2D2DA

Crystal structure of sars-cov mpro in complex with an inhibitor i2
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
301
structure length
301
Chain Sequence
FRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQCSGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Wide-Spectrum Inhibitors Targeting Coronavirus Main Proteases.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase
molecule keywords 3C-like proteinase
total genus 79
structure length 301
sequence length 301
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2005-09-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 2d2dA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d2dA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2d2dA02
1GBHA 1TNKA 1FI8A 1XUJA 1UMAH 1AQ7A 3QTOH 2SGAA 4ZUHA 1RS0A 2QV1A 4Y76A 1LHCH 4FUFA 1JMOH 1AO5A 2FS8A 2GT8A 4THNH 1O5DH 1QJ6B 2STBE 3U69H 4DCDA 1TFXA 1O3LA 3U8TH 1NU7B 3SJOA 1IQHA 1GHVH 1LHGH 3KF2A 1V2NT 3W95A 1C2EA 2BLWA 1A5HA 1O3CA 3ZVAA 3M3VA 2EI6A 2TIOA 2I6QA 1GPZA 4ESTE 1GBTA 1S85A 5DP6A 1HUTH 4GLYA 4Z0KA 5EPYA 1H8DH 2CHAB 1Y3VA 4AYYB 3M3TA 2VINA 2NU4E 3BG4C 3A87A 2ZPSA 1SGTA 5CHAC 4NFEA 4KELA 1ZYOA 2TBSA 1OWHA 2SGFE 4NSYA 1BZXE 4Y7BA 1GMDF 2JH6D 1YLCA 2LNCA 5GJ4B 1MKXK 1MKWH 2B8OH 2J95A 3NKKA 4TY6A 1TYNA 4ZHAA 1QTFA 2F91A 3AASA 3F68H 3AW0A 3BEUA 2I6SA 2P8OB 2ZI2H 1ESAA 4OS6A 4TY7A 3KEEA 1C4U2 3SQEE 3AAUA 3H5CB 4CRAA 2FOMB 1W7GH 3SV7A 5E2OA 1A0JA 2FO9A 1XUFA 1C1TA 2AS9A 3UIRA 1N6YA 4FVDA 4F49A 3D65E 3ZVFA 2HOBA 3TLOA 1DWBH 2PKAA 3HKIB 3RU4T 1MBMA 4U30A 3FP6E 1O2SA 2XC4A 1MU6B 1GJ9B 2IJOB 3UQOA 1FY4A 1IQMA 3EA7A 3D62A 1AFQB 1CGHA 1O5AB 2FS9A 4I8KA 4O97A 1C5OH 1A3BH 5E2PA 4MQAA 2BLOA 3HK3B 4CH2B 1EP5A 1ACBE 5HM9A 1SL3A 5DKMA 2QN5T 4I8JA 3HGPA 4X8SH 1MQ6A 1VJ9U 3EGKH 2A4OA 1HAOH 1CHGA 1Y5UT 3LGIA 5ESBA 1MQ5A 4IC5A 4D7GA 3SU5A 5FHTA 4X6MA 2AYWA 2H5DA 1ELTA 1CE5A 1F92A 2ZTYA 1PPGE 1GL1A 3WY8A 1T8MA 1T4VH 2FTLE 3A86A 2OXSA 1DUAA 5C5OA 2H9TH 3M36A 3TJUA 2BVSH 1TNHA 5TCAA 2RCEA 4FUDA 3O8RA 1KY9A 2GTBA 1LVOA 1BDAA 4Y0YE 3MI4A 3HPTB 3MYWA 1GHAG 1C5TA 2CJIA 2R9PA 2G5VA 3A82A 5HGGA 4CBNA 1IQJA 3SGBE 2XBXA 1ZSLA 4D9RA 1P3CA 4B2CA 2V0BA 3QZQA 2DE8A 2OC0A 4B76A 1PQAA 1C5LH 2BVRH 1O3NA 3A7ZA 3GY4A 2THFB 2ANMH 1V2RT 1ESBA 4YLQH 1P8VC 2TGPZ 1UK2A 1PPHE 4WMFA 4BAQB 3UFAA 2H2ZA 2ZPRA 3F9GA 4TWYA 1B0FA 1YPHC 4X1NU 2XBWA 5BRRE 3GOVB 2GV6A 1TA6A 2VJ1A 4NIXA 4B2AA 1GBCA 4I32A 2A4GA 4Y0ZE 1ZPZA 2WUCA 1C1RA 4IN1A 4AFQA 4Y10E 1G32B 3UPEA 1WTHD 1GHXH 2EEKA 2PUXB 2FOCA 1NU9A 1DT2A 5F8TA 1GBDA 1CQQA 2VWNA 4X2WA 1O32A 3SV6A 2A7CA 2GT7A 1IOEA 2WV5A 3F9FA 4NA9H 1B0EA 3BEIB 3NPSA 1BCUH 2IN2A 4X2VA 2J34A 3FZZA 1C2FA 3QLPH 2FYRA 1DS2E 4PROA 3BTWE 1MU8B 1W0YH 2R2MB 4BXSA 5A8YA 3TNTA 2PKAB 4GPGA 1GG6B 1BTZA 2FEQH 1SI5H 2WINI 2ODQA 1QL7A 3MO3A 3MO9A 1ANCA 4DJZB 4D9QA 4LZ1H 4XBBA 1GJAB 2Q6FA 2VB0A 5GCHF 3U1IB 1OYTH 1CVWH 4E7RG 3ZZ4A 1O3FA 1F5KU 2AFQB 1FUJA 1IQNA 2ZCKP 1ZHMA 3MWIU 3RXUA 2HALA 3QTVH 1CBWB 5A0BA 2VH6A 1EQ9A 1MUEB 1UK4A 4H6TA 1ZMLA 1DXPA 1KXEA 1OPHB 7LPRA 3MNCA 3KQBA 4UONA 2ZFSA 1IQEA 1AHTH 1GVZA 4NWKA 1MTVA 2BDAA 4ISHH 4MNYA 2UUKB 2V35A 3RMNH 1A46H 1S0RA 1NRNH 2XWAA 1TBQH 1GG6C 2CXVA 2ILNA 4X8TH 3ZZBA 1SGFA 2Z9KA 4UE7H 5AF9H 2F3CE 4CHAC 1O5BB 3A7WA 1E36B 2Q6GA 4X6PA 2VWLA 3S0NA 1H9LB 3RXRA 2P8OC 1QBOA 5DG6A 1KLJH 1YC0A 3LDXH 1TALA 1OYQA 4Y6DA 4IW4E 4IMZA 1IQIA 5EW2H 1KTSB 1Z8IB 3N7OA 1GBBA 2VVCA 2GMTC 1V2LT 1V2ST 4AG1A 2Z3EA 1AWFH 1HNEE 1FNIA 1UTNA 3FP7E 3ZVBA 1S0QA 1YF4A 4I8LA 3QZRA 1LHFH 3T2NA 2O8TA 5HM2A 1G2MA 1SGFG 3K6YA 1CBWC 2FYQA 1KXDA 3QN7A 3SGAE 1YBWA 1RIWB 1W13U 4E05H 1OOKB 5GCHG 1Q3XA 3ODFA 1SGRE 3MU5A 3BTFE 3C27B 4WF8A 2C3SA 1UTMA 1DUEA 4OS2A 5HXFA 5HYOA 1LVMA 2M5TA 2A4RA 3F6UH 1GHBG 1NRPH 2EC9H 3O8DA 2FIRH 1F0RA 1BTWA 4DURA 2R2WU 4U32A 5HMAA 1LPKB 4ZROA 3UWIA 2OP9A 1HXEH 1TGTA 5T6GA 1CHOF 1HAZB 3A80A 1TWXB 1QHRB 2A2QH 5LPFA 2RA3A 1H4WA 2FOHA 2G55A 2BQ7B 3O8CA 1MCTA 2GX4A 4A1TA 3E90B 7GCHF 1J17T 3E3TA 3M7TA 1BOQA 5ESTE 4OS7A 2ZG0H 3MU8A 4JZDH 2ZDAH 1O2TA 2GP9B 2BQWB 1GWAA 1HDTH 5LPRA 2FM2A 5L2YH 3GY8A 1EOLA 1LDTT 1C5YB 1BJVA 4JZEH 1BRBE 1GJBB 2BZ6H 1WYKA 3SNBA 1E38B 2ULLA 1E35B 1BQYA 3LT3A 4AGKA 5FXLA 5EODA 2FODA 3V13A 1P9SA 3UR6A 2HNTC 1GVKB 1EPTB 2ZU5A 1C2IA 3ZVDA 3UR9A 4TPYA 1O30A 3RXDA 2ODYB 3K9XB 5FAHA 1GI6A 2EA3A 3UTUH 1V2TT 1Z6EA 4A1XA 3K65B 1PJPA 5GIBA 3BTDE 2C8YB 3VPKA 4UFGH 2J94A 1TIOA 3A85A 2K1QA 2QC2A 4CBOA 3ZZ7A 1P2MA 1KDQA 4X8VH 1W10U 1CT4E 1RFNA 1K28D 1KLIH 1Z71A 2VIQA 1G3DA 1GDUA 1B7XB 2XCNA 3TK5A 1MTNC 4K8BA 1WTGH 4FUJA 1FN8A 3PM3A 1K1JA 1P06A 5DP8A 3SJ8A 1BHXF 4A92A 1FQ3A 2CHAC 1GBAA 5DP5A 3ZZ8A 3H7OA 5G4BA 1QL8A 2XXLA 3L33A 1ZRBA 1C2DA 1VITG 2QGRA 2Y7XA 1F0TA 3LU9B 1O2PA 1SBWA 2BOKA 1SLVB 5F8XA 1EAUA 2ZO3H 1WQSA 3UWJH 2W5EA 2P3FH 1O5CB 1QBNA 1PPBH 3FVFB 1SLWB 2ZFRH 1L0ZA 1P2KA 4Y8YA 5TJXA 1GGDB 1YCPH 1W2KH 1AB9C 1NROH 2A45B 2QXIA 3SV2H 1QB6A 1TMBH 2ZHWH 