2G5NA

Indole-amidine complexes with bovine trypsin
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Ligand Epitoping By Proton NMR Chemical Shift Differences
rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5nA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g5nA02
5FPYA 1OX1A 1RTLA 3RMOH 2BZAA 1TE0A 1XKAC 4ABHA 2STAE 2Z9IA 4UE7H 1S81A 2WUBA 8LPRA 3M3VA 4GHQA 2Z7FE 4B1TA 2EI8A 2FMJA 3CS0A 3Q00A 1P05A 1F0UA 2QA9E 3KCGH 1HUTH 3UIRA 4K8YA 1C5VA 3F9EA 2J4IA 2F83A 4D8NA 4WXVA 5J4QA 1S6FA 4DY7B 3CP7A 4KTCA 1BBRH 1YBWA 4OS6A 5AHGH 1P12E 2QY0B 1XVOA 3ENSB 1GBCA 1MKWH 5A8XA 4GPGA 3MNSA 2F3CE 1C1MA 1UK2A 3UTUH 1C5SA 1O2KA 1A61H 3OYPA 3O8DA 2VH6A 2OC1A 1Y5UT 5C67A 1O2XA 2J95A 4K3JA 1SGNE 1UTNA 1JIMA 1FPCH 3RMMH 3E0PB 3V7TA 1BRAA 4R0IA 1QBNA 2GZ8A 4AB8A 1EJNA 1SB1H 3MWIU 1RGQA 1QFKH 2TPIZ 2SFAA 4UEHH 3PLKA 4DGJA 2ZDVH 2C8XB 1C5RA 1AFQB 3H7TA 4NA8A 4NGAH 4BXSA 1SPJA 4IGDA 2XC4A 2SGEE 5C5OA 4UFEH 1OWJA 4WJG2 3EE0B 4LZ4B 1TRYA 1TABE 3KHVA 3GYLB 4O97A 4SGBE 1BMAA 4ABDA 1IHSH 2ZFQH 2YNBA 1PQ8A 2WUCA 4AOQA 3E1XB 4X2YA 2FYRA 3KGPA 4U32A 2PLXA 5EXNA 4E05H 4J1YA 2AMDA 4YLQH 1TNLA 3AW0A 2OP9A 3VB7A 3SJIA 2K1QA 1IQIA 1GI1A 1GJ7B 3SUEA 3DT0H 4WXIA 2G5VA 3A7YA 3URDA 1PYTD 4X6NA 1RRKA 1P2IA 3TGJE 1DLKB 2G5NA 3UY9A 1ELEE 4CBOA 4JZDH 2WINI 2OTVA 3A84A 4YTAA 1UVTH 3FZZA 1FAKH 1DOJA 2P95A 3ESTA 1A3EH 1ELDE 4PROA 1MCVA 1ZPBA 3STJA 3A87A 4E7RG 1OWDA 1D3QB 1ABJH 3FP6E 1EAIA 1F0SA 3TH2H 3SU5A 1TWXB 3QUMP 3CENA 2SGPE 3A82A 3C1KA 3B8JA 2M5TA 1FY1A 1C5YB 2NWNA 5EPYA 2ZECA 2CHAB 1CVWH 5E2OA 1GI3A 3PMJA 4LK4A 3TU7H 5F03A 1T4VH 9ESTA 2R3UA 1FJSA 2BQWB 1BRCE 4KGAA 3ZZAA 4DG4A 1X7AC 3UPEA 1XUGA 1CQQA 2V35A 1LVMA 1VITH 2FS9A 2WPJS 1BA8B 1HYLA 1G2MA 5GWZA 1S85A 1N8OB 1MTVA 2O8TA 4I7YH 1BRUP 5C3NA 2ZU4A 1KDQB 3MU8A 5FX6A 1D6RA 3RXTA 1FUJA 2PV9B 2ULLA 2VWOA 3IG6B 4BTTB 5L2ZH 4ISOA 1WSSH 1E0FD 4THNH 3TH4H 4NSYA 1Z1JA 3MI4A 1RS0A 1TNGA 3LGVA 1SGFA 2V6NA 1MTNC 2LNCA 3N7OA 4FUFA 2GGVB 2H6MA 3UNRA 1ZJKA 1YF4A 3L3TA 1GCTC 2A45B 1MAXA 1BT7A 1GJ5H 3S9AA 1GGDB 4RN6A 4A6LA 3RXLA 4YZUA 1AWFH 5GIBA 1DWBH 3RM2H 2FOHA 2XTTB 1GL0E 3ATWA 1UCYE 3GDUA 1C1TA 2CGAA 4Y71A 3ZZ6A 2VB0A 4WVPE 1HXEH 1O38A 1TRMA 1V3XA 3PROA 4YESB 2ANWA 3V0XA 1CGJE 3HKJB 3MH7A 1IQKA 2PWXA 3LOXA 6LPRA 5EG4A 2ODQA 4Y0YE 4KTUA 2BDYA 3TK6A 4Y10E 2V3HH 5DP3A 1G32B 4JZFH 2AMQA 3D49H 3M7TA 1EZUC 1D9IA 4BOHA 1ELAA 1H9IE 2C4FH 1GCTB 3SU3A 1ZMNA 2BTCE 1AUJA 1EATA 1ZRKA 2BVRH 2J92A 2R0KA 4ZHLU 2BD5A 2C8ZB 3QZRA 8GCHG 5HYOA 5JYIA 2GVFA 3BTQE 4ZROA 1C4V2 2PUXB 4BNRA 1AB9B 3RXPA 1MZAA 1EP6A 1ELTA 1TX7A 4FUGA 3UREA 4CRDA 1L4ZA 1AGJA 1C1QA 3O8RA 5DP7A 3SUGA 3PB1E 1CBWC 3KQBA 2AFQB 1TX8A 2ZDLA 2CXVA 1OYQA 2OC8A 5I25A 1BTXA 1TBQH 2ALPA 5A0AE 3BG4B 1DWEH 2Y6TA 4NG9H 2FZZA 1DICA 1JRTA 1UK3A 1SHYA 3TPIZ 2FOMB 3PWCA 3M3SA 1TFXA 1TNIA 2QGRA 3T62A 3U1IB 2OC7A 4D7GA 3E0NB 2ZIQH 1OYTH 2BVSH 1Z71A 4J2YB 1MCTA 2XWBI 3ATLA 5EXMA 4A5TS 5DP8A 1HAPH 2PTCE 3GCHB 4OS5A 1PPBH 2Q1JA 4IC6A 3RXBA 3RXRA 1TMUH 4FVDA 1CBWB 2YOLA 3URCA 1MQ5A 2A4QA 2BLOA 1L1GA 3SI3H 3FZDA 2RDLA 1QL8A 2ZO3H 1C4Y2 1O2PA 2UWOA 3K65B 1JXPA 5GJ4B 1K9OE 2I6SA 1HJ9A 3ZZDA 2VIQA 4GCHF 2Q6DA 5C20A 4NA7A 1O36A 1O0DH 1QTFA 1LMWB 2BVXH 1CT0E 3IWMA 1P0SH 5FBEA 1KXCA 2H9HA 4AN7A 4AYYB 2GCTB 4AG1A 1EJAA 1GI7B 1KXEA 3S9CA 2PSYA 1C2EA 1MU8B 1YPHC 1BTUA 3T26A 2ZEBA 1C5ZB 1NRQH 1VCPA 1EQ9A 1C1VH 1P06A 4RKJB 2A5AA 4XBBA 5TCCA 3BEIB 4MTBA 1C2MA 5ESTE 3TH3H 3GCOA 1ELFA 4YOIA 2A4RA 1THSH 4O3UA 1K1NA 2OLGA 2RG3A 3U9AH 3ZVEA 2XXLA 2THFB 4BAOB 2ZFTA 1ETTH 2O8LA 6ESTA 4CRFA 1O5BB 3LH3A 2H9TH 1TALA 9LPRA 1OP2A 1TBZH 1DY8A 2HNTF 1P11E 2FPZA 3GICB 3SZNA 3MU0A 3RXAA 7KMEH 5FHTA 5DP5A 3RLYH 2NU0E 2FTLE 2ZGXH 1ZYOA 1QY6A 3ZVCA 1CO7E 3M5NA 2A1DB 2PKSB 2EI6A 1GBDA 2FIRH 3A7XA 1V2ST 4IBLH 1O2UA 4BAHB 1O33A 1HAIH 4ZHAA 1C5UA 3IITA 1EP5A 2DE9A 4ABGA 3LJJA 4HFPB 1BJVA 6CHAC 1A2CH 3VGCB 3F9FA 1NESE 1GHBF 3W94A 4FUIA 4LOYH 1D3DB 1GJDB 2QXGA 1XXDA 8KME2 3TIUA 1HAOH 1NN6A 4Y7AA 7GCHF 1WBGB 2F9VA 2WYJA 3SBKA 1GMHG 4CRGA 2Y81A 4QT8C 4H4FA 1TONA 3QK1A 3ODFA 2FOBA 1NC6A 1SGIB 4CBNA 3UQOA 2AGIX 2C93B 1EASA 3F6UH 1FN6A 1AQ7A 1GMDF 1TOMH 1HCGA 1V2LT 3TGKE 3Q77A 4X1RU 3EGKH 1INCA 4FUCA 1BTPA 1GBKA 1C1NA 3PLPA 2Q6GA 1P8VC 2UUKB 5K7RA 1KXAA 1DANH 4TPYA 1DUEA 3NUMA 3A8AA 4IN2A 4YT7H 1O5FH 1SHHB 3SI4H 2VGCC 3FP8E 4LXBH 1F0TA 1DX5M 1O2JA 3U69H 3LU9B 5F6MA 2LPRA 2SGDE 2ZHQH 3M35A 3TJUA 1GBEA 4YT6H 3M36A 1L4DA 2H1UA 3VB3A 1P01A 4D7FA 3SO3A 1K21H 3ZVFA 3ZV9A 5TCAA 1W2KH 3VEQB 1SLWB 3MFJA 1TNHA 1AO5A 1AIXH 1F5RA 1Z8RA 1IOEA 5CE1A 4BXWA 2VGCB 2H5DA 3M7UA 3FFGA 7LPRA 1UMAH 3DFLA 1S0QA 5PTPA 1O3DA 4OGYA 2ZHDA 5H4IB 3SORA 4DCDA 5I46H 1SLUB 1TNJA 1SLXB 4K1EA 1OOKB 3RXCA 1OWIA 2P93A 5AVDA 1BHXF 1VITG 4CR5A 3SV7A 4KTSA 1O3CA 1O2MA 3CS7A 2GT7A 4ZAEA 1ETSH 1CGHA 1A4WH 2V3OH 3GY2A 2OC0A 4A1XA 2A4OA 1J17T 1CHGA 1UJ1A 4YLUA 1NO9H 2Z9JA 2VIVA 1HJAC 3SU6A 3Q3KA 4B2CA 3EA8A 2BDBA 4CHAC 1FV9A 3L6PA 1O3FA 2FDAA 4B71A 2O8MA 4BAMB 3BTFE 1HBTH 2HVXA 3U8TH 4VGCC 1XKBC 2GMTB 3ZVAA 4JYTA 3EDXB 3A88A 1O5EH 1ESTA 4BAKB 