLA 2GP9B 3S7HB 1QRWA 1P2IA 1QQ4A 3LGYA 4CBOA 3UWIA 4Q2KA 1O3HA 2C8WB 6CHAB 1W2KH 2V3OH 5EW2H 2BLVA 3RXCA 4AG2A 1S84A 4I8KA 1AFQB 1H8IH 1O2UA 2ZU1A 4WY3A 1NRSH 1SLUB 4NCYA 3U8RH 1D3TB 2C4FH 1TRNA 1CU1A 1K1MA 3T5FH 2BDAA 1K2I1 1FY4A 1QRZA 4K1TA 1FDPA 1SGRE 1ZGIA 3RXTA 3UR6A 4X8SH 1EUFA 5DP4A 4X1SU 3TH3H 1O5AB 8ESTE 1MZDA 1G3BA 2O9QA 2FOFA 1PPCE 2H9TH 1P01A 2G5VA 2GV6A 1UK3A 4X0WU 2XXLA 2Z3DA 1FY5A 1LPKB 4NFEA 1XUHA 5G4BA 2R3YA 4UE7H 1GI8B 4YOJA 1O5BB 1F92A 2VVCA 1UMAH 4B71A 1P2KA 3PWCA 1HDTH 1JOUB 1VGCB 2Z9IA 3OTJE 2H6MA 5HXFA 3TU7H 2BLWA 2A1DB 1HAZB 1SGCA 3VXEH 5DJ7A 1PPFE 2ZWLH 4K2YA 1UJ1A 2ZG0H 2GGVB 1PQ5A 1AO5A 1GHBG 4ZKOU 1C5RA 1GCTC 3GCOA 4HGCA 3T62A 2W5EA 1P04A 4ZHLU 2HLCA 5EQQA 1NC6A 2XCNA 4CRGA 3UQOA 1C1UH 3FAOA 5BRRE 4ABDA 4LZ1H 1YPHC 2Z3CA 3RMMH 2ZDMA 1HJ9A 4LK4A 3E8LA 1OWHA 3GY7A 1CE5A 4I8HA 1NM6A 1FNIA 2B5TB 2ZGXH 1KTTB 4NIVA 2DE8A 1OP8A 2R3UA 1D3PB 4JCNA 4BTUB 1HLTH 1OS8A 1DOJA 2A5KA 3UPEA 1Z6JH 1M9UA 1KXDA 1IOEA 3B8JA 3P6ZB 3GDUA 4DCDA 3K2UA 5A0CA 4IGDA 2VIPA 3VGCB 1WQVH 1MD7A 1ZRBA 2Y7XA 1Y3YA 4CR9A 1ESBA 1HAYB 1DUEA 3RXJA 1FONA 1XXFA 1PQAA 1UTOA 1EAIA 3GY5A 2A5AA 2IN2A 2GMTC 1HAPH 2OQUA 1QHRB 2FMJA 1SGPE 1O5EH 5HMAA 1T7CA 1V2QT 2FLRH 4X1QU 3ZYEA 1MCTA 1GHWH 1J17T 4X8VH 4FUCA 1C5TA 1CO7E 2EC9H 3BTEE 1DVAH 1C2EA 5A8XA 1H4WA 3LJOA 1RFNA 3EAJA 2XBYA 5C3NA 3OX7U 1EP5A 1H1BA 5C5NA 1MCVA 4MG3A 2BOHB 3TGJE 3MFJA 1KLJH 1SPJA 1BIOA 3RXQA 4AORA 2BDHA 2BY6X 3SNAA 4KELA 1YLDA 3SQHE 1BCUH 4I8JA 2ULLA 2BQWB 3A7WA 3SU3A 2SNWA 4ABHA 1BZXE 1GJCB 2D8WA 2UWLA 2QF0A 3A7VA 3MNBA 5DP7A 1S0QA 3D23A 1UVTH 2G55A 1HYLA 3PLBA 4OS6A 1EOJA 1O35A 2FPZA 1OKXA 1HXEH 4IMQA 1YBWA 1CT0E 1O2YA 5DPAA 4YOIA 5GCHF 1RTFB 4ABFA 1GBKA 2NU4E 4ISNA 4DIHH 5GPIB 1J15A 1MTWA 1HAVA 3SV2H 1JRTA 3SV7A 2AMQA 1A2CH 3EA9A 3LGUA 1QQUA 1L4ZA 2BMGB 1SHHB 3SNEA 3TK6A 1EKBB 3TPIZ 1P8VC 1O2QA 1V2RT 3GY4A 1YP9A 1MMJN 1XUGA 1RJXB 2BYAX 1WOFA 2J34A 2BZAA 1E38B 3BV9B 1EOLA 1UCYK 3BTWE 2F91A 1C5WB 2A4QA 4OS4A 1IHSH 2OQ5A 1GHYH 4NGAH 2PKAB 2VWLA 3A80A 1UHBB 2CF8H 4JYTA 4A1VA 3V13A 1ZMNA 3FP7E 1Z6EA 1AE5A 4X2XA 5EODA 1GBFA 1H8DH 4Q80A 5C2ZA 2ODYB 1TBQH 3Q00A 4YT7H 3SUDA 2BY8X 1O3CA 2AMDA 2NU3E 1TNIA 2QXHA 2O8WA 1UTMA 2HVXA 4AZ2B 1GJ7B 1WU1A 2GTBA 3FANA 5C1XA 1XVMA 3H7TA 2FOCA 1NRRH 2PTNA 3P70B 2SGFE 4YZUA 4GUXA 2C3SA 3LH3A 1ZJKA 2FS9A 3D65E 1V2OT 3SJ8A 2Z3EA 4X6PA 4D76A 1JBUH 1IQFA 3M3TA 2VWOA 1EXFA 3M7TA 1ELBA 3RM2H 3F6UH 1AY6H 3TITA 4AG1A 3BG8A 1Z8JB 1IQLA 1GBLA 2ANWA 3CENA 1UVPA 1GVLA 4DIIH 3VXFH 4NWKA 2PSYA 1HUTH 1L0ZA 3VB6A 1NRNH 5E0JA 1S0RA 4O3UA 1P06A 1O3KA 3M36A 3UREA 3RXMA 3ENSB 1DPOA 4DOQA 2BQ6B 5A8YA 8GCHF 1HAXB 1XUIA 1TX6A 2Z9KA 1TOCB 1W12U 3HK6B 1AFQC 2Y5HA 1NTPA 1ABJH 3SORA 1SR5C 2P8OB 3FFGA 2W3IA 3A7XA 2R0KA 2SGDE 1GI2A 1BTZA 1A1RA 3N7OA 1CSOE 4JZDH 3GYLB 5L2ZH 5FX5A 4AB9A 4IS5A 9ESTA 3S7KB 1B0FA 3BTFE 3QO6A 2Q6GA 3U1JB 1BJUA 1SLWB 4A1TA 3SGQE 4K5ZA 1QURH 1UCYH 1IAUA 4THNH 5E0GA 2C8YB 1Q3XA 1FQ3A 1GI6A 4JK6A 1TWXB 2B7DH 2O8MA 4ZMAH 2IPHA 3UNQA 2WPLS 3Q3YA 1MTNB 2JETB 3PMHB 1VITH 1MU8B 3GY3A 1Q31A 2ESTE 3BF6H 2UUFB 1KLTA 1TNLA 2P3TB 1AVGH 1C2KA 2RA0A 4A1XA 2CHAC 1IHTH 4OGXA 2F9VA 3DHKH 3M35A 3RXUA 3ZZBA 1W11U 3GCHC 4FVDA 2Y82A 4JZFH 1C1PA 3TJOA 1DWCH 2ZHDA 3A81A 1C5YB 1KDQB 2P59A 4HTCH 4E05H 2CHAB 3DUXH 1GMHF 3EYDA 1T31A 1V2PT 1X7AC 3RXOA 1O33A 3QTVH 4GCHG 1O2KA 1MAXA 4IN2A 1DLEA 1BBRH 5FBEA 3DD2H 1P3EA 4CRFA 2FX4A 2C8ZB 5A2MH 3GCNA 1LCYA 1IQEA 1VJ9U 2P3FH 1SI5H 1JWTA 3MO6A 2ZDVH 4GSOA 2FXRA 5C1UA 2WPHS 1EB2A 3ZVFA 1C5OH 3PMAB 2W7UA 1DXPA 2BM2A 5HGGA 2ZQ1A 3MU8A 2ZGCA 1HAOH 1GHAF 1UK4A 3ZV8A 3UR9A 2QY0B 2B8OH 1W0ZU 1ZSKA 1C1VH 2OTVA 3A8BA 5LPRA 1O3IA 3OSYA 1P11E 5TCAA 5E2PA 5C67A 3G01A 1MAYA 1G36A 2A4RA 3TJNA 1O2PA 1FXYA 2R2MB 4JMYA 1UVUH 1RTKA 1P0SH 5DK1A 1K21H 2BD4A 1QGFA 2ZPQA 1ZHRA 3TVJB 1GI7B 1MU6B 4MQAA 1H9HE 1LHGH 3PO1B 1K1OA 4FUGA 4AFQA 1ELCA 1YKTA 3PMJA 4FXGH 5FAHA 1GJBB 3SU6A 3BG4B 1YM0A 5EQSA 1ZYOA 1XUFA 1O2TA 1UTPA 2FI4E 1Z7KA 1TGSZ 3PM3A 2B0FA 1KXFA 4FUFA 2EA3A 3R3GB 3QK1A 2QXJA 1E0FD 2ZHWH 2V6NA 1P9UA 3HGNA 4UFEH 1RIWB 1GCDA 2Y7ZA 1MKXK 1GI3A 3RM0H 3BEFB 1VCQA 1GBCA 3KQEA 2ZO3H 4MTBA 1F7ZA 5DO4H 2GCHG 4CHAB 1DY8A 2BY5X 2UWOA 1Z8RA 1E34B 1TPAE 2OXSA 3GICB 1A5IA 2R0LA 1S85A 3UUZA 2UUKB 2CMYA 3LJJA 1OWIA 1TAWA 1O2NA 3GYMA 1ABIH 1SFQB 1BBRK 1NRPH 3A82A 1P2OA 4NSVA 4UDWH 2Y80A 1KTSB 2EEKA 1TIOA 2SGAA 4ZUHA 3QGJA 1AZZA 2XBWA 1MQ6A 2WV4A 1PFXC 1OYQA 3PLPA 1LVOA 4MLFB 3VGCC 2A45B 3AASA 3DFJA 2Y5FA 7ESTE 3KF2A 3UNSA 1QY6A 1UTLM 2O8UA 3S9AA 2G52A 1BJVA 2GCTB 2Z94A 1GBIA 2BD7A 3MNSA 1O0DH 1P2QA 2D1JA 1C1OA 4XDEA 4MVNA 5T3HA 2ILNA 3ZZCA 2GZ8A 