5AFYH 1HBTH 1RRKA 1HAXB 1WAYB 3GDSA 1ANDA 3C1KA 3RMMH 1BTUA 4ISNA 3GYLB 3B23B 1RTKA 1RTLA 3GCTF 1TX7A 1HJAC 3PMBB 1DPOA 1ANBA 1G9IE 5LPEA 3T27A 1ELAA 3I77A 5GDSH 4U01A 1BB0B 3KIDU 1XUGA 2YNAA 3KQEA 8GCHF 4E7NA 2OQ5A 2H1UA 1GJCB 1G3EA 1MAYA 3Q3KA 4MG3A 1NRQH 1O2WA 1UCYE 2FI5E 2OBOA 4VGCB 2D8WA 5EOKA 3IWMA 4J2YB 1MTUA 4XSKU 3G01A 1P05A 1D3TB 1JWTA 1L1NA 4MLFB 2P3TB 2SNVA 2SGDE 1MTSA 4DOQA 4O03A 1Y3WA 3AAVA 5K0HA 1SOZA 1DXWA 1HJ8A 1E37B 4ABAA 3RXOA 4I8GA 1Y3UA 2ZDKA 1SFQB 2ZFPH 1TOMH 3MH7A 1AB9B 2ZFTA 1HJAB 2W7SA 1GI1A 1QFKH 4ZMAH 1DOJA 1T8OA 1W3CA 2BZAA 2ZU2A 2HNTE 1S6HA 3S7HB 3S69A 1OXGA 3EA8A 2GZ7A 5FBEA 3OY5U 2C8WB 2WPKS 3UNRA 1AE5A 1INCA 3RDZA 1FAKH 1BHXB 1E0FD 1BBRK 1BT7A 3VGCB 2C93B 1SG8B 2ZDLA 1XVOA 1TRMA 2ZGCA 4OS1A 4OS4A 2A7HA 1YPKH 2A4QA 1GBKA 2XC5A 4MNVA 1BMNH 1AD8H 2SFAA 1LQEA 1C5UA 1ESTA 1SHHB 2V3OH 4FUEA 1F5LA 3GDVA 4JK6A 1OX1A 3B9FH 4WJG2 4D8NA 4YOJA 2Y80A 4M7GA 2XC0A 4AOQA 4UDWH 2CN0H 3TJVA 3UOPA 4NIWA 2ZHFH 4ISIH 3K6ZA 3Q3XA 2AGIX 3A7YA 2ZF0H 3P17H 3UNQA 2JETC 4MTBA 1ZMNA 2OUAA 4BTTB 3R0FA 1P04A 4X2YA 4KGAA 1BRUP 5DPAA 1YGCH 2AH4X 2O8MA 1D6RA 1V2UT 5E8EH 1TGCA 3GCHC 4TYDA 5BPEA 4ABEA 1D3QB 2D1JA 1QL9A 4JZIA 5E0JA 4ABBA 2PV9B 3BTQE 2Z3DA 3SU2A 2OQUA 1EPTC 2ZDNA 1DSTA 3I78A 2ESTE 1X7AC 1TB6H 4H4FA 2B0FA 3SUDA 4CR5A 2EI7A 2ZGJA 2A5KA 3SNAA 2TGDA 4BAKB 2FP7B 1S5SA 4XBDA 4WMDA 1G37A 2BLQA 2QXGA 1EASA 3BTTE 1W11U 2BOHB 1DM4B 5DP4A 5DGJA 3FZDA 1JIRA 1K1MA 4E06H 3OY6U 4X1QU 2RDLA 3GY7A 1O5FH 3RUOA 3RXSA 1MH0A 4ZAEA 2G51A 1WQVH 2AEIH 4UD9H 1EB1H 1HGTH 1NS3A 2TGTA 1N8OB 2OINA 1QRWA 1QB1A 4INKA 1T32A 1C9PA 3ATMA 1SQTA 2J9NA 3PLPA 1O2HA 1FN6A 2Z94A 1VITF 3IG6B 1C5RA 1OWIA 1MCVA 1P2JA 3PMAB 3ZVEA 4BAMB 1O2IA 1T4UH 1GHWH 1V3XA 2F9UA 3M7UA 3VB3A 4BNRA 1HLTH 1O2XA 2PTCE 3LGTA 4UEHH 2GCTC 3TGKE 1KXFA 4K1EA 1NPMA 3IITA 2FMJA 3TGJE 1Y8TA 2Z9IA 4GHTA 3VB5A 2ZIQH 4Y8ZA 2J38A 3Q76A 1GMCG 1RTFB 5F8ZA 4K8YA 1FJSA 3PWBA 2Z7FE 1EATA 3QWCH 1Z8JB 2GGVB 1OS8A 3E0PB 2DE9A 4AFUA 1OWKA 1SR5C 1XUKA 3FANA 3ZZDA 3TJNA 3SGQE 1NN6A 4NA7A 1WBGB 3V3MA 1UHBA 1GI7B 5DO4H 1TGNA 1TBZH 1HXFH 1F7ZA 4QT8C 4K3JA 3UQVA 1FV9A 3BTHE 4Y7AA 2VIOA 2STAE 2GKVE 4ASHA 3Q3YA 4CRDA 3OU0A 4AFSA 5DP9A 1AUJA 3B8JA 4DIHH 4O3TA 1LO6A 1GI2A 2WYJA 3GY5A 1TOCB 2PKSB 4FVBA 3SU0A 1G30B 1GJ8B 4FXGH 1C5XB 3CP7A 3CS7A 1UTPA 3LJOA 2WPLS 2HPQH 3GICB 4A5TS 1GBIA 1D6WA 4KP0A 3P92A 4AB8A 1YCPM 2ZHDA 4BOHA 1NRRH 1V2MT 2BD7A 3KN2A 4Q7XA 1K1PA 1XKBC 1HAGE 1S84A 5A8ZA 1AVGH 5EQSA 1C1WH 2VVVA 2IOTA 4RSPA 3KCGH 1V2PT 1QB9A 5EQRA 1HAPH 3BEFB 4IC6A 4NIYA 4RKOB 2PLXA 1QQUA 2Y81A 1SSXA 3E0NB 3M7QA 1ZGVA 4O3UA 1AUTC 4R8TB 4AG2A 1DFPA 1PPZA 1C9TA 8GCHG 5J4SA 1GI3A 1QIXB 2FX6A 1C5VA 1C2MA 1Z8GA 1WU1A 1OP8A 1MD7A 2W26A 1LKBA 1HIAB 2JETB 2BD4A 3SHCH 3S9AA 2Q1JA 1UCYK 1NO9H 5ABWA 1CA8B 2A5IA 3SO3A 2HVXA 1UTOA 5C20A 5CE1A 9LPRA 3RXMA 1ZPCA 4GAWA 3RMLH 1V2QT 3TK9A 1ELDE 2FPZA 3ZV8A 1BITA 1IAUA 1TE0A 3ESTA 3UREA 1S82A 1TQ0B 3GCNA 4XDEA 2A5AA 2UUJB 1EP6A 1ANEA 4CRBA 1XVMA 3VB4A 1J8AA 1O2MA 2SNWA 1C1NA 1GMHG 1YPEH 4J1YA 1AFQC 2BXTH 3SOSA 5JYIA 2FOGA 3SNDA 2Z9GA 4MPXA 3KGPA 3A84A 5C5NA 2VVUA 1BTYA 1N8OC 4MPVA 3SZNA 1C5ZB 1TNIA 3STIA 1C1SA 4ZXYH 2BDHA 2Y6TA 4X0WU 3RXLA 1ZOMA 2XCFA 1DSUA 3SU1A 8KME2 2F9PA 4NCYA 5JBCS 3BSQA 3PTNA 1P2IA 1O37A 1TABE 3RC4A 4I7YH 3P8NA 2ZHQH 4WVPE 3P95A 3QK1A 3MOCA 1VCPA 2PSYA 1C2JA 1P12E 3RC6A 3DHKH 4Y71A 1K9OE 1GBEA 1IHTH 1GMDG 4X1RU 5E0GA 1NZQH 4BXWA 1UVPA 2GCTB 1XXFA 4Y8XA 2W3IA 1AI8H 1O3DA 1J9CH 4MNWA 2TGAA 2Z6BD 1IQGA 3TITA 1F0UA 3GCHB 5DP3A 1VCWA 3AVZA 1LHDH 2BTCE 4ABHA 3SI3H 1K22H 1O2OA 1P01A 3HGNA 1O31A 1TRYA 1LQDB 4CRFA 2RA0A 4K1TA 4UFFH 5JBAS 4MPUA 1SQAA 5EXLA 1VGCB 1AKSA 2BD8A 2WPIS 3KNXA 2FOAA 4I31A 1BJUA 4JCNA 1CGIE 3EYDA 4Z6AH 4ZKNU 1OWEA 4H6SB 5JB8S 3EBNA 3ZZ3A 3A81A 1GGDC 1EOJA 1ELGA 1WOFA 2G52A 5GWZA 1AY6H 1NY22 3P8OA 2GMTB 1P10A 4MNXA 1TONA 4Q7YA 6CHAC 1N6XA 3GCTG 5A09A 1O2ZA 2FTMA 1DWDH 1XXDA 3LC5A 1MZAA 1UO6A 1GHBF 1MTWA 3GY3A 1T8LA 1XM1A 3M5LA 1SQOA 3P8GA 3RXQA 2AERH 3M5NA 5AHGH 1ZLRA 4AZ2B 3T62A 1A5GH 4LOYH 4YT7H 1JBUH 2OC1A 5EU8A 4YTAA 3ZZAA 5F03A 5C1YA 1SC8U 3EDXB 1EJMA 4FUIA 2UUFB 3SU4A 1SGQE 3TVJB 2PKSC 1RJXB 2UWLA 1Y3YA 2WUBA 3OSYA 2J2UA 1FAXA 2A1DB 1CGJE 1V2KT 3F1SB 2A7JA 1KYNA 3NWUA 2XRCA 1UTKA 3VB6A 3F9HA 2PW8H 2VGCB 1QA7A 1SLUB 1ID5H 2G00A 4I33A 2Y5HA 5J4QA 6ESTA 1M9UA 3R3GB 2ZQ2A 1P57B 3TU7H 2ZP0H 2AMDA 1YPHE 1QGFA 2A32A 1LMWB 1V2JT 5GXPA 3BIVH 4HZHA 1FMGA 5JBTA 1O3MA 3FP8E 2XTTB 3SI4H 4X1SU 3BV9B 3MU1A 1BMLA 1A61H 1J16A 1O2YA 3QGJA 1O0DH 1A1RA 5DJ7A 3M5OA 1BBRE 1HV7A 4A7IB 5L6NH 1A7SA 1ABIH 1JRSA 2ANWA 4B73A 1T31A 1HCGA 2A2XH 2NU0E 2BD9A 5L30H 1Z7KA 3SJKA 4A6LA 4DT7B 1UTLM 3L6PA 1S81A 1O39A 2PGQB 1YPJH 1KLTA 4ABFA 3CS0A 1LTOA 2VWMA 2ZDMA 7KMEH 4K60A 1SGIB 4X6NA 1Y5BT 4JYTA 1SPJA 2PR3A 4DW2U 1HIAA 2BY9X 3LOXA 2ZHEH 2FOFA 3GDUA 1O2RA 2Q6DA 3TH4H 1QA0A 4CR9A 1JRTA 2FX4A 4FUBA 3TK6A 3A8BA 3BTME 1PPCE 