1O3NA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA02
4UFGH 3A88A 4WXVA 4ABDA 2BDCA 4FU8A 2VIOA 3ATWA 3GCHC 3PWCA 2ZA5A 3M7UA 1HUTH 3SJ9A 3G01A 1C1MA 1K1JA 1VGCB 1PPGE 1JIRA 1HAXB 2F83A 3QGNB 3B8JA 3M5OA 1ZSKA 4MNVA 1SGFG 3RC5A 1O5AB 4ZKNU 1UTLM 7ESTE 1P11E 1W11U 2FOGA 2O8MA 1C4Y2 1E35B 1NFXA 3QTOH 1QTFA 4INHA 1TRMA 3RXQA 1AIXH 3SNCA 2C8ZB 1O31A 4NG9H 2BY8X 1P2MA 1D3QB 1O3KA 2FI5E 2OC7A 4DY7B 1XX9A 3HGNA 3EE0B 3LC5A 3UQVA 3QZRA 1OP0A 3LU9B 4TPYA 2BDYA 3GY6A 2AERH 4BANB 2SFAA 3GCTG 2ZHFH 3OTJE 3TIUA 1HIAB 5J4QA 2R3UA 1BHXB 1O37A 1DDJA 1WUNH 3TU7H 2SGFE 1IOEA 2GVFA 4Y79A 2FODA 2H6MA 4X8TH 1FY8E 1K21H 1UK4A 3E6PH 3SGQE 1TBZH 1TA2A 5I25A 2DUCA 1SGTA 5K0HA 3ODFA 3ZYDA 2XCNA 1FMGA 1P9UA 4YOIA 2ZTYA 1O3FA 2A2QH 2AFQB 2ZDVH 1HDTH 1NRNH 3U8TH 1GG6C 4Y8XA 1D3PB 5A0CA 5GWZA 1O3OA 3PLPA 7GCHG 1CA0B 1O3MA 1XUFA 5T6GA 1C5RA 5EG4A 2Z7FE 4TYDA 3RXGA 3RMLH 4ABGA 1IQGA 1TBQH 1BDAA 1O2VA 3E91A 1PQ8A 5E0GA 3TH3H 1P10A 1PFXC 1LDTT 1QURH 3A89A 3KIDU 4BAOB 1GDQA 5HGGA 2VVVA 5ETXA 1ZRBA 4CRAA 8ESTE 1EAIA 2ZIQH 3SU0A 1BTZA 1Y3VA 5B6OA 1O39A 2HPPH 5FXLA 1LQEA 3ZVDA 2VJ1A 1BTPA 3ZZ7A 1QHRB 2ZDLA 4O3TA 1MZAA 4WXIA 1SHHB 2VGCB 1D3DB 1V2WT 3KEEA 1C1TA 2OLGA 1XUIA 3A7XA 1QR3E 1EJMA 1GVKB 1ZLRA 2JETC 2SNVA 1GBLA 4D7FA 4B73A 4A7IB 1SOZA 1TX7A 1BRUP 1C2HA 2ZTZA 2NU0E 2BB4A 1C9PA 1SHYA 1CBWB 1GHYH 3UIRA 1OKXA 2GTBA 1PPEE 1SLUB 5LPFA 1Y5BT 3PMAB 1K9OE 1EASA 2ZKSA 3RLYH 1GWAA 4OS5A 2PTNA 4HTCH 5IYTA 1F7ZA 2IOTA 4NIVA 2J38A 1RRKA 2ZU5A 2R3YA 3U98H 3ATKA 1OWJA 3AVZA 2OCVB 1O5EH 1ESTA 4NSVA 2IN2A 2FYRA 2XTTB 2ZGXH 1QRZA 4DURA 1N6XA 1EB1H 1HAPH 3PV4A 3ZVEA 4DVAU 2W5EA 1AUTC 1SG8B 4FUEA 2KAIA 1O2XA 6CHAB 5EODA 1W10U 4I8HA 1SLVB 4GHQA 1AB9B 1Z8RA 3RC6A 1GJ5H 4BXWA 3UNRA 3MNXA 4GCHF 5FCKA 4NZQA 4B2BA 3UR6A 5E0JA 1BUIA 1C2IA 1Y3UA 4UFDH 1C5XB 4K3JA 5GPIB 1DANH 3Q3YA 1Y3XA 4X1RU 1TGCA 4JYVH 5LGOA 1YM0A 2XC4A 4NA7A 4E06H 2CHAC 1LMWB 3BG4B 2QGRA 4X2XA 1L1NA 1D9IA 1P57B 1IQJA 5JB9S 3S7HB 4A1XA 1ZPZA 2C90B 1V2ST 4MNWA 1EOLA 5JBAS 1AE5A 3HKIB 2ZPSA 2FIRH 2G52A 2OINA 2QIQA 2O9QA 3S0NA 3TNSA 2D1JA 1BB0B 3GCTF 3KQEA 1GJ7B 1LKAA 1QQUA 1EXFA 4DW2U 2H1UA 4JYTA 2Z3CA 4X6NA 1KYNA 2Y6TA 5FPTA 3E1XB 1AY6H 3ZVFA 1ZJDA 1GHBG 4Y71A 3RXKA 2CXVA 3ATMA 4XE4A 4ABFA 1V2QT 2EI7A 4MLFB 4E7RG 2PKSB 3UPEA 2YOLA 2V35A 1TFXA 3EGKH 2VB0A 3I77A 2ZDKA 2ZG0H 1C5YB 3LGWA 7GCHF 8LPRA 1CT0E 2JKHA 5FX5A 1NO9H 4ZKSU 1LVOA 1P05A 2G51A 1SSXA 1JMOH 2TPIZ 3QGJA 1MAYA 2VWMA 4FXGH 2OBQA 1HXEH 2RDLA 1F92A 1TPSA 4AB9A 1A2CH 1OSSA 1F0UA 1GMCG 4I8GA 3RMMH 1EP6A 4OS7A 1A7SA 1FNIA 1J17T 1P04A 2H5CA 1ZJKA 1O5FH 4IW4E 1FJSA 1N8OB 1DXPA 1GCTB 2IPHA 1GBJA 3M37A 3QX5H 3A85A 3A82A 1YLDA 3GICB 4IMZA 1CQQA 1T32A 1O2HA 1AVGH 1ABJH 2QY0B 1AVXA 2PV9B 2VIQA 1ZGIA 2QCYA 4SGAE 4OS6A 4KKDA 1DLEA 1O3GA 1ZHMA 4AFSA 2HALA 1OWIA 3FAOA 3MI4A 1TAWA 2Z3EA 4B75A 3R3GB 3MMGA 4Q7YA 3P8OA 1K28D 2BLWA 1P3CA 3M3TA 1O5BB 9ESTA 4X1NU 3GY8A 1ID5H 1MKXK 1EOJA 2PSXA 3E90B 2BX4A 2SNWA 3UQOA 2R0LA 1LQDB 1W0YH 1EZSC 2ZP0H 2BVSH 3ENSB 3BTME 1UCYK 2R2WU 1VCWA 4AFUA 4GHTA 3JZ2B 4FU7A 2DE9A 2XNIA 1SGQE 1WU1A 3BTDE 4U2WA 2HWLB 2GKVE 1OYTH 5T6FA 1MTNB 2QF0A 1EP5A 1O5DH 3VGCC 2BQ6B 2F9VA 4IGDA 1AD8H 3P70B 3D65E 2A7HA 1W8BH 3K6ZA 1TBRH 1L1GA 2TRMA 2BD2A 1FY1A 4FVDA 2FOHA 2ZPRA 1C5NH 3LT3A 2GCTC 1O30A 4FUDA 1GI2A 4MTBA 1T8NA 5EW2H 1GL1A 2YNAA 1DICA 4ISOA 4E05H 3BTGE 2WV5A 1XMNB 2JH5D 2IJOB 2FDAA 3FP6E 3UNQA 3AW1A 4UONA 2LNCA 3PWBA 3K6YA 1D4PB 2BVRH 1SLXB 1T8MA 3M3VA 2BMGB 2PTCE 3O8DA 2ZFFH 2AMQA 1CGHA 1V2KT 1PQAA 1V3XA 1DSUA 4RKOB 1NN6A 1C2MA 3GYLB 3S69A 1AFQB 3T2NA 4AG1A 3NK8A 1HPGA 1HAVA 5EXMA 3BF6H 3V12A 1P2OA 4RKJB 3UWJH 5A0AE 1TNGA 2WPKS 1Q31A 2ZC9H 5J4SA 4MG3A 2J34A 4FUIA 2G5VA 1UTMA 2FOEA 3KHVA 3BV9B 4IN2A 4KTSA 1KXCA 1KLIH 1C5UA 2OC1A 1BJVA 2BDHA 1ELEE 1WV7H 2ODYB 1O2YA 1GJ8B 3GDVA 2O8LA 3ATIA 1A0JA 1YPMH 1BTXA 1GDNA 2I6SA 1QL7A 2PWXA 1L1JA 3MU5A 4TWWA 2BYAX 5C5OA 1TMUH 1GJ9B 2G81E 5JB8S 4JK6A 2NWNA 4X8SH 2F9BH 3O8CA 3IG6B 1MZDA 1P2JA 1JWTA 4VGCC 4ZHAA 3MO3A 4J2YB 3TPIZ 1C5QA 1TNLA 1H4WA 1SGPE 3ZVAA 4M7GA 1MBMA 2XYAA 4ESTE 4K1TA 4HZHA 2A5IA 2TGDA 5ESBA 1AU8A 1JXPA 2ZDAH 5JBTA 2C4FH 2GDEH 4TPIZ 3ZVGA 3M5MA 1N6YA 1ZYOA 5DP7A 2F3CE 2AGGX 4HGCA 3ZYEA 3TJVA 1T4VH 3BTHE 5GJ4B 2QF3A 2Z9KA 1LHDH 3P8GA 3NZIA 4H4FA 5DK1A 3UTUH 4BAHB 1TB6H 4TY7A 2A45B 2P94A 1EAUA 2A4RA 1OWHA 2G4UA 1CGJE 2HOBA 4IMQA 4Y0YE 1TPAE 3LOXA 1UVUH 1GL0E 2CN0H 3F9FA 1MQ6A 1W7GH 3KGPA 1E37B 4OS4A 5C20A 2FS9A 2ZQ2A 4CHAC 3F9HA 5EW1H 1FY3A 1V2NT 1C5VA 5JDUB 1HAGE 1SMFE 1THPB 1FAKH 3MHWU 4Q7ZA 1MU6B 3B23B 1GHVH 1O32A 1AMHA 7KMEH 1HIAA 1V2JT 1NU9A 2OC8A 1XUHA 5TCCA 1DWBH 2Q1JA 1K22H 1P09A 2D8WA 4U32A 2XRCA 2ZHDA 1QY6A 1GMDG 4FU9A 2UUKB 1F0RA 2FO9A 3FP8E 2BY6X 3SU5A 1BBRK 4J1YA 1RGQA 1SBWA 4ZUHA 5CE1A 1MUEB 3QZQA 2HRVA 3MU0A 2ZZUH 5EXNA 1SI5H 4Y76A 1ZR0A 3BTTE 3SHCH 2HLCA 1RIWC 1ZRKA 3TJOA 1TE0A 3EA9A 1C2DA 1XUGA 1O2IA 3V0XA 5FPYA 3GOVB 3PO1B 1N1LA 1QRXA 1DS2E 1HJAB 1NY22 4GCHG 1EZQA 2J4IA 4CR9A 3GDUA 2VH0A 3SZNA 1GHAG 1CHOF 1G9IE 1C1VH 2G8TA 