1O3NA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA02
4B2AA 1C1SA 1F0UA 1RD3B 2PUQH 1RTKA 1TX7A 3GCHB 3O8BA 1IHSH 2TIOA 2A7HA 3UR6A 1EZQA 2YOLA 1H9IE 2ZQ2A 3SU2A 1BB0B 1RIWC 2R2WU 1TNKA 1BTXA 1O3MA 4A1XA 1CT0E 3SN8A 1EAWA 3W95A 3A8BA 4ASHA 1MTSA 1XKBC 4B2BA 3UNRA 1NN6A 1Y3WA 1C5RA 1VZQH 2VWNA 3V12A 4Y8XA 1C5MD 4DG4A 4WVPE 2A7CA 3GCNA 1C9TA 2ZHDA 2GCTB 1L1NA 2W5EA 2ZI2H 1OWJA 4CR9A 1GJ4H 3BN9A 1L1GA 1A1RA 1AN1E 1ZPZA 3AASA 1QB1A 2P59A 6GCHG 1FI8A 4I8KA 2CHAC 4ZHLU 1QL8A 2W3IA 1KXBA 1RFNA 1T8NA 5K7RA 4FUIA 1DPOA 4A6LA 3EAJA 2QF0A 2ZU3A 1LHCH 1NU9A 1W11U 4GHTA 2G55A 1MU6B 2EI7A 3ZVBA 4AFZA 1IQMA 1Q3XA 4GCHF 1LO6A 5L6NH 3QZQA 1IQFA 2FLRH 5A2MH 1F0TA 1KXEA 5EG4A 3TIUA 3A88A 2JH6D 5I25A 1EB1H 3LU9B 5F03A 2C93B 2ODYB 2XXLA 1E36B 1TMBH 2BXTH 3QN7A 3SUDA 4I33A 4H42U 1C5XB 2G81E 2BD5A 5DP7A 2GZ8A 2XWAA 1GG6C 3GY4A 1K1IA 2RA3A 2XWBI 1INCA 3V3MA 2Q6FA 4MLFB 5A0AE 1V2QT 4Y0ZE 3NZIA 1GI0A 2GMTB 4QT8C 4INHA 2CXVA 4CR5A 4UDWH 3S9AA 2NU3E 4UD9H 2A45B 1QBOA 3A81A 2B0FA 1ETTH 3GY6A 1S82A 3ZV9A 2FWWA 1C1UH 1ACBE 1ZGVA 3BTQE 4U01A 5L2YH 1V2NT 2C8XB 4MNYA 5LH8A 3HGNA 1OWKA 1YF4A 3RC5A 1DWEH 1DOJA 1PPEE 4WXVA 3KHVA 1HAOH 1MTUA 1OPHB 4MNVA 1O2GH 3GISB 1Y5UT 1O2RA 5LPEA 1GBDA 1TABE 2Z6BD 1TGCA 1CU1A 1S84A 2OINA 6GCHF 1QB6A 1ZHMA 1ZPCA 3RXCA 2VIPA 2H2ZA 2J34A 4NZLA 4BAKB 1V2ST 2FP7B 1UTNA 1T4UH 2YNBA 3ZZDA 1C5QA 1XMNB 4K5ZA 1V2TT 4ZXYH 2HOBA 1GBLA 1MD7A 1QRZA 1SLVB 1IQEA 3ATIA 4VGCC 1BTUA 4BTUB 3RC6A 3GDSA 1DY9A 1PQ8A 3LOXA 5EXNA 3ZVEA 3ELAH 8LPRA 1X7AC 1S5SA 1FY3A 2BDGA 4O97A 2FS9A 2OC1A 2ODPA 1YCPH 1NFWA 2BLWA 1UVTH 4CRFA 1V2RT 4CRCA 1VCWA 2FO9A 3FANA 1LVBA 3EA7A 1LPGB 3D23A 3P8OA 1JXPA 2UUJB 1DSUA 1OWDA 1GI4A 3NWUA 5C1XA 1HB0B 1P04A 2D1JA 4M7GA 1GWAA 1H9HE 2F9BH 4GUXA 5T6GA 1CE5A 1C1OA 1ZTJA 1GHVH 4AN7A 1TNIA 1BMAA 3OY6U 1TBQH 1TBRH 1UK2A 4CRGA 3SHCH 1TAWA 1O32A 4MQAA 5ETXA 1C2GA 3QO6A 3QTVH 3F9HA 4TWWA 1OYQA 1Q31A 1MD8A 1GBBA 3MMGA 4OS5A 1S0QA 3SI3H 3BTHE 3K9XB 5PTPA 4XBCA 4D76A 2ZPSA 2ZP0H 5JPMH 1SI5H 1PYTD 1C4V2 1IQNA 2P94A 2ZU5A 4I8LA 3RLWH 7ESTE 1YP9A 3A7ZA 3PROA 4O3UA 1SGTA 3BEFB 1DDJA 2ZFTA 1D3DB 1EP5A 4WMFA 2HNTE 2Z3DA 2BX3A 2F91A 2AYWA 3LGIA 3SNAA 1PYTC 4IGDA 4BANB 1T8LA 3S9CA 1C2KA 3U1IB 1O34A 2ASUB 4KTUA 4A7IB 1LDTT 2C3SA 1GGDB 5CHAC 4JYTA 1EQ9A 5GIBA 1CT2E 1DLEA 3TITA 4HI3A 3KQDA 5C2ZA 2K1QA 2O9QA 4JYUH 1H1BA 1SGIB 3T26A 4B74A 4OS6A 1THRH 4NSYA 3HATH 3FP6E 1F2SE 4CREA 2Z9JA 1O3CA 3MI4A 1O3EA 1UVOA 4U32A 5JBCS 3S0NA 3V7TA 1N6XA 3I77A 2QXIA 3A84A 3RM0H 4A1TA 4AFQA 3SJIA 1W10U 2CV3A 1Z71A 2FOBA 3QDZB 1O0DH 1BQYA 1BOQA 1QBNA 3LC3A 2VVCA 2Y6TA 4Q7XA 3M5NA 5A8XA 3M7TA 4B76A 1HPGA 5EQRA 1YPMH 1P3CA 2RG3A 3E3TA 4YM9A 1ABJH 2C8WB 1A61H 1K21H 1PQ5A 3F9GA 4UEHH 2AH4X 2CMYA 1ETSH 1W8BH 1Z8GA 4R8TB 4DVAU 5JB9S 3RXQA 2ZDAH 3F6UH 5L2ZH 5CE1A 2J92A 1J16A 2ZPRA 4UE7H 4J1YA 4ZH8A 3DFLA 1AKSB 2P93A 2UUKB 3M3VA 1NROH 5E0GA 1AB9B 4U30A 1LPZB 1AGJA 3AW0A 1AUJA 2CF9H 1O3LA 4FUCA 3A87A 1EPTB 2UWOA 1C1TA 4FU7A 3HKJB 1ANBA 2R2MB 5FBIA 1O38A 1G3BA 1ORFA 1K9OE 1K1NA 4LOYH 2FTLE 3ODDA 1FY5A 5E0HA 3LGVA 3HGPA 2A31A 3LONA 1SMFE 1SGRE 3FVFB 3BTKE 2UWLA 3EA8A 4Q7ZA 1IQKA 1GHBG 3LDXH 1YPHE 3RXJA 4K2YA 1KXCA 4ZKNU 4Y71A 3BG4B 1TFXA 2OC8A 1AVWA 1Z8JB 1O2KA 3PWCA 2BTCE 4BXSA 1A7SA 4XSKU 1LHGH 5ESBA 3PM3A 1GBEA 4K3JA 3DA9B 2FPZA 1OSSA 2DUCA 3PV4A 2F3CE 1FY8E 1AKSA 1P2NA 1KDQA 1G2MA 3NXPA 3TH3H 2WPIS 4ESTE 1EPTA 1C5UA 2BVXH 1HAIH 3T62A 3S9BA 1XX9A 1AWFH 4A1VA 4JZDH 1P57B 1TQ0B 2EEKA 5DPAA 3U8OH 3L33A 1XUKA 3MO3A 1QRXA 1GJ7B 4YT7H 1O2PA 2BD2A 2ZGCA 3URCA 1D6RA 1O5GH 2GDEH 5A8YA 3WY8A 4LK4A 3GY8A 5A0CA 2BD9A 1TA2A 3UOUA 3TH2H 1O2QA 4MPUA 1FIWA 3RDZA 2ZU4A 1HDTH 1V2WT 1ABIH 1EAUA 2BY8X 4I8JA 1LQDB 1GJBB 3LPRA 1MH0A 2G00A 3RXFA 5A8ZA 3KQCA 1XUGA 3O8DA 4F4OC 1ELCA 3MOCA 3P6ZB 1S81A 3K6YA 4TY6A 1O31A 3TPIZ 1V3XA 2EI8A 2OXSA 2AMDA 4BAHB 2XBXA 4AB9A 4UFDH 4OS4A 3MH5A 2QA9E 1KY9A 1MKXH 3LJOA 4D9QA 1MTWA 3SU4A 2PKSB 1DSTA 1GHBF 5E2PA 1ELAA 4KP0A 1MAYA 3SJ8A 1HLTH 1ANDA 4OS7A 2ILNA 4JZEH 1YYY1 1AZ8A 3SV9A 1O5FH 5EPNA 1VJ9U 1WBGB 1RS0A 2LNCA 3ZZ3A 3NPSA 2Q1JA 1NRPH 3TGIE 3TJUA 4NZQA 1OWEA 1XKAC 3OY5U 4Y6DA 1EASA 2P8OB 4TWYA 4SGBE 5F8TA 4ABEA 1P2IA 5FPSA 2VIWA 2BOHB 3LGWA 1MBMA 3A80A 1BT7A 2WUBA 2PFEA 2PR3A 1DM4B 1LHFH 5FCRA 1JBUH 4DCDA 1P06A 1YPLH 1BRAA 2H6MA 3RXMA 1TRNA 1O3BA 3SGQE 4E7RG 1P9UA 2QGRA 2V35A 3PMBB 4WY3A 1NRQH 1MCVA 2ZHQH 3T29A 1GBTA 1O3NA 1QRWA 2HVXA 1BUIA 5HGGA 1P02A 4UONA 4Y7AA 2FTMA 4FVDA 1AY6H 2ZDNA 1O3IA 3NK8A 1KSNA 4X0WU 4AOQA 5EQQA 1V2OT 4Z0KA 3RXTA 1S85A 4X6OA 4K1SA 4AG1A 1MU8B 1UTJA 4MNXA 2NU2E 1D3QB 1K1JA 1OKXA 3SJ9A 1O2NA 3ESTA 3MNSA 1H4WA 1VCQA 2HWLB 2QXGA 1O2XA 1NFUA 1JRTA 1NS3A 2NU0E 1TGSZ 4K69A 1QR3E 1J9CH 5TJXA 4D8NA 4X6MA 2TBSA 1E37B 2A4OA 1DWBH 3E1XB 4ISLA 1ESTA 1A5HA 1QY6A 3A85A 1FAKH 1KLTA 1TPPA 3LIWA 1DXPA 1EX3A 3QZRA 3T27A 2Z94A 1O36A 3UQOA 2H5CA 2QCYA 1BMMH 2FI5E 1KLJH 1P03A 1YM0A 2PTNA 2ZHWH 1K28D 2KAIB 1TGTA 1ARBA 3TJVA 4X2XA 1RJXB 2ZDKA 1O2HA 1SOTA 4AB8A 1P8VC 5DJ7A 4GVUA 2W3KA 3LH1A 2VU8E 