2D2DA

Crystal structure of sars-cov mpro in complex with an inhibitor i2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
301
structure length
301
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 79
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2d2dA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d2dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d2dA02
3FP6E 3SU2A 3WY8A 4UD9H 4NFFA 1BRUP 1UTLM 1QJ7B 1OPHB 1XUGA 3EYDA 3FANA 8LPRA 2G81E 4IBLH 2XTTB 1PPGE 3TJVA 1L4ZA 3GCOA 1E35B 1XUHA 3BTGE 3E90B 1HRTH 3FP8E 4ZXYH 4YOJA 1O3EA 2FOBA 1B0EA 1SQOA 2B5TB 2VWMA 1GHZA 3B23B 5ETXA 3ZZ5A 5EW1H 3BTME 1LVBA 4UFEH 1MCTA 3SBKA 1IQMA 3PWCA 3GYLB 1BHXF 1SQTA 4CH8B 1XMNB 1C5YB 3TK5A 1DWEH 1SOZA 2ZGHA 3ZZ3A 1SLWB 3VB4A 3M7UA 3P95A 1IQNA 4MTBA 1L4DA 1TGTA 3F9EA 1BCUH 4KTCA 2TGDA 5E2PA 4BXSA 4ZHLU 1Z6EA 1GCDA 3M5NA 3HKIB 2ZU5A 5EG4A 3GY3A 3NCLA 2F9PA 5L2YH 1J15A 3QUMP 2SNVA 2BVXH 3BTTE 1P2NA 1JRTA 2I6QA 3D23A 1CBWC 3UWJH 1NRQH 2R3YA 2BDCA 2UUJB 2XXLA 3OSYA 3PLKA 1Z8IB 4I8LA 1C5XB 2AS9A 3P8GA 2C8ZB 2JETB 1L1JA 1O3AA 2BD9A 4ZXXH 3VB7A 4HGCA 3TGIE 1AU8A 4FUGA 3KEEA 3S7KB 2UWPA 1PQ8A 3UOPA 1LTOA 2FZZA 3LC5A 3EGKH 1E34B 1ZZZA 2ZHWH 4JK5A 1NFWA 1Y3UA 4CRFA 1SPJA 1HGTH 1MBMA 2AGEX 1T31A 2CF8H 3EBNA 1WYKA 1PYTC 1XUKA 4VGCB 1O3FA 1J8AA 1Z8JB 4XE4A 5IYTA 4ZUHA 2KAIB 1DOJA 2TGTA 2SGDE 1EZSC 1VJAU 1PFXC 1ANCA 2HWLB 1FY3A 4F49A 4SGBE 1OP8A 3A8CA 1YPGH 1O3BA 1QIXB 3A80A 3P8NA 2ZI2H 1D6WA 1BJUA 1Y5UT 2ZDKA 1ELGA 2I6SA 3E16B 1BBRH 3ODDA 1MQ6A 5DP7A 2RCEA 3M35A 2FPZA 4ZROA 1JOUB 4IMZA 3KNXA 4X8TH 5EQRA 2GVFA 1AVWA 3RDZA 1D4PB 1B5GH 2OLGA 2LIZA 2O8WA 2BLOA 2GCHF 1HAZB 2EC9H 4CH2B 3A85A 3H7TA 1S81A 3DA9B 2WUCA 1YLDA 4GHQA 3STIA 1GI8B 2ODYB 2BDHA 1JIMA 1RIWB 1KLIH 1EQ9A 5F03A 3A7VA 4GPGA 2A4RA 1EAUA 4K60A 1O3DA 1F0SA 4MNWA 1HAXB 3ZZAA 3MU5A 3O8DA 4Q7ZA 4FVDA 4ABHA 2ANKH 1GBBA 4FUBA 5JB8S 1EB2A 3RP2A 1SVPA 2GCHG 2ZGCA 4NFEA 3RXBA 3T26A 1V2VT 1JRSA 1IQIA 4YLUA 1XM1A 1O2QA 1D3DB 2BDIA 3L33A 5B6OA 1FUJA 4ABIA 1W2KH 2JKHA 3T28A 2AMDA 3ATMA 2FP7B 1RS0A 3LU9B 1CHOG 2FO9A 4DURA 3TGKE 1MZAA 2XBWA 1TX7A 1HXFH 2GX4A 1YLCA 3AAUA 3SNAA 3P92A 4JYTA 4MNXA 2FTMA 4TPYA 1ZGVA 3I78A 1DUAA 2FXRA 1O38A 1GBHA 3ZVDA 1F92A 2XWAA 4I31A 5DP6A 3SJIA 1KLTA 1P10A 1GL0E 7GCHF 1JIRA 3BEUA 4XBDA 2ZDMA 1TBRH 1TGSZ 3FFGA 1YPHE 4X1RU 1Z8GA 3DT0H 3SU0A 1OWHA 4LZ1H 1LO6A 2V6NA 4BTIB 1BBRE 4KELA 3QGJA 2ZFRH 3U9AH 4KP0A 1GMHG 1TIOA 1TAWA 2BX3A 3O8CA 3T29A 1O2NA 1V2WT 4ZMAH 2FOHA 2JETC 5HM9A 3T27A 3UUZA 2GCTB 3BG4B 1ETTH 1P3EA 3Q3XA 3I77A 2P93A 2VWNA 2ZU1A 3F6UH 1UMAH 1QR3E 2WV4A 5A8XA 3PYHA 3LT3A 2FTLE 2GD4B 3GDUA 1YPHC 4RN6A 1ANDA 1MTNB 3KQCA 3ENSB 2ZCKP 2OUAA 1AMHA 2ZFFH 3Q77A 2ODPA 2CGAA 1KY9A 1IQFA 3U8RH 1FMGA 2ZIQH 3N7OA 4CR5A 4YM9A 4VGCC 3SU3A 2G4UA 1V2PT 1WBGB 2PKSC 1OYQA 2CN0H 4AYVB 3HK6B 3MH4A 1RRKA 2GDDA 3UY9A 4CRCA 1ZSKA 1O5DH 1AE8H 1BTPA 5A0BA 5JBCS 1GJ4H 2GMTC 4OS1A 1SLUB 1O36A 1D9IA 1ETSH 4GHTA 2PSXA 3S0NA 1GBTA 2Y82A 2R2MB 1ELBA 3U1JB 4HFPB 1BZXE 1TOMH 3UR9A 4MDSA 1SGCA 3BTWE 1EJAA 2OXSA 1XXDA 3LGIA 3QK1A 1A0JA 5EQSA 1ZMJA 3PTNA 1ZHMA 5C3NA 4B2CA 1GI7B 2H1UA 3M7QA 4X6NA 2H6MA 4Q7XA 1ZGIA 4DGJA 1ESBA 2WPMS 1IQEA 2ZZUH 1GJCB 2BD8A 1GGDB 1MKWH 1GBLA 1OWEA 3LGVA 1GJDB 1EOJA 1THSH 5FBEA 2R0LA 3E91A 2BY5X 1GI4A 1SG8B 3U69H 2PKAB 2FLRH 1W3CA 1MBQA 3MNSA 3M5LA 5EXMA 1ZSLA 3FZZA 3BN9A 2YOLA 4NIWA 1TWXB 1GI3A 2ZKSA 4UDWH 1GMDF 3ZZ4A 1SHHB 2K7XA 2J34A 4UFDH 1OP2A 3IWMA 2AFQB 4Y10E 2BM2A 4ABJA 2Y7ZA 4B1TA 2B9LA 4Z6AH 3P17H 1T8NA 1N8OB 4LZ4B 1DT2A 3BIVH 1SGRE 1QCPA 2Y80A 1TBQH 3LJOA 4X8UH 1SGYE 3LPRA 3ZVFA 5E0GA 2O8LA 2G8TA 1KXBA 4HZHA 4JZIA 2TRMA 4OS7A 1KXEA 1HFDA 1A5GH 1DICA 3GDVA 3RXIA 1J17T 8ESTE 1AIXH 3SQHE 1QNJA 2G5NA 3RLWH 1G37A 1HAIH 1O3KA 1PQ5A 3PO1B 3A7TA 3ZYDA 1AHTH 3P8FA 1XKBC 4YT6H 1MQ5A 1GJAB 3EA8A 1MU8B 1AI8H 3E6PH 4ZKSU 3SHAH 1RXPA 5C1UA 1C1QA 1TRYA 2PFEA 2Y5GA 3RU4E 2R3UA 5EW2H 2SFAA 3F9FA 1NM6A 4CRGA 4IW4E 5HGGA 4Y8YA 1LHEH 1ZPZA 1SGTA 3AW0A 1E0FD 2PGBB 1EJNA 5GDSH 1FNIA 3U1IB 2Z3EA 1P2OA 2Z9GA 1TRNA 3AVZA 4AG1A 5C2ZA 1S0QA 1ZSJA 4F4OC 5I25A 1ZJDA 1KXFA 1ID5H 1GBJA 2HNTF 1SLVB 2ZPQA 1GBIA 1GI9B 4X2YA 1UK4A 2HPPH 3MYWA 2ZFPH 1C1VH 4Q80A 2Q6GA 4BAKB 1C5QA 2XC4A 9ESTA 2M5TA 1K1JA 2OC1A 2P16A 2ULLA 1CVWH 5FPSA 4WMDA 2D1JA 2QYIA 2A31A 2STAE 6CHAC 1AY6H 2ZECA 1YPKH 4CBOA 2K1QA 5HYOA 3F9HA 1FONA 1TNHA 4RKOB 4ISNA 4Z0KA 1UVOA 1C5RA 3V13A 4YT7H 2GZ7A 1W14U 1DXPA 3RXUA 3U98H 1DSTA 2GP9B 1O2KA 1DPOA 1WV7H 3ODFA 2GGVB 1EPTB 1C2IA 1C2EA 2FMJA 1N6XA 1ZJKA 5FPTA 1O3GA 1KXAA 1AB9B 3GY8A 1AFQC 2ZHQH 4ISHH 1GDUA 2WPHS 2VGCC 3SUGA 1X7AC 1SQAA 1GHBF 3TH4H 1DX5M 1KLJH 3ELAH 3LIWA 4LXBH 3SJKA 2OC8A 1FY5A 1Q31A 3LH1A 2ZA5A 3SQEE 3MU4A 1WAYB 1GJ9B 5E2OA 3UWIA 3ZV8A 1GHAF 4E05H 2BVRH 3HPTB 3OU0A 3T5FH 3ITIA 3RMLH 3SNDA 3K6ZA 4I8JA 2STBE 3ZZ9A 1GI6A 5ESBA 1ZTJA 2GDEH 2OTVA 3VGCB 1C1SA 1ELVA 1EZUC 2D2DA 4X1NU 2HVXA 4DT7B 2BD5A 1GHBG 1GBDA 3BTHE 1A3BH 1P09A 3M61U 5AVDA 2Q6DA 5GPIB 1BMMH 5PTPA 1F5LA 2FODA 3UNQA 1PJPA 1UO6A 4U2WA 3EAJA 1NRRH 3NK8A 4CHAB 1GHAG 1QL7A 5F8XA 