1O3NA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3nA02
3ENSB 5T3HA 4D7FA 4GHTA 4AFQA 2BZ6H 1UCYE 3GYMA 4KTCA 2ZHFH 1NC6A 1TNLA 1UVOA 1ELCA 4IC5A 3S0NA 1H8IH 1C5YB 1C4V2 2FOAA 2VIDA 1BTYA 1CHGA 5CHAB 1FPCH 1LPGB 1TX8A 4BXSA 1L0ZA 1XUFA 6LPRA 2R9PA 1SR5C 1O2NA 2F83A 2VVVA 5GCHG 1T4UH 1UHBA 1Z7KA 2G8TA 1QY6A 1BMMH 3SBKA 3KQCA 1P2NA 4TYDA 2V3OH 3FP6E 1VCWA 2F9UA 1HAVB 3UNRA 1JIMA 3PLKA 4FU8A 5E2OA 1MMJN 2XBVA 1D3QB 3Q3KA 4GSOA 1LQDB 3KF2A 4XOJA 1YLDA 1K1OA 3M5OA 3SU2A 1GBDA 1F5RA 2BVSH 1HYLA 2R0LA 2P3UB 1OP0A 1SLUB 1MCVA 1P10A 1GBMA 1DDJA 3STIA 4ZXXH 3NK8A 1QL9A 2VNTA 1THRH 3NKKA 1LVMA 1MZDA 2P8OB 1A4WH 1GPZA 1EJNA 3GDVA 2H5CA 2XBXA 3U9AH 1NPMA 2AMPA 1GDNA 3DUXH 4JYUH 2AIQA 2TBSA 1WQSA 1F5LA 2NU1E 3P8FA 3E1XB 2AEIH 3RXFA 2EC9H 2AMQA 3TITA 1EZSC 4OS4A 4NZLA 1CBWB 5HGGA 3D49H 5T6FA 1XM1A 1MZAA 2HVXA 4X1NU 3VPKA 5JBAS 1ZGVA 1LHEH 1SHYA 1O3PB 5C2ZA 1GBTA 3RXGA 3SI4H 1Y3YA 3D65E 2D1JA 4ZUHA 4AZ2B 4I33A 3FFGA 5DJ7A 4MVNA 1O0DH 1ZOMA 1SFIA 1XUIA 4MPWA 1ANDA 1O2PA 3BG8A 2Z9LA 1O3IA 1O2LA 1G37A 3K9XB 1EPTA 4HTCH 1WYKA 2YNAA 1FZZA 1ORFA 3TK6A 1CO7E 2B5TB 1BQYA 1W3CA 5C1UA 1BJUA 1D6RA 1YYY1 4OGYA 2FOEA 4AOQA 2SFAA 1AUJA 2Y80A 4GHQA 3MU5A 1DFPA 1GG6C 2IN2A 1A3EH 1O2SA 2Q6FA 3Q3YA 2I6QA 3U98H 2HPQH 2HGTH 3BN9A 1FY4A 2B9LA 2QAAA 4IBLH 2PHBA 2ULLA 3VGCC 1TRMA 2WUBA 3SU3A 2GGVB 2IOTA 5LPRA 2FI5E 2F9NA 3A81A 1TB6H 3SN8A 1P0SH 1DANH 2XWAA 3I78A 4AORA 3M36A 3KIDU 3RXHA 2G4UA 2V35A 2BD5A 3O8CA 3MO6A 1SOTA 4K60A 2Z3DA 2WYGA 3V0XA 4ABAA 1H9HE 3UPEA 2VVCA 1NTPA 1AE8H 4DG4A 1O34A 1QFKH 1F5KU 3S7HB 1TNGA 1C1WH 3UIRA 5GPIB 2CF9H 3GY8A 2P93A 1D3TB 1B7XB 1EX3A 4X2VA 1A0HB 1HFDA 2O8LA 1P2JA 5GIBA 1GJ4H 1SGNE 2QY0B 3F9EA 3SUEA 1TABE 1YGCH 3RXUA 4U2WA 1HAVA 2ALPA 1GJ9B 2Q6GA 3RXQA 5T6GA 4NIVA 5GWZA 1B0FA 4YM9A 3NWUA 3VB6A 4K69A 4XBCA 5JBCS 3SNCA 4O9VA 4XE4A 3H5CB 4JYTA 4NSYA 1SGEE 3GICB 1D3DB 3RM0H 2STAE 1K1NA 1O3NA 1K21H 4XDEA 1W0ZU 1LPZB 1AUTC 3ZV9A 1XVOA 1T7CA 1V2UT 4XBBA 2C8XB 1HDTH 2J38A 3LJJA 1KXDA 4MQAA 2H2ZA 1TGBA 1A2CH 4MNWA 1IQKA 1UTNA 1OWKA 4FVDA 4WF8A 7ESTE 2BLVA 1KLIH 3KN2A 3U8TH 1C2MA 1PPEE 1EOLA 1K1PA 2AERH 3ZVAA 4DY7B 2H9EH 4WJG2 1HXFH 4ABHA 1O2HA 3MH6A 2BDCA 3RXVA 3UOPA 3RXBA 2OC1A 1SI5H 4NWLA 7GCHG 2FOMB 3GY6A 1G2MA 2VIQA 4ZAEA 1BBRH 1A5IA 4I31A 4FUEA 2ANMH 1S6HA 1FY1A 3S9AA 8LPRA 3SHCH 1LVBA 1BITA 2OC8A 4OS6A 1DX5M 1V6DA 1UTKA 1BB0B 1LHDH 1LVOA 2ZC9H 4TWYA 3ODDA 1O5EH 2ZWLH 1Y3UA 1YM0A 1TNKA 5E8EH 1P3CA 3T5FH 4IMQA 1C2EA 3LGUA 4TPIZ 2RA3A 1EB2A 1K1JA 2BVRH 4AFZA 1J14A 1VJ9U 3TJOA 1BJVA 5AVDA 1O5DH 4VGCC 3E8LA 3GY5A 1EAUA 1SGRE 1THSH 1AIXH 2GT7A 3M3VA 4GLYA 1F2SE 4K2YA 1UCYH 3M5LA 2ANKH 3HK3B 4D9RA 3GCHB 3T28A 1DITH 3W95A 2OBQA 1PPBH 3PMJA 5T6DA 3QTVH 3P6ZB 1IOEA 1FN6A 5IDKA 2PGQB 1SLVB 3RXLA 1P11E 3RXSA 1SGYE 1RTKA 3TK5A 2OQ5A 3MMGA 4B2BA 1V3XA 1EZUC 3MNCA 3SGBE 1ACBE 1AI8H 4CRBA 1FAKH 1IQFA 1XUJA 2OP9A 1T8MA 1FPHH 2C8YB 1Z6JH 3GY3A 3RXAA 4AG1A 2BY6X 3FVFB 5EW1H 2P94A 3P8OA 5DP5A 1RFNA 5C1YA 3PB1E 5K0HA 4FXGH 2SNVA 2ZGJA 1QB6A 1SVPA 1K1MA 1BTPA 4ZMAH 4RKJB 1GJBB 1PQ8A 1YF4A 2QC2A 3LDXH 4WMDA 5AHGH 2HNTF 1HAHH 4JZEH 2ZO3H 1CGIE 5ESTE 1VITF 2SGAA 1P05A 4BOHA 3MWIU 3TJNA 3SQEE 1QQ4A 2Y5HA 2TGAA 5B6OA 3A86A 2G81E 3LKWA 2ODPA 4B76A 4JYVH 2A32A 1L1NA 5JYIA 4X0WU 1O2TA 4B1TA 5A8YA 1TMUH 1GHYH 1BUIA 1ESTA 3A80A 3OSYA 4BTTB 1JWTA 2NWNA 2O8WA 2VWNA 1CSOE 5HYOA 4HI3A 1PPGE 1Z8JB 3HGPA 1GBFA 4OS1A 3GCTG 3BV9B 1OP8A 4FU9A 5DG6A 2J34A 1C5QA 1WTHD 3LGWA 3MO3A 4CHAC 1BBRK 1WUNH 1TNJA 1GI5A 2G55A 3ZZ4A 4DCDA 1C5RA 1TOMH 1A0JA 3Q76A 5GJ4B 2QA9E 3MYWA 1O5AB 3LGYA 1QA0A 3SU4A 1MH0A 2BXTH 1GI0A 1IQLA 2VJ1A 1GMDF 3RC6A 4ISLA 1GJ8B 5CE1A 2OC7A 2VH6A 1GJ5H 2V3HH 3TIUA 1MAXA 2ODYB 3M5NA 2A7HA 4D7GA 1SFQB 2QGRA 1IHSH 3WY8A 1C5WB 5DKMA 2W7SA 2TGTA 1UCYK 2Z9KA 3RU4E 1T4VH 1HXEH 2PTCE 1UK2A 2JH0D 1OPHB 1O5GH 1K1LA 2EI6A 3BG4B 3RXCA 1P57B 1AY6H 3G01A 1AHTH 4HGCA 1O2XA 4YESB 5EPYA 1P01A 1LPKB 1EZQA 1HB0B 1TX7A 1H4WA 3A88A 2VGCC 1GDUA 2H9TH 4A92A 3S69A 4D76A 1LVYA 1GMHF 1D9IA 1QR3E 2BDBA 1P2KA 2BB4A 4QT8C 1YCPH 4DW2U 5HM2A 3SW2B 1GHWH 1AO5A 5HXFA 1HBTH 4ZKRU 5EPNA 4X6OA 3GCOA 1P9SA 1P09A 2A2QH 1UK4A 2AGIX 3SOSA 1UK3A 3TK9A 3MHWU 2BX4A 2WPHS 3RLWH 3AVZA 4FUGA 3SQHE 3UWJH 2ESTE 2ZTZA 3V3MA 5E2PA 3UTUH 4H42U 1P2MA 1TMBH 2FM2A 2GMTC 3F9HA 1ABIH 1ZZZA 2Y5GA 2G4TA 2VWLA 1BHXB 1G3EA 1E36B 4IW4E 4H4FA 4Y7AA 3LIWA 4Y8XA 4ABJA 1O2JA 4BAOB 1P8VC 1UVSH 1YKTA 1VR1H 1O32A 3P70B 3RC5A 2C90B 1HCGA 1O3JA 3F9GA 5E0HA 3T26A 4UFEH 4YZUA 1BZXE 4AFSA 5F03A 1W7XH 1SHHB 3VXEH 1IQHA 2BM2A 3QO6A 1ZYOA 3T25A 1MQ6A 2DE9A 3QX5H 3VB7A 4YOGA 3U1JB 1HJAC 2Y7ZA 3RXDA 4NIYA 2AH4X 1GHXH 2XBWA 1SLXB 5F8XA 1UTJA 1C1OA 1CA8B 5LPEA 1LDTT 2ZP0H 3ZZ5A 1UTLM 1PQ5A 3GY7A 4O3UA 4J1YA 3EE0B 1GG6B 1AQ7A 3V7TA 1BRCE 5DGJA 1RD3B 4CBOA 3QGNB 4RKOB 3MU0A 3QWCH 8KME2 2SGPE 2VU8E 3RXIA 1FIZA 3DT0H 3TNTA 1Y3WA 3D62A 1GHBF 1UVUH 1HAOH 3L6PA 1MBMA 4GAWA 1BBRE 1O3KA 1YPGH 3VB4A 1ARBA 2HNTC 3Q3XA 1GI1A 3RXMA 4AGJA 1NS3A 4JZIA 1IQJA 1CA0C 3BSQA 1G3DA 7LPRA 1G3CA 1KYNA 