2BD4A 3M36A 1BJUA 3Q3XA 1VITG 2XYAA 4I7YH 3S7HB 1UVUH 1GBMA 3OYPA 3SI4H 2Z9LA 4AG2A 5GCHG 2HPQH 3V13A 2SGEE 1SQOA 5C20A 1EOLA 1L1JA 1GJ8B 1GL1A 4NA7A 2HALA 2H5DA 8ESTE 1S6FA 4THNH 2TGTA 4TY7A 5AHGH 4F49A 5EXLA 4ZAEA 3RXHA 1HV7A 2A1DB 2A2QH 1C4U2 1JIRA 4CH2B 2BX4A 3GYLB 5AFYH 3DD2H 1CA0B 4O9VA 3RXPA 3VGCC 1YGCH 1A5IA 1RTFB 1ZJDA 3SU3A 1VGCC 4HTCH 1C4Y2 2BZ6H 2IPHA 1UHBB 1SQAA 3GY5A 3RXUA 3UNQA 1DS2E 3L6PA 5EODA 4B75A 4KTCA 2Z7FE 1PPZA 2WINI 2Z3EA 1C5VA 1WCZA 3MNCA 2ZTZA 2BXUH 1LVYA 3SUFA 1EXFA 2KAIA 1OOKB 2VIOA 3SHAH 5IYTA 1C5LH 3ZV8A 1EP6A 1EKBB 1BRBE 1E35B 2BQ7B 2VIQA 3SOSA 3BTFE 4TYDA 1IQLA 4GPGA 3ZYDA 4AFUA 3EQ0H 3RM2H 4DIIH 1BRUP 4DY7B 2AERH 2B7DH 3SNCA 3U98H 4X1PU 3Q77A 1DITH 1KXFA 2Y7ZA 4D7FA 1A0JA 2G52A 8KME2 5DGJA 3SO3A 1CHGA 4H6SB 2G5VA 3DT0H 4WF8A 4NFEA 1PQ7A 4X1SU 1UTLM 1G36A 3I78A 1XUIA 1P2QA 1T8MA 3URDA 2SNWA 1QURH 1SVPA 1UHBA 3SQHE 2ANWA 3BF6H 1GCDA 4IMZA 1G30B 4E06H 1VITF 4Z6AH 5T3HA 4DURA 3GDVA 1ZOMA 2BDCA 1C1NA 3UTUH 1MMJN 1C5PA 4OGXA 1BMNH 4X2WA 1SSXA 3ZZCA 7LPRA 5GCHF 1UVPA 1IQIA 1T8OA 2JETB 3PO1B 2P3FH 1GMCG 4I32A 1IQGA 4YESB 1SGFA 2XCNA 1SLWB 2O8TA 3ZZ6A 1AVXA 3M7QA 5H4IB 1BZXE 3RXOA 1FQ3A 2VJ1A 1Z6JH 3ENSB 5EW1H 4BOHA 2IN2A 1HNEE 2ZFQH 2H9TH 1PFXC 1V2LT 4ABIA 3JZ2B 4GHQA 3MWIU 1GJ5H 2VIDA 3GOVB 1D3TB 5FHTA 6LPRA 1GBFA 1EB2A 6ESTA 1OP2A 4WXIA 1AFQC 1HAHH 1FZZA 1NM6A 1QL9A 1TALA 1NFXA 3OTJE 5EU8A 4AYVB 2WPKS 3SUEA 1K2I1 1OP8A 2G8TA 2B9LA 2HNTC 4D9RA 2BLOA 3BTWE 6CHAC 5HMAA 1KLIH 1WAYB 1A2CH 4FUHA 2A2XH 2ANYA 3EA9A 1AUTC 3A7TA 1J17T 3P8NA 3GY3A 1H9LB 4BTIB 3LH3A 5TCAA 2ZCLP 2ZFFH 1MTNB 1LKBA 1DXWA 1O3JA 4NA9H 3U1JB 3A86A 2UWPA 1FAXA 2PGBB 3E6PH 1C5SA 1C2FA 4X2YA 1ELFA 1G37A 5E0JA 2VH6A 1Z1IA 3OU0A 3FZZA 1O5EH 4UFEH 5DK1A 3GCHC 7KMEH 4MPVA 7GCHG 2NU4E 4ABGA 4SGAE 1WU1A 3A8AA 2M5TA 1BJVA 2TGAA 4JMYA 5SGAE 2H1UA 1NRRH 3PLPA 1T7CA 4K8YA 2GZ9A 2SGQE 2Z9GA 3M35A 5J4SA 3SQEE 2Z9KA 2QYIA 3LT3A 2ZEBA 1QFKH 4Y7BA 2QN5T 2D8WA 3ZVFA 2ULLA 1AD8H 1A5GH 1G3CA 1SGDE 3M3TA 3UIRA 1GMCF 1Z8RA 1OWHA 4ABFA 1ZPBA 5A09A 5LGOA 1P0SH 2GCTC 1ZTLA 3RXBA 1A3BH 2R9PA 3PLKA 1GBHA 3T28A 1TNGA 2FOHA 2JKHA 2Y7XA 3MH4A 2C4FH 4NG9H 1KTTB 3TNSA 1HAXB 2A4GA 1F5KU 1B7XB 2BDHA 2YNAA 1THSH 1FJSA 1SLUB 1N8OB 3SW2B 1MBQA 1BTZA 1HJ9A 3A8CA 1HRTH 1UTOA 4KTSA 1O5DH 1ELTA 1GCTB 3KF2A 3ZYEA 4WMEA 1QJ7B 4K1TA 1FY1A 2VH0A 1O2WA 3GY2A 1KXAA 1F5RA 2SGFE 1O3AA 3NKKA 1WSSH 2C8YB 1YPHC 2EA3A 1DFPA 1V2MT 2RDLA 1W2KH 1J8AA 5L30H 4WWYA 3T25A 1Y5BT 5K0HA 1ZJKA 1VCPA 5EGMA 2VWOA 3TU7H 1V2UT 3FP8E 1SGNE 2DE8A 1SHHB 3RMNH 2D26C 4Y76A 4RKOB 5DP4A 4RKJB 5FBEA 3RXAA 4IN2A 1C1RA 1UTMA 1YPKH 5CMXH 1TX8A 4XBBA 2ZGJA 1O2IA 1GI1A 7GCHF 2GMTC 4Q2KA 1SPJA 4AX9H 1QL7A 1GHAG 1GPZA 3TK5A 2J4IA 3RXRA 1LTOA 1O33A 1C1PA 2IOTA 2VGCC 3HKIB 1CGHA 2O8UA 2ZGXH 1ELEE 3ZZ4A 2BB4A 9ESTA 2J95A 5EW2H 3U9AH 3UR9A 3ATMA 1L0ZA 1SGFG 1ZRBA 3IG6B 3SU0A 2Z9IA 2WV5A 3MO6A 4NGAH 3P95A 4XDEA 1HJAB 3JZ1B 1W7GH 4Q80A 3UY9A 1ZRKA 1KDQB 1Y3UA 5HM9A 1TMTH 2OTVA 3UFAA 2B8OH 3ZVDA 4Y10E 4YLUA 1CGJE 1ETRH 1K1LA 2AEIH 1XUJA 3BEUA 1Y3VA 2DE9A 1QHRB 1NESE 1OWIA 2FMJA 2BYAX 4CHAB 4YOIA 3ZZ9A 3MTYA 9LPRA 3C27B 3B23B 2A32A 1FNIA 1PPFE 5EPYA 1IQHA 1MZDA 3ZZBA 3FAOA 4MPXA 2AGEX 3P8FA 1MQ6A 1V2PT 3RXIA 1ELVA 1E38B 3E90B 3GY7A 1HGTH 1V6DA 1NO9H 5GPIB 1O3FA 2PHBA 2G51A 2UUYA 4JCNA 1C2JA 1EZXC 1O2SA 3KQBA 4RSPA 4CRDA 1FN6A 5E2OA 1MUEB 1SFIA 1XXFA 3RC4A 1BBRK 4JZ1A 1C5NH 1GBJA 1BTPA 3IWMA 4HZHA 1TGBA 5JBTA 3ATLA 1RTLA 1DUEA 1GI2A 3ODFA 1GHAF 1KXDA 1BDAA 3MNBA 1ZMNA 3QWCH 1CHOG 1FUJA 1ZLRA 4MTBA 2ZCHP 1GMDG 4O03A 1QQ4A 3K65B 2PUXB 3RXEA 4AGKA 1CQQA 1O2LA 1G32B 1SR5C 1C1QA 1TNJA 4X1RU 4TPIZ 3A8DA 4WH8A 5A0BA 1UJ1A 2ZDMA 5LPRA 1Y3XA 1O2OA 1CA8B 3DHKH 1HUTH 5DP8A 3M5LA 1O2TA 3D49H 1RIWB 3SZNA 2ANMH 3MU5A 2ZNKH 2FI3E 3M7UA 3SBKA 1O5CB 4XBDA 1C5TA 2GP9B 4B2CA 1SGQE 2ZFRH 2OQUA 1JRSA 3F9FA 1O5BB 3BTEE 2I6SA 3GCTG 3KL6A 2HRVA 1NC6A 2ZFSA 1ZR0A 1V2JT 3QK1A 2PKAA 2GGVB 1SOZA 3PYHA 2FOFA 2XBVA 1S0RA 4ABAA 5GWZA 2A5IA 4HGCA 3BTME 2XRCA 2CHAB 1BTYA 4KGAA 1B0FA 1GHZA 1GBKA 1NU7B 2O8WA 1QGFA 4E05H 4JZIA 2BDAA 1V2KT 1TPSA 3K6ZA 3MFJA 1P2OA 1BTHH 1SB1H 1O3DA 1MAXA 3UNSA 3PMHB 4IMQA 1CGIE 1SC8U 3UREA 2GVFA 3VXEH 1HCGA 4NIVA 2CJIA 4CRAA 2AMQA 3UWIA 2XCFA 3TLOA 1WTGH 1BMLA 2ZF0H 1FIZA 2P3UB 1AWHB 1UVSH 3UPEA 3SV6A 1ZSJA 1NRSH 1O3GA 5AFZH 3L3TA 3OX7U 4B1TA 3BIVH 1EUFA 2PLXA 4XE4A 3ZVGA 1OX1A 1QTFA 2OUAA 5C1YA 1YC0A 1CHOF 3F1SB 4Y0YE 1SHYA 1UTQA 4I8GA 1GG6B 3QX5H 2F9OA 2J38A 1HAGE 2V3HH 4NCYA 1Z8IB 2ZU1A 1GMDF 2HLCA 4X8VH 4A5TS 3E0NB 1CO7E 1AVGH 1P12E 1RRKA 1K1PA 3BTGE 1TIOA 4X6NA 5E8EH 1WQVH 1F7ZA 3PLBA 4NIYA 1K1OA 4JK6A 3O8RA 2RCEA 1G3DA 4MDSA 4O3TA 1AB9C 3MU4A 4ISOA 3O8CA 1IQJA 4UFFH 3TK6A 4DT7B 3TK9A 1EPTC 1O30A 1O3PB 3VEQB 3FZDA 1HAYB 2BDBA 1JWTA 1TBZH 2PWXA 1PPCE 1QB9A 1H8DH 4CRBA 2A0QB 1FDPA 3OSYA 1AI8H 3GCTF 1A3EH 1BA8B 4NFFA 4YZUA 3UWJH 3BEIB 2W7SA 1WQSA 2FM2A 4NIXA 2F83A 2B5TB 3LGYA 3ATKA 5T6FA 1D3PB 2GKVE 3MYWA 5DG6A 3ZZ7A 1UTPA 1NTPA 1DWDH 4JYVH 4FUFA 1HAVB 1LKAA 3BG4C 2GT8A 