3RU4E 5PTPA 1PQ5A 2BMGB 2BVXH 3RLWH 4YM9A 1HB0B 1TQ7B 2Y82A 4HI3A 1ZJKA 1TPSA 3T28A 1TMTH 3MU0A 3SN8A 2VWOA 1YPMH 4BAOB 1CHOG 3MNBA 1EAWA 1A0HB 2W7UA 3DFJA 2BDYA 3MHWU 5H4IB 3LGWA 3RXCA 1BUIA 4BTUB 3GY2A 5EW1H 4TPIZ 2P93A 1XMNB 5AFZH 2QF3A 4MDSA 1O2UA 4HTCH 1AN1E 2G5NA 1DY8A 4XBCA 4Q80A 1PYTD 5SGAE 2UWOA 2A31A 4O9VA 1GJ6A 2H6MA 1EJAA 4WXVA 4XE4A 2BY6X 2R3YA 3A7XA 2OD3B 1YM0A 2G81E 5FPYA 5EGMA 2FOBA 4AX9H 1W14U 1O38A 2HWLB 2ZA5A 2XYAA 3PYHA 3ATKA 1RGQA 4CH8B 4RKJB 1OP2A 4ISLA 1OKXA 1DVAH 4UFDH 1TBRH 1TPPA 3MH5A 2J4IA 1ARCA 4ABIA 4B75A 1O3EA 1D3DB 1ZJDA 4WY3A 2XWBI 1VR1H 1GMCF 1GHAF 2PWXA 1DITH 3T29A 1LVBA 3ZZCA 4NZLA 3ZVGA 2GDEH 1Z1JA 7ESTE 3QGNB 2SGQE 1NFXA 1DDJA 3PMJA 1GBJA 1C1OA 1K1LA 1AGJA 3TGIE 1C5WB 3M61U 3QO6A 1W8BH 2BLVA 3SJ9A 1QBVH 2ALPA 4LK4A 1CT2E 2PHBA 1TX6A 5FCKA 3V0XA 2TRMA 2DUCA 4YOIA 1DWCH 4INHA 2F83A 1P03A 2TPIZ 4IBLH 4ABDA 4WH6A 1SGPE 4B1TA 2KAIA 1G3BA 3A89A 1SOTA 2BD3A 2XBYA 1GHZA 2ANKH 5CHAB 3RM0H 1ELBA 2ZFFH 2ZNKH 1MZDA 2O8WA 1FY8E 3SBKA 2ALVA 1JOUB 4K2YA 1FLEE 6CHAB 2PTNA 4ABGA 3U9AH 1VJAU 2CGAA 1LVYA 4NZQA 4X8UH 1ELFA 2CF8H 3QX5H 1DANH 3P70B 2C8XB 1SB1H 3HKJB 1GCTC 4Q7ZA 4XOJA 1O3AA 1IQKA 2O8LA 5B6OA 3BTKE 3V12A 2OC8A 5C1UA 3HK6B 4MPWA 4KKDA 1ZSJA 1GBFA 1ZGIA 5F6MA 3Q77A 1MBQA 2D26C 2WV4A 5A0CA 4JZFH 1DE7H 1O3JA 3E1XB 5CMXH 3PLKA 1LKAA 1GDQA 4K5ZA 2WPMS 1C2HA 1WV7H 3P6ZB 1C5PA 1V2VT 1OWJA 1QURH 2HPPH 1C5SA 3RXIA 2QYIA 1EJNA 1L4DA 1GI4A 1ZHPA 4AB9A 1O3PB 3GISB 1ELEE 3BTGE 3MNSA 1KDQB 4GHQA 1WSSH 4X1PU 3MNXA 2D2DA 2B5TB 4VGCC 1QJ7B 5T3HA 1TNLA 4Y79A 1K1OA 2NU2E 1MKXH 1GI9B 4K1SA 1GI5A 2BX4A 2FOEA 1EB2A 5FX6A 3MU4A 1EX3A 4AGJA 2GDDA 5IDKA 3EE0B 5EXMA 1AWHB 3PMHB 3LPRA 1K2I1 2PGBB 1IQFA 2AIQA 1D3PB 1GCTB 3MTYA 4IS5A 1AFEH 3M3SA 5TCCA 1KXCA 1CT0E 1HPGA 5EG4A 5C1XA 1W12U 3NXPA 3ATLA 4FUHA 3P8FA 4WMEA 5T6FA 2ZWLH 2Z9JA 3SUFA 2BY7X 4XFQA 2ZU3A 1LCYA 1YKTA 3NZIA 5LGOA 1TX8A 3LH3A 3RXBA 3SW2B 2Z9LA 1P02A 3A7TA 5FPSA 4DY7B 4GUXA 1EZXC 2H9HA 2ZGBH 1VCQA 4YT6H 1Y59T 2B7DH 1QQ4A 2FLBH 2AGEX 2QAAA 1ETRH 2Y7ZA 4A1VA 3LIWA 1D9IA 1TPAE 1HJ9A 3SUEA 4GSOA 3T25A 2UWPA 2BD5A 1QJ1B 4HFPB 1A2CH 4CHAB 3PO1C 4IMQA 2AMPA 1ZHRA 4NFFA 1P3EA 3V7TA 2JKHA 2HLCA 5FX5A 1SMFE 1O2LA 1SHYA 1GBLA 3STJA 2HRVA 4ZKSU 1DLKB 1PPFE 2ZU4A 5AVDA 3SHAH 2R3UA 1BIOA 1O2NA 2ZECA 1V2OT 4BAHB 5L2ZH 1YPGH 1BMAA 1TNGA 1FIWA 1O35A 2BQ6B 2PSXA 1DX5M 3E16B 4OS5A 3LONA 1P09A 3UNSA 3VFEA 2F9VA 4KTSA 1QY6A 1FY3A 2BDCA 3NK8A 4FU7A 3M5MA 1UHBB 2OCVB 1SLXB 1O33A 2KAIB 1EXFA 1SGDE 1GJ5H 2RG3A 3RMOH 1C4V2 2SGEE 1O3HA 1BTPA 2QY0B 3PV4A 1O5EH 1FY5A 1MD8A 1HFDA 3BN9A 1C1UH 3OX7U 1C1MA 1Q31A 1QR3E 1YCPK 2ZGHA 9ESTA 2PUQH 2VIPA 2XBVA 1VZQH 4X6OA 1UTQA 5JB9S 3ZZ9A 5EXNA 1TAWA 1NESE 3ITIA 4DIIH 3RXAA 1FZZA 1P2OA 5DP7A 1HYLA 2VH0A 2VU8E 1DLEA 4AN7A 1AVWA 1QCPA 4TWWA 3KQCA 2QXHA 3M37A 3A8AA 2WPHS 1AVXA 3D49H 3URDA 1AU8A 1FXYA 4FU9A 3RXKA 5JPMH 3RLYH 1DWEH 1L4ZA 1B5GH 1BRAA 1NT1A 1Z6JH 4NSVA 1DY9A 3UOUA 1OWDA 4FU8A 1O2KA 5C67A 2WPJS 2VIWA 2BY8X 2ZTZA 3T5FH 4YLUA 3PLBA 1RXPA 1CU1A 2BHGA 2BXUH 3RXPA 4CRCA 5A2MH 1UJ1A 1O3IA 2QA9E 3S7KB 4ZKOU 3MFJA 5K7RA 2ZZUH 4AYVB 2QIQA 1C1PA 1YP9A 4AFZA 1Y3XA 1YPLH 2BB4A 3TIUA 4SGAE 3DT0H 1AIXH 3JZ1B 2BDGA 2NWNA 3U98H 1Z8RA 1C1VH 5FBIA 1V2WT 1S83A 1GBMA 2FWWA 5C2ZA 1ZTJA 3DD2H 3LH1A 1WCZA 1SGYE 1LPGB 3L3TA 2VIVA 1HAYB 1D4PB 3TJOA 4JYVH 3SQHE 2BD2A 4U2WA 3EA9A 2O8UA 3UY9A 3E6PH 2YOLA 3BIUH 3OTJE 2FZZA 2C90B 2OBQA 3TNSA 1BMMH 5I25A 1PYTC 1UVTH 1NM6A 3A7VA 1Z1IA 1PFXC 1UVSH 1KXAA 2V6NA 1F5RA 4JMYA 1UVOA 1HAIH 1MTNB 3MO6A 3U8RH 2G4TA 3QDZB 2IPHA 2C4FH 1JXPA 3TH3H 1GI0A 2NU3E 1EAIA 1XUHA 3MMGA 3RM2H 1L1GA 3RP2A 1P2QA 1H8IH 7GCHG 2F9BH 3VXFH 1DICA 4BTIB 4K69A 2YNBA 3VGCC 3ZV9A 1K21H 2ZU1A 1GMHF 3SUGA 1GJDB 1G2LA 2BM2A 2ZCLP 4RN6A 4R0IA 2OTVA 2ANYA 2FLRH 1SVPA 3BTEE 4DVAU 1O3GA 1SGCA 2C8ZB 2W3KA 2ZFQH 4YOGA 2ZDVH 3M35A 3ZYEA 3DFLA 3ZZ5A 5IYTA 4D7FA 1ETSH 3PTBA 4Q2KA 3ATWA 4FUGA 2HGTH 2P94A 4NA8A 1VITH 5I46H 1P9UA 3LGUA 4B71A 4WWYA 2GVFA 1Y5AT 3CENA 3GY6A 2QCYA 4WH8A 4GCHF 1C4Y2 5C3NA 1V6DA 3ENSB 1GJ4H 4B74A 1VGCC 3KL6A 1KTTB 1ZMJA 4NWLA 4BANB 2ZQ1A 5A0AE 2P59A 1FPHH 5EPNA 2AMQA 1FONA 1T8NA 2HNTF 2J92A 2LPRA 6GCHF 1F2SE 3LJJA 1ZSKA 1C1QA 5ETXA 1ORFA 2XW9A 4ZXXH 4D76A 3HATH 3RXFA 1RD3B 3KQDA 3SNEA 1ABJH 3UUZA 1EPTA 2R0KA 1KXBA 2CMYA 4AORA 3ZYDA 2ZKSA 2BX3A 3FAOA 3E91A 4B2BA 1GL0E 3A88A 1QNJA 4YESB 1P0SH 1C2LA 3OYPA 1W0ZU 1ZTLA 1CA0B 1A0LA 3DA9B 4INLA 2OLGA 4LZ4B 3LGVA 2F9OA 4ZHMU 1O2QA 2PFEA 3LGYA 1O5GH 2F9NA 3A8DA 5A8XA 4KTCA 2GD4B 3S9BA 2H5CA 1O2JA 3K2UA 1PPEE 1HAHH 3RU4D 4ABJA 1AZZA 1O34A 2GCHG 1AZ8A 1A3EH 1CO7E 4NGAH 2UUYA 1THRH 2BY5X 2GV7A 2A0QB 1FPCH 3TPIZ 3ODDA 4ISOA 2P3UB 2FI3E 3ATIA 1HRTH 1THSH 1WUNH 3RXVA 2CF9H 3ZVCA 3RXJA 1TLDA 8ESTE 4ZKRU 4F4OC 2ASUB 1FDPA 2P16A 2EI8A 3BG4B 1O2VA 2BDIA 1U6QA 3BG8A 2Z3CA 5FPTA 1H9HE 4SGBE 4CREA 1TPOA 1FY1A 1AMHA 1RIWC 1SFIA 2V3HH 3SU6A 1AKSB 1H1BA 1ZRKA 1KIGH 3ELAH 