1QJ1B 1TPSA 2J94A 1DT2A 1D3TB 2QIQA 1GBIA 1P2OA 1EKBB 1UTLM 4ISIH 4JZ1A 5A8YA 1C5LH 2J34A 2ESTE 3TLOA 1G30B 1MTWA 4INKA 2ZGHA 4HTCH 1GMCF 3QZQA 4XDEA 2CF8H 1GJ6A 1FNIA 4OS1A 1E36B 1BUIA 1UTKA 2ZG0H 2A32A 3TK9A 3W95A 1TB6H 1F92A 1XUHA 2B0FA 2FI5E 3SNBA 1L0ZA 1O3BA 1O2TA 1MH0A 2GKVE 1NZQH 3PM3A 3GDSA 3A81A 3HATH 3UR6A 5C2ZA 4AFUA 1F5KU 1Q31A 1MUEB 1V2TT 1A5HA 2BLWA 3D62A 1FQ3A 1ESAA 3S7HB 3A89A 3BTKE 1Y59T 4CRAA 1Z1IA 1GI2A 2HPPH 4HGCA 1WCZA 1O3AA 3R0FA 1MZDA 1HIAB 3NCLA 4MDSA 1YCPK 1QJ7B 3V13A 2AH4X 1LO6A 1FY3A 2AYWA 4AX9H 2W7UA 3AW1A 1OXGA 1YKTA 1CHOF 5EW2H 1NRNH 3SW2B 4XBCA 3MYWA 2BY8X 1BHXB 2DUCA 1HLTH 1TGNA 1P03A 2TIOA 2BXUH 4XOJA 1Y3UA 2BDGA 1SQOA 1FN8A 3LIWA 2GT8A 4UFFH 1CHOG 1O5DH 3E90B 2Z9GA 5GCHG 1Y5AT 1ZSJA 5E0GA 3HKIB 3BTME 3RXJA 4WMFA 2GX4A 1VZQH 3M3TA 4TYDA 5F8XA 4JYVH 1D3PB 5LH8A 1FIWA 1S82A 1YCPM 1C1RA 1QBOA 3ZZ5A 4INHA 3SHCH 5IYTA 3ZZ3A 4XBDA 2OUAA 3MH5A 1V2VT 1W7GH 2FOEA 1QHRB 2GTBA 2GZ7A 4AZ2B 2O8UA 5EPNA 3VB5A 3SU1A 3KL6A 1QB1A 2STBE 3KN2A 1BOQA 1HAYB 3D23A 2P8OC 2WYGA 4X6OA 5A2MH 3UWIA 1C2KA 3RC4A 1ANDA 1HRTH 4I8LA 1C1PA 1RJXB 3NPSA 4MNXA 4OS4A 7ESTE 5HM9A 2TRMA 3QTVH 1QBVH 2SGFE 3SU4A 1EJMA 2WPLS 5DO4H 4X1SU 3WY8A 4GHTA 2VINA 4K1SA 4DIHH 3R3GB 1YYY1 3A7VA 1ZTLA 1DLEA 5JBAS 3ELAH 1TIOA 2HOBA 4NFFA 2Y5FA 2ANKH 5FAHA 5JB8S 1PPHE 1DUAA 5T3HA 3BTHE 3KEEA 1KXDA 1IQLA 1THRH 1C2JA 2CMYA 1ZTJA 1O2GH 2Z9LA 2P8OB 1QB6A 4B75A 2ZFFH 5DGJA 1SOTA 1D4PB 1UHBA 1S83A 1C2GA 2PUQH 1QRZA 1IHTH 1O5GH 1VJ9U 1G3DA 2A7JA 5F8ZA 4UD9H 3TITA 1Y3YA 2CN0H 2UUFB 3RMLH 3TVJB 3T27A 1XX9A 1FLEE 4JZIA 4Y8YA 1B7XB 1CT2E 1DWDH 4Q7YA 1FZZA 4CH2B 2XWAA 4K2YA 1GVZA 1KSNA 2ZF0H 1A3BH 3LT3A 2F9PA 3SV2H 1YPHE 1DS2E 2EEKA 3I78A 5T6GA 1MAYA 1IQFA 2H5CA 1ZHPA 3HGNA 1TGCA 1RIWC 2A5IA 3QGJA 3GISB 1AUTC 1CGIE 1AMHA 1OP8A 1G37A 3EQ0H 1GBJA 1XM1A 1LPZB 2BQ6B 3MU5A 4CRCA 4K69A 1PJPA 3RXDA 1BMLA 1SFQB 2QC2A 2B8OH 1O3NA 1K1PA 4ZXXH 2FXRA 3HK3B 3A7ZA 3UOPA 5JBBS 2ZDNA 2A2QH 1XMNB 1ETRH 1K2I1 3BIVH 2NU2E 2BYAX 4O03A 1IQJA 4ABAA 1WV7H 3RXEA 5C5NA 4U30A 1B0EA 5FXLA 4A1VA 1XUIA 5DG6A 4Q2KA 5BRRE 4JYUH 2BDCA 4I8HA 2W5EA 4WMEA 5B6OA 4ISNA 4FUBA 1A0HB 1LPKB 1O2HA 1SL3A 2C8YB 2OXSA 4I32A 1MBMA 1CA0C 1S6HA 3KF2A 1ZMJA 4ABFA 1YP9A 4AORA 4I8KA 1F2SE 1UTPA 1B5GH 1YPGH 2TGTA 1MTNB 3P8GA 4Y8XA 1O2OA 8GCHF 5DP4A 3S69A 5ETXA 3ZZ9A 2CJIA 1AZZA 3BF6H 1KYNA 1QL7A 1GI5A 2D2DA 3PWBA 1GJ4H 2BOHB 2AGGX 2ODPA 5EW1H 3DHKH 1GBTA 1QRWA 3GY5A 1H9HE 2BMGB 2PGBB 1O5AB 1OWKA 1WYKA 4UFGH 2P3FH 4LZ1H 2Z3CA 4OS2A 3ATMA 1QGFA 3T5FH 1NFYA 5DK1A 3E91A 3QX5H 4ABEA 1O3GA 1DY9A 2AS9A 1C2IA 1O2RA 1XXFA 2G4TA 3OSYA 1KIGH 4H42U 3A80A 2ZCHP 1ZMLA 3TGIE 3NK8A 4JK5A 4WWYA 1GI4A 1HIAA 1DM4B 1LVBA 4X8SH 1N6XA 5HXFA 1BBRE 2FOCA 2TGDA 2B7DH 1P2JA 1G3CA 5A0BA 3AASA 2ZU2A 3B9FH 5FX5A 3RUOA 2GCHG 1GJAB 1O5CB 1TGBA 1ELBA 2A5KA 2HGTH 1W3CA 1W0ZU 1C1UH 4FUDA 2P3TB 1Y3WA 1AE5A 2J9NA 3KNXA 1C5TA 3BN9A 3KQCA 3SU2A 1LHGH 3P8NA 3QDZB 2ZCKP 2ILNA 3JZ1B 2VIOA 1YLCA 2V0BA 1TQ7B 2QCYA 2FO9A 2XBWA 3Q3YA 1AFEH 1P2KA 1HAXB 1HJ8A 2F9NA 1V2PT 2GDDA 2Z3EA 4X2VA 1O35A 2FX6A 5EGMA 1HAZB 4AYVB 1VR1H 1DDJA 2ZDAH 1OS8A 3PYHA 1O31A 1GWAA 2XBVA 5EQQA 3DFJA 4YM9A 1LHFH 3G01A 3SGQE 3TJNA 1Z6JH 1TQ0B 3PMBB 1QJ6B 1Z8JB 1LVYA 2FOFA 4MPVA 1BMNH 2NU3E 2R2WU 1T32A 3LGYA 3UQVA 2J2UA 3U8OH 1DPOA 1O2YA 1EB2A 5ABWA 1GDQA 3FAOA 1OSSA 1C5QA 5T6FA 3LKWA 3TK5A 1AWHB 3MOCA 1WTGH 3A83A 1UTOA 2ZWLH 2OBOA 1ANBA 1A5GH 5LGOA 1C5PA 4DVAU 1O3HA 1P10A 3HPTB 1KLTA 1RD3B 5FBIA 3RP2A 2VU8E 3K2UA 4U2WA 3LC3A 2D8WA 4RKOB 3SQHE 5AFZH 1ELCA 2F9BH 2ANMH 4Y76A 3L33A 5F8TA 3PMHB 2FI4E 3GY6A 1UTMA 2G81E 3FP7E 3PTNA 4CRBA 2HPQH 2FLRH 2GV7A 1EZQA 1YPLH 4DW2U 1HPGA 1V2QT 5LPRA 4SGAE 4UFDH 1E37B 1A7SA 1SGYE 1NPMA 4WF8A 2SNVA 3DA9B 1ZRBA 3DUXH 1P04A 1GMHF 1MU6B 1UVOA 1ELVA 2BLVA 2CF9H 2VVCA 3ZV8A 1Y3XA 2VJ1A 2QF3A 1F7ZA 2B5TB 2WPIS 1WUNH 1IQEA 2XCNA 3BTGE 4WMDA 1GDUA 3QGNB 1VJAU 1BQYA 1PQ7A 1YGCH 1GBAA 1JRSA 2P16A 3SQEE 1EXFA 6CHAB 4B73A 1AVGH 4FUEA 3MO3A 1ARBA 5GDSH 1W8BH 2JETC 2XC0A 2VWLA 2Z3DA 1UHBB 1FY8E 1FY4A 1QR3E 1NT1A 4AG2A 2Y7XA 1SI5H 1GBBA 3VXEH 1XUJA 3PLBA 5EU8A 2F9UA 2BY9X 1BIOA 1D6WA 1NY22 1SGPE 2BX3A 3OU0A 3DD2H 2F9OA 2P3UB 2Y5GA 1SG8B 3SNEA 5DPAA 1A1RA 1OKXA 3P8OA 2A31A 1HAVA 2PGQB 1ZHMA 1SOZA 2RA3A 2FEQH 3GDVA 3UWJH 1FDPA 1T7CA 1S5SA 3PMAB 4BANB 2HNTC 3LGIA 2XW9A 1SGTA 3SNDA 1FIZA 2WPKS 3GYMA 3Q3XA 1C5NH 3SNCA 3S0NA 2ANYA 1VITF 2AGEX 1ELGA 5E0HA 3QLPH 1LHEH 4BAQB 3A7WA 3MO9A 4FU8A 1NRRH 1M9UA 2UWLA 1CT4E 4ZKOU 4I31A 3ZVDA 2BQ7B 2ZPSA 3SV8A 1DSUA 5FPTA 1PFXC 2ZI2H 1GDNA 3BSQA 3MNBA 4NZQA 1C2HA 3H7OA 3P6ZB 1PQ5A 2PTNA 1MQ6A 3SU0A 3SGAE 4O3TA 3RXHA 2FI3E 3OX7U 4K5ZA 2FP7B 3ZYDA 1V6DA 3RXOA 4D76A 1C4U2 4B76A 2R2MB 2G51A 1A46H 3EAJA 4I8JA 5K0HA 3UUZA 4AFQA 1HB0B 2HALA 4FU9A 1WAYB 2ODYB 2OBQA 4GVUA 1QA7A 3M7QA 1QQ4A 3LGWA 1WTHD 1C5OH 3SUDA 1HDTH 2A0QB 5CHAC 2BD2A 3KQDA 4ABIA 1NU9A 2O8WA 1HJAB 2BM2A 3FVFB 5C1YA 2G55A 4CHAB 1DSTA 2A4GA 4TY7A 3K6ZA 3PO1C 1C5WB 2BD3A 2BY6X 4VGCB 1QQUA 3BTDE 4NWKA 2I6QA 1LKAA 2Q6FA 4ZKRU 3BTEE 3UR9A 3S7KB 3RXUA 3STIA 