2VB0A 4Y79A 5T6DA 2XC4A 1AE8H 2IJOB 2ZG0H 1NPMA 4YOJA 1P2JA 2FX4A 1UCYE 4H6TA 2C90B 3RU4E 4CBNA 2ZDLA 6CHAB 2BD7A 2F9NA 4VGCB 4INLA 1FXYA 2FOGA 3V0XA 1XXDA 4FUJA 4BAQB 1QJ6B 1NFYA 4KKDA 3CENA 3H7TA 2BVSH 1L2EA 4DW2U 2QY0B 2XTTB 1ZHRA 2NU1E 1P09A 3B9FH 3SGAE 2VVVA 3M5OA 2WYJA 4I31A 3ZZ8A 4FUDA 3RUOA 1ELDE 5JBAS 3KIDU 1L4ZA 3IITA 2FODA 5BRRE 4FUGA 2XBYA 3SNEA 1Y8TA 2EC9H 1GHWH 3D65E 4XFQA 3ZZ5A 1SBWA 1AE5A 3VXFH 3M3SA 5JDUB 3AVZA 3ITIA 1SQTA 4FU9A 1P11E 2HGTH 4DGJA 1GDNA 1THPB 2VIVA 1V2VT 1O39A 1QA0A 1F5LA 3CP7A 1HAVA 2FYQA 1AU8A 3SJOA 1XVOA 3RXLA 2O8LA 3A7WA 2WPHS 2H9EH 1DY8A 4X8SH 3N7OA 2FXRA 1TX6A 5DP5A 3SU1A 1ZYOA 3ZVAA 3MNXA 2SFAA 4WJG2 3QGNB 1WV7H 3BTTE 2BLVA 2BQ6B 1QBVH 3K2UA 1GI6A 4ZKRU 4OGYA 3RXGA 2FESH 1A4WH 1O2YA 4WMDA 2BZAA 1KTSB 2FYRA 1NZQH 2ZC9H 2PKSC 1UCYH 2ZWLH 3LGTA 1QCPA 1HXEH 2G5NA 3HK3B 1GI9B 3MU1A 3SGBE 1GI7B 3M5MA 4YO9A 1LHEH 1A46H 2BD8A 1GBIA 2QAAA 2PGQB 1Z7KA 3VPKA 3EYDA 1DLKB 1W3CA 2R3UA 4I8HA 1G3EA 1FLEE 4RN6A 3KQEA 1AHTH 2P8OC 1EOJA 5J4QA 2OC0A 3W94A 1ZSLA 2CF8H 4X1QU 5ABWA 2QC2A 2SGAA 1FONA 5JBBS 5EQSA 1D9IA 2O8MA 1PQAA 3RXSA 1TNLA 3F9EA 5GXPA 5CHAB 3EE0B 2ODQA 3VB3A 2ZA5A 1SGCA 1TA6A 3F68H 2VVUA 1MKWH 1B5GH 1CBWC 5AVDA 2G4TA 2JH5D 1MTVA 2ALVA 3VB7A 1E34B 3P92A 1TE0A 1KYNA 1RGQA 2NWNA 1TNHA 1QA7A 1Y5AT 3RXDA 2FDAA 2SGPE 4WH6A 1VITH 5HXFA 5DP3A 1JOUB 1P10A 2V3OH 5JB8S 5HM2A 2BM2A 4NIWA 1O37A 4YT6H 2OCVB 1QIXB 3Q00A 2RA0A 2ZIQH 1TMUH 2STAE 2VGCB 3Q3YA 2FZZA 3A89A 2UUFB 3BIUH 1TOCB 5F8ZA 5FPTA 4AORA 5DO4H 1EZUC 3A7XA 4K1EA 3MU8A 2ZGHA 4NWLA 3VB4A 3HK6B 4DJZB 3S69A 1DANH 1UMAH 1C1VH 3B8JA 2ESTE 1MZAA 3DUXH 1O3HA 1OYTH 1GDUA 1UCYK 2BY7X 1C1MA 3VB5A 3MHWU 1YBWA 5I46H 3KGPA 4Y11E 2XC0A 1G2LA 1YPJH 3SV2H 5EOKA 2A5KA 4FU8A 1YPGH 1PPHE 2CN0H 2Q6DA 3TNTA 4LZ1H 5AF9H 1QNJA 2J94A 3A82A 2AIQA 1FPCH 3BTDE 4A92A 2GTBA 4JZFH 4ABDA 1LCYA 1DX5M 3SNDA 1GJCB 5C5OA 2PTCE 1GVKB 1P2KA 1O3KA 1P9SA 3TH4H 4PROA 1MKWK 1GBCA 4MPWA 2W7UA 3C1KA 1VJAU 3SV7A 1RXPA 3TJNA 2BQWB 2XW9A 1BBRE 3M37A 1FPHH 2WV4A 3ATWA 1H8IH 1DWCH 3NCLA 1TLDA 4YTAA 4Q7YA 1PPBH 1CA0C 2QV1A 1IHTH 2GCHG 2FI4E 3A7YA 2XNIA 1ZHPA 4BTTB 2BY6X 3NUMA 2Y82A 1WUNH 2G4UA 1AIXH 5FXLA 5EXMA 3TVJB 3RXVA 1EAIA 5DKMA 1U6QA 3TGJE 4NSVA 2AGIX 5G4BA 2Y81A 1O2UA 1UTKA 3RMMH 1QQUA 1CSOE 1YKTA 1OXGA 1T31A 1BHXB 1GMHG 2F9VA 4D7GA 4B71A 1SGEE 3SNBA 1C2HA 2WPMS 2R0KA 1AQ7A 2WPLS 2OD3B 4FUEA 4Y8ZA 3UUZA 3R0FA 2FX6A 1BITA 1CVWH 1JIMA 1WOFA 1HFDA 2ALPA 1YPEH 2P3TB 4X8UH 2A7JA 4ZKOU 3PTNA 1FY4A 2TGPZ 5FPYA 1Z1JA 4IS5A 3CS7A 5C5NA 2ZTXA 1O2MA 3RU4T 3QUMP 5FX6A 3E16B 3P70B 3P17H 4YOGA 1LVMA 1F0RA 2PW8H 3KNXA 4AFSA 5ESTE 1IOEA 4GAWA 1W0ZU 2F9UA 3E8LA 1WTHD 1BCUH 2WPJS 2WUCA 3BG8A 4DOQA 1LVOA 1QJ1B 1BBRH 1CT4E 2ZTYA 2FIRH 3BV9B 3T5FH 1UK4A 1GJAB 1YCPK 4NA8A 2FEQH 3AAUA 3RXKA 1Q2WA 2JETC 1EAXA 1HJ8A 2BDIA 3I29A 5F8XA 3SORA 3PO1C 4ABBA 3HPTB 2P16A 1F0SA 1ANCA 3MO9A 1M9UA 1ZTKA 2ZGBH 1TRYA 4AGJA 2Y80A 3PWBA 2AFQB 1UK3A 2A4RA 2GCHF 1GI3A 4IC6A 4GLYA 2A5AA 1G9IE 4BNRA 2FOEA 3MU0A 1T4VH 5C3NA 5C1UA 3VB6A 4Y8YA 1A0LA 2XC5A 5LPFA 3H7OA 4X6PA 3UOPA 4MG3A 1FMGA 1EJNA 1DUAA 3QLPH 2I6QA 2HNTF 2CGAA 2D2DA 4ZHAA 1DE7H 2Z3CA 3RP2A 1P2MA 1ESAA 1MCTA 2ZDVH 1GMHF 4IBLH 1ID5H 5TCCA 1HBTH 3STJA 4YLQH 2A4QA 2R3YA 3QGJA 2V0BA 1DICA 1GJ9B 1O35A 2ZU2A 1GJ6A 3TGKE 1GI8B 4HFPB 1EJAA 5FAHA 1MTNC 3BSQA 3GDUA 1Y59T 1YLCA 1B0EA 1TWXB 1HAZB 1LMWB 2QIQA 1TQ7B 1PJPA 4X2VA 4ZKSU 2VWMA 2ZZUH 3PMAB 1KIGH 1TB6H 1S83A 3SUGA 3EGKH 5FCKA 2QF3A 5HYOA 3UQVA 1GJDB 3STIA 3FFGA 5JYIA 4R0IA 4H4FA 4E7NA 1A0HB 4ABHA 2OP9A 2JH0D 4OS1A 2Y5HA 5GDSH 1ANEA 1JMOH 2PKAB 1NT1A 2GT7A 2OBOA 3MH6A 4ISNA 1ARCA 5C67A 2Y5GA 4AYYB 1TONA 3LGUA 4MVNA 1O2VA 2AIPA 1DVAH 1MQ5A 2GDDA 5FX5A 1C5YB 4INKA 1C2EA 4JK5A 2GX4A 3ZZAA 1HXFH 2GZ7A 5B6OA 2WYGA 3DFJA 1K1MA 1O2JA 1AMHA 2FOAA 2ZCKP 3PTBA 4DIHH 2GD4B 4ZROA 3SU5A 1NRNH 4CH8B 2ANKH 2PSYA 3U8TH 1BRCE 3SJKA 1XUHA 2PV9B 3PMJA 3Q3KA 4ZUHA 1HIAB 4K60A 1BTWA 1AO5A 1N8OC 2BY9X 2F9PA 4ZHMU 4ABJA 1FN8A 1OP0A 2ZFPH 3LKWA 1GCTC 1IAUA 3SU6A 3VGCB 1L4DA 2P95A 8GCHG 1AFEH 1VGCB 2H9HA 2OC7A 1GHXH 3LJJA 1YLDA 2FOMB 1GDQA 3H5CB 2AGGX 2AS9A 1SGPE 3RMLH 1J15A 3TJOA 4KELA 1W13U 2BMGB 3FP7E 1E0FD 2BLQA 3RU4D 3AW1A 4TPYA 5F6MA 1GGDC 1J14A 1ZMJA 3Q76A 2SNVA 5BPEA 1GI5A 2SGDE 1ELBA 1SFQB 3SV8A 1EATA 1FV9A 1SGYE 1C5WB 1T32A 1W7XH 2FS8A 3T2NA 1GBAA 1SG8B 1GL0E 1BIOA 2AMPA 4AZ2B 2TRMA 3GCOA 4BAMB 1UO6A 2ZO3H 4J2YB 1HYLA 3A83A 4XOJA 1XVMA 1C1WH 3KEEA 4OS2A 2ZECA 2J9NA 3PB1E 3RLYH 1DT2A 1HIAA 3M61U 2BY5X 2FLBH 2GV7A 4ZXXH 1D6WA 2VNTA 1HAPH 2XBWA 3U8RH 4FUBA 1C2LA 3RMOH 4FVBA 3EDXB 1O2ZA 1ZMLA 2W26A 1LHDH 4IW4E 2EI6A 4CBOA 2OQ5A 1N6YA 2ZKSA 1TRMA 4K8BA 4MNWA 5DP9A 4IC5A 4UFGH 1SL3A 4ISHH 4NWKA 3GYMA 1O5AB 5DP6A 2STBE 1WYKA 3KCGH 2THFB 3KN2A 4LZ4B 3LC5A 1HJAC 1XUFA 4ISIH 2ZHEH 1O3OA 2VINA 1XM1A 2OBQA 3A7VA 1Y3YA 1CBWB 3AAVA 1ELGA 1ZSKA 4FXGH 4B73A 2BDYA 1EZSC 1GVLA 1C2MA 1TYNA 1ZZZA 2OLGA 3S7KB 1W12U 2BOKA 3D62A 1VR1H 2ZHFH 1ESBA 1F92A 1TPOA 4CHAC 2Y5FA 4LXBH 2QXHA 1GHYH 4BXWA 5GJ4B 8GCHF 1LQEA 1EJMA 1SLXB 1C5ZB 4X8TH 4IN1A 2ZQ1A 4X1NU 1P05A 2C8ZB 3CS0A 1P3EA 2BHGA 1GVZA 3U69H 1YCPM 1AFQB 1TOMH 1W14U 2HPPH 3ZVCA 2BD3A 4GCHG 5IDKA 3QTOH 3E91A 3GICB 1S6HA 1AZZA 1D4PB 3R3GB 4BAOB 1W0YH 2V6NA 1C2IA 1PPGE 2FOCA 2BVRH 1K22H 1TGNA 1OS8A 1Z6EA 4ZMAH 1P01A 3E0PB 4U2WA 1MKXK 2Q6GA 2GV6A 3MH7A 4GSOA 2PSXA 1C9PA 3G01A 1LPKB 3VFEA 2R0LA 1NY22 1TPAE 1ZGIA 2TGDA 1N1LA 2VWLA 3P8GA 1C2DA 2J2UA 2QXJA 1C5OH 1BHXF 2ZPQA 2LPRA 2TPIZ