4Y11E 2ZCHP 3H7TA 4JZ1A 2G8TA 3SV9A 1UTJA 4OGYA 1NRSH 5T6DA 1P2NA 2BYAX 1OP0A 2SGPE 3W94A 2ZTXA 1CA0C 4I8HA 1MKWK 2Y5FA 2H9EH 4ZH8A 1ARBA 1AE8H 1MAXA 1A5IA 1T7CA 1YLDA 2AIPA 1A4WH 1L2EA 3A8CA 2Y5GA 5LH8A 1NFWA 2FI4E 3BF6H 3VEQB 1GI8B 1O3KA 1BTHH 1S6FA 5EQQA 5DK1A 3U1JB 1ZR0A 2NU1E 3VB7A 4YO9A 1GDNA 3U8OH 1GHYH 3F9EA 3VXEH 1MMJN 1EAXA 2QF0A 1J15A 1W7XH 1IQLA 3RXEA 2XNIA 4NIVA 1NFYA 3S9CA 1ZTKA 1IHSH 2R0LA 1CSOE 8LPRA 2O9QA 1UVUH 3ZZ6A 3T26A 2FXRA 4FUCA 1TMUH 5FCRA 1PQ8A 1GVLA 3RXTA 1TGBA 1QRZA 4OGXA 1BRCE 2QXJA 1Q2WA 4KTUA 3O8BA 1EZQA 1N1LA 1O36A 3JZ2B 3KHVA 1C5MD 1KSNA 3LKWA 3NUMA 3D23A 1SGEE 1GCDA 3SORA 3PWCA 4IN2A 1BA8B 2GZ9A 4GCHG 4HGCA 2JH0D 4H42U 1TNJA 3PO1B 1TGSZ 1G36A 1PQ7A 3GCOA 2LIZA 4NG9H 3RXHA 2GCHF 1UCYH 1LHEH 1XKAC 2AGGX 1LPZB 3GYMA 4JYUH 2WYGA 1EZSC 1L1JA 3PROA 4LXBH 1HAVB 5JBBS 5JDUB 3EQ0H 3NCLA 2ODPA 1K1IA 4YZUA 3LC3A 3AW1A 1UK3A 1ELCA 2ZGXH 3DUXH 3TH2H 3E8LA 4ZHLU 1EKBB 1NFUA 3RC5A 1NC6A 1O3OA 1TRNA 1G3CA 3FFGA 1ZPBA 3URCA 1TA2A 1ETTH 4CRGA 2ZC9H 1GJ7B 2K7XA 2BDBA 1C2KA 3QUMP 2VNTA 2ZEBA 4DGJA 1C5NH 1QRXA 2B9LA 1K1NA 3PB1E 3A83A 1FIZA 4WXIA 1J14A 4GVUA 1O2GH 2VGCC 6GCHG 3MH6A 1HAVA 1ZZZA 1EZUC 1OSSA 2GZ8A 3SNCA 3SJIA 1P11E 3SU3A 1SGNE 1E34B 2P95A 1BBRH 5GPIB 6LPRA 1F0SA 1JIMA 2JH5D 4X2XA 2FDAA 2ZPQA 1YYY1 4DG4A 2VIDA 4MVNA 4IGDA 1H9IE 1THPB 3RXGA 1ELVA 2G4UA 2OC7A 3MH4A 1NTPA 3SV8A 2CV3A 2FESH 1C5QA 3I29A 4JK5A 1XUIA 1EUFA 5E0HA 1C2GA 3Q00A 1XX9A 1BTXA 1O3BA 4UFEH 3EAJA
chains in the Genus database with same CATH superfamily
1GBHA 1TNKA 1FI8A 1XUJA 1UMAH 1AQ7A 2KCYA 3QTOH 2SGAA 4ZUHA 1RS0A 2QV1A 4Y76A 1LHCH 4FUFA 1JMOH 1AO5A 2FS8A 2GT8A 4THNH 1O5DH 1QJ6B 2STBE 3U69H 4DCDA 1TFXA 1O3LA 3U8TH 1NU7B 3SJOA 1IQHA 1GHVH 1LHGH 3KF2A 1V2NT 3W95A 1C2EA 2BLWA 1A5HA 1O3CA 3ZVAA 3M3VA 2EI6A 2TIOA 2I6QA 1GPZA 4ESTE 1GBTA 1S85A 5DP6A 1HUTH 4GLYA 4Z0KA 5EPYA 1H8DH 2CHAB 1Y3VA 4AYYB 3M3TA 2VINA 2NU4E 3BG4C 3A87A 2ZPSA 1SGTA 5CHAC 4NFEA 4KELA 1ZYOA 2TBSA 1OWHA 2SGFE 4NSYA 1BZXE 4Y7BA 1GMDF 2JH6D 1YLCA 2LNCA 5GJ4B 3AK5A 1MKXK 1MKWH 2B8OH 2J95A 3NKKA 4RI0A 1TYNA 4TY6A 4ZHAA 1QTFA 2F91A 3AASA 3F68H 3AW0A 3BEUA 2I6SA 2P8OB 2ZI2H 1ESAA 4OS6A 4TY7A 3KEEA 1C4U2 3SQEE 3AAUA 3H5CB 4CRAA 2FOMB 1W7GH 3SV7A 5E2OA 2KCAA 1A0JA 2FO9A 1XUFA 1C1TA 2AS9A 3UIRA 1N6YA 3OEHD 4FVDA 4F49A 3D65E 3ZVFA 2HOBA 3TLOA 1DWBH 2PKAA 3HKIB 3RU4T 1MBMA 4U30A 3FP6E 1O2SA 2XC4A 1MU6B 1GJ9B 2IJOB 3UQOA 1FY4A 1IQMA 3EA7A 3D62A 1AFQB 1CGHA 1O5AB 2FS9A 4I8KA 4O97A 1C5OH 1A3BH 5E2PA 4MQAA 2BLOA 3HK3B 4CH2B 3N99A 1EP5A 1ACBE 5HM9A 1SL3A 5DKMA 2QN5T 4I8JA 3HGPA 4X8SH 1MQ6A 2JDID 1VJ9U 3EGKH 2A4OA 1HAOH 1CHGA 1Y5UT 3LGIA 5ESBA 1MQ5A 2WZQA 5HKKD 4IC5A 4D7GA 3SU5A 5FHTA 4X6MA 2AYWA 2H5DA 1ELTA 2WV9A 1CE5A 1F92A 2ZTYA 1PPGE 1GL1A 3WY8A 1T8MA 1T4VH 2FTLE 1COWD 3A86A 2OXSA 1DUAA 5C5OA 2H9TH 3M36A 3TJUA 2BVSH 5IK2D 1TNHA 5TCAA 2RCEA 4FUDA 3O8RA 1KY9A 2GTBA 1LVOA 1BDAA 4Y0YE 3MI4A 3HPTB 3MYWA 1GHAG 1C5TA 2CJIA 2R9PA 2G5VA 3A82A 5HGGA 4CBNA 1IQJA 3SGBE 2XBXA 1ZSLA 4D9RA 1P3CA 4B2CA 2V0BA 3QZQA 2DE8A 2OC0A 4B76A 1PQAA 1C5LH 2BVRH 1O3NA 3A7ZA 2J98A 3GY4A 2THFB 2ANMH 1V2RT 1ESBA 2LELA 4YLQH 1P8VC 2TGPZ 1UK2A 1PPHE 4WMFA 4BAQB 3UFAA 2H2ZA 2ZPRA 3F9GA 4TWYA 1B0FA 1YPHC 4X1NU 2XBWA 5BRRE 3GOVB 2GV6A 1TA6A 2VJ1A 4NIXA 4B2AA 1GBCA 5C94A 4I32A 2A4GA 4Y0ZE 1ZPZA 2WUCA 1C1RA 4IN1A 4AFQA 4Y10E 1G32B 3UPEA 1WTHD 1GHXH 2EEKA 2PUXB 2FOCA 1NU9A 1DT2A 5F8TA 1GBDA 1CQQA 2VWNA 4X2WA 1O32A 3SV6A 2A7CA 2GT7A 1IOEA 2WV5A 3F9FA 4NA9H 1B0EA 3BEIB 3NPSA 1BCUH 2IN2A 4X2VA 2J34A 3FZZA 1C2FA 3QLPH 2FYRA 1DS2E 4PROA 3BTWE 1MU8B 1W0YH 2R2MB 4BXSA 5A8YA 3TNTA 2PKAB 4GPGA 1GG6B 1BTZA 2FEQH 1SI5H 4XRNA 2WINI 2ODQA 1QL7A 3MO3A 3MO9A 1ANCA 4DJZB 4D9QA 4LZ1H 4XBBA 1GJAB 2Q6FA 2VB0A 5GCHF 3U1IB 1OYTH 1CVWH 4E7RG 3ZZ4A 1O3FA 1F5KU 2AFQB 1FUJA 1IQNA 2ZCKP 1ZHMA 3MWIU 3RXUA 2HALA 3QTVH 1CBWB 5A0BA 2VH6A 1EQ9A 1MUEB 1UK4A 4H6TA 1ZMLA 1DXPA 1KXEA 1OPHB 4ZCNA 7LPRA 3MNCA 3KQBA 4UONA 2ZFSA 1IQEA 1AHTH 1GVZA 4NWKA 1MTVA 2BDAA 4ISHH 4MNYA 2GJGA 2UUKB 4TSFD 2V35A 3RMNH 1A46H 1S0RA 1NRNH 2XWAA 1TBQH 3FO8D 1GG6C 2CXVA 2ILNA 4X8TH 3ZZBA 1SGFA 2Z9KA 4UE7H 5AF9H 2F3CE 4CHAC 1O5BB 3A7WA 1E79D 1E36B 2Q6GA 4X6PA 2VWLA 3S0NA 1H9LB 3RXRA 2P8OC 1QBOA 5DG6A 1KLJH 1YC0A 3LDXH 1TALA 1OYQA 4Y6DA 4IW4E 4IMZA 1IQIA 5EW2H 1KTSB 1Z8IB 3N7OA 1GBBA 2VVCA 2GMTC 1V2LT 1V2ST 4AG1A 2Z3EA 2V3MA 1AWFH 5EJZA 5CHBA 1HNEE 1FNIA 1UTNA 3FP7E 3ZVBA 1S0QA 1YF4A 4I8LA 3QZRA 1LHFH 3T2NA 2O8TA 5HM2A 1G2MA 1SGFG 3K6YA 1CBWC 2FYQA 1KXDA 3QN7A 3SGAE 1YBWA 1RIWB 1W13U 4E05H 1OOKB 5GCHG 1Q3XA 3ODFA 1SGRE 3MU5A 3BTFE 3C27B 4WF8A 2C3SA 1UTMA 1DUEA 4OS2A 5HXFA 5HYOA 1LVMA 3SZEA 2M5TA 2A4RA 3F6UH 1GHBG 1NRPH 2EC9H 3O8DA 2FIRH 1F0RA 1BTWA 4DURA 2R2WU 4U32A 5HMAA 1LPKB 4ZROA 2J5UA 1SQRA 2OP9A 1HXEH 3UWIA 1TGTA 5T6GA 1CHOF 2IPQX 1HAZB 3A80A 1TWXB 1QHRB 2A2QH 5LPFA 2RA3A 1H4WA 2FOHA 2G55A 2BQ7B 3O8CA 1MCTA 2GX4A 4A1TA 3FN8A 