5DPAA 3SUEA 2VU8E 4WXIA 3K65B 1INCA 2CMYA 1MD7A 4LOYH 3T2NA 3PO1C 3SV2H 1PPEE 1LHDH 4ZKRU 2P8OC 5LPEA 3RXQA 1A46H 5ESTE 1P8VC 1BTHH 1XUIA 2ZTYA 2GKVE 2XC0A 3NUMA 1AUJA 4J1YA 4ZKNU 5JYIA 2BXTH 4SGAE 1SI5H 1W0YH 1UVUH 2H9HA 1CT2E 2W5EA 5FX5A 1ANEA 2BDGA 3A84A 1C4Y2 1TPSA 2A2QH 1ARBA 1CT4E 3O8RA 1ABJH 4NSYA 7ESTE 2BY6X 5JBTA 3AAVA 4K8BA 3SUDA 3OYPA 3RXGA 3L6PA 4X2XA 2EA3A 1IQJA 2GZ8A 3QN7A 1OWJA 2EI8A 2QXHA 1CA0B 6GCHF 5K7RA 3PMHB 1W8BH 2SNWA 1NRPH 3A89A 5JBBS 1HAOH 1HAGE 2A7CA 3KGPA 3ZZ7A 1W7GH 1FY4A 2QIQA 3KIDU 1UK2A 1LMWB 4NIVA 1QBVH 1UHBA 2H9EH 1TLDA 1T8MA 1ELEE 2ZHFH 4Y8XA 1TYNA 1UK3A 1GI2A 2A32A 3GCHC 1HCGA 1W10U 2SGQE 2BDBA 3MU8A 4ABGA 2UUKB 2W7SA 1O2PA 3SOSA 3UIRA 1ELFA 2O9QA 1N6YA 2F9VA 1TA2A 3RXAA 3MHWU 2AIQA 1C2MA 2J2UA 2PV9B 3Q3YA 2GTBA 1AB9C 1RFNA 1TNKA 1C5WB 1GVZA 2BLWA 4NIYA 3UPEA 1AKSB 1H8IH 1DWBH 3GYMA 1HJAC 3RXOA 1NRNH 2ZDNA 4THNH 3H7OA 1E37B 2BZAA 3M3TA 3GCTF 1GBFA 1NC6A 1WTHD 3VB5A 2ZTXA 4FUIA 3UNRA 1EKBB 2ZU4A 3EDXB 3RXKA 3VB6A 2FESH 1UTPA 4X2WA 3A7ZA 2UUFB 3NKKA 4GUXA 3SNBA 1TONA 3ATLA 3TH2H 4I7YH 5EU8A 2ZFTA 5BPEA 1CGIE 4U32A 3RMMH 1LHFH 1QY6A 3GY6A 3RXEA 2VB0A 2BDAA 3E8LA 3RXHA 2UUYA 1O5BB 2Z9LA 1Y3YA 3GCTG 4UEHH 4A5TS 5DO4H 1FY1A 1OSSA 3PMBB 3E0NB 1AVXA 1YM0A 1C2KA 1OP0A 2ANMH 2BTCE 2H5DA 4CHAC 1Y59T 3KQEA 4X2VA 4AYYB 3T25A 2R2WU 2AMQA 4XBBA 1NN6A 2A4OA 2Y6TA 3RXJA 1G30B 2D8WA 4X8SH 1C2DA 2GT7A 3M36A 1T32A 1Y3VA 1YPMH 2F83A 3HKJB 4MPWA 2QV1A 1F5RA 1FQ3A 2QY0B 1GVLA 2UWOA 3GCNA 2LPRA 1A4WH 1WUNH 3W94A 3URCA 2HRVA 4K69A 3B8JA 3A7YA 4GCHF 3VXEH 3RXLA 3TNSA 2FEQH 4AB8A 1HNEE 1QA0A 4ISIH 8GCHF 3RU4T 2JH0D 3CP7A 4MPVA 1QBOA 3PLBA 1QQ4A 4X6OA 3ZVEA 1BRCE 1CA0C 4FU7A 2A5KA 1DSUA 3UR6A 3SUFA 1HYLA 1PYTD 2AMPA 3TLOA 1C9TA 3V7TA 1G3DA 1UCYK 1QB1A 1SC8U 1P02A 1TB6H 2YNAA 2V3HH 4GCHG 2BXUH 4WVPE 8KME2 4ESTE 2J95A 3A83A 2ZGXH 1TGNA 1G2MA 4ISOA 3K2UA 4TWWA 1TNIA 1JMOH 4MVNA 1KDQA 4GVUA 3MMGA 1P2IA 4Q2KA 1UTQA 1C5UA 1FXYA 1MTVA 3R3GB 1VR1H 2F91A 2ZDLA 5AHGH 1SSXA 1BTZA 3SJOA 1LVYA 5LGOA 1FAXA 1C5VA 2R0KA 1YP9A 1ELTA 4OS6A 3GISB 3KL6A 2ALVA 1BTYA 1BITA 1Z8RA 1C2JA 1WTGH 2ANWA 1D3TB 1BRAA 4B76A 1P04A 3IG6B 1B0FA 3GY5A 2CXVA 4K1TA 1DLEA 3KQBA 4CR9A 2WV5A 1E38B 3QZQA 1DDJA 1O34A 4I33A 1TALA 3ATWA 4Y0ZE 1QA7A 1S83A 1HAVA 4A1TA 4DOQA 4LK4A 5FCKA 3KCGH 1O0DH 3SHCH 1SGDE 3TJOA 4BXWA 4UE7H 1THPB 5DK1A 2OP9A 3V3MA 1GCTB 2A2XH 3OTJE 3SGBE 3PWBA 5J4QA 1FAKH 1NFYA 3LGUA 4JK6A 6ESTA 7GCHG 1NU9A 3DUXH 9LPRA 2C8XB 3RXSA 4DCDA 1S6HA 1ZRBA 1BJVA 3MO3A 2C93B 1EP6A 3SV8A 3BF6H 2ZF0H 1PPHE 2G4TA 3E1XB 4I8HA 1O2IA 5A8ZA 1FN6A 2ZCHP 4Y79A 4GSOA 5GJ4B 4Y7BA 1AUTC 7KMEH 1HDTH 2PGQB 3LKWA 2H2ZA 1LHGH 1SFQB 3M5OA 2NU3E 4KGAA 1CHGA 3LONA 1YBWA 3S9BA 4OGYA 1NFUA 4AFZA 1K1LA 3AASA 3SV9A 1IQLA 1TQ0B 1RTFB 3TIUA 2W7UA 2SGFE 1AQ7A 1TE0A 3MOCA 1ABIH 3S7HB 4NA9H 5G4BA 5JDUB 1V2JT 3VPKA 1EZQA 2BMGB 1FZZA 1ANBA 1PQ7A 3LJJA 5FXLA 2V3OH 1HUTH 3GY4A 2HGTH 2BZ6H 3MNCA 3LDXH 3QZRA 5GCHF 3Q00A 1DANH 1MUEB 1RIWC 4JMYA 1SGNE 2EI7A 1W0ZU 4CRDA 1T8LA 1P03A 3RXCA 4NSVA 1QTFA 3M3VA 3SO3A 1V2OT 7LPRA 3SORA 1O2SA 3TITA 2VIWA 1C2GA 1HPGA 2UWLA 4FU8A 4MPXA 1C5SA 5TCAA 1H8DH 1MTUA 5C1XA 1LKBA 1S5SA 3F68H 3V12A 1O3IA 1K28D 1LDTT 1K21H 2VIPA 2VIOA 2ZGBH 3PB1E 1HAPH 3ZVCA 2HLCA 4GAWA 1MCVA 1SL3A 3GDSA 1F0TA 3OY6U 3RM0H 3NPSA 4D76A 2AH4X 1NPMA 1P11E 4X1SU 4JZ1A 1DLKB 4NIXA 4YOIA 1V2TT 1QGFA 1XVMA 1K1NA 4AFUA 1DFPA 5E8EH 1RTLA 3BG8A 4YLQH 2ZCLP 1F0RA 3MH5A 1O33A 5GWZA 3PTBA 1GHVH 4ZH8A 1P12E 5TCCA 4YESB 2ZU3A 1HAYB 4BAMB 1CGHA 3RXVA 3MTYA 5F8ZA 5FAHA 4UFGH 1GBEA 3M7TA 3EE0B 3LH3A 2ZFQH 2CJIA 5DKMA 1QJ1B 1GMDG 2DE9A 2QXJA 4D7GA 2B8OH 4Y76A 2V35A 3TH3H 1GJ5H 1V2ST 3LOXA 2A5IA 1O3LA 3P70B 3B9FH 1NRSH 2GCTC 1NESE 3BG4C 5FX6A 1GG6B 5FBIA 3RC6A 1V2QT 5CHAB 2PR3A 4BAHB 1O5GH 2AIPA 1CA8B 4BAQB 1UJ1A 4X1PU 3QO6A 4RKJB 5AFZH 1MTNC 1QL8A 2H5CA 5T3HA 5LPRA 1TMBH 3A82A 3DFJA 4UFFH 1O5CB 1A5IA 4INHA 1O3JA 1ZPBA 5JB9S 2AEIH 4NGAH 3C27B 1P2KA 1C5TA 1OKXA 3A8DA 5EOKA 2OD3B 4WJG2 2O8MA 1A1RA 1NU7B 1G32B 1YCPK 1QFKH 1H9IE 1C1UH 1S85A 3CS7A 4J2YB 4FXGH 1VZQH 1P01A 1VCPA 1P9SA 2BX4A 1XVOA 1NS3A 2FOCA 2G52A 4K8YA 1Z7KA 1CE5A 1RTKA 4XDEA 4CRAA 2AGIX 2FOAA 4AX9H 1NROH 1AGJA 3ESTA 1GBMA 1WU1A 3S9CA 3SGAE 1IQKA 5HMAA 4YZUA 4K3JA 2DE8A 1O3HA 4CBNA 4MNVA 3ZVBA 3SI4H 5A8YA 5E0HA 3RLYH 1GI0A 2NU0E 1GWAA 2Z3CA 1J9CH 1HJ8A 3QGNB 2QGRA 2XBYA 3U8OH 2OQUA 1LPZB 2ALPA 1GGDC 4NWKA 1DY8A 4ABFA 3MFJA 5HXFA 1O3OA 1TBZH 3RU4D 1DS2E 1BB0B 4WY3A 1EATA 1N1LA 1UVSH 5EXLA 4MQAA 4QT8C 2HPQH 1CGJE 4B73A 2F9OA 2GV7A 2Q1JA 5C20A 1W7XH 1L1NA 5ABWA 1H9HE 5T6GA 2ZC9H 2TPIZ 4NA7A 1BMLA 1O2JA 2TGAA 4KTSA 1JXPA 1MTSA 1MAXA 1O35A 2Y5HA 3TGJE 3BTFE 1KIGH 1AWHB 3HGPA 1N8OC 1OOKB 2FI5E 3E3TA 2PTNA 4JYVH 4IN1A 4A92A 1TMTH 1C1WH 4DJZB 4IS5A 4K2YA 1VCWA 3PROA 2FX6A 1QBNA 1Y3XA 2PUQH 3ZZ6A 5FPYA 3ZVGA 1MZDA 1F5KU 3SW2B 5IDKA 5JPMH 2SGAA 2WYGA 1C4V2 1C9PA 2VVVA 3BTDE 3M5MA 3LGYA 1WSSH 3FP7E 3ZZCA 5T6FA 3LGWA 5EODA 1EX3A 1O2YA 1TFXA 5F6MA 1TPOA 4X6MA 1P05A 3BTKE 1EB1H 4CREA 3MH7A 1AD8H 1ZHRA 1HIAA 2QN5T 3R0FA 3QLPH 4A7IB 2FOFA 