2FM2A 1YLDA 3F1SB 1P57B 1C1WH 1T8LA 1V2RT 3LH1A 4JK6A 1EOLA 1L2EA 1Z6EA 3NXPA 2R3YA 1EPTC 1QL9A 2GV6A 2Y82A 1W14U 1GBFA 1P2NA 1J14A 2ZDMA 1GJBB 1O3PB 1PQAA 1SR5C 4ZKSU 1F5LA 1NTPA 3ZZBA 1T8OA 4MLFB 4TPIZ 5GXPA 3O8BA 1GHXH 1MMJN 1SQAA 3RU4E 4A7IB 5ESBA 1EOJA 1ZOMA 5J4SA 4Y7BA 3LC5A 5G4BA 3OTJE 1V2NT 4NWLA 2ZCLP 1O2NA 1OP0A 1OWEA 2ZQ2A 3U98H 1GG6C 3ZVGA 3RDZA 2BLQA 2WPHS 2EA3A 4MPWA 5GCHF 4MPUA 2ZTYA 3AAVA 4JMYA 1XUFA 4MNYA 2ZHFH 2BY7X 1GBHA 4XE4A 3RLWH 1W11U 1EPTB 5DJ7A 1S0RA 1NRPH 1K22H 2SGAA 3LJOA 2UWPA 3AAUA 5EODA 2XCFA 5LPFA 3E16B 2Y80A 1BRBE 1E38B 1J9CH 5L6NH 1GHAF 1VCWA 2KAIB 1AFQC 2BHGA 4X2WA 3T2NA 2XNIA 1TNKA 2ZFSA 1NFUA 1LDTT 4CREA 2GDEH 1GHAG 1SGRE 4D9QA 3VB4A 1GG6B 2PFEA 3QTOH 1YPEH 3O8CA 1GHVH 4NFEA 1FMGA 1NFWA 1UVPA 1AHTH 1L1JA 1G3EA 1THPB 3ATIA 3SN8A 5BPEA 3MHWU 1SLVB 2ZQ1A 2Z6BD 5HGGA 1ID5H 1P9SA 1GJ9B 3RU4T 3TNSA 4FVBA 5DKMA 1FY5A 1LHCH 1AN1E 2FX4A 3P8FA 1EZXC 4ESTE 1EAWA 5C1XA 2JH6D 5EOKA 3S9BA 4X8UH 5L2YH 1CSOE 4NA9H 3D65E 1GHYH 4AB9A 1BMMH 2W3KA 1W13U 4BTUB 1O37A 2BDIA 4FUHA 3B23B 4MNVA 1SGCA 4NIYA 1EAXA 4TWYA 4E7NA 1EUFA 1BB0B 1W10U 2QXJA 2HRVA 1W12U 1U6QA 1KXBA 4AFSA 1MKXK 3NZIA 2ZA5A 1K1JA 2JH0D 1V2UT 1ZJDA 3PV4A 2P59A 1FONA 1XVMA 2FTMA 4F49A 2CHAC 3U8RH 1O3OA 1LKBA 3SJOA 1V2OT 4ABBA 1C2FA 3ATKA 5FCRA 3M37A 4Y8ZA 2QF0A 1HXFH 1UK4A 1DITH 1T31A 1MTUA 2UUJB 2RCEA 3E8LA 4CR9A 2G52A 4X1PU 2AEIH 3EYDA 4BTIB 2ZGCA 1SC8U 3RXIA 4AFZA 2ZDKA 5HMAA 5E8EH 2PSXA 2F91A 3K6YA 2ASUB 3RXQA 4ASHA 1ABIH 3ZZCA 2QN5T 1FPHH 2A7HA 3GY7A 1N8OC 1N1LA 2HWLB 3KIDU 3RXVA 2FESH 2ZGBH 1QCPA 2EI7A 1FAXA 2ZFPH 1Y3VA 1ZLRA 2ALVA 1V2WT 2PKAB 1A5IA 2BDAA 2C90B 5HM2A 2FS8A 4F4OC 2NU4E 3SJ8A 1Z8IB 2TBSA 5EQSA 1AI8H 2ZHEH 1P2MA 2ZC9H 3SJ9A 5DP6A 3M5MA 1W0YH 5AF9H 1DE7H 1ORFA 1PPGE 2GZ9A 1JMOH 2ZTXA 2FODA 1O3IA 4UDWH 4DT7B 3QN7A 1J16A 4GLYA 1GGDC 2OQUA 3PTBA 1BTWA 4ZH8A 3M61U 1QURH 1YPKH 1PPZA 1IAUA 1HAVB 1UVUH 4ABJA 1SFIA 2VWMA 1GI6A 1AKSA 1G36A 2FWWA 1P9UA 1O3LA 1K28D 4GUXA 1O30A 2R9PA 1RIWB 2FOAA 1AVWA 4HI3A 1Z7KA 1UO6A 1WQVH 5A8ZA 1C2DA 2ZFRH 2QXIA 2G00A 5GPIB 1NRSH 1FXYA 2BXTH 2J38A 4R8TB 3BV9B 3M5LA 3E6PH 4Q7ZA 1KLIH 1G2LA 4AGJA 2OINA 4DIIH 4KP0A 5A09A 1BITA 5LPEA 3ZZ7A 1C1OA 1O39A 5JB9S 2H9EH 2JH5D 2HLCA 1GBMA 3TJOA 1AB9C 3SGBE 1NROH 1TMBH 1ZSKA 1QB9A 1ESBA 1GPZA 3RXSA 2FOGA 2O9QA 1GI8B 1ANCA 1GJ8B 1W7XH 4GAWA 1ARCA 1LPGB 1JOUB 1L1NA 4B2AA 2OD3B 3BG4C 4OS7A 1EB1H 2XBYA 1CA0B 4FU7A 1PPCE 1YCPH 5CMXH 2W26A 3AVZA 1NM6A 1SVPA 1E35B 3A8DA 3H5CB 1BTZA 1G3BA 1LCYA 4WH6A 3SUFA 1DWCH 1EAUA 1AE8H 3RMNH 4I33A 1GBLA 3I77A 3GCHC 2SGQE 1BJUA 3VPKA 1V2KT 2GCHF 1HNEE 2VH0A 3SV6A 2VIDA 1SMFE 1H9LB 2XRCA 2D1JA 1HAGE 2VWNA 5C1UA 4ZHMU 1BDAA 4HZHA 3EA7A 3M5OA 2PHBA 5IDKA 1E34B 2D26C 2VNTA 3P92A 3F9HA 3P70B 2QYIA 3TJVA 2PR3A 1PPFE 1YPJH 2ZTZA 3T29A 1LVOA 1AY6H 1O2LA 5JDUB 3MNXA 1HV7A 1C9PA 2C8WB 4KELA 1SSXA 2GCTC 4Y11E 1AZ8A 1DVAH 2HNTE 1WQSA 2FYQA 3RXGA 3TNTA 1EPTA 1ZGIA 1KTTB 1YC0A 1Q2WA 1ZGVA 1H1BA 2R0LA 1UCYK 4AGKA 5JBTA 2KAIA 3VFEA 4DJZB 2A7CA 2VIWA 4FUJA 1ZHRA 1CE5A 2GP9B 1QIXB 4B74A 1B0FA 1OPHB 2IJOB 1TPAE 4IMQA 3T28A 4MNWA 1RTFB 2ZNKH 4FXGH 2TGAA 3Q76A 2YNAA 2VVUA 4ZXYH 2WPMS 2EC9H 1Z8GA 2FLBH 1Q3XA 2PW8H 1KXFA 4MG3A 2Y5HA 4X1NU 4WH8A 4GCHG 3OY5U 2BZ6H 1T4UH 2IPHA 1C2LA 3JZ2B 4H6SB 3UNQA 3NWUA 3BIUH 4X6MA 2BY5X 2BD9A 2GD4B 1K1LA 1S84A 1JIRA 1GHZA 4TY6A 2BD7A 1TGSZ 1MKXH 4WY3A 1HAHH 3MU4A 1UVSH 4K8BA 2RA0A 2BD4A 2PKSC 1O2WA 1H8DH 8ESTE 4U01A 5JBCS 4INLA 3ZZ8A 1MBQA 3ZYEA 4E06H 1NU7B 5T6DA 1Y8TA 4DURA 1O2SA 3KQEA 1H4WA 1ZTKA 4MQAA 1SQTA 3OY6U 5A0CA 1SGQE 3BEFB 1P3CA 4TWWA 1NFXA 4XFQA 3VGCC 2A2XH 2OCVB 1DFPA 1JBUH 2VIPA 4NSVA 1UTQA 1IQHA 1AVXA 4NIWA 3ITIA 2AIPA 4Y79A 1A0JA 1GI0A 1PPEE 1SGDE 4H6TA 1WOFA 4NCYA 3RXFA 1BBRK 1P3EA 4ISHH 2ZPRA 1T8MA 1MKWK 2JKHA 3BG8A 5EQRA 3HGPA 1K1OA 5L30H 2WV4A 1GHWH 2ZU1A 4D9RA 1F0RA 3T25A 1ACBE 1BTYA 1FI8A 3RM0H 2DE8A 3GY3A 3F9GA 3RC5A 4NIVA 1SGFG 1TYNA 1C9TA 1A0LA 4ZMAH 3UOUA 3MNCA 3A7TA 2UUYA 2BX4A 1G9IE 3GCNA 1TAWA 1VCQA 1P09A 2OQ5A 1O2QA 1LQEA 3RU4D 3GY8A 2G8TA 1GVKB 2PKAA 3FANA 1P02A 3ZZ4A 4ZUHA 1AU8A 1GHBG 4KKDA 3SHAH 2BDHA 2Z94A 4Z6AH 3GY4A 1TGTA 2Z9KA 1J8AA 3K9XB 3MO6A 4GSOA 1TX6A 2ZP0H 3LPRA 1GI9B 1KTSB 4IMZA 4K1TA 1NS3A 3P95A 4IN1A 3MTYA 1O2IA 7GCHG 3E3TA 2VVVA 3LONA 1UTJA 2P94A 1V2MT 2QXHA 3MU1A 2XYAA 1ZSLA 4X0WU 3LGUA 5DP9A 2AERH 2BB4A 3GCTF 1ZPZA 1CA8B 1VGCC 4UONA 1PYTC 3ODDA 1QNJA 2ZU3A 1KDQA 1TRNA 1C5MD 1DXPA 4MPXA 1GJCB 1LHDH 1MD8A 3BEUA 3A8BA 4ZKNU 1O2VA 2NU1E 3GCTG 3RXKA 4Y6DA 1ZZZA 1GMDG 1BCUH 2C3SA 1AD8H 3SV9A 4OGXA 2ZHWH 2JETB 1OWHA 1O2ZA 2H2ZA 1TOCB 4X6PA 6GCHF 5JPMH 2B9LA 1RTKA 1H8IH 1LQDB 5E2PA 2G4UA 3RXMA 1EZSC 1LTOA 6GCHG 1V2JT 3EA9A 2Y7ZA 3C27B 1VGCB 2W3IA 3BTTE 4CH8B 1ZPCA 1SGEE 2AIQA 1N6YA 1IQNA 2W7SA 4O9VA 4A1TA 2ZKSA 4Y0ZE 3ZVBA 2SNWA 1BTHH 1JWTA 1Y5BT 4X8TH 1AKSB 4IC5A 3A86A 1TPPA 3LGTA 4YO9A 4B2BA 1TA2A 1KLJH 2GMTC 1O3MA 1QA0A 3MH6A 1IQMA 1MTSA 4MVNA 1RFNA 3SNAA 1ANEA 1GVLA 1GL1A 1K1IA 2ZZUH 4NIXA 1GCDA 1ZR0A 3F68H 5EXLA 4DOQA 2ZU5A 4IS5A 4RSPA 1J15A 1YPMH 1K1MA 5AFYH 1HFDA 1O3JA 3I29A 1EX3A 3RC6A 2IOTA 1BZXE 1IQGA 4JCNA 2WV5A 2XBXA 1SBWA 5TJXA 3MMGA 3MH4A 1YM0A 2BOKA 2CV3A 1T8NA 4Z0KA 3GOVB 2ZGJA 4M7GA 1TMTH 2QAAA 4I8GA 5FPSA 2TGPZ 2ZPQA 3UFAA 3A85A 3V12A 1WU1A 4JZEH 1UCYH 2BD8A 4YOGA 3VB6A 3SOSA 1C1SA 3P17H 1HGTH 3HK6B 4NZLA 2QV1A 3QO6A 4Q80A 3U1JB 1KY9A 2IN2A 1TA6A 3UNSA 3A8CA 1O32A 5CHAB 1CU1A 5E0JA 3LDXH 1GMCG 4X2XA 4Q7XA 1TLDA 4A92A 1P2QA 4ISLA 1O3KA 3NKKA 4X8VH 5FCKA 2AMPA 4K60A 1TPOA 1DXWA 1QRXA 3VXFH 1XUKA 3BTWE 4YOJA 1RXPA 1O34A 1O3EA 4XSKU 4IW4E 3PO1B 3QWCH 2XC5A 1MD7A 3SJKA 5SGAE 4X1QU 3V3MA 1C5XB 1TBRH