3E90B 2JJ2D 7GCHF 1J17T 3WW7A 3E3TA 3M7TA 1BOQA 5ESTE 4OS7A 2ZG0H 3MU8A 4JZDH 2ZDAH 1O2TA 2GP9B 2BQWB 1GWAA 1HDTH 5LPRA 2FM2A 5L2YH 3GY8A 1EOLA 3DCLA 1LDTT 1C5YB 1BJVA 4JZEH 1BRBE 1GJBB 2BZ6H 1WYKA 3SNBA 1E38B 2ULLA 1E35B 1BQYA 3LT3A 3KYFA 4AGKA 5FXLA 5EODA 2FODA 3V13A 1P9SA 3UR6A 2HNTC 1GVKB 1EPTB 2ZU5A 1C2IA 3ZVDA 3UR9A 4TPYA 1O30A 3RXDA 2ODYB 3K9XB 5FAHA 1GI6A 2EA3A 3UTUH 1V2TT 1Z6EA 4A1XA 3K65B 1PJPA 5GIBA 4F55A 1OHHD 3BTDE 2C8YB 3VPKA 4UFGH 2J94A 1TIOA 3A85A 2K1QA 2QC2A 4CBOA 3ZZ7A 1P2MA 1KDQA 4X8VH 1W10U 1CT4E 1RFNA 1K28D 1KLIH 1Z71A 2VIQA 1G3DA 4OM9A 1GDUA 1B7XB 2XCNA 3TK5A 1MTNC 4K8BA 1WTGH 4FUJA 1FN8A 3PM3A 1K1JA 1P06A 5DP8A 3SJ8A 1BHXF 4A92A 1FQ3A 2CHAC 1GBAA 5DP5A 3ZZ8A 3H7OA 5G4BA 1QL8A 2XXLA 3L33A 1H8HD 1C2DA 1VITG 1ZRBA 2QGRA 2Y7XA 1F0TA 3LU9B 1O2PA 1SBWA 2BOKA 3DSGA 1SLVB 5F8XA 1EAUA 2ZO3H 1WQSA 3UWJH 2W5EA 2P3FH 1O5CB 1QBNA 1PPBH 3PRBA 3FVFB 1SLWB 2ZFRH 1L0ZA 1P2KA 4Y8YA 5TJXA 1GGDB 1YCPH 1W2KH 1AB9C 1NROH 2A45B 2QXIA 3SV2H 1QB6A 1TMBH 2ZHWH 5AFYH 1HBTH 1RRKA 1HAXB 1W0JD 1WAYB 3GDSA 1ANDA 3C1KA 3RMMH 1BTUA 4ISNA 5KGOA 3GYLB 3B23B 2HVYB 3MQKC 1RTKA 1RTLA 3GCTF 1TX7A 1HJAC 3PMBB 1DPOA 1ANBA 1G9IE 5EJLA 3T27A 5LPEA 1ELAA 3I77A 5GDSH 4U01A 1BB0B 3KIDU 1XUGA 2YNAA 3KQEA 8GCHF 4E7NA 2OQ5A 2H1UA 1GJCB 2F43B 1G3EA 1MAYA 3Q3KA 5GNDA 4MG3A 1NRQH 1O2WA 1UCYE 2FI5E 2OBOA 4VGCB 2D8WA 5EOKA 3IWMA 4J2YB 2VBCA 1MTUA 4XSKU 3G01A 1P05A 1D3TB 1JWTA 1L1NA 2JIZD 4MLFB 2EY4C 2P3TB 2SNVA 2SGDE 1MTSA 4DOQA 4O03A 1Y3WA 3AAVA 5K0HA 1SOZA 1DXWA 1HJ8A 1E37B 4ABAA 3RXOA 2W6JD 4I8GA 1Y3UA 2ZDKA 3OFND 1SFQB 2ZFPH 1TOMH 3MH7A 1AB9B 2ZFTA 1HJAB 2W7SA 1GI1A 1QFKH 4ZMAH 1DOJA 1T8OA 1W3CA 2BZAA 2ZU2A 2HNTE 1S6HA 3S7HB 3S69A 1OXGA 3EA8A 2GZ7A 5FBEA 3OY5U 2C8WB 2WPKS 3UNRA 1AE5A 1INCA 4F48B 3RDZA 1FAKH 1BHXB 1E0FD 1BBRK 1BT7A 3VGCB 2C93B 1SG8B 2ZDLA 1XVOA 1TRMA 2ZGCA 4OS1A 4OS4A 2A7HA 1YPKH 2A4QA 1GBKA 2XC5A 4MNVA 1BMNH 1AD8H 2SFAA 1LQEA 1C5UA 1ESTA 1SHHB 2V3OH 4FUEA 1F5LA 3GDVA 4JK6A 1OX1A 3B9FH 2OK5A 4WJG2 4D8NA 4YOJA 2Y80A 4M7GA 2XC0A 4AOQA 4UDWH 2CN0H 3TJVA 3UOPA 4NIWA 2ZHFH 4ISIH 5HIYA 3K6ZA 3Q3XA 2AGIX 3A7YA 2ZF0H 3P17H 3UNQA 2JETC 4MTBA 1ZMNA 2OUAA 4BTTB 3R0FA 1P04A 4X2YA 2WHXA 4KGAA 1BRUP 5DPAA 5T1VA 1YGCH 2AH4X 2O8MA 1D6RA 1V2UT 5E8EH 1TGCA 3GCHC 4TYDA 5BPEA 4ABEA 1D3QB 2D1JA 1QL9A 4JZIA 5E0JA 4ABBA 2PV9B 3BTQE 2Z3DA 2AHME 3SU2A 2OQUA 1EPTC 2ZDNA 1DSTA 3I78A 2ESTE 4ACAA 1X7AC 1TB6H 4H4FA 2B0FA 2JJ1D 3SUDA 4CR5A 2EI7A 2ZGJA 2A5KA 3SNAA 2TGDA 4BAKB 2FP7B 1S5SA 2KFWA 4XBDA 4WMDA 1G37A 2BLQA 2QXGA 1EASA 2KM0A 3BTTE 1W11U 2BOHB 1DM4B 5DP4A 4RT1A 5DGJA 3FZDA 1JIRA 1K1MA 4E06H 3OY6U 4X1QU 2RDLA 3GY7A 1O5FH 3RUOA 3RXSA 1MH0A 4ZAEA 2G51A 1WQVH 2AEIH 4UD9H 3F2GA 1EB1H 1HGTH 1NS3A 2TGTA 1N8OB 2OINA 1QRWA 1QB1A 4INKA 1T32A 4P00A 1C9PA 3ATMA 1SQTA 2J9NA 3PLPA 1O2HA 3N7DA 1FN6A 2Z94A 1VITF 3IG6B 1C5RA 1OWIA 1MCVA 1P2JA 3PMAB 3ZVEA 4BAMB 1O2IA 1T4UH 1GHWH 1V3XA 2F9UA 2EQNA 3M7UA 3OEED 3VB3A 4BNRA 1HLTH 1O2XA 2PTCE 3LGTA 4UEHH 2GCTC 3TGKE 1KXFA 4K1EA 1NPMA 3IITA 2FMJA 3TGJE 3VG8A 1Y8TA 2Z9IA 4GHTA 3VB5A 2ZIQH 4Y8ZA 2J38A 3Q76A 1GMCG 1RTFB 5F8ZA 4K8YA 1FJSA 3PWBA 2Z7FE 1EATA 3QWCH 1Z8JB 2GGVB 1OS8A 2CK3D 2DE9A 3E0PB 4AFUA 1OWKA 1SR5C 1XUKA 3FANA 3ZZDA 3TJNA 3SGQE 1NN6A 4NA7A 1WBGB 3V3MA 1UHBA 1GI7B 5DO4H 1TGNA 1TBZH 1HXFH 1F7ZA 1W0KD 4QT8C 4K3JA 5KECA 3UQVA 1FV9A 3BTHE 4Y7AA 2VIOA 2STAE 2GKVE 4ASHA 3Q3YA 4CRDA 3OU0A 4AFSA 5DP9A 1AUJA 3B8JA 4DIHH 4O3TA 1LO6A 4TT3D 1GI2A 2WYJA 3GY5A 1TOCB 2PKSB 4FVBA 3SU0A 1G30B 1GJ8B 4FXGH 1C5XB 3NRLA 3CP7A 3CS7A 1UTPA 3LJOA 2WPLS 2HPQH 3F3BA 3GICB 4A5TS 1GBIA 1D6WA 4KP0A 3P92A 4AB8A 1BMFD 1YCPM 2ZHDA 4BOHA 1NRRH 1V2MT 2BD7A 3KN2A 4Q7XA 1K1PA 1XKBC 1HAGE 1S84A 5A8ZA 1AVGH 5EQSA 2KR7A 1C1WH 2VVVA 2IOTA 4RSPA 5KEDA 3KCGH 1V2PT 1QB9A 5EQRA 1HAPH 3BEFB 4IC6A 4NIYA 4RKOB 2PLXA 4Q63A 1QQUA 2Y81A 1SSXA 3E0NB 3M7QA 1ZGVA 4O3UA 5CDFE 1AUTC 4R8TB 4AG2A 1DFPA 1PPZA 1C9TA 8GCHG 5J4SA 3OAAD 1GI3A 1QIXB 2FX6A 1C5VA 1C2MA 1Z8GA 1WU1A 1OP8A 1MD7A 2W26A 1LKBA 1HIAB 2JETB 2BD4A 3SHCH 3S9AA 5B6LA 2Q1JA 1UCYK 1NO9H 5ABWA 1CA8B 5FL7D 2A5IA 3SO3A 2HVXA 1UTOA 5C20A 5CE1A 9LPRA 3RXMA 1ZPCA 4GAWA 3RMLH 1V2QT 3TK9A 1ELDE 2FPZA 3ZV8A 1BITA 1IAUA 1TE0A 3ESTA 3UREA 1S82A 1TQ0B 3GCNA 4XDEA 2A5AA 2UUJB 1EP6A 1ANEA 4CRBA 1XVMA 3VB4A 1J8AA 1O2MA 2SNWA 1C1NA 1GMHG 1YPEH 4J1YA 1AFQC 2BXTH 3SOSA 5JYIA 2FOGA 3SNDA 2Z9GA 4MPXA 3KGPA 3A84A 5C5NA 2VVUA 1BTYA 1N8OC 4MPVA 3SZNA 1C5ZB 1TNIA 3STIA 1C1SA 4ZXYH 2BDHA 2Y6TA 4X0WU 3RXLA 1ZOMA 2XCFA 1DSUA 3SU1A 8KME2 2F9PA 3F0OA 4NCYA 5JBCS 3BSQA 3PTNA 1P2IA 1O37A 1TABE 4I86A 3RC4A 2QF4A 4I7YH 3P8NA 2ZHQH 4WVPE 3P95A 3QK1A 4HG6A 3MOCA 1VCPA 2PSYA 1C2JA 1P12E 3RC6A 1WDIA 3DHKH 4Y71A 1K9OE 1GBEA 1IHTH 1GMDG 4X1RU 5E0GA 1NZQH 4BXWA 1UVPA 2GCTB 1XXFA 4Y8XA 2W3IA 1AI8H 1O3DA 1J9CH 4MNWA 2TGAA 2Z6BD 1IQGA 3TITA 1F0UA 3GCHB 5DP3A 1VCWA 3AVZA 1LHDH 2BTCE 4ABHA 3SI3H 1K22H 1O2OA 