1AZZA 1GGDB 1GVLA 5I25A 5JB8S 1NT1A 5C5OA 4AGKA 1OWIA 1DXPA 2ZU2A 4TY6A 3K6ZA 1A3BH 3F6UH 1EXFA 3HGNA 3ZZ7A 1C5UA 3A89A 3ZVFA 2LNCA 3MNXA 3GY2A 3P8GA 1Q3XA 1Y5BT 2FX4A 2ZECA 3L33A 3RDZA 3ZVDA 2OC0A 4MTBA 4DJZB 1THPB 2Z6BD 4Z6AH 2W3IA 2ZGBH 4I7YH 5PTPA 2ZFFH 5JBBS 4ABGA 3PO1C 6GCHG 4UFGH 4X2XA 1DSUA 2B8OH 3MO9A 1W10U 4B73A 2QCYA 9LPRA 3FP8E 3TLOA 1GI7B 3MU4A 3SORA 4R0IA 3ZZ6A 2UWLA 5CMXH 2R0KA 3OYPA 3S7KB 1TONA 3RUOA 1CHOF 4YLQH 2VB0A 2ZDKA 1OXGA 1EKBB 1QB9A 4X1RU 1ZHRA 5C67A 1KXAA 4YT6H 3N7OA 2ZFTA 1ANCA 3AW1A 2OD3B 2OCVB 2QV1A 1MTWA 2CMYA 1O2UA 3ATIA 1QJ6B 4GVUA 4Q7YA 1AGJA 1SGTA 5A0AE 2XW9A 2WPMS 4Y0YE 4AX9H 2JETB 1T31A 1O3BA 3RXTA 3ZZ8A 2WPKS 1ZSKA 2FP7B 2P59A 1FONA 2C8WB 1ZMNA 3MI4A 1O2WA 1GBJA 2ZFPH 1BTXA 3UREA 1BTHH 1DWDH 3FZZA 1FUJA 1QURH 5BPEA 3KGPA 3M3TA 2GCHG 3PV4A 1IQEA 3SJOA 2HOBA 3OTJE 4JCNA 1GJCB 4VGCB 3HKIB 3KNXA 1QJ7B 1FY5A 2EI7A 2KAIB 4ZH8A 3EAJA 1O2OA 3E91A 4FUHA 1V2QT 2ZFSA 4UFFH 2A5IA 1OOKB 3TH2H 1MTNC 2VVUA 2FYQA 1ETTH 1V2KT 4KGAA 3ZV8A 1FY8E 1GCTB 1KXEA 2XNIA 1P12E 1KXFA 1KXCA 1SGCA 5FBEA 1N1LA 4FUIA 1O2GH 2A31A 4O03A 3A87A 1GWAA 1IHTH 1EJMA 2SGEE 4I8KA 3RXRA 2HLCA 3AW0A 2BTCE 1VITG 4KTSA 2CN0H 2FS9A 2ZIQH 2ZPQA 1S6FA 3VB5A 3ZZBA 1VGCC 5L2YH 3M5MA 1ELGA 2J9NA 1C2HA 4DIHH 2ZGXH 2HPPH 2FOGA 2ZQ1A 1B0EA 1DPOA 1DICA 4WVPE 1P9UA 2BY7X 1E0FD 3BTKE 3NPSA 1GHAF 2GDDA 4Q7XA 1T8NA 2F9OA 4CRCA 5L30H 2FDAA 4X1QU 2HALA 1JRTA 2G00A 1EPTC 1RIWC 4BTIB 3RXOA 3UFAA 4Y8ZA 1GJAB 5C5NA 4H6TA 4OS5A 5JBTA 1P02A 4YOJA 1TGSZ 2ZHWH 3ZZ3A 1N8OB 5AFZH 3URDA 2JH6D 1ELDE 1XKBC 1OYQA 1NU9A 3D23A 3AASA 4NGAH 2BDAA 3AAUA 1ANEA 3BTHE 2ZFQH 1O38A 1SQAA 4I8LA 4NFEA 1GMDG 1DOJA 5DP4A 4RN6A 4CHAB 2G51A 2PW8H 2PWXA 4AN7A 1GBHA 4X6PA 1SGFG 3FZDA 4OS2A 4A1VA 1BOQA 1MKWH 1H9LB 1QJ1B 2PGBB 2Z9IA 3KHVA 5DP7A 5ESBA 1NO9H 5DK1A 3SGAE 4ESTE 5TCCA 1W14U 1DLEA 3MNSA 3CP7A 4AYYB 2QXIA 1QL8A 1OKXA 1OSSA 4LOYH 1LMWB 1C2IA 4FU7A 4U30A 1DUAA 1Y5AT 2WPIS 1K22H 4IGDA 4KELA 2TGPZ 3ATWA 1M9UA 1VZQH 6CHAB 2D8WA 2G5NA 1YCPM 1WAYB 2AIPA 2VIVA 1X7AC 3CENA 2ZG0H 1QB1A 3SV8A 3PMBB 3VB3A 2GX4A 1GBEA 2P3FH 1O2RA 1C5MD 1BRAA 2TPIZ 1CE5A 3M7TA 1HAGE 1TPAE 3QDZB 1LQEA 2F3CE 1TGNA 2W5EA 2BDIA 2RG3A 1AVGH 1J9CH 1XUKA 3SU0A 2G52A 3H7TA 3VXFH 3MH4A 4BXWA 3S9CA 4WY3A 5JB9S 2KAIA 1KTSB 4U01A 2VIOA 3RXJA 2FOCA 2VGCB 1SPJA 2QXHA 2QF3A 3A85A 3SJKA 1AB9B 1PPZA 4FVBA 1NM6A 1QNJA 1G9IE 4NSVA 2FPZA 3A7XA 2NU3E 1KLTA 3E6PH 2GD4B 4Y6DA 3OY5U 4HZHA 1LO6A 3OX7U 1DWEH 1VJAU 1WTGH 1ZSJA 2O8MA 3ZYEA 1DE7H 1LKBA 2QF0A 2BDHA 2A4OA 1K9OE 2BMGB 4A1XA 2WPLS 1HRTH 1N6YA 3F9FA 3ZVBA 2XCFA 1GBKA 2ZZUH 3Q00A 1FI8A 1CBWC 1HLTH 4I32A 1E34B 2BZAA 3JZ1B 2K1QA 2ZDMA 5EQRA 2CV3A 4ABBA 1MKXH 2EI8A 3ZVEA 4TWWA 1NRNH 1SGPE 4INHA 2BQ7B 2WINI 4K3JA 4AB8A 5ABWA 3LH3A 1B5GH 2UUFB 2Y6TA 1O2ZA 2ODQA 3ODFA 4X6MA 2AFQB 1AN1E 3MFJA 3CS7A 4K1TA 1J16A 2Z9JA 2UUKB 4K1SA 3RMLH 5I46H 2Y81A 1O2IA 2FIRH 1AFEH 1H1BA 2NU0E 1F92A 1K28D 3ZVGA 4E06H 5FHTA 2Z3CA 3BTTE 1LHFH 2ILNA 3T27A 4NA8A 4IMZA 1O31A 3QN7A 5DP6A 4Y0ZE 2Q6DA 3RU4D 2UWOA 3P92A 1EQ9A 4FUBA 1GDQA 1E38B 1MKWK 4E7RG 1C2GA 1HAZB 1ANBA 1O3GA 3K6YA 3TNSA 3NCLA 1YP9A 1RGQA 2M5TA 2ZF0H 4MG3A 2F9VA 2A5KA 1HJAB 4ISHH 5A8ZA 5SGAE 5A0BA 1UO6A 1RTFB 3STJA 3BF6H 1QRZA 2FO9A 2FI4E 2XC0A 1CQQA 3C1KA 3O8BA 1O3AA 4DT7B 1HV7A 1PYTD 3EA7A 2FOFA 4XSKU 1AE5A 1IQGA 1TBQH 1TE0A 3A82A 3PTBA 2QXGA 4Z0KA 4Y76A 5A8XA 3GOVB 1MD7A 3SU6A 3O8DA 1O3DA 4ZHLU 1N6XA 5E0GA 2FESH 1HAPH 1O35A 1QIXB 2H5DA 4J2YB 2PKSB 4ISOA 2FI3E 2OBOA 3AAVA 4X8TH 3MU8A 1TPPA 2EEKA 2TIOA 1KTTB 3NXPA 2GV6A 1C5TA 5L2ZH 2A5AA 2VH0A 1D4PB 1CA0B 2HRVA 2ZCLP 3UR6A 2DUCA 2STBE 1MD8A 3GCNA 5E0JA 1P2QA 1YPKH 3E90B 1FMGA 1TGTA 1DT2A 4IN2A 3QZQA 3BTEE 1G30B 1EJAA 1MQ5A 4TY7A 1C5PA 4B71A 1C2LA 1DXWA 3HKJB 4JZFH 3TGKE 3EQ0H 3V12A 2J2UA 1ZTLA 4NG9H 1BRBE 1ARCA 3P17H 4NFFA 2Z7FE 1A7SA 3BTDE 4BTUB 1NFYA 3BIVH 4RSPA 4NIWA 5FX5A 4ZHMU 2O8UA 1UTPA 2FMJA 2ZU4A 1Q31A 2W7UA 1MTSA 3UQVA 1Q2WA 2SGQE 3PLPA 1EOJA 1CHOG 3M3SA 1SLWB 3RC4A 4Y8YA 1BT7A 1TIOA 4R8TB 2I6SA 2BLWA 4BAKB 3BTGE 1O5CB 4K8YA 1MKXK 3TJVA 1SGDE 1C4Y2 2C8ZB 1O2QA 2ZPRA 2BY8X 4TPYA 2R3YA 1C2DA 5LH8A 3RMMH 3M37A 5FAHA 5EQQA 1ZMJA 3LGIA 3LT3A 3SNAA 2CF8H 1NZQH 1KY9A 4A6LA 1TRNA 4X6NA 1RRKA 2PTNA 1DY8A 3B8JA 1GI6A 1NRRH 4U32A 1O3LA 1SBWA 2CJIA 2FTLE 1PQAA 1P3EA 1NRPH 1FIWA 2YOLA 2J92A 1BHXF 4SGAE 1MU8B 1XXDA 1DM4B 3MNBA 2WV4A 1UHBB 3RMNH 4INLA 1QTFA 1ZHPA 1CGHA 3R3GB 2NU4E 3GCHC 1F7ZA 1XKAC 4YOIA 2ZFRH 4F49A 3M7QA 1ZRKA 2ZEBA 1TRYA 1FJSA 1C9PA 3RXPA 2OQUA 1MCTA 3KL6A 1YPMH 3LGVA 1L1JA 3PMHB 5FBIA 1P06A 2BOHB 1AD8H 2BLQA 1C1PA 2BY9X 3BTQE 1ZSLA 3F68H 2A45B 4E7NA 1TA6A 2ANYA 2QN5T 3BTME 3MH5A 5FPTA 1MTNB 3GISB 4ZKNU 1G3BA 1GI8B 1ETSH 2H1UA 4YLUA 5J4SA 3ZVCA 4NZQA 3T29A 5GDSH 2GDEH 1O5FH 4KP0A 1AWHB 2B7DH 1GMCF 1TPSA 1XVMA 4OGXA 4WXVA 2BD2A 2YNBA 2A7CA 1IQMA 1EASA 2PSXA 3MOCA 1C5SA 1C1MA 3ATKA 1DUEA 3Q77A 1GHAG 1QGFA 1YLCA 2BDYA 1BMAA 4WMEA 1KIGH 1Y3VA 4NA7A 4DOQA 2CHAC 2XTTB 1FXYA 4WWYA 2ZU1A 1OX1A 4JMYA 3VGCB 1EUFA 1UTQA 3A8BA 5J4QA 