chains in the Genus database with same CATH superfamily
5C94A 5FPYA 1OX1A 1RTLA 3RMOH 2BZAA 1TE0A 1XKAC 4ABHA 2STAE 2Z9IA 4UE7H 1S81A 2WUBA 8LPRA 3M3VA 4GHQA 1MABB 2Z7FE 2KR7A 4B1TA 2EI8A 2FMJA 3CS0A 3Q00A 1P05A 3OEED 1F0UA 2QA9E 3KCGH 1HUTH 3UIRA 4K8YA 3MQKC 1C5VA 3F9EA 2J4IA 2F83A 4D8NA 2AHME 4WXVA 5J4QA 1S6FA 4DY7B 3CP7A 4KTCA 1BBRH 1YBWA 2KM0A 4OS6A 5AHGH 1P12E 2QY0B 1XVOA 3ENSB 1GBCA 1MKWH 5A8XA 4GPGA 3MNSA 2F3CE 1C1MA 1UK2A 3UTUH 1C5SA 1O2KA 1A61H 3OYPA 3O8DA 2VH6A 2OC1A 1Y5UT 2YMSD 5C67A 1O2XA 2J95A 4K3JA 1SGNE 1UTNA 1JIMA 1FPCH 3RMMH 2V7QD 3E0PB 3V7TA 1BRAA 4R0IA 1QBNA 2GZ8A 4AB8A 1EJNA 1SB1H 3MWIU 1RGQA 1QFKH 2TPIZ 2SFAA 4UEHH 3PLKA 4DGJA 2ZDVH 2C8XB 1C5RA 1AFQB 3H7TA 4NA8A 4NGAH 4BXSA 1SPJA 4IGDA 2XC4A 2SGEE 5C5OA 4UFEH 1OWJA 4WJG2 3EE0B 4LZ4B 1TRYA 1TABE 3KHVA 3GYLB 4O97A 4SGBE 1BMAA 4ABDA 1IHSH 2ZFQH 2YNBA 1PQ8A 2WUCA 4AOQA 3E1XB 4X2YA 2FYRA 3KGPA 4U32A 2PLXA 5EXNA 4E05H 4J1YA 2AMDA 4YLQH 1QZ8A 1TNLA 3AW0A 2OP9A 3VB7A 3SJIA 2K1QA 1IQIA 1GI1A 1GJ7B 3SUEA 3DT0H 4WXIA 2G5VA 3A7YA 3URDA 1PYTD 4X6NA 1RRKA 1P2IA 3TGJE 1DLKB 2G5NA 3UY9A 5DN6D 1ELEE 4CBOA 4JZDH 2WINI 2OTVA 3A84A 4YTAA 1UVTH 3FZZA 1FAKH 1DOJA 2P95A 3ESTA 1A3EH 1ELDE 4PROA 1MCVA 1ZPBA 3STJA 3A87A 4E7RG 1OWDA 1D3QB 1ABJH 3FP6E 1EAIA 1F0SA 3TH2H 3SU5A 1TWXB 3QUMP 3CENA 2SGPE 3A82A 3C1KA 3B8JA 2M5TA 1FY1A 1C5YB 2NWNA 5EPYA 2ZECA 2CHAB 1CVWH 5E2OA 1GI3A 3PMJA 4LK4A 3TU7H 5F03A 1T4VH 9ESTA 2R3UA 1FJSA 2BQWB 1BRCE 4KGAA 3ZZAA 4DG4A 1W0JD 1X7AC 4Z1MD 3UPEA 1XUGA 1CQQA 2V35A 1LVMA 1VITH 2FS9A 2WPJS 1BA8B 1HYLA 1G2MA 5GWZA 1S85A 1N8OB 1MTVA 2O8TA 4I7YH 1BRUP 3NRLA 5C3NA 2ZU4A 1KDQB 3MU8A 5FX6A 1D6RA 3RXTA 1FUJA 2PV9B 2ULLA 2VWOA 3IG6B 4BTTB 5L2ZH 4ISOA 1WSSH 1E0FD 4THNH 3TH4H 4NSYA 2JJ2D 1Z1JA 3MI4A 1RS0A 1TNGA 3LGVA 2EY4C 1SGFA 2V6NA 1MTNC 2LNCA 3N7OA 4RT0A 4FUFA 2GGVB 2H6MA 3UNRA 1ZJKA 1YF4A 3L3TA 1GCTC 2A45B 1MAXA 1BT7A 1GJ5H 3S9AA 1GGDB 4RN6A 4A6LA 3RXLA 3EE7A 4YZUA 1AWFH 5GIBA 1DWBH 3RM2H 2FOHA 2XTTB 1GL0E 3ATWA 1UCYE 3GDUA 1C1TA 2CGAA 4Y71A 3ZZ6A 2VB0A 4WVPE 1HXEH 1O38A 1TRMA 1V3XA 3PROA 4YESB 2ANWA 3V0XA 1CGJE 3HKJB 3MH7A 1IQKA 2PP6A 2PWXA 3LOXA 6LPRA 5EG4A 2ODQA 4Y0YE 4KTUA 2BDYA 3TK6A 4Y10E 2V3HH 5DP3A 1G32B 4JZFH 2AMQA 3D49H 3M7TA 1EZUC 1D9IA 4BOHA 1ELAA 1H9IE 2C4FH 1GCTB 3SU3A 1ZMNA 2BTCE 1AUJA 1EATA 1ZRKA 2BVRH 2J92A 2R0KA 4ZHLU 2BD5A 2C8ZB 3QZRA 8GCHG 2KCYA 5HYOA 5JYIA 4M9FA 2GVFA 3BTQE 4ZROA 1C4V2 2PUXB 4BNRA 2QE7D 1AB9B 3RXPA 1MZAA 1EP6A 1ELTA 1TX7A 4FUGA 3UREA 4CRDA 1L4ZA 1AGJA 1C1QA 3O8RA 5DP7A 3SUGA 3PB1E 1CBWC 3KQBA 2LP6A 2AFQB 1TX8A 2ZDLA 2CXVA 1OYQA 2OC8A 5I25A 1BTXA 1TBQH 2ALPA 2KZ4A 5A0AE 3BG4B 1DWEH 2Y6TA 4NG9H 2FZZA 1DICA 1JRTA 1UK3A 1SHYA 3TPIZ 2FOMB 3PWCA 2WZQA 3M3SA 1TFXA 1TNIA 2QGRA 3T62A 3U1IB 2OC7A 3PRBA 4D7GA 3E0NB 2ZIQH 1OYTH 2BVSH 1Z71A 4J2YB 1MCTA 2QF5A 2XWBI 3ATLA 5EXMA 4A5TS 5DP8A 1HAPH 2PTCE 3GCHB 4OS5A 1PPBH 2Q1JA 4IC6A 3RXBA 3RXRA 1TMUH 3N99A 4FVDA 1CBWB 2YOLA 3URCA 1MQ5A 2A4QA 2BLOA 1L1GA 2IPQX 3SI3H 3FZDA 2RDLA 3N7DA 1QL8A 2ZO3H 1C4Y2 1O2PA 2UWOA 3K65B 4ACBA 2XOKD 1JXPA 5GJ4B 1K9OE 2I6SA 1HJ9A 3ZZDA 2VIQA 4GCHF 2Q6DA 5C20A 4NA7A 1O36A 1O0DH 1QTFA 2JJ1D 1LMWB 2BVXH 1CT0E 3IWMA 1P0SH 5FBEA 1KXCA 2H9HA 4AN7A 4AYYB 2GCTB 4AG1A 1EJAA 1GI7B 1KXEA 3S9CA 2PSYA 1C2EA 1MU8B 1YPHC 1BTUA 3T26A 2ZEBA 3OTPA 3AK5A 1C5ZB 1NRQH 1VCPA 1EQ9A 1C1VH 1P06A 4RKJB 2A5AA 4XBBA 5TCCA 3BEIB 4MTBA 1C2MA 5ESTE 3TH3H 3GCOA 1EFRD 1ELFA 4YOIA 2A4RA 1THSH 4O3UA 1K1NA 2OLGA 2RG3A 3U9AH 3ZVEA 2XXLA 3GS9A 2THFB 4BAOB 2ZFTA 1ETTH 2O8LA 6ESTA 4CRFA 1O5BB 3LH3A 2H9TH 3FN8A 1TALA 9LPRA 1OP2A 1TBZH 1DY8A 2HNTF 1P11E 2FPZA 3GICB 3SZNA 3MU0A 3RXAA 7KMEH 5FHTA 4TT3D 5DP5A 3RLYH 2NU0E 2FTLE 2ZGXH 1ZYOA 1QY6A 3ZVCA 1CO7E 3M5NA 2A1DB 2PKSB 2EI6A 3OE7D 1GBDA 2FIRH 3A7XA 1V2ST 4IBLH 1O2UA 4BAHB 1O33A 1HAIH 4ZHAA 1C5UA 3IITA 1EP5A 2DE9A 4ABGA 3LJJA 4HFPB 1BJVA 6CHAC 1A2CH 3VGCB 2K0QA 3F9FA 1NESE 2OK5A 1GHBF 3W94A 4FUIA 4LOYH 1D3DB 1GJDB 2QXGA 1XXDA 8KME2 3TIUA 5F53A 1HAOH 1NN6A 4Y7AA 7GCHF 1WBGB 2F9VA 2WYJA 3SBKA 1GMHG 4CRGA 2Y81A 4QT8C 4H4FA 1TONA 3DSOA 3QK1A 2QF4A 3ODFA 2FOBA 1NC6A 1SGIB 4CBNA 3UQOA 2AGIX 2C93B 1EASA 3F6UH 1FN6A 1AQ7A 1GMDF 1TOMH 1HCGA 1V2LT 3TGKE 3Q77A 4X1RU 3EGKH 1INCA 3WW7A 4FUCA 1BTPA 1GBKA 1C1NA 3PLPA 2Q6GA 1P8VC 2UUKB 5K7RA 1KXAA 1DANH 4TPYA 1DUEA 3NUMA 3A8AA 4IN2A 4YT7H 1O5FH 1SHHB 3SI4H 2VGCC 3FP8E 4LXBH 1F0TA 1DX5M 1O2JA 3U69H 3LU9B 5F6MA 2LPRA 2SGDE 2ZHQH 3M35A 3TJUA 1GBEA 