1P01A 3HGNA 1O31A 1TRYA 1LQDB 4CRFA 2RA0A 4K1TA 4UFFH 5JBAS 4MPUA 1SQAA 5EXLA 1VGCB 2WSSD 1AKSA 2BD8A 2WPIS 3KNXA 2FOAA 4I31A 1BJUA 4JCNA 4AC9A 1CGIE 3EYDA 4ACBA 4Z6AH 4ZKNU 1OWEA 4H6SB 5JB8S 3EBNA 3CNRA 3ZZ3A 3A81A 1GGDC 1EOJA 1ELGA 1WOFA 2G52A 5GWZA 1AY6H 1NY22 3P8OA 2GMTB 1P10A 4MNXA 1TONA 4Q7YA 6CHAC 1N6XA 3GCTG 5A09A 1O2ZA 2FTMA 1DWDH 1XXDA 3LC5A 1MZAA 1UO6A 1GHBF 1MTWA 3GY3A 1T8LA 1XM1A 3M5LA 1SQOA 3P8GA 3RXQA 2AERH 3M5NA 5AHGH 1ZLRA 4AZ2B 3T62A 1A5GH 4LOYH 4YT7H 1JBUH 2OC1A 5EU8A 4YTAA 3ZZAA 5F03A 5C1YA 1SC8U 3EDXB 1EJMA 4FUIA 2UUFB 3SU4A 1SGQE 4FOUC 3TVJB 2PKSC 1RJXB 2UWLA 1E1QD 1Y3YA 2WUBA 3OSYA 2J2UA 1FAXA 2A1DB 1CGJE 1V2KT 3F1SB 2A7JA 1KYNA 3NWUA 2XRCA 1UTKA 3VB6A 3F9HA 2PW8H 2VGCB 1QA7A 1SLUB 1ID5H 2G00A 4I33A 2Y5HA 5J4QA 6ESTA 1M9UA 3R3GB 2ZQ2A 1P57B 3TU7H 2ZP0H 2AMDA 1YPHE 1QGFA 2A32A 1LMWB 1V2JT 5GXPA 3BIVH 3UB0A 4HZHA 1FMGA 5JBTA 1O3MA 3FP8E 2XTTB 3SI4H 4X1SU 3BV9B 3MU1A 1BMLA 1A61H 1J16A 1O2YA 3QGJA 1O0DH 1A1RA 5DJ7A 3M5OA 1BBRE 1HV7A 4A7IB 5L6NH 1A7SA 1ABIH 1JRSA 2ANWA 4B73A 1T31A 1HCGA 2A2XH 2NU0E 2BD9A 5L30H 1Z7KA 3SJKA 4A6LA 4DT7B 1UTLM 3L6PA 1S81A 1O39A 2PGQB 1YPJH 1KLTA 4ABFA 3CS0A 1LTOA 2VWMA 2ZDMA 7KMEH 4K60A 5EJ1A 1SGIB 4X6NA 1Y5BT 4JYTA 1SPJA 2PR3A 4DW2U 1HIAA 2BY9X 2KCOA 3LOXA 2XOKD 2ZHEH 2FOFA 3GDUA 1O2RA 2Q6DA 3TH4H 1QA0A 4CR9A 1JRTA 2FX4A 4FUBA 3TK6A 3A8BA 3BTME 1PPCE 3RU4E 5PTPA 1PQ5A 2BMGB 2BVXH 3DSPA 3RLWH 4YM9A 1HB0B 1TQ7B 2Y82A 4HI3A 1ZJKA 1TPSA 3T28A 1TMTH 3MU0A 3SN8A 2VWOA 1YPMH 4BAOB 3OTPA 1CHOG 3MNBA 1EAWA 2J97A 1A0HB 2W7UA 3FOAA 3DFJA 3W1EA 2BDYA 3MHWU 5H4IB 3LGWA 3RXCA 1BUIA 4BTUB 3GY2A 5EW1H 4TPIZ 1XMNB 2P93A 4M9FA 5AFZH 2QF3A 4MDSA 1O2UA 4HTCH 1AN1E 2G5NA 1DY8A 4XBCA 4Q80A 1PYTD 5SGAE 2UWOA 2A31A 4O9VA 1GJ6A 2H6MA 1EJAA 4WXVA 4XE4A 2BY6X 2R3YA 3A7XA 2OD3B 1YM0A 2G81E 5FPYA 1VKYA 5EGMA 2FOBA 4AX9H 2KCPA 1W14U 1O38A 2HWLB 2ZA5A 2XYAA 3PYHA 3ATKA 1RGQA 4CH8B 4RKJB 1OP2A 4ISLA 3PV2A 1OKXA 1DVAH 4UFDH 1TBRH 1EFRD 1TPPA 3MH5A 2J4IA 1ARCA 4ABIA 4B75A 1O3EA 1D3DB 1ZJDA 4WY3A 2XWBI 1VR1H 1GMCF 1GHAF 2PWXA 1DITH 3T29A 1LVBA 3ZZCA 4NZLA 3ZVGA 2GDEH 1Z1JA 7ESTE 3F2FA 3QGNB 2SGQE 1NFXA 1DDJA 2M2AA 3PMJA 1GBJA 1C1OA 1K1LA 1AGJA 3TGIE 1C5WB 3M61U 3QO6A 1W8BH 2BLVA 3SJ9A 1QBVH 2ALPA 4LK4A 1CT2E 2PHBA 1TX6A 3UAIC 5FCKA 3V0XA 2TRMA 2DUCA 4YOIA 1DWCH 4INHA 2F83A 1P03A 2TPIZ 4IBLH 4ABDA 4WH6A 1SGPE 4B1TA 2KAIA 1G3BA 3A89A 1SOTA 2BD3A 2XBYA 1GHZA 2ANKH 5CHAB 3RM0H 1ELBA 2ZFFH 5HIZA 2ZNKH 1MZDA 2O8WA 1FY8E 3SBKA 2ALVA 1JOUB 4K2YA 1FLEE 6CHAB 2PTNA 4ABGA 3U9AH 1VJAU 2CGAA 1LVYA 4NZQA 4X8UH 1ELFA 2CF8H 3QX5H 1DANH 3P70B 2C8XB 1SB1H 3HKJB 1GCTC 3DSOA 4Q7ZA 4XOJA 1O3AA 1IQKA 2O8LA 5B6OA 3FKSD 3BTKE 3V12A 2HLDD 2K0QA 2OC8A 5C1UA 3HK6B 4MPWA 4KKDA 1ZSJA 1GBFA 1ZGIA 5F6MA 3Q77A 1MBQA 2D26C 2WV4A 5A0CA 4JZFH 1DE7H 1O3JA 3E1XB 5CMXH 3PLKA 1WXRA 1LKAA 1GDQA 4K5ZA 2WPMS 1C2HA 1WV7H 3P6ZB 1C5PA 1V2VT 1OWJA 4ASUD 1QURH 2HPPH 1C5SA 3RXIA 2QYIA 3PRDA 1EJNA 1L4DA 1GI4A 1ZHPA 4AB9A 1O3PB 3GISB 1ELEE 3BTGE 3MNSA 1KDQB 4GHQA 1WSSH 3OE7D 4X1PU 3MNXA 2D2DA 2B5TB 4VGCC 1QJ7B 5T3HA 1TNLA 4Y79A 1K1OA 2NU2E 1MKXH 1GI9B 4K1SA 1GI5A 2BX4A 2FOEA 1EB2A 5FX6A 3MU4A 1EX3A 4AGJA 2GDDA 5IDKA 3EE0B 5EXMA 4DT4A 1AWHB 3PMHB 3LPRA 1K2I1 2PGBB 1IQFA 2AIQA 1D3PB 1GCTB 3MTYA 4IS5A 1AFEH 3M3SA 5EIYA 5TCCA 1KXCA 1CT0E 1HPGA 2F4LA 5EG4A 5C1XA 4P02A 1W12U 3NXPA 3ATLA 4FUHA 3P8FA 4WMEA 5T6FA 2ZWLH 2Z9JA 3SUFA 2BY7X 4XFQA 2ZU3A 1LCYA 1YKTA 3NZIA 5LGOA 1TX8A 3LH3A 3RXBA 3SW2B 2Z9LA 1P02A 3A7TA 5FPSA 4DY7B 4GUXA 1EZXC 2H9HA 2L6OA 2ZGBH 1VCQA 4YT6H 1Y59T 2B7DH 1QQ4A 2FLBH 2AGEX 2QAAA 1ETRH 2Y7ZA 4A1VA 3LIWA 1D9IA 1TPAE 1HJ9A 3SUEA 4GSOA 3T25A 2UWPA 2BD5A 1QJ1B 4HFPB 1A2CH 4CHAB 3WWFA 3PO1C 4IMQA 2AMPA 1ZHRA 4NFFA 1P3EA 3V7TA 2JKHA 2HLCA 5FX5A 1SMFE 1O2LA 1SHYA 1GBLA 3STJA 2HRVA 4ZKSU 1DLKB 1PPFE 2ZU4A 5AVDA 3SHAH 2R3UA 3SYJA 1BIOA 1NBME 1O2NA 2ZECA 1V2OT 2IJD1 4BAHB 5L2ZH 1YPGH 1BMAA 1TNGA 1FIWA 1O35A 2BQ6B 2PSXA 1DX5M 3E16B 4OS5A 3LONA 1P09A 3UNSA 3VFEA 2F9VA 4KTSA 1QY6A 1FY3A 2BDCA 3GS9A 3NK8A 4FU7A 3M5MA 1UHBB 2OCVB 1SLXB 1O33A 2KAIB 5DSFA 1EXFA 1SGDE 1GJ5H 2RG3A 3RMOH 1C4V2 2SGEE 1O3HA 1BTPA 4B6FA 2QY0B 3PV4A 1O5EH 1FY5A 1MD8A 1HFDA 3BN9A 1C1UH 3OX7U 1C1MA 1Q31A 1QR3E 1YCPK 2ZGHA 9ESTA 2PUQH 2VIPA 2XBVA 1VZQH 4X6OA 1UTQA 5JB9S 3ZZ9A 5EXNA 1TAWA 1NESE 3ITIA 4DIIH 3RXAA 1FZZA 1P2OA 5DP7A 1HYLA 4RT0A 2VH0A 2VU8E 3F0PA 1DLEA 4AN7A 1AVWA 2K8IA 1QCPA 4TWWA 3KQCA 2QXHA 3M37A 3A8AA 2WPHS 1AVXA 3D49H 3URDA 1AU8A 1FXYA 4FU9A 3RXKA 3H09A 5DN6D 5JPMH 3RLYH 1DWEH 1L4ZA 1B5GH 1BRAA 1NT1A 1Z6JH 4B6EA 4NSVA 1DY9A 3UOUA 1OWDA 4FU8A 1O2KA 5C67A 2WPJS 2VIWA 2BY8X 2ZTZA 3T5FH 4YLUA 3PLBA 1RXPA 1CU1A 2BHGA 2BXUH 3RXPA 4CRCA 5A2MH 1UJ1A 1O3IA 2QA9E 3S7KB 4ZKOU 3MFJA 5K7RA 2ZZUH 4AYVB 2QIQA 1C1PA 1YP9A 4AFZA 1Y3XA 2YMSB 1YPLH 2BB4A 3TIUA 4SGAE 3DT0H 1AIXH 3JZ1B 2BDGA 2NWNA 3U98H 1Z8RA 1C1VH 5FBIA 1V2WT 1S83A 1GBMA 2FWWA 5C2ZA 