4I8GA 4H6SB 3F1SB 3SV6A 1KSNA 2H6MA 3EGKH 1W11U 1MAYA 1NESE 1QRXA 3QZRA 2HNTE 2DE8A 4UEHH 1A5GH 3LPRA 1EP6A 2GT8A 3IG6B 1EPTB 1P2IA 3C27B 1F0RA 1RIWB 1Z8GA 1A5HA 2UWPA 4CRFA 5FX6A 1ELTA 2FXRA 1MTVA 1FLEE 1Y3XA 2AS9A 1IQNA 1T8OA 1W8BH 4I8HA 2A0QB 3QK1A 3VFEA 1L2EA 1SGQE 4ZXYH 1AVXA 4NIXA 4ABIA 1YCPK 2CXVA 3PWBA 2ZHEH 1UVPA 5ETXA 5F8TA 1YPEH 5EODA 1O3EA 1C5OH 2W3KA 1GVZA 2ZGHA 4YT7H 2FYRA 2JH5D 1V2VT 3ZZAA 2BD8A 4X2WA 6ESTA 1ZHMA 1W0YH 1BMNH 1W7GH 3KQBA 1A0LA 3SZNA 1K1IA 3ELAH 2BDGA 4LZ1H 1BMLA 2ZNKH 4ZKSU 2BX3A 1QRWA 1SG8B 1C2FA 2P16A 5FXLA 1G32B 3RP2A 1XMNB 4MNVA 3BG4C 1W12U 1GI9B 5IYTA 1K2I1 4B2CA 3U69H 1XUHA 1QBNA 5EG4A 3NZIA 1ESAA 1O3OA 1UJ1A 2BVXH 3JZ2B 1W2KH 1H9IE 1HNEE 4Q7ZA 2OXSA 3ATMA 1G2LA 1V2NT 1V2PT 1C5NH 2Y5FA 2UUYA 2QYIA 3QLPH 1J8AA 2THFB 1HIAB 1GCDA 3ESTA 3SUGA 2LPRA 1O30A 2BQWB 2AGEX 1V2RT 2FS8A 2V6NA 3IWMA 3LC3A 2ZDVH 1HGTH 1GVKB 3V13A 3UQOA 1IQIA 3M61U 2BQ6B 4JZ1A 3SJ9A 4GCHF 2ZU3A 3RXKA 5JPMH 3KQDA 5FPYA 3MTYA 1DSTA 4CH2B 1BIOA 4CRDA 1J17T 1OYTH 4M7GA 1BTWA 4YO9A 2R2WU 1ZMLA 1QHRB 3CS0A 1OWDA 2IPHA 5LPFA 4NWKA 1TX6A 2PR3A 3GYLB 4K5ZA 3RM2H 8GCHF 2FEQH 3K65B 4MPVA 4UONA 5TCAA 1ZPBA 1GI3A 1V2MT 4CH8B 1GBIA 1DWBH 4THNH 1ZTJA 2PLXA 1D6WA 1GJDB 2GTBA 3SNEA 4YTAA 1J15A 4X8UH 1O2YA 4BANB 2C93B 1TLDA 1TGCA 2ZDNA 7KMEH 2Z3EA 5BRRE 1JMOH 2PUQH 3MU1A 4ISNA 1EATA 3OY6U 1HUTH 5F6MA 1EAWA 5DPAA 4AG2A 3EA9A 4F4OC 3PLBA 1JRSA 1TBZH 1EP5A 2Q1JA 4O97A 1C5LH 1G36A 1TQ7B 2XWBI 4GUXA 4WMFA 3R0FA 1AMHA 3SJIA 3RU4T 2TRMA 4Y11E 5HM9A 1AU8A 3BEFB 1QBVH 1TPOA 3DFJA 1LTOA 1O39A 5C1XA 3I29A 2BHGA 1SB1H 1T8LA 1DY9A 4ABEA 2ZCHP 1RTLA 1ZPZA 1SL3A 1WBGB 1HJ8A 1FY3A 3LGTA 1PPCE 2ZQ2A 3BTWE 1OWEA 4O3TA 1BCUH 1TALA 3L3TA 1SQOA 2J94A 4DIIH 4CRGA 1UTOA 3O8RA 2ZA5A 3A7VA 3SO3A 2J95A 2A4QA 3A83A 1NROH 1C2JA 2ZU5A 2OUAA 1ZRBA 1O3MA 3SU5A 1AKSB 2FLRH 1FDPA 2XYAA 3EDXB 4A1TA 2H9HA 2VWOA 1GGDC 1GBLA 3PM3A 1GL1A 2CGAA 1C4U2 2PSYA 2GCTC 1LCYA 1SGIB 3DFLA 1AFQC 1O37A 1P2OA 3LJOA 4Q80A 3A8CA 2FX6A 3ZZDA 4BAMB 4CREA 4BNRA 1FV9A 1KDQB 4DVAU 2GZ7A 4NCYA 1BDAA 1C5XB 5DP9A 1WCZA 1F0SA 1PPHE 1L1GA 5EXMA 1HJ9A 2QXJA 1YC0A 4UFDH 1LKAA 1ELVA 1ZPCA 3TPIZ 1HIAA 4X2YA 3EA8A 4K8BA 4BAHB 2Y82A 4X1SU 3LONA 5CHAC 3QGJA 4DURA 1Y5UT 3UNSA 4OS7A 2OLGA 1AZ8A 3A7YA 3M35A 1EZXC 3SGQE 3P8NA 2A2XH 2BD4A 4XFQA 1A46H 3U1IB 1O5BB 1ELFA 1Z8RA 1V2TT 1ZJKA 1TA2A 3E3TA 5FCRA 4AB9A 1EB1H 4ISIH 3DD2H 1WV7H 3KQEA 3SNDA 1WQVH 3A7WA 1O3CA 1GMHG 3H7OA 1C1TA 1GJ7B 5DP3A 1HAIH 5GCHF 6GCHF 2HWLB 1NU7B 4AYVB 4DGJA 1V2JT 2V0BA 2ZPSA 1VITH 1ESBA 2O9QA 2RCEA 2GKVE 5GXPA 2GP9B 1WU1A 4I8JA 4X1PU 1NN6A 2JETC 2P8OC 3QUMP 1C9TA 1VCPA 3ITIA 1Z1IA 1GI2A 3SV9A 4IC6A 2FODA 3TGJE 1EAXA 1Y59T 4E05H 1TYNA 2OINA 3ATLA 2OTVA 1O3FA 2R2MB 3UY9A 1SSXA 1GBAA 3T2NA 1HPGA 3SUDA 3LH1A 1QQUA 1ZGIA 2P95A 3A84A 2GMTB 1T32A 4HFPB 1INCA 4ZHAA 1LHCH 1BTUA 5EU8A 2F91A 3E16B 3W94A 2BY5X 1GCTC 1S0RA 2GCHF 1C1SA 2TGDA 1C5VA 1UVTH 1O3HA 4ABFA 3LC5A 2SNWA 1VCQA 3DHKH 1A1RA 1GMCG 2PFEA 3TU7H 3OU0A 1O36A 1H8DH 2P3TB 2Z9GA 4ZKOU 2BD3A 1YBWA 1LHGH 1AWFH 3ZYDA 1O2MA 1SQTA 3GDSA 1AKSA 1ETRH 1CT4E 1V2ST 3TGIE 4Y10E 3FP7E 4MPXA 1SOZA 4XBDA 5EGMA 3ZZ9A 3BEUA 5AFYH 3RMOH 1Z1JA 1P03A 4FUCA 1GHBG 3SHAH 2FOBA 3GDUA 3TJUA 3BEIB 3S9BA 1MBQA 1KDQA 2VIWA 1Z6EA 2RA0A 3SUFA 2VIPA 1CT2E 5JDUB 1GHVH 3PMAB 3UUZA 4B75A 2WPJS 2A4GA 3TVJB 1NRQH 2FOHA 2CHAB 1AVWA 1NRSH 1YPHC 1C1NA 3UWIA 3T62A 8ESTE 2BXUH 4KTUA 2ZHQH 1Y8TA 3FAOA 3PYHA 3B23B 1Z71A 3RLYH 4MNXA 2IJOB 1FN8A 4Y71A 1WOFA 3HK6B 3K2UA 3U8OH 1ZLRA 2WV5A 4Q2KA 1TBRH 1N8OC 1GHZA 1YPHE 2XCNA 4MLFB 1GJ6A 1OWHA 1C1VH 5EXLA 3E0NB 2XBYA 1ID5H 2XC4A 2BLOA 2ZCKP 1CGJE 1UTMA 2ZI2H 1U6QA 1OWJA 2XC5A 1DLKB 1ELBA 1MUEB 2ZDLA 2ALVA 2SGFE 1UMAH 5TJXA 4MNYA 4IN1A 1JIRA 4CBNA 2ZKSA 1S5SA 1E37B 1OS8A 5EOKA 1PPFE 1JBUH 1V2OT 1JOUB 5F8ZA 3HATH 4GPGA 2G5VA 4MDSA 1SMFE 1ELAA 3UR9A 4B74A 4BAQB 5DO4H 1E35B 4LXBH 4MPUA 6CHAC 1S82A 4Y79A 2FZZA 3SI3H 3TH4H 4ABDA 4X8VH 2WYJA 3PO1B 1YPLH 3BIUH 2ANWA 1L4DA 4JK5A 5C3NA 1C1UH 1C2KA 3A8AA 4B2AA 3GY4A 1S0QA 1TNIA 2BD7A 2PV9B 1NFUA 4FUFA 1RS0A 1MU6B 3PWCA 1PFXC 3B9FH 2VINA 3SV2H 1PYTC 4INKA 1O2KA 3ZZCA 4UE7H 2PKAB 2BOKA 1SC8U 2B0FA 4JK6A 2F9BH 5H4IB 5A09A 2BD9A 5DP8A 1DWCH 3TH3H 4UDWH 5FCKA 1KLJH 2RDLA 7GCHF 4FUDA 3LU9B 1ZTKA 1PQ7A 1TQ0B 4GCHG 3VEQB 1CT0E 1FQ3A 1HAYB 5A2MH 1NFXA 1QA7A 1AB9C 1C1RA 1WSSH 3A8DA 1CVWH 5K7RA 2R3UA 2Z94A 2ZGCA 4A7IB 2BYAX 1D3PB 2A4RA 2Y7XA 4A5TS 2ZHDA 1BA8B 3PTNA 8GCHG 5LGOA 2ASUB 4LZ4B 1DVAH 4JZDH 1FNIA 3FANA 3A7TA 1S81A 2D2DA 4Y7BA 3BTFE 4WXIA 3SNBA 2UUJB 3KEEA 5FPSA 2FLBH 1NFWA 1TOCB 3U8RH 3I77A 5EW2H 1EAIA 2J4IA 1RXPA 1S85A 2WUCA 4AFUA 1C5ZB 1TAWA 1F0UA 1O2VA 1V2LT 1QCPA 1ZR0A 2JKHA 1F0TA 2F9PA 1NY22 4KKDA 1A61H 4D9QA 1GBBA 1MTUA 1QL7A 1CU1A 3SU1A 4CRAA 4K1EA 3KCGH 3LOXA 1YPJH 2GZ9A 2AYWA 2GVFA 1QBOA 3SJ8A 4D8NA 1XX9A 5EXNA 1IAUA 3UNQA 5C20A 2A7JA 3HPTB 1L4ZA 2FTMA 1KXBA 3E0PB 1DS2E 2SGDE 3QTOH 4UD9H 1BRUP 3NUMA 3URCA 3DA9B 1GI4A 2AGGX 2GZ8A 1V2WT 4LK4A 2XXLA 5A0CA 4NA9H 1ELEE 1VGCB 5L6NH 1Z8IB 1GBCA 3UOUA 2PUXB 1XUGA 3RXEA 2QIQA 1XXFA 3M7UA 4IS5A 4X8SH 1C1QA 1S84A 4SGBE 1OP2A 2FWWA 2W26A 2NU2E 1FAXA 4ZROA 1ZJDA 5AF9H 3MH7A 2C3SA 1PJPA 1JXPA 2A1DB 4WH6A 4PROA 5HMAA 2ZTXA 5G4BA 1HAXB 4WH8A 2PKSC 3EYDA 3PROA 2C4FH 4CR9A 1TNHA 3A7ZA 1S83A 9ESTA 5EQSA 4FUJA 4CR5A 1BTZA 1O33A 1P04A 3GCTF 2ZDAH 1TWXB 3P95A 1W13U 4ASHA 2EA3A 3SV7A 2AMDA 2ZTYA 2GCTB 2O8TA 1RJXB 1ABJH 1AFQB 2GV7A 1TFXA 2D26C 2XRCA 1SGFA 1TMTH 1GL0E 2VWMA 3IITA 2PKAA