2PSXA 2XRCA 1Y5UT 3VFEA 4NG9H 2PW8H 3E91A 5FPTA 3T28A 2KAIB 4TWYA 4BXSA 1GBTA 3ZZ7A 1TA2A 4DJZB 1UTNA 2Z9JA 2XC5A 3BN9A 5AF9H 1VZQH 4UEHH 2A2XH 4UFGH 4F49A 1P12E 5DG6A 1GHZA 3RXRA 3SO3A 1BB0B 1GBHA 1IQMA 2B9LA 1MUEB 3OU0A 2TGDA 6GCHG 2F3CE 4HI3A 4MPWA 1EX3A 1P09A 2AH4X 2KAIA 3BIUH 3GDVA 1MTUA 1QFKH 1BTWA 3MOCA 4B2BA 3KNXA 4XBDA 2GCHF 5EGMA 3NZIA 3SU1A 5SGAE 2ZGHA 3HGPA 2BQ7B 3ATIA 4K8YA 5DKMA 1DXWA 1IQJA 3DT0H 1O5CB 1ESAA 2ZCHP 1C5XB 2LNCA 1GJ9B 3O8CA 8KME2 1YPMH 2BX3A 4KTSA 1FAXA 5F8ZA 1O37A 2QAAA 3MYWA 4WMFA 4OS2A 4ISLA 1ZGVA 2TGTA 4WWYA 1G9IE 3L3TA 1C2IA 1ELAA 1ANDA 1JMOH 3BEUA 4Y10E 1Y3VA 1KYNA 2VIVA 1ELFA 2SGPE 1T8OA 3RXKA 1TNHA 1ARCA 2Z9LA 4FUIA 1HCGA 1AVXA 2FS8A 1HIAB 2PLXA 1C4U2 2FM2A 3BTTE 5EU8A 3RU4E 2BLOA 1ORFA 2RCEA 3IWMA 3C1KA 2ZF0H 1D9IA 3FP8E 3JZ2B 3AVZA 1C5LH 1QBOA 4GLYA 4YOGA 1RS0A 2AGGX 3AAVA 2WYJA 3E0PB 3FZDA 3KL6A 2Y81A 5F8XA 1EZUC 4R8TB 5L6NH 1NS3A 5GWZA 4BTIB 4XSKU 1KLIH 1QB9A 2BVRH 2W3KA 4Y71A 4FVBA 1AKSB 1S5SA 1YYY1 1JRSA 2GT7A 1L2EA 3NK8A 1DICA 1C1SA 3BTQE 1DITH 1WV7H 4TY7A 1FLEE 4FUJA 4J2YB 5LPFA 1TB6H 1GI9B 1W8BH 1GJ8B 3ZVEA 1Z1JA 1C5SA 3ATLA 1C2JA 2OBOA 2ZTYA 2FOEA 2G81E 1OX1A 4KGAA 2Z9GA 3VB5A 1SGYE 1AKSA 1O2HA 2ZCKP 1THSH 1VCPA 2NU0E 2FOAA 2H2ZA 2Y5GA 5C20A 5ETXA 1EPTA 1QB6A 1TMBH 4JK5A 2V3HH 3M37A 1TA6A 3RXFA 7KMEH 1JXPA 3O8BA 2BD3A 2BOKA 2XYAA 1TGNA 1HAIH 2A5IA 3TNTA 4Z6AH 1HGTH 2NWNA 5GCHG 3ZVCA 1TX7A 3AAUA 4CH8B 4OGYA 5I46H 4O97A 2GCTC 4AYVB 1ZR0A 2CF9H 3F9HA 1K1IA 2WPIS 3BEIB 3RXLA 2OC1A 1OSSA 3PTBA 1NN6A 1QA7A 5GDSH 3U9AH 2ZIQH 2AEIH 1C9PA 1AIXH 2GV7A 1OWKA 1KSNA 2C90B 2BDGA 2I6QA 1PJPA 3M61U 3GISB 4FU8A 4DG4A 4VGCC 1O36A 1LTOA 2SFAA 4MNXA 1HXFH 1CQQA 1D6RA 3RDZA 2QIQA 1O2VA 4I31A 3SV6A 3PO1C 1ZPBA 2A2QH 4A92A 1QL7A 2D2DA 4QT8C 3UNRA 2IOTA 2J9NA 2XCFA 2QN5T 1A0JA 4UONA 1K1PA 3KQDA 3U1IB 2WPKS 4B2AA 1HPGA 2A31A 2VWNA 1O3EA 1P10A 2BHGA 2TIOA 4UFFH 3U8OH 4KP0A 3V0XA 1GGDB 1GGDC 1PQ8A 3LC3A 1P05A 2J95A 1FI8A 5EPYA 2FTMA 2FI3E 7GCHG 1SQTA 1O2RA 3FP6E 4O3TA 1FUJA 2BY9X 4B75A 1V3XA 3SHAH 2FESH 2WUCA 3E0NB 1CT4E 1LO6A 2PUQH 1MKWH 1THRH 1DY9A 4SGAE 1QRXA 3W95A 1VJAU 2JH6D 1LHEH 1IQIA 1TALA 4TY6A 1WYKA 3RXVA 1MZAA 1RGQA 4GPGA 4IC6A 1BRBE 4GHTA 1KXEA 4XFQA 1Y5BT 4Y8ZA 4TWWA 2HWLB 5DP5A 1VITG 5IYTA 4X1PU 3PTNA 3URCA 3SNCA 2ZDKA 4B73A 4D7GA 2HRVA 1ZOMA 2UWPA 1A5HA 8GCHG 3TJUA 4Y0ZE 1ZPCA 2HPQH 4JYVH 4U30A 1GJ4H 2PGBB 3D62A 1GHVH 3V3MA 1V2MT 1GBBA 2CGAA 2ZFSA 1TONA 1MKXH 1KIGH 1SFIA 5FX6A 4ZXXH 4A7IB 5LGOA 3UFAA 1TGBA 1F2SE 1OWEA 1SMFE 2AERH 4ZROA 4Q7ZA 4NIYA 3HKIB 8LPRA 3KQCA 1ELEE 3BTKE 1GDQA 5LPEA 2Z7FE 3KEEA 1ZHPA 1O2XA 3Q3KA 1MTSA 3RXHA 2ZKSA 1O2SA 1ANBA 1SGEE 1EZQA 1NFXA 2TRMA 1DSTA 3HK3B 2ZPSA 3UY9A 1AUTC 1UK2A 4X6MA 5FCRA 3RP2A 2XC4A 3K6ZA 1QB1A 1ZPZA 3TK9A 5I25A 3PYHA 1AGJA 1BTXA 1DUAA 4KKDA 4YESB 2G51A 2EI7A 2W7SA 1BOQA 1BQYA 4LZ4B 3B9FH 3MH7A 2SGEE 3QWCH 5PTPA 1BBRE 1NRQH 2BY7X 1GL1A 1C5ZB 2OCVB 3BG4C 2GT8A 1AU8A 1C5VA 3ODFA 1F0SA 3H7OA 3TGIE 3VB4A 3MNCA 1YC0A 2FODA 2ZHEH 3SGBE 2CJIA 1CA8B 1RRKA 2SNVA 1O3OA 3SUFA 2EI6A 2ZDLA 4ABJA 1W7XH 1AB9C 2A7CA 1BTUA 4GCHF 3T27A 2ODQA 3RMOH 3MO9A 1XXDA 1F0RA 1Z71A 2BXTH 1A3EH 2J38A 4K60A 1Y3WA 1FAKH 3LOXA 2AYWA 4YLUA 3ZZ9A 4ABAA 3B23B 2ZU4A 3HATH 3PWBA 4Y0YE 3I77A 1SB1H 4BOHA 1TMUH 3OYPA 5ABWA 4LXBH 1HJ8A 1BTHH 2C93B 1F5KU 3QLPH 1C1MA 3RXAA 1FZZA 3M3VA 3A86A 2OC0A 4INHA 2GZ9A 2Z6BD 4NA9H 1KXBA 1CA0C 3HKJB 2TGAA 1SGFA 1PPEE 2K1QA 4Y6DA 3TIUA 1W10U 4DW2U 1ZSJA 3QN7A 1ZZZA 4ISHH 4ZKSU 3RXEA 3GY8A 1OYTH 3STJA 3V12A 2FOBA 1LPGB 3FZZA 1G3DA 3ATWA 2FYRA 3MU5A 1HIAA 2GDDA 1GHXH 3QGNB 2QGRA 3DA9B 4KTUA 5CMXH 3K6YA 1Y3XA 3KCGH 2P3UB 3ZZ6A 2FWWA 3S0NA 2FOHA 5L30H 4JZIA 3EGKH 2BTCE 3M5LA 2ZP0H 4MPUA 1D6WA 1QTFA 3LT3A 1C4V2 3ZZ5A 4NFFA 4FUHA 2HGTH 2XW9A 1SVPA 1CGIE 1N8OB 5A09A 4BANB 2Q6DA 1S6FA 2TGPZ 3M7QA 4K8BA 1MH0A 2P94A 2FOGA 4TPIZ 1W7GH 2HNTF 2R9PA 5JBCS 1INCA 1BHXB 1QL9A 2FZZA 5F8TA 1K22H 3QDZB 7LPRA 2H9EH 3EQ0H 4I8GA 5CHAB 2PV9B 4NSYA 3GCTG 2Y6TA 1GVKB 3BSQA 1W3CA 2BD2A 1O2MA 3SV8A 4DT7B 1LVYA 1OXGA 2OD3B 2XBVA 4ZH8A 1V2NT 2AS9A 1GBJA 1GDUA 1L4DA 1P03A 1N6XA 1V2LT 3A83A 2BD5A 1A0HB 2VVUA 1HJAB 2PHBA 4B74A 4YLQH 1O3PB 4ISOA 1V2ST 1GCTB 1BMAA 1HFDA 1NFYA 1ZMLA 2AMPA 3M3SA 1D3DB 1ZMJA 1O3FA 4ABGA 4X6NA 3M5MA 1B5GH 4AFZA 2ZI2H 1AZ8A 1GPZA 1SHYA 2PGQB 2PKAA 2V35A 1BMNH 5A0AE 5A0BA 1SSXA 2H5CA 2O8TA 2ZU3A 2ZFFH 1V2VT 9LPRA 1TPSA 1OWJA 3KQBA 3LIWA 4NZQA 4WMEA 1BHXF 3ZYDA 2OC7A 2GVFA 1HBTH 1SGTA 5EG4A 1TBRH 2FOMB 2J4IA 3UWJH 1JIMA 4U2WA 3V7TA 1SOZA 3M7UA 1O3LA 3PB1E 4CRCA 1O5FH 3OY6U 1LHFH 1NU9A 5JPMH 2VGCC 3SNDA 4YM9A 1LPZB 4A6LA 4OS5A 2DE9A 3NWUA 