1ZTJA 3DD2H 3LH1A 1WCZA 1SGYE 1LPGB 3L3TA 2VIVA 1HAYB 1D4PB 3TJOA 4JYVH 3SQHE 2BD2A 4U2WA 3EA9A 2O8UA 3UY9A 3E6PH 2YOLA 3BIUH 3OTJE 2FZZA 2C90B 2OBQA 3TNSA 1BMMH 5I25A 1PYTC 1UVTH 1NM6A 3A7VA 1Z1IA 1PFXC 1UVSH 1K0HA 1KXAA 2V6NA 1F5RA 4JMYA 1UVOA 1HAIH 1MTNB 3MO6A 3U8RH 2G4TA 3QDZB 2IPHA 2C4FH 1JXPA 3TH3H 1GI0A 2NU3E 1EAIA 1XUHA 3MMGA 3RM2H 2V7QD 1L1GA 3RP2A 1P2QA 1H8IH 7GCHG 2F9BH 3VXFH 1DICA 4BTIB 4K69A 2YNBA 2YMSC 3VGCC 3ZV9A 1K21H 2ZU1A 2W6ID 1GMHF 3SUGA 1GJDB 1G2LA 4FETA 5C0TA 2BM2A 2ZCLP 4RN6A 4R0IA 2OTVA 2ANYA 2FLRH 1SVPA 3BTEE 4DVAU 1O3GA 1YWUA 1SGCA 2C8ZB 2W3KA 2ZFQH 4YOGA 2ZDVH 3M35A 3ZYEA 3DFLA 3ZZ5A 5IYTA 4D7FA 1ETSH 3PTBA 4Q2KA 3ATWA 4FUGA 2HGTH 2P94A 4NA8A 1VITH 5I46H 1P9UA 1MABB 3LGUA 4B71A 4WWYA 1S6LA 2GVFA 1Y5AT 3CENA 3GY6A 2QCYA 4WH8A 4GCHF 1C4Y2 5C3NA 1V6DA 2YMSD 1GJ4H 3ENSB 4B74A 1VGCC 3KL6A 1KTTB 1ZMJA 4NWLA 4BANB 2ZQ1A 5A0AE 2P59A 1FPHH 5EPNA 2AMQA 1FONA 1T8NA 2HNTF 2J92A 2LPRA 6GCHF 1F2SE 3LJJA 1ZSKA 1C1QA 5ETXA 1ORFA 2XW9A 4ZXXH 4D76A 3HATH 3RXFA 1RD3B 3KQDA 3SNEA 1ABJH 3UUZA 1EPTA 2R0KA 1KXBA 2CMYA 4AORA 2QE7D 3ZYDA 2ZKSA 2BX3A 3FAOA 3E91A 4B2BA 1GL0E 3A88A 2WPDD 1QNJA 4YESB 1P0SH 1C2LA 3OYPA 1W0ZU 1ZTLA 1CA0B 1A0LA 3DA9B 4INLA 2OLGA 4LZ4B 3LGVA 2F9OA 1YY3A 4ZHMU 1O2QA 2PFEA 3LGYA 1O5GH 2F9NA 3A8DA 5A8XA 4KTCA 2GD4B 3S9BA 2H5CA 1O2JA 3K2UA 1SKYE 1PPEE 1HAHH 3RU4D 1H8ED 3ZIAD 4ABJA 1AZZA 1O34A 2GCHG 2RDEA 1AZ8A 1A3EH 1CO7E 4NGAH 2UUYA 1THRH 2BY5X 2GV7A 2A0QB 1FPCH 3TPIZ 3ODDA 4ISOA 2P3UB 2FI3E 3ATIA 3KYGA 1HRTH 1THSH 1WUNH 3RXVA 2L74A 2CF9H 3ZVCA 1QZ8A 3RXJA 1TLDA 8ESTE 4ZKRU 4F4OC 2ASUB 1FDPA 2P16A 2EI8A 3BG4B 1O2VA 2BDIA 1U6QA 3BG8A 2Z3CA 5FPTA 1H9HE 4SGBE 4CREA 1TPOA 1FY1A 1AMHA 1RIWC 1SFIA 2V3HH 3SU6A 1AKSB 1H1BA 1ZRKA 1KIGH 3ELAH 4Y11E 2ZCHP 3H7TA 4JZ1A 2G8TA 3SV9A 1UTJA 4OGYA 1NRSH 3N7EA 1E1RD 5T6DA 1P2NA 2BYAX 1OP0A 5C0UA 2SGPE 3W94A 2ZTXA 1CA0C 4I8HA 1MKWK 2Y5FA 2H9EH 4ZH8A 1ARBA 1FX0B 1AE8H 5F53A 1MAXA 1A5IA 1T7CA 1YLDA 2AIPA 1A4WH 1L2EA 3A8CA 2Y5GA 5LH8A 1NFWA 2FI4E 3BF6H 3VEQB 3WWBA 3EE7A 1GI8B 1O3KA 1BTHH 1S6FA 5EQQA 5DK1A 3U1JB 1ZR0A 2NU1E 3VB7A 4YO9A 1GDNA 3U8OH 1GHYH 1KMHB 3F9EA 3VXEH 1MMJN 1EAXA 2QF0A 1J15A 1W7XH 2J98B 1IQLA 3RXEA 2XNIA 4NIVA 1NFYA 3S9CA 1ZTKA 1IHSH 2R0LA 1CSOE 8LPRA 2O9QA 1UVUH 3ZZ6A 3T26A 2FXRA 2RFKC 4FUCA 1TMUH 1UW7A 5FCRA 1PQ8A 1GVLA 3RXTA 1TGBA 1QRZA 4OGXA 1BRCE 2QXJA 1Q2WA 4KTUA 3O8BA 1EZQA 1N1LA 1O36A 3JZ2B 3KHVA 1C5MD 3F2HA 1KSNA 3LKWA 3NUMA 3D23A 2XNDD 1SGEE 1GCDA 2KX4A 3SORA 3PWCA 4IN2A 1BA8B 2GZ9A 4GCHG 4HGCA 2JH0D 2KZ4A 4H42U 1TNJA 3PO1B 1TGSZ 1G36A 1PQ7A 3GCOA 2LIZA 4NG9H 3RXHA 2GCHF 1UCYH 1LHEH 1NBMD 1XKAC 2AGGX 1LPZB 3GYMA 4JYUH 2WYGA 1EZSC 1L1JA 3PROA 4LXBH 1HAVB 5JBBS 5JDUB 3EQ0H 3NCLA 2ODPA 1K1IA 4YZUA 3LC3A 3AW1A 1UK3A 1ELCA 2ZGXH 3DUXH 3TH2H 3E8LA 4ZHLU 1EKBB 1NFUA 3RC5A 1NC6A 1O3OA 1TRNA 1G3CA 3FFGA 1ZPBA 4XD7D 3URCA 1TA2A 1ETTH 4CRGA 2ZC9H 1GJ7B 2K7XA 2BDBA 1C2KA 3QUMP 2VNTA 2ZEBA 4DGJA 1YLNA 1C5NH 1QRXA 2B9LA 1K1NA 3PB1E 3A83A 1FIZA 4WXIA 2PP6A 1J14A 4GVUA 1O2GH 2VGCC 6GCHG 3MH6A 4YXWD 1HAVA 5C17A 1ZZZA 3KQ5A 1EZUC 1OSSA 2GZ8A 3SNCA 3SJIA 1P11E 3SU3A 1SGNE 1E34B 2P95A 1BBRH 5GPIB 6LPRA 1F0SA 1JIMA 2JH5D 2LP6A 4X2XA 2FDAA 2ZPQA 1YYY1 4DG4A 2VIDA 4MVNA 4IGDA 4Z1MD 1H9IE 1THPB 3RXGA 1ELVA 2G4UA 2OC7A 3MH4A 1NTPA 2QF5A 3SV8A 2CV3A 4Q4LA 3PV5A 2FESH 1C5QA 3I29A 4JK5A 1XUIA 3U28C 1EUFA 5E0HA 1C2GA 3Q00A 1XX9A 1BTXA 1O3BA 4UFEH 3EAJA
chains in the Genus database with same CATH topology
1GBHA 1TNKA 1FI8A 1XUJA 1UMAH 1AQ7A 3QTOH 2SGAA 4ZUHA 1RS0A 2QV1A 4Y76A 1LHCH 4FUFA 1JMOH 1AO5A 2FS8A 2GT8A 4THNH 1O5DH 1QJ6B 2STBE 3U69H 4DCDA 1TFXA 1O3LA 3U8TH 1NU7B 3SJOA 1IQHA 1GHVH 1LHGH 3KF2A 1V2NT 3W95A 1C2EA 2BLWA 1A5HA 1O3CA 3ZVAA 3M3VA 2EI6A 2TIOA 2I6QA 1GPZA 4ESTE 1GBTA 1S85A 5DP6A 1HUTH 4GLYA 4Z0KA 5EPYA 1H8DH 2CHAB 1Y3VA 4AYYB 3M3TA 2VINA 2NU4E 3BG4C 3A87A 2ZPSA 1SGTA 5CHAC 4NFEA 4KELA 1ZYOA 2TBSA 1OWHA 2SGFE 4NSYA 1BZXE 4Y7BA 1GMDF 2JH6D 1YLCA 2LNCA 5GJ4B 1MKXK 1MKWH 2B8OH 2J95A 3NKKA 4TY6A 1TYNA 4ZHAA 1QTFA 2F91A 3AASA 3F68H 3AW0A 3BEUA 2I6SA 2P8OB 2ZI2H 1ESAA 4OS6A 4TY7A 3KEEA 1C4U2 3SQEE 3AAUA 3H5CB 4CRAA 2FOMB 1W7GH 3SV7A 5E2OA 1A0JA 2FO9A 1XUFA 1C1TA 2AS9A 3UIRA 1N6YA 4FVDA 4F49A 3D65E 3ZVFA 2HOBA 3TLOA 1DWBH 2PKAA 3HKIB 3RU4T 1MBMA 4U30A 3FP6E 1O2SA 2XC4A 1MU6B 1GJ9B 2IJOB 3UQOA 1FY4A 1IQMA 3EA7A 3D62A 1AFQB 1CGHA 1O5AB 2FS9A 4I8KA 4O97A 1C5OH 1A3BH 5E2PA 4MQAA 2BLOA 3HK3B 4CH2B 1EP5A 1ACBE 5HM9A 1SL3A 5DKMA 2QN5T 4I8JA 3HGPA 4X8SH 1MQ6A 1VJ9U 3EGKH 2A4OA 1HAOH 1CHGA 1Y5UT 3LGIA 5ESBA 1MQ5A 4IC5A 4D7GA 3SU5A 5FHTA 4X6MA 2AYWA 2H5DA 1ELTA 1CE5A 1F92A 2ZTYA 1PPGE 1GL1A 3WY8A 1T8MA 1T4VH 2FTLE 3A86A 2OXSA 1DUAA 5C5OA 2H9TH 3M36A 3TJUA 2BVSH 1TNHA 5TCAA 2RCEA 4FUDA 3O8RA 1KY9A 2GTBA 1LVOA 1BDAA 4Y0YE 3MI4A 3HPTB 3MYWA 1GHAG 1C5TA 2CJIA 2R9PA 2G5VA 3A82A 5HGGA 4CBNA 1IQJA 3SGBE 2XBXA 1ZSLA 4D9RA 1P3CA 4B2CA 2V0BA 