3SI3H 1ZOMA 4OGXA 4Q7YA 4IGDA 1P0SH 1YKTA 1FDPA 2FLBH 2BY8X 1P9UA 1GHWH 1VITF 1GBAA 1K1MA 4NCYA 5L30H 1L0ZA 2H9TH 2ZHEH 3SN8A 2OCVB 5H4IB 1O2HA 1UTKA 1T4UH 1G9IE 1ZRKA 2XW9A 2OBQA 5GXPA 1XUJA 5DP5A 5K0HA 4R8TB 1Y3WA 1C5OH 1ARCA 1O2VA 1WCZA 1DY9A 4ABEA 2ZHDA 3Q76A 1BHXB 1OWDA 4NA8A 1EUFA 2GT8A 4AFQA 2VNTA 5L2ZH 1UCYH 2XBVA 1P3CA 1TMUH 4XSKU 4M7GA 4A1VA 1O39A 4MPUA 2G55A 1O3MA 1SGQE 3CS0A 3ZV9A 4XFQA 2AGGX 1NTPA 3OX7U 2NU1E 2QC2A 3MU1A 3RXTA 2QF0A 5A2MH 5C5OA 2FX4A 4X0WU 1GDNA 1BDAA 4Y8ZA 6GCHG 2C4FH 2P3FH 3GOVB 1IAUA 1B7XB 1G3BA 2BOKA 1GDQA 4E7RG 1V2MT 4XBCA 1UTMA 4AGKA 1BTUA 3SNEA 1GJ6A 1FLEE 1ZYOA 3SV6A 2Q6FA 1EPTC 4WH8A 2D26C 4FVBA 1K9OE 1P2JA 2PHBA 1ZMNA 3SZNA 1IQGA 4B71A 1TNJA 1CU1A 3NWUA 1S0RA 1AN1E 2HALA 2QF3A 2WPKS 3I29A 5DP8A 4Y7AA 1C1PA 1T7CA 2XRCA 4Y11E 1SR5C 2P59A 1K22H 2XNIA 1F0UA 3FAOA 2ZQ1A 1HAHH 1W11U 1YPLH 2VH0A 3LC3A 1DUEA 1EP5A 1Y8TA 1V2NT 2J92A 3VGCC 3RXFA 1BA8B 1QB6A 4UONA 2AERH 3MWIU 5L6NH 3EA7A 2PUXB 2FYQA 1Z6JH 1FPCH 1DM4B 2Z7FE 4B2BA 4HI3A 2OC7A 1SHYA 2PKAA 3G01A 3AW1A 1WQSA 1UCYE 1J16A 1DE7H 5F8TA 2VWLA 3A8AA 5EPNA 2Y81A 3IITA 1GJBB 4RSPA 2WINI 3K9XB 2ANYA 4O03A 5BRRE 3RM2H 5I46H 3BTQE 4K5ZA 4O3UA 4FU9A 4NWLA 1MD8A 3DFLA 2EEKA 1QHRB 1TNGA 3UNSA 2ZQ2A 3MO9A 4ZHMU 5TJXA 1AZZA 1BUIA 2C8YB 3D62A 2BD3A 1O37A 2A0QB 1QB9A 4FUEA 1H9LB 2Z94A 3SJ8A 1MTWA 2WPIS 1KTTB 2ZPSA 2PKSB 4D7FA 1GMCF 2G5VA 5LH8A 3VB3A 4O3TA 1YYY1 1E36B 1H4WA 2NU4E 2ZFSA 4YOGA 2G51A 2GMTB 1F2SE 1S6FA 4ABBA 3ZZ8A 3BEIB 3A87A 3A88A 1WOFA 1BMAA 4A1XA 2FIRH 3GICB 2QA9E 1ACBE 2W26A 2EI6A 5DGJA 1EXFA 1DWCH 8GCHG 3SGQE 2BLVA 4KTUA 1SFIA 1SGIB 1GMCG 1YCPM 4WXVA 1Z1JA 2A5AA 4BOHA 1TX8A 1DITH 2R9PA 1HBTH 1O2UA 1JWTA 2LNCA 3JZ1B 3KN2A 2C90B 3SU5A 3W95A 1CHOF 1K1IA 1GJ7B 1C5NH 1SMFE 1ELCA 1MKXK 1QJ6B 2ZNKH 1V2KT 2RG3A 1D3QB 3ATKA 1V6DA 1LKAA 1V3XA 1LPGB 1CQQA 1GHYH 2ESTE 4CRBA 5A09A 4BAOB 1EAWA 3E0PB 1ELDE 2Z9IA 2QXGA 1L1GA 1O2OA 3DHKH 1AZ8A 4INLA 4WF8A 4TYDA 1AWFH 1D3PB 3TPIZ 1C4U2 2ZP0H 1G36A 1KXDA 2Y7XA 3TU7H 1AVGH 1XKAC 1U6QA 1GMHF 4JZDH 4D9RA 1HIAB 3MH6A 2BY7X 5FCRA 2J9NA 3RC5A 2F3CE 3DD2H 1UTNA 1GI1A 1TGCA 4ZHAA 1FV9A 3A7WA 3BV9B 5JBAS 5DP3A 1C1OA 1O3NA 2IN2A 4H6SB 3SJ9A 1EPTA 2Z3DA 1IHTH 1K1PA 1ZPCA 1BMNH 4O9VA 3TJUA 3FZDA 2FOGA 3SU1A 3F1SB 3JZ2B 2FOEA 2RA0A 1FJSA 1KSNA 1Q3XA 4FUJA 3RC4A 3PLPA 1A2CH 2B0FA 1PPBH 2VVCA 5DG6A 5LPFA 3MNBA 2TBSA 4H6TA 2VIDA 1C5LH 4H42U 2WUBA 3UOUA 3RUOA 2IPHA 5FHTA 2C8WB 2FM2A 4E7NA 1A61H 2SGEE 1VCQA 1YCPH 1UHBB 1WQVH 1C1TA 3MI4A 4WH6A 3P8OA 2TIOA 1A0HB 1SGFA 1THRH 4AN7A 4IN2A 1A7SA 5EQQA 1W12U 3PM3A 1DXWA 3HATH 2BQ7B 4Y6DA 1C5ZB 4TPIZ 3UREA 3H5CB 2CHAB 3M37A 4AG2A 2WPJS 3EA9A 1V2RT 4DIHH 1C5PA 3K6YA 1FI8A 4FUFA 4X6PA 1ELAA 1JBUH 4FUHA 1SOTA 5GIBA 1TABE 4NG9H 2BLQA 2TGPZ 1IQHA 3URDA 1OXGA 1YF4A 1BBRK 2ZDVH 2QCYA 2ZO3H 1G3CA 1HV7A 2XCFA 1PPCE 2VJ1A 5EGMA 1YC0A 4H4FA 2W3IA 6CHAB 1VJ9U 2A4GA 3ZYEA 2OQ5A 3ATIA 3L3TA 1LCYA 1SLXB 2VWOA 1ZMLA 3SU6A 3MNXA 1LQDB 1PPFE 2VH6A 2ILNA 2A7HA 2BYAX 4U30A 1NZQH 1O2XA 1GBCA 3MO6A 4AORA 3BIUH 4DIIH 4TY7A 3TNTA 1OS8A 6LPRA 1ZTLA 1S82A 2FS9A 1DWDH 1ZTKA 2VINA 1CO7E 3EQ0H 4AOQA 2HOBA 5GCHG 2BQ6B 4MNYA 1FIZA 4KKDA 1K1OA 1O2RA 4IC6A 1Y5AT 2PTCE 1Q2WA 4JZEH 3UTUH 4WMEA 4YTAA 4INKA 3UQVA 1BQYA 4A6LA 2G00A 1OX1A 1AFQB 3PMJA 2JH5D 2V0BA 1ZLRA 2O8TA 2VGCB 2F9NA 1TPAE 2BY9X 3GY2A 1EOLA 1NFXA 1P2QA 1SB1H 1TX6A 1P2MA 2OC0A 2Y5FA 4TWYA 1YPJH 1C2LA 1RD3B 1BIOA 1TGBA 2OBOA 2RDLA 2PSYA 2PLXA 2ODQA 3PV4A 3T62A 5E0JA 4JCNA 1HLTH 3MU0A 3SU4A 2THFB 1EZXC 1G3EA 4AFSA 1BTXA 1OWIA 3CENA 3UQOA 1OWKA 1FPHH 2Z9KA 2BOHB 4U01A 1SBWA 1VGCB 4YO9A 1GCTC 2F9UA 2BD2A 2VVUA 1GL1A 2FWWA 4FUCA 2P95A 5T6DA 2FOMB 1C1MA 1FY8E 2P3TB 2VIQA 4TY6A 1AKSA 1BTWA 4PROA 1BRBE 1ESAA 1QL9A 4D9QA 1S84A 2BB4A 3ZZDA 2BDYA 1SGPE 1EAIA 3RXPA 3TK9A 2P8OB 4I8GA 1XUFA 3QTOH 1RJXB 3KHVA 2ZWLH 2IOTA 1C2HA 5SGAE 1MH0A 1QQUA 4ISLA 5EPYA 4OS5A 1RGQA 3ZVAA 1MMJN 3QTVH 1O5FH 1M9UA 2ASUB 3RXDA 1DVAH 3HGNA 2XCNA 3BSQA 1EASA 1SGEE 3VXFH 4AZ2B 4OS2A 1GBKA 1MU6B 3RMOH 3U8TH 4ABDA 3F9GA 2Z6BD 2SGPE 3Q3KA 2O8UA 1BT7A 1KDQB 1C5MD 3M3SA 2Z9JA 2A1DB 1V2LT 3OY5U 1TOCB 3BEFB 3NXPA 2FI3E 2CHAC 3ZZBA 4JZFH 4WWYA 5A0AE 5DP9A 3BTEE 1V2UT 4I32A 1FN8A 1P57B 2XYAA 4BNRA 1LPKB 4IC5A 1PQAA 1O2WA 1BOQA 2QAAA 2VIVA 1O5AB 2PW8H 3RXRA 1ETRH 1G2LA 1QURH 5HM2A 3TVJB 2XWBI 1GI5A 1O3CA 2P3UB 2KAIA 1CSOE 2IJOB 2QXIA 1KYNA 2FDAA 4NZQA 3SV7A 4K1SA 4AGJA 5C67A 1CT0E 2FI4E 1TA6A 5EXNA 1O2TA 2A7JA 2NU2E 4ASHA 3FVFB 4K1EA 3STJA 1HAVB 3GCHB 3QWCH 5C1YA 1NO9H 1GJ8B 1UVPA 1P06A 5CE1A 1QRZA 5A0CA 4BTUB 2OINA 1O2ZA 4AB9A 1O3PB 2WPLS 2J38A 4O97A 1IHSH 2GZ9A 4E06H 1T8OA 1MKWK 1ZR0A 3A7XA 1EJMA 2BQWB 4XOJA 4Y71A 5AF9H 1ESTA 2A4QA 3KF2A 1O31A 1XX9A 2HNTE 3D49H 1HJAB 1F7ZA 1QRWA 3TK6A 1Z1IA 4R0IA 4Y0YE 4HTCH 1HJ9A 1NY22 3A81A 4JYUH 2YNBA 4DY7B 1W13U 2ZPRA 4GLYA 4BANB 2ZEBA 2CF9H 1LVMA 1TQ7B 1LHCH 2W3KA 3QX5H 1KXCA 1YPEH 1GVKB 3A8BA 4WMFA 4DW2U 2BD4A 2WYJA 1O2MA 3V0XA 1CBWB 1AE5A 3LGTA 4DG4A 1J14A 3HK3B 1O2LA 1VGCC 1C1RA 1L2EA 4I8KA 5DP4A 3GY7A 3PMAB 4OS4A 1C2FA 1A5HA 1GHXH 2P94A 2DUCA 2HNTC 4MG3A 1KTSB 1GG6C 4ABAA 2PWXA 4BTTB 2FS8A 5CHAC 1A0LA 3S9AA 1O5EH 3C1KA 1VITH 2ZTZA 4ZKOU 2ZG0H 3TJNA 5CMXH 4B74A 5AFYH 2JH6D 2ZU2A 1UTOA 1C1NA 2BHGA 1Z71A 3P6ZB 5DJ7A 1UVTH 1TNLA 1LVOA 1GPZA 1O30A 2GV6A 1XXFA 4DVAU 1O2GH 1TRMA 4NZLA 3KQDA 5C5NA 2J4IA 3O8BA 2F9BH 2B7DH 4X1QU 3VFEA 1PPZA 1QRXA 1Y5BT 2ZGJA 3SNCA 2BVSH 3UFAA 4B2AA 4MLFB 1UTJA 3D65E 3VEQB 2XC5A 3RXMA 4X8VH 2C3SA 4B75A 2CV3A 1T4VH 1TPPA 1EAXA 1H1BA 1LQEA 1O32A 1VITG 4D8NA 1AO5A 4IMQA 1YGCH 2BD7A 1IOEA 1HXEH 1D6RA 2FYRA 2NWNA 1K2I1 3NZIA 3A86A 2J94A 5J4SA 2AYWA 1FIWA 3S69A 3QDZB 4FUDA 2A45B 1AFEH 1NT1A 2ZDAH 4ZAEA 1SGFG 1HB0B 1A3EH 1MAYA 3RMNH 1OYTH 2RA3A 2XBXA 1ZHPA 1MKXH 1ORFA