3GCHB 1Z8GA 5GIBA 1ZSLA 4Y7BA 3SU4A 1PPGE 1GVZA 2QXIA 5FPYA 1NT1A 3A85A 2AGIX 2VH6A 1O2WA 3SI4H 5AHGH 3ZVBA 3MH6A 1LKAA 4XBBA 3T26A 2P93A 1ANEA 1TBZH 4B76A 1HRTH 2PKSC 3NXPA 3GCTF 4CRAA 2CXVA 2F9NA 1MBQA 3AW0A 5H4IB 3RC5A 3LONA 2NU1E 1C2FA 1FY1A 2ANMH 1EAWA 2ANYA 2ZU5A 3K65B 1N6YA 1SGQE 3SU0A 2VVVA 1DWDH 3UOPA 5EXMA 1FMGA 3WY8A 3F1SB 2AGEX 4BAQB 1LVMA 3RU4D 4BAHB 3C27B 6CHAC 1EAXA 1Q2WA 4FUDA 4WVPE 1GBMA 2JH5D 4NA8A 2P16A 3RXBA 3QUMP 3SU5A 1J16A 1DM4B 4IW4E 1HJAC 3RXIA 1SOTA 3L6PA 1BTYA 1HB0B 2FX6A 2QV1A 3QTOH 3S69A 1P2MA 4MPVA 1C1TA 1XUJA 3URDA 1K1JA 2ZQ2A 1YGCH 1E37B 1ELGA 1O38A 1DDJA 4NIWA 2G4UA 1UTQA 1FIWA 1BUIA 3A7YA 1FPHH 3LKWA 2BVSH 2WPJS 2QCYA 4BAMB 3L33A 1FN8A 2M5TA 1T4VH 4TPYA 1A4WH 4Y11E 1PYTD 2BXUH 2STAE 4D9RA 4DY7B 3STIA 3KGPA 3VEQB 4E06H 3HPTB 3KIDU 1ZTJA 5K7RA 5HM9A 1AQ7A 1GI1A 1OP2A 2A0QB 2A4OA 3T25A 1FJSA 2ZDNA 1VR1H 1DLKB 1Y59T 2GX4A 1UVOA 2STBE 1EPTC 3ZZ3A 3EDXB 4CH2B 1RIWC 3F9EA 1Z8IB 3SJIA 1W0YH 4WXVA 1V2KT 2F9OA 1F0UA 1YCPH 3CS0A 2FYQA 2VGCB 4RSPA 2WUBA 3EA8A 2VB0A 2XWBI 2XC0A 1PPZA 5FCKA 3UIRA 4XE4A 2ZZUH 1NPMA 1C5NH 4R0IA 2ODPA 2ZHQH 4I32A 1UTKA 3LC5A 5DGJA 1HV7A 1ID5H 3MI4A 2FP7B 1GHAG 1B7XB 1T8MA 2YNAA 5FXLA 1GG6B 2FDAA 5EXNA 1DWBH 4JZEH 3LGTA 4E7RG 4A5TS 1K9OE 1FV9A 1OWDA 2ZA5A 5JB9S 2ZNKH 4WMDA 3QZQA 2QA9E 4E7NA 2AIPA 1NROH 2WINI 3FVFB 3S9CA 1SG8B 1TOMH 3SQEE 4K1SA 1ETTH 4X2VA 3ELAH 3JZ1B 2GZ7A 1GMCG 1O31A 5EPNA 1TNJA 1UO6A 4J1YA 2HOBA 3SUGA 1W14U 5JBBS 3RXGA 1BRCE 1O30A 5L2YH 1AE8H 3RC6A 3F9GA 1V2TT 3TJVA 3PV4A 2NU2E 5J4QA 4ZHAA 1P2NA 4K69A 2D26C 1IQKA 2DUCA 3SGAE 4AGJA 1O2GH 3SI3H 1BRAA 2F9PA 1WSSH 3RLWH 4AFSA 1RTLA 1KY9A 3R0FA 1YPEH 1TRMA 5JYIA 3KN2A 3Q76A 1MQ5A 1KXAA 4INLA 3TLOA 3ZVGA 2J2UA 1SC8U 3DFLA 2Q6FA 3ATKA 3NPSA 1FY8E 1E36B 5AFYH 2TPIZ 2G5NA 4AGKA 3T2NA 1O2OA 5EOKA 1O2ZA 2XNIA 1YPGH 3NUMA 3SZNA 1C5MD 1EAUA 1WBGB 3LPRA 3MU1A 4K3JA 3PROA 4O9VA 1WQSA 4ZKRU 4WJG2 1G3EA 1HAVB 3F9FA 4JYUH 1Y8TA 2BDIA 4INKA 1A0LA 3UTUH 1IQGA 2GMTB 3RXSA 5B6OA 1FY3A 4CRBA 5JBTA 1GJ6A 1H9IE 3OY5U 2A7JA 1EZSC 1TFXA 2THFB 2BD8A 4CRDA 7GCHF 1LQEA 4U01A 3TNSA 1CA0B 1NO9H 4JZ1A 4MDSA 2OP9A 1CGJE 1F5LA 1LKBA 1ELTA 3ESTA 3E16B 3P8GA 5FHTA 2ZHFH 2BDCA 3A8DA 4ABIA 1GMDG 1YPLH 1DANH 2FI5E 4RN6A 1TNGA 3MNXA 2C8XB 3A7ZA 1ZTKA 1S82A 1GDNA 1SGFG 4D8NA 4LOYH 3W94A 3GOVB 5JBAS 1C2MA 1SGDE 1QJ1B 1EJAA 4YO9A 2ALPA 3MTYA 3O8DA 3EE0B 3M5NA 3U69H 4HFPB 1WCZA 2ZCLP 1C2DA 2VU8E 3IG6B 3MMGA 1SGIB 2FEQH 1JIRA 3CP7A 4Y76A 1GI4A 4B1TA 3E90B 2FIRH 4B2CA 1ACBE 1XVOA 3E3TA 4AFUA 4AOQA 4Y79A 3ZZ4A 1AMHA 1C2HA 1XMNB 1W13U 1BDAA 3SJOA 1WAYB 4ABEA 1UHBA 1C5UA 3I78A 4YT6H 4NZLA 5EW1H 1PPHE 5T6FA 1O2JA 1ANCA 4X8UH 2PKSB 3RU4T 3ZZ8A 1Y5AT 2F9BH 3SBKA 2F83A 4X1RU 1KDQA 3LGVA 1CBWB 4FUBA 1HAGE 1Z1IA 4NA7A 2BX4A 3BIVH 4X1NU 3O8RA 3E1XB 2VWMA 1O5GH 2LPRA 2TBSA 2XWAA 3CS7A 2PR3A 5AFZH 5TCCA 1MTVA 1YPJH 1A5GH 4D7FA 1J8AA 1CHOG 1EPTB 1EASA 3ZZDA 1MD8A 1C1QA 1ELVA 3P92A 1G30B 1P57B 4O03A 6GCHF 1EB1H 1O2LA 1GWAA 2QYIA 4UD9H 1L1JA 1NFUA 1WTGH 1DT2A 4AN7A 1TQ7B 2QF3A 1TPPA 4H6TA 1AFEH 2VINA 1C2GA 2Q1JA 1YPKH 1HNEE
chains in the Genus database with same CATH superfamily
4K1EA 2ANKH 5ESBA 1PQ7A 1C4Y2 1YF4A 1BTPA 1S6HA 1J14A 5C17A 1BA8B 1GI0A 1TE0A 3KHVA 1QL8A 1C9TA 3VPKA 3SNBA 3P8FA 4BXWA 1O34A 4H6SB 4CREA 1XUKA 4WXIA 3LU9B 2H9HA 2RA3A 3E6PH 3P8NA 1SQOA 3A88A 1LDTT 4I8LA 1THPB 3MH5A 4H42U 2RG3A 1C5QA 1TGCA 3QZRA 1VITF 3NCLA 1QIXB 1ETSH 1CGHA 1QJ7B 4Y8XA 2PTCE 2IJOB 5FPSA 4GAWA 3A84A 1C1RA 3ITIA 1A61H 2ASUB 4WH8A 3PLKA 1VCWA 1O3NA 5J4SA 1GMCF 1SGNE 4I7YH 1GG6C 3GY6A 5C94A 1Y3UA 4BNRA 5DN6D 2GDEH 1O3JA 3MQKC 5TJXA 2ZPRA 1CBWC 4YTAA 4H4FA 1ELDE 1XKAC 2BZ6H 1LQDB 4IN1A 5DP9A 2R2WU 3EA7A 2BB4A 1NY22 5DP6A 2ZTZA 1UCYE 5K0HA 3Q3XA 1SBWA 2I6SA 1LHCH 2WYGA 1N8OC 1MKWK 4DGJA 4U32A 1UVSH 1GHBF 3GY2A 5DP8A 3A7TA 4BAKB 2ZECA 1IQNA 1O32A 4Q7XA 3TGKE 4CBNA 4DURA 2J92A 2ZGBH 2V0BA 1WDIA 1NU7B 1RD3B 2VH0A 5A8ZA 5HYOA 3S9BA 4XBCA 3A8AA 5CE1A 1OPHB 1V2JT 2BDBA 4MNVA 1TABE 2ZC9H 4ASUD 2W26A 2CV3A 1XM1A 3ATMA 4NWLA 1T4UH 1NFWA 1KXCA 2EQNA 3SJ9A 4RKJB 4X2YA 1WXRA 5F6MA 1F0TA 3P17H 1CVWH 2VIQA 1BT7A 3TH2H 1PPBH 1K1LA 1KMHB 2A4GA 4IBLH 5E2OA 4XOJA 5JDUB 4AX9H 1G2MA 2AIQA 1T32A 2VIWA 2BDYA 1P2JA 3GDSA 3Q77A 3RMNH 2GKVE 4TYDA 1DWEH 1BMLA 2P8OC 2XBXA 1XX9A 3MHWU 5T6DA 1LVBA 1AD8H 1GBEA 1O3DA 3A87A 3OE7D 2UUYA 1FN6A 1ZJDA 5EJ1A 1RXPA 3IITA 1YCPM 4ZXYH 1EJMA 4CR5A 4KTCA 2ZFTA 3A89A 1EQ9A 1U6QA 1AUJA 1TLDA 1AI8H 2FTLE 2YOLA 4FU7A 3TH4H 1C5PA 1QR3E 2GD4B 4X2WA 4M7GA 1GMDF 2ZFPH 1O3BA 1BRUP 5T6GA 1WTHD 2ZDAH 1B0EA 2O8LA 1GJAB 1LHDH 1DX5M 1AN1E 1TX8A 3H5CB 4IC5A 3U8TH 1XKBC 