4YT6H 3M36A 1L4DA 2H1UA 3VB3A 1P01A 4D7FA 3SO3A 1K21H 3ZVFA 3ZV9A 5TCAA 1W2KH 3VEQB 1SLWB 3MFJA 1TNHA 1AO5A 1AIXH 1F5RA 1Z8RA 1IOEA 5CE1A 2CK3D 4BXWA 2VGCB 2H5DA 3M7UA 3FFGA 7LPRA 1UMAH 3DFLA 1S0QA 5PTPA 1O3DA 4OGYA 2ZHDA 5H4IB 3SORA 4DCDA 5I46H 1SLUB 1TNJA 1SLXB 4K1EA 1OOKB 3RXCA 1E1RD 1OWIA 2P93A 5AVDA 1BHXF 1VITG 4CR5A 3SV7A 4KTSA 1O3CA 1BMFD 1O2MA 3CS7A 2GT7A 4ZAEA 1ETSH 1CGHA 5KGOA 1VKYA 1A4WH 2V3OH 3GY2A 2OC0A 4A1XA 2A4OA 1J17T 1CHGA 1UJ1A 4YLUA 1NO9H 2Z9JA 2VIVA 1HJAC 3SU6A 3Q3KA 4B2CA 3EA8A 2BDBA 4CHAC 1FV9A 3L6PA 1O3FA 2FDAA 4B71A 2O8MA 4BAMB 3BTFE 1HBTH 2HVXA 3U8TH 4VGCC 1XKBC 2GMTB 3ZVAA 4JYTA 3EDXB 3A88A 5EJ1A 1O5EH 1ESTA 4BAKB 1QJ1B 1TPSA 2J94A 1DT2A 1D3TB 2QIQA 1GBIA 1P2OA 1EKBB 1UTLM 4ISIH 4JZ1A 5A8YA 1C5LH 2J34A 2ESTE 3TLOA 1G30B 1MTWA 4INKA 5HIYA 2ZGHA 4HTCH 1GMCF 3QZQA 4XDEA 2CF8H 1GJ6A 1FNIA 4OS1A 1E36B 1BUIA 1UTKA 2ZG0H 2A32A 3TK9A 3W95A 1TB6H 1F92A 1XUHA 2B0FA 2FI5E 3SNBA 1L0ZA 1O3BA 1O2TA 1MH0A 2GKVE 1NZQH 3PM3A 3GDSA 3A81A 3HATH 3UR6A 5C2ZA 3FOAA 4AFUA 1F5KU 1Q31A 1MUEB 1V2TT 1A5HA 2BLWA 3D62A 1FQ3A 2WSSD 1ESAA 3S7HB 3A89A 3BTKE 1Y59T 4CRAA 1Z1IA 1GI2A 2HPPH 4HGCA 1WCZA 1O3AA 3R0FA 1MZDA 1HIAB 3NCLA 4MDSA 1YCPK 1QJ7B 3V13A 2AH4X 1LO6A 4B6EA 1FY3A 2AYWA 4AX9H 2W7UA 5T1VA 3AW1A 1OXGA 1YKTA 1CHOF 5EW2H 1NRNH 3SW2B 4XBCA 3MYWA 2BY8X 1BHXB 2DUCA 2F4LA 1HLTH 1TGNA 1P03A 2TIOA 2BXUH 4XOJA 1Y3UA 2BDGA 1SQOA 1FN8A 3LIWA 2GT8A 3H09A 4UFFH 1CHOG 1O5DH 3E90B 2Z9GA 5GCHG 1Y5AT 1ZSJA 5E0GA 3HKIB 3BTME 3RXJA 4WMFA 2GX4A 1VZQH 3M3TA 4TYDA 5F8XA 3F0PA 4JYVH 1D3PB 5LH8A 1FIWA 1S82A 1YCPM 1C1RA 1QBOA 3ZZ5A 4INHA 3SHCH 5IYTA 3ZZ3A 4XBDA 2OUAA 3MH5A 1V2VT 1W7GH 2FOEA 1QHRB 2GTBA 2GZ7A 4AZ2B 3F0OA 2O8UA 5EPNA 3VB5A 3SU1A 3KL6A 1QB1A 2STBE 3PV2A 3KN2A 1BOQA 1HAYB 3D23A 2P8OC 2WYGA 3SZEA 4X6OA 5A2MH 3UWIA 1C2KA 3RC4A 1ANDA 1HRTH 4I8LA 1C1PA 1RJXB 3NPSA 4MNXA 4OS4A 7ESTE 5HM9A 2TRMA 3QTVH 1QBVH 2SGFE 3SU4A 1EJMA 2WPLS 5DO4H 2KFWA 4X1SU 3WY8A 4GHTA 2VINA 4K1SA 4DIHH 3R3GB 1YYY1 3A7VA 1ZTLA 1DLEA 5JBAS 3ELAH 1TIOA 2HOBA 4NFFA 2Y5FA 2ANKH 5FAHA 5JB8S 1PPHE 1DUAA 5T3HA 3BTHE 3KEEA 1KXDA 1IQLA 1THRH 1C2JA 2CMYA 1ZTJA 1O2GH 2Z9LA 2P8OB 1QB6A 4B75A 2ZFFH 5DGJA 1SOTA 1D4PB 1UHBA 1YWUA 3WWBA 1S83A 1C2GA 2PUQH 1QRZA 1IHTH 1O5GH 1VJ9U 1G3DA 2J5UA 2A7JA 5F8ZA 2KCPA 4UD9H 3TITA 1Y3YA 2CN0H 2UUFB 3RMLH 3TVJB 3T27A 1XX9A 1FLEE 4JZIA 4Y8YA 1B7XB 1CT2E 1DWDH 4Q7YA 1FZZA 4CH2B 2XWAA 4K2YA 1GVZA 1KSNA 2ZF0H 1A3BH 3LT3A 2F9PA 2HLDD 3KQ5A 3SV2H 1YPHE 1DS2E 2EEKA 3I78A 5T6GA 1MAYA 1IQFA 2H5CA 1ZHPA 3HGNA 1TGCA 1RIWC 2A5IA 3QGJA 3GISB 1AUTC 1CGIE 1AMHA 5EIYA 1OP8A 1G37A 3EQ0H 1GBJA 1XM1A 1LPZB 2BQ6B 3MU5A 4CRCA 4K69A 1PJPA 3RXDA 5EJZA 1BMLA 1SFQB 2QC2A 2B8OH 1O3NA 1K1PA 4ZXXH 2FXRA 3HK3B 3A7ZA 3UOPA 5JBBS 2ZDNA 3UAIC 2A2QH 1XMNB 1ETRH 1K2I1 3BIVH 2NU2E 5C0TA 3FO8D 2BYAX 4O03A 1IQJA 4ABAA 1WV7H 3RXEA 5C5NA 4U30A 1B0EA 5FXLA 4A1VA 1XUIA 2XNDD 5DG6A 4Q2KA 4Q63A 5BRRE 4JYUH 2BDCA 4I8HA 2W5EA 4WMEA 5B6OA 4ISNA 4FUBA 1A0HB 1LPKB 1O2HA 1SL3A 2C8YB 2OXSA 4I32A 1MBMA 3U28C 1CA0C 1S6HA 3KF2A 1ZMJA 4ABFA 1YP9A 4AORA 4I8KA 1F2SE 1UTPA 1B5GH 1YPGH 2TGTA 1MTNB 3P8GA 4Y8XA 1O2OA 8GCHF 5DP4A 3S69A 5ETXA 3ZZ9A 2CJIA 1AZZA 3BF6H 1KYNA 1QL7A 1GI5A 2D2DA 3PWBA 1GJ4H 2BOHB 2WPDD 2AGGX 1H8ED 2ODPA 5EW1H 3DHKH 1GBTA 1QRWA 3OFND 3GY5A 1H9HE 2BMGB 2PGBB 1O5AB 1OWKA 1WYKA 4UFGH 2P3FH 4LZ1H 2Z3CA 4OS2A 3ATMA 1QGFA 3T5FH 5IK2D 1NFYA 5DK1A 3E91A 3QX5H 4ABEA 1O3GA 1DY9A 2AS9A 4F55A 1C2IA 1O2RA 1XXFA 2G4TA 3OSYA 1KIGH 4H42U 3A80A 2ZCHP 1ZMLA 3TGIE 3NK8A 4JK5A 4WWYA 1GI4A 1HIAA 1DM4B 1LVBA 4X8SH 1N6XA 5HXFA 2EQNA 1BBRE 2FOCA 2TGDA 2B7DH 1P2JA 1G3CA 5A0BA 3AASA 4ASUD 2ZU2A 3B9FH 5FX5A 3RUOA 2GCHG 1GJAB 2HVYB 1O5CB 1TGBA 1ELBA 2A5KA 2HGTH 1W3CA 1W0ZU 1C1UH 4FUDA 2P3TB 1Y3WA 1AE5A 2J9NA 3KNXA 1C5TA 3BN9A 3KQCA 3SU2A 1LHGH 3P8NA 3QDZB 2ZCKP 2ILNA 3JZ1B 2VIOA 1OHHD 1YLCA 2V0BA 1TQ7B 2QCYA 2FO9A 2XBWA 3Q3YA 1AFEH 1P2KA 1HAXB 1HJ8A 2F9NA 1V2PT 2GDDA 2Z3EA 4X2VA 1O35A 2FX6A 5EGMA 1HAZB 4AYVB 1VR1H 1DDJA 2ZDAH 1OS8A 3PYHA 1O31A 1GWAA 2XBVA 5EQQA 3DFJA 4YM9A 1LHFH 3G01A 3SGQE 3TJNA 1Z6JH 1TQ0B 3PMBB 1QJ6B 1Z8JB 1LVYA 2FOFA 4MPVA 1BMNH 2NU3E 2R2WU 1T32A 3LGYA 3UQVA 2J2UA 4XRNA 3U8OH 3KYGA 1DPOA 1O2YA 1EB2A 5ABWA 1GDQA 3FAOA 1OSSA 1C5QA 5T6FA 3LKWA 3TK5A 1AWHB 3MOCA 1WTGH 3A83A 1UTOA 2ZWLH 2OBOA 1ANBA 1A5GH 5LGOA 1C5PA 4DVAU 1O3HA 1P10A 3HPTB 1KLTA 1RD3B 5FBIA 3RP2A 2VU8E 3K2UA 4U2WA 3LC3A 2D8WA 4RKOB 3SQHE 5AFZH 1ELCA 2F9BH 2ANMH 4Y76A 3L33A 5F8TA 3PMHB 2FI4E 3F2GA 3GY6A 1UTMA 2G81E 3FP7E 3PTNA 4CRBA 2HPQH 2FLRH 2GV7A 1EZQA 1YPLH 4DW2U 1HPGA 2J97A 1V2QT 5LPRA 4SGAE 4UFDH 1E37B 1A7SA 1SGYE 1NPMA 1K0HA 4WF8A 2SNVA 3DA9B 1ZRBA 3DUXH 1P04A 1GMHF 1MU6B 1UVOA 1ELVA 2BLVA 2CF9H 2VVCA 3ZV8A 1Y3XA 1KMHB 2VJ1A 1FX0B 2QF3A 3DCLA 2YMSC 1F7ZA 2B5TB 2WPIS 1WUNH 1IQEA 2XCNA 3BTGE 4WMDA 1GDUA 3QGNB 1VJAU 1BQYA 1PQ7A 1YGCH 1GBAA 1JRSA 2P16A 3SQEE 1EXFA 6CHAB 4B73A 1AVGH 4FUEA 3MO3A 1W0KD 1ARBA 5GDSH 1SQRA 1W8BH 2JETC 4F48B 2XC0A 2VWLA 2Z3DA 1UHBB 1FY8E 1FY4A 1QR3E 1H8HD 1NT1A 4AG2A 2Y7XA 