chains in the Genus database with same CATH superfamily
2PP6A 3ENSB 5T3HA 4D7FA 4GHTA 4AFQA 2BZ6H 1UCYE 3GYMA 4KTCA 2ZHFH 1NC6A 1TNLA 1UVOA 1ELCA 4IC5A 3S0NA 1H8IH 1C5YB 1C4V2 2FOAA 2VIDA 3OTPA 1BTYA 1CHGA 5CHAB 1FPCH 1LPGB 1TX8A 4BXSA 1L0ZA 1K0HA 1XUFA 6LPRA 2R9PA 1SR5C 1O2NA 2F83A 2VVVA 5GCHG 1T4UH 1UHBA 1Z7KA 2G8TA 1QY6A 3ZIAD 1BMMH 3SBKA 3KQCA 1P2NA 4TYDA 2V3OH 3FP6E 1VCWA 2F9UA 1HAVB 3UNRA 1JIMA 3PLKA 4FU8A 5E2OA 1MMJN 2XBVA 4Z1MD 1D3QB 2J5UA 3Q3KA 4GSOA 4M9FA 1LQDB 3KF2A 4XOJA 1YLDA 1K1OA 3M5OA 3SU2A 1GBDA 1F5RA 2BVSH 1HYLA 2R0LA 2P3UB 1OP0A 1SLUB 2VBCA 1MCVA 1P10A 1GBMA 1DDJA 3STIA 4ZXXH 3NK8A 1QL9A 2VNTA 1THRH 3NKKA 1LVMA 1MZDA 2P8OB 1A4WH 1GPZA 1EJNA 3GDVA 2H5CA 2XBXA 3U9AH 1NPMA 2AMPA 1GDNA 3DUXH 4JYUH 3F0PA 2AIQA 2EY4C 2TBSA 1WQSA 1F5LA 2NU1E 3P8FA 3E1XB 2AEIH 3RXFA 2EC9H 2AMQA 3TITA 1EZSC 4OS4A 4NZLA 1CBWB 5HGGA 3D49H 5T6FA 1XM1A 1MZAA 2HVXA 4X1NU 3VPKA 5JBAS 1ZGVA 1LHEH 4B6EA 1SHYA 1O3PB 5C2ZA 1GBTA 3RXGA 3SI4H 1Y3YA 3D65E 2D1JA 4ZUHA 4AZ2B 2LP6A 4I33A 3FFGA 5DJ7A 2JJ2D 4MVNA 1O0DH 1ZOMA 1SFIA 1XUIA 4MPWA 1ANDA 1O2PA 4AC9A 3BG8A 2Z9LA 1NBME 2YMSC 1O3IA 1O2LA 1G37A 3K9XB 1EPTA 4HTCH 1WYKA 2YNAA 1FZZA 1ORFA 3TK6A 1CO7E 2B5TB 1BQYA 1W3CA 5C1UA 1BJUA 1D6RA 1YYY1 4OGYA 2FOEA 4AOQA 2SFAA 1AUJA 2Y80A 4GHQA 3MU5A 1DFPA 1GG6C 2IN2A 1A3EH 1O2SA 2Q6FA 3FOAA 3Q3YA 2I6QA 3U98H 2HPQH 2HGTH 3BN9A 1FY4A 2B9LA 2QAAA 4IBLH 2PHBA 2ULLA 3VGCC 1TRMA 2WUBA 3SU3A 2GGVB 2IOTA 2WPDD 5LPRA 2FI5E 2F9NA 3A81A 1TB6H 3SN8A 1P0SH 1DANH 2XWAA 3I78A 4AORA 3M36A 3FO8D 3KIDU 3RXHA 2G4UA 2V35A 2BD5A 3O8CA 3MO6A 1SOTA 4K60A 2Z3DA 2WYGA 3V0XA 4ABAA 1H9HE 3UPEA 2VVCA 1NTPA 5KGOA 1AE8H 2KCPA 4DG4A 1O34A 1QFKH 1F5KU 3S7HB 1TNGA 1C1WH 3UIRA 5GPIB 2CF9H 3GY8A 2P93A 1D3TB 1B7XB 1EX3A 4X2VA 1A0HB 1HFDA 2O8LA 1P2JA 5GIBA 1GJ4H 1SGNE 2QY0B 3F9EA 3SUEA 1TABE 1YGCH 3RXUA 2M2AA 4U2WA 1HAVA 2ALPA 1GJ9B 2Q6GA 3RXQA 5T6GA 4NIVA 5GWZA 1B0FA 3F2FA 4YM9A 3NWUA 3VB6A 4K69A 4XBCA 5JBCS 3SNCA 4O9VA 4TSFD 4XE4A 3H5CB 4JYTA 4NSYA 1SGEE 3GICB 1D3DB 3RM0H 2STAE 1K1NA 1O3NA 1K21H 4XDEA 1W0ZU 1LPZB 1AUTC 3ZV9A 1XVOA 1T7CA 1V2UT 4XBBA 2C8XB 1HDTH 2J38A 3LJJA 1KXDA 4MQAA 2H2ZA 1TGBA 1A2CH 4MNWA 1IQKA 1UTNA 1OWKA 4FVDA 4WF8A 7ESTE 2BLVA 1KLIH 3KN2A 3U8TH 1C2MA 1PPEE 1EOLA 1K1PA 2AERH 3ZVAA 4DY7B 2H9EH 4WJG2 1HXFH 4ABHA 1O2HA 3MH6A 2BDCA 3RXVA 3UOPA 3RXBA 2OC1A 1SI5H 4NWLA 7GCHG 2FOMB 3GY6A 1G2MA 2VIQA 4ZAEA 1BBRH 1A5IA 4I31A 4FUEA 2ANMH 1S6HA 2KCYA 1FY1A 3S9AA 8LPRA 3SHCH 1LVBA 1BITA 2OC8A 4OS6A 1DX5M 1V6DA 1UTKA 3EE7A 1BB0B 1LHDH 1LVOA 2ZC9H 4TWYA 3ODDA 1O5EH 2ZWLH 3KYFA 1Y3UA 1YM0A 1TNKA 5E8EH 1P3CA 3T5FH 4IMQA 5B6LA 1C2EA 3NRLA 3LGUA 4TPIZ 2RA3A 1EB2A 1K1JA 2BVRH 4AFZA 1J14A 1VJ9U 3TJOA 1BJVA 5AVDA 1O5DH 4VGCC 3E8LA 3GY5A 1EAUA 1SGRE 1THSH 2QF4A 1AIXH 2GT7A 3M3VA 4GLYA 4F48B 1F2SE 4K2YA 1UCYH 3M5LA 2ANKH 3HK3B 4D9RA 1KMHB 3GCHB 3T28A 3CNRA 1DITH 3W95A 2OBQA 1PPBH 3PMJA 5T6DA 3WWBA 3QTVH 3P6ZB 1IOEA 1FN6A 5IDKA 2WSSD 2PGQB 1SLVB 1UW7A 3RXLA 1P11E 4DT4A 3RXSA 1SGYE 1RTKA 3TK5A 5C0TA 2OQ5A 3MMGA 4B2BA 1V3XA 1EZUC 3MNCA 3SGBE 1ACBE 1AI8H 4CRBA 4Q4LA 1FAKH 1IQFA 1XUJA 2OP9A 1T8MA 1FPHH 2C8YB 1Z6JH 3GY3A 3RXAA 4AG1A 2BY6X 3FVFB 5EW1H 2P94A 3P8OA 5DP5A 1RFNA 5C1YA 3PB1E 5K0HA 2J98B 4FXGH 2SNVA 2ZGJA 1QB6A 1SVPA 1K1MA 1BTPA 4ZMAH 1E1RD 4RKJB 1GJBB 1PQ8A 1YF4A 2QC2A 3LDXH 4WMDA 5AHGH 2HNTF 1HAHH 4JZEH 2ZO3H 1CGIE 5ESTE 1VITF 2SGAA 1P05A 4BOHA 3MWIU 3TJNA 3SQEE 1QQ4A 2Y5HA 2TGAA 5B6OA 3A86A 2G81E 3LKWA 2ODPA 4B76A 4JYVH 2A32A 1L1NA 5JYIA 4X0WU 1O2TA 4B1TA 5A8YA 1TMUH 2W6ID 1GHYH 1BUIA 1ESTA 3A80A 3OSYA 4BTTB 1JWTA 2NWNA 2O8WA 2VWNA 1CSOE 5HYOA 4HI3A 2JIZD 1PPGE 1Z8JB 3HGPA 1GBFA 4I86A 3GCTG 3BV9B 1OP8A 4FU9A 4OS1A 5DG6A 5DSFA 2J34A 1C5QA 1WTHD 3LGWA 3MO3A 4CHAC 1BBRK 1WUNH 1TNJA 1GI5A 2G55A 3ZZ4A 4DCDA 1C5RA 1TOMH 1A0JA 3Q76A 5GJ4B 2QA9E 3MYWA 1O5AB 3LGYA 1QA0A 3SU4A 1MH0A 2BXTH 1GI0A 1IQLA 2VJ1A 1GMDF 3RC6A 4ISLA 1GJ8B 5CE1A 2OC7A 2VH6A 1GJ5H 2V3HH 3TIUA 1MAXA 2ODYB 3M5NA 2A7HA 4D7GA 2LELA 1SFQB 2QGRA 1IHSH 3WY8A 1C5WB 5DKMA 2W7SA 2TGTA 1UCYK 2Z9KA 3RU4E 1T4VH 1HXEH 2PTCE 1UK2A 2AHME 2JH0D 1OPHB 1O5GH 1K1LA 2EI6A 3BG4B 3RXCA 1P57B 1AY6H 3G01A 1AHTH 3FKSD 4HGCA 1O2XA 4YESB 5EPYA 1P01A 1LPKB 1EZQA 1HB0B 2GJGA 1S6LA 1TX7A 1H4WA 3A88A 2VGCC 1GDUA 2H9TH 4A92A 3S69A 4D76A 1LVYA 1GMHF 1D9IA 1QR3E 2BDBA 1P2KA 2BB4A 4QT8C 1YCPH 4DW2U 5HM2A 3SW2B 1GHWH 1AO5A 5HXFA 1HBTH 4ZKRU 5EPNA 4X6OA 3GCOA 1P9SA 1P09A 2A2QH 1UK4A 2AGIX 3SOSA 5C94A 1UK3A 3TK9A 3MHWU 2BX4A 2WPHS 3RLWH 3AVZA 4FUGA 3SQHE 3UWJH 2ESTE 2ZTZA 3V3MA 5E2PA 3UTUH 