chains in the Genus database with same CATH superfamily
4B2AA 1C1SA 1F0UA 1RD3B 2PUQH 5T1VA 1RTKA 1TX7A 3GCHB 3O8BA 1IHSH 2TIOA 2A7HA 3UR6A 1EZQA 2YOLA 1H9IE 2ZQ2A 3SU2A 1BB0B 1RIWC 2R2WU 1TNKA 1BTXA 1O3MA 4A1XA 1CT0E 3SN8A 1EAWA 3W95A 3A8BA 4ASHA 1MTSA 1XKBC 4B2BA 3UNRA 1NN6A 1Y3WA 1C5RA 1VZQH 2VWNA 3V12A 4Y8XA 1C5MD 4DG4A 4WVPE 2A7CA 3GCNA 1C9TA 2ZHDA 2GCTB 1L1NA 2W5EA 2ZI2H 1OWJA 4CR9A 1GJ4H 3BN9A 1L1GA 1A1RA 1AN1E 1ZPZA 3AASA 1QB1A 2P59A 1UW7A 6GCHG 1FI8A 4I8KA 2CHAC 4ZHLU 1QL8A 2W3IA 1KXBA 1RFNA 1T8NA 5K7RA 4FUIA 1DPOA 4A6LA 3EAJA 2QF0A 2ZU3A 1LHCH 1NU9A 1W11U 4GHTA 2G55A 1MU6B 2EI7A 3ZVBA 4AFZA 1IQMA 1Q3XA 4GCHF 1LO6A 5L6NH 3UB0A 3QZQA 1IQFA 2FLRH 5A2MH 1F0TA 1KXEA 3DSPA 5EG4A 3TIUA 3A88A 2JH6D 5I25A 1EB1H 3LU9B 5F03A 2C93B 2ODYB 2XXLA 1E36B 5EIYA 1TMBH 2BXTH 3QN7A 3SUDA 4I33A 4H42U 1C5XB 2G81E 2BD5A 5DP7A 2GZ8A 2XWAA 1GG6C 3GY4A 1K1IA 2RA3A 2XWBI 1INCA 3V3MA 2Q6FA 4MLFB 5A0AE 1V2QT 4Y0ZE 3NZIA 2KCOA 3F0OA 1GI0A 2GMTB 4QT8C 4INHA 2KCPA 2CXVA 4CR5A 4UDWH 3S9AA 2NU3E 4UD9H 2A45B 1QBOA 3A81A 2B0FA 1ETTH 3GY6A 1S82A 3ZV9A 2FWWA 1C1UH 1ACBE 1ZGVA 3BTQE 4U01A 5L2YH 1V2NT 2C8XB 4MNYA 5LH8A 3HGNA 1OWKA 1YF4A 3RC5A 1DWEH 1DOJA 1PPEE 4WXVA 3KHVA 1HAOH 1MTUA 1OPHB 4MNVA 1O2GH 3GISB 1Y5UT 1O2RA 5LPEA 1GBDA 1TABE 2Z6BD 1TGCA 1CU1A 1S84A 2K8IA 2OINA 6GCHF 1QB6A 1ZHMA 1ZPCA 3RXCA 2VIPA 2H2ZA 2J34A 4NZLA 4BAKB 1V2ST 2FP7B 1UTNA 1T4UH 2YNBA 3ZZDA 1C5QA 1XMNB 4K5ZA 1V2TT 4ZXYH 2HOBA 1GBLA 1MD7A 1QRZA 1SLVB 1IQEA 3ATIA 2L74A 4VGCC 1BTUA 4BTUB 3RC6A 3GDSA 1DY9A 1PQ8A 3LOXA 5EXNA 3ZVEA 3ELAH 8LPRA 1X7AC 1S5SA 3UAIC 1FY3A 2BDGA 4O97A 2FS9A 2OC1A 2ODPA 5HIZA 1YCPH 1NFWA 2BLWA 1UVTH 4CRFA 1V2RT 4CRCA 2WZQA 1VCWA 2FO9A 3FANA 1LVBA 3EA7A 1LPGB 3D23A 2L6OA 3P8OA 1JXPA 2UUJB 1DSUA 1OWDA 1GI4A 3NWUA 5C1XA 1HB0B 1P04A 2D1JA 4M7GA 1GWAA 1H9HE 2F9BH 4GUXA 5T6GA 1CE5A 1C1OA 1ZTJA 1GHVH 4AN7A 1TNIA 1BMAA 3OY6U 1TBQH 1TBRH 1UK2A 3CNRA 4CRGA 3SHCH 1TAWA 1O32A 4MQAA 5ETXA 5CDFE 1C2GA 3QO6A 3QTVH 3F9HA 4ACAA 4TWWA 1OYQA 1Q31A 1MD8A 1GBBA 3MMGA 4OS5A 1S0QA 3SI3H 3BTHE 3K9XB 5PTPA 4XBCA 4D76A 2ZPSA 2ZP0H 3F2GA 5JPMH 1SI5H 3U28C 1PYTD 1C4V2 1IQNA 2P94A 2ZU5A 4I8LA 3RLWH 3F0PA 7ESTE 1YP9A 3A7ZA 3PROA 4O3UA 1SGTA 3BEFB 1DDJA 2ZFTA 1D3DB 1EP5A 4WMFA 2HNTE 2Z3DA 2BX3A 2F91A 2AYWA 3LGIA 3SNAA 1PYTC 4IGDA 4BANB 1T8LA 3S9CA 1C2KA 3U1IB 1O34A 2ASUB 4KTUA 4A7IB 1LDTT 2C3SA 1GGDB 5CHAC 4JYTA 1EQ9A 5GIBA 1CT2E 1DLEA 3TITA 3WWFA 4HI3A 3KQDA 5C2ZA 2K1QA 2O9QA 4JYUH 1H1BA 1SGIB 3T26A 4B74A 4OS6A 1THRH 4NSYA 3HATH 3FP6E 1F2SE 4CREA 2Z9JA 1O3CA 3MI4A 1O3EA 1UVOA 4U32A 5JBCS 3S0NA 3V7TA 1N6XA 3I77A 2QXIA 3A84A 4RT1A 3RM0H 4A1TA 4AFQA 3SJIA 1W10U 2CV3A 1Z71A 2M2AA 2FOBA 3QDZB 1O0DH 1BQYA 1BOQA 1QBNA 3LC3A 2VVCA 2Y6TA 4Q7XA 2XOKD 3M5NA 4RT0A 3M7TA 5A8XA 4B76A 2V7QD 1HPGA 5EQRA 1YPMH 1P3CA 2RG3A 3E3TA 4YM9A 1ABJH 2C8WB 1A61H 1K21H 1PQ5A 3F9GA 4UEHH 2AH4X 2CMYA 1ETSH 1W8BH 1Z8GA 4R8TB 4DVAU 5JB9S 3RXQA 2ZDAH 3F6UH 5KGOA 5L2ZH 5CE1A 2J92A 1J16A 2ZPRA 4UE7H 4J1YA 4ZH8A 3DFLA 1AKSB 2P93A 2UUKB 4DT4A 3M3VA 1NROH 5E0GA 1QZ8A 1AB9B 4U30A 1LPZB 1AGJA 3AW0A 3KYFA 1AUJA 2CF9H 1O3LA 2KZ4A 4FUCA 3A87A 1EPTB 2UWOA 1C1TA 2J5UA 4FU7A 3HKJB 1ANBA 2R2MB 5FBIA 3H09A 1O38A 1G3BA 1ORFA 1K9OE 2HLDD 1K1NA 4LOYH 2FTLE 3ODDA 1FY5A 5E0HA 3LGVA 3HGPA 2A31A 3LONA 1SMFE 1SGRE 3FVFB 3BTKE 2UWLA 3EA8A 4Q7ZA 1IQKA 2LELA 1GHBG 3LDXH 1YPHE 3RXJA 4K2YA 2F4LA 1KXCA 4ZKNU 4Y71A 3BG4B 1TFXA 2OC8A 1AVWA 1Z8JB 1O2KA 3PWCA 2BTCE 4BXSA 1A7SA 4XSKU 1LHGH 5ESBA 3PM3A 1GBEA 4K3JA 3DA9B 5IK2D 2FPZA 1OSSA 5EJ1A 2DUCA 3PV4A 2F3CE 1FY8E 1AKSA 1P2NA 1KDQA 1BMFD 1G2MA 3NXPA 4FOUC 3TH3H 2WPIS 4ESTE 1EPTA 1C5UA 2BVXH 1HAIH 3T62A 3S9BA 1XX9A 1AWFH 4A1VA 4JZDH 1P57B 1TQ0B 2EEKA 5DPAA 3U8OH 3L33A 1XUKA 3MO3A 1QRXA 1GJ7B 4YT7H 1O2PA 2BD2A 2ZGCA 3URCA 1D6RA 1O5GH 2GDEH 5A8YA 3WY8A 4LK4A 1COWD 3GY8A 5A0CA 2BD9A 1TA2A 3UOUA 3TH2H 1O2QA 4MPUA 1FIWA 3RDZA 2ZU4A 1HDTH 1V2WT 1ABIH 1EAUA 2BY8X 4I8JA 1LQDB 1GJBB 3LPRA 1MH0A 2G00A 3RXFA 5A8ZA 3KQCA 1XUGA 3O8DA 4F4OC 1ELCA 3MOCA 3P6ZB 1S81A 3K6YA 4TY6A 1O31A 3TPIZ 1V3XA 2EI8A 2OXSA 2AMDA 2KFWA 4BAHB 2XBXA 4AB9A 4UFDH 1NBME 3MH5A 2QA9E 1KY9A 1MKXH 3LJOA 4OS4A 4D9QA 1MTWA 5EJZA 3SU4A 2PKSB 1DSTA 1GHBF 5E2PA 1ELAA 4KP0A 1MAYA 3SJ8A 1HLTH 3PV5A 1ANDA 4OS7A 2ILNA 4JZEH 1YYY1 1AZ8A 3SV9A 1O5FH 5EPNA 1VJ9U 1WBGB 1RS0A 2LNCA 3ZZ3A 3NPSA 2Q1JA 1NRPH 3TGIE 2KX4A 5GNDA 3TJUA 4NZQA 1OWEA 1XKAC 3OY5U 4Y6DA 1EASA 2P8OB 4TWYA 4SGBE 5F8TA 4ABEA 1P2IA 2J97A 5FPSA 2VIWA 2BOHB 3LGWA 1MBMA 3A80A 4YXWD 1BT7A 2WUBA 2PFEA 2PR3A 1DM4B 1LHFH 5FCRA 