chains in the Genus database with same CATH superfamily
3FP6E 5B6LA 3SU2A 3WY8A 4UD9H 4NFFA 1BRUP 1UTLM 1H8ED 1QJ7B 1OPHB 1W0KD 1XUGA 3EYDA 3FANA 8LPRA 2G81E 4IBLH 2XTTB 1PPGE 3TJVA 1L4ZA 3GCOA 1E35B 1XUHA 3BTGE 3E90B 1HRTH 3FP8E 4ZXYH 4YOJA 1O3EA 2FOBA 1B0EA 1SQOA 2B5TB 2VWMA 1GHZA 3B23B 5ETXA 3ZZ5A 5EW1H 3BTME 1LVBA 4UFEH 1MCTA 3SBKA 1IQMA 3PWCA 3GYLB 1BHXF 1SQTA 4CH8B 1XMNB 1C5YB 3TK5A 1DWEH 1SOZA 2ZGHA 3ZZ3A 1SLWB 3VB4A 3M7UA 3P95A 1IQNA 4MTBA 1L4DA 1TGTA 3F9EA 1BCUH 4KTCA 2TGDA 5E2PA 4BXSA 4ZHLU 2WV9A 1Z6EA 1GCDA 3M5NA 3HKIB 2ZU5A 5EG4A 3GY3A 3NCLA 2F9PA 5L2YH 1J15A 3QUMP 2SNVA 2BVXH 3BTTE 1P2NA 1JRTA 2I6QA 3D23A 3DSGA 1CBWC 3UWJH 1NRQH 2R3YA 2BDCA 2UUJB 2XXLA 3OSYA 3PLKA 1Z8IB 4I8LA 1C5XB 2AS9A 3P8GA 2C8ZB 2JETB 1L1JA 1O3AA 2RDEA 2BD9A 3WWFA 4ZXXH 3VB7A 4HGCA 3TGIE 2OK5A 1AU8A 4FUGA 3KEEA 3S7KB 2UWPA 1PQ8A 3UOPA 1LTOA 2FZZA 3LC5A 3EGKH 1E34B 1ZZZA 2ZHWH 4JK5A 1NFWA 1Y3UA 4CRFA 1SPJA 1HGTH 1MBMA 2AGEX 1T31A 3SZEA 2CF8H 3EBNA 1WYKA 1PYTC 1XUKA 4VGCB 1O3FA 1J8AA 1Z8JB 4XE4A 5IYTA 4ZUHA 2KAIB 1DOJA 2TGTA 2SGDE 1EZSC 1VJAU 1PFXC 5C0UA 1ANCA 2HWLB 1FY3A 4F49A 4SGBE 1OP8A 3A8CA 1YPGH 1O3BA 1QIXB 3A80A 3P8NA 5KEDA 2ZI2H 1D6WA 1BJUA 1Y5UT 2ZDKA 1ELGA 2I6SA 3E16B 1BBRH 3ODDA 1MQ6A 5DP7A 2RCEA 3M35A 2FPZA 4ZROA 1JOUB 4IMZA 3KNXA 4X8TH 5EQRA 2GVFA 1AVWA 3RDZA 1D4PB 1B5GH 2OLGA 2LIZA 2O8WA 2BLOA 2GCHF 1HAZB 2EC9H 4CH2B 3A85A 3H7TA 1S81A 3DA9B 2WUCA 1YLDA 4GHQA 3STIA 1GI8B 2ODYB 2BDHA 1JIMA 1RIWB 1KLIH 2IJD1 1EQ9A 5F03A 3A7VA 4GPGA 2A4RA 1EAUA 4K60A 1O3DA 1F0SA 4MNWA 1HAXB 3ZZAA 3MU5A 3O8DA 4Q7ZA 4FVDA 4ABHA 2ANKH 1GBBA 4FUBA 5JB8S 1EB2A 3RP2A 3W1EA 1SVPA 2GCHG 2ZGCA 4NFEA 3RXBA 3T26A 1V2VT 1JRSA 1IQIA 4F48B 4YLUA 1XM1A 1O2QA 1D3DB 2BDIA 3L33A 5B6OA 1FUJA 4ABIA 1W2KH 2JKHA 3T28A 2AMDA 3ATMA 2FP7B 1RS0A 3LU9B 1CHOG 2FO9A 4DURA 3TGKE 1MZAA 2XBWA 1TX7A 1HXFH 1MABB 2L74A 3OE7D 2GX4A 1YLCA 3AAUA 3SNAA 3P92A 4JYTA 4MNXA 2FTMA 4TPYA 4ZCNA 1ZGVA 3I78A 1DUAA 2FXRA 1O38A 2K8IA 1GBHA 3ZVDA 1F92A 2XWAA 2V7QD 4I31A 5DP6A 3SJIA 1KLTA 1P10A 1GL0E 3KYFA 7GCHF 1JIRA 3BEUA 4XBDA 2ZDMA 1TBRH 1TGSZ 3FFGA 5EJLA 1YPHE 4X1RU 1Z8GA 3DT0H 3SU0A 1OWHA 4LZ1H 1LO6A 2V6NA 4BTIB 1BBRE 4KELA 3QGJA 2ZFRH 3U9AH 4KP0A 1GMHG 1TIOA 1TAWA 2BX3A 3O8CA 3T29A 1O2NA 1V2WT 4ZMAH 2FOHA 2JETC 5HM9A 3T27A 3UUZA 2GCTB 2F4LA 3BG4B 1ETTH 1P3EA 3Q3XA 3I77A 2P93A 2VWNA 2ZU1A 3F6UH 1UMAH 1QR3E 2WV4A 5A8XA 3PYHA 3LT3A 2FTLE 2GD4B 3GDUA 1YPHC 4RT1A 4RN6A 1ANDA 1MTNB 3KQCA 3ENSB 2ZCKP 2OUAA 1AMHA 2ZFFH 3Q77A 2ODPA 2CGAA 1KY9A 1IQFA 3U8RH 1FMGA 2ZIQH 3N7OA 4CR5A 4YM9A 4VGCC 3SU3A 2G4UA 1V2PT 1WBGB 2PKSC 1OYQA 2CN0H 2XOKD 4AYVB 3HK6B 3MH4A 1RRKA 2GDDA 3UY9A 4CRCA 1ZSKA 1O5DH 1AE8H 1BTPA 5A0BA 5JBCS 1GJ4H 2GMTC 4OS1A 1SLUB 1O36A 1D9IA 1ETSH 4GHTA 2PSXA 2JIZD 3S0NA 1GBTA 2Y82A 2R2MB 1ELBA 3U1JB 4HFPB 1BZXE 1TOMH 3UR9A 4MDSA 1SGCA 3BTWE 1EJAA 2OXSA 1XXDA 3LGIA 3QK1A 1A0JA 5EQSA 2WZQA 1ZMJA 3PTNA 4TT3D 1ZHMA 5C3NA 4B2CA 1GI7B 2H1UA 3M7QA 2F43B 4X6NA 2H6MA 4Q7XA 1ZGIA 4DGJA 2K0QA 1ESBA 2WPMS 1IQEA 2ZZUH 1COWD 1GJCB 4TSFD 2BD8A 1GGDB 1MKWH 1GBLA 1OWEA 3LGVA 3U28C 1GJDB 1EOJA 1THSH 5FBEA 2R0LA 3E91A 2BY5X 1GI4A 1SG8B 3U69H 2PKAB 2FLRH 1W3CA 1MBQA 3MNSA 3M5LA 5EXMA 1ZSLA 3FZZA 3BN9A 2YOLA 4NIWA 1TWXB 1GI3A 2ZKSA 4UDWH 1GMDF 3ZZ4A 1SHHB 2K7XA 2J34A 4UFDH 1OP2A 3IWMA 2AFQB 4Y10E 2BM2A 4ABJA 2Y7ZA 4B1TA 2B9LA 2WSSD 3OEED 4Z6AH 3P17H 1T8NA 1N8OB 4LZ4B 1DT2A 3BIVH 1SGRE 1QCPA 2Y80A 1TBQH 3LJOA 4X8UH 1SGYE 3LPRA 3ZVFA 5E0GA 2O8LA 2G8TA 1KXBA 4HZHA 4JZIA 2TRMA 4XRNA 4OS7A 1KXEA 1HFDA 1A5GH 1DICA 3PV2A 3GDVA 3RXIA 1J17T 8ESTE 1AIXH 3SQHE 1QNJA 2G5NA 3RLWH 1G37A 1HAIH 1O3KA 1PQ5A 3PO1B 3A7TA 3ZYDA 1AHTH 3P8FA 1XKBC 4YT6H 1MQ5A 1GJAB 2J97A 2J98A 3EA8A 1MU8B 1AI8H 3E6PH 4ZKSU 3SHAH 1RXPA 5C1UA 1WXRA 1C1QA 1TRYA 2PFEA 2Y5GA 3RU4E 2R3UA 5EW2H 2SFAA 3F9FA 1NM6A 4CRGA 4IW4E 5HGGA 4Y8YA 1LHEH 1ZPZA 2QF4A 4I86A 1SGTA 3AW0A 1E0FD 2PGBB 1EJNA 5GDSH 1FNIA 3U1IB 2Z3EA 1P2OA 2Z9GA 1TRNA 3AVZA 4AG1A 5C2ZA 1S0QA 1ZSJA 4F4OC 5I25A 1ZJDA 1KXFA 1ID5H 1GBJA 2HNTF 1SLVB 2ZPQA 1GBIA 1GI9B 4X2YA 1UK4A 2HPPH 3MYWA 2ZFPH 1C1VH 4Q80A 2Q6GA 4BAKB 1C5QA 2XC4A 9ESTA 2M5TA 1K1JA 2OC1A 2P16A 2ULLA 1CVWH 5FPSA 4WMDA 2D1JA 2QYIA 2A31A 2STAE 6CHAC 3EE7A 1AY6H 2ZECA 1YPKH 1E1RD 4CBOA 2K1QA 5HYOA 3F9HA 1FONA 1TNHA 4RKOB 4ISNA 4Z0KA 1UVOA 2EQNA 1C5RA 3V13A 4YT7H 3UAIC 2GZ7A 1W14U 