4H42U 4P00A 1P2MA 5KEDA 1TMBH 2FM2A 2GMTC 3F9HA 1ABIH 1ZZZA 2Y5GA 2G4TA 2VWLA 1BHXB 1G3EA 1E36B 4IW4E 4H4FA 4Y7AA 3LIWA 4Y8XA 4ABJA 1O2JA 4BAOB 2K0QA 1P8VC 1UVSH 1YKTA 1VR1H 1O32A 3P70B 3RC5A 2C90B 3PV2A 1HCGA 1O3JA 3F9GA 5E0HA 3T26A 4UFEH 4YZUA 1BZXE 4AFSA 5F03A 3WW7A 1W7XH 1SHHB 3VXEH 1IQHA 2BM2A 3QO6A 1ZYOA 3T25A 1MQ6A 2DE9A 3QX5H 3VB7A 4YOGA 3U1JB 2YMSB 1HJAC 2Y7ZA 3RXDA 4NIYA 2AH4X 1GHXH 2XBWA 3DCLA 1SLXB 5F8XA 1UTJA 5CDFE 1C1OA 1CA8B 2IJD1 5LPEA 1LDTT 2ZP0H 3ZZ5A 1UTLM 1PQ5A 3GY7A 4O3UA 4J1YA 3EE0B 1GG6B 1AQ7A 3V7TA 1BRCE 5DGJA 1RD3B 4CBOA 3QGNB 4RKOB 3MU0A 3QWCH 2KZ4A 8KME2 2SGPE 2VU8E 3RXIA 1FIZA 3DT0H 3TNTA 3WWFA 1Y3WA 3D62A 1GHBF 1UVUH 1HAOH 3L6PA 1MBMA 4GAWA 1BBRE 1O3KA 1YPGH 3VB4A 1ARBA 2HNTC 3Q3XA 1GI1A 2KM0A 3RXMA 4AGJA 1NS3A 4JZIA 1IQJA 1CA0C 3BSQA 1G3DA 7LPRA 1G3CA 1KYNA 1AZZA 1GGDB 1GVLA 5I25A 5JB8S 1NT1A 3OFND 5C5OA 4AGKA 1OWIA 1DXPA 2ZU2A 4TY6A 3K6ZA 3H09A 1A3BH 3F6UH 1EXFA 3HGNA 3ZZ7A 4ZCNA 1C5UA 3GS9A 3A89A 3ZVFA 2LNCA 3MNXA 3GY2A 3P8GA 1SKYE 1Q3XA 1Y5BT 2FX4A 2ZECA 3L33A 3RDZA 3ZVDA 2OC0A 4MTBA 4DJZB 1THPB 2Z6BD 4Z6AH 2W3IA 2ZGBH 4I7YH 5PTPA 2ZFFH 5JBBS 4ABGA 3PO1C 6GCHG 4UFGH 4X2XA 1DSUA 2B8OH 3MO9A 1W10U 4B73A 2QCYA 9LPRA 3FP8E 3TLOA 1GI7B 3MU4A 3SORA 4R0IA 3ZZ6A 2QF5A 2UWLA 5CMXH 2R0KA 3OYPA 3S7KB 1TONA 3RUOA 5C17A 1CHOF 4YLQH 2VB0A 2ZDKA 1OXGA 1EKBB 3F0OA 1QB9A 4X1RU 1ZHRA 5C67A 1KXAA 4YT6H 3N7OA 2ZFTA 1ANCA 3AW1A 2OD3B 2OCVB 2QV1A 1MTWA 2CMYA 1O2UA 3ATIA 1QJ6B 4GVUA 4Q7YA 1AGJA 1SGTA 5A0AE 2XW9A 2WPMS 4Y0YE 4AX9H 2JETB 1T31A 1O3BA 3RXTA 3ZZ8A 2WPKS 1ZSKA 2FP7B 2P59A 1FONA 2C8WB 3OEHD 1ZMNA 3MI4A 1O2WA 1GBJA 2ZFPH 1BTXA 4FETA 3UREA 1BTHH 1DWDH 5F53A 3FZZA 1FUJA 1QURH 5BPEA 3KGPA 3M3TA 2GCHG 3PV4A 1IQEA 3SJOA 2HOBA 3OTJE 4JCNA 1GJCB 4VGCB 3HKIB 3KNXA 1QJ7B 1FY5A 2EI7A 2KR7A 2KAIB 4ZH8A 3EAJA 1O2OA 3E91A 4FUHA 1V2QT 2ZFSA 3OAAD 3VG8A 4UFFH 2A5IA 1OOKB 3TH2H 1MTNC 2VVUA 2FYQA 4ASUD 1ETTH 1V2KT 4KGAA 3ZV8A 1FY8E 1GCTB 1BMFD 1KXEA 2XNIA 1P12E 1KXFA 1KXCA 1SGCA 5FBEA 1N1LA 4FUIA 1O2GH 2A31A 4O03A 3A87A 1GWAA 1IHTH 1EJMA 2SGEE 4I8KA 3RXRA 2HLCA 3AW0A 2BTCE 1VITG 4KTSA 2CN0H 1H8ED 2FS9A 2ZIQH 2ZPQA 1S6FA 3VB5A 2JDID 3ZZBA 1VGCC 5L2YH 3M5MA 1ELGA 2J9NA 1C2HA 4DIHH 2ZGXH 2HPPH 2FOGA 2ZQ1A 1B0EA 1DPOA 1DICA 4WVPE 1P9UA 2BY7X 1E0FD 3BTKE 3NPSA 3PRDA 1GHAF 2GDDA 4Q7XA 1T8NA 2F9OA 4CRCA 5L30H 2FDAA 4X1QU 2HALA 1JRTA 2G00A 1EPTC 1RIWC 2V3MA 4BTIB 3RXOA 3UFAA 4Y8ZA 1GJAB 5C5NA 4H6TA 4OS5A 5JBTA 1P02A 4YOJA 1TGSZ 2ZHWH 3ZZ3A 1N8OB 5AFZH 3URDA 4YXWD 2JH6D 1ELDE 1XKBC 1OYQA 1NU9A 3D23A 3AASA 4NGAH 2BDAA 3AAUA 1ANEA 3BTHE 2ZFQH 1O38A 1SQAA 4I8LA 4NFEA 1GMDG 1DOJA 5DP4A 4RN6A 4CHAB 2G51A 5EIYA 2PW8H 2PWXA 4AN7A 1GBHA 4X6PA 1SGFG 3FZDA 4OS2A 4A1VA 1BOQA 1MKWH 1H9LB 1QJ1B 2PGBB 2Z9IA 3DSPA 3KHVA 5DP7A 5ESBA 1NO9H 5DK1A 3SGAE 4ESTE 5TCCA 1W14U 1DLEA 3MNSA 3CP7A 4AYYB 2QXIA 1QL8A 1OKXA 1OSSA 4LOYH 1LMWB 1C2IA 4Q63A 4FU7A 4U30A 1DUAA 1Y5AT 2WPIS 1K22H 4IGDA 4KELA 2TGPZ 3ATWA 1M9UA 1VZQH 6CHAB 2D8WA 2G5NA 1YCPM 1WAYB 2AIPA 2VIVA 1X7AC 3CENA 2ZG0H 1QB1A 3SV8A 3PMBB 3VB3A 2GX4A 3KYGA 1GBEA 2P3FH 1O2RA 1C5MD 1BRAA 2TPIZ 1CE5A 3M7TA 1FX0B 1HAGE 1W0JD 1TPAE 3QDZB 1LQEA 2F3CE 1TGNA 2W5EA 2BDIA 2RG3A 1AVGH 1J9CH 1XUKA 3F2GA 3SU0A 2G52A 3H7TA 3VXFH 3MH4A 4BXWA 3S9CA 4WY3A 5JB9S 2KAIA 1KTSB 4U01A 4XRNA 2VIOA 3RXJA 2FOCA 2VGCB 1SPJA 2QXHA 2QF3A 3A85A 3SJKA 1AB9B 1PPZA 4FVBA 1NM6A 1QNJA 1G9IE 4NSVA 2FPZA 3A7XA 2NU3E 1KLTA 3E6PH 2GD4B 4Y6DA 3OY5U 4HZHA 1LO6A 2HVYB 1VKYA 3OX7U 1DWEH 1VJAU 1WTGH 1ZSJA 2O8MA 3ZYEA 3N7EA 1DE7H 1LKBA 2QF0A 2BDHA 2A4OA 1K9OE 2BMGB 4A1XA 2WPLS 1HRTH 1N6YA 3F9FA 3ZVBA 2XCFA 1GBKA 2ZZUH 3Q00A 1FI8A 5HIZA 1CBWC 1HLTH 4I32A 1E34B 2BZAA 3JZ1B 2K1QA 2ZDMA 5EQRA 2CV3A 4ABBA 1MKXH 2EI8A 3ZVEA 4TWWA 1NRNH 1SGPE 4INHA 3U28C 2BQ7B 2WINI 4K3JA 4AB8A 5ABWA 3LH3A 1B5GH 2UUFB 2Y6TA 1O2ZA 2ODQA 3ODFA 4X6MA 2AFQB 1AN1E 3MFJA 3CS7A 4K1TA 1J16A 2Z9JA 2UUKB 4K1SA 3RMLH 5I46H 2Y81A 1O2IA 2FIRH 1AFEH 1H1BA 2NU0E 1F92A 1K28D 3ZVGA 4E06H 5FHTA 2Z3CA 3BTTE 1LHFH 2ILNA 3T27A 4NA8A 4IMZA 1O31A 3QN7A 5DP6A 4Y0ZE 2Q6DA 3RU4D 2UWOA 3P92A 1EQ9A 4FUBA 1GDQA 1E38B 1MKWK 4E7RG 1C2GA 1HAZB 1ANBA 1O3GA 3K6YA 3TNSA 3NCLA 1YP9A 1RGQA 2M5TA 2ZF0H 3DSOA 4MG3A 2F9VA 2A5KA 1HJAB 4ISHH 5A8ZA 5SGAE 5A0BA 5CHBA 1UO6A 1RTFB 3STJA 3BF6H 1QRZA 2FO9A 2FI4E 2XC0A 1CQQA 3C1KA 3O8BA 1O3AA 4DT7B 1HV7A 1PYTD 3EA7A 3OE7D 2FOFA 4XSKU 1AE5A 1IQGA 1TBQH 1TE0A 3A82A 3PTBA 2QXGA 4Z0KA 4Y76A 5A8XA 3GOVB 1MD7A 3SU6A 3O8DA 1O3DA 4ZHLU 1N6XA 5E0GA 2FESH 1HAPH 1O35A 1QIXB 2H5DA 4J2YB 2PKSB 4ISOA 2FI3E 2OBOA 3AAVA 4X8TH 3MU8A 1TPPA 2EEKA 2TIOA 1KTTB 3NXPA 2GV6A 1C5TA 5L2ZH 2A5AA 2VH0A 1D4PB 1CA0B 2HRVA 2ZCLP 3UR6A 2DUCA 2STBE 1MD8A 3GCNA 5E0JA 1P2QA 1YPKH 3E90B 1FMGA 1TGTA 1DT2A 4IN2A 3QZQA 3FN8A 3BTEE 1G30B 1EJAA 1MQ5A 4TY7A 1C5PA 4B71A 1C2LA 1DXWA 5GNDA 3HKJB 4JZFH 3UAIC 3TGKE 3EQ0H 3V12A 2J2UA 2JJ1D 1ZTLA 4NG9H 1BRBE 1ARCA 3P17H 4NFFA 2Z7FE 1A7SA 3BTDE 4BTUB 1NFYA 3BIVH 4RSPA 4NIWA 5FX5A 4ZHMU 2O8UA 1UTPA 2FMJA 2XOKD 2ZU4A 