3K9XB 2Y5HA 1BJUA 1OWEA 3P6ZB 1C1NA 4WMFA 8GCHF 2Y7XA 1V2VT 1LVMA 2F9OA 3BTFE 2XBYA 4DJZB 4XBDA 6GCHG 1HJ8A 1SOTA 1EQ9A 4B76A 1M9UA 3M7QA 1YCPK 1DX5M 4I31A 1MTVA 5GDSH 3SUEA 4IN1A 2BDBA 5DJ7A 3MH4A 1PQ5A 1TWXB 1H8DH 2BZAA 2ZGCA 3TK6A 1RXPA 3RXMA 3T25A 1O3AA 1EPTB 4GAWA 4CH2B 2FI3E 5C2ZA 4JZFH 1LCYA 3RU4D 2BXUH 3SU1A 3QTVH 3U1JB 1Z8GA 1DUEA 1MD7A 1UCYE 4UEHH 1O2UA 2HGTH 1O35A 3V7TA 4ZXYH 2P3TB 1W7XH 4NSYA 1MH0A 4HI3A 4WH8A 1O38A 1GMHF 5GXPA 1OS8A 1GBTA 1NRPH 5CMXH 1AWFH 1F2SE 1L4ZA 1IQEA 1MMJN 1QIXB 1SGDE 1BITA 1FONA 1FV9A 3KCGH 1GI4A 4ABIA 2DE8A 2SGQE 3VEQB 5G4BA 1IQFA 1QJ1B 1SGRE 1UK3A 2A7CA 3M7TA 1C5MD 1MBQA 1MQ5A 1GI7B 3KQCA 3ZV9A 2WYJA 1UO6A 1MKWH 3GCNA 2K1QA 4BXSA 1BRAA 4CBOA 5E0HA 1CBWC 3SU3A 3KL6A 1A3BH 1L4DA 1TGTA 3UNSA 4D76A 1SFIA 2H2ZA 1ZTJA 1G30B 1C5SA 4LOYH 1WQSA 2A0QB 4AGJA 2GV7A 2ZHEH 4K1SA 2CV3A 3KQDA 3VXFH 3L6PA 3LGYA 3A84A 2WPLS 3EAJA 2Z9GA 1SFQB 1C2GA 1MU8B 3ITIA 3M3SA 1TMBH 3LJOA 4MPVA 3QWCH 1NFWA 5I46H 2C3SA 1FDPA 3F6UH 1ARBA 4YZUA 3KNXA 5A8YA 1BMMH 3A8DA 4AX9H 1LO6A 5DKMA 2C8WB 3ZV8A 1P2IA 2B9LA 1GG6B 1QRWA 3IITA 1LHFH 1ETSH 1EAXA 1CVWH 4NFEA 4FUBA 2UWOA 1B7XB 1QBNA 3F9GA 1GMDF 1XUJA 5LH8A 5EPNA 3S9BA 2P8OC 4ZKOU 1SLWB 5IDKA 3S9CA 4WVPE 2AGIX 2ZFQH 4YO9A 2ZI2H 4I32A 2BLQA 2BLVA 4U01A 3BG4C 1YPGH 2P3UB 3V3MA 4DIIH 2ZEBA 2GMTC 1VJAU 2FX6A 4YLUA 2WV4A 4ZMAH 3TGIE 1F5LA 2NU3E 1AUJA 2GD4B 2BD4A 1V2PT 2OQUA 1EATA 2OXSA 1F5KU 3VB7A 1Y59T 1FLEE 4OS2A 3SGAE 2ZCLP 2G5NA 1HAHH 3P92A 4CRBA 1LVYA 3HATH 3SJ8A 3U8RH 1ANDA 4OS1A 1GHAF 3GDSA 4KELA 3HK3B 3OY6U 2GGVB 2W7SA 1IQIA 3LKWA 1FAXA 1V2MT 1HB0B 4IC6A 1SQTA 2JETB 1VCQA 1L0ZA 1CT4E 1RD3B 4YOGA 5TCAA 6GCHF 3PLBA 2ANYA 4WWYA 1NC6A 3RXDA 1SR5C 2PKSC 2OP9A 2Y5FA 3DD2H 3TJUA 3PMBB 2Z94A 2BTCE 2ZO3H 1T8LA 4Y11E 5T3HA 2B8OH 2GP9B 3A87A 2OTVA 1PPZA 2UUJB 1XKAC 1O3DA 1VZQH 1YPLH 3QLPH 3MH5A 5C1YA 5HMAA 2FMJA 1JIMA 5GCHF 1AN1E 4BTIB 1O5CB 4GLYA 3K2UA 1LHCH 3STIA 4IS5A 3AAVA 1Z6EA 2ZFSA 5HYOA 3SO3A 1ZMLA 2VIDA 2HNTF 2FPZA 3ZZDA 4Y10E 5A8ZA 4FUGA 2QAAA 3DT0H 1S0RA 1FN8A 4BAQB 2EI6A 5HM9A 4ZH8A 2BD5A 3Q00A 1KXDA 2ZWLH 1YPJH 1T8OA 3FFGA 5HM2A 3A8AA 1A5GH 1GCTC 3MNBA 1MTWA 1YYY1 5EU8A 5BPEA 1UTPA 2SGAA 3NPSA 1UHBB 1O2SA 2CHAB 3VPKA 1EJNA 2BX3A 2FS8A 2ZCKP 2W26A 1Z1JA 2BHGA 1SQOA 3ZZ5A 4BAKB 1WBGB 2C8YB 1H9IE 1QBOA 1GBKA 3ZZBA 1GGDC 1QQ4A 1ELTA 4X2WA 2NU4E 3R0FA 1QJ7B 3UOUA 3D23A 1BCUH 3TK5A 2ZF0H 4FUHA 5LPRA 2XCFA 1B5GH 1GHWH 3I29A 4XFQA 3A7ZA 1CGIE 3SN8A 1SB1H 2ZCHP 2THFB 4XBCA 4O03A 4KP0A 3RXTA 5L6NH 2BDAA 2UUFB 1OYQA 1GHXH 1S84A 3GISB 1O2JA 3NXPA 1TQ0B 1S82A 3VFEA 5CHAC 1LPKB 3QDZB 4AFQA 4MDSA 2ZTXA 1VITH 1YPEH 1PPHE 2TGPZ 3SQHE 2GDDA 3C1KA 2R9PA 3GCOA 4D9QA 2FOCA 3RXCA 4D7GA 3BSQA 2G00A 1C5TA 2FOBA 1W0ZU 2PLXA 2V3HH 1HAYB 2TGAA 1YLCA 3SU6A 3KQBA 1GJ4H 3LH3A 2FOFA 4NGAH 4Y0ZE 1C1QA 1DITH 1GI8B 3QUMP 5EPYA 3Q3KA 4MPXA 1P3EA 4UFEH 3VB6A 2VIVA 3VB5A 1NFYA 2AS9A 2BY9X 3RM2H 3GY2A 1GBIA 2ASUB 4ISIH 1O3IA 1ZHRA 2ZDNA 2R2MB 3DUXH 3SV7A 3SNEA 1DUAA 3O8RA 1FY4A 3A83A 3SORA 4X1PU 4AGKA 4Q80A 2J2UA 3QO6A 2FOMB 3C27B 1P03A 1GVZA 2FTMA 1DSTA 1AKSB 1PJPA 3AW0A 4IC5A 5K7RA 3MWIU 1YGCH 2NU2E 3BEUA 4WY3A 4ISLA 4Q2KA 1O2NA 5EGMA 2YNBA 3PMJA 2WPIS 3DHKH 3S9AA 1IQMA 1XVMA 2F9UA 1DVAH 1G2LA 1E38B 2ZQ1A 1O2GH 2ZGHA 1QGFA 1TNJA 1TX8A 5ESTE 1YP9A 4CRFA 5FX6A 2W3KA 1AFEH 4FUCA 1O2RA 4MNXA 5E2PA 1SQAA 3LPRA 5F8ZA 1T31A 3UUZA 1QL8A 1ZSLA 2Z3DA 1BT7A 1O3JA 3P8NA 4Z6AH 2FX4A 2J9NA 4CRGA 2WYGA 3IWMA 1IQLA 1SL3A 1O3NA 1EB2A 3ZVBA 2VNTA 3RXJA 4NIYA 1QA7A 1CHOG 4DIHH 2FOAA 1G32B 1NM6A 3OSYA 1FZZA 1LHEH 1SGEE 1C2KA 1ORFA 3S7KB 2XW9A 4AB8A 8GCHG 3MO9A 3VGCB 5DGJA 1C9TA 1GBCA 1NESE 4GSOA 4X2YA 1DE7H 4X2VA 3GY5A 1AZ8A 3MTYA 3V13A 2ZDMA 2EI8A 3E0NB 4KTUA 2RG3A 6ESTA 1Q2WA 4ZKRU 4X6MA 1GJDB 5A09A 1KDQB 1MAXA 1UTOA 3LONA 4A92A 3MFJA 4ABEA 4A5TS 3URCA 1XVOA 2GX4A 2GCTB 1BQYA 3T27A 1GJCB 3FZZA 1MCTA 3K65B 4KTCA 1O34A 2ZU1A 3GYMA 1HAOH 2RA0A 3SV8A 3LGTA 1TLDA 1MD8A 2ZU2A 1Z8IB 1OPHB 2HPQH 4K8YA 2V6NA 1WOFA 4OGYA 5L2YH 1C2LA 1GMHG 4MPUA 1BHXF 1GDUA 1TPOA 5C67A 1GJBB 3M36A 2BQ7B 1RS0A 3LJJA 2PR3A 4GUXA 1GPZA 2A4QA 1AVWA 3ZZ3A 2W3IA 2ZPQA 4O3UA 4JZ1A 4INKA 2FI4E 3TK9A 2BOKA 1ZTKA 1QL9A 2ALPA 3F9EA 2XC0A 1IQKA 4H6SB 3A8BA 1VJ9U 1F5RA 1G37A 5TJXA 5EQSA 1Y3WA 3LIWA 5L30H 2EC9H 4MVNA 1PPCE 1AWHB 4R8TB 3PLKA 3BEFB 3LH1A 3UWIA 1ELDE 1BMLA 3GY3A 2OUAA 4Y8ZA 1F0TA 1O2LA 5DP6A 4U30A 1ELGA 5DPAA 2A1DB 1C4U2 1WQVH 1TPPA 1ETTH 1WYKA 2BOHB 1C1SA 2BM2A 5JBCS 1O3CA 1NZQH 1O36A 1O2QA 2UWPA 1QJ6B 3RXLA 1KLTA 1J16A 4KGAA 4Y8YA 2FZZA 1NT1A 1OWDA 3PTBA 1GVLA 4I7YH 3SU4A 1O3HA 1BOQA 3A80A 3PB1E 2VWOA 4MQAA 1EPTA 1YCPM 3TNTA 5FCRA 3RXFA 3RM0H 3OYPA 2BDGA 1A5HA 1P0SH 3PO1C 3TGKE 4AORA 3TJNA 4WH6A 4VGCB 1VGCC 1DWEH 2Y7ZA 1ETRH 3E8LA 3EYDA 3LGVA 4AYYB 3OY5U 4THNH 3SJOA 1TMTH 3SNBA 2WUBA 1BMAA 1D6WA 1VR1H 2RCEA 1GI6A 2QYIA 2V0BA 1TONA 1BIOA 3BEIB 3LDXH 2QXGA 1KXEA 4TY6A 3A8CA 3RXOA 1DLKB 1TQ7B 2FLBH 1ELAA 8KME2 1GBFA 1O3LA 2OD3B 1H8IH 5ABWA 3SNDA 1XXFA 2UUYA 1FPHH 1C2JA 4I8KA 4B74A 3T26A 5EXLA 