3GS9A 1JBUH 4DCDA 2QF5A 1P06A 1YPLH 1BRAA 2H6MA 3RXMA 1TRNA 1O3BA 3SGQE 4E7RG 1P9UA 2QGRA 2V35A 3PMBB 4WY3A 1NRQH 1MCVA 2ZHQH 3T29A 5B6LA 3DCLA 1GBTA 1O3NA 1QRWA 2HVXA 1BUIA 5HGGA 1P02A 3KQ5A 4UONA 4Y7AA 2FTMA 4FVDA 4M9FA 1AY6H 2ZDNA 1O3IA 3NK8A 1KSNA 4X0WU 4Z1MD 4B6EA 4AOQA 5EQQA 1V2OT 4Z0KA 3RXTA 1S85A 4X6OA 4K1SA 4AG1A 1MU8B 1UTJA 4MNXA 2NU2E 1D3QB 1K1JA 1OKXA 3SJ9A 1O2NA 3ESTA 3MNSA 1H4WA 1VCQA 2HWLB 2QXGA 1O2XA 1NFUA 1JRTA 1NS3A 2NU0E 1TGSZ 4K69A 1QR3E 1J9CH 5TJXA 4D8NA 4X6MA 2TBSA 1E37B 2A4OA 1DWBH 3E1XB 4ISLA 1ESTA 1A5HA 1QY6A 3A85A 5F53A 1FAKH 1KLTA 1TPPA 5C17A 3LIWA 1DXPA 1EX3A 3FKSD 3QZRA 3T27A 2Z94A 5KECA 1O36A 3UQOA 2H5CA 2QCYA 1BMMH 2FI5E 1KLJH 1P03A 4P00A 1YM0A 2PTNA 2ZHWH 1VKYA 1K28D 2KAIB 1TGTA 1ARBA 3TJVA 4X2XA 1RJXB 2ZDKA 1O2HA 1SOTA 4AB8A 1P8VC 5DJ7A 4GVUA 2W3KA 3F2FA 3LH1A 2VU8E 2BD4A 3M36A 1BJUA 3Q3XA 1VITG 2XYAA 4I7YH 3S7HB 1UVUH 1GBMA 3OYPA 3SI4H 2Z9LA 4AG2A 5GCHG 2HPQH 3V13A 2SGEE 1SQOA 5C20A 1EOLA 1L1JA 1GJ8B 1GL1A 4NA7A 2HALA 2H5DA 8ESTE 1S6FA 4THNH 2TGTA 4TY7A 5AHGH 4F49A 5EXLA 4ZAEA 3RXHA 1HV7A 2A1DB 2A2QH 1C4U2 3OTPA 1JIRA 4CH2B 2BX4A 3GYLB 5AFYH 3DD2H 1CA0B 4O9VA 3RXPA 3VGCC 1YGCH 1A5IA 1RTFB 1ZJDA 3SU3A 1VGCC 4HTCH 1C4Y2 2BZ6H 2IPHA 1UHBB 1SQAA 3GY5A 3RXUA 3UNQA 1DS2E 2WSSD 3L6PA 5EODA 4B75A 4KTCA 2Z7FE 1PPZA 2WINI 2Z3EA 1C5VA 1WCZA 3MNCA 2ZTZA 2BXUH 1LVYA 3SUFA 1EXFA 2KAIA 1OOKB 5EJLA 2VIOA 3SHAH 5IYTA 1C5LH 3ZV8A 1EP6A 1EKBB 1BRBE 1E35B 2BQ7B 2VIQA 3KYGA 3SOSA 3BTFE 4TYDA 1IQLA 4GPGA 3ZYDA 4AFUA 3OAAD 3EQ0H 3RM2H 3PRDA 4DIIH 1BRUP 4DY7B 2AERH 4B6FA 2B7DH 3SNCA 3U98H 4X1PU 3Q77A 1DITH 1KXFA 2Y7ZA 4TSFD 4D7FA 1A0JA 2G52A 8KME2 5DGJA 3SO3A 1CHGA 4H6SB 2G5VA 3DT0H 4WF8A 4NFEA 1PQ7A 4X1SU 1UTLM 1G36A 3I78A 1XUIA 1P2QA 1T8MA 3URDA 2SNWA 1QURH 1SVPA 1UHBA 3SQHE 2ANWA 3BF6H 4P02A 1GCDA 4IMZA 1G30B 4E06H 2JJ1D 1VITF 3MQKC 4Z6AH 5T3HA 4DURA 3GDVA 1ZOMA 2BDCA 1C1NA 3UTUH 1MMJN 1C5PA 4OGXA 1BMNH 4X2WA 1SSXA 3ZZCA 7LPRA 5GCHF 1UVPA 1IQIA 1T8OA 2JETB 3PO1B 2P3FH 1GMCG 4I32A 1IQGA 4YESB 1MABB 1SGFA 2XCNA 1SLWB 2O8TA 3ZZ6A 1AVXA 3M7QA 5H4IB 5KEDA 1BZXE 3RXOA 1FQ3A 2VJ1A 1Z6JH 3ENSB 5EW1H 4BOHA 2IN2A 1HNEE 2ZFQH 2H9TH 1KMHB 1PFXC 2W6JD 1V2LT 4ABIA 3JZ2B 4GHQA 3OE7D 3MWIU 1GJ5H 1FX0B 2VIDA 3GOVB 1D3TB 5FHTA 6LPRA 1GBFA 1EB2A 6ESTA 1OP2A 4WXIA 1AFQC 1HAHH 1FZZA 1NM6A 1QL9A 5HKKD 1TALA 1NFXA 3OTJE 5EU8A 2EQNA 4AYVB 2WPKS 3SUEA 1K2I1 1OP8A 2G8TA 2B9LA 2HNTC 2PP6A 4D9RA 2BLOA 3BTWE 6CHAC 5HMAA 1KLIH 1WAYB 1A2CH 4FUHA 2A2XH 2ANYA 1K0HA 3EA9A 1AUTC 3A7TA 1J17T 3P8NA 3GY3A 1H9LB 4BTIB 3LH3A 5TCAA 2ZCLP 2ZFFH 1MTNB 1LKBA 1DXWA 1O3JA 4NA9H 3U1JB 3A86A 2UWPA 1FAXA 2PGBB 3E6PH 1C5SA 1C2FA 3SYJA 4X2YA 1ELFA 1G37A 5CHBA 5E0JA 2VH6A 1Z1IA 3OU0A 3FZZA 1O5EH 4UFEH 5DK1A 3GCHC 7KMEH 4MPVA 7GCHG 2NU4E 4ABGA 4SGAE 1WU1A 3A8AA 2M5TA 1BJVA 2TGAA 4JMYA 5SGAE 2H1UA 1NRRH 3PLPA 1T7CA 4K8YA 2GZ9A 2SGQE 2Z9GA 3M35A 5J4SA 3SQEE 2Z9KA 2QYIA 3LT3A 2ZEBA 1QFKH 3FN8A 4Y7BA 2QN5T 2D8WA 3ZVFA 2ULLA 1AD8H 1A5GH 1G3CA 1SGDE 3M3TA 3UIRA 1GMCF 1Z8RA 1OWHA 4ABFA 1ZPBA 1YY3A 5A09A 5LGOA 1P0SH 2GCTC 1ZTLA 3RXBA 1A3BH 2R9PA 3PLKA 2IPQX 1GBHA 3T28A 1TNGA 2FOHA 2JKHA 2Y7XA 3MH4A 2C4FH 4NG9H 1KTTB 3TNSA 1HAXB 2A4GA 1F5KU 1B7XB 2BDHA 2YNAA 1THSH 1FJSA 1SLUB 1N8OB 3SW2B 1MBQA 2YMSD 1BTZA 1HJ9A 3A8CA 1HRTH 1UTOA 4KTSA 1O5DH 1ELTA 1GCTB 3KF2A 3ZYEA 4WMEA 1QJ7B 4K1TA 1FY1A 2VH0A 1O2WA 3GY2A 1KXAA 1F5RA 2SGFE 1O3AA 2YMSC 3NKKA 1WSSH 2C8YB 1YPHC 2EA3A 1DFPA 1V2MT 2RDLA 1W2KH 1J8AA 5L30H 4WWYA 3T25A 1Y5BT 5K0HA 1ZJKA 1VCPA 5EGMA 2VWOA 3TU7H 1V2UT 3FP8E 1SGNE 2DE8A 1SHHB 3RMNH 2D26C 4Y76A 4RKOB 1H8HD 5DP4A 4RKJB 5FBEA 3RXAA 3ZIAD 3PV2A 4IN2A 1C1RA 1UTMA 1YPKH 5CMXH 1TX8A 4XBBA 2ZGJA 1O2IA 1GI1A 1W0JD 7GCHF 2GMTC 4Q2KA 1OHHD 1SPJA 4AX9H 1QL7A 3EE7A 1GHAG 1GPZA 3TK5A 2J4IA 3RXRA 1LTOA 1O33A 1C1PA 2IOTA 2VGCC 3HKIB 1CGHA 2O8UA 2ZGXH 1ELEE 3ZZ4A 2BB4A 9ESTA 2J95A 5EW2H 3U9AH 3UR9A 3ATMA 2QF4A 1L0ZA 1SGFG 1ZRBA 3IG6B 3SU0A 2Z9IA 2WV5A 3MO6A 4NGAH 3P95A 4XDEA 1HJAB 2LP6A 3JZ1B 1W7GH 4Q80A 3UY9A 1ZRKA 1KDQB 1Y3UA 5HM9A 1TMTH 2OTVA 3UFAA 2B8OH 3ZVDA 4Y10E 4YLUA 1CGJE 1ETRH 1K1LA 2AEIH 1XUJA 3BEUA 1Y3VA 2DE9A 1QHRB 1NESE 1OWIA 2FMJA 2BYAX 4CHAB 2IJD1 4YOIA 3ZZ9A 3MTYA 9LPRA 3C27B 3B23B 2A32A 1FNIA 1PPFE 5EPYA 1IQHA 2RFKC 1MZDA 3ZZBA 3FAOA 4MPXA 2AGEX 3P8FA 1MQ6A 1V2PT 3RXIA 1ELVA 1E38B 3E90B 3GY7A 1HGTH 1V6DA 1NO9H 5GPIB 2J98B 1O3FA 2PHBA 2G51A 2UUYA 4JCNA 3PRBA 1C2JA 1EZXC 1O2SA 3KQBA 4RSPA 4CRDA 1FN6A 5E2OA 1MUEB 1SFIA 1XXFA 3RC4A 1BBRK 4JZ1A 1C5NH 1GBJA 1BTPA 3IWMA 4HZHA 1TGBA 5JBTA 3ATLA 1RTLA 1DUEA 1GI2A 3ODFA 1GHAF 1KXDA 1BDAA 3MNBA 1ZMNA 3QWCH 1CHOG 1FUJA 1ZLRA 4MTBA 2ZCHP 1GMDG 4O03A 1QQ4A 3K65B 2PUXB 3RXEA 4AGKA 1CQQA 1O2LA 1S6LA 1G32B 1SR5C 1C1QA 1TNJA 4X1RU 4TPIZ 3A8DA 4WH8A 1EFRD 1UJ1A 5A0BA 2ZDMA 5LPRA 1Y3XA 1O2OA 1CA8B 3DHKH 1HUTH 4AC9A 5DP8A 3M5LA 1O2TA 3D49H 1RIWB 3SZNA 2ANMH 3MU5A 2ZNKH 3N99A 2FI3E 2J98A 3M7UA 3SBKA 1O5CB 4XBDA 1C5TA 2GP9B 4B2CA 1SGQE 2ZFRH 2OQUA 1JRSA 3F9FA 1O5BB 3BTEE 2I6SA 3GCTG 3KL6A 