1SI5H 1GBBA 3VXEH 1XUJA 3PLBA 5EU8A 2F9UA 2BY9X 1BIOA 5KEDA 1D6WA 1NY22 1SGPE 2BX3A 3OU0A 4RI0A 3DD2H 5C0UA 2F9OA 2P3UB 2Y5GA 1SG8B 3SNEA 5DPAA 1A1RA 1OKXA 3P8OA 2A31A 1HAVA 2PGQB 1ZHMA 1SOZA 2RA3A 2FEQH 3GDVA 3UWJH 1FDPA 1T7CA 1S5SA 3PMAB 4BANB 2HNTC 3LGIA 2XW9A 1SGTA 3SNDA 1FIZA 2WPKS 3GYMA 3Q3XA 1C5NH 3SNCA 3S0NA 4ACAA 2ANYA 1VITF 2AGEX 1ELGA 5E0HA 3UB0A 3QLPH 1LHEH 4BAQB 3A7WA 3MO9A 4FU8A 1NRRH 1M9UA 2UWLA 4OM9A 1CT4E 4ZKOU 4I31A 3ZVDA 2BQ7B 2ZPSA 3SV8A 1DSUA 5FPTA 1PFXC 2ZI2H 3VG8A 2K8IA 1GDNA 3BSQA 3MNBA 4NZQA 5DSFA 1C2HA 5C17A 3H7OA 3P6ZB 1PQ5A 2V3MA 2PTNA 1MQ6A 3SU0A 3SGAE 4O3TA 3RXHA 2FI3E 3OX7U 4K5ZA 3WWFA 2FP7B 3ZYDA 1V6DA 3RXOA 4D76A 1C4U2 4B76A 2R2MB 2G51A 1A46H 3EAJA 2LELA 4I8JA 5K0HA 3UUZA 4AFQA 1HB0B 2HALA 3PV5A 4FU9A 1WAYB 2ODYB 2OBQA 4GVUA 4P02A 1QA7A 3M7QA 1QQ4A 3LGWA 5CDFE 1WTHD 1C5OH 3F2FA 3SUDA 1HDTH 2A0QB 5CHAC 2BD2A 3KQDA 4ABIA 1NU9A 2O8WA 1HJAB 2BM2A 3FVFB 5C1YA 2G55A 4CHAB 1DSTA 2A4GA 4TY7A 3K6ZA 3PO1C 1C5WB 2BD3A 2BY6X 4VGCB 1QQUA 3BTDE 4NWKA 2I6QA 1LKAA 2Q6FA 4ZKRU 3BTEE 3UR9A 3S7KB 3RXUA 3STIA 2FM2A 1YLDA 3F1SB 1P57B 1C1WH 1T8LA 1V2RT 3LH1A 4JK6A 1EOLA 2L74A 1L2EA 1Z6EA 3NXPA 2R3YA 1EPTC 1QL9A 2GV6A 2Y82A 1W14U 1GBFA 1P2NA 1J14A 2ZDMA 1GJBB 1O3PB 1PQAA 1SR5C 4ZKSU 1F5LA 1NTPA 3ZZBA 1T8OA 4MLFB 4TPIZ 5GXPA 3O8BA 1GHXH 1MMJN 1SQAA 3RU4E 4A7IB 5ESBA 1EOJA 1ZOMA 5J4SA 4Y7BA 3LC5A 5G4BA 3OTJE 2J98A 1V2NT 4NWLA 2ZCLP 1NBME 1O2NA 1OP0A 1OWEA 2ZQ2A 3U98H 1GG6C 3ZVGA 3RDZA 2BLQA 2WPHS 2EA3A 4MPWA 5GCHF 4MPUA 4AC9A 2ZTYA 3AAVA 4JMYA 1XUFA 4MNYA 2ZHFH 2BY7X 1GBHA 4XE4A 3RLWH 1W11U 1EPTB 5DJ7A 1S0RA 1NRPH 1K22H 2SGAA 3LJOA 2UWPA 3AAUA 5EODA 2XCFA 5LPFA 3E16B 2Y80A 1BRBE 1E38B 1J9CH 5L6NH 1GHAF 1VCWA 2KAIB 1AFQC 2BHGA 4X2WA 3T2NA 2XNIA 1WDIA 1TNKA 2ZFSA 1NFUA 1LDTT 1S6LA 4CREA 2GDEH 1GHAG 1SGRE 4D9QA 3VB4A 1GG6B 2PFEA 2KX4A 3QTOH 1YPEH 3O8CA 1GHVH 4P00A 4NFEA 1FMGA 1NFWA 1UVPA 1AHTH 1L1JA 1G3EA 1THPB 3ATIA 3SN8A 5BPEA 3MHWU 1SLVB 2ZQ1A 2Z6BD 3DSGA 5HGGA 1ID5H 1P9SA 1GJ9B 3RU4T 3TNSA 4FVBA 5DKMA 1FY5A 1LHCH 1AN1E 2FX4A 3P8FA 1EZXC 4ESTE 1EAWA 5C1XA 2JH6D 5EOKA 2VBCA 3S9BA 4X8UH 5L2YH 1CSOE 4NA9H 3D65E 1GHYH 3W1EA 4AB9A 1BMMH 2W3KA 1W13U 2W6JD 1O37A 4BTUB 2BDIA 4FUHA 3B23B 4MNVA 1SGCA 4NIYA 1EAXA 4TWYA 4E7NA 1EUFA 1BB0B 1W10U 2QXJA 3OEHD 2HRVA 1W12U 1U6QA 1KXBA 4AFSA 1MKXK 3NZIA 3FKSD 2ZA5A 1K1JA 2JH0D 1V2UT 1ZJDA 3PV4A 2P59A 1FONA 1XVMA 2FTMA 4F49A 3SYJA 2CHAC 3U8RH 1O3OA 1LKBA 3SJOA 1V2OT 4ABBA 1C2FA 3ATKA 5FCRA 3M37A 5FL7D 4Y8ZA 2QF0A 1HXFH 1UK4A 1DITH 1T31A 1MTUA 2UUJB 2RCEA 3E8LA 2W6ID 4CR9A 2G52A 4X1PU 2AEIH 3EYDA 4BTIB 2ZGCA 1SC8U 3RXIA 4AFZA 2ZDKA 5HMAA 5E8EH 2PSXA 2F91A 3K6YA 4ZCNA 3N7EA 2ASUB 3RXQA 4ASHA 1ABIH 3ZZCA 2QN5T 1FPHH 2A7HA 3GY7A 1N8OC 1N1LA 2HWLB 3KIDU 3RXVA 2FESH 2ZGBH 1QCPA 2EI7A 1FAXA 2ZFPH 1Y3VA 1ZLRA 2ALVA 1V2WT 2PKAB 1A5IA 2BDAA 2C90B 5HM2A 2FS8A 2JIZD 4F4OC 2NU4E 3SJ8A 1Z8IB 2RFKC 2TBSA 5EQSA 1AI8H 2ZHEH 5CHBA 1P2MA 2ZC9H 3SJ9A 5DP6A 3M5MA 1W0YH 5AF9H 1DE7H 1ORFA 1PPGE 2GZ9A 1JMOH 2ZTXA 2FODA 1O3IA 4UDWH 1UW7A 4DT7B 3QN7A 1J16A 4GLYA 1GGDC 2OQUA 3PTBA 1BTWA 4ZH8A 3M61U 1QURH 1YPKH 1PPZA 1IAUA 1HAVB 1UVUH 4ABJA 1SFIA 2VWMA 1GI6A 2L6OA 1AKSA 1G36A 2FWWA 1P9UA 1O3LA 1K28D 4GUXA 1O30A 2R9PA 1RIWB 2FOAA 3DSPA 1AVWA 4HI3A 1Z7KA 1UO6A 1WQVH 5A8ZA 1C2DA 2ZFRH 2QXIA 2G00A 5GPIB 1NRSH 1FXYA 2BXTH 2J38A 4R8TB 3BV9B 3M5LA 3E6PH 4Q7ZA 1KLIH 1G2LA 4AGJA 2OINA 4DIIH 4KP0A 5A09A 1BITA 5LPEA 3ZZ7A 1C1OA 1O39A 5JB9S 2H9EH 2JH5D 2HLCA 1GBMA 3TJOA 1AB9C 3SGBE 1NROH 1TMBH 4FETA 1ZSKA 1QB9A 4HG6A 1ESBA 1GPZA 3RXSA 2FOGA 2O9QA 1GI8B 1ANCA 1GJ8B 1W7XH 4GAWA 1ARCA 1LPGB 1JOUB 1L1NA 4B2AA 2OD3B 3BG4C 4OS7A 1EB1H 2XBYA 1CA0B 4FU7A 1PPCE 1YCPH 5CMXH 2W26A 3AVZA 1NM6A 1SVPA 1E35B 3A8DA 3H5CB 1BTZA 1G3BA 1LCYA 4WH6A 3SUFA 1DWCH 1EAUA 1AE8H 3RMNH 4I33A 1GBLA 3I77A 3GCHC 2SGQE 1BJUA 3VPKA 1V2KT 2GCHF 1HNEE 2VH0A 3SV6A 2VIDA 1SMFE 1H9LB 2XRCA 2D1JA 1HAGE 2VWNA 5C1UA 4ZHMU 1BDAA 4HZHA 3EA7A 3M5OA 2PHBA 5IDKA 1E34B 2D26C 2VNTA 3P92A 3F9HA 3P70B 2QYIA 3TJVA 2PR3A 1PPFE 1YPJH 2ZTZA 3T29A 1LVOA 3F2HA 1AY6H 1O2LA 5JDUB 3MNXA 1HV7A 1C9PA 2C8WB 4KELA 1SSXA 2GCTC 4Y11E 1AZ8A 1DVAH 2HNTE 1WQSA 2FYQA 3RXGA 3TNTA 1EPTA 1ZGIA 1KTTB 1YC0A 1Q2WA 1ZGVA 1H1BA 2R0LA 1UCYK 3F3BA 4AGKA 5JBTA 2KAIA 3VFEA 4DJZB 2A7CA 2VIWA 4FUJA 1ZHRA 1CE5A 2GP9B 4XD7D 2IJD1 1QIXB 4B74A 1B0FA 1OPHB 2WHXA 2IJOB 1TPAE 4IMQA 3T28A 4MNWA 1RTFB 2ZNKH 2J98B 1WXRA 4FXGH 2TGAA 3Q76A 2YNAA 1E1QD 2VVUA 4ZXYH 2WPMS 2EC9H 1Z8GA 2FLBH 1Q3XA 2PW8H 2M2AA 1KXFA 4MG3A 2Y5HA 4X1NU 4WH8A 4GCHG 3OY5U 2BZ6H 1T4UH 2IPHA 3KYFA 1C2LA 3JZ2B 4H6SB 3UNQA 3NWUA 3BIUH 4X6MA 2BY5X 2BD9A 2GD4B 1K1LA 1S84A 4B6FA 1JIRA 1GHZA 4TY6A 2BD7A 1TGSZ 1MKXH 4WY3A 1HAHH 4YXWD 3MU4A 1UVSH 4K8BA 2JDID 2RA0A 2BD4A 3ZIAD 2PKSC 1O2WA 1H8DH 8ESTE 4U01A 5JBCS 4INLA 3ZZ8A 1MBQA 1SKYE 3ZYEA 4E06H 1NU7B 5T6DA 1Y8TA 4DURA 1O2SA 3KQEA 1H4WA 1ZTKA 4MQAA 1SQTA 3OY6U 5A0CA 1SGQE 3BEFB 1P3CA 2KCAA 4TWWA 1NFXA 4XFQA 3VGCC 2A2XH 2OCVB 1DFPA 1JBUH 2VIPA 4NSVA 1UTQA 2GJGA 1IQHA 1AVXA 4NIWA 3ITIA 