1Y8TA 3F68H 1DFPA 3A7WA 4JZIA 3T28A 2VINA 2STBE 4Y7AA 1HNEE 2O8WA 3M61U 4WF8A 4CHAB 1NPMA 3CENA 1PYTD 3PMHB 2FYQA 3GY7A 4F4OC 1DY8A 4Q7XA 2P59A 1V2OT 2PUXB 2PHBA 4DG4A 4UFFH 3RXPA 2J92A 1JRTA 5E2OA 1O2PA 3BIUH 1GI5A 3T62A 1UVOA 4K60A 1YC0A 5F6MA 2ZU4A 4GVUA 5FBEA 2BY5X 2A7JA 1SGNE 2AH4X 1ELCA 1CA0C 1BRCE 9LPRA 4YLQH 1EJAA 3A7VA 2FESH 4YESB 2GZ8A 1KTSB 4K5ZA 2BQWB 1NRRH 2W7UA 3ELAH 1O3BA 1BTYA 1OOKB 4NA9H 3FZDA 5FAHA 5GCHG 1K1MA 2ZNKH 1O5GH 3FVFB 2B7DH 3W95A 1ZZZA 2FXRA 1RIWB 1K1OA 1FUJA 1UTJA 1ZSJA 1TOCB 1KSNA 4K1EA 1H9LB 3UFAA 3SNAA 1PPFE 1AE8H 1TNKA 1GBEA 1INCA 1CU1A 3AASA 3GCHB 1O2TA 1IAUA 4CR5A 1HGTH 3D49H 2FM2A 4XDEA 2EA3A 5C1UA 1C2FA 4AZ2B 4MNYA 1TGBA 2VGCC 3UY9A 5FPSA 1SGIB 1KLJH 3ZZAA 1KXFA 3NCLA 3NWUA 3N7OA 3A7TA 1V2UT 4SGBE 2Z9IA 3ZZCA 1G2MA 1O2WA 3P17H 2PKAB 1KXAA 1A0HB 1DPOA 1YBWA 2C8XB 3UR9A 3EDXB 1F0SA 4ZXXH 3ZZ9A 5AF9H 1ZMNA 2GT7A 1EZXC 1OXGA 2VVUA 4YM9A 1PPBH 1K1IA 3M35A 1ZOMA 2A4OA 4BAMB 4O97A 1T7CA 1ARCA 2VIPA 3T29A 2ZGBH 2TBSA 1Z71A 3BTEE 2QXHA 1CO7E 1S0QA 4NCYA 3I78A 3U69H 4HFPB 1SC8U 4ABHA 4FUFA 1H9HE 1NS3A 3SJIA 1P8VC 1ANBA 2CF8H 3BTQE 2GZ7A 1J9CH 1RTLA 4X1QU 6CHAC 3U9AH 1AB9C 1HAIH 3SBKA 1IQNA 4IBLH 2GT8A 3ZZ6A 5SGAE 1FIZA 2AYWA 1C1UH 5A2MH 4ISNA 1O3PB 5DG6A 1Z8JB 1S81A 1K1NA 1X7AC 2RA3A 1W12U 1W14U 2WPHS 4WMEA 4F49A 1BRBE 1WCZA 5C1XA 3ODDA 1THRH 1MTUA 1P02A 3CS0A 1H1BA 4ISHH 3BTKE 3E16B 3H5CB 4H6TA 3SUGA 1P2QA 4JCNA 3STJA 1MCVA 4Y6DA 1C5WB 4ZROA 1Z7KA 1O2ZA 2Z9JA 3A81A 2XBVA 1ELVA 3ESTA 4UDWH 1Z6JH 4BTTB 1G3EA 4NFFA 2A5AA 1E36B 1ZMJA 2H9HA 1A4WH 2P16A 1W3CA 1HFDA 1UHBA 4NIWA 4WJG2 4CRCA 1C5OH 3HKJB 2A5KA 2ESTE 1RTKA 1TNIA 5F03A 1HJ9A 3O8BA 3W94A 2VWNA 3MOCA 2XBWA 1TGNA 3KF2A 4B1TA 4LXBH 2G4TA 1GI0A 3LC3A 2ODPA 4INLA 3TLOA 4DCDA 1BMNH 1JBUH 1P01A 1UTQA 4ABJA 1IQHA 4BOHA 1TIOA 1TOMH 2Y81A 1J8AA 1T4UH 1O3EA 4BNRA 7LPRA 4CRDA 3OU0A 2QXJA 1NRQH 2V3OH 1CHGA 1HCGA 1UVPA 1FIWA 2O8UA 2WPMS 2ODQA 2P8OB 4A1TA 3MU1A 4LZ1H 1NU7B 3RUOA 1ELFA 3VB3A 2ANKH 2A31A 1DT2A 1MKXH 3TH2H 2GV6A 1UVTH 2XWAA 3ATLA 5PTPA 2QC2A 5DP4A 3RXBA 1QB1A 2GMTB 3RDZA 2B5TB 1FPCH 2XBXA 2XWBI 1DXWA 2AIPA 1FQ3A 1UCYH 3E3TA 1D6RA 2P93A 4FUJA 3HPTB 2BZ6H 3M5NA 1GJ6A 1MKWK 3CP7A 4B2CA 1ZPBA 4GPGA 5F8XA 1DM4B 2P95A 2TIOA 3ZZ4A 2ZFPH 1N8OC 2Y80A 3LGIA 3SI3H 3H7OA 1YKTA 4CBNA 4XBBA 5H4IB 1QB9A 1A1RA 3NKKA 2PW8H 4LZ4B 1WTHD 1EUFA 2CMYA 5HXFA 4WMDA 3D62A 2F9PA 5JBBS 4Y7BA 2JH6D 1TALA 1BZXE 2VVCA 3MU4A 2H5DA 1BBRE 1XXDA 3SV2H 4B71A 1JRSA 1QBVH 1Y5AT 3EA8A 5GIBA 1A5IA 3RC4A 3SHAH 1AKSA 1O33A 2AEIH 4UD9H 1FXYA 3RXIA 2KAIB 5DO4H 3SV9A 2ZFTA 2WINI 4PROA 1TRYA 1EX3A 2FP7B 3Q3XA 3DA9B 1HYLA 2OQ5A 4YOJA 1CSOE 1O0DH 1SGFA 2SGEE 4D8NA 1ACBE 3DFJA 3SOSA 3CS7A 1ESBA 2AMDA 5T6DA 1OWKA 1PYTC 2GZ9A 2LPRA 5FHTA 1D3TB 1BA8B 3L3TA 2PSYA 3RXVA 1C1RA 1MTSA 4RN6A 2ZECA 4DOQA 1K2I1 1ESAA 1VITG 1DWCH 4CREA 1A0LA 2HVXA 1SPJA 2ANWA 2CF9H 4NWLA 4X0WU 4AYVB 3VB4A 1TA6A 2A4GA 3HGPA 3U8OH 4B2AA 3MU8A 3RXRA 3BG8A 3FP7E 1MTNC 2A2XH 1WAYB 1Q3XA 1Y5UT 2C93B 1UMAH 3H7TA 1CT2E 1GBHA 1ANCA 1L2EA 4ZHLU 1THSH 1GI9B 1C4V2 1J15A 1RTFB 2FWWA 1GGDB 1U6QA 2AGEX 3BTWE 1W13U 1P9SA 1A3EH 3RXSA 1FY5A 2ALVA 3Q77A 1AI8H 2PGQB 2BVXH 2HNTC 4UE7H 1GJAB 2FTLE 3QK1A 5FBIA 4BTUB 1TX6A 1SGYE 1HLTH 1BTWA 1B0FA 1OP8A 6LPRA 1WSSH 3PROA 3SW2B 1KTTB 5DP3A 1V2LT 3SQEE 2BXTH 3JZ1B 4NIXA 1KDQA 5CHAB 1ZGVA 3PYHA 3RU4T 1GI1A 1QCPA 3PM3A 1BTUA 3RXUA 3L33A 1UK2A 2H9EH 1UJ1A 1AGJA 4YT7H 2STAE 3U1IB 2ZFRH 1V2RT 1XUKA 3SUDA 3ZZ8A 2FEQH 1BTHH 1ZTLA 2Q6FA 2AMPA 4ZAEA 3NUMA 4ABBA 4I33A 5C3NA 4D9RA 3QN7A 2ILNA 3RMNH 1AFQC 1QB6A 2BLOA 1ZPCA 3TH4H 1C5ZB 1E34B 2Z6BD 2VIWA 1LVBA 2SGDE 1AO5A 1G3DA 3SGBE 1K1PA 3RLWH 2ZHQH 3MH6A 1G36A 1YPHC 3DFLA 1TRNA 1HAZB 3P95A 4CH8B 1GCDA 4I8JA 1C1WH 1SGCA 3M5LA 4NZLA 1ANEA 4O9VA 1DOJA 3MYWA 2A32A 3SI4H 1TNHA 4NWKA 2BD7A 5L2ZH 5C5NA 2PFEA 3SU2A 2GCHG 1HBTH 1DWDH 1IHTH 1GHBF 4X6OA 5JYIA 1JOUB 1O2KA 1NROH 5AFZH 1O2MA 1QA0A 1AZZA 2WUCA 5EOKA 1B0EA 2QXIA 2P3FH 4OGXA 1GI3A 4RSPA 3BIVH 1HXFH 2D2DA 1C1OA 5EQQA 1W2KH 5DP9A 3AAUA 1BBRH 1NRSH 5AHGH 3SUFA 1PQ7A 4A6LA 3E0PB 2QV1A 2AIQA 1GBMA 1XKBC 3ZVCA 3RXAA 4K8BA 1RFNA 2WPJS 1SVPA 1YPKH 1IHSH 2OBOA 4ABAA 4DGJA 4NA8A 1UVSH 2EEKA 2ZHWH 4E7NA 1KXBA 1LPGB 2H9TH 4TWYA 3PTNA 2XXLA 3RU4E 1QFKH 1C1PA 1CA8B 2XC5A 1GMCF 1KIGH 3EA7A 4AFZA 3UOPA 2O8TA 5A0BA 1EZUC 1K1LA 3TGJE 3KN2A 1RJXB 1KY9A 1C5PA 3TITA 2VU8E 1VITF 2ANMH 1AQ7A 3Q76A 2UWLA 4YT6H 5DP8A 1ELBA 3LGUA 3WY8A 4LK4A 4AN7A 4K69A 2VH6A 1GHZA 2HNTE 1C5LH 1YCPH 2BD9A 1TGSZ 1Y3YA 4XOJA 4YTAA 3T5FH 2CJIA 2NU1E 4MPWA 5LPEA 1EKBB 2M5TA 1UTKA 1VCPA 4JYUH 3MNCA 3SJKA 3RXHA 2BD3A 2FLRH 1TYNA 1EAWA 5BRRE 2Q6GA 2BDIA 1WTGH 4I8LA 3F1SB 1YF4A 3A7YA 4K2YA 4DT7B 1GBAA 4X6PA 1NTPA 3UREA 1C2EA 4X1SU 3HK6B 1XM1A 1S5SA 4ASHA 3RXEA 4QT8C 2SGPE 1O2OA 2CGAA 1UTNA 2B0FA 2ULLA 2PUQH 2I6QA 3RMOH 4JZEH 1GBBA 2R0KA 4Z0KA 3OX7U 4JZDH 1NFUA 1A61H 1LTOA 2Y5GA 1V6DA 5F8TA 1P2NA 1LKBA 2PGBB 1AHTH 4X8VH 5AVDA 1HAVB 2BD8A 4X8UH 3RP2A 1S83A 1S6HA 4FVBA 5AFYH 5JPMH 3P8FA 1HJAC 2F91A 1YPHE 2OC0A 2D26C 1S85A 2Q6DA 1GBDA 1ZHPA 1QNJA 4AG2A 3A86A 2G55A 1S6FA 2Y82A 1Z1IA 1CE5A 3BN9A 4JK5A 3SV6A 1LHGH 3GY4A 1OX1A 4R0IA 5DP5A 3EQ0H 2J94A 1LPZB 2QN5T 4JMYA 3TVJB 1G3CA 2F9NA 2ZU3A 2BY7X 1FN6A 1ABIH 1TABE 4A1VA 1P12E 1EPTC 3VXEH 1HRTH 3B9FH 4ZHMU 1HV7A 1DY9A 2QA9E 5E8EH 1A46H 1V2TT 3MNSA 4H42U 1P2KA 2J95A 2Z9LA 2JH0D 3URDA 2PKAA 1G3BA 3FANA 5A8XA 1FI8A 4AOQA 2VWLA 1J14A 1OP2A 2TGTA 5EQRA 1P06A 2ZGJA 3MH7A 1E0FD 4XSKU 2GCHF 3MO6A