1TMTH 3DSGA 1LMWB 2A7HA 2PFEA 1D4PB 2UUJB 3A8CA 3BTGE 3RUOA 3ZVAA 3MH4A 1L1NA 1VGCC 3K9XB 1C2LA 4GVUA 1EJNA 1AVWA 2YMSC 1P3CA 2ALVA 2OC8A 2H5DA 1FIZA 2VJ1A 4NIXA 4AYYB 1S81A 3NKKA 4GHQA 2PWXA 1GJDB 2ZEBA 1NESE 1L1GA 1YLCA 1NZQH 3RMLH 2KFWA 3VB7A 2OINA 1DSUA 4ACAA 1IQHA 1O3GA 4UFDH 1DE7H 1MTNC 1NBMD 4FU9A 4F4OC 5EQRA 3UQVA 2BD9A 5AVDA 1OOKB 1ZRKA 3M5OA 1BMMH 1EP6A 1WUNH 3D49H 1DS2E 3I29A 2F9UA 1O2IA 4MPXA 4FUEA 1ZTLA 3QX5H 5DP3A 4OM9A 3AW1A 3BTHE 1SLXB 4WF8A 3BTDE 1D3QB 2WV5A 3VB3A 5GXPA 4ASHA 1AWHB 2VIDA 4ESTE 2OBQA 1QJ6B 5F53A 1E35B 2QXGA 1PYTC 3LDXH 3RXPA 3SV9A 1QBVH 1G2LA 4OS1A 4BTTB 4D9QA 1T8NA 5BPEA 1GL0E 4WH6A 3MO3A 4X6OA 4MNYA 1S83A 1P02A 4Z0KA 2ZGJA 1EATA 4I33A 2G8TA 3SU2A 1V6DA 1GMHG 1TQ0B 1GBAA 2XTTB 2HNTE 1TGTA 1G32B 1QA0A 2OLGA 1O39A 2ZU2A 4XD7D 2CN0H 5CHAC 1AB9B 1CHGA 2YNBA 1DFPA 3SUEA 5EJLA 1GBDA 1K1NA 4VGCB 4PROA 3LGIA 3P8OA 2J98B 2G00A 1TRYA 1E79D 1ZHMA 1SL3A 3SJKA 2ZFRH 2J94A 1HAHH 5F03A 3OAAD 2VNTA 1F5RA 2QC2A 1K28D 1G3CA 2JH0D 4RKOB 2PUXB 4ISIH 5LH8A 6ESTA 2G4TA 3MWIU 6LPRA 2BLQA 2BVXH 2A32A 3GS9A 1ZLRA 5EXLA 1QNJA 1V2UT 4X8TH 2EI8A 1SQAA 1YCPK 1CT2E 3U98H 1YPHE 1A3BH 3MU0A 4Y7AA 2FLBH 5ESTE 4ZKNU 5JB8S 4ZAEA 1C1WH 2HALA 2KZ4A 1ARBA 1ESTA 3SN8A 1C1NA 4DVAU 2JETC 2AFQB 3LH1A 3PMBB 5FBIA 3SHCH 4CHAC 1FPCH 2K8IA 3ZVDA 3F0PA 3F68H 3BTME 4BAOB 3MU4A 3LGWA 1EZXC 1GI5A 1A46H 1T8LA 3SW2B 1O5DH 5IDKA 3RXDA 1P9SA 1QCPA 3DSPA 4OS7A 2WV9A 5HM2A 4ACBA 1TPOA 1YY3A 4SGBE 1O3AA 3RLYH 1O3MA 3SOSA 3RC4A 1AHTH 2H1UA 2OUAA 1N1LA 5C1YA 3TK5A 3ZZAA 3UOUA 2HNTC 5E0HA 1ETRH 1CHOF 4MNWA 5E8EH 4Y8YA 3T29A 1A7SA 2VIOA 2ZTXA 1SLVB 1V2WT 2FO9A 5C5OA 2JKHA 4AB8A 1BITA 1GJ5H 4ABBA 3P95A 2ZFQH 1J9CH 2WPMS 3ODDA 1QBNA 1UTJA 2HPPH 1MBMA 2J98A 2P95A 1AWFH 2SGQE 1G37A 4HZHA 5GJ4B 4Q7YA 1H9LB 3ZV9A 4ZHMU 1TNKA 2WZQA 1OP0A 4IMZA 1TYNA 2RDLA 2GP9B 3S7HB 1QRWA 1P2IA 1QQ4A 3LGYA 4CBOA 3UWIA 4Q2KA 1O3HA 2C8WB 6CHAB 1W2KH 2V3OH 5EW2H 2BLVA 3RXCA 4AG2A 1S84A 4I8KA 1AFQB 1H8IH 1O2UA 2ZU1A 4WY3A 1NRSH 1SLUB 4NCYA 3U8RH 1D3TB 2C4FH 1TRNA 3DSOA 1CU1A 1K1MA 3T5FH 2BDAA 1K2I1 1FY4A 1QRZA 4K1TA 1FDPA 1SGRE 1ZGIA 3RXTA 3UR6A 1YWUA 4X8SH 5B6LA 1EUFA 5DP4A 4X1SU 3TH3H 1O5AB 8ESTE 2JJ2D 1MZDA 1G3BA 2O9QA 2FOFA 1PPCE 2H9TH 1P01A 2G5VA 2GV6A 1UK3A 4X0WU 2XXLA 2Z3DA 1FY5A 1LPKB 4NFEA 1XUHA 5G4BA 2R3YA 4UE7H 1GI8B 4YOJA 1O5BB 1F92A 2VVCA 1UMAH 4B71A 1P2KA 3PWCA 1HDTH 1JOUB 1VGCB 3OEED 2Z9IA 3OTJE 2H6MA 5HXFA 3AK5A 3TU7H 2BLWA 3KQ5A 2A1DB 1HAZB 1SGCA 3VXEH 5DJ7A 1S6LA 1PPFE 2ZWLH 4K2YA 1UJ1A 2ZG0H 3U28C 2GGVB 1PQ5A 1AO5A 1GHBG 4ZKOU 1C5RA 1GCTC 3GCOA 4HGCA 3T62A 2W5EA 1P04A 4ZHLU 2HLCA 5EQQA 1NC6A 2XCNA 4CRGA 3UQOA 1C1UH 3FAOA 5BRRE 4ABDA 4LZ1H 1YPHC 2Z3CA 3RMMH 2ZDMA 1HJ9A 4LK4A 3E8LA 1OWHA 3GY7A 1CE5A 4I8HA 1NM6A 1FNIA 2B5TB 2ZGXH 1KTTB 4NIVA 2DE8A 1OP8A 2R3UA 1D3PB 4JCNA 4BTUB 1HLTH 1OS8A 1DOJA 2A5KA 3UPEA 1Z6JH 1M9UA 1KXDA 1IOEA 3B8JA 3P6ZB 3GDUA 2RFKC 3VG8A 4DCDA 3K2UA 5A0CA 4IGDA 2VIPA 3VGCB 1WQVH 1MD7A 1ZRBA 2Y7XA 1Y3YA 4CR9A 1ESBA 1HAYB 1DUEA 3RXJA 1FONA 1XXFA 1PQAA 1UTOA 1EAIA 3GY5A 2A5AA 4P00A 2IN2A 2GMTC 1HAPH 2OQUA 1QHRB 2FMJA 1SGPE 2JDID 1O5EH 5HMAA 1T7CA 1V2QT 2FLRH 4X1QU 3ZYEA 1MCTA 1GHWH 1J17T 4X8VH 4TT3D 4FUCA 1C5TA 1CO7E 2EC9H 3BTEE 1DVAH 1C2EA 5A8XA 1H4WA 3LJOA 1RFNA 3EAJA 2XBYA 3F2FA 5C3NA 3OX7U 1EP5A 1H1BA 5C5NA 1MCVA 4MG3A 2BOHB 3TGJE 3MFJA 1KLJH 1SPJA 1BIOA 3RXQA 4AORA 2BDHA 2BY6X 3SNAA 4KELA 1YLDA 3SQHE 1BCUH 4I8JA 2ULLA 2BQWB 3A7WA 3SU3A 2SNWA 4ABHA 1BZXE 1GJCB 2D8WA 2UWLA 2QF0A 3A7VA 3MNBA 5DP7A 1S0QA 3D23A 1UVTH 2G55A 1HYLA 3PLBA 4OS6A 1EOJA 1O35A 2FPZA 1OKXA 1HXEH 4IMQA 1YBWA 1H8HD 1CT0E 1O2YA 5DPAA 4YOIA 5GCHF 1RTFB 4ABFA 1GBKA 2NU4E 4ISNA 4DIHH 5GPIB 1J15A 4Q4LA 1MTWA 1HAVA 3SV2H 1JRTA 3SV7A 2AMQA 1A2CH 3EA9A 3LGUA 1QQUA 1L4ZA 2BMGB 1SHHB 3SNEA 3TK6A 1EKBB 3TPIZ 1P8VC 2IJD1 1O2QA 3PRDA 5C0UA 1V2RT 3GY4A 1YP9A 1MMJN 1XUGA 1RJXB 2BYAX 1WOFA 2J34A 2BZAA 1E38B 3BV9B 1EOLA 1UCYK 3BTWE 2F91A 1C5WB 2A4QA 4OS4A 2KR7A 1IHSH 2OQ5A 1GHYH 4NGAH 2PKAB 2VWLA 3A80A 1UHBB 2CF8H 2F43B 4JYTA 4A1VA 3V13A 1ZMNA 3FP7E 1Z6EA 1AE5A 4X2XA 5EODA 1GBFA 1H8DH 4Q80A 5C2ZA 2ODYB 1TBQH 3Q00A 4YT7H 4F48B 3SUDA 2BY8X 1O3CA 2AMDA 2NU3E 1TNIA 5HKKD 2QXHA 2O8WA 1UTMA 2HVXA 4AZ2B 1GJ7B 1WU1A 2GTBA 3FANA 5C1XA 1XVMA 3H7TA 2FOCA 1NRRH 2PTNA 3P70B 2SGFE 4YZUA 4GUXA 2C3SA 2AHME 3LH3A 1ZJKA 2FS9A 3D65E 1V2OT 3SJ8A 2HVYB 2Z3EA 2EY4C 4X6PA 4D76A 1JBUH 1IQFA 3M3TA 2VWOA 1EXFA 2K0QA 3M7TA 1ELBA 3RM2H 3F6UH 1AY6H 3TITA 4AG1A 3BG8A 1Z8JB 1IQLA 1GBLA 2ANWA 3CENA 1UVPA 1GVLA 4DIIH 3VXFH 4NWKA 2PSYA 1HUTH 1L0ZA 3VB6A 3WWFA 1NRNH 4RT1A 5E0JA 1S0RA 5CHBA 4O3UA 1P06A 