1DXPA 4AC9A 3RXUA 3U98H 1DSTA 2GP9B 1O2KA 1DPOA 1WV7H 3ODFA 2GGVB 1EPTB 1C2IA 1C2EA 2FMJA 1N6XA 1ZJKA 5FPTA 1O3GA 1KXAA 1AB9B 3GY8A 1AFQC 2ZHQH 4ISHH 1GDUA 2WPHS 2VGCC 3SUGA 1X7AC 1SQAA 1GHBF 3TH4H 1DX5M 1KLJH 3ELAH 5FL7D 3LIWA 4LXBH 3SJKA 2OC8A 1FY5A 1Q31A 3LH1A 2ZA5A 4HG6A 3SQEE 3MU4A 1WAYB 1GJ9B 5E2OA 3UWIA 3ZV8A 1GHAF 4E05H 2BVRH 3HPTB 3OU0A 3T5FH 3ITIA 3RMLH 3SNDA 3K6ZA 4I8JA 2STBE 3ZZ9A 1GI6A 5ESBA 1ZTJA 2GDEH 2OTVA 3VGCB 1C1SA 1ELVA 1EZUC 2D2DA 4X1NU 2HVXA 4DT7B 2BD5A 1GHBG 1GBDA 1WDIA 3BTHE 1A3BH 1P09A 3M61U 5AVDA 2Q6DA 5GPIB 1BMMH 5PTPA 1F5LA 2FODA 3UNQA 1PJPA 1UO6A 4U2WA 3EAJA 1NRRH 3NK8A 4CHAB 1GHAG 1QL7A 5F8XA 5DPAA 3SUEA 2VU8E 4WXIA 3K65B 1INCA 2CMYA 1MD7A 4LOYH 3T2NA 2GJGA 3PO1C 3SV2H 1PPEE 1LHDH 4ZKRU 2P8OC 5LPEA 3RXQA 1A46H 5ESTE 2KM0A 1P8VC 1BTHH 4FETA 1XUIA 2ZTYA 2GKVE 2XC0A 3NUMA 1AUJA 4J1YA 4ZKNU 5JYIA 2BXTH 4SGAE 1SI5H 1W0YH 1UVUH 2H9HA 1CT2E 2W5EA 5FX5A 1ANEA 2BDGA 3A84A 1C4Y2 1TPSA 2A2QH 2KFWA 1ARBA 1CT4E 3O8RA 1ABJH 4NSYA 7ESTE 2BY6X 5JBTA 3AAVA 4K8BA 3SUDA 3OYPA 3WW7A 3RXGA 3L6PA 4X2XA 2EA3A 1IQJA 2GZ8A 3QN7A 1OWJA 2EI8A 2QXHA 1CA0B 6GCHF 5K7RA 3PMHB 1W8BH 2SNWA 1NRPH 3ZIAD 3A89A 5JBBS 1HAOH 5HIZA 1HAGE 2A7CA 3KGPA 3ZZ7A 1W7GH 1FY4A 2QIQA 3KIDU 1UK2A 1LMWB 4NIVA 1QBVH 1UHBA 2H9EH 1TLDA 1T8MA 1ELEE 2ZHFH 4Y8XA 1TYNA 1UK3A 2W6ID 1SKYE 1GI2A 2A32A 3GCHC 1HCGA 1W10U 2SGQE 2BDBA 3MU8A 4ABGA 2UUKB 2W7SA 1O2PA 3SOSA 3UIRA 1ELFA 2O9QA 1N6YA 2F9VA 1TA2A 3RXAA 3MHWU 2AIQA 1C2MA 2J2UA 2PV9B 3Q3YA 5T1VA 2GTBA 1AB9C 1RFNA 1TNKA 1C5WB 1GVZA 2BLWA 1UW7A 4NIYA 3UPEA 1AKSB 1H8IH 1DWBH 3GYMA 1HJAC 3RXOA 5C94A 1NRNH 2ZDNA 4THNH 3H7OA 1E37B 2BZAA 3M3TA 3GCTF 1GBFA 1NC6A 1WTHD 3VB5A 2ZTXA 2J98B 4FUIA 3UNRA 1EKBB 2ZU4A 3EDXB 3RXKA 3VB6A 2FESH 1UTPA 4X2WA 3A7ZA 2UUFB 3NKKA 4GUXA 3SNBA 1TONA 5EJZA 3ATLA 3TH2H 4I7YH 4ASUD 5EU8A 2ZFTA 5BPEA 1CGIE 1EFRD 4U32A 3RMMH 1LHFH 1QY6A 3GY6A 3RXEA 2VB0A 2BDAA 3E8LA 3RXHA 2UUYA 1O5BB 2Z9LA 1Y3YA 5CHBA 3GCTG 4UEHH 4A5TS 5DO4H 1FY1A 1OSSA 3PMBB 3E0NB 1AVXA 1YM0A 1C2KA 1OP0A 2ANMH 2BTCE 2H5DA 4CHAC 3F2GA 1Y59T 3KQEA 4X2VA 4AYYB 3T25A 2R2WU 2AMQA 4XBBA 1NN6A 2A4OA 2Y6TA 3RXJA 1G30B 2D8WA 4X8SH 1C2DA 2GT7A 3M36A 1T32A 1Y3VA 1YPMH 2F83A 3HKJB 4MPWA 2QV1A 1F5RA 1FQ3A 2QY0B 1GVLA 2UWOA 3GCNA 2LPRA 1A4WH 1WUNH 3W94A 3URCA 2HRVA 4K69A 3B8JA 3A7YA 4GCHF 1NBMD 3VXEH 3RXLA 3TNSA 2JJ1D 2FEQH 2RFKC 4AB8A 1HNEE 1QA0A 4ISIH 8GCHF 3RU4T 2JH0D 3CP7A 4Z1MD 4MPVA 1QBOA 3PLBA 1QQ4A 4X6OA 3ZVEA 1BRCE 1CA0C 4FU7A 2A5KA 1DSUA 3UR6A 3SUFA 1HYLA 1PYTD 2AMPA 3TLOA 1C9TA 3FN8A 3V7TA 1G3DA 1UCYK 1QB1A 1SC8U 1P02A 1TB6H 2YNAA 2V3HH 4GCHG 2BXUH 4WVPE 8KME2 4ESTE 2J95A 3A83A 2ZGXH 3N99A 1TGNA 1G2MA 4ISOA 3K2UA 4TWWA 1TNIA 1E79D 1JMOH 4MVNA 1KDQA 4GVUA 3MMGA 1P2IA 4Q2KA 1UTQA 1C5UA 1FXYA 1MTVA 2JJ2D 3R3GB 1VR1H 2F91A 2ZDLA 5AHGH 1SSXA 1BTZA 3SJOA 1LVYA 5LGOA 1FAXA 1C5VA 3N7EA 2R0KA 1YP9A 1ELTA 4OS6A 3GISB 3KL6A 2ALVA 1BTYA 1BITA 1Z8RA 1C2JA 1WTGH 2ANWA 1D3TB 1BRAA 4B76A 1P04A 3IG6B 1B0FA 3GY5A 2CXVA 4K1TA 1DLEA 3KQBA 4CR9A 2WV5A 1E38B 3QZQA 1DDJA 1O34A 4I33A 1TALA 4OM9A 3ATWA 4Y0ZE 1QA7A 1S83A 2YMSB 1HAVA 4A1TA 4DOQA 4LK4A 5FCKA 3KCGH 1O0DH 3SHCH 3NRLA 1SGDE 3TJOA 4BXWA 4UE7H 1THPB 5KGOA 5DK1A 2OP9A 3V3MA 1GCTB 2A2XH 3OTJE 3SGBE 3PWBA 5J4QA 1FAKH 1NFYA 3LGUA 4JK6A 6ESTA 5C17A 7GCHG 1NU9A 3DUXH 9LPRA 2C8XB 3RXSA 4DCDA 1S6HA 1ZRBA 1BJVA 3MO3A 2C93B 4ACBA 1EP6A 3SV8A 3F2HA 3BF6H 2ZF0H 1PPHE 2G4TA 3E1XB 4I8HA 1O2IA 5A8ZA 1FN6A 2ZCHP 4Y79A 4GSOA 5GJ4B 4Y7BA 1AUTC 7KMEH 1HDTH 2PGQB 3LKWA 2H2ZA 1LHGH 1SFQB 3M5OA 2NU3E 4KGAA 1CHGA 3LONA 1YBWA 3S9BA 3FOAA 4OGYA 1NFUA 4AFZA 1BMFD 1K1LA 3AASA 3SV9A 1IQLA 1TQ0B 1RTFB 3TIUA 2W7UA 2SGFE 1AQ7A 1TE0A 3MOCA 1ABIH 3S7HB 4NA9H 5G4BA 5JDUB 1V2JT 2KZ4A 1EZQA 3VPKA 2BMGB 1FZZA 1ANBA 1PQ7A 3LJJA 5FXLA 2V3OH 3AK5A 3GY4A 2HGTH 1HUTH 2BZ6H 3MNCA 3LDXH 3QZRA 5GCHF 3Q00A 1DANH 1MUEB 1RIWC 4JMYA 1SGNE 2EI7A 1W0ZU 4CRDA 1W0JD 1T8LA 1P03A 3RXCA 4NSVA 1QTFA 3M3VA 2QE7D 3SO3A 1V2OT 7LPRA 3SORA 1O2SA 3TITA 2VIWA 1C2GA 1HPGA 2UWLA 4FU8A 4MPXA 1C5SA 5TCAA 1H8DH 1MTUA 5C1XA 1LKBA 1S5SA 3F68H 3V12A 1O3IA 1K28D 1LDTT 1K21H 3FO8D 2VIPA 2VIOA 2ZGBH 3PB1E 1HAPH 3ZVCA 2HLCA 4GAWA 1MCVA 1SL3A 3GDSA 1F0TA 3OY6U 3RM0H 3NPSA 4D76A 2AH4X 1NPMA 1P11E 1OHHD 4X1SU 4JZ1A 1DLKB 4NIXA 4YOIA 1V2TT 1YWUA 1QGFA 1XVMA 1K1NA 4AFUA 1DFPA 5E8EH 1RTLA 3BG8A 4YLQH 2ZCLP 1F0RA 3MH5A 1O33A 2KX4A 5GWZA 3PTBA 1GHVH 4ZH8A 1P12E 5TCCA 4YESB 2ZU3A 1HAYB 3DSOA 4BAMB 1CGHA 3RXVA 3MTYA 5F8ZA 5FAHA 4UFGH 1GBEA 3M7TA 3EE0B 3LH3A 2ZFQH 4M9FA 2CJIA 5DKMA 1QJ1B 2DE9A 1GMDG 2QXJA 4D7GA 2B8OH 4Y76A 2V35A 3TH3H 1GJ5H 1V2ST 3LOXA 2A5IA 3OAAD 1O3LA 3P70B 3B9FH 1NRSH 2GCTC 1NESE 5DN6D 3BG4C 5FX6A 1GG6B 5FBIA 3RC6A 1V2QT 5CHAB 2PR3A 4BAHB 1O5GH 2AIPA 1CA8B 4BAQB 1UJ1A 4X1PU 3QO6A 4RKJB 5AFZH 1MTNC 1QL8A 2H5CA 5T3HA 5LPRA 1TMBH 3A82A 3DFJA 4UFFH 5HKKD 1O5CB 1A5IA 4INHA 1O3JA 1ZPBA 5JB9S 2AEIH 1E1QD 4NGAH 3C27B 1P2KA 1C5TA 1OKXA 3A8DA 5EOKA 2OD3B 4WJG2 2O8MA 3GS9A 1A1RA 1NU7B 1G32B 1YCPK 1QFKH 1H9IE 1C1UH 1S85A 3CS7A 2KCPA 4J2YB 4FXGH 1VZQH 