chains in the Genus database with same CATH superfamily
4UFGH 3A88A 4WXVA 4ABDA 2BDCA 4FU8A 2VIOA 3ATWA 3GCHC 3PWCA 2ZA5A 3M7UA 1HUTH 3SJ9A 3G01A 1C1MA 1K1JA 1VGCB 1PPGE 1JIRA 1HAXB 2F83A 3QGNB 3B8JA 3M5OA 1ZSKA 4MNVA 1SGFG 3RC5A 1O5AB 4ZKNU 1UTLM 7ESTE 1P11E 1W11U 2FOGA 5FL7D 2O8MA 1C4Y2 5GNDA 1E35B 1NFXA 3QTOH 1QTFA 4INHA 1TRMA 3RXQA 1AIXH 3SNCA 2C8ZB 1O31A 4NG9H 2BY8X 1P2MA 1D3QB 1O3KA 2FI5E 2OC7A 4DY7B 1XX9A 3EE7A 3HGNA 3EE0B 3LC5A 3UQVA 3QZRA 1OP0A 3LU9B 4TPYA 2BDYA 3GY6A 2AERH 4BANB 2SFAA 3TGIE 3GCTG 2ZHFH 3OTJE 3TIUA 1HIAB 5J4QA 2R3UA 1BHXB 1O37A 1DDJA 1WUNH 1E1QD 3TU7H 2SGFE 1IOEA 2GVFA 4Y79A 5C0TA 2FODA 2J5UA 2H6MA 4X8TH 1FY8E 3WWBA 1K21H 1UK4A 3E6PH 3SGQE 1TBZH 1TA2A 5CHBA 5I25A 2DUCA 1SGTA 5K0HA 3ODFA 3ZYDA 2XCNA 1FMGA 1P9UA 4YOIA 2ZTYA 1O3FA 2A2QH 2AFQB 2ZDVH 4F55A 1HDTH 1NRNH 3U8TH 1GG6C 4Y8XA 1D3PB 5A0CA 5GWZA 1O3OA 3PLPA 7GCHG 1CA0B 1O3MA 1XUFA 5T6GA 1C5RA 5EG4A 2Z7FE 4TYDA 3RXGA 3RMLH 4ABGA 1IQGA 1TBQH 1BDAA 1O2VA 3E91A 1PQ8A 5E0GA 3TH3H 1P10A 1PFXC 1LDTT 1QURH 3A89A 3KIDU 4BAOB 1GDQA 5HGGA 2VVVA 5ETXA 1ZRBA 4CRAA 4RT0A 8ESTE 1EAIA 2ZIQH 3SU0A 1BTZA 1Y3VA 5B6OA 1O39A 2HPPH 5FXLA 1LQEA 3ZVDA 2VJ1A 1BTPA 3ZZ7A 1QHRB 2ZDLA 4O3TA 1MZAA 5EJZA 4WXIA 1SHHB 2VGCB 1D3DB 1V2WT 3KEEA 1C1TA 4Q4LA 2OLGA 3H09A 1XUIA 3A7XA 5B6LA 1QR3E 1EJMA 1GVKB 1ZLRA 2JETC 2SNVA 1GBLA 4D7FA 4B73A 4A7IB 1SOZA 1TX7A 1BRUP 1C2HA 2ZTZA 2NU0E 2BB4A 1C9PA 1SHYA 1CBWB 1GHYH 3UIRA 1OKXA 2GTBA 1PPEE 1SLUB 5LPFA 1Y5BT 3PMAB 1K9OE 1EASA 2ZKSA 3RLYH 1GWAA 4OS5A 2PTNA 4HTCH 5IYTA 1F7ZA 2IOTA 4NIVA 2J38A 1RRKA 2LELA 4B6FA 2ZU5A 2R3YA 3U98H 3ATKA 1OWJA 3AVZA 2OCVB 1O5EH 1ESTA 4NSVA 2IN2A 2FYRA 2XTTB 2ZGXH 1QRZA 4DURA 1N6XA 1EB1H 1HAPH 3PV4A 3ZVEA 4DVAU 2W5EA 1AUTC 1SG8B 5EJ1A 4FUEA 2KAIA 1O2XA 6CHAB 5EODA 1W10U 4I8HA 1SLVB 4GHQA 1AB9B 1Z8RA 3RC6A 1GJ5H 3OFND 4BXWA 3UNRA 3MNXA 4GCHF 5FCKA 4NZQA 4B2BA 3UR6A 5E0JA 1BUIA 1C2IA 1Y3UA 4UFDH 1C5XB 4K3JA 5GPIB 1DANH 3Q3YA 3WWFA 1Y3XA 4X1RU 1TGCA 4JYVH 5LGOA 1YM0A 2XC4A 1FX0B 4NA7A 2QF5A 4E06H 2CHAC 1UW7A 1LMWB 3BG4B 4XD7D 2QGRA 4X2XA 1L1NA 1D9IA 1P57B 1IQJA 5JB9S 3S7HB 3FOAA 4A1XA 1ZPZA 2C90B 1V2ST 4MNWA 1EOLA 5JBAS 1AE5A 3HKIB 2ZPSA 2FIRH 2G52A 2OINA 2QIQA 2O9QA 3S0NA 3TNSA 2D1JA 1BB0B 3GCTF 3KQEA 1WXRA 1GJ7B 1LKAA 1QQUA 1EXFA 4DW2U 2H1UA 4JYTA 2Z3CA 4X6NA 1KYNA 2Y6TA 5FPTA 3E1XB 1AY6H 3ZVFA 1ZJDA 1GHBG 4Y71A 3RXKA 2CXVA 3ATMA 4XE4A 4ABFA 1V2QT 2WV9A 2EI7A 4MLFB 4E7RG 2PKSB 3UPEA 2YOLA 2V35A 1TFXA 3EGKH 2VB0A 3I77A 1EFRD 2ZDKA 2ZG0H 1C5YB 3LGWA 7GCHF 8LPRA 1CT0E 4YXWD 2JKHA 5FX5A 1NO9H 4ZKSU 1LVOA 1E79D 1P05A 2KM0A 2G51A 1SSXA 5EIYA 1JMOH 2TPIZ 3QGJA 1MAYA 2VWMA 4FXGH 2OBQA 1HXEH 2RDLA 1F92A 1TPSA 4AB9A 1A2CH 1OSSA 1F0UA 1GMCG 4I8GA 3RMMH 1EP6A 4OS7A 1A7SA 1FNIA 1J17T 1P04A 2H5CA 1ZJKA 1O5FH 4IW4E 1FJSA 1N8OB 1DXPA 1GCTB 2IPHA 1GBJA 3M37A 3QX5H 3A85A 3A82A 1YLDA 3GICB 3KYGA 4IMZA 1CQQA 1T32A 3PV5A 1O2HA 1AVGH 1ABJH 2QY0B 1AVXA 2PV9B 2VIQA 1ZGIA 2QCYA 4SGAE 4OS6A 4KKDA 1DLEA 1O3GA 1ZHMA 4AFSA 2HALA 1OWIA 3FAOA 3MI4A 1TAWA 2Z3EA 1SKYE 4B75A 3R3GB 3MMGA 4Q7YA 3P8OA 1K28D 2BLWA 1P3CA 3M3TA 1O5BB 9ESTA 4X1NU 3GY8A 1ID5H 1MKXK 1EOJA 2PSXA 3E90B 2BX4A 2SNWA 3UQOA 2R0LA 1LQDB 1W0YH 1EZSC 2ZP0H 2BVSH 3ENSB 3BTME 1UCYK 2R2WU 1VCWA 4AFUA 4GHTA 3JZ2B 4FU7A 2DE9A 2XNIA 1SGQE 1WU1A 3BTDE 4U2WA 2HWLB 2GJGA 2GKVE 1OYTH 5T6FA 1MTNB 2QF0A 1EP5A 1O5DH 3VG8A 3VGCC 2BQ6B 2F9VA 4IGDA 1AD8H 3P70B 3D65E 2A7HA 1W8BH 3K6ZA 1TBRH 3OTPA 1L1GA 2TRMA 2BD2A 1FY1A 4FVDA 4ASUD 2FOHA 2ZPRA 1C5NH 3LT3A 2GCTC 1O30A 4FUDA 2L6OA 1GI2A 4MTBA 1T8NA 5EW2H 1GL1A 2YNAA 1DICA 4ISOA 4E05H 3BTGE 2WV5A 1XMNB 2JH5D 2IJOB 2FDAA 3FP6E 3UNQA 3AW1A 4UONA 2LNCA 3PWBA 3K6YA 1D4PB 2BVRH 1SLXB 1T8MA 3M3VA 2BMGB 2PTCE 3O8DA 2ZFFH 2AMQA 1CGHA 1V2KT 1PQAA 1V3XA 1DSUA 4RKOB 1NN6A 1C2MA 3GYLB 3S69A 1AFQB 2EY4C 3T2NA 4AG1A 3NK8A 1HPGA 1HAVA 5EXMA 3BF6H 3V12A 1P2OA 4RKJB 3UWJH 5A0AE 1TNGA 2WPKS 1Q31A 2ZC9H 5J4SA 4MG3A 2J34A 4FUIA 2KX4A 2G5VA 1UTMA 2FOEA 3KHVA 3BV9B 4IN2A 4KTSA 1KXCA 1KLIH 1C5UA 3SZEA 2OC1A 1BJVA 2BDHA 1ELEE 3DSOA 1WV7H 2YMSC 2ODYB 1O2YA 1GJ8B 3GDVA 4P02A 3DSGA 2O8LA 3ATIA 1A0JA 1YPMH 1BTXA 1GDNA 2I6SA 1QL7A 2PWXA 1L1JA 3MU5A 3FN8A 4TWWA 2BYAX 5C5OA 1TMUH 1GJ9B 2G81E 5JB8S 4JK6A 2NWNA 2L74A 4X8SH 2F9BH 3O8CA 3DSPA 3IG6B 1MZDA 1P2JA 1JWTA 4VGCC 4ZHAA 3MO3A 4J2YB 3TPIZ 1C5QA 1TNLA 1H4WA 1SGPE 2WPDD 3ZVAA 4M7GA 1MBMA 2XYAA 4ESTE 4K1TA 4HZHA 2A5IA 2TGDA 5ESBA 1AU8A 1JXPA 2ZDAH 5JBTA 2C4FH 2GDEH 4TPIZ 3ZVGA 3M5MA 5KEDA 1N6YA 1ZYOA 5DP7A 2F3CE 2AGGX 4HGCA 3ZYEA 3TJVA 1T4VH 3BTHE 5GJ4B 2QF3A 