1O3KA 3M36A 3UREA 3RXMA 3ENSB 1DPOA 4DOQA 2BQ6B 5A8YA 8GCHF 1HAXB 1XUIA 3F2GA 1TX6A 2Z9KA 1NBME 1TOCB 1W12U 3HK6B 1AFQC 2Y5HA 1NTPA 2KCPA 1ABJH 3SORA 1SR5C 2P8OB 3FFGA 2W3IA 3A7XA 2R0KA 2SGDE 1GI2A 1BTZA 1A1RA 3N7OA 1CSOE 4JZDH 3GYLB 5L2ZH 5FX5A 4AB9A 4IS5A 2QF5A 9ESTA 3S7KB 1B0FA 3BTFE 3QO6A 4HG6A 2Q6GA 3U1JB 1BJUA 1SLWB 4A1TA 3SGQE 4K5ZA 1QURH 1UCYH 1IAUA 4THNH 5E0GA 2C8YB 1Q3XA 1FQ3A 1GI6A 4JK6A 1TWXB 2B7DH 2O8MA 4ZMAH 2IPHA 3UNQA 2WPLS 3Q3YA 1MTNB 2JETB 3PMHB 1VITH 1MU8B 3GY3A 1Q31A 2ESTE 3BF6H 2UUFB 1KLTA 1TNLA 2P3TB 1AVGH 1C2KA 2RA0A 4A1XA 2CHAC 1IHTH 4OGXA 2F9VA 3DHKH 3M35A 3RXUA 3ZZBA 1W11U 3GCHC 4FVDA 2YMSB 2Y82A 4JZFH 1C1PA 1EFRD 3TJOA 1DWCH 2ZHDA 3A81A 1C5YB 1KDQB 2P59A 4HTCH 4E05H 2CHAB 3DUXH 5HIYA 1GMHF 3EYDA 1T31A 1V2PT 1X7AC 3RXOA 1O33A 3QTVH 4GCHG 1O2KA 1MAXA 4IN2A 1DLEA 1BBRH 5FBEA 3DD2H 1P3EA 4CRFA 2FX4A 2C8ZB 5A2MH 3GCNA 1LCYA 1IQEA 1VJ9U 2P3FH 3F3BA 1SI5H 1JWTA 3MO6A 2ZDVH 4GSOA 2FXRA 5C1UA 2WPHS 2VBCA 1EB2A 3ZVFA 1C5OH 3PMAB 2W7UA 1DXPA 2BM2A 5HGGA 2ZQ1A 3MU8A 2ZGCA 5C0TA 1HAOH 1GHAF 1UK4A 3ZV8A 3UR9A 2QY0B 2B8OH 1W0ZU 1ZSKA 1C1VH 4FOUC 2OTVA 1OHHD 3A8BA 5LPRA 1O3IA 3OSYA 1P11E 5TCAA 5E2PA 5C67A 3G01A 1MAYA 1G36A 2A4RA 3TJNA 1O2PA 1FXYA 2R2MB 4JMYA 1UVUH 1RTKA 1P0SH 5DK1A 1K21H 2BD4A 1QGFA 2ZPQA 5HIZA 1ZHRA 3TVJB 1GI7B 1MU6B 4MQAA 1H9HE 1LHGH 3PO1B 1K1OA 4FUGA 4AFQA 1ELCA 1YKTA 3PMJA 4FXGH 5FAHA 1GJBB 3SU6A 3BG4B 1YM0A 1SQRA 5EQSA 1ZYOA 1XUFA 1O2TA 1UTPA 2FI4E 1Z7KA 1TGSZ 3PM3A 2B0FA 1KXFA 4FUFA 2EA3A 3R3GB 3QK1A 2QXJA 3KYGA 1E0FD 2ZHWH 2V6NA 1P9UA 3HGNA 4UFEH 1RIWB 1GCDA 2Y7ZA 1MKXK 1GI3A 3RM0H 3BEFB 1VCQA 1GBCA 3KQEA 2ZO3H 4MTBA 1F7ZA 5DO4H 2GCHG 4CHAB 1DY8A 2BY5X 2UWOA 1Z8RA 1E34B 1TPAE 2OXSA 3GICB 1A5IA 2R0LA 1S85A 3CNRA 3UUZA 2UUKB 2CMYA 3LJJA 1OWIA 1TAWA 1O2NA 3GYMA 1ABIH 1SFQB 4TSFD 1BBRK 1NRPH 3A82A 1P2OA 4NSVA 4UDWH 2Y80A 1KTSB 2EEKA 1TIOA 2SGAA 4ZUHA 3QGJA 1AZZA 2XBWA 1MQ6A 2WV4A 1PFXC 1OYQA 3PLPA 1LVOA 4MLFB 3VGCC 2A45B 3AASA 3DFJA 2Y5FA 7ESTE 3KF2A 2XNDD 3UNSA 1QY6A 1UTLM 2O8UA 3S9AA 2G52A 1BJVA 2GCTB 2Z94A 1GBIA 2BD7A 3MNSA 1O0DH 1P2QA 2D1JA 1C1OA 4XDEA 4MVNA 5T3HA 2ILNA 3ZZCA 2GZ8A 2PSXA 2XRCA 1Y5UT 3VFEA 4NG9H 2PW8H 3E91A 5FPTA 3T28A 2KAIB 4TWYA 4BXSA 1GBTA 3F2HA 3ZZ7A 3ZIAD 1TA2A 4DJZB 1UTNA 5CDFE 2Z9JA 2XC5A 3BN9A 5AF9H 1VZQH 4UEHH 2A2XH 4UFGH 4XRNA 2PP6A 4F49A 1P12E 2L74A 5DG6A 1GHZA 3RXRA 3SO3A 3WW7A 1BB0B 1GBHA 1IQMA 2B9LA 1MUEB 3OU0A 2TGDA 6GCHG 2F3CE 4HI3A 4MPWA 1EX3A 1P09A 5KEDA 2AH4X 2KAIA 3BIUH 3GDVA 1MTUA 1QFKH 1BTWA 3MOCA 4B2BA 3KNXA 4XBDA 2GCHF 2J97A 5EGMA 3NZIA 3SU1A 5SGAE 2ZGHA 3HGPA 2BQ7B 3ATIA 4K8YA 5DKMA 1DXWA 1IQJA 3DT0H 1O5CB 1ESAA 2ZCHP 1C5XB 2LNCA 1GJ9B 2JIZD 3O8CA 8KME2 1YPMH 2BX3A 4KTSA 1FAXA 5F8ZA 1O37A 2QAAA 3MYWA 2LP6A 4WMFA 4OS2A 4ISLA 1ZGVA 2TGTA 4WWYA 1G9IE 2W6ID 3L3TA 1C2IA 1ELAA 1ANDA 2W6JD 1JMOH 3BEUA 4Y10E 1Y3VA 1KYNA 2VIVA 1ELFA 2SGPE 1T8OA 3RXKA 2KX4A 1TNHA 1ARCA 2Z9LA 4FUIA 1HCGA 1AVXA 2FS8A 1HIAB 2PLXA 1C4U2 2FM2A 3BTTE 5EU8A 3RU4E 2BLOA 1ORFA 2RCEA 3IWMA 5EIYA 3C1KA 2ZF0H 1D9IA 3FP8E 3JZ2B 3AVZA 2WPDD 1C5LH 1QBOA 4GLYA 4YOGA 1RS0A 2AGGX 3AAVA 2WYJA 3E0PB 3FZDA 3KL6A 2Y81A 5F8XA 1EZUC 4R8TB 5L6NH 1NS3A 5GWZA 4BTIB 4XSKU 1KLIH 1QB9A 2BVRH 2W3KA 4Y71A 4FVBA 1AKSB 1S5SA 1YYY1 1JRSA 2GT7A 1L2EA 3NK8A 1DICA 1C1SA 3BTQE 1DITH 1WV7H 4TY7A 1FLEE 4FUJA 4J2YB 5LPFA 1TB6H 1GI9B 1W8BH 1GJ8B 3ZVEA 4P02A 1Z1JA 1C5SA 3ATLA 3N99A 1C2JA 2OBOA 2ZTYA 2FOEA 2G81E 1OX1A 1YLNA 4KGAA 2Z9GA 3VB5A 1SGYE 1AKSA 1O2HA 2ZCKP 1THSH 1VCPA 2NU0E 2FOAA 2H2ZA 2Y5GA 5C20A 5ETXA 1EPTA 2CK3D 1QB6A 1TMBH 4JK5A 2V3HH 3M37A 1TA6A 3RXFA 7KMEH 1JXPA 3O8BA 2BD3A 2BOKA 2XYAA 1TGNA 1HAIH 2A5IA 3TNTA 4ZCNA 4Z6AH 1HGTH 2NWNA 5GCHG 3ZVCA 1TX7A 3AAUA 4CH8B 4OGYA 5I46H 4O97A 2GCTC 4AYVB 1ZR0A 2CF9H 4RT0A 3F9HA 1K1IA 2WPIS 3BEIB 3RXLA 2OC1A 1OSSA 3PTBA 1NN6A 1QA7A 5GDSH 4M9FA 3U9AH 2ZIQH 2AEIH 1C9PA 1AIXH 2GV7A 1OWKA 1KSNA 2C90B 2BDGA 2I6QA 1PJPA 3M61U 3GISB 4FU8A 4DG4A 4VGCC 1O36A 1LTOA 2SFAA 4MNXA 1HXFH 1CQQA 1D6RA 3RDZA 2QIQA 1O2VA 4I31A 3SV6A 3PO1C 1ZPBA 2A2QH 4A92A 1QL7A 5KGOA 2D2DA 4QT8C 3UNRA 2IOTA 2J9NA 2XCFA 2QN5T 1A0JA 4UONA 1K1PA 3KQDA 3U1IB 2WPKS 4B2AA 1HPGA 2A31A 2VWNA 1O3EA 1P10A 2BHGA 2TIOA 4UFFH 3U8OH 1E1RD 4KP0A 3V0XA 1GGDB 1GGDC 1PQ8A 3LC3A 1P05A 2J95A 1FI8A 5EPYA 2FTMA 2FI3E 7GCHG 1SQTA 1O2RA 1H8ED 3FP6E 4O3TA 5FL7D 1FUJA 2BY9X 4B75A 1V3XA 3SHAH 2FESH 2WUCA 3E0NB 3F0OA 1CT4E 1LO6A 2PUQH 1MKWH 1THRH 1DY9A 4SGAE 1QRXA 3W95A 1VJAU 4B6EA 2JH6D 1LHEH 1IQIA 1TALA 4TY6A 1WYKA 3RXVA 1MZAA 1RGQA 4GPGA 4I86A 4IC6A 1BRBE 3SZEA 4GHTA 1KXEA 4XFQA 1Y5BT 4Y8ZA 4TWWA 2HWLB 5DP5A 