1P01A 1VCPA 1P9SA 2BX4A 1XVOA 1NS3A 2FOCA 2G52A 4K8YA 1Z7KA 1CE5A 1RTKA 4XDEA 4CRAA 2AGIX 2FOAA 2WHXA 4AX9H 1NROH 1AGJA 2QF5A 3ESTA 5EIYA 1GBMA 1WU1A 3S9CA 3SGAE 1IQKA 5HMAA 4YZUA 4K3JA 2DE8A 1O3HA 4CBNA 4MNVA 3ZVBA 3SI4H 5A8YA 5E0HA 3RLYH 1GI0A 2NU0E 1GWAA 2Z3CA 1J9CH 1HJ8A 3QGNB 3SYJA 2QGRA 2XBYA 3U8OH 2OQUA 1LPZB 2ALPA 1GGDC 4NWKA 1DY8A 4ABFA 2CK3D 3MFJA 1O3OA 5HXFA 1TBZH 3RU4D 3CNRA 1DS2E 1BB0B 4WY3A 1EATA 1N1LA 1UVSH 5EXLA 4MQAA 4QT8C 2HPQH 1CGJE 4B73A 3F0PA 2F9OA 2GV7A 2LP6A 2Q1JA 5C20A 1W7XH 1L1NA 5ABWA 1H9HE 5T6GA 2ZC9H 2TPIZ 4NA7A 1BMLA 1O2JA 2TGAA 4KTSA 3F0OA 1JXPA 1MTSA 1MAXA 1O35A 2Y5HA 3TGJE 3BTFE 1KIGH 1AWHB 3HGPA 1N8OC 1OOKB 4FOUC 2FI5E 3E3TA 2PTNA 4JYVH 4IN1A 4A92A 1TMTH 1C1WH 4DJZB 4IS5A 4K2YA 1VCWA 3PROA 2FX6A 1QBNA 1Y3XA 2PUQH 3ZZ6A 5FPYA 3ZVGA 1MZDA 5GNDA 1F5KU 3SW2B 5IDKA 5JPMH 2SGAA 3OFND 2WYGA 1C4V2 1C9PA 2VVVA 3BTDE 3M5MA 3LGYA 1WSSH 3FP7E 3ZZCA 5T6FA 3LGWA 5EODA 1EX3A 1O2YA 1TFXA 5F6MA 1TPOA 4X6MA 1P05A 3BTKE 1EB1H 4CREA 3MH7A 1AD8H 1ZHRA 1HIAA 2QN5T 3R0FA 3QLPH 4A7IB 2FOFA 3SI3H 1ZOMA 4OGXA 4Q7YA 4IGDA 1P0SH 1YKTA 1FDPA 2FLBH 2BY8X 1P9UA 1GHWH 1VITF 1GBAA 1K1MA 3OTPA 4NCYA 5L30H 1L0ZA 2H9TH 2ZHEH 3SN8A 2OCVB 5H4IB 1O2HA 1UTKA 1T4UH 1G9IE 1ZRKA 2XW9A 2OBQA 5GXPA 1XUJA 3DSPA 5DP5A 5K0HA 4R8TB 1Y3WA 1C5OH 1ARCA 1O2VA 1WCZA 1DY9A 4ABEA 2ZHDA 3Q76A 1BHXB 1OWDA 4NA8A 1EUFA 2GT8A 4AFQA 3UB0A 2VNTA 5L2ZH 1UCYH 2XBVA 1P3CA 1TMUH 4XSKU 4M7GA 4A1VA 1O39A 4MPUA 2G55A 1O3MA 1SGQE 3CS0A 3ZV9A 4XFQA 2AGGX 1NTPA 1YY3A 3OX7U 2NU1E 2QC2A 3MU1A 3RXTA 2QF0A 5A2MH 5C5OA 2FX4A 4X0WU 1GDNA 1BDAA 4Y8ZA 6GCHG 2C4FH 2P3FH 3GOVB 1IAUA 1B7XB 1G3BA 2BOKA 1GDQA 4E7RG 1V2MT 4XBCA 1UTMA 4AGKA 1BTUA 3SNEA 1GJ6A 1FLEE 1ZYOA 3SV6A 2Q6FA 1EPTC 4WH8A 2D26C 4FVBA 1K9OE 1P2JA 2PHBA 1ZMNA 5DSFA 3SZNA 1IQGA 3DCLA 4B71A 1TNJA 1CU1A 3NWUA 1S0RA 1AN1E 2HALA 2QF3A 2WPKS 3I29A 5DP8A 4Y7AA 1C1PA 1T7CA 2W6JD 2XRCA 4Y11E 1SQRA 1SR5C 2P59A 1K22H 2M2AA 2XNIA 1F0UA 3FAOA 2ZQ1A 1HAHH 1W11U 1YPLH 2VH0A 3LC3A 1DUEA 1EP5A 2L6OA 1Y8TA 1NBME 1V2NT 4XD7D 2J92A 3VGCC 3RXFA 1BA8B 1QB6A 1H8HD 4UONA 2AERH 3MWIU 5L6NH 3EA7A 2PUXB 2FYQA 1Z6JH 1FPCH 1DM4B 2Z7FE 4B2BA 4HI3A 2OC7A 1SHYA 2PKAA 3G01A 3AW1A 1WQSA 1UCYE 4B6EA 1J16A 1DE7H 5F8TA 2VWLA 3A8AA 5EPNA 2Y81A 3IITA 1GJBB 4RSPA 2WINI 3K9XB 2ANYA 4O03A 5BRRE 3RM2H 5I46H 3BTQE 3PRBA 4K5ZA 4O3UA 4FU9A 4NWLA 1MD8A 3DFLA 2EEKA 1S6LA 1QHRB 1TNGA 3UNSA 2ZQ2A 3MO9A 4ZHMU 5TJXA 4YXWD 1AZZA 3N7DA 1BUIA 2C8YB 3D62A 2BD3A 1O37A 2A0QB 1QB9A 4FUEA 1H9LB 2Z94A 3SJ8A 1MTWA 2WPIS 1KTTB 2ZPSA 2PKSB 4D7FA 1GMCF 2G5VA 5LH8A 3VB3A 4O3TA 1YYY1 4P00A 1E36B 1H4WA 2NU4E 2ZFSA 4YOGA 2G51A 2GMTB 1F2SE 1S6FA 4ABBA 3ZZ8A 3BEIB 3H09A 3A87A 3A88A 1WOFA 1BMAA 4A1XA 2FIRH 3GICB 2QA9E 1ACBE 2W26A 2EI6A 5DGJA 1EXFA 1DWCH 8GCHG 3SGQE 2BLVA 4KTUA 1SFIA 1SGIB 1GMCG 1YCPM 4WXVA 1Z1JA 2A5AA 4BOHA 1TX8A 1DITH 2R9PA 1HBTH 1O2UA 1JWTA 2LNCA 3JZ1B 3KN2A 2C90B 3SU5A 3W95A 1CHOF 1K1IA 1GJ7B 1C5NH 1SMFE 1ELCA 1MKXK 1QJ6B 2ZNKH 1V2KT 2RG3A 1D3QB 3ATKA 1V6DA 1LKAA 2KCAA 1V3XA 1LPGB 1CQQA 1GHYH 2ESTE 2JDID 4CRBA 5A09A 4BAOB 1EAWA 3E0PB 1ELDE 2Z9IA 2QXGA 1L1GA 1O2OA 3DHKH 1AZ8A 4INLA 4WF8A 5EJ1A 4TYDA 1AWFH 1D3PB 3TPIZ 1C4U2 2ZP0H 1G36A 1KXDA 2Y7XA 3TU7H 1AVGH 1XKAC 2KCOA 1U6QA 2PP6A 4RT0A 1GMHF 4JZDH 4D9RA 1HIAB 3MH6A 2BY7X 5FCRA 2J9NA 3RC5A 2F3CE 3DD2H 1UTNA 1GI1A 1TGCA 4ZHAA 1FV9A 3A7WA 3BV9B 5JBAS 5DP3A 1C1OA 1O3NA 2IN2A 4H6SB 3SJ9A 1EPTA 2Z3DA 1IHTH 1K1PA 1ZPCA 1BMNH 4O9VA 3TJUA 3FZDA 3OEHD 2HLDD 2FOGA 3SU1A 3F1SB 3JZ2B 2FOEA 2RA0A 1FJSA 1KSNA 1Q3XA 3VG8A 5C0TA 4FUJA 3RC4A 3PLPA 1A2CH 2B0FA 5KECA 1PPBH 2VVCA 5DG6A 5LPFA 3MNBA 2TBSA 4H6TA 2VIDA 1C5LH 4H42U 2WUBA 3UOUA 3RUOA 2IPHA 5FHTA 2C8WB 2FM2A 4E7NA 1A61H 2SGEE 3F3BA 1VCQA 1YCPH 1UHBB 1WQVH 1C1TA 3MI4A 4WH6A 3P8OA 2TIOA 3FKSD 1A0HB 1SGFA 3WWBA 1THRH 4AN7A 4IN2A 2WPDD 1A7SA 5EQQA 1W12U 3PM3A 1DXWA 3HATH 2BQ7B 4Y6DA 1C5ZB 4TPIZ 3UREA 3H5CB 2CHAB 3M37A 4AG2A 2WPJS 3EA9A 1V2RT 4DIHH 2IPQX 1C5PA 3K6YA 1FI8A 4FUFA 4X6PA 1ELAA 1JBUH 4FUHA 1SOTA 5GIBA 1TABE 4NG9H 2BLQA 2TGPZ 1IQHA 3URDA 1OXGA 1YF4A 1BBRK 2ZDVH 2QCYA 2ZO3H 1G3CA 1HV7A 2XCFA 1PPCE 2VJ1A 5EGMA 1YC0A 4H4FA 2W3IA 6CHAB 1VJ9U 2A4GA 3ZYEA 2OQ5A 3ATIA 3L3TA 1LCYA 1SLXB 2VWOA 1ZMLA 3SU6A 3MNXA 1LQDB 1PPFE 2VH6A 2ILNA 2KR7A 2A7HA 2BYAX 4U30A 1NZQH 1O2XA 1GBCA 3MO6A 4AORA 3BIUH 4DIIH 4TY7A 3TNTA 1OS8A 6LPRA 1ZTLA 1S82A 2FS9A 1DWDH 1ZTKA 2EY4C 2VINA 1CO7E 3EQ0H 4AOQA 2HOBA 5GCHG 2BQ6B 4MNYA 1FIZA 4KKDA 1K1OA 1O2RA 4IC6A 4P02A 1Y5AT 2PTCE 1Q2WA 4JZEH 3UTUH 4WMEA 4YTAA 4INKA 3UQVA 1BQYA 4A6LA 2G00A 1OX1A 3KQ5A 1AFQB 3PMJA 2JH5D 2V0BA 1ZLRA 2O8TA 2VGCB 2F9NA 1TPAE 2BY9X 3GY2A 1EOLA 1NFXA 1P2QA 1SB1H 1TX6A 1P2MA 2OC0A 2Y5FA 4TWYA 1YPJH 1C2LA 1RD3B 1BIOA 1TGBA 2OBOA 3F2FA 2RDLA 2PSYA 2HVYB 2PLXA 2ODQA 3PV4A 3T62A 5E0JA 4JCNA 1HLTH 2YMSC 3MU0A 3SU4A 2THFB 1EZXC 4Q4LA 1G3EA 2LELA 4AFSA 1BTXA 1OWIA 3CENA 3UQOA 1OWKA 1FPHH 2Z9KA 2BOHB 4U01A 1SBWA 1VGCB 4YO9A 1GCTC 2J5UA 2F9UA 2BD2A 3PV5A 2VVUA 1GL1A 2FWWA 4FUCA 2P95A 2V3MA 5T6DA 2FOMB 5F53A 1C1MA 1FY8E 