2Z9KA 1LHDH 3N7EA 3P8GA 3NZIA 4H4FA 5DK1A 3UTUH 4BAHB 1TB6H 4TY7A 2A45B 2P94A 1EAUA 2A4RA 5HIZA 1OWHA 2G4UA 1CGJE 2HOBA 4IMQA 4Y0YE 1TPAE 3LOXA 1UVUH 1GL0E 2CN0H 3F9FA 1MQ6A 1W7GH 3KGPA 1E37B 4OS4A 5C20A 2FS9A 2ZQ2A 4CHAC 3F9HA 5EW1H 1FY3A 1V2NT 1C5VA 5JDUB 1HAGE 1SMFE 1THPB 1FAKH 3MHWU 4Q7ZA 1MU6B 3B23B 1GHVH 1O32A 1AMHA 7KMEH 1HIAA 1V2JT 1NU9A 2OC8A 1XUHA 5TCCA 1DWBH 2Q1JA 1K22H 1P09A 2D8WA 2WSSD 4U32A 2XRCA 2ZHDA 1QY6A 1GMDG 2F4LA 4FU9A 2UUKB 1F0RA 2FO9A 3FP8E 5HIYA 2BY6X 3SU5A 1BBRK 4J1YA 1RGQA 1SBWA 4ZUHA 5CE1A 1MUEB 3QZQA 2HRVA 3MU0A 2ZZUH 5EXNA 1SI5H 4Y76A 1ZR0A 3BTTE 3SHCH 2HLCA 1RIWC 1ZRKA 3TJOA 1TE0A 3EA9A 1C2DA 1XUGA 1O2IA 3V0XA 5FPYA 3GOVB 3PO1B 1N1LA 1QRXA 1DS2E 1HJAB 1NY22 4GCHG 1EZQA 2WHXA 2J4IA 4CR9A 3GDUA 2VH0A 3SZNA 1GHAG 1CHOF 1G9IE 1C1VH 2G8TA 3K9XB 2Y5HA 1BJUA 1OWEA 2IJD1 5CDFE 3P6ZB 1C1NA 3NRLA 4WMFA 2Y7XA 1V2VT 8GCHF 3MQKC 1LVMA 2F9OA 3BTFE 2XBYA 4DJZB 4XBDA 6GCHG 1HJ8A 1SOTA 1EQ9A 4B76A 1M9UA 3M7QA 1YCPK 4FETA 1DX5M 4I31A 1MTVA 5GDSH 3SUEA 4IN1A 2BDBA 5DJ7A 3MH4A 1PQ5A 1TWXB 1H8DH 2BZAA 2ZGCA 3TK6A 1RXPA 3RXMA 3T25A 1O3AA 1EPTB 4GAWA 4CH2B 2FI3E 5C2ZA 4JZFH 1LCYA 3RU4D 2BXUH 3SU1A 3KYFA 3QTVH 3U1JB 1Z8GA 1DUEA 1MD7A 1UCYE 4UEHH 1O2UA 4RT1A 2HGTH 1O35A 3V7TA 4ZXYH 2P3TB 1W7XH 4NSYA 1MH0A 4HI3A 4WH8A 1O38A 1GMHF 5GXPA 1OS8A 1GBTA 1NRPH 5CMXH 1AWFH 1F2SE 1L4ZA 1IQEA 1MMJN 1QIXB 1SGDE 1BITA 1FONA 1FV9A 3KCGH 1GI4A 4ABIA 2DE8A 2SGQE 3VEQB 5C17A 5G4BA 1IQFA 1QJ1B 1SGRE 1UK3A 2A7CA 3M7TA 1C5MD 1MBQA 1MQ5A 1GI7B 3KQCA 3ZV9A 2WYJA 1UO6A 1MKWH 3GCNA 2K1QA 4BXSA 1BRAA 4CBOA 5E0HA 1CBWC 3SU3A 3KL6A 1A3BH 1L4DA 1TGTA 3UNSA 1QZ8A 4D76A 1SFIA 2H2ZA 1ZTJA 1G30B 1C5SA 4LOYH 1WQSA 2A0QB 4AGJA 2GV7A 2ZHEH 4K1SA 2CV3A 3KQDA 3VXFH 3L6PA 3LGYA 3A84A 3UB0A 2WPLS 3EAJA 2Z9GA 1SFQB 1C2GA 1MU8B 3ITIA 3M3SA 1TMBH 3LJOA 3PRDA 4MPVA 3QWCH 1NFWA 5I46H 2C3SA 1FDPA 3F6UH 1ARBA 4YZUA 3KNXA 2LP6A 5A8YA 1BMMH 3A8DA 4AX9H 1LO6A 5DKMA 2C8WB 3ZV8A 4AC9A 1P2IA 2B9LA 1GG6B 1QRWA 3IITA 1LHFH 1ETSH 1EAXA 1CVWH 4NFEA 4FUBA 2UWOA 1B7XB 2PP6A 1QBNA 3F9GA 1GMDF 1XUJA 5LH8A 5EPNA 3S9BA 2P8OC 4ZKOU 1SLWB 5IDKA 3S9CA 4WVPE 2AGIX 2ZFQH 4YO9A 2ZI2H 4I32A 2BLQA 2BLVA 4U01A 3BG4C 1YPGH 2P3UB 3V3MA 4DIIH 2ZEBA 2GMTC 1VJAU 2FX6A 4YLUA 2WV4A 4ZMAH 5IK2D 1F5LA 2NU3E 1AUJA 2J98B 2GD4B 2BD4A 1V2PT 2OQUA 1EATA 2OXSA 1W0KD 1KMHB 1F5KU 3VB7A 1Y59T 1FLEE 4OS2A 3SGAE 2ZCLP 2G5NA 1HAHH 3P92A 4CRBA 1LVYA 3HATH 3SJ8A 3U8RH 1ANDA 4OS1A 1GHAF 3GDSA 4KELA 3HK3B 3OY6U 2GGVB 2W7SA 1IQIA 3LKWA 1FAXA 1V2MT 1HB0B 4IC6A 1SQTA 2JETB 1VCQA 3DCLA 1L0ZA 1CT4E 1RD3B 4YOGA 5TCAA 6GCHF 3PLBA 2ANYA 4WWYA 1NC6A 3RXDA 1SR5C 2PKSC 3GS9A 2OP9A 2Y5FA 3DD2H 3TJUA 3PMBB 2Z94A 2BTCE 2ZO3H 1T8LA 4Y11E 5T3HA 2B8OH 2GP9B 3A87A 2OTVA 4P00A 1PPZA 2UUJB 1XKAC 1O3DA 1VZQH 1YPLH 3QLPH 3MH5A 5C1YA 5HMAA 2FMJA 1JIMA 5GCHF 1AN1E 4BTIB 1O5CB 3FO8D 3K2UA 1LHCH 4GLYA 3STIA 4IS5A 3AAVA 1Z6EA 2ZFSA 5HYOA 3SO3A 1ZMLA 2VIDA 2HNTF 2FPZA 3ZZDA 4Y10E 5A8ZA 4FUGA 2QAAA 3DT0H 1S0RA 1FN8A 4BAQB 2EI6A 5HM9A 4ZH8A 2BD5A 3Q00A 1KXDA 2ZWLH 1YPJH 1T8OA 3OEED 3FFGA 5HM2A 3A8AA 2HLDD 1A5GH 1GCTC 3MNBA 1MTWA 1YYY1 5EU8A 5BPEA 1UTPA 2SGAA 3NPSA 1UHBB 1O2SA 2CHAB 3VPKA 1EJNA 2BX3A 2KCAA 2FS8A 2ZCKP 2W26A 1Z1JA 2BHGA 1SQOA 3ZZ5A 4BAKB 1WBGB 2C8YB 1H9IE 1QBOA 1GBKA 3ZZBA 1GGDC 1QQ4A 1ELTA 4X2WA 2NU4E 3R0FA 1QJ7B 3UOUA 3D23A 1BCUH 3TK5A 2ZF0H 4FUHA 5LPRA 2XCFA 1B5GH 1GHWH 3I29A 4XFQA 3A7ZA 2KCYA 1CGIE 3SN8A 1SB1H 2ZCHP 2THFB 4XBCA 4O03A 4KP0A 3RXTA 5L6NH 2BDAA 2UUFB 1OYQA 2RFKC 1GHXH 1S84A 2KCOA 3GISB 1O2JA 3NXPA 1TQ0B 1S82A 2JDID 3VFEA 5CHAC 1LPKB 3QDZB 4AFQA 4MDSA 2ZTXA 1VITH 1YPEH 2W6ID 1PPHE 2TGPZ 3SQHE 2GDDA 3C1KA 2R9PA 3GCOA 4D9QA 2FOCA 3RXCA 4D7GA 3BSQA 2G00A 1C5TA 2FOBA 1W0ZU 2PLXA 2V3HH 1HAYB 2TGAA 5EJLA 1YLCA 3SU6A 4HG6A 3KQBA 1GJ4H 3LH3A 2FOFA 4NGAH 4Y0ZE 1C1QA 1DITH 1GI8B 3QUMP 5EPYA 3Q3KA 4MPXA 1P3EA 4UFEH 3VB6A 2VIVA 2EQNA 3VB5A 1NFYA 2AS9A 2BY9X 3RM2H 3GY2A 1GBIA 2ASUB 4ISIH 1O3IA 1ZHRA 2ZDNA 2R2MB 3DUXH 3SV7A 3SNEA 1DUAA 3O8RA 1FY4A 3A83A 3SORA 4X1PU 4AGKA 4Q80A 2J2UA 3QO6A 2FOMB 3C27B 1P03A 1GVZA 2FTMA 1DSTA 1AKSB 1PJPA 3AW0A 3F3BA 4IC5A 5K7RA 3MWIU 1YGCH 2NU2E 3BEUA 4WY3A 4ISLA 4Q2KA 1O2NA 5EGMA 2YNBA 3PMJA 2WPIS 3DHKH 3S9AA 1IQMA 1XVMA 2F9UA 1DVAH 1G2LA 1E38B 2ZQ1A 1O2GH 1NBME 2ZGHA 1QGFA 1TNJA 3KQ5A 1TX8A 5ESTE 1YP9A 4CRFA 5FX6A 2W3KA 1AFEH 4FUCA 1O2RA 4MNXA 5E2PA 1SQAA 3LPRA 5F8ZA 1T31A 3UUZA 1QL8A 1ZSLA 2Z3DA 1BT7A 1O3JA 3P8NA 4Z6AH 2FX4A 2J9NA 4CRGA 2WYGA 3IWMA 1IQLA 1SL3A 1O3NA 2K0QA 1EB2A 3ZVBA 2VNTA 3RXJA 4NIYA 1SQRA 1QA7A 1CHOG 4DIHH 2FOAA 1G32B 1NM6A 3OSYA 1FZZA 1LHEH 1SGEE 1C2KA 1ORFA 3S7KB 2XW9A 4AB8A 8GCHG 3MO9A 3VGCB 5DGJA 2IPQX 1C9TA 1GBCA 1NESE 4GSOA 4X2YA 1DE7H 4X2VA 3GY5A 1AZ8A 3MTYA 3V13A 2ZDMA 1YY3A 2EI8A 1YLNA 3E0NB 2RG3A 4KTUA 6ESTA 1Q2WA 4ZKRU 4X6MA 1GJDB 5A09A 1KDQB 1MAXA 1UTOA 3LONA 4A92A 3MFJA 4ABEA 4A5TS 3URCA 1XVOA 5T1VA 2GX4A 2GCTB 1BQYA 3T27A 1GJCB 3FZZA 1MCTA 3K65B 4KTCA 1O34A 2ZU1A 3GYMA 1HAOH 2RA0A 5KGOA 3SV8A 3LGTA 1TLDA 1MD8A 