1VITG 5IYTA 4X1PU 3PTNA 1FX0B 3URCA 3SNCA 2ZDKA 4B73A 4D7GA 4DT4A 3FOAA 2HRVA 1ZOMA 2UWPA 1A5HA 8GCHG 3TJUA 4Y0ZE 1ZPCA 2HPQH 4JYVH 4U30A 5KECA 1GJ4H 2PGBB 3D62A 1GHVH 3V3MA 1V2MT 1GBBA 2CGAA 2ZFSA 2KCAA 1TONA 1MKXH 1KIGH 3UB0A 1SFIA 1W0JD 5FX6A 4ZXXH 4A7IB 5LGOA 3UFAA 1TGBA 1F2SE 1OWEA 1SMFE 2AERH 4ZROA 4Q7ZA 4NIYA 3HKIB 8LPRA 3KQCA 1ELEE 3BTKE 1GDQA 5LPEA 2Z7FE 3KEEA 1ZHPA 1O2XA 3Q3KA 1MTSA 3RXHA 2ZKSA 1O2SA 1ANBA 1SGEE 1EZQA 1NFXA 2TRMA 1DSTA 3HK3B 2ZPSA 3UY9A 1AUTC 1UK2A 4X6MA 5FCRA 3RP2A 2XC4A 3K6ZA 1QB1A 1ZPZA 3TK9A 5I25A 3PYHA 1AGJA 1BTXA 1DUAA 4KKDA 4YESB 2G51A 2EI7A 2W7SA 1BOQA 1BQYA 3NRLA 4LZ4B 3B9FH 3MH7A 2SGEE 2QF4A 3QWCH 5PTPA 3N7DA 1BBRE 1NRQH 2BY7X 1GL1A 1C5ZB 3FO8D 1SKYE 2OCVB 3BG4C 2GT8A 1AU8A 1C5VA 3ODFA 1F0SA 3H7OA 3TGIE 3VB4A 3MNCA 1YC0A 2FODA 2ZHEH 3SGBE 2CJIA 1CA8B 1RRKA 2SNVA 4RI0A 1O3OA 3SUFA 2EI6A 2ZDLA 4ABJA 1W7XH 1AB9C 2A7CA 5GNDA 5IK2D 1BTUA 4GCHF 3T27A 2ODQA 3RMOH 3MO9A 1XXDA 3PV5A 1F0RA 1W0KD 1Z71A 2BXTH 1A3EH 2J38A 4K60A 1Y3WA 1FAKH 3LOXA 2AYWA 4YLUA 3ZZ9A 4ABAA 3B23B 2ZU4A 3HATH 3PWBA 4Y0YE 3I77A 1SB1H 4BOHA 1TMUH 3OYPA 5ABWA 4LXBH 1HJ8A 1BTHH 2C93B 1F5KU 3QLPH 1C1MA 3RXAA 1FZZA 3M3VA 3A86A 2OC0A 3PV2A 4INHA 2GZ9A 1BMFD 2Z6BD 4NA9H 1KXBA 1CA0C 3HKJB 2TGAA 1SGFA 1PPEE 2K1QA 4Y6DA 3TIUA 1W10U 4DW2U 1ZSJA 3QN7A 1ZZZA 4ISHH 4ZKSU 3RXEA 4Z1MD 3GY8A 1OYTH 3STJA 3V12A 2FOBA 1LPGB 3FZZA 1G3DA 3ATWA 2FYRA 3MU5A 1HIAA 2GDDA 1GHXH 3QGNB 2QGRA 3DA9B 4KTUA 3FKSD 5CMXH 3K6YA 1Y3XA 3KCGH 2P3UB 3ZZ6A 2FWWA 3S0NA 2QE7D 2LELA 2FOHA 5L30H 2J5UA 4JZIA 3EGKH 2BTCE 3M5LA 2ZP0H 4MPUA 1D6WA 1QTFA 3LT3A 1C4V2 3ZZ5A 4NFFA 4FUHA 2HGTH 2XW9A 1SVPA 1CGIE 1N8OB 5A09A 4BANB 2Q6DA 1S6FA 2TGPZ 3M7QA 4K8BA 1MH0A 2P94A 2FOGA 4TPIZ 1W7GH 2HNTF 2R9PA 2HLDD 5JBCS 1INCA 1BHXB 1QL9A 2FZZA 5F8TA 1COWD 1K22H 3QDZB 7LPRA 2H9EH 3EQ0H 4I8GA 5CHAB 2PV9B 2KCOA 4NSYA 3GCTG 2Y6TA 1GVKB 3BSQA 1W3CA 2BD2A 1O2MA 3SV8A 4DT7B 1LVYA 1OXGA 2OD3B 2XBVA 4ZH8A 1V2NT 2AS9A 1GBJA 1GDUA 1L4DA 1P03A 1N6XA 1V2LT 3A83A 2BD5A 1A0HB 2KM0A 2VVUA 1HJAB 2PHBA 4B74A 4YLQH 1O3PB 4ISOA 2YMSD 1V2ST 1GCTB 1BMAA 1HFDA 1NFYA 1ZMLA 2AMPA 3M3SA 1D3DB 1ZMJA 1O3FA 4ABGA 4X6NA 3M5MA 1B5GH 4AFZA 2ZI2H 1AZ8A 1GPZA 1SHYA 2PGQB 2PKAA 2V35A 1BMNH 5A0AE 5A0BA 1SSXA 2H5CA 2O8TA 2ZU3A 2ZFFH 1V2VT 9LPRA 1TPSA 1OWJA 3KQBA 3LIWA 4NZQA 4WMEA 1BHXF 3ZYDA 2OC7A 2GVFA 1HBTH 1SGTA 5EG4A 1TBRH 2FOMB 2J4IA 3UWJH 1JIMA 4U2WA 3V7TA 1SOZA 3M7UA 1O3LA 3PB1E 4FETA 4CRCA 1O5FH 3OY6U 1LHFH 1NU9A 5JPMH 2GJGA 2VGCC 3SNDA 4YM9A 1LPZB 4A6LA 4AC9A 4OS5A 2DE9A 3NWUA 3GCHB 1Z8GA 5GIBA 1ZSLA 4Y7BA 3SU4A 1PPGE 1GVZA 2QXIA 5FPYA 1NT1A 3A85A 2AGIX 2VH6A 1O2WA 3SI4H 5AHGH 3ZVBA 3MH6A 1LKAA 4XBBA 3T26A 2P93A 1ANEA 1TBZH 4B76A 1HRTH 2PKSC 3NXPA 3GCTF 4CRAA 2CXVA 2F9NA 1MBQA 3AW0A 5H4IB 2KCYA 3RC5A 3LONA 2NU1E 1C2FA 1FY1A 2ANMH 1EAWA 2ANYA 2ZU5A 3K65B 1N6YA 1SGQE 3SU0A 2VVVA 1DWDH 3UOPA 4Q63A 5T1VA 5EXMA 1FMGA 3WY8A 3F1SB 2AGEX 4BAQB 1LVMA 3RU4D 4BAHB 3C27B 6CHAC 1EAXA 1Q2WA 4FUDA 4WVPE 1GBMA 1MABB 2JH5D 4NA8A 2P16A 3RXBA 3QUMP 2OK5A 2V7QD 3SU5A 1J16A 1DM4B 1QZ8A 1HJAC 4IW4E 3RXIA 1SOTA 3L6PA 1BTYA 1HB0B 2FX6A 2L6OA 2QV1A 3QTOH 1P2MA 3S69A 4MPVA 1C1TA 3W1EA 1XUJA 3URDA 1K1JA 2ZQ2A 1YGCH 1E37B 1ELGA 1O38A 1DDJA 4NIWA 2G4UA 1UTQA 1FIWA 1BUIA 3A7YA 1FPHH 3LKWA 3KYFA 2BVSH 2WPJS 2QCYA 4BAMB 3L33A 1FN8A 2M5TA 1T4VH 4TPYA 1A4WH 4Y11E 1PYTD 2BXUH 2STAE 4D9RA 4DY7B 3STIA 3KGPA 3VEQB 4E06H 3HPTB 3KIDU 1ZTJA 3OFND 5HM9A 1AQ7A 5K7RA 1GI1A 1OP2A 2A0QB 2A4OA 3T25A 1FJSA 2ZDNA 1VR1H 1DLKB 1Y59T 2GX4A 1UVOA 2STBE 1EPTC 3ZZ3A 3EDXB 4CH2B 3N7EA 1RIWC 2WSSD 3F9EA 1Z8IB 3SJIA 1W0YH 4WXVA 1V2KT 2F9OA 1F0UA 1YCPH 1K0HA 3CS0A 2FYQA 2VGCB 4RSPA 2WUBA 3EA8A 2VB0A 2XWBI 2XC0A 1PPZA 5FCKA 3UIRA 4XE4A 1VKYA 2ZZUH 1NPMA 1C5NH 4R0IA 2ODPA 2ZHQH 4I32A 1UTKA 3LC5A 5DGJA 1HV7A 1ID5H 4F55A 3MI4A 2FP7B 1GHAG 1B7XB 1T8MA 2YNAA 3EE7A 5FXLA 1GG6B 2FDAA 5EXNA 1DWBH 4JZEH 3LGTA 4E7RG 4A5TS 1K9OE 1FV9A 1OWDA 2ZA5A 5JB9S 3OEHD 2ZNKH 4WMDA 3QZQA 2QA9E 4E7NA 2AIPA 1NROH 2WINI 3FVFB 3S9CA 1SG8B 1TOMH 3SQEE 4K1SA 1ETTH 4X2VA 3ELAH 3JZ1B 2GZ7A 1GMCG 1O31A 5EPNA 1TNJA 1UO6A 4J1YA 2HOBA 2RDEA 3H09A 5DSFA 1W14U 3SUGA 5JBBS 3RXGA 1BRCE 2F4LA 1O30A 5L2YH 1AE8H 3RC6A 3F9GA 1V2TT 3TJVA 3PV4A 2NU2E 5J4QA 4ZHAA 1P2NA 4K69A 2D26C 1IQKA 2DUCA 3SGAE 4B6FA 4AGJA 1O2GH 3SI3H 1BRAA 2F9PA 1WSSH 3RLWH 4AFSA 1RTLA 1KY9A 3R0FA 1YPEH 1TRMA 2V3MA 5JYIA 3KN2A 3Q76A 1MQ5A 1KXAA 4INLA 3TLOA 3ZVGA 2J2UA 1SC8U 3DFLA 2Q6FA 3ATKA 3NPSA 1FY8E 1E36B 5AFYH 2TPIZ 2G5NA 4AGKA 3T2NA 1O2OA 5EOKA 1O2ZA 2XNIA 1YPGH 3NUMA 3SZNA 1C5MD 1EAUA 1WBGB 3LPRA 3MU1A 4K3JA 3PROA 4O9VA 