1Q31A 2W7UA 1MTSA 3UQVA 3N99A 1Q2WA 2CK3D 2SGQE 3PLPA 1EOJA 1CHOG 3M3SA 1SLWB 3RC4A 4Y8YA 1BT7A 1TIOA 4R8TB 2I6SA 2BLWA 4BAKB 3BTGE 1O5CB 4K8YA 4P02A 1MKXK 3TJVA 1SGDE 1C4Y2 2C8ZB 1O2QA 2ZPRA 2BY8X 4TPYA 2R3YA 1C2DA 5LH8A 3RMMH 3M37A 5FAHA 5EQQA 1ZMJA 3LGIA 3LT3A 3SNAA 2CF8H 1NZQH 1KY9A 4A6LA 1TRNA 4X6NA 1RRKA 2PTNA 1DY8A 3B8JA 1GI6A 1NRRH 2L74A 4U32A 1O3LA 1SBWA 2CJIA 2FTLE 1PQAA 1P3EA 1NRPH 1YWUA 1FIWA 2YOLA 2J92A 2OK5A 1BHXF 4SGAE 1MU8B 1XXDA 1DM4B 1YY3A 3MNBA 2WV4A 2J98A 1UHBB 3RMNH 5FL7D 4INLA 1QTFA 1ZHPA 1CGHA 3R3GB 2NU4E 3GCHC 1F7ZA 1XKAC 4YOIA 2ZFRH 2KFWA 4F49A 3M7QA 1ZRKA 2ZEBA 4FOUC 4HG6A 1TRYA 1FJSA 1C9PA 3RXPA 2OQUA 1MCTA 3KL6A 1YPMH 3LGVA 1L1JA 3PMHB 5FBIA 1P06A 3AK5A 2BOHB 1AD8H 2BLQA 2F4LA 1C1PA 2BY9X 3BTQE 1ZSLA 3F68H 2A45B 4E7NA 1TA6A 2ANYA 2QN5T 3BTME 3MH5A 5FPTA 1MTNB 3GISB 4ZKNU 1G3BA 1GI8B 1ETSH 2H1UA 4YLUA 5J4SA 3ZVCA 4NZQA 2WHXA 3T29A 5GDSH 2GDEH 1O5FH 4KP0A 1AWHB 2B7DH 1GMCF 1TPSA 1XVMA 4OGXA 4WXVA 2BD2A 3SZEA 2YNBA 2A7CA 1IQMA 1EASA 2PSXA 3MOCA 1C5SA 1C1MA 3ATKA 1DUEA 3Q77A 1GHAG 4RT1A 1QGFA 1YLCA 2BDYA 1BMAA 4WMEA 1KIGH 1Y3VA 4NA7A 4ACBA 4DOQA 2CHAC 2XTTB 1FXYA 4WWYA 2ZU1A 1OX1A 4JMYA 3VGCB 1EUFA 1UTQA 3A8BA 5J4QA 3PV5A 4I8GA 4H6SB 3F1SB 3SV6A 1KSNA 2H6MA 3EGKH 1W11U 1MAYA 1NESE 1QRXA 3QZRA 2HNTE 2DE8A 4UEHH 1A5GH 3LPRA 1EP6A 2GT8A 3IG6B 1EPTB 1P2IA 3C27B 1F0RA 1RIWB 1Z8GA 1A5HA 2UWPA 4CRFA 5FX6A 1ELTA 2FXRA 1MTVA 1FLEE 1Y3XA 5KECA 2AS9A 1IQNA 1T8OA 1W8BH 4I8HA 2A0QB 3QK1A 4OM9A 2F43B 1L2EA 3VFEA 1SGQE 4ZXYH 1AVXA 4NIXA 4ABIA 1YCPK 2CXVA 3PWBA 2ZHEH 1UVPA 5ETXA 5F8TA 1YPEH 5EODA 2V7QD 1O3EA 1C5OH 2W3KA 1GVZA 2ZGHA 4YT7H 2FYRA 2JH5D 1V2VT 3ZZAA 2BD8A 2J97A 4X2WA 6ESTA 1ZHMA 1W0YH 1BMNH 1W7GH 3KQBA 1A0LA 3SZNA 1K1IA 3ELAH 2BDGA 4LZ1H 1BMLA 2ZNKH 4ZKSU 2BX3A 1QRWA 1SG8B 1C2FA 2P16A 5FXLA 1G32B 1NBMD 3RP2A 5EJLA 1XMNB 4MNVA 1WXRA 3DSGA 3BG4C 1W12U 1GI9B 5IYTA 1K2I1 4B2CA 3U69H 1XUHA 1QBNA 5EG4A 3NZIA 1ESAA 1O3OA 2YMSD 1UJ1A 2BVXH 3JZ2B 1W2KH 1H9IE 1HNEE 4Q7ZA 2OXSA 3ATMA 1G2LA 1V2NT 1V2PT 1C5NH 2Y5FA 2UUYA 2QYIA 3QLPH 1J8AA 2THFB 1HIAB 1GCDA 3ESTA 3SUGA 2LPRA 1O30A 2BQWB 2AGEX 1V2RT 2FS8A 2V6NA 3IWMA 3LC3A 2ZDVH 1HGTH 1GVKB 3V13A 3UQOA 1IQIA 3M61U 2BQ6B 4JZ1A 3SJ9A 4GCHF 2ZU3A 3RXKA 5JPMH 3KQDA 2KCOA 5FPYA 3MTYA 1DSTA 4CH2B 1BIOA 4CRDA 1J17T 1OYTH 4M7GA 1BTWA 4YO9A 2R2WU 1QZ8A 1ZMLA 1QHRB 3CS0A 1OWDA 2IPHA 5LPFA 4NWKA 1TX6A 2PR3A 3GYLB 4K5ZA 3RM2H 8GCHF 2FEQH 3K65B 4MPVA 4UONA 5TCAA 1ZPBA 1GI3A 4B6FA 2WZQA 1V2MT 4CH8B 5HIYA 1GBIA 1DWBH 4THNH 1ZTJA 2PLXA 1D6WA 1GJDB 2GTBA 3SNEA 5T1VA 4YTAA 1J15A 4X8UH 1O2YA 4BANB 5C0UA 2C93B 2IPQX 1TLDA 1TGCA 2ZDNA 1E1QD 7KMEH 3MQKC 2Z3EA 5BRRE 1JMOH 2PUQH 3MU1A 4ISNA 1EATA 3OY6U 1HUTH 5F6MA 1EAWA 5DPAA 4AG2A 3EA9A 4F4OC 3PLBA 1JRSA 5EJ1A 1TBZH 1EP5A 2Q1JA 4O97A 1C5LH 1G36A 1TQ7B 2XWBI 4GUXA 4WMFA 4F55A 4ACAA 3R0FA 1AMHA 3SJIA 3RU4T 2TRMA 4Y11E 5HM9A 1AU8A 3BEFB 1QBVH 1TPOA 3DFJA 1LTOA 1O39A 5C1XA 3I29A 2BHGA 1SB1H 1T8LA 1DY9A 4ABEA 2ZCHP 1RTLA 1ZPZA 1SL3A 1WBGB 1HJ8A 1FY3A 3LGTA 1PPCE 2ZQ2A 3BTWE 1OWEA 4O3TA 1BCUH 1TALA 3L3TA 1SQOA 2J94A 1COWD 4DIIH 4CRGA 1UTOA 2QE7D 3O8RA 2ZA5A 3A7VA 3SO3A 2J95A 2A4QA 3A83A 1NROH 1C2JA 2KX4A 2ZU5A 2OUAA 1ZRBA 1O3MA 3SU5A 1AKSB 2FLRH 1FDPA 2XYAA 3EDXB 4RI0A 4A1TA 2H9HA 2VWOA 1GGDC 1GBLA 3PM3A 1GL1A 2CGAA 1C4U2 2PSYA 2GCTC 1LCYA 1SGIB 3DFLA 1AFQC 1O37A 3SYJA 1P2OA 3LJOA 4Q80A 3A8CA 2FX6A 3ZZDA 4BAMB 4CREA 4BNRA 1FV9A 1KDQB 4DVAU 2GZ7A 4NCYA 1BDAA 1C5XB 5DP9A 1WCZA 1F0SA 1PPHE 3F3BA 1L1GA 5EXMA 1HJ9A 2QXJA 1YC0A 4UFDH 1LKAA 1ELVA 1ZPCA 3TPIZ 1HIAA 4X2YA 3EA8A 4K8BA 4BAHB 2Y82A 3OEED 4X1SU 3LONA 5CHAC 3QGJA 4DURA 1Y5UT 3UNSA 4OS7A 2OLGA 1AZ8A 3A7YA 3M35A 1EZXC 1MABB 3SGQE 3P8NA 2A2XH 2BD4A 4XFQA 1A46H 3U1IB 1O5BB 1ELFA 1Z8RA 1V2TT 1ZJKA 1TA2A 3E3TA 5FCRA 4AB9A 1EB1H 4ISIH 3DD2H 1WV7H 3KQEA 3SNDA 1WQVH 3A7WA 1O3CA 1GMHG 3H7OA 1C1TA 1GJ7B 5DP3A 1HAIH 4XD7D 5GCHF 6GCHF 2HWLB 1NU7B 4AYVB 4DGJA 5DN6D 1WDIA 1V2JT 2V0BA 2ZPSA 1VITH 1ESBA 2O9QA 2RCEA 2GKVE 5GXPA 2GP9B 1WU1A 4I8JA 4X1PU 1W0KD 1NN6A 2JETC 2P8OC 3QUMP 2K8IA 1C9TA 1VCPA 3ITIA 1Z1IA 1GI2A 3SV9A 4IC6A 2FODA 3TGJE 1EAXA 1Y59T 4E05H 1TYNA 2OINA 3ATLA 2OTVA 1O3FA 2R2MB 3UY9A 1SSXA 1GBAA 3T2NA 1HPGA 3SUDA 3LH1A 1QQUA 1ZGIA 2P95A 3A84A 2GMTB 1T32A 4HFPB 1INCA 4ZHAA 1LHCH 1BTUA 5EU8A 2F91A 3E16B 3W94A 2BY5X 1GCTC 1S0RA 2GCHF 1C1SA 2TGDA 1C5VA 1UVTH 1O3HA 4ABFA 3LC5A 2SNWA 1VCQA 3DHKH 1A1RA 1GMCG 2PFEA 3TU7H 3OU0A 1O36A 1H8DH 2P3TB 2Z9GA 4ZKOU 2BD3A 1YBWA 1LHGH 1AWFH 3ZYDA 1O2MA 1SQTA 3GDSA 1AKSA 1ETRH 1CT4E 1V2ST 3TGIE 4Y10E 3FP7E 4MPXA 1SOZA 4XBDA 5EGMA 3ZZ9A 2L6OA 3BEUA 5AFYH 3RMOH 1Z1JA 1P03A 4FUCA 1GHBG 3SHAH 2FOBA 3GDUA 3TJUA 3BEIB 3S9BA 1MBQA 5EJZA 1KDQA 2VIWA 1Z6EA 2RA0A 3SUFA 2VIPA 1CT2E 5JDUB 1GHVH 3PMAB 3UUZA 4B75A 2WPJS 2A4GA 3TVJB 1NRQH 2FOHA 2CHAB 1AVWA 3KQ5A 1NRSH 1YPHC 2WV9A 1C1NA 3UWIA 3T62A 8ESTE 2BXUH 4KTUA 2ZHQH 1Y8TA 3FAOA 3PYHA 3B23B 1Z71A 3RLYH 4MNXA 2IJOB 1FN8A 4Y71A 1WOFA 3HK6B 3K2UA 3U8OH 1ZLRA 2WV5A 4Q2KA 2EQNA 1TBRH 