2ZU2A 1Z8IB 1OPHB 2HPQH 4K8YA 2V6NA 1WOFA 4OGYA 5L2YH 1C2LA 1GMHG 4MPUA 1BHXF 1GDUA 2AHME 1TPOA 5C67A 1GJBB 3M36A 2BQ7B 1RS0A 3LJJA 2PR3A 4GUXA 1GPZA 2A4QA 1AVWA 3ZZ3A 2W3IA 2ZPQA 4O3UA 4JZ1A 3OE7D 4INKA 2FI4E 3TK9A 2BOKA 1ZTKA 1QL9A 2ALPA 3F9EA 2XC0A 1IQKA 4H6SB 3A8BA 1VJ9U 2QF4A 1F5RA 1G37A 5KECA 5TJXA 5EQSA 4OM9A 1Y3WA 3LIWA 5L30H 2EC9H 4MVNA 1PPCE 1AWHB 4R8TB 3PLKA 3BEFB 3LH1A 3UWIA 1ELDE 1BMLA 3GY3A 2OUAA 4Y8ZA 1F0TA 1O2LA 5DP6A 4U30A 1ELGA 5DPAA 2A1DB 1WDIA 1C4U2 1WQVH 1TPPA 1ETTH 1WYKA 2BOHB 1COWD 1C1SA 2BM2A 5JBCS 1O3CA 2YMSB 1NZQH 1O36A 1O2QA 2UWPA 1QJ6B 3RXLA 1KLTA 1J16A 4KGAA 4Y8YA 2FZZA 1NT1A 3N99A 1OWDA 3PTBA 1GVLA 4I7YH 3SU4A 1O3HA 1BOQA 3A80A 3PB1E 2VWOA 4MQAA 1EPTA 1YCPM 3TNTA 5FCRA 3RXFA 2F43B 3RM0H 3OYPA 2BDGA 1A5HA 1P0SH 3PO1C 1BMFD 3TGKE 4AORA 3TJNA 4WH6A 2JJ1D 4VGCB 1VGCC 1DWEH 2Y7ZA 1ETRH 3E8LA 3EYDA 3LGVA 4AYYB 3OY5U 4THNH 3SJOA 1TMTH 3SNBA 2WUBA 1BMAA 1D6WA 1VR1H 2RCEA 1GI6A 2QYIA 2V0BA 1TONA 3OAAD 1BIOA 1NBMD 3BEIB 3LDXH 2QXGA 1KXEA 4TY6A 3A8CA 3RXOA 1DLKB 1TQ7B 2FLBH 1ELAA 8KME2 1GBFA 1O3LA 2OD3B 3CNRA 3U28C 1H8IH 5ABWA 3SNDA 1XXFA 2UUYA 1FPHH 1C2JA 4I8KA 4B74A 3T26A 5EXLA 1Y8TA 3F68H 1DFPA 3A7WA 4JZIA 3T28A 2VINA 2STBE 4Y7AA 1HNEE 2O8WA 3M61U 4WF8A 4CHAB 2K8IA 1NPMA 3CENA 1PYTD 3PMHB 2FYQA 3GY7A 4F4OC 1DY8A 4Q7XA 2P59A 1V2OT 2PUXB 2PHBA 4DG4A 4UFFH 3RXPA 2J92A 1JRTA 5E2OA 1O2PA 3BIUH 1GI5A 3T62A 1UVOA 4K60A 1YC0A 5F6MA 2ZU4A 3F0OA 4GVUA 5FBEA 2BY5X 2A7JA 1SGNE 4TSFD 2AH4X 1ELCA 1CA0C 1BRCE 9LPRA 4YLQH 1H8ED 1EJAA 3A7VA 2FESH 4YESB 2GZ8A 1KTSB 4K5ZA 2BQWB 1NRRH 2W7UA 3ELAH 3F0PA 1O3BA 1BTYA 1OOKB 4NA9H 3FZDA 5FAHA 5GCHG 1K1MA 2ZNKH 3N7DA 1O5GH 4ACBA 3FVFB 2B7DH 3W95A 1ZZZA 2FXRA 1RIWB 1K1OA 1FUJA 1UTJA 1ZSJA 1TOCB 1KSNA 4K1EA 1H9LB 3UFAA 3SNAA 1PPFE 1AE8H 1TNKA 1GBEA 1INCA 1CU1A 3AASA 3GCHB 1O2TA 1IAUA 4CR5A 1HGTH 3D49H 2FM2A 4XDEA 2EA3A 5C1UA 1C2FA 4AZ2B 4MNYA 1TGBA 2VGCC 3UY9A 5FPSA 1SGIB 2J98A 1KLJH 3ZZAA 1W0JD 1KXFA 3NCLA 3NWUA 2HVYB 3N7OA 3A7TA 1V2UT 4SGBE 2Z9IA 3ZZCA 1G2MA 1O2WA 3P17H 1KXAA 2PKAB 1A0HB 1DPOA 1YBWA 2C8XB 3UR9A 3EDXB 1F0SA 4ZXXH 3ZZ9A 5AF9H 1ZMNA 2GT7A 1EZXC 1OXGA 2VVUA 4YM9A 1PPBH 1K1IA 3OEHD 3M35A 1ZOMA 2A4OA 4BAMB 4O97A 1T7CA 1ARCA 2VIPA 3T29A 2ZGBH 2KZ4A 2TBSA 1Z71A 3BTEE 2QXHA 1CO7E 1S0QA 4NCYA 3I78A 3U69H 4HFPB 1SC8U 4ABHA 4FUFA 1H9HE 1NS3A 3SJIA 1P8VC 1ANBA 2CF8H 3BTQE 2GZ7A 1J9CH 1RTLA 4X1QU 6CHAC 3U9AH 1AB9C 1HAIH 3SBKA 1IQNA 4IBLH 2GT8A 3ZZ6A 5SGAE 1FIZA 2AYWA 4DT4A 1C1UH 5A2MH 2CK3D 1O3PB 4ISNA 5DG6A 1Z8JB 1S81A 1K1NA 1X7AC 2RA3A 1W12U 1W14U 2WPHS 4WMEA 4F49A 1BRBE 1WCZA 5C1XA 3ODDA 1THRH 1MTUA 1P02A 3CS0A 1H1BA 4ISHH 3BTKE 3E16B 3H5CB 5DSFA 2J97A 4H6TA 3SUGA 1P2QA 4JCNA 3STJA 1MCVA 4Y6DA 1C5WB 4ZROA 1Z7KA 1O2ZA 2Z9JA 3A81A 2XBVA 1ELVA 3ESTA 4UDWH 1Z6JH 4BTTB 1G3EA 4NFFA 2A5AA 2W6JD 1E36B 1ZMJA 2H9HA 1A4WH 2P16A 1W3CA 1HFDA 1UHBA 4NIWA 4WJG2 4CRCA 1C5OH 4B6EA 3HKJB 1VKYA 2A5KA 2ESTE 1RTKA 2QE7D 1TNIA 5F03A 1HJ9A 3O8BA 3W94A 2VWNA 3MOCA 2XBWA 1TGNA 3KF2A 4B1TA 4LXBH 2G4TA 1GI0A 3LC3A 2ODPA 4INLA 3TLOA 4DCDA 1BMNH 1JBUH 1P01A 1UTQA 4ABJA 1IQHA 4BOHA 1TIOA 1TOMH 2Y81A 1J8AA 1T4UH 1O3EA 4BNRA 7LPRA 4CRDA 2YMSD 3OU0A 2QXJA 1NRQH 2V3OH 1CHGA 1HCGA 1UVPA 1FIWA 2O8UA 2WPMS 3W1EA 2ODQA 2P8OB 4A1TA 3MU1A 4LZ1H 1NU7B 3RUOA 1ELFA 3VB3A 2ANKH 2A31A 1DT2A 1MKXH 3SYJA 2GV6A 3TH2H 1UVTH 2XWAA 3ATLA 5PTPA 2QC2A 5DP4A 3RXBA 1QB1A 2GMTB 3RDZA 2B5TB 1FPCH 2XBXA 2XWBI 1DXWA 2AIPA 1FQ3A 1UCYH 3F2HA 5F53A 3E3TA 1D6RA 2P93A 4FUJA 3HPTB 2BZ6H 3M5NA 1GJ6A 1MKWK 2XOKD 3CP7A 4B2CA 1ZPBA 4GPGA 5F8XA 1DM4B 2P95A 2XNDD 2TIOA 3ZZ4A 2ZFPH 1N8OC 2WZQA 2Y80A 3LGIA 3SI3H 3H7OA 1YKTA 4CBNA 4XBBA 5H4IB 1QB9A 1A1RA 3NKKA 2JJ2D 2PW8H 4LZ4B 1WTHD 1EUFA 2CMYA 5HXFA 4WMDA 3D62A 2F9PA 5JBBS 4Y7BA 2JH6D 1TALA 1BZXE 2VVCA 3MU4A 2H5DA 1BBRE 1XXDA 3SV2H 4B71A 1JRSA 1QBVH 4ZCNA 1Y5AT 3EA8A 5GIBA 1A5IA 3RC4A 2KCPA 3SHAH 1AKSA 1O33A 2AEIH 4UD9H 1FXYA 3RXIA 2KAIB 5DO4H 3SV9A 2ZFTA 2WINI 4PROA 1TRYA 1EX3A 2FP7B 3Q3XA 3DA9B 4Z1MD 5C94A 1HYLA 2OQ5A 4YOJA 1CSOE 1O0DH 1SGFA 2SGEE 5C0UA 4D8NA 1ACBE 3DFJA 3SOSA 3CS7A 1ESBA 2AMDA 5T6DA 1OWKA 1PYTC 2GZ9A 2LPRA 5FHTA 1D3TB 1BA8B 3L3TA 2PSYA 3RXVA 1C1RA 1MTSA 4ACAA 4RN6A 2ZECA 4DOQA 1K2I1 1ESAA 1VITG 1DWCH 4CREA 1A0LA 2HVXA 1SPJA 2ANWA 2CF9H 4NWLA 4X0WU 4AYVB 3VB4A 1TA6A 2A4GA 3HGPA 3U8OH 4B2AA 3MU8A 5HKKD 3RXRA 3BG8A 3FP7E 3WW7A 1MTNC 2A2XH 1WAYB 1Q3XA 1Y5UT 2C93B 1UMAH 3H7TA 1CT2E 1GBHA 1ANCA 1L2EA 4ZHLU 1THSH 1GI9B 1C4V2 1J15A 1RTFB 2FWWA 1GGDB 1U6QA 2AGEX 3BTWE 1W13U 1P9SA 1A3EH 3RXSA 1YWUA 1FY5A 2ALVA 3Q77A 1AI8H 2JIZD 2PGQB 2BVXH 2HNTC 4UE7H 1GJAB 2FTLE 3QK1A 5FBIA 4BTUB 1TX6A 1SGYE 1HLTH 1BTWA 1B0FA 1OP8A 6LPRA 1WSSH 3PROA 3SW2B 1KTTB 5DP3A 3F2FA 1V2LT 3SQEE 2BXTH 3JZ1B 4NIXA 1KDQA 5CHAB 1ZGVA 3PYHA 4Q63A 3RU4T 1GI1A 1QCPA 3PM3A 1BTUA 3RXUA 3L33A 1UK2A 2H9EH 1UJ1A 1AGJA 1E1RD 2STAE 4YT7H 3U1IB 2ZFRH 1V2RT 1XUKA 3SUDA 3ZZ8A 2FEQH 1BTHH 1ZTLA 2Q6FA 2AMPA 4ZAEA 3NUMA 4ABBA 4I33A 5C3NA 2RDEA 4D9RA 3QN7A 2ILNA 3RMNH 1AFQC 1QB6A 