1WQSA 4ZKRU 4WJG2 1G3EA 1HAVB 3F9FA 4JYUH 1Y8TA 2BDIA 4INKA 1A0LA 3UTUH 3DCLA 1IQGA 2GMTB 3RXSA 5B6OA 1FY3A 4CRBA 5JBTA 1GJ6A 1H9IE 5EJZA 3OY5U 2A7JA 1EZSC 1TFXA 2THFB 2BD8A 4CRDA 7GCHF 1LQEA 4U01A 3TNSA 1CA0B 1NO9H 4JZ1A 4MDSA 2OP9A 1CGJE 3UAIC 1F5LA 2XOKD 1LKBA 1ELTA 3ESTA 3E16B 3P8GA 5FHTA 2ZHFH 2IPQX 2BDCA 3A8DA 4ABIA 1GMDG 1YPLH 1DANH 2FI5E 4RN6A 1TNGA 3MNXA 2C8XB 3A7ZA 1ZTKA 1S82A 1GDNA 1SGFG 4D8NA 4LOYH 3W94A 3GOVB 5JBAS 1C2MA 1SGDE 2WHXA 1QJ1B 1UW7A 3SYJA 1EJAA 3OTPA 4YO9A 2ALPA 3MTYA 3FN8A 3O8DA 3EE0B 3M5NA 3U69H 4HFPB 1WCZA 2ZCLP 1C2DA 2VU8E 3IG6B 3MMGA 1SGIB 2FEQH 1JIRA 3CP7A 4Y76A 1GI4A 4B1TA 3E90B 2FIRH 4B2CA 1ACBE 1XVOA 3E3TA 4AFUA 4AOQA 4Y79A 3ZZ4A 1AMHA 1C2HA 1XMNB 1W13U 1BDAA 3SJOA 1WAYB 4ABEA 1UHBA 3WWBA 1C5UA 3I78A 4YT6H 4NZLA 5EW1H 1PPHE 5T6FA 1O2JA 1ANCA 4X8UH 2PKSB 3RU4T 3ZZ8A 2JJ1D 1Y5AT 2F9BH 3SBKA 2F83A 4X1RU 1KDQA 3LGVA 1CBWB 4FUBA 1HAGE 1Z1IA 4NA7A 2BX4A 3BIVH 4X1NU 3O8RA 3E1XB 2VWMA 1O5GH 2LPRA 2TBSA 2XWAA 3CS7A 2PR3A 5AFZH 5TCCA 1MTVA 1YPJH 1A5GH 4D7FA 1J8AA 1CHOG 1EPTB 4YXWD 1EASA 3ZZDA 1MD8A 1C1QA 1ELVA 3P92A 1G30B 1P57B 4O03A 6GCHF 1EB1H 2M2AA 1O2LA 3PRBA 1GWAA 2QYIA 4UD9H 1L1JA 1NFUA 1WTGH 1DT2A 4AN7A 1TQ7B 2QF3A 1TPPA 4H6TA 1AFEH 2VINA 1C2GA 2Q1JA 1YPKH 1E1QD 1HNEE
chains in the Genus database with same CATH topology
4K1EA 2ANKH 5ESBA 1PQ7A 1C4Y2 1YF4A 1BTPA 1S6HA 1J14A 1BA8B 1GI0A 1TE0A 3KHVA 1QL8A 1C9TA 3VPKA 3SNBA 3P8FA 4BXWA 1O34A 4H6SB 4CREA 1XUKA 4WXIA 3LU9B 2H9HA 2RA3A 3E6PH 3P8NA 1SQOA 3A88A 1LDTT 4I8LA 1THPB 3MH5A 4H42U 2RG3A 1C5QA 1TGCA 3QZRA 1VITF 3NCLA 1QIXB 1ETSH 1CGHA 1QJ7B 4Y8XA 2PTCE 2IJOB 5FPSA 4GAWA 3A84A 1C1RA 3ITIA 1A61H 2ASUB 4WH8A 3PLKA 1VCWA 1O3NA 5J4SA 1GMCF 1SGNE 4I7YH 1GG6C 3GY6A 1Y3UA 4BNRA 2GDEH 1O3JA 5TJXA 2ZPRA 1CBWC 4YTAA 4H4FA 1ELDE 1XKAC 2BZ6H 1LQDB 4IN1A 5DP9A 2R2WU 3EA7A 2BB4A 1NY22 5DP6A 2ZTZA 1UCYE 5K0HA 3Q3XA 1SBWA 2I6SA 1LHCH 2WYGA 1N8OC 1MKWK 4DGJA 4U32A 1UVSH 1GHBF 3GY2A 5DP8A 3A7TA 4BAKB 2ZECA 1IQNA 1O32A 4Q7XA 3TGKE 4CBNA 4DURA 2J92A 2ZGBH 2V0BA 1NU7B 1RD3B 2VH0A 5A8ZA 5HYOA 3S9BA 4XBCA 3A8AA 5CE1A 1OPHB 1V2JT 2BDBA 4MNVA 1TABE 2ZC9H 2W26A 2CV3A 1XM1A 3ATMA 4NWLA 1T4UH 1NFWA 1KXCA 3SJ9A 4RKJB 4X2YA 5F6MA 1F0TA 3P17H 1CVWH 2VIQA 1BT7A 3TH2H 1PPBH 1K1LA 2A4GA 4IBLH 5E2OA 4XOJA 5JDUB 4AX9H 1G2MA 2AIQA 1T32A 2VIWA 2BDYA 1P2JA 3GDSA 3Q77A 3RMNH 2GKVE 4TYDA 1DWEH 1BMLA 2P8OC 2XBXA 1XX9A 3MHWU 5T6DA 1LVBA 1AD8H 1GBEA 1O3DA 3A87A 2UUYA 1FN6A 1ZJDA 1RXPA 3IITA 1YCPM 4ZXYH 1EJMA 4CR5A 4KTCA 2ZFTA 3A89A 1EQ9A 1U6QA 1AUJA 1TLDA 1AI8H 2FTLE 2YOLA 4FU7A 3TH4H 1C5PA 1QR3E 2GD4B 4X2WA 4M7GA 1GMDF 2ZFPH 1O3BA 1BRUP 5T6GA 1WTHD 2ZDAH 1B0EA 2O8LA 1GJAB 1LHDH 1DX5M 1AN1E 1TX8A 3H5CB 4IC5A 3U8TH 1XKBC 1TMTH 1LMWB 2A7HA 2PFEA 1D4PB 2UUJB 3A8CA 3BTGE 3RUOA 3ZVAA 3MH4A 1L1NA 1VGCC 3K9XB 1C2LA 4GVUA 1EJNA 1AVWA 1P3CA 2ALVA 2OC8A 2H5DA 1FIZA 2VJ1A 4NIXA 4AYYB 1S81A 3NKKA 4GHQA 2PWXA 1GJDB 2ZEBA 1NESE 1L1GA 1YLCA 1NZQH 3RMLH 3VB7A 2OINA 1DSUA 1IQHA 1O3GA 4UFDH 1DE7H 1MTNC 4FU9A 4F4OC 5EQRA 3UQVA 2BD9A 5AVDA 1OOKB 1ZRKA 3M5OA 1BMMH 1EP6A 1WUNH 3D49H 1DS2E 3I29A 2F9UA 1O2IA 4MPXA 4FUEA 1ZTLA 3QX5H 5DP3A 3AW1A 3BTHE 1SLXB 4WF8A 3BTDE 1D3QB 2WV5A 3VB3A 5GXPA 4ASHA 1AWHB 2VIDA 4ESTE 2OBQA 1QJ6B 1E35B 2QXGA 1PYTC 3LDXH 3RXPA 3SV9A 1QBVH 1G2LA 4OS1A 4BTTB 4D9QA 1T8NA 5BPEA 1GL0E 4WH6A 3MO3A 4X6OA 4MNYA 1S83A 1P02A 4Z0KA 2ZGJA 1EATA 4I33A 2G8TA 3SU2A 1V6DA 1GMHG 1TQ0B 1GBAA 2XTTB 2HNTE 1TGTA 1G32B 1QA0A 2OLGA 1O39A 2ZU2A 2CN0H 5CHAC 1AB9B 1CHGA 2YNBA 1DFPA 3SUEA 1GBDA 1K1NA 4VGCB 4PROA 3LGIA 3P8OA 2G00A 1TRYA 1ZHMA 1SL3A 3SJKA 2ZFRH 2J94A 1HAHH 5F03A 2VNTA 1F5RA 2QC2A 1K28D 1G3CA 2JH0D 4RKOB 2PUXB 4ISIH 5LH8A 6ESTA 2G4TA 3MWIU 6LPRA 2BLQA 2BVXH 2A32A 1ZLRA 5EXLA 1QNJA 1V2UT 4X8TH 2EI8A 1SQAA 1YCPK 1CT2E 3U98H 1YPHE 1A3BH 3MU0A 4Y7AA 2FLBH 5ESTE 4ZKNU 5JB8S 4ZAEA 1C1WH 2HALA 1ARBA 1ESTA 3SN8A 1C1NA 4DVAU 2JETC 2AFQB 3LH1A 3PMBB 5FBIA 3SHCH 4CHAC 1FPCH 3ZVDA 3F68H 3BTME 4BAOB 3MU4A 3LGWA 1EZXC 1GI5A 1A46H 1T8LA 3SW2B 1O5DH 5IDKA 3RXDA 1P9SA 1QCPA 4OS7A 5HM2A 1TPOA 4SGBE 1O3AA 3RLYH 1O3MA 3SOSA 3RC4A 1AHTH 2H1UA 2OUAA 1N1LA 5C1YA 3TK5A 3ZZAA 3UOUA 2HNTC 5E0HA 1ETRH 1CHOF 4MNWA 5E8EH 4Y8YA 3T29A 1A7SA 2VIOA 2ZTXA 1SLVB 1V2WT 2FO9A 5C5OA 2JKHA 4AB8A 1BITA 1GJ5H 4ABBA 3P95A 2ZFQH 1J9CH 2WPMS 3ODDA 1QBNA 1UTJA 2HPPH 1MBMA 2P95A 1AWFH 2SGQE 1G37A 4HZHA 5GJ4B 4Q7YA 1H9LB 3ZV9A 4ZHMU 1TNKA 1OP0A 4IMZA 1TYNA 2RDLA 2GP9B 3S7HB 1QRWA 1P2IA 1QQ4A 3LGYA 4CBOA 3UWIA 4Q2KA 1O3HA 2C8WB 6CHAB 1W2KH 2V3OH 5EW2H 2BLVA 3RXCA 4AG2A 1S84A 4I8KA 1AFQB 1H8IH 1O2UA 2ZU1A 4WY3A 1NRSH 1SLUB 4NCYA 