1N8OC 1GHZA 1YPHE 2XCNA 4MLFB 1GJ6A 1OWHA 1C1VH 5EXLA 3E0NB 2XBYA 1ID5H 2RDEA 2XC4A 2BLOA 2ZCKP 1CGJE 4TT3D 1H8HD 5IK2D 1UTMA 2ZI2H 1U6QA 1OWJA 2XC5A 1DLKB 1ELBA 1MUEB 2ZDLA 2ALVA 2SGFE 1UMAH 5TJXA 1OHHD 4MNYA 4IN1A 1JIRA 5HKKD 4CBNA 2ZKSA 1S5SA 1E37B 1OS8A 5EOKA 1PPFE 1JBUH 1V2OT 1JOUB 5F8ZA 3HATH 4GPGA 2G5VA 4MDSA 1SMFE 1ELAA 3UR9A 4B74A 4BAQB 5DO4H 1E35B 2W6JD 4LXBH 4MPUA 6CHAC 1S82A 4Y79A 2FZZA 3SI3H 3TH4H 4ABDA 4X8VH 2WYJA 3PO1B 1YPLH 3BIUH 2ANWA 1L4DA 4JK5A 5C3NA 1C1UH 3PRBA 1E79D 2KCAA 1C2KA 3A8AA 4B2AA 3GY4A 1S0QA 1TNIA 1SQRA 2BD7A 2PV9B 1NFUA 4FUFA 1RS0A 2XNDD 1MU6B 3PWCA 1PFXC 3B9FH 2VINA 3SV2H 1PYTC 4INKA 1O2KA 3ZZCA 4UE7H 2PKAB 2BOKA 1SC8U 2B0FA 4JK6A 2F9BH 5H4IB 5A09A 2BD9A 5DP8A 1DWCH 3TH3H 4UDWH 5FCKA 1KLJH 2RDLA 7GCHF 4FUDA 3LU9B 1ZTKA 1PQ7A 1TQ0B 4GCHG 3VEQB 1CT0E 1FQ3A 1HAYB 5A2MH 1NFXA 1QA7A 1AB9C 1C1RA 1WSSH 3A8DA 1CVWH 5K7RA 2R3UA 2Z94A 2ZGCA 4A7IB 2BYAX 1D3PB 2A4RA 2Y7XA 4A5TS 2ZHDA 1BA8B 4RT0A 3PTNA 8GCHG 5LGOA 2ASUB 4LZ4B 1DVAH 4JZDH 1FNIA 3FANA 3A7TA 1S81A 2D2DA 4Y7BA 3BTFE 4WXIA 2HLDD 3SNBA 2UUJB 3KEEA 5FPSA 2FLBH 1NFWA 1TOCB 3U8RH 3I77A 5EW2H 1EAIA 2J4IA 1RXPA 1S85A 2WUCA 4AFUA 1C5ZB 1TAWA 1F0UA 1O2VA 1V2LT 1QCPA 1ZR0A 2JKHA 1F0TA 2F9PA 1NY22 4KKDA 1A61H 4D9QA 1GBBA 1MTUA 1QL7A 1CU1A 3SU1A 4CRAA 4K1EA 3KCGH 3LOXA 1YPJH 2GZ9A 2AYWA 2GVFA 1QBOA 3SJ8A 4D8NA 1XX9A 5EXNA 1IAUA 3UNQA 5C20A 2A7JA 3HPTB 1L4ZA 1YLNA 2FTMA 1KXBA 3E0PB 1DS2E 2SGDE 3QTOH 4UD9H 1BRUP 3NUMA 3URCA 3DA9B 1GI4A 2AGGX 2GZ8A 1V2WT 4LK4A 2XXLA 5A0CA 4NA9H 1ELEE 1VGCB 5L6NH 1Z8IB 3W1EA 1GBCA 3UOUA 2PUXB 3UB0A 1XUGA 3RXEA 2QIQA 1XXFA 3M7UA 4IS5A 4X8SH 1C1QA 1S84A 4SGBE 1OP2A 2FWWA 2W26A 2NU2E 1FAXA 4ZROA 1ZJDA 2RFKC 5AF9H 3MH7A 2C3SA 1PJPA 1JXPA 2A1DB 4WH6A 4PROA 5HMAA 2ZTXA 5G4BA 1HAXB 4WH8A 1EFRD 2PKSC 3EYDA 3PROA 2C4FH 4CR9A 1TNHA 3N7DA 3A7ZA 1S83A 9ESTA 5EQSA 4FUJA 4CR5A 1BTZA 1O33A 1P04A 3GCTF 2ZDAH 1TWXB 3P95A 1W13U 4ASHA 2EA3A 3SV7A 2AMDA 2ZTYA 2GCTB 2O8TA 1RJXB 1ABJH 1AFQB 3F2HA 2GV7A 1TFXA 2D26C 2XRCA 1SGFA 1TMTH 1GL0E 2VWMA 3IITA 2PKAA
chains in the Genus database with same CATH topology
3ENSB 5T3HA 4D7FA 4GHTA 4AFQA 2BZ6H 1UCYE 3GYMA 4KTCA 2ZHFH 1NC6A 1TNLA 1UVOA 1ELCA 4IC5A 3S0NA 1H8IH 1C5YB 1C4V2 2FOAA 2VIDA 1BTYA 1CHGA 5CHAB 1FPCH 1LPGB 1TX8A 4BXSA 1L0ZA 1XUFA 6LPRA 2R9PA 1SR5C 1O2NA 2F83A 2VVVA 5GCHG 1T4UH 1UHBA 1Z7KA 2G8TA 1QY6A 1BMMH 3SBKA 3KQCA 1P2NA 4TYDA 2V3OH 3FP6E 1VCWA 2F9UA 1HAVB 3UNRA 1JIMA 3PLKA 4FU8A 5E2OA 1MMJN 2XBVA 1D3QB 3Q3KA 4GSOA 1LQDB 3KF2A 4XOJA 1YLDA 1K1OA 3M5OA 3SU2A 1GBDA 1F5RA 2BVSH 1HYLA 2R0LA 2P3UB 1OP0A 1SLUB 1MCVA 1P10A 1GBMA 1DDJA 3STIA 4ZXXH 3NK8A 1QL9A 2VNTA 1THRH 3NKKA 1LVMA 1MZDA 2P8OB 1A4WH 1GPZA 1EJNA 3GDVA 2H5CA 2XBXA 3U9AH 1NPMA 2AMPA 1GDNA 3DUXH 4JYUH 2AIQA 2TBSA 1WQSA 1F5LA 2NU1E 3P8FA 3E1XB 2AEIH 3RXFA 2EC9H 2AMQA 3TITA 1EZSC 4OS4A 4NZLA 1CBWB 5HGGA 3D49H 5T6FA 1XM1A 1MZAA 2HVXA 4X1NU 3VPKA 5JBAS 1ZGVA 1LHEH 1SHYA 1O3PB 5C2ZA 1GBTA 3RXGA 3SI4H 1Y3YA 3D65E 2D1JA 4ZUHA 4AZ2B 4I33A 3FFGA 5DJ7A 4MVNA 1O0DH 1ZOMA 1SFIA 1XUIA 4MPWA 1ANDA 1O2PA 3BG8A 2Z9LA 1O3IA 1O2LA 1G37A 3K9XB 1EPTA 4HTCH 1WYKA 2YNAA 1FZZA 1ORFA 3TK6A 1CO7E 2B5TB 1BQYA 1W3CA 5C1UA 1BJUA 1D6RA 1YYY1 4OGYA 2FOEA 4AOQA 2SFAA 1AUJA 2Y80A 4GHQA 3MU5A 1DFPA 1GG6C 2IN2A 1A3EH 1O2SA 2Q6FA 3Q3YA 2I6QA 3U98H 2HPQH 2HGTH 3BN9A 1FY4A 2B9LA 2QAAA 4IBLH 2PHBA 2ULLA 3VGCC 1TRMA 2WUBA 3SU3A 2GGVB 2IOTA 5LPRA 2FI5E 2F9NA 3A81A 1TB6H 3SN8A 1P0SH 1DANH 2XWAA 3I78A 4AORA 3M36A 3KIDU 3RXHA 2G4UA 2V35A 2BD5A 3O8CA 3MO6A 1SOTA 4K60A 2Z3DA 2WYGA 3V0XA 4ABAA 1H9HE 3UPEA 2VVCA 1NTPA 1AE8H 4DG4A 1O34A 1QFKH 1F5KU 3S7HB 1TNGA 1C1WH 3UIRA 5GPIB 2CF9H 3GY8A 2P93A 1D3TB 1B7XB 1EX3A 4X2VA 1A0HB 1HFDA 2O8LA 1P2JA 5GIBA 1GJ4H 1SGNE 2QY0B 3F9EA 3SUEA 1TABE 1YGCH 3RXUA 4U2WA 1HAVA 2ALPA 1GJ9B 2Q6GA 3RXQA 5T6GA 4NIVA 5GWZA 1B0FA 4YM9A 3NWUA 3VB6A 4K69A 4XBCA 5JBCS 3SNCA 4O9VA 4XE4A 3H5CB 4JYTA 4NSYA 1SGEE 3GICB 1D3DB 3RM0H 2STAE 1K1NA 1O3NA 1K21H 4XDEA 1W0ZU 1LPZB 1AUTC 3ZV9A 1XVOA 1T7CA 1V2UT 4XBBA 2C8XB 1HDTH 2J38A 3LJJA 1KXDA 4MQAA 2H2ZA 1TGBA 1A2CH 4MNWA 1IQKA 1UTNA 1OWKA 4FVDA 4WF8A 7ESTE 2BLVA 1KLIH 3KN2A 3U8TH 1C2MA 1PPEE 1EOLA 1K1PA 2AERH 3ZVAA 4DY7B 2H9EH 4WJG2 1HXFH 4ABHA 1O2HA 3MH6A 2BDCA 3RXVA 3UOPA 3RXBA 2OC1A 1SI5H 4NWLA 7GCHG 2FOMB 3GY6A 1G2MA 2VIQA 4ZAEA 1BBRH 1A5IA 4I31A 4FUEA 2ANMH 1S6HA 1FY1A 3S9AA 8LPRA 3SHCH 1LVBA 1BITA 2OC8A 4OS6A 1DX5M 1V6DA 1UTKA 1BB0B 1LHDH 1LVOA 2ZC9H 4TWYA 3ODDA 1O5EH 2ZWLH 1Y3UA 1YM0A 1TNKA 5E8EH 1P3CA 3T5FH 4IMQA 1C2EA 3LGUA 4TPIZ 2RA3A 1EB2A 1K1JA 2BVRH 4AFZA 1J14A 1VJ9U 3TJOA 1BJVA 5AVDA 1O5DH 4VGCC 3E8LA 3GY5A 1EAUA 1SGRE 1THSH 1AIXH 2GT7A 3M3VA 4GLYA 1F2SE 4K2YA 1UCYH 3M5LA 2ANKH 3HK3B 4D9RA 3GCHB 3T28A 1DITH 3W95A 2OBQA 1PPBH 3PMJA 5T6DA 3QTVH 3P6ZB 1IOEA 1FN6A 5IDKA 2PGQB 1SLVB 3RXLA 1P11E 3RXSA 1SGYE 1RTKA 3TK5A 2OQ5A 3MMGA 4B2BA 1V3XA 1EZUC 3MNCA 3SGBE 1ACBE 1AI8H 4CRBA 1FAKH 1IQFA 1XUJA 2OP9A 1T8MA 1FPHH 2C8YB 1Z6JH 3GY3A 3RXAA 4AG1A 2BY6X 3FVFB 5EW1H 