2BLOA 1ZPCA 3TH4H 1C5ZB 1E34B 2Z6BD 2VIWA 1LVBA 2SGDE 1AO5A 1G3DA 3FKSD 3SGBE 1K1PA 3RLWH 2ZHQH 2KR7A 3MH6A 1G36A 1YPHC 3DFLA 1TRNA 1HAZB 3P95A 4CH8B 1GCDA 4I8JA 1C1WH 1MABB 1SGCA 3M5LA 4NZLA 3AK5A 1ANEA 4O9VA 1DOJA 3MYWA 2A32A 1H8HD 3SI4H 1TNHA 4NWKA 2BD7A 5L2ZH 5C5NA 2PFEA 3SU2A 2GCHG 1HBTH 1DWDH 1IHTH 1GHBF 4X6OA 5JYIA 1JOUB 2OK5A 1O2KA 1NROH 5AFZH 1O2MA 1QA0A 1AZZA 2WUCA 5EOKA 1B0EA 2QXIA 4FOUC 2P3FH 4OGXA 1GI3A 4RSPA 3BIVH 1HXFH 2D2DA 1C1OA 5EQQA 1W2KH 5DP9A 3AAUA 1BBRH 1NRSH 5AHGH 3SUFA 1PQ7A 4A6LA 3PV2A 3E0PB 2QV1A 2AIQA 1GBMA 1XKBC 3ZVCA 3RXAA 4K8BA 1RFNA 2WPJS 1SVPA 1YPKH 1IHSH 2OBOA 4ABAA 4DGJA 4NA8A 3F2GA 1UVSH 2EEKA 2ZHWH 4E7NA 1KXBA 1LPGB 2H9TH 4TWYA 3PTNA 2XXLA 3RU4E 1QFKH 1C1PA 1CA8B 2XC5A 1GMCF 1KIGH 3EA7A 4AFZA 3UOPA 2O8TA 5A0BA 1EZUC 2V3MA 4M9FA 1K1LA 3TGJE 3KN2A 1RJXB 1KY9A 1C5PA 3TITA 2VU8E 2V7QD 1VITF 2ANMH 1AQ7A 3Q76A 2UWLA 4YT6H 5DP8A 1ELBA 3LGUA 4F48B 3WY8A 4LK4A 4AN7A 4K69A 2VH6A 1GHZA 2HNTE 1C5LH 1YCPH 2BD9A 1TGSZ 1Y3YA 4XOJA 4YTAA 4XRNA 2CJIA 2NU1E 3T5FH 2KFWA 4MPWA 5LPEA 1EKBB 2M5TA 1UTKA 1VCPA 2M2AA 4JYUH 3MNCA 3SJKA 3RXHA 2BD3A 2FLRH 1TYNA 1EAWA 5BRRE 2Q6GA 2BDIA 1WTGH 4I8LA 3F1SB 1YF4A 3A7YA 4K2YA 4DT7B 1GBAA 4X6PA 1NTPA 3UREA 1C2EA 4X1SU 3HK6B 1XM1A 1S5SA 4ASHA 3RXEA 4QT8C 2SGPE 1O2OA 2CGAA 3ZIAD 1UTNA 1K0HA 2B0FA 2ULLA 2PUQH 2I6QA 3RMOH 4JZEH 1GBBA 1OHHD 3PRBA 2R0KA 4Z0KA 3OX7U 4JZDH 1NFUA 1A61H 1LTOA 2Y5GA 1V6DA 5F8TA 1P2NA 1LKBA 2PGBB 1AHTH 4X8VH 5AVDA 1HAVB 2BD8A 4X8UH 3RP2A 1S83A 1S6HA 4FVBA 5AFYH 5JPMH 5DN6D 3P8FA 3UAIC 1HJAC 2F91A 1YPHE 2OC0A 2D26C 1S85A 2Q6DA 1GBDA 1ZHPA 1QNJA 4AG2A 2VBCA 3A86A 2G55A 4RI0A 1S6FA 2Y82A 1Z1IA 1CE5A 3BN9A 4JK5A 3SV6A 1LHGH 3GY4A 1OX1A 4R0IA 4I86A 5DP5A 3EQ0H 2J94A 1LPZB 2QN5T 4JMYA 3TVJB 1G3CA 2F9NA 2ZU3A 2BY7X 1FN6A 1ABIH 1TABE 4A1VA 1P12E 1EPTC 3VXEH 1HRTH 3B9FH 1S6LA 4ZHMU 1HV7A 1DY9A 2QA9E 5E8EH 1A46H 1V2TT 3MNSA 4TT3D 4H42U 1P2KA 2J95A 2Z9LA 2JH0D 3URDA 2PKAA 1G3BA 3FANA 5A8XA 1FI8A 4AOQA 2VWLA 1J14A 1OP2A 2TGTA 5EQRA 1P06A 2ZGJA 3MH7A 1E0FD 4XSKU 2GCHF 3MO6A
chains in the Genus database with same CATH topology
4UFGH 3A88A 4WXVA 4ABDA 2BDCA 4FU8A 2VIOA 3ATWA 3GCHC 3PWCA 2ZA5A 3M7UA 1HUTH 3SJ9A 3G01A 1C1MA 1K1JA 1VGCB 1PPGE 1JIRA 1HAXB 2F83A 3QGNB 3B8JA 3M5OA 1ZSKA 4MNVA 1SGFG 3RC5A 1O5AB 4ZKNU 1UTLM 7ESTE 1P11E 1W11U 2FOGA 2O8MA 1C4Y2 1E35B 1NFXA 3QTOH 1QTFA 4INHA 1TRMA 3RXQA 1AIXH 3SNCA 2C8ZB 1O31A 4NG9H 2BY8X 1P2MA 1D3QB 1O3KA 2FI5E 2OC7A 4DY7B 1XX9A 3HGNA 3EE0B 3LC5A 3UQVA 3QZRA 1OP0A 3LU9B 4TPYA 2BDYA 3GY6A 2AERH 4BANB 2SFAA 3GCTG 2ZHFH 3OTJE 3TIUA 1HIAB 5J4QA 2R3UA 1BHXB 1O37A 1DDJA 1WUNH 3TU7H 2SGFE 1IOEA 2GVFA 4Y79A 2FODA 2H6MA 4X8TH 1FY8E 1K21H 1UK4A 3E6PH 3SGQE 1TBZH 1TA2A 5I25A 2DUCA 1SGTA 5K0HA 3ODFA 3ZYDA 2XCNA 1FMGA 1P9UA 4YOIA 2ZTYA 1O3FA 2A2QH 2AFQB 2ZDVH 1HDTH 1NRNH 3U8TH 1GG6C 4Y8XA 1D3PB 5A0CA 5GWZA 1O3OA 3PLPA 7GCHG 1CA0B 1O3MA 1XUFA 5T6GA 1C5RA 5EG4A 2Z7FE 4TYDA 3RXGA 3RMLH 4ABGA 1IQGA 1TBQH 1BDAA 1O2VA 3E91A 1PQ8A 5E0GA 3TH3H 1P10A 1PFXC 1LDTT 1QURH 3A89A 3KIDU 4BAOB 1GDQA 5HGGA 2VVVA 5ETXA 1ZRBA 4CRAA 8ESTE 1EAIA 2ZIQH 3SU0A 1BTZA 1Y3VA 5B6OA 1O39A 2HPPH 5FXLA 1LQEA 3ZVDA 2VJ1A 1BTPA 3ZZ7A 1QHRB 2ZDLA 4O3TA 1MZAA 4WXIA 1SHHB 2VGCB 1D3DB 1V2WT 3KEEA 1C1TA 2OLGA 1XUIA 3A7XA 1QR3E 1EJMA 1GVKB 1ZLRA 2JETC 2SNVA 1GBLA 4D7FA 4B73A 4A7IB 1SOZA 1TX7A 1BRUP 1C2HA 2ZTZA 2NU0E 2BB4A 1C9PA 1SHYA 1CBWB 1GHYH 3UIRA 1OKXA 2GTBA 1PPEE 1SLUB 5LPFA 1Y5BT 3PMAB 1K9OE 1EASA 2ZKSA 3RLYH 1GWAA 4OS5A 2PTNA 4HTCH 5IYTA 1F7ZA 2IOTA 4NIVA 2J38A 1RRKA 2ZU5A 2R3YA 3U98H 3ATKA 1OWJA 3AVZA 2OCVB 1O5EH 1ESTA 4NSVA 2IN2A 2FYRA 2XTTB 2ZGXH 1QRZA 4DURA 1N6XA 1EB1H 1HAPH 3PV4A 3ZVEA 4DVAU 2W5EA 1AUTC 1SG8B 4FUEA 2KAIA 1O2XA 6CHAB 5EODA 1W10U 4I8HA 1SLVB 4GHQA 1AB9B 1Z8RA 3RC6A 1GJ5H 4BXWA 3UNRA 3MNXA 4GCHF 5FCKA 4NZQA 4B2BA 3UR6A 5E0JA 1BUIA 1C2IA 1Y3UA 4UFDH 1C5XB 4K3JA 5GPIB 1DANH 3Q3YA 1Y3XA 4X1RU 1TGCA 4JYVH 5LGOA 1YM0A 2XC4A 4NA7A 4E06H 2CHAC 1LMWB 3BG4B 2QGRA 4X2XA 1L1NA 1D9IA 1P57B 1IQJA 5JB9S 3S7HB 4A1XA 1ZPZA 2C90B 1V2ST 4MNWA 1EOLA 5JBAS 1AE5A 3HKIB 2ZPSA 2FIRH 2G52A 2OINA 2QIQA 2O9QA 3S0NA 3TNSA 2D1JA 1BB0B 3GCTF 3KQEA 1GJ7B 1LKAA 1QQUA 1EXFA 4DW2U 2H1UA 4JYTA 2Z3CA 4X6NA 1KYNA 2Y6TA 5FPTA 3E1XB 1AY6H 3ZVFA 1ZJDA 1GHBG 4Y71A 3RXKA 2CXVA 3ATMA 4XE4A 4ABFA 1V2QT 2EI7A 4MLFB 4E7RG 2PKSB 3UPEA 2YOLA 2V35A 1TFXA 3EGKH 2VB0A 3I77A 2ZDKA 2ZG0H 1C5YB 3LGWA 7GCHF 8LPRA 1CT0E 2JKHA 5FX5A 1NO9H 4ZKSU 1LVOA 1P05A 2G51A 1SSXA 1JMOH 2TPIZ 3QGJA 1MAYA 2VWMA 4FXGH 2OBQA 1HXEH 2RDLA 1F92A 1TPSA 4AB9A 1A2CH 1OSSA 1F0UA 1GMCG 4I8GA 3RMMH 1EP6A 4OS7A 1A7SA 1FNIA 1J17T 1P04A 2H5CA 1ZJKA 1O5FH 4IW4E 1FJSA 1N8OB 1DXPA 1GCTB 2IPHA 1GBJA 3M37A 3QX5H 3A85A 3A82A 1YLDA 3GICB 4IMZA 1CQQA 1T32A 1O2HA 1AVGH 1ABJH 2QY0B 1AVXA 2PV9B 2VIQA 1ZGIA 2QCYA 4SGAE 4OS6A 4KKDA 1DLEA 1O3GA 1ZHMA 4AFSA 2HALA 1OWIA 3FAOA 3MI4A 1TAWA 2Z3EA 4B75A 3R3GB 3MMGA 4Q7YA 3P8OA 1K28D 2BLWA 1P3CA 3M3TA 1O5BB 9ESTA 4X1NU 3GY8A 1ID5H 1MKXK 1EOJA 2PSXA 3E90B 