3U8RH 1D3TB 2C4FH 1TRNA 1CU1A 1K1MA 3T5FH 2BDAA 1K2I1 1FY4A 1QRZA 4K1TA 1FDPA 1SGRE 1ZGIA 3RXTA 3UR6A 4X8SH 1EUFA 5DP4A 4X1SU 3TH3H 1O5AB 8ESTE 1MZDA 1G3BA 2O9QA 2FOFA 1PPCE 2H9TH 1P01A 2G5VA 2GV6A 1UK3A 4X0WU 2XXLA 2Z3DA 1FY5A 1LPKB 4NFEA 1XUHA 5G4BA 2R3YA 4UE7H 1GI8B 4YOJA 1O5BB 1F92A 2VVCA 1UMAH 4B71A 1P2KA 3PWCA 1HDTH 1JOUB 1VGCB 2Z9IA 3OTJE 2H6MA 5HXFA 3TU7H 2BLWA 2A1DB 1HAZB 1SGCA 3VXEH 5DJ7A 1PPFE 2ZWLH 4K2YA 1UJ1A 2ZG0H 2GGVB 1PQ5A 1AO5A 1GHBG 4ZKOU 1C5RA 1GCTC 3GCOA 4HGCA 3T62A 2W5EA 1P04A 4ZHLU 2HLCA 5EQQA 1NC6A 2XCNA 4CRGA 3UQOA 1C1UH 3FAOA 5BRRE 4ABDA 4LZ1H 1YPHC 2Z3CA 3RMMH 2ZDMA 1HJ9A 4LK4A 3E8LA 1OWHA 3GY7A 1CE5A 4I8HA 1NM6A 1FNIA 2B5TB 2ZGXH 1KTTB 4NIVA 2DE8A 1OP8A 2R3UA 1D3PB 4JCNA 4BTUB 1HLTH 1OS8A 1DOJA 2A5KA 3UPEA 1Z6JH 1M9UA 1KXDA 1IOEA 3B8JA 3P6ZB 3GDUA 4DCDA 3K2UA 5A0CA 4IGDA 2VIPA 3VGCB 1WQVH 1MD7A 1ZRBA 2Y7XA 1Y3YA 4CR9A 1ESBA 1HAYB 1DUEA 3RXJA 1FONA 1XXFA 1PQAA 1UTOA 1EAIA 3GY5A 2A5AA 2IN2A 2GMTC 1HAPH 2OQUA 1QHRB 2FMJA 1SGPE 1O5EH 5HMAA 1T7CA 1V2QT 2FLRH 4X1QU 3ZYEA 1MCTA 1GHWH 1J17T 4X8VH 4FUCA 1C5TA 1CO7E 2EC9H 3BTEE 1DVAH 1C2EA 5A8XA 1H4WA 3LJOA 1RFNA 3EAJA 2XBYA 5C3NA 3OX7U 1EP5A 1H1BA 5C5NA 1MCVA 4MG3A 2BOHB 3TGJE 3MFJA 1KLJH 1SPJA 1BIOA 3RXQA 4AORA 2BDHA 2BY6X 3SNAA 4KELA 1YLDA 3SQHE 1BCUH 4I8JA 2ULLA 2BQWB 3A7WA 3SU3A 2SNWA 4ABHA 1BZXE 1GJCB 2D8WA 2UWLA 2QF0A 3A7VA 3MNBA 5DP7A 1S0QA 3D23A 1UVTH 2G55A 1HYLA 3PLBA 4OS6A 1EOJA 1O35A 2FPZA 1OKXA 1HXEH 4IMQA 1YBWA 1CT0E 1O2YA 5DPAA 4YOIA 5GCHF 1RTFB 4ABFA 1GBKA 2NU4E 4ISNA 4DIHH 5GPIB 1J15A 1MTWA 1HAVA 3SV2H 1JRTA 3SV7A 2AMQA 1A2CH 3EA9A 3LGUA 1QQUA 1L4ZA 2BMGB 1SHHB 3SNEA 3TK6A 1EKBB 3TPIZ 1P8VC 1O2QA 1V2RT 3GY4A 1YP9A 1MMJN 1XUGA 1RJXB 2BYAX 1WOFA 2J34A 2BZAA 1E38B 3BV9B 1EOLA 1UCYK 3BTWE 2F91A 1C5WB 2A4QA 4OS4A 1IHSH 2OQ5A 1GHYH 4NGAH 2PKAB 2VWLA 3A80A 1UHBB 2CF8H 4JYTA 4A1VA 3V13A 1ZMNA 3FP7E 1Z6EA 1AE5A 4X2XA 5EODA 1GBFA 1H8DH 4Q80A 5C2ZA 2ODYB 1TBQH 3Q00A 4YT7H 3SUDA 2BY8X 1O3CA 2AMDA 2NU3E 1TNIA 2QXHA 2O8WA 1UTMA 2HVXA 4AZ2B 1GJ7B 1WU1A 2GTBA 3FANA 5C1XA 1XVMA 3H7TA 2FOCA 1NRRH 2PTNA 3P70B 2SGFE 4YZUA 4GUXA 2C3SA 3LH3A 1ZJKA 2FS9A 3D65E 1V2OT 3SJ8A 2Z3EA 4X6PA 4D76A 1JBUH 1IQFA 3M3TA 2VWOA 1EXFA 3M7TA 1ELBA 3RM2H 3F6UH 1AY6H 3TITA 4AG1A 3BG8A 1Z8JB 1IQLA 1GBLA 2ANWA 3CENA 1UVPA 1GVLA 4DIIH 3VXFH 4NWKA 2PSYA 1HUTH 1L0ZA 3VB6A 1NRNH 5E0JA 1S0RA 4O3UA 1P06A 1O3KA 3M36A 3UREA 3RXMA 3ENSB 1DPOA 4DOQA 2BQ6B 5A8YA 8GCHF 1HAXB 1XUIA 1TX6A 2Z9KA 1TOCB 1W12U 3HK6B 1AFQC 2Y5HA 1NTPA 1ABJH 3SORA 1SR5C 2P8OB 3FFGA 2W3IA 3A7XA 2R0KA 2SGDE 1GI2A 1BTZA 1A1RA 3N7OA 1CSOE 4JZDH 3GYLB 5L2ZH 5FX5A 4AB9A 4IS5A 9ESTA 3S7KB 1B0FA 3BTFE 3QO6A 2Q6GA 3U1JB 1BJUA 1SLWB 4A1TA 3SGQE 4K5ZA 1QURH 1UCYH 1IAUA 4THNH 5E0GA 2C8YB 1Q3XA 1FQ3A 1GI6A 4JK6A 1TWXB 2B7DH 2O8MA 4ZMAH 2IPHA 3UNQA 2WPLS 3Q3YA 1MTNB 2JETB 3PMHB 1VITH 1MU8B 3GY3A 1Q31A 2ESTE 3BF6H 2UUFB 1KLTA 1TNLA 2P3TB 1AVGH 1C2KA 2RA0A 4A1XA 2CHAC 1IHTH 4OGXA 2F9VA 3DHKH 3M35A 3RXUA 3ZZBA 1W11U 3GCHC 4FVDA 2Y82A 4JZFH 1C1PA 3TJOA 1DWCH 2ZHDA 3A81A 1C5YB 1KDQB 2P59A 4HTCH 4E05H 2CHAB 3DUXH 1GMHF 3EYDA 1T31A 1V2PT 1X7AC 3RXOA 1O33A 3QTVH 4GCHG 1O2KA 1MAXA 4IN2A 1DLEA 1BBRH 5FBEA 3DD2H 1P3EA 4CRFA 2FX4A 2C8ZB 5A2MH 3GCNA 1LCYA 1IQEA 1VJ9U 2P3FH 1SI5H 1JWTA 3MO6A 2ZDVH 4GSOA 2FXRA 5C1UA 2WPHS 1EB2A 3ZVFA 1C5OH 3PMAB 2W7UA 1DXPA 2BM2A 5HGGA 2ZQ1A 3MU8A 2ZGCA 1HAOH 1GHAF 1UK4A 3ZV8A 3UR9A 2QY0B 2B8OH 1W0ZU 1ZSKA 1C1VH 2OTVA 3A8BA 5LPRA 1O3IA 3OSYA 1P11E 5TCAA 5E2PA 5C67A 3G01A 1MAYA 1G36A 2A4RA 3TJNA 1O2PA 1FXYA 2R2MB 4JMYA 1UVUH 1RTKA 1P0SH 5DK1A 1K21H 2BD4A 1QGFA 2ZPQA 1ZHRA 3TVJB 1GI7B 1MU6B 4MQAA 1H9HE 1LHGH 3PO1B 1K1OA 4FUGA 4AFQA 1ELCA 1YKTA 3PMJA 4FXGH 5FAHA 1GJBB 3SU6A 3BG4B 1YM0A 5EQSA 1ZYOA 1XUFA 1O2TA 1UTPA 2FI4E 1Z7KA 1TGSZ 3PM3A 2B0FA 1KXFA 4FUFA 2EA3A 3R3GB 3QK1A 2QXJA 1E0FD 2ZHWH 2V6NA 1P9UA 3HGNA 4UFEH 1RIWB 1GCDA 2Y7ZA 1MKXK 1GI3A 3RM0H 3BEFB 1VCQA 1GBCA 3KQEA 2ZO3H 4MTBA 1F7ZA 5DO4H 2GCHG 4CHAB 1DY8A 2BY5X 2UWOA 1Z8RA 1E34B 1TPAE 2OXSA 3GICB 1A5IA 2R0LA 1S85A 3UUZA 2UUKB 2CMYA 3LJJA 1OWIA 1TAWA 1O2NA 3GYMA 1ABIH 1SFQB 1BBRK 1NRPH 3A82A 1P2OA 4NSVA 4UDWH 2Y80A 1KTSB 2EEKA 1TIOA 2SGAA 4ZUHA 3QGJA 1AZZA 2XBWA 1MQ6A 2WV4A 1PFXC 1OYQA 3PLPA 1LVOA 4MLFB 3VGCC 2A45B 3AASA 3DFJA 2Y5FA 7ESTE 3KF2A 3UNSA 1QY6A 1UTLM 2O8UA 3S9AA 2G52A 1BJVA 2GCTB 2Z94A 1GBIA 2BD7A 3MNSA 1O0DH 1P2QA 2D1JA 1C1OA 4XDEA 4MVNA 5T3HA 2ILNA 3ZZCA 2GZ8A 2PSXA 2XRCA 1Y5UT 3VFEA 4NG9H 2PW8H 3E91A 5FPTA 3T28A 2KAIB 4TWYA 4BXSA 1GBTA 3ZZ7A 1TA2A 4DJZB 1UTNA 2Z9JA 2XC5A 3BN9A 5AF9H 1VZQH 4UEHH 2A2XH 4UFGH 4F49A 1P12E 5DG6A