2P3TB 2VIQA 4TY6A 1AKSA 1BTWA 4PROA 2KCYA 1BRBE 1ESAA 1QL9A 4D9QA 1S84A 2BB4A 3ZZDA 2BDYA 1SGPE 1EAIA 3RXPA 3TK9A 2P8OB 4I8GA 1XUFA 3QTOH 1RJXB 3KHVA 2ZWLH 4DT4A 2IOTA 1C2HA 5SGAE 1MH0A 1QQUA 4ISLA 5EPYA 4OS5A 2YMSD 1KMHB 1RGQA 3ZVAA 4B6FA 1MMJN 3QTVH 1O5FH 1M9UA 2ASUB 3RXDA 1DVAH 3HGNA 2XCNA 3BSQA 1EASA 1SGEE 3VXFH 4AZ2B 4OS2A 1GBKA 1MU6B 3RMOH 3U8TH 4ABDA 3F9GA 2Z6BD 4F55A 2SGPE 3Q3KA 2O8UA 1BT7A 1KDQB 1C5MD 3M3SA 2Z9JA 2A1DB 1V2LT 3OY5U 1TOCB 3BEFB 3NXPA 2FI3E 2CHAC 3ZZBA 4JZFH 1K0HA 4WWYA 5A0AE 5DP9A 3BTEE 5HIYA 1V2UT 4I32A 1FN8A 1P57B 2XYAA 4BNRA 1LPKB 4IC5A 1PQAA 1O2WA 1BOQA 2QAAA 2VIVA 1O5AB 2PW8H 3RXRA 1ETRH 1G2LA 1QURH 5HM2A 3TVJB 2XWBI 1GI5A 1O3CA 1QZ8A 2KAIA 1YLNA 2P3UB 1CSOE 2IJOB 2QXIA 1KYNA 2FDAA 4NZQA 3SV7A 4K1SA 4AGJA 5C67A 1CT0E 2FI4E 1TA6A 5EXNA 1O2TA 2A7JA 2NU2E 4ASHA 3FVFB 4K1EA 3STJA 1VKYA 1HAVB 3GCHB 3QWCH 5C1YA 1NO9H 3KYGA 1GJ8B 1UVPA 1P06A 5CE1A 1QRZA 5A0CA 4BTUB 2OINA 1O2ZA 4AB9A 1O3PB 2WPLS 2J38A 4O97A 1IHSH 2GZ9A 4E06H 1T8OA 1MKWK 1ZR0A 3A7XA 1EJMA 2BQWB 4XOJA 4Y71A 5AF9H 1ESTA 2A4QA 3KF2A 1O31A 1XX9A 2HNTE 3D49H 1HJAB 1F7ZA 1QRWA 3TK6A 1Z1IA 4R0IA 4Y0YE 4HTCH 1HJ9A 1NY22 3A81A 4JYUH 2YNBA 4DY7B 1W13U 2ZPRA 4GLYA 4BANB 2ZEBA 2CF9H 1LVMA 1TQ7B 1LHCH 2W3KA 3QX5H 1KXCA 1YPEH 1GVKB 3A8BA 4WMFA 4DW2U 2BD4A 2WYJA 1O2MA 3V0XA 1CBWB 1AE5A 3LGTA 4Q63A 5CDFE 4DG4A 1J14A 3HK3B 1O2LA 1VGCC 1C1RA 1L2EA 4I8KA 5DP4A 3GY7A 3PMAB 4OS4A 1C2FA 1A5HA 1GHXH 2P94A 2DUCA 2HNTC 4MG3A 1KTSB 1GG6C 4ABAA 2PWXA 4BTTB 2FS8A 3MQKC 5CHAC 1A0LA 3S9AA 1O5EH 3C1KA 1VITH 2ZTZA 4ZKOU 2ZG0H 3TJNA 5CMXH 4B74A 5AFYH 2JH6D 2ZU2A 1UTOA 1C1NA 2BHGA 1Z71A 3P6ZB 4RI0A 5DJ7A 1UVTH 1TNLA 1LVOA 1GPZA 1O30A 2GV6A 1XXFA 4ACAA 4DVAU 1O2GH 1TRMA 4NZLA 3KQDA 5C5NA 2J4IA 3O8BA 2F9BH 2B7DH 4X1QU 3VFEA 1PPZA 1QRXA 1Y5BT 2ZGJA 3SNCA 2BVSH 3UFAA 4B2AA 4MLFB 1UTJA 3PRDA 3D65E 3VEQB 2XC5A 3RXMA 4X8VH 2C3SA 4B75A 2CV3A 1T4VH 1TPPA 1EAXA 1H1BA 1LQEA 1O32A 1VITG 4D8NA 1AO5A 4IMQA 1YGCH 2BD7A 1IOEA 2VBCA 2AHME 1HXEH 1D6RA 2FYRA 2NWNA 1FX0B 1K2I1 3NZIA 3A86A 2J94A 2XNDD 5J4SA 2AYWA 1FIWA 3S69A 3QDZB 4FUDA 2A45B 1AFEH 1NT1A 2ZDAH 4ZAEA 1SGFG 1HB0B 1A3EH 1MAYA 3RMNH 1OYTH 2RA3A 2XBXA 1ZHPA 5IK2D 1MKXH 1ORFA
chains in the Genus database with same CATH topology
3FP6E 3SU2A 3WY8A 4UD9H 4NFFA 1BRUP 1UTLM 1QJ7B 1OPHB 1XUGA 3EYDA 3FANA 8LPRA 2G81E 4IBLH 2XTTB 1PPGE 3TJVA 1L4ZA 3GCOA 1E35B 1XUHA 3BTGE 3E90B 1HRTH 3FP8E 4ZXYH 4YOJA 1O3EA 2FOBA 1B0EA 1SQOA 2B5TB 2VWMA 1GHZA 3B23B 5ETXA 3ZZ5A 5EW1H 3BTME 1LVBA 4UFEH 1MCTA 3SBKA 1IQMA 3PWCA 3GYLB 1BHXF 1SQTA 4CH8B 1XMNB 1C5YB 3TK5A 1DWEH 1SOZA 2ZGHA 3ZZ3A 1SLWB 3VB4A 3M7UA 3P95A 1IQNA 4MTBA 1L4DA 1TGTA 3F9EA 1BCUH 4KTCA 2TGDA 5E2PA 4BXSA 4ZHLU 1Z6EA 1GCDA 3M5NA 3HKIB 2ZU5A 5EG4A 3GY3A 3NCLA 2F9PA 5L2YH 1J15A 3QUMP 2SNVA 2BVXH 3BTTE 1P2NA 1JRTA 2I6QA 3D23A 1CBWC 3UWJH 1NRQH 2R3YA 2BDCA 2UUJB 2XXLA 3OSYA 3PLKA 1Z8IB 4I8LA 1C5XB 2AS9A 3P8GA 2C8ZB 2JETB 1L1JA 1O3AA 2BD9A 4ZXXH 3VB7A 4HGCA 3TGIE 1AU8A 4FUGA 3KEEA 3S7KB 2UWPA 1PQ8A 3UOPA 1LTOA 2FZZA 3LC5A 3EGKH 1E34B 1ZZZA 2ZHWH 4JK5A 1NFWA 1Y3UA 4CRFA 1SPJA 1HGTH 1MBMA 2AGEX 1T31A 2CF8H 3EBNA 1WYKA 1PYTC 1XUKA 4VGCB 1O3FA 1J8AA 1Z8JB 4XE4A 5IYTA 4ZUHA 2KAIB 1DOJA 2TGTA 2SGDE 1EZSC 1VJAU 1PFXC 1ANCA 2HWLB 1FY3A 4F49A 4SGBE 1OP8A 3A8CA 1YPGH 1O3BA 1QIXB 3A80A 3P8NA 2ZI2H 1D6WA 1BJUA 1Y5UT 2ZDKA 1ELGA 2I6SA 3E16B 1BBRH 3ODDA 1MQ6A 5DP7A 2RCEA 3M35A 2FPZA 4ZROA 1JOUB 4IMZA 3KNXA 4X8TH 5EQRA 2GVFA 1AVWA 3RDZA 1D4PB 1B5GH 2OLGA 2LIZA 2O8WA 2BLOA 2GCHF 1HAZB 2EC9H 4CH2B 3A85A 3H7TA 1S81A 3DA9B 2WUCA 1YLDA 4GHQA 3STIA 1GI8B 2ODYB 2BDHA 1JIMA 1RIWB 1KLIH 1EQ9A 5F03A 3A7VA 4GPGA 2A4RA 1EAUA 4K60A 1O3DA 1F0SA 4MNWA 1HAXB 3ZZAA 3MU5A 3O8DA 4Q7ZA 4FVDA 4ABHA 2ANKH 1GBBA 4FUBA 5JB8S 1EB2A 3RP2A 1SVPA 2GCHG 2ZGCA 4NFEA 3RXBA 3T26A 1V2VT 1JRSA 1IQIA 4YLUA 1XM1A 1O2QA 1D3DB 2BDIA 3L33A 5B6OA 1FUJA 4ABIA 1W2KH 2JKHA 3T28A 2AMDA 3ATMA 2FP7B 1RS0A 3LU9B 1CHOG 2FO9A 4DURA 3TGKE 1MZAA 2XBWA 1TX7A 1HXFH 2GX4A 1YLCA 3AAUA 3SNAA 3P92A 4JYTA 4MNXA 2FTMA 4TPYA 1ZGVA 3I78A 1DUAA 2FXRA 1O38A 1GBHA 3ZVDA 1F92A 2XWAA 4I31A 5DP6A 3SJIA 1KLTA 1P10A 1GL0E 7GCHF 1JIRA 3BEUA 4XBDA 2ZDMA 1TBRH 1TGSZ 3FFGA 1YPHE 4X1RU 1Z8GA 3DT0H 3SU0A 1OWHA 4LZ1H 1LO6A 2V6NA 4BTIB 1BBRE 4KELA 3QGJA 2ZFRH 3U9AH 4KP0A 1GMHG 1TIOA 1TAWA 2BX3A 3O8CA 3T29A 1O2NA 1V2WT 4ZMAH 2FOHA 2JETC 5HM9A 3T27A 3UUZA 2GCTB 3BG4B 1ETTH 1P3EA 3Q3XA 3I77A 2P93A 2VWNA 2ZU1A 3F6UH 1UMAH 1QR3E 2WV4A 5A8XA 3PYHA 3LT3A 2FTLE 2GD4B 3GDUA 1YPHC 4RN6A 1ANDA 1MTNB 3KQCA 3ENSB 2ZCKP 2OUAA 1AMHA 2ZFFH 3Q77A 2ODPA 2CGAA 1KY9A 1IQFA 3U8RH 1FMGA 2ZIQH 3N7OA 4CR5A 4YM9A 4VGCC 3SU3A 2G4UA 1V2PT 1WBGB 2PKSC 1OYQA 2CN0H 4AYVB 3HK6B 3MH4A 1RRKA 2GDDA 3UY9A 4CRCA 1ZSKA 1O5DH 1AE8H 1BTPA 5A0BA 5JBCS 1GJ4H 2GMTC 4OS1A 1SLUB 1O36A 1D9IA 1ETSH 4GHTA 2PSXA 3S0NA 1GBTA 2Y82A 2R2MB 1ELBA 3U1JB 4HFPB 1BZXE 1TOMH 3UR9A 4MDSA 1SGCA 3BTWE 1EJAA 2OXSA 1XXDA 3LGIA 3QK1A 1A0JA 5EQSA 1ZMJA 3PTNA 1ZHMA 5C3NA 4B2CA 1GI7B 2H1UA 3M7QA 4X6NA 2H6MA 4Q7XA 1ZGIA 4DGJA 1ESBA 2WPMS 