2BX4A 2SNWA 3UQOA 2R0LA 1LQDB 1W0YH 1EZSC 2ZP0H 2BVSH 3ENSB 3BTME 1UCYK 2R2WU 1VCWA 4AFUA 4GHTA 3JZ2B 4FU7A 2DE9A 2XNIA 1SGQE 1WU1A 3BTDE 4U2WA 2HWLB 2GKVE 1OYTH 5T6FA 1MTNB 2QF0A 1EP5A 1O5DH 3VGCC 2BQ6B 2F9VA 4IGDA 1AD8H 3P70B 3D65E 2A7HA 1W8BH 3K6ZA 1TBRH 1L1GA 2TRMA 2BD2A 1FY1A 4FVDA 2FOHA 2ZPRA 1C5NH 3LT3A 2GCTC 1O30A 4FUDA 1GI2A 4MTBA 1T8NA 5EW2H 1GL1A 2YNAA 1DICA 4ISOA 4E05H 3BTGE 2WV5A 1XMNB 2JH5D 2IJOB 2FDAA 3FP6E 3UNQA 3AW1A 4UONA 2LNCA 3PWBA 3K6YA 1D4PB 2BVRH 1SLXB 1T8MA 3M3VA 2BMGB 2PTCE 3O8DA 2ZFFH 2AMQA 1CGHA 1V2KT 1PQAA 1V3XA 1DSUA 4RKOB 1NN6A 1C2MA 3GYLB 3S69A 1AFQB 3T2NA 4AG1A 3NK8A 1HPGA 1HAVA 5EXMA 3BF6H 3V12A 1P2OA 4RKJB 3UWJH 5A0AE 1TNGA 2WPKS 1Q31A 2ZC9H 5J4SA 4MG3A 2J34A 4FUIA 2G5VA 1UTMA 2FOEA 3KHVA 3BV9B 4IN2A 4KTSA 1KXCA 1KLIH 1C5UA 2OC1A 1BJVA 2BDHA 1ELEE 1WV7H 2ODYB 1O2YA 1GJ8B 3GDVA 2O8LA 3ATIA 1A0JA 1YPMH 1BTXA 1GDNA 2I6SA 1QL7A 2PWXA 1L1JA 3MU5A 4TWWA 2BYAX 5C5OA 1TMUH 1GJ9B 2G81E 5JB8S 4JK6A 2NWNA 4X8SH 2F9BH 3O8CA 3IG6B 1MZDA 1P2JA 1JWTA 4VGCC 4ZHAA 3MO3A 4J2YB 3TPIZ 1C5QA 1TNLA 1H4WA 1SGPE 3ZVAA 4M7GA 1MBMA 2XYAA 4ESTE 4K1TA 4HZHA 2A5IA 2TGDA 5ESBA 1AU8A 1JXPA 2ZDAH 5JBTA 2C4FH 2GDEH 4TPIZ 3ZVGA 3M5MA 1N6YA 1ZYOA 5DP7A 2F3CE 2AGGX 4HGCA 3ZYEA 3TJVA 1T4VH 3BTHE 5GJ4B 2QF3A 2Z9KA 1LHDH 3P8GA 3NZIA 4H4FA 5DK1A 3UTUH 4BAHB 1TB6H 4TY7A 2A45B 2P94A 1EAUA 2A4RA 1OWHA 2G4UA 1CGJE 2HOBA 4IMQA 4Y0YE 1TPAE 3LOXA 1UVUH 1GL0E 2CN0H 3F9FA 1MQ6A 1W7GH 3KGPA 1E37B 4OS4A 5C20A 2FS9A 2ZQ2A 4CHAC 3F9HA 5EW1H 1FY3A 1V2NT 1C5VA 5JDUB 1HAGE 1SMFE 1THPB 1FAKH 3MHWU 4Q7ZA 1MU6B 3B23B 1GHVH 1O32A 1AMHA 7KMEH 1HIAA 1V2JT 1NU9A 2OC8A 1XUHA 5TCCA 1DWBH 2Q1JA 1K22H 1P09A 2D8WA 4U32A 2XRCA 2ZHDA 1QY6A 1GMDG 4FU9A 2UUKB 1F0RA 2FO9A 3FP8E 2BY6X 3SU5A 1BBRK 4J1YA 1RGQA 1SBWA 4ZUHA 5CE1A 1MUEB 3QZQA 2HRVA 3MU0A 2ZZUH 5EXNA 1SI5H 4Y76A 1ZR0A 3BTTE 3SHCH 2HLCA 1RIWC 1ZRKA 3TJOA 1TE0A 3EA9A 1C2DA 1XUGA 1O2IA 3V0XA 5FPYA 3GOVB 3PO1B 1N1LA 1QRXA 1DS2E 1HJAB 1NY22 4GCHG 1EZQA 2J4IA 4CR9A 3GDUA 2VH0A 3SZNA 1GHAG 1CHOF 1G9IE 1C1VH 2G8TA 3K9XB 2Y5HA 1BJUA 1OWEA 3P6ZB 1C1NA 4WMFA 8GCHF 2Y7XA 1V2VT 1LVMA 2F9OA 3BTFE 2XBYA 4DJZB 4XBDA 6GCHG 1HJ8A 1SOTA 1EQ9A 4B76A 1M9UA 3M7QA 1YCPK 1DX5M 4I31A 1MTVA 5GDSH 3SUEA 4IN1A 2BDBA 5DJ7A 3MH4A 1PQ5A 1TWXB 1H8DH 2BZAA 2ZGCA 3TK6A 1RXPA 3RXMA 3T25A 1O3AA 1EPTB 4GAWA 4CH2B 2FI3E 5C2ZA 4JZFH 1LCYA 3RU4D 2BXUH 3SU1A 3QTVH 3U1JB 1Z8GA 1DUEA 1MD7A 1UCYE 4UEHH 1O2UA 2HGTH 1O35A 3V7TA 4ZXYH 2P3TB 1W7XH 4NSYA 1MH0A 4HI3A 4WH8A 1O38A 1GMHF 5GXPA 1OS8A 1GBTA 1NRPH 5CMXH 1AWFH 1F2SE 1L4ZA 1IQEA 1MMJN 1QIXB 1SGDE 1BITA 1FONA 1FV9A 3KCGH 1GI4A 4ABIA 2DE8A 2SGQE 3VEQB 5G4BA 1IQFA 1QJ1B 1SGRE 1UK3A 2A7CA 3M7TA 1C5MD 1MBQA 1MQ5A 1GI7B 3KQCA 3ZV9A 2WYJA 1UO6A 1MKWH 3GCNA 2K1QA 4BXSA 1BRAA 4CBOA 5E0HA 1CBWC 3SU3A 3KL6A 1A3BH 1L4DA 1TGTA 3UNSA 4D76A 1SFIA 2H2ZA 1ZTJA 1G30B 1C5SA 4LOYH 1WQSA 2A0QB 4AGJA 2GV7A 2ZHEH 4K1SA 2CV3A 3KQDA 3VXFH 3L6PA 3LGYA 3A84A 2WPLS 3EAJA 2Z9GA 1SFQB 1C2GA 1MU8B 3ITIA 3M3SA 1TMBH 3LJOA 4MPVA 3QWCH 1NFWA 5I46H 2C3SA 1FDPA 3F6UH 1ARBA 4YZUA 3KNXA 5A8YA 1BMMH 3A8DA 4AX9H 1LO6A 5DKMA 2C8WB 3ZV8A 1P2IA 2B9LA 1GG6B 1QRWA 3IITA 1LHFH 1ETSH 1EAXA 1CVWH 4NFEA 4FUBA 2UWOA 1B7XB 1QBNA 3F9GA 1GMDF 1XUJA 5LH8A 5EPNA 3S9BA 2P8OC 4ZKOU 1SLWB 5IDKA 3S9CA 4WVPE 2AGIX 2ZFQH 4YO9A 2ZI2H 4I32A 2BLQA 2BLVA 4U01A 3BG4C 1YPGH 2P3UB 3V3MA 4DIIH 2ZEBA 2GMTC 1VJAU 2FX6A 4YLUA 2WV4A 4ZMAH 3TGIE 1F5LA 2NU3E 1AUJA 2GD4B 2BD4A 1V2PT 2OQUA 1EATA 2OXSA 1F5KU 3VB7A 1Y59T 1FLEE 4OS2A 3SGAE 2ZCLP 2G5NA 1HAHH 3P92A 4CRBA 1LVYA 3HATH 3SJ8A 3U8RH 1ANDA 4OS1A 1GHAF 3GDSA 4KELA 3HK3B 3OY6U 2GGVB 2W7SA 1IQIA 3LKWA 1FAXA 1V2MT 1HB0B 4IC6A 1SQTA 2JETB 1VCQA 1L0ZA 1CT4E 1RD3B 4YOGA 5TCAA 6GCHF 3PLBA 2ANYA 4WWYA 1NC6A 3RXDA 1SR5C 2PKSC 2OP9A 2Y5FA 3DD2H 3TJUA 3PMBB 2Z94A 2BTCE 2ZO3H 1T8LA 4Y11E 5T3HA 2B8OH 2GP9B 3A87A 2OTVA 1PPZA 2UUJB 1XKAC 1O3DA 1VZQH 1YPLH 3QLPH 3MH5A 5C1YA 5HMAA 2FMJA 1JIMA 5GCHF 1AN1E 4BTIB 1O5CB 4GLYA 3K2UA 1LHCH 3STIA 4IS5A 3AAVA 1Z6EA 2ZFSA 5HYOA 3SO3A 1ZMLA 2VIDA 2HNTF 2FPZA 3ZZDA 4Y10E 5A8ZA 4FUGA 2QAAA 3DT0H 1S0RA 1FN8A 4BAQB 2EI6A 5HM9A 4ZH8A 2BD5A 3Q00A 1KXDA 2ZWLH 1YPJH 1T8OA 3FFGA 5HM2A 3A8AA 1A5GH 1GCTC 3MNBA 1MTWA 1YYY1 5EU8A 5BPEA 1UTPA 2SGAA 3NPSA 1UHBB 1O2SA 2CHAB 3VPKA 1EJNA 2BX3A 2FS8A 2ZCKP 2W26A 1Z1JA 2BHGA 1SQOA 3ZZ5A 4BAKB 1WBGB 2C8YB 1H9IE 1QBOA 1GBKA 3ZZBA 1GGDC 1QQ4A 1ELTA 4X2WA 2NU4E 3R0FA 1QJ7B 3UOUA 3D23A 1BCUH 3TK5A 2ZF0H 4FUHA 5LPRA 2XCFA 1B5GH 1GHWH 3I29A 4XFQA 3A7ZA 1CGIE 3SN8A 1SB1H 2ZCHP 2THFB 4XBCA 4O03A 4KP0A 3RXTA 5L6NH 2BDAA 2UUFB 1OYQA 1GHXH 1S84A 3GISB 1O2JA 3NXPA 1TQ0B 1S82A 3VFEA 5CHAC 1LPKB 3QDZB 4AFQA 4MDSA 2ZTXA 1VITH 1YPEH 1PPHE 2TGPZ 3SQHE 2GDDA 3C1KA 2R9PA 3GCOA 4D9QA 2FOCA 3RXCA 4D7GA 3BSQA 2G00A 1C5TA 2FOBA 1W0ZU 2PLXA 2V3HH 1HAYB 2TGAA 1YLCA 3SU6A 3KQBA 1GJ4H 3LH3A 2FOFA 4NGAH 4Y0ZE 1C1QA 1DITH 1GI8B 3QUMP 5EPYA 3Q3KA 4MPXA 1P3EA 4UFEH 3VB6A 2VIVA 3VB5A 1NFYA 2AS9A 2BY9X 3RM2H 3GY2A 1GBIA 2ASUB 4ISIH 1O3IA 1ZHRA