2P94A 3P8OA 5DP5A 1RFNA 5C1YA 3PB1E 5K0HA 4FXGH 2SNVA 2ZGJA 1QB6A 1SVPA 1K1MA 1BTPA 4ZMAH 4RKJB 1GJBB 1PQ8A 1YF4A 2QC2A 3LDXH 4WMDA 5AHGH 2HNTF 1HAHH 4JZEH 2ZO3H 1CGIE 5ESTE 1VITF 2SGAA 1P05A 4BOHA 3MWIU 3TJNA 3SQEE 1QQ4A 2Y5HA 2TGAA 5B6OA 3A86A 2G81E 3LKWA 2ODPA 4B76A 4JYVH 2A32A 1L1NA 5JYIA 4X0WU 1O2TA 4B1TA 5A8YA 1TMUH 1GHYH 1BUIA 1ESTA 3A80A 3OSYA 4BTTB 1JWTA 2NWNA 2O8WA 2VWNA 1CSOE 5HYOA 4HI3A 1PPGE 1Z8JB 3HGPA 1GBFA 4OS1A 3GCTG 3BV9B 1OP8A 4FU9A 5DG6A 2J34A 1C5QA 1WTHD 3LGWA 3MO3A 4CHAC 1BBRK 1WUNH 1TNJA 1GI5A 2G55A 3ZZ4A 4DCDA 1C5RA 1TOMH 1A0JA 3Q76A 5GJ4B 2QA9E 3MYWA 1O5AB 3LGYA 1QA0A 3SU4A 1MH0A 2BXTH 1GI0A 1IQLA 2VJ1A 1GMDF 3RC6A 4ISLA 1GJ8B 5CE1A 2OC7A 2VH6A 1GJ5H 2V3HH 3TIUA 1MAXA 2ODYB 3M5NA 2A7HA 4D7GA 1SFQB 2QGRA 1IHSH 3WY8A 1C5WB 5DKMA 2W7SA 2TGTA 1UCYK 2Z9KA 3RU4E 1T4VH 1HXEH 2PTCE 1UK2A 2JH0D 1OPHB 1O5GH 1K1LA 2EI6A 3BG4B 3RXCA 1P57B 1AY6H 3G01A 1AHTH 4HGCA 1O2XA 4YESB 5EPYA 1P01A 1LPKB 1EZQA 1HB0B 1TX7A 1H4WA 3A88A 2VGCC 1GDUA 2H9TH 4A92A 3S69A 4D76A 1LVYA 1GMHF 1D9IA 1QR3E 2BDBA 1P2KA 2BB4A 4QT8C 1YCPH 4DW2U 5HM2A 3SW2B 1GHWH 1AO5A 5HXFA 1HBTH 4ZKRU 5EPNA 4X6OA 3GCOA 1P9SA 1P09A 2A2QH 1UK4A 2AGIX 3SOSA 1UK3A 3TK9A 3MHWU 2BX4A 2WPHS 3RLWH 3AVZA 4FUGA 3SQHE 3UWJH 2ESTE 2ZTZA 3V3MA 5E2PA 3UTUH 4H42U 1P2MA 1TMBH 2FM2A 2GMTC 3F9HA 1ABIH 1ZZZA 2Y5GA 2G4TA 2VWLA 1BHXB 1G3EA 1E36B 4IW4E 4H4FA 4Y7AA 3LIWA 4Y8XA 4ABJA 1O2JA 4BAOB 1P8VC 1UVSH 1YKTA 1VR1H 1O32A 3P70B 3RC5A 2C90B 1HCGA 1O3JA 3F9GA 5E0HA 3T26A 4UFEH 4YZUA 1BZXE 4AFSA 5F03A 1W7XH 1SHHB 3VXEH 1IQHA 2BM2A 3QO6A 1ZYOA 3T25A 1MQ6A 2DE9A 3QX5H 3VB7A 4YOGA 3U1JB 1HJAC 2Y7ZA 3RXDA 4NIYA 2AH4X 1GHXH 2XBWA 1SLXB 5F8XA 1UTJA 1C1OA 1CA8B 5LPEA 1LDTT 2ZP0H 3ZZ5A 1UTLM 1PQ5A 3GY7A 4O3UA 4J1YA 3EE0B 1GG6B 1AQ7A 3V7TA 1BRCE 5DGJA 1RD3B 4CBOA 3QGNB 4RKOB 3MU0A 3QWCH 8KME2 2SGPE 2VU8E 3RXIA 1FIZA 3DT0H 3TNTA 1Y3WA 3D62A 1GHBF 1UVUH 1HAOH 3L6PA 1MBMA 4GAWA 1BBRE 1O3KA 1YPGH 3VB4A 1ARBA 2HNTC 3Q3XA 1GI1A 3RXMA 4AGJA 1NS3A 4JZIA 1IQJA 1CA0C 3BSQA 1G3DA 7LPRA 1G3CA 1KYNA 1AZZA 1GGDB 1GVLA 5I25A 5JB8S 1NT1A 5C5OA 4AGKA 1OWIA 1DXPA 2ZU2A 4TY6A 3K6ZA 1A3BH 3F6UH 1EXFA 3HGNA 3ZZ7A 1C5UA 3A89A 3ZVFA 2LNCA 3MNXA 3GY2A 3P8GA 1Q3XA 1Y5BT 2FX4A 2ZECA 3L33A 3RDZA 3ZVDA 2OC0A 4MTBA 4DJZB 1THPB 2Z6BD 4Z6AH 2W3IA 2ZGBH 4I7YH 5PTPA 2ZFFH 5JBBS 4ABGA 3PO1C 6GCHG 4UFGH 4X2XA 1DSUA 2B8OH 3MO9A 1W10U 4B73A 2QCYA 9LPRA 3FP8E 3TLOA 1GI7B 3MU4A 3SORA 4R0IA 3ZZ6A 2UWLA 5CMXH 2R0KA 3OYPA 3S7KB 1TONA 3RUOA 1CHOF 4YLQH 2VB0A 2ZDKA 1OXGA 1EKBB 1QB9A 4X1RU 1ZHRA 5C67A 1KXAA 4YT6H 3N7OA 2ZFTA 1ANCA 3AW1A 2OD3B 2OCVB 2QV1A 1MTWA 2CMYA 1O2UA 3ATIA 1QJ6B 4GVUA 4Q7YA 1AGJA 1SGTA 5A0AE 2XW9A 2WPMS 4Y0YE 4AX9H 2JETB 1T31A 1O3BA 3RXTA 3ZZ8A 2WPKS 1ZSKA 2FP7B 2P59A 1FONA 2C8WB 1ZMNA 3MI4A 1O2WA 1GBJA 2ZFPH 1BTXA 3UREA 1BTHH 1DWDH 3FZZA 1FUJA 1QURH 5BPEA 3KGPA 3M3TA 2GCHG 3PV4A 1IQEA 3SJOA 2HOBA 3OTJE 4JCNA 1GJCB 4VGCB 3HKIB 3KNXA 1QJ7B 1FY5A 2EI7A 2KAIB 4ZH8A 3EAJA 1O2OA 3E91A 4FUHA 1V2QT 2ZFSA 4UFFH 2A5IA 1OOKB 3TH2H 1MTNC 2VVUA 2FYQA 1ETTH 1V2KT 4KGAA 3ZV8A 1FY8E 1GCTB 1KXEA 2XNIA 1P12E 1KXFA 1KXCA 1SGCA 5FBEA 1N1LA 4FUIA 1O2GH 2A31A 4O03A 3A87A 1GWAA 1IHTH 1EJMA 2SGEE 4I8KA 3RXRA 2HLCA 3AW0A 2BTCE 1VITG 4KTSA 2CN0H 2FS9A 2ZIQH 2ZPQA 1S6FA 3VB5A 3ZZBA 1VGCC 5L2YH 3M5MA 1ELGA 2J9NA 1C2HA 4DIHH 2ZGXH 2HPPH 2FOGA 2ZQ1A 1B0EA 1DPOA 1DICA 4WVPE 1P9UA 2BY7X 1E0FD 3BTKE 3NPSA 1GHAF 2GDDA 4Q7XA 1T8NA 2F9OA 4CRCA 5L30H 2FDAA 4X1QU 2HALA 1JRTA 2G00A 1EPTC 1RIWC 4BTIB 3RXOA 3UFAA 4Y8ZA 1GJAB 5C5NA 4H6TA 4OS5A 5JBTA 1P02A 4YOJA 1TGSZ 2ZHWH 3ZZ3A 1N8OB 5AFZH 3URDA 2JH6D 1ELDE 1XKBC 1OYQA 1NU9A 3D23A 3AASA 4NGAH 2BDAA 3AAUA 1ANEA 3BTHE 2ZFQH 1O38A 1SQAA 4I8LA 4NFEA 1GMDG 1DOJA 5DP4A 4RN6A 4CHAB 2G51A 2PW8H 2PWXA 4AN7A 1GBHA 4X6PA 1SGFG 3FZDA 4OS2A 4A1VA 1BOQA 1MKWH 1H9LB 1QJ1B 2PGBB 2Z9IA 3KHVA 5DP7A 5ESBA 1NO9H 5DK1A 3SGAE 4ESTE 5TCCA 1W14U 1DLEA 3MNSA 3CP7A 4AYYB 2QXIA 1QL8A 1OKXA 1OSSA 4LOYH 1LMWB 1C2IA 4FU7A 4U30A 1DUAA 1Y5AT 2WPIS 1K22H 4IGDA 4KELA 2TGPZ 3ATWA 1M9UA 1VZQH 6CHAB 2D8WA 2G5NA 1YCPM 1WAYB 2AIPA 2VIVA 1X7AC 3CENA 2ZG0H 1QB1A 3SV8A 3PMBB 3VB3A 2GX4A 1GBEA 2P3FH 1O2RA 1C5MD 1BRAA 2TPIZ 1CE5A 3M7TA 1HAGE 1TPAE 3QDZB 1LQEA 2F3CE 1TGNA 2W5EA 2BDIA 2RG3A 1AVGH 1J9CH 1XUKA 3SU0A 2G52A 3H7TA 3VXFH 3MH4A 4BXWA 3S9CA 4WY3A 5JB9S 2KAIA 1KTSB 4U01A 2VIOA 3RXJA 2FOCA 2VGCB 1SPJA 2QXHA 2QF3A 3A85A 3SJKA 1AB9B 1PPZA 4FVBA 1NM6A 1QNJA 1G9IE 4NSVA 2FPZA 3A7XA 2NU3E 1KLTA 3E6PH 2GD4B 4Y6DA 3OY5U 4HZHA 1LO6A 3OX7U 1DWEH 1VJAU 1WTGH 1ZSJA 2O8MA 3ZYEA 1DE7H 1LKBA 2QF0A 2BDHA 2A4OA 1K9OE 2BMGB 4A1XA 2WPLS 1HRTH 1N6YA 3F9FA 3ZVBA 2XCFA 1GBKA 2ZZUH 3Q00A 1FI8A 1CBWC 1HLTH 4I32A 1E34B 2BZAA 3JZ1B 2K1QA 2ZDMA 5EQRA 2CV3A 4ABBA 1MKXH 2EI8A 3ZVEA 4TWWA 1NRNH 1SGPE 4INHA 2BQ7B 2WINI 4K3JA 4AB8A 5ABWA 3LH3A 1B5GH 2UUFB 2Y6TA 1O2ZA 2ODQA 3ODFA 4X6MA 2AFQB 1AN1E 3MFJA 3CS7A 4K1TA 1J16A 2Z9JA 2UUKB 4K1SA 3RMLH 5I46H 2Y81A 1O2IA 2FIRH 1AFEH 1H1BA 2NU0E 1F92A 1K28D 3ZVGA 4E06H 5FHTA 2Z3CA