1IQEA 2ZZUH 1GJCB 2BD8A 1GGDB 1MKWH 1GBLA 1OWEA 3LGVA 1GJDB 1EOJA 1THSH 5FBEA 2R0LA 3E91A 2BY5X 1GI4A 1SG8B 3U69H 2PKAB 2FLRH 1W3CA 1MBQA 3MNSA 3M5LA 5EXMA 1ZSLA 3FZZA 3BN9A 2YOLA 4NIWA 1TWXB 1GI3A 2ZKSA 4UDWH 1GMDF 3ZZ4A 1SHHB 2K7XA 2J34A 4UFDH 1OP2A 3IWMA 2AFQB 4Y10E 2BM2A 4ABJA 2Y7ZA 4B1TA 2B9LA 4Z6AH 3P17H 1T8NA 1N8OB 4LZ4B 1DT2A 3BIVH 1SGRE 1QCPA 2Y80A 1TBQH 3LJOA 4X8UH 1SGYE 3LPRA 3ZVFA 5E0GA 2O8LA 2G8TA 1KXBA 4HZHA 4JZIA 2TRMA 4OS7A 1KXEA 1HFDA 1A5GH 1DICA 3GDVA 3RXIA 1J17T 8ESTE 1AIXH 3SQHE 1QNJA 2G5NA 3RLWH 1G37A 1HAIH 1O3KA 1PQ5A 3PO1B 3A7TA 3ZYDA 1AHTH 3P8FA 1XKBC 4YT6H 1MQ5A 1GJAB 3EA8A 1MU8B 1AI8H 3E6PH 4ZKSU 3SHAH 1RXPA 5C1UA 1C1QA 1TRYA 2PFEA 2Y5GA 3RU4E 2R3UA 5EW2H 2SFAA 3F9FA 1NM6A 4CRGA 4IW4E 5HGGA 4Y8YA 1LHEH 1ZPZA 1SGTA 3AW0A 1E0FD 2PGBB 1EJNA 5GDSH 1FNIA 3U1IB 2Z3EA 1P2OA 2Z9GA 1TRNA 3AVZA 4AG1A 5C2ZA 1S0QA 1ZSJA 4F4OC 5I25A 1ZJDA 1KXFA 1ID5H 1GBJA 2HNTF 1SLVB 2ZPQA 1GBIA 1GI9B 4X2YA 1UK4A 2HPPH 3MYWA 2ZFPH 1C1VH 4Q80A 2Q6GA 4BAKB 1C5QA 2XC4A 9ESTA 2M5TA 1K1JA 2OC1A 2P16A 2ULLA 1CVWH 5FPSA 4WMDA 2D1JA 2QYIA 2A31A 2STAE 6CHAC 1AY6H 2ZECA 1YPKH 4CBOA 2K1QA 5HYOA 3F9HA 1FONA 1TNHA 4RKOB 4ISNA 4Z0KA 1UVOA 1C5RA 3V13A 4YT7H 2GZ7A 1W14U 1DXPA 3RXUA 3U98H 1DSTA 2GP9B 1O2KA 1DPOA 1WV7H 3ODFA 2GGVB 1EPTB 1C2IA 1C2EA 2FMJA 1N6XA 1ZJKA 5FPTA 1O3GA 1KXAA 1AB9B 3GY8A 1AFQC 2ZHQH 4ISHH 1GDUA 2WPHS 2VGCC 3SUGA 1X7AC 1SQAA 1GHBF 3TH4H 1DX5M 1KLJH 3ELAH 3LIWA 4LXBH 3SJKA 2OC8A 1FY5A 1Q31A 3LH1A 2ZA5A 3SQEE 3MU4A 1WAYB 1GJ9B 5E2OA 3UWIA 3ZV8A 1GHAF 4E05H 2BVRH 3HPTB 3OU0A 3T5FH 3ITIA 3RMLH 3SNDA 3K6ZA 4I8JA 2STBE 3ZZ9A 1GI6A 5ESBA 1ZTJA 2GDEH 2OTVA 3VGCB 1C1SA 1ELVA 1EZUC 2D2DA 4X1NU 2HVXA 4DT7B 2BD5A 1GHBG 1GBDA 3BTHE 1A3BH 1P09A 3M61U 5AVDA 2Q6DA 5GPIB 1BMMH 5PTPA 1F5LA 2FODA 3UNQA 1PJPA 1UO6A 4U2WA 3EAJA 1NRRH 3NK8A 4CHAB 1GHAG 1QL7A 5F8XA 5DPAA 3SUEA 2VU8E 4WXIA 3K65B 1INCA 2CMYA 1MD7A 4LOYH 3T2NA 3PO1C 3SV2H 1PPEE 1LHDH 4ZKRU 2P8OC 5LPEA 3RXQA 1A46H 5ESTE 1P8VC 1BTHH 1XUIA 2ZTYA 2GKVE 2XC0A 3NUMA 1AUJA 4J1YA 4ZKNU 5JYIA 2BXTH 4SGAE 1SI5H 1W0YH 1UVUH 2H9HA 1CT2E 2W5EA 5FX5A 1ANEA 2BDGA 3A84A 1C4Y2 1TPSA 2A2QH 1ARBA 1CT4E 3O8RA 1ABJH 4NSYA 7ESTE 2BY6X 5JBTA 3AAVA 4K8BA 3SUDA 3OYPA 3RXGA 3L6PA 4X2XA 2EA3A 1IQJA 2GZ8A 3QN7A 1OWJA 2EI8A 2QXHA 1CA0B 6GCHF 5K7RA 3PMHB 1W8BH 2SNWA 1NRPH 3A89A 5JBBS 1HAOH 1HAGE 2A7CA 3KGPA 3ZZ7A 1W7GH 1FY4A 2QIQA 3KIDU 1UK2A 1LMWB 4NIVA 1QBVH 1UHBA 2H9EH 1TLDA 1T8MA 1ELEE 2ZHFH 4Y8XA 1TYNA 1UK3A 1GI2A 2A32A 3GCHC 1HCGA 1W10U 2SGQE 2BDBA 3MU8A 4ABGA 2UUKB 2W7SA 1O2PA 3SOSA 3UIRA 1ELFA 2O9QA 1N6YA 2F9VA 1TA2A 3RXAA 3MHWU 2AIQA 1C2MA 2J2UA 2PV9B 3Q3YA 2GTBA 1AB9C 1RFNA 1TNKA 1C5WB 1GVZA 2BLWA 4NIYA 3UPEA 1AKSB 1H8IH 1DWBH 3GYMA 1HJAC 3RXOA 1NRNH 2ZDNA 4THNH 3H7OA 1E37B 2BZAA 3M3TA 3GCTF 1GBFA 1NC6A 1WTHD 3VB5A 2ZTXA 4FUIA 3UNRA 1EKBB 2ZU4A 3EDXB 3RXKA 3VB6A 2FESH 1UTPA 4X2WA 3A7ZA 2UUFB 3NKKA 4GUXA 3SNBA 1TONA 3ATLA 3TH2H 4I7YH 5EU8A 2ZFTA 5BPEA 1CGIE 4U32A 3RMMH 1LHFH 1QY6A 3GY6A 3RXEA 2VB0A 2BDAA 3E8LA 3RXHA 2UUYA 1O5BB 2Z9LA 1Y3YA 3GCTG 4UEHH 4A5TS 5DO4H 1FY1A 1OSSA 3PMBB 3E0NB 1AVXA 1YM0A 1C2KA 1OP0A 2ANMH 2BTCE 2H5DA 4CHAC 1Y59T 3KQEA 4X2VA 4AYYB 3T25A 2R2WU 2AMQA 4XBBA 1NN6A 2A4OA 2Y6TA 3RXJA 1G30B 2D8WA 4X8SH 1C2DA 2GT7A 3M36A 1T32A 1Y3VA 1YPMH 2F83A 3HKJB 4MPWA 2QV1A 1F5RA 1FQ3A 2QY0B 1GVLA 2UWOA 3GCNA 2LPRA 1A4WH 1WUNH 3W94A 3URCA 2HRVA 4K69A 3B8JA 3A7YA 4GCHF 3VXEH 3RXLA 3TNSA 2FEQH 4AB8A 1HNEE 1QA0A 4ISIH 8GCHF 3RU4T 2JH0D 3CP7A 4MPVA 1QBOA 3PLBA 1QQ4A 4X6OA 3ZVEA 1BRCE 1CA0C 4FU7A 2A5KA 1DSUA 3UR6A 3SUFA 1HYLA 1PYTD 2AMPA 3TLOA 1C9TA 3V7TA 1G3DA 1UCYK 1QB1A 1SC8U 1P02A 1TB6H 2YNAA 2V3HH 4GCHG 2BXUH 4WVPE 8KME2 4ESTE 2J95A 3A83A 2ZGXH 1TGNA 1G2MA 4ISOA 3K2UA 4TWWA 1TNIA 1JMOH 4MVNA 1KDQA 4GVUA 3MMGA 1P2IA 4Q2KA 1UTQA 1C5UA 1FXYA 1MTVA 3R3GB 1VR1H 2F91A 2ZDLA 5AHGH 1SSXA 1BTZA 3SJOA 1LVYA 5LGOA 1FAXA 1C5VA 2R0KA 1YP9A 1ELTA 4OS6A 3GISB 3KL6A 2ALVA 1BTYA 1BITA 1Z8RA 1C2JA 1WTGH 2ANWA 1D3TB 1BRAA 4B76A 1P04A 3IG6B 1B0FA 3GY5A 2CXVA 4K1TA 1DLEA 3KQBA 4CR9A 2WV5A 1E38B 3QZQA 1DDJA 1O34A 4I33A 1TALA 3ATWA 4Y0ZE 1QA7A 1S83A 1HAVA 4A1TA 4DOQA 4LK4A 5FCKA 3KCGH 1O0DH 3SHCH 1SGDE 3TJOA 4BXWA 4UE7H 1THPB 5DK1A 2OP9A 3V3MA 1GCTB 2A2XH 3OTJE 3SGBE 3PWBA 5J4QA 1FAKH 1NFYA 3LGUA 4JK6A 6ESTA 7GCHG 1NU9A 3DUXH 9LPRA 2C8XB 3RXSA 4DCDA 1S6HA 1ZRBA 1BJVA 3MO3A 2C93B 1EP6A 3SV8A 3BF6H 2ZF0H 1PPHE 2G4TA 3E1XB 4I8HA 1O2IA 5A8ZA 1FN6A 2ZCHP 4Y79A 4GSOA 5GJ4B 4Y7BA 1AUTC 7KMEH 1HDTH 2PGQB 3LKWA 2H2ZA 1LHGH 1SFQB 3M5OA 2NU3E 4KGAA 1CHGA 3LONA 1YBWA 3S9BA 4OGYA 1NFUA 4AFZA 1K1LA 3AASA 3SV9A 1IQLA 1TQ0B 1RTFB 3TIUA 2W7UA 2SGFE 1AQ7A 1TE0A 3MOCA 1ABIH 3S7HB 4NA9H 5G4BA 5JDUB 1V2JT 3VPKA 1EZQA 2BMGB 1FZZA 1ANBA 1PQ7A 3LJJA 5FXLA 2V3OH 1HUTH 3GY4A 2HGTH 2BZ6H 3MNCA 3LDXH 3QZRA 5GCHF 3Q00A 1DANH 1MUEB 1RIWC 4JMYA 1SGNE 2EI7A 1W0ZU 4CRDA 1T8LA 1P03A 3RXCA 4NSVA 1QTFA 3M3VA 3SO3A 1V2OT 7LPRA 3SORA 1O2SA 3TITA 2VIWA 1C2GA 1HPGA 2UWLA 4FU8A 4MPXA 1C5SA 5TCAA 1H8DH 1MTUA 5C1XA 1LKBA 1S5SA 3F68H 3V12A 1O3IA