2HRVA 1NC6A 2ZFSA 1ZR0A 1V2JT 3QK1A 2PKAA 2GGVB 1SOZA 2KR7A 2FOFA 2XBVA 1S0RA 3PYHA 4ABAA 5GWZA 2A5IA 4HGCA 3BTME 2XRCA 2CHAB 1BTYA 3OFND 4KGAA 4FETA 1B0FA 1GHZA 1GBKA 1NU7B 2O8WA 1QGFA 4E05H 1YWUA 4JZIA 2BDAA 1V2KT 1TPSA 3K6ZA 3MFJA 4F55A 1P2OA 1BTHH 1SB1H 2EY4C 1O3DA 1MAXA 3UNSA 3PMHB 4IMQA 1CGIE 1SC8U 3UREA 2GVFA 3VXEH 1HCGA 4NIVA 2CJIA 4CRAA 2AMQA 3UWIA 2XCFA 3TLOA 1WTGH 1BMLA 2W6ID 2ZF0H 1FIZA 2P3UB 1AWHB 1UVSH 3UPEA 3SV6A 1ZSJA 1NRSH 1O3GA 5AFZH 3L3TA 3OX7U 4B1TA 3BIVH 1EUFA 2PLXA 4XE4A 3F3BA 3ZVGA 1OX1A 1QTFA 2OUAA 5C1YA 1YC0A 2RDEA 1CHOF 3F1SB 4Y0YE 1SHYA 1UTQA 4I8GA 1GG6B 3QX5H 2F9OA 2J38A 1HAGE 2V3HH 4NCYA 1Z8IB 2ZU1A 1GMDF 2HLCA 4X8VH 1SQRA 4A5TS 3E0NB 1CO7E 1AVGH 3NRLA 1P12E 1RRKA 1K1PA 3SZEA 3BTGE 1TIOA 4X6NA 5E8EH 1WQVH 1F7ZA 3PLBA 4NIYA 1K1OA 4JK6A 3O8RA 2RCEA 1G3DA 4MDSA 4O3TA 1AB9C 2KCYA 3MU4A 4ISOA 3O8CA 1IQJA 4UFFH 3TK6A 4DT7B 2JDID 3TK9A 1EPTC 1O30A 1O3PB 3VEQB 3FZDA 1HAYB 2BDBA 1JWTA 2VBCA 1TBZH 2PWXA 1PPCE 2CK3D 1QB9A 1H8DH 4CRBA 2A0QB 1FDPA 3OSYA 1AI8H 3GCTF 1A3EH 1BA8B 4NFFA 4YZUA 3UWJH 3BEIB 2W7SA 1WQSA 2FM2A 4NIXA 2F83A 2B5TB 3LGYA 3ATKA 3DSGA 4TT3D 5T6FA 1D3PB 2GKVE 3MYWA 3OEHD 5DG6A 3ZZ7A 1UTPA 1NTPA 1DWDH 4JYVH 4FUFA 1HAVB 1LKAA 3BG4C 2GT8A 2VB0A 4Y79A 5T6DA 2XC4A 1AE8H 2IJOB 2ZG0H 5FL7D 1NPMA 4YOJA 1P2JA 2FX4A 1UCYE 4H6TA 2C90B 3RU4E 4CBNA 2ZDLA 6CHAB 2BD7A 2F9NA 4VGCB 4INLA 1FXYA 2FOGA 3V0XA 1XXDA 4FUJA 4BAQB 1QJ6B 1NFYA 4KKDA 3CENA 3H7TA 2BVSH 1L2EA 4DW2U 2QY0B 2XTTB 1ZHRA 2NU1E 1P09A 3B9FH 3SGAE 2VVVA 3M5OA 2WYJA 4I31A 3ZZ8A 4FUDA 3RUOA 1ELDE 5JBAS 3KIDU 1L4ZA 3IITA 2FODA 5BRRE 4FUGA 2XBYA 3SNEA 1Y8TA 2EC9H 1GHWH 3D65E 4XFQA 3ZZ5A 1SBWA 1AE5A 3VXFH 3M3SA 5JDUB 3AVZA 3ITIA 1SQTA 4FU9A 1P11E 2HGTH 4DGJA 1GDNA 1THPB 2VIVA 1V2VT 1O39A 1QA0A 1F5LA 3CP7A 2GJGA 1HAVA 2FYQA 1AU8A 3SJOA 1XVOA 3RXLA 2O8LA 3A7WA 2WPHS 2H9EH 1DY8A 4X8SH 3N7OA 2FXRA 1TX6A 5DP5A 3SU1A 1ZYOA 3ZVAA 3MNXA 2SFAA 4WJG2 3QGNB 1WV7H 3BTTE 2BLVA 2BQ6B 1QBVH 3K2UA 1GI6A 4ZKRU 4OGYA 3RXGA 2FESH 1A4WH 1O2YA 4WMDA 2BZAA 1KTSB 1YLNA 2FYRA 1NZQH 2ZC9H 2PKSC 1UCYH 2ZWLH 3LGTA 1QCPA 1HXEH 2G5NA 3HK3B 1GI9B 3MU1A 3SGBE 1WDIA 1GI7B 3M5MA 4YO9A 1LHEH 1A46H 2BD8A 1GBIA 2QAAA 2PGQB 1Z7KA 2QE7D 3VPKA 3EYDA 1DLKB 1W3CA 2R3UA 4I8HA 1G3EA 1FLEE 4RN6A 3KQEA 1AHTH 2P8OC 1EOJA 5J4QA 2OC0A 3W94A 1ZSLA 2CF8H 2YMSB 4X1QU 5ABWA 2QC2A 2SGAA 1FONA 5JBBS 5EQSA 1D9IA 2O8MA 1PQAA 3RXSA 1TNLA 3F9EA 5GXPA 5CHAB 3EE0B 1W0KD 2ODQA 3VB3A 2KM0A 2ZA5A 1SGCA 1TA6A 3F68H 2VVUA 1MKWH 1B5GH 1CBWC 5AVDA 2G4TA 2JH5D 1MTVA 2ALVA 3VB7A 1E34B 3FO8D 3P92A 1TE0A 1KYNA 1RGQA 2NWNA 1TNHA 1QA7A 1Y5AT 3RXDA 2FDAA 2SGPE 4WH6A 1VITH 5HXFA 5DP3A 2HVYB 1JOUB 3AK5A 1P10A 2V3OH 5JB8S 5HM2A 2BM2A 4NIWA 1O37A 4YT6H 2OCVB 1QIXB 4HG6A 3Q00A 2RA0A 2ZIQH 1TMUH 2STAE 2VGCB 3DSOA 3Q3YA 2FZZA 3A89A 2UUFB 3BIUH 1TOCB 5F8ZA 5FPTA 4AORA 5DO4H 1E1QD 1EZUC 3A7XA 4K1EA 3MU8A 2ZGHA 4NWLA 3VB4A 1SKYE 3HK6B 4DJZB 3S69A 1DANH 4ACBA 1UMAH 2K0QA 1C1VH 3B8JA 2ESTE 4I86A 1MZAA 3DUXH 1O3HA 1OYTH 1GDUA 1UCYK 2JJ2D 3WWBA 2BY7X 1C1MA 3VB5A 3MHWU 1YBWA 5I46H 3KGPA 4Y11E 2XC0A 1G2LA 1YPJH 3SV2H 5EOKA 2A5KA 4FU8A 1YPGH 1PPHE 2CN0H 2Q6DA 3TNTA 4LZ1H 5AF9H 1QNJA 2J94A 3A82A 2AIQA 1FPCH 3BTDE 4A92A 2GTBA 4JZFH 4ABDA 1LCYA 1DX5M 3SNDA 1GJCB 5C5OA 2PTCE 1GVKB 1P2KA 1O3KA 1P9SA 3TH4H 4PROA 1MKWK 1GBCA 4MPWA 2W7UA 3C1KA 1VJAU 3SV7A 1RXPA 3TJNA 2BQWB 2XW9A 1BBRE 3M37A 1FPHH 1H8ED 2WV4A 3ATWA 1H8IH 1DWCH 3NCLA 1TLDA 4YTAA 4Q7YA 1PPBH 3F2HA 1CA0C 2QV1A 1IHTH 2GCHG 2FI4E 3A7YA 2XNIA 1ZHPA 4BTTB 2BY6X 3NUMA 2Y82A 1WUNH 2G4UA 2XNDD 5C0TA 1AIXH 5FXLA 5EXMA 3TVJB 2OK5A 3RXVA 1EAIA 5DKMA 1U6QA 3TGJE 4NSVA 2AGIX 5G4BA 2Y81A 1O2UA 1UTKA 3RMMH 1QQUA 1CSOE 4XD7D 1YKTA 1OXGA 1T31A 1BHXB 1GMHG 2F9VA 4D7GA 4B71A 2AHME 1SGEE 3SNBA 1C2HA 2WPMS 2R0KA 1AQ7A 2WPLS 2OD3B 4FUEA 4Y8ZA 3UUZA 3R0FA 2FX6A 1BITA 1CVWH 1JIMA 1WOFA 1HFDA 2ALPA 1YPEH 2P3TB 4X8UH 2A7JA 4ZKOU 3PTNA 1FY4A 2TGPZ 5FPYA 3W1EA 1Z1JA 4IS5A 3CS7A 5C5NA 2ZTXA 1O2MA 3RU4T 3QUMP 5FX6A 3E16B 3P70B 3P17H 4YOGA 1LVMA 1F0RA 2PW8H 3KNXA 4AFSA 5ESTE 1IOEA 4GAWA 1W0ZU 2WPDD 2F9UA 3E8LA 1WTHD 1BCUH 2WPJS 2WUCA 3BG8A 4DOQA 1LVOA 1QJ1B 1BBRH 1CT4E 2ZTYA 2FIRH 3BV9B 3T5FH 1UK4A 1GJAB 1YCPK 4NA8A 2FEQH 3AAUA 3RXKA 1Q2WA 2JETC 1EAXA 1HJ8A 2BDIA 3I29A 5F8XA 3VG8A 3SORA 3PO1C 4ABBA 3HPTB 2P16A 1F0SA 1ANCA 3MO9A 1M9UA 1ZTKA 2ZGBH 1TRYA 4AGJA 2Y80A 3PWBA 2AFQB 1UK3A 2A4RA 2GCHF 2V3MA 1GI3A 4IC6A 4GLYA 2A5AA 1G9IE 4BNRA 2FOEA 3MU0A 1T4VH 5C3NA 5C1UA 1E79D 3VB6A 4Y8YA 4Q63A 1A0LA 2XC5A 5LPFA 3H7OA 4X6PA 3UOPA 4MG3A 1FMGA 1EJNA 1DUAA 3QLPH 2I6QA 2HNTF 2CGAA 2D2DA 4ZHAA 1DE7H 1NBMD 2Z3CA 3RP2A 1P2MA 1ESAA 1MCTA 2ZDVH 1GMHF 4IBLH 1ID5H 5TCCA 1HBTH 3STJA 4YLQH 2A4QA 2KCAA 2R3YA 3FOAA 3QGJA 2V0BA 1DICA 1GJ9B 1O35A 2ZU2A 1GJ6A 3TGKE 1GI8B 4HFPB 1EJAA 5FAHA 1MTNC 3BSQA 3GDUA 1Y59T 1YLCA 3N7EA 1B0EA 1TWXB 1HAZB 1LMWB 2QIQA 1TQ7B 1PJPA 4X2VA 4ZKSU 2VWMA 2ZZUH 3PMAB 1KIGH 1TB6H 1S83A 3OEED 3SUGA 3EGKH 5FCKA 2QF3A 5HYOA 3UQVA 1GJDB 3N7DA 3FFGA 3STIA 5JYIA 4R0IA 