2AIPA 4Y79A 1A0JA 4FOUC 1GI0A 1PPEE 1SGDE 4H6TA 1WOFA 3CNRA 4NCYA 3RXFA 5GNDA 2KCOA 1BBRK 1P3EA 4ISHH 2ZPRA 1T8MA 1MKWK 2JKHA 2F43B 3BG8A 3HGPA 5EQRA 1K1OA 5L30H 2WV4A 1GHWH 2ZU1A 4D9RA 1F0RA 3T25A 1ACBE 4Q4LA 1BTYA 1FI8A 3RM0H 2DE8A 3GY3A 3F9GA 3RC5A 4NIVA 1SGFG 1TYNA 1C9TA 1A0LA 4ZMAH 3UOUA 3MNCA 3A7TA 2UUYA 2BX4A 1G9IE 3GCNA 1TAWA 1VCQA 1P09A 2OQ5A 1COWD 1O2QA 1LQEA 3RU4D 3GY8A 2G8TA 1GVKB 3PRDA 2PKAA 3FANA 1P02A 1NBMD 3ZZ4A 4ZUHA 1AU8A 1GHBG 4KKDA 3SHAH 2BDHA 2Z94A 4Z6AH 3GY4A 1TGTA 2Z9KA 1J8AA 3K9XB 3MO6A 4GSOA 1TX6A 2ZP0H 3LPRA 1GI9B 1KTSB 4IMZA 4K1TA 1NS3A 3P95A 4IN1A 3MTYA 1O2IA 7GCHG 3E3TA 2VVVA 2YMSB 3LONA 1UTJA 2P94A 1V2MT 2QXHA 3MU1A 2XYAA 1ZSLA 4X0WU 3LGUA 5DP9A 2AERH 2BB4A 3GCTF 1ZPZA 1CA8B 5HIZA 1VGCC 4UONA 1PYTC 3ODDA 1QNJA 2ZU3A 1KDQA 4DT4A 1TRNA 1C5MD 1DXPA 4MPXA 1GJCB 1YLNA 4TSFD 1LHDH 1MD8A 3BEUA 3A8BA 4ZKNU 1O2VA 2NU1E 3GCTG 3RXKA 4Y6DA 1ZZZA 1GMDG 1BCUH 2C3SA 1AD8H 3SV9A 4OGXA 2ZHWH 2JETB 1OWHA 1O2ZA 2H2ZA 1TOCB 4X6PA 6GCHF 5JPMH 2B9LA 5HKKD 1RTKA 1H8IH 1LQDB 5E2PA 2G4UA 3RXMA 1EZSC 1LTOA 6GCHG 1V2JT 3EA9A 2Y7ZA 3C27B 1VGCB 2W3IA 3BTTE 4CH8B 1ZPCA 1E79D 1SGEE 2AIQA 1N6YA 1IQNA 2W7SA 4O9VA 4A1TA 2ZKSA 4RT1A 4Y0ZE 3ZVBA 2SNWA 1BTHH 5KECA 1JWTA 1Y5BT 4X8TH 1AKSB 4IC5A 3A86A 1TPPA 3LGTA 4YO9A 4B2BA 1TA2A 1KLJH 2GMTC 1O3MA 4I86A 1QA0A 3MH6A 1IQMA 1MTSA 4MVNA 1RFNA 3SNAA 1ANEA 1GVLA 1GL1A 1K1IA 2ZZUH 4NIXA 1GCDA 1ZR0A 3F68H 3OAAD 5EXLA 4DOQA 2ZU5A 4IS5A 4RSPA 1J15A 1YPMH 1K1MA 5AFYH 1HFDA 1O3JA 3I29A 1EX3A 3RC6A 2IOTA 1BZXE 1IQGA 4JCNA 2WV5A 2XBXA 1SBWA 5TJXA 3MMGA 3MH4A 1YM0A 5EJLA 2BOKA 2CV3A 1T8NA 4Z0KA 3GOVB 2ZGJA 4M7GA 1TMTH 2QAAA 4I8GA 5FPSA 2TGPZ 2ZPQA 3UFAA 3A85A 3V12A 1WU1A 4JZEH 1UCYH 5B6LA 2BD8A 4YOGA 3VB6A 3SOSA 1C1SA 3P17H 1HGTH 3HK6B 4NZLA 2QV1A 3QO6A 4Q80A 3U1JB 1KY9A 2IN2A 1TA6A 3UNSA 3A8CA 1O32A 5CHAB 1CU1A 1YY3A 5E0JA 3LDXH 1GMCG 4X2XA 4Q7XA 1TLDA 4A92A 1P2QA 4ISLA 1O3KA 3NKKA 4X8VH 5FCKA 2AMPA 4K60A 1TPOA 1DXWA 1QRXA 3VXFH 1XUKA 3BTWE 4YOJA 1RXPA 2WV9A 1O34A 1O3EA 4XSKU 2RDEA 4IW4E 3PO1B 3QWCH 2XC5A 1MD7A 3SJKA 5SGAE 4X1QU 3V3MA 1C5XB 1TBRH
chains in the Genus database with same CATH topology
5FPYA 1OX1A 1RTLA 3RMOH 2BZAA 1TE0A 1XKAC 4ABHA 2STAE 2Z9IA 4UE7H 1S81A 2WUBA 8LPRA 3M3VA 4GHQA 2Z7FE 4B1TA 2EI8A 2FMJA 3CS0A 3Q00A 1P05A 1F0UA 2QA9E 3KCGH 1HUTH 3UIRA 4K8YA 1C5VA 3F9EA 2J4IA 2F83A 4D8NA 4WXVA 5J4QA 1S6FA 4DY7B 3CP7A 4KTCA 1BBRH 1YBWA 4OS6A 5AHGH 1P12E 2QY0B 1XVOA 3ENSB 1GBCA 1MKWH 5A8XA 4GPGA 3MNSA 2F3CE 1C1MA 1UK2A 3UTUH 1C5SA 1O2KA 1A61H 3OYPA 3O8DA 2VH6A 2OC1A 1Y5UT 5C67A 1O2XA 2J95A 4K3JA 1SGNE 1UTNA 1JIMA 1FPCH 3RMMH 3E0PB 3V7TA 1BRAA 4R0IA 1QBNA 2GZ8A 4AB8A 1EJNA 1SB1H 3MWIU 1RGQA 1QFKH 2TPIZ 2SFAA 4UEHH 3PLKA 4DGJA 2ZDVH 2C8XB 1C5RA 1AFQB 3H7TA 4NA8A 4NGAH 4BXSA 1SPJA 4IGDA 2XC4A 2SGEE 5C5OA 4UFEH 1OWJA 4WJG2 3EE0B 4LZ4B 1TRYA 1TABE 3KHVA 3GYLB 4O97A 4SGBE 1BMAA 4ABDA 1IHSH 2ZFQH 2YNBA 1PQ8A 2WUCA 4AOQA 3E1XB 4X2YA 2FYRA 3KGPA 4U32A 2PLXA 5EXNA 4E05H 4J1YA 2AMDA 4YLQH 1TNLA 3AW0A 2OP9A 3VB7A 3SJIA 2K1QA 1IQIA 1GI1A 1GJ7B 3SUEA 3DT0H 4WXIA 2G5VA 3A7YA 3URDA 1PYTD 4X6NA 1RRKA 1P2IA 3TGJE 1DLKB 2G5NA 3UY9A 1ELEE 4CBOA 4JZDH 2WINI 2OTVA 3A84A 4YTAA 1UVTH 3FZZA 1FAKH 1DOJA 2P95A 3ESTA 1A3EH 1ELDE 4PROA 1MCVA 1ZPBA 3STJA 3A87A 4E7RG 1OWDA 1D3QB 1ABJH 3FP6E 1EAIA 1F0SA 3TH2H 3SU5A 1TWXB 3QUMP 3CENA 2SGPE 3A82A 3C1KA 3B8JA 2M5TA 1FY1A 1C5YB 2NWNA 5EPYA 2ZECA 2CHAB 1CVWH 5E2OA 1GI3A 3PMJA 4LK4A 3TU7H 5F03A 1T4VH 9ESTA 2R3UA 1FJSA 2BQWB 1BRCE 4KGAA 3ZZAA 4DG4A 1X7AC 3UPEA 1XUGA 1CQQA 2V35A 1LVMA 1VITH 2FS9A 2WPJS 1BA8B 1HYLA 1G2MA 5GWZA 1S85A 1N8OB 1MTVA 2O8TA 4I7YH 1BRUP 5C3NA 2ZU4A 1KDQB 3MU8A 5FX6A 1D6RA 3RXTA 1FUJA 2PV9B 2ULLA 2VWOA 3IG6B 4BTTB 5L2ZH 4ISOA 1WSSH 1E0FD 4THNH 3TH4H 4NSYA 1Z1JA 3MI4A 1RS0A 1TNGA 3LGVA 1SGFA 2V6NA 1MTNC 2LNCA 3N7OA 4FUFA 2GGVB 2H6MA 3UNRA 1ZJKA 1YF4A 3L3TA 1GCTC 2A45B 1MAXA 1BT7A 1GJ5H 3S9AA 1GGDB 4RN6A 4A6LA 3RXLA 4YZUA 1AWFH 5GIBA 1DWBH 3RM2H 2FOHA 2XTTB 1GL0E 3ATWA 1UCYE 3GDUA 1C1TA 2CGAA 4Y71A 3ZZ6A 2VB0A 4WVPE 1HXEH 1O38A 1TRMA 1V3XA 3PROA 4YESB 2ANWA 3V0XA 1CGJE 3HKJB 3MH7A 1IQKA 2PWXA 3LOXA 6LPRA 5EG4A 2ODQA 4Y0YE 4KTUA 2BDYA 3TK6A 4Y10E 2V3HH 5DP3A 1G32B 4JZFH 2AMQA 3D49H 3M7TA 1EZUC 1D9IA 4BOHA 1ELAA 1H9IE 2C4FH 1GCTB 3SU3A 1ZMNA 2BTCE 1AUJA 1EATA 1ZRKA 2BVRH 2J92A 2R0KA 4ZHLU 2BD5A 2C8ZB 3QZRA 8GCHG 5HYOA 5JYIA 2GVFA 3BTQE 4ZROA 1C4V2 2PUXB 4BNRA 1AB9B 3RXPA 1MZAA 1EP6A 1ELTA 1TX7A 4FUGA 3UREA 4CRDA 1L4ZA 1AGJA 1C1QA 3O8RA 5DP7A 3SUGA 3PB1E 1CBWC 3KQBA 2AFQB 1TX8A 2ZDLA 2CXVA 1OYQA 2OC8A 5I25A 1BTXA 1TBQH 2ALPA 5A0AE 3BG4B 1DWEH 2Y6TA 4NG9H 2FZZA 1DICA 1JRTA 1UK3A 1SHYA 3TPIZ 2FOMB 3PWCA 3M3SA 1TFXA 1TNIA 2QGRA 3T62A 3U1IB 2OC7A 4D7GA 3E0NB 2ZIQH 1OYTH 2BVSH 1Z71A 4J2YB 1MCTA 2XWBI 3ATLA 5EXMA 4A5TS 5DP8A 1HAPH 2PTCE 3GCHB 4OS5A 1PPBH 2Q1JA 4IC6A 3RXBA 3RXRA 1TMUH 4FVDA 1CBWB 2YOLA 3URCA 1MQ5A 2A4QA 2BLOA 1L1GA 3SI3H 3FZDA 2RDLA 1QL8A 2ZO3H 1C4Y2 1O2PA 2UWOA 3K65B 1JXPA 5GJ4B 1K9OE 2I6SA 1HJ9A 3ZZDA 2VIQA 4GCHF 2Q6DA 5C20A 