4H4FA 4E7NA 3WW7A 1A0HB 4ABHA 2OP9A 2JH0D 4OS1A 2Y5HA 5GDSH 1ANEA 1JMOH 2PKAB 4OM9A 1NT1A 2GT7A 2OBOA 3MH6A 4ISNA 1ARCA 5C67A 2Y5GA 4AYYB 1TONA 3LGUA 4MVNA 1O2VA 2AIPA 1DVAH 1MQ5A 2GDDA 5FX5A 1C5YB 2WV9A 4INKA 1C2EA 4JK5A 4XRNA 2GX4A 3ZZAA 1HXFH 2GZ7A 5B6OA 2WYGA 3DFJA 1K1MA 1O2JA 1AMHA 2FOAA 2WHXA 2ZCKP 3PTBA 4F48B 4DIHH 5DN6D 2GD4B 4ZROA 3SU5A 1NRNH 4CH8B 2ANKH 2PSYA 4Q4LA 3U8TH 1BRCE 3SJKA 1XUHA 5C94A 2PV9B 3PMJA 3Q3KA 4ZUHA 1HIAB 4K60A 1BTWA 4ASUD 1AO5A 1N8OC 2BY9X 2F9PA 4ZHMU 4ABJA 1FN8A 1OP0A 2ZFPH 3LKWA 1GCTC 1IAUA 3SU6A 3VGCB 1L4DA 2P95A 8GCHG 1AFEH 1VGCB 2H9HA 1GHXH 2OC7A 3LJJA 1YLDA 2FOMB 1GDQA 3H5CB 2AGGX 2AS9A 1SGPE 3RMLH 2JIZD 1J15A 3TJOA 4KELA 5HIYA 1W13U 2BMGB 5DSFA 3FP7E 1E0FD 2BLQA 3RU4D 3AW1A 4TPYA 5F6MA 1GGDC 1J14A 1ZMJA 3Q76A 2SNVA 5BPEA 1GI5A 2SGDE 1ELBA 1SFQB 3SV8A 1EATA 1FV9A 1SGYE 1C5WB 1T32A 1W7XH 2FS8A 3T2NA 1GBAA 1SG8B 1GL0E 1BIOA 2AMPA 4AZ2B 2TRMA 3GCOA 4BAMB 1UO6A 2ZO3H 4J2YB 1HYLA 3A83A 4XOJA 1XVMA 1C1WH 3KEEA 1WXRA 4OS2A 2ZECA 1E1RD 2J9NA 3PB1E 3RLYH 1DT2A 1HIAA 3M61U 2BY5X 2FLBH 2GV7A 4ZXXH 1D6WA 2VNTA 1HAPH 2XBWA 3U8RH 4FUBA 1C2LA 3RMOH 4FVBA 3EDXB 1O2ZA 1ZMLA 2W26A 1LHDH 4IW4E 2EI6A 4ZCNA 4CBOA 2OQ5A 1N6YA 2ZKSA 1TRMA 4K8BA 4MNWA 5DP9A 4IC5A 4UFGH 1SL3A 4ISHH 4NWKA 3GYMA 1O5AB 5DP6A 2STBE 1WYKA 3KCGH 2THFB 3KN2A 4LZ4B 3LC5A 1HJAC 1XUFA 4ISIH 4RI0A 2ZHEH 1O3OA 2VINA 1XM1A 2OBQA 3A7VA 1Y3YA 1CBWB 3AAVA 1ELGA 1ZSKA 4FXGH 4B73A 2BDYA 1EZSC 1GVLA 1C2MA 1TYNA 1ZZZA 2OLGA 3S7KB 1W12U 2BOKA 3D62A 1VR1H 2ZHFH 1ESBA 1F92A 1TPOA 4CHAC 2Y5FA 4LXBH 2QXHA 1GHYH 4BXWA 5GJ4B 8GCHF 1LQEA 1EJMA 1SLXB 1C5ZB 4X8TH 4IN1A 2ZQ1A 4X1NU 1P05A 2C8ZB 3CS0A 1P3EA 2BHGA 1GVZA 3U69H 1YCPM 1AFQB 1TOMH 2F43B 1W14U 2HPPH 3ZVCA 2BD3A 4GCHG 5IDKA 3QTOH 3E91A 3GICB 1S6HA 1AZZA 1D4PB 3R3GB 4BAOB 1W0YH 2V6NA 1C2IA 1PPGE 2FOCA 2BVRH 1K22H 1TGNA 1OS8A 5C0UA 1Z6EA 4ZMAH 1P01A 3E0PB 4U2WA 1MKXK 2Q6GA 2GV6A 3MH7A 4GSOA 2PSXA 1C9PA 3G01A 1LPKB 3VFEA 2R0LA 1NY22 1TPAE 1ZGIA 2TGDA 1N1LA 2VWLA 3P8GA 1C2DA 2J2UA 2QXJA 1C5OH 1BHXF 2ZPQA 2LPRA 2TPIZ
chains in the Genus database with same CATH topology
4B2AA 1C1SA 1F0UA 1RD3B 2PUQH 1RTKA 1TX7A 3GCHB 3O8BA 1IHSH 2TIOA 2A7HA 3UR6A 1EZQA 2YOLA 1H9IE 2ZQ2A 3SU2A 1BB0B 1RIWC 2R2WU 1TNKA 1BTXA 1O3MA 4A1XA 1CT0E 3SN8A 1EAWA 3W95A 3A8BA 4ASHA 1MTSA 1XKBC 4B2BA 3UNRA 1NN6A 1Y3WA 1C5RA 1VZQH 2VWNA 3V12A 4Y8XA 1C5MD 4DG4A 4WVPE 2A7CA 3GCNA 1C9TA 2ZHDA 2GCTB 1L1NA 2W5EA 2ZI2H 1OWJA 4CR9A 1GJ4H 3BN9A 1L1GA 1A1RA 1AN1E 1ZPZA 3AASA 1QB1A 2P59A 6GCHG 1FI8A 4I8KA 2CHAC 4ZHLU 1QL8A 2W3IA 1KXBA 1RFNA 1T8NA 5K7RA 4FUIA 1DPOA 4A6LA 3EAJA 2QF0A 2ZU3A 1LHCH 1NU9A 1W11U 4GHTA 2G55A 1MU6B 2EI7A 3ZVBA 4AFZA 1IQMA 1Q3XA 4GCHF 1LO6A 5L6NH 3QZQA 1IQFA 2FLRH 5A2MH 1F0TA 1KXEA 5EG4A 3TIUA 3A88A 2JH6D 5I25A 1EB1H 3LU9B 5F03A 2C93B 2ODYB 2XXLA 1E36B 1TMBH 2BXTH 3QN7A 3SUDA 4I33A 4H42U 1C5XB 2G81E 2BD5A 5DP7A 2GZ8A 2XWAA 1GG6C 3GY4A 1K1IA 2RA3A 2XWBI 1INCA 3V3MA 2Q6FA 4MLFB 5A0AE 1V2QT 4Y0ZE 3NZIA 1GI0A 2GMTB 4QT8C 4INHA 2CXVA 4CR5A 4UDWH 3S9AA 2NU3E 4UD9H 2A45B 1QBOA 3A81A 2B0FA 1ETTH 3GY6A 1S82A 3ZV9A 2FWWA 1C1UH 1ACBE 1ZGVA 3BTQE 4U01A 5L2YH 1V2NT 2C8XB 4MNYA 5LH8A 3HGNA 1OWKA 1YF4A 3RC5A 1DWEH 1DOJA 1PPEE 4WXVA 3KHVA 1HAOH 1MTUA 1OPHB 4MNVA 1O2GH 3GISB 1Y5UT 1O2RA 5LPEA 1GBDA 1TABE 2Z6BD 1TGCA 1CU1A 1S84A 2OINA 6GCHF 1QB6A 1ZHMA 1ZPCA 3RXCA 2VIPA 2H2ZA 2J34A 4NZLA 4BAKB 1V2ST 2FP7B 1UTNA 1T4UH 2YNBA 3ZZDA 1C5QA 1XMNB 4K5ZA 1V2TT 4ZXYH 2HOBA 1GBLA 1MD7A 1QRZA 1SLVB 1IQEA 3ATIA 4VGCC 1BTUA 4BTUB 3RC6A 3GDSA 1DY9A 1PQ8A 3LOXA 5EXNA 3ZVEA 3ELAH 8LPRA 1X7AC 1S5SA 1FY3A 2BDGA 4O97A 2FS9A 2OC1A 2ODPA 1YCPH 1NFWA 2BLWA 1UVTH 4CRFA 1V2RT 4CRCA 1VCWA 2FO9A 3FANA 1LVBA 3EA7A 1LPGB 3D23A 3P8OA 1JXPA 2UUJB 1DSUA 1OWDA 1GI4A 3NWUA 5C1XA 1HB0B 1P04A 2D1JA 4M7GA 1GWAA 1H9HE 2F9BH 4GUXA 5T6GA 1CE5A 1C1OA 1ZTJA 1GHVH 4AN7A 1TNIA 1BMAA 3OY6U 1TBQH 1TBRH 1UK2A 4CRGA 3SHCH 1TAWA 1O32A 4MQAA 5ETXA 1C2GA 3QO6A 3QTVH 3F9HA 4TWWA 1OYQA 1Q31A 1MD8A 1GBBA 3MMGA 4OS5A 1S0QA 3SI3H 3BTHE 3K9XB 5PTPA 4XBCA 4D76A 2ZPSA 2ZP0H 5JPMH 1SI5H 1PYTD 1C4V2 1IQNA 2P94A 2ZU5A 4I8LA 3RLWH 7ESTE 1YP9A 3A7ZA 3PROA 4O3UA 1SGTA 3BEFB 1DDJA 2ZFTA 1D3DB 1EP5A 4WMFA 2HNTE 2Z3DA 2BX3A 2F91A 2AYWA 3LGIA 3SNAA 1PYTC 4IGDA 4BANB 1T8LA 3S9CA 1C2KA 3U1IB 1O34A 2ASUB 4KTUA 4A7IB 1LDTT 2C3SA 1GGDB 5CHAC 4JYTA 1EQ9A 5GIBA 1CT2E 1DLEA 3TITA 4HI3A 3KQDA 5C2ZA 2K1QA 2O9QA 4JYUH 1H1BA 1SGIB 3T26A 4B74A 4OS6A 1THRH 4NSYA 3HATH 3FP6E 1F2SE 4CREA 2Z9JA 1O3CA 3MI4A 1O3EA 1UVOA 4U32A 5JBCS 3S0NA 3V7TA 1N6XA 3I77A 2QXIA 3A84A 3RM0H 4A1TA 4AFQA 3SJIA 1W10U 2CV3A 1Z71A 2FOBA 3QDZB 1O0DH 1BQYA 1BOQA 1QBNA 3LC3A 2VVCA 2Y6TA 4Q7XA 3M5NA 5A8XA 3M7TA 4B76A 1HPGA 5EQRA 1YPMH 1P3CA 2RG3A 3E3TA 4YM9A 1ABJH 2C8WB 1A61H 1K21H 1PQ5A 3F9GA 4UEHH 2AH4X 2CMYA 1ETSH 1W8BH 1Z8GA 4R8TB 4DVAU 5JB9S 3RXQA 2ZDAH 3F6UH 5L2ZH 5CE1A 2J92A 1J16A 2ZPRA 4UE7H 4J1YA 4ZH8A 3DFLA 1AKSB 2P93A 2UUKB 3M3VA 1NROH 5E0GA 1AB9B 4U30A 1LPZB 1AGJA 3AW0A 1AUJA 2CF9H 1O3LA 4FUCA 