4NA7A 1O36A 1O0DH 1QTFA 1LMWB 2BVXH 1CT0E 3IWMA 1P0SH 5FBEA 1KXCA 2H9HA 4AN7A 4AYYB 2GCTB 4AG1A 1EJAA 1GI7B 1KXEA 3S9CA 2PSYA 1C2EA 1MU8B 1YPHC 1BTUA 3T26A 2ZEBA 1C5ZB 1NRQH 1VCPA 1EQ9A 1C1VH 1P06A 4RKJB 2A5AA 4XBBA 5TCCA 3BEIB 4MTBA 1C2MA 5ESTE 3TH3H 3GCOA 1ELFA 4YOIA 2A4RA 1THSH 4O3UA 1K1NA 2OLGA 2RG3A 3U9AH 3ZVEA 2XXLA 2THFB 4BAOB 2ZFTA 1ETTH 2O8LA 6ESTA 4CRFA 1O5BB 3LH3A 2H9TH 1TALA 9LPRA 1OP2A 1TBZH 1DY8A 2HNTF 1P11E 2FPZA 3GICB 3SZNA 3MU0A 3RXAA 7KMEH 5FHTA 5DP5A 3RLYH 2NU0E 2FTLE 2ZGXH 1ZYOA 1QY6A 3ZVCA 1CO7E 3M5NA 2A1DB 2PKSB 2EI6A 1GBDA 2FIRH 3A7XA 1V2ST 4IBLH 1O2UA 4BAHB 1O33A 1HAIH 4ZHAA 1C5UA 3IITA 1EP5A 2DE9A 4ABGA 3LJJA 4HFPB 1BJVA 6CHAC 1A2CH 3VGCB 3F9FA 1NESE 1GHBF 3W94A 4FUIA 4LOYH 1D3DB 1GJDB 2QXGA 1XXDA 8KME2 3TIUA 1HAOH 1NN6A 4Y7AA 7GCHF 1WBGB 2F9VA 2WYJA 3SBKA 1GMHG 4CRGA 2Y81A 4QT8C 4H4FA 1TONA 3QK1A 3ODFA 2FOBA 1NC6A 1SGIB 4CBNA 3UQOA 2AGIX 2C93B 1EASA 3F6UH 1FN6A 1AQ7A 1GMDF 1TOMH 1HCGA 1V2LT 3TGKE 3Q77A 4X1RU 3EGKH 1INCA 4FUCA 1BTPA 1GBKA 1C1NA 3PLPA 2Q6GA 1P8VC 2UUKB 5K7RA 1KXAA 1DANH 4TPYA 1DUEA 3NUMA 3A8AA 4IN2A 4YT7H 1O5FH 1SHHB 3SI4H 2VGCC 3FP8E 4LXBH 1F0TA 1DX5M 1O2JA 3U69H 3LU9B 5F6MA 2LPRA 2SGDE 2ZHQH 3M35A 3TJUA 1GBEA 4YT6H 3M36A 1L4DA 2H1UA 3VB3A 1P01A 4D7FA 3SO3A 1K21H 3ZVFA 3ZV9A 5TCAA 1W2KH 3VEQB 1SLWB 3MFJA 1TNHA 1AO5A 1AIXH 1F5RA 1Z8RA 1IOEA 5CE1A 4BXWA 2VGCB 2H5DA 3M7UA 3FFGA 7LPRA 1UMAH 3DFLA 1S0QA 5PTPA 1O3DA 4OGYA 2ZHDA 5H4IB 3SORA 4DCDA 5I46H 1SLUB 1TNJA 1SLXB 4K1EA 1OOKB 3RXCA 1OWIA 2P93A 5AVDA 1BHXF 1VITG 4CR5A 3SV7A 4KTSA 1O3CA 1O2MA 3CS7A 2GT7A 4ZAEA 1ETSH 1CGHA 1A4WH 2V3OH 3GY2A 2OC0A 4A1XA 2A4OA 1J17T 1CHGA 1UJ1A 4YLUA 1NO9H 2Z9JA 2VIVA 1HJAC 3SU6A 3Q3KA 4B2CA 3EA8A 2BDBA 4CHAC 1FV9A 3L6PA 1O3FA 2FDAA 4B71A 2O8MA 4BAMB 3BTFE 1HBTH 2HVXA 3U8TH 4VGCC 1XKBC 2GMTB 3ZVAA 4JYTA 3EDXB 3A88A 1O5EH 1ESTA 4BAKB 1QJ1B 1TPSA 2J94A 1DT2A 1D3TB 2QIQA 1GBIA 1P2OA 1EKBB 1UTLM 4ISIH 4JZ1A 5A8YA 1C5LH 2J34A 2ESTE 3TLOA 1G30B 1MTWA 4INKA 2ZGHA 4HTCH 1GMCF 3QZQA 4XDEA 2CF8H 1GJ6A 1FNIA 4OS1A 1E36B 1BUIA 1UTKA 2ZG0H 2A32A 3TK9A 3W95A 1TB6H 1F92A 1XUHA 2B0FA 2FI5E 3SNBA 1L0ZA 1O3BA 1O2TA 1MH0A 2GKVE 1NZQH 3PM3A 3GDSA 3A81A 3HATH 3UR6A 5C2ZA 4AFUA 1F5KU 1Q31A 1MUEB 1V2TT 1A5HA 2BLWA 3D62A 1FQ3A 1ESAA 3S7HB 3A89A 3BTKE 1Y59T 4CRAA 1Z1IA 1GI2A 2HPPH 4HGCA 1WCZA 1O3AA 3R0FA 1MZDA 1HIAB 3NCLA 4MDSA 1YCPK 1QJ7B 3V13A 2AH4X 1LO6A 1FY3A 2AYWA 4AX9H 2W7UA 3AW1A 1OXGA 1YKTA 1CHOF 5EW2H 1NRNH 3SW2B 4XBCA 3MYWA 2BY8X 1BHXB 2DUCA 1HLTH 1TGNA 1P03A 2TIOA 2BXUH 4XOJA 1Y3UA 2BDGA 1SQOA 1FN8A 3LIWA 2GT8A 4UFFH 1CHOG 1O5DH 3E90B 2Z9GA 5GCHG 1Y5AT 1ZSJA 5E0GA 3HKIB 3BTME 3RXJA 4WMFA 2GX4A 1VZQH 3M3TA 4TYDA 5F8XA 4JYVH 1D3PB 5LH8A 1FIWA 1S82A 1YCPM 1C1RA 1QBOA 3ZZ5A 4INHA 3SHCH 5IYTA 3ZZ3A 4XBDA 2OUAA 3MH5A 1V2VT 1W7GH 2FOEA 1QHRB 2GTBA 2GZ7A 4AZ2B 2O8UA 5EPNA 3VB5A 3SU1A 3KL6A 1QB1A 2STBE 3KN2A 1BOQA 1HAYB 3D23A 2P8OC 2WYGA 4X6OA 5A2MH 3UWIA 1C2KA 3RC4A 1ANDA 1HRTH 4I8LA 1C1PA 1RJXB 3NPSA 4MNXA 4OS4A 7ESTE 5HM9A 2TRMA 3QTVH 1QBVH 2SGFE 3SU4A 1EJMA 2WPLS 5DO4H 4X1SU 3WY8A 4GHTA 2VINA 4K1SA 4DIHH 3R3GB 1YYY1 3A7VA 1ZTLA 1DLEA 5JBAS 3ELAH 1TIOA 2HOBA 4NFFA 2Y5FA 2ANKH 5FAHA 5JB8S 1PPHE 1DUAA 5T3HA 3BTHE 3KEEA 1KXDA 1IQLA 1THRH 1C2JA 2CMYA 1ZTJA 1O2GH 2Z9LA 2P8OB 1QB6A 4B75A 2ZFFH 5DGJA 1SOTA 1D4PB 1UHBA 1S83A 1C2GA 2PUQH 1QRZA 1IHTH 1O5GH 1VJ9U 1G3DA 2A7JA 5F8ZA 4UD9H 3TITA 1Y3YA 2CN0H 2UUFB 3RMLH 3TVJB 3T27A 1XX9A 1FLEE 4JZIA 4Y8YA 1B7XB 1CT2E 1DWDH 4Q7YA 1FZZA 4CH2B 2XWAA 4K2YA 1GVZA 1KSNA 2ZF0H 1A3BH 3LT3A 2F9PA 3SV2H 1YPHE 1DS2E 2EEKA 3I78A 5T6GA 1MAYA 1IQFA 2H5CA 1ZHPA 3HGNA 1TGCA 1RIWC 2A5IA 3QGJA 3GISB 1AUTC 1CGIE 1AMHA 1OP8A 1G37A 3EQ0H 1GBJA 1XM1A 1LPZB 2BQ6B 3MU5A 4CRCA 4K69A 1PJPA 3RXDA 1BMLA 1SFQB 2QC2A 2B8OH 1O3NA 1K1PA 4ZXXH 2FXRA 3HK3B 3A7ZA 3UOPA 5JBBS 2ZDNA 2A2QH 1XMNB 1ETRH 1K2I1 3BIVH 2NU2E 2BYAX 4O03A 1IQJA 4ABAA 1WV7H 3RXEA 5C5NA 4U30A 1B0EA 5FXLA 4A1VA 1XUIA 5DG6A 4Q2KA 5BRRE 4JYUH 2BDCA 4I8HA 2W5EA 4WMEA 5B6OA 4ISNA 4FUBA 1A0HB 1LPKB 1O2HA 1SL3A 2C8YB 2OXSA 4I32A 1MBMA 1CA0C 1S6HA 3KF2A 1ZMJA 4ABFA 1YP9A 4AORA 4I8KA 1F2SE 1UTPA 1B5GH 1YPGH 2TGTA 1MTNB 3P8GA 4Y8XA 1O2OA 8GCHF 5DP4A 3S69A 5ETXA 3ZZ9A 2CJIA 1AZZA 3BF6H 1KYNA 1QL7A 1GI5A 2D2DA 3PWBA 1GJ4H 2BOHB 2AGGX 2ODPA 5EW1H 3DHKH 1GBTA 1QRWA 3GY5A 1H9HE 2BMGB 2PGBB 1O5AB 1OWKA 1WYKA 4UFGH 2P3FH 4LZ1H 2Z3CA 4OS2A 3ATMA 1QGFA 3T5FH 1NFYA 5DK1A 3E91A 3QX5H 4ABEA 1O3GA 1DY9A 2AS9A 1C2IA 1O2RA 1XXFA 2G4TA 3OSYA 1KIGH 4H42U 3A80A 2ZCHP 1ZMLA 3TGIE 3NK8A 4JK5A 4WWYA 1GI4A 1HIAA 1DM4B 1LVBA 4X8SH 1N6XA 5HXFA 1BBRE 2FOCA 2TGDA 2B7DH 1P2JA 1G3CA 5A0BA 3AASA 2ZU2A 3B9FH 5FX5A 3RUOA 2GCHG 1GJAB 1O5CB 1TGBA 1ELBA 2A5KA 2HGTH 1W3CA 1W0ZU 1C1UH 4FUDA 2P3TB 1Y3WA 1AE5A 2J9NA 3KNXA 1C5TA 3BN9A 3KQCA 3SU2A 1LHGH 3P8NA 3QDZB 2ZCKP 2ILNA 3JZ1B 2VIOA 1YLCA 2V0BA 1TQ7B 2QCYA 2FO9A 2XBWA 3Q3YA 1AFEH 1P2KA 1HAXB 1HJ8A 2F9NA 1V2PT 2GDDA 2Z3EA 4X2VA 1O35A 2FX6A 5EGMA 1HAZB 4AYVB 1VR1H 1DDJA 2ZDAH 1OS8A 3PYHA 1O31A 1GWAA 2XBVA 5EQQA 3DFJA 4YM9A 1LHFH