3A87A 1EPTB 2UWOA 1C1TA 4FU7A 3HKJB 1ANBA 2R2MB 5FBIA 1O38A 1G3BA 1ORFA 1K9OE 1K1NA 4LOYH 2FTLE 3ODDA 1FY5A 5E0HA 3LGVA 3HGPA 2A31A 3LONA 1SMFE 1SGRE 3FVFB 3BTKE 2UWLA 3EA8A 4Q7ZA 1IQKA 1GHBG 3LDXH 1YPHE 3RXJA 4K2YA 1KXCA 4ZKNU 4Y71A 3BG4B 1TFXA 2OC8A 1AVWA 1Z8JB 1O2KA 3PWCA 2BTCE 4BXSA 1A7SA 4XSKU 1LHGH 5ESBA 3PM3A 1GBEA 4K3JA 3DA9B 2FPZA 1OSSA 2DUCA 3PV4A 2F3CE 1FY8E 1AKSA 1P2NA 1KDQA 1G2MA 3NXPA 3TH3H 2WPIS 4ESTE 1EPTA 1C5UA 2BVXH 1HAIH 3T62A 3S9BA 1XX9A 1AWFH 4A1VA 4JZDH 1P57B 1TQ0B 2EEKA 5DPAA 3U8OH 3L33A 1XUKA 3MO3A 1QRXA 1GJ7B 4YT7H 1O2PA 2BD2A 2ZGCA 3URCA 1D6RA 1O5GH 2GDEH 5A8YA 3WY8A 4LK4A 3GY8A 5A0CA 2BD9A 1TA2A 3UOUA 3TH2H 1O2QA 4MPUA 1FIWA 3RDZA 2ZU4A 1HDTH 1V2WT 1ABIH 1EAUA 2BY8X 4I8JA 1LQDB 1GJBB 3LPRA 1MH0A 2G00A 3RXFA 5A8ZA 3KQCA 1XUGA 3O8DA 4F4OC 1ELCA 3MOCA 3P6ZB 1S81A 3K6YA 4TY6A 1O31A 3TPIZ 1V3XA 2EI8A 2OXSA 2AMDA 4BAHB 2XBXA 4AB9A 4UFDH 4OS4A 3MH5A 2QA9E 1KY9A 1MKXH 3LJOA 4D9QA 1MTWA 3SU4A 2PKSB 1DSTA 1GHBF 5E2PA 1ELAA 4KP0A 1MAYA 3SJ8A 1HLTH 1ANDA 4OS7A 2ILNA 4JZEH 1YYY1 1AZ8A 3SV9A 1O5FH 5EPNA 1VJ9U 1WBGB 1RS0A 2LNCA 3ZZ3A 3NPSA 2Q1JA 1NRPH 3TGIE 3TJUA 4NZQA 1OWEA 1XKAC 3OY5U 4Y6DA 1EASA 2P8OB 4TWYA 4SGBE 5F8TA 4ABEA 1P2IA 5FPSA 2VIWA 2BOHB 3LGWA 1MBMA 3A80A 1BT7A 2WUBA 2PFEA 2PR3A 1DM4B 1LHFH 5FCRA 1JBUH 4DCDA 1P06A 1YPLH 1BRAA 2H6MA 3RXMA 1TRNA 1O3BA 3SGQE 4E7RG 1P9UA 2QGRA 2V35A 3PMBB 4WY3A 1NRQH 1MCVA 2ZHQH 3T29A 1GBTA 1O3NA 1QRWA 2HVXA 1BUIA 5HGGA 1P02A 4UONA 4Y7AA 2FTMA 4FVDA 1AY6H 2ZDNA 1O3IA 3NK8A 1KSNA 4X0WU 4AOQA 5EQQA 1V2OT 4Z0KA 3RXTA 1S85A 4X6OA 4K1SA 4AG1A 1MU8B 1UTJA 4MNXA 2NU2E 1D3QB 1K1JA 1OKXA 3SJ9A 1O2NA 3ESTA 3MNSA 1H4WA 1VCQA 2HWLB 2QXGA 1O2XA 1NFUA 1JRTA 1NS3A 2NU0E 1TGSZ 4K69A 1QR3E 1J9CH 5TJXA 4D8NA 4X6MA 2TBSA 1E37B 2A4OA 1DWBH 3E1XB 4ISLA 1ESTA 1A5HA 1QY6A 3A85A 1FAKH 1KLTA 1TPPA 3LIWA 1DXPA 1EX3A 3QZRA 3T27A 2Z94A 1O36A 3UQOA 2H5CA 2QCYA 1BMMH 2FI5E 1KLJH 1P03A 1YM0A 2PTNA 2ZHWH 1K28D 2KAIB 1TGTA 1ARBA 3TJVA 4X2XA 1RJXB 2ZDKA 1O2HA 1SOTA 4AB8A 1P8VC 5DJ7A 4GVUA 2W3KA 3LH1A 2VU8E 2BD4A 3M36A 1BJUA 3Q3XA 1VITG 2XYAA 4I7YH 3S7HB 1UVUH 1GBMA 3OYPA 3SI4H 2Z9LA 4AG2A 5GCHG 2HPQH 3V13A 2SGEE 1SQOA 5C20A 1EOLA 1L1JA 1GJ8B 1GL1A 4NA7A 2HALA 2H5DA 8ESTE 1S6FA 4THNH 2TGTA 4TY7A 5AHGH 4F49A 5EXLA 4ZAEA 3RXHA 1HV7A 2A1DB 2A2QH 1C4U2 1JIRA 4CH2B 2BX4A 3GYLB 5AFYH 3DD2H 1CA0B 4O9VA 3RXPA 3VGCC 1YGCH 1A5IA 1RTFB 1ZJDA 3SU3A 1VGCC 4HTCH 1C4Y2 2BZ6H 2IPHA 1UHBB 1SQAA 3GY5A 3RXUA 3UNQA 1DS2E 3L6PA 5EODA 4B75A 4KTCA 2Z7FE 1PPZA 2WINI 2Z3EA 1C5VA 1WCZA 3MNCA 2ZTZA 2BXUH 1LVYA 3SUFA 1EXFA 2KAIA 1OOKB 2VIOA 3SHAH 5IYTA 1C5LH 3ZV8A 1EP6A 1EKBB 1BRBE 1E35B 2BQ7B 2VIQA 3SOSA 3BTFE 4TYDA 1IQLA 4GPGA 3ZYDA 4AFUA 3EQ0H 3RM2H 4DIIH 1BRUP 4DY7B 2AERH 2B7DH 3SNCA 3U98H 4X1PU 3Q77A 1DITH 1KXFA 2Y7ZA 4D7FA 1A0JA 2G52A 8KME2 5DGJA 3SO3A 1CHGA 4H6SB 2G5VA 3DT0H 4WF8A 4NFEA 1PQ7A 4X1SU 1UTLM 1G36A 3I78A 1XUIA 1P2QA 1T8MA 3URDA 2SNWA 1QURH 1SVPA 1UHBA 3SQHE 2ANWA 3BF6H 1GCDA 4IMZA 1G30B 4E06H 1VITF 4Z6AH 5T3HA 4DURA 3GDVA 1ZOMA 2BDCA 1C1NA 3UTUH 1MMJN 1C5PA 4OGXA 1BMNH 4X2WA 1SSXA 3ZZCA 7LPRA 5GCHF 1UVPA 1IQIA 1T8OA 2JETB 3PO1B 2P3FH 1GMCG 4I32A 1IQGA 4YESB 1SGFA 2XCNA 1SLWB 2O8TA 3ZZ6A 1AVXA 3M7QA 5H4IB 1BZXE 3RXOA 1FQ3A 2VJ1A 1Z6JH 3ENSB 5EW1H 4BOHA 2IN2A 1HNEE 2ZFQH 2H9TH 1PFXC 1V2LT 4ABIA 3JZ2B 4GHQA 3MWIU 1GJ5H 2VIDA 3GOVB 1D3TB 5FHTA 6LPRA 1GBFA 1EB2A 6ESTA 1OP2A 4WXIA 1AFQC 1HAHH 1FZZA 1NM6A 1QL9A 1TALA 1NFXA 3OTJE 5EU8A 4AYVB 2WPKS 3SUEA 1K2I1 1OP8A 2G8TA 2B9LA 2HNTC 4D9RA 2BLOA 3BTWE 6CHAC 5HMAA 1KLIH 1WAYB 1A2CH 4FUHA 2A2XH 2ANYA 3EA9A 1AUTC 3A7TA 1J17T 3P8NA 3GY3A 1H9LB 4BTIB 3LH3A 5TCAA 2ZCLP 2ZFFH 1MTNB 1LKBA 1DXWA 1O3JA 4NA9H 3U1JB 3A86A 2UWPA 1FAXA 2PGBB 3E6PH 1C5SA 1C2FA 4X2YA 1ELFA 1G37A 5E0JA 2VH6A 1Z1IA 3OU0A 3FZZA 1O5EH 4UFEH 5DK1A 3GCHC 7KMEH 4MPVA 7GCHG 2NU4E 4ABGA 4SGAE 1WU1A 3A8AA 2M5TA 1BJVA 2TGAA 4JMYA 5SGAE 2H1UA 1NRRH 3PLPA 1T7CA 4K8YA 2GZ9A 2SGQE 2Z9GA 3M35A 5J4SA 3SQEE 2Z9KA 2QYIA 3LT3A 2ZEBA 1QFKH 4Y7BA 2QN5T 2D8WA 3ZVFA 2ULLA 1AD8H 1A5GH 1G3CA 1SGDE 3M3TA 3UIRA 1GMCF 1Z8RA 1OWHA 4ABFA 1ZPBA 5A09A 5LGOA 1P0SH 2GCTC 1ZTLA 3RXBA 1A3BH 2R9PA 3PLKA 1GBHA 3T28A 1TNGA 2FOHA 2JKHA 2Y7XA 3MH4A 2C4FH 4NG9H 1KTTB 3TNSA 1HAXB 2A4GA 1F5KU 1B7XB 2BDHA 2YNAA 1THSH 1FJSA 1SLUB 1N8OB 3SW2B 1MBQA 1BTZA 1HJ9A 3A8CA 1HRTH 1UTOA 4KTSA 1O5DH 1ELTA 1GCTB 3KF2A 3ZYEA 4WMEA 1QJ7B 4K1TA 1FY1A 2VH0A 1O2WA 3GY2A 1KXAA 1F5RA 2SGFE 1O3AA 3NKKA 1WSSH 2C8YB 1YPHC 2EA3A 1DFPA 1V2MT 2RDLA 1W2KH 1J8AA 5L30H 4WWYA 3T25A 1Y5BT 5K0HA 1ZJKA 1VCPA 5EGMA 2VWOA 3TU7H 1V2UT 3FP8E 1SGNE 2DE8A 1SHHB 3RMNH 2D26C 4Y76A 4RKOB 5DP4A 4RKJB 5FBEA 3RXAA 4IN2A 1C1RA 1UTMA 1YPKH 5CMXH 1TX8A 4XBBA 2ZGJA 1O2IA 1GI1A 7GCHF 2GMTC 4Q2KA 1SPJA 4AX9H 1QL7A 1GHAG 1GPZA 3TK5A 2J4IA 3RXRA 1LTOA 1O33A 1C1PA 2IOTA 2VGCC 3HKIB 1CGHA 2O8UA 2ZGXH 1ELEE 3ZZ4A 2BB4A 9ESTA 2J95A 5EW2H 3U9AH 3UR9A 3ATMA 1L0ZA 1SGFG 1ZRBA 3IG6B 3SU0A 2Z9IA 2WV5A 3MO6A 4NGAH 3P95A 4XDEA 1HJAB 3JZ1B 1W7GH 4Q80A 3UY9A 1ZRKA