3QZQA 2DE8A 2OC0A 4B76A 1PQAA 1C5LH 2BVRH 1O3NA 3A7ZA 3GY4A 2THFB 2ANMH 1V2RT 1ESBA 4YLQH 1P8VC 2TGPZ 1UK2A 1PPHE 4WMFA 4BAQB 3UFAA 2H2ZA 2ZPRA 3F9GA 4TWYA 1B0FA 1YPHC 4X1NU 2XBWA 5BRRE 3GOVB 2GV6A 1TA6A 2VJ1A 4NIXA 4B2AA 1GBCA 4I32A 2A4GA 4Y0ZE 1ZPZA 2WUCA 1C1RA 4IN1A 4AFQA 4Y10E 1G32B 3UPEA 1WTHD 1GHXH 2EEKA 2PUXB 2FOCA 1NU9A 1DT2A 5F8TA 1GBDA 1CQQA 2VWNA 4X2WA 1O32A 3SV6A 2A7CA 2GT7A 1IOEA 2WV5A 3F9FA 4NA9H 1B0EA 3BEIB 3NPSA 1BCUH 2IN2A 4X2VA 2J34A 3FZZA 1C2FA 3QLPH 2FYRA 1DS2E 4PROA 3BTWE 1MU8B 1W0YH 2R2MB 4BXSA 5A8YA 3TNTA 2PKAB 4GPGA 1GG6B 1BTZA 2FEQH 1SI5H 2WINI 2ODQA 1QL7A 3MO3A 3MO9A 1ANCA 4DJZB 4D9QA 4LZ1H 4XBBA 1GJAB 2Q6FA 2VB0A 5GCHF 3U1IB 1OYTH 1CVWH 4E7RG 3ZZ4A 1O3FA 1F5KU 2AFQB 1FUJA 1IQNA 2ZCKP 1ZHMA 3MWIU 3RXUA 2HALA 3QTVH 1CBWB 5A0BA 2VH6A 1EQ9A 1MUEB 1UK4A 4H6TA 1ZMLA 1DXPA 1KXEA 1OPHB 7LPRA 3MNCA 3KQBA 4UONA 2ZFSA 1IQEA 1AHTH 1GVZA 4NWKA 1MTVA 2BDAA 4ISHH 4MNYA 2UUKB 2V35A 3RMNH 1A46H 1S0RA 1NRNH 2XWAA 1TBQH 1GG6C 2CXVA 2ILNA 4X8TH 3ZZBA 1SGFA 2Z9KA 4UE7H 5AF9H 2F3CE 4CHAC 1O5BB 3A7WA 1E36B 2Q6GA 4X6PA 2VWLA 3S0NA 1H9LB 3RXRA 2P8OC 1QBOA 5DG6A 1KLJH 1YC0A 3LDXH 1TALA 1OYQA 4Y6DA 4IW4E 4IMZA 1IQIA 5EW2H 1KTSB 1Z8IB 3N7OA 1GBBA 2VVCA 2GMTC 1V2LT 1V2ST 4AG1A 2Z3EA 1AWFH 1HNEE 1FNIA 1UTNA 3FP7E 3ZVBA 1S0QA 1YF4A 4I8LA 3QZRA 1LHFH 3T2NA 2O8TA 5HM2A 1G2MA 1SGFG 3K6YA 1CBWC 2FYQA 1KXDA 3QN7A 3SGAE 1YBWA 1RIWB 1W13U 4E05H 1OOKB 5GCHG 1Q3XA 3ODFA 1SGRE 3MU5A 3BTFE 3C27B 4WF8A 2C3SA 1UTMA 1DUEA 4OS2A 5HXFA 5HYOA 1LVMA 2M5TA 2A4RA 3F6UH 1GHBG 1NRPH 2EC9H 3O8DA 2FIRH 1F0RA 1BTWA 4DURA 2R2WU 4U32A 5HMAA 1LPKB 4ZROA 3UWIA 2OP9A 1HXEH 1TGTA 5T6GA 1CHOF 1HAZB 3A80A 1TWXB 1QHRB 2A2QH 5LPFA 2RA3A 1H4WA 2FOHA 2G55A 2BQ7B 3O8CA 1MCTA 2GX4A 4A1TA 3E90B 7GCHF 1J17T 3E3TA 3M7TA 1BOQA 5ESTE 4OS7A 2ZG0H 3MU8A 4JZDH 2ZDAH 1O2TA 2GP9B 2BQWB 1GWAA 1HDTH 5LPRA 2FM2A 5L2YH 3GY8A 1EOLA 1LDTT 1C5YB 1BJVA 4JZEH 1BRBE 1GJBB 2BZ6H 1WYKA 3SNBA 1E38B 2ULLA 1E35B 1BQYA 3LT3A 4AGKA 5FXLA 5EODA 2FODA 3V13A 1P9SA 3UR6A 2HNTC 1GVKB 1EPTB 2ZU5A 1C2IA 3ZVDA 3UR9A 4TPYA 1O30A 3RXDA 2ODYB 3K9XB 5FAHA 1GI6A 2EA3A 3UTUH 1V2TT 1Z6EA 4A1XA 3K65B 1PJPA 5GIBA 3BTDE 2C8YB 3VPKA 4UFGH 2J94A 1TIOA 3A85A 2K1QA 2QC2A 4CBOA 3ZZ7A 1P2MA 1KDQA 4X8VH 1W10U 1CT4E 1RFNA 1K28D 1KLIH 1Z71A 2VIQA 1G3DA 1GDUA 1B7XB 2XCNA 3TK5A 1MTNC 4K8BA 1WTGH 4FUJA 1FN8A 3PM3A 1K1JA 1P06A 5DP8A 3SJ8A 1BHXF 4A92A 1FQ3A 2CHAC 1GBAA 5DP5A 3ZZ8A 3H7OA 5G4BA 1QL8A 2XXLA 3L33A 1ZRBA 1C2DA 1VITG 2QGRA 2Y7XA 1F0TA 3LU9B 1O2PA 1SBWA 2BOKA 1SLVB 5F8XA 1EAUA 2ZO3H 1WQSA 3UWJH 2W5EA 2P3FH 1O5CB 1QBNA 1PPBH 3FVFB 1SLWB 2ZFRH 1L0ZA 1P2KA 4Y8YA 5TJXA 1GGDB 1YCPH 1W2KH 1AB9C 1NROH 2A45B 2QXIA 3SV2H 1QB6A 1TMBH 2ZHWH 5AFYH 1HBTH 1RRKA 1HAXB 1WAYB 3GDSA 1ANDA 3C1KA 3RMMH 1BTUA 4ISNA 3GYLB 3B23B 1RTKA 1RTLA 3GCTF 1TX7A 1HJAC 3PMBB 1DPOA 1ANBA 1G9IE 5LPEA 3T27A 1ELAA 3I77A 5GDSH 4U01A 1BB0B 3KIDU 1XUGA 2YNAA 3KQEA 8GCHF 4E7NA 2OQ5A 2H1UA 1GJCB 1G3EA 1MAYA 3Q3KA 4MG3A 1NRQH 1O2WA 1UCYE 2FI5E 2OBOA 4VGCB 2D8WA 5EOKA 3IWMA 4J2YB 1MTUA 4XSKU 3G01A 1P05A 1D3TB 1JWTA 1L1NA 4MLFB 2P3TB 2SNVA 2SGDE 1MTSA 4DOQA 4O03A 1Y3WA 3AAVA 5K0HA 1SOZA 1DXWA 1HJ8A 1E37B 4ABAA 3RXOA 4I8GA 1Y3UA 2ZDKA 1SFQB 2ZFPH 1TOMH 3MH7A 1AB9B 2ZFTA 1HJAB 2W7SA 1GI1A 1QFKH 4ZMAH 1DOJA 1T8OA 1W3CA 2BZAA 2ZU2A 2HNTE 1S6HA 3S7HB 3S69A 1OXGA 3EA8A 2GZ7A 5FBEA 3OY5U 2C8WB 2WPKS 3UNRA 1AE5A 1INCA 3RDZA 1FAKH 1BHXB 1E0FD 1BBRK 1BT7A 3VGCB 2C93B 1SG8B 2ZDLA 1XVOA 1TRMA 2ZGCA 4OS1A 4OS4A 2A7HA 1YPKH 2A4QA 1GBKA 2XC5A 4MNVA 1BMNH 1AD8H 2SFAA 1LQEA 1C5UA 1ESTA 1SHHB 2V3OH 4FUEA 1F5LA 3GDVA 4JK6A 1OX1A 3B9FH 4WJG2 4D8NA 4YOJA 2Y80A 4M7GA 2XC0A 4AOQA 4UDWH 2CN0H 3TJVA 3UOPA 4NIWA 2ZHFH 4ISIH 3K6ZA 3Q3XA 2AGIX 3A7YA 2ZF0H 3P17H 3UNQA 2JETC 4MTBA 1ZMNA 2OUAA 4BTTB 3R0FA 1P04A 4X2YA 4KGAA 1BRUP 5DPAA 1YGCH 2AH4X 2O8MA 1D6RA 1V2UT 5E8EH 1TGCA 3GCHC 4TYDA 5BPEA 4ABEA 1D3QB 2D1JA 1QL9A 4JZIA 5E0JA 4ABBA 2PV9B 3BTQE 2Z3DA 3SU2A 2OQUA 1EPTC 2ZDNA 1DSTA 3I78A 2ESTE 1X7AC 1TB6H 4H4FA 2B0FA 3SUDA 4CR5A 2EI7A 2ZGJA 2A5KA 3SNAA 2TGDA 4BAKB 2FP7B 1S5SA 4XBDA 4WMDA 1G37A 2BLQA 2QXGA 1EASA 3BTTE 1W11U 2BOHB 1DM4B 5DP4A 5DGJA 3FZDA 1JIRA 1K1MA 4E06H 3OY6U 4X1QU 2RDLA 3GY7A 1O5FH 3RUOA 3RXSA 1MH0A 4ZAEA 2G51A 1WQVH 2AEIH 4UD9H 1EB1H 1HGTH 1NS3A 2TGTA 1N8OB 2OINA 1QRWA 1QB1A 4INKA 1T32A 1C9PA 3ATMA 1SQTA 2J9NA 3PLPA 1O2HA 1FN6A 2Z94A 1VITF 3IG6B 1C5RA 1OWIA 1MCVA 1P2JA 3PMAB 3ZVEA 4BAMB 1O2IA 1T4UH 1GHWH 1V3XA 2F9UA 3M7UA 3VB3A 4BNRA 1HLTH 1O2XA 2PTCE 3LGTA 4UEHH 2GCTC 3TGKE 1KXFA 4K1EA 1NPMA 3IITA 2FMJA 3TGJE 1Y8TA 2Z9IA 4GHTA 3VB5A 2ZIQH 4Y8ZA 2J38A 3Q76A 1GMCG 1RTFB 5F8ZA 4K8YA 1FJSA 3PWBA 2Z7FE 1EATA 3QWCH 1Z8JB 2GGVB 1OS8A 3E0PB 2DE9A 4AFUA 1OWKA 1SR5C 1XUKA 3FANA 3ZZDA 3TJNA 3SGQE 1NN6A 4NA7A 1WBGB 3V3MA 1UHBA 1GI7B 5DO4H 1TGNA 1TBZH 1HXFH 1F7ZA 4QT8C 4K3JA 3UQVA 1FV9A 3BTHE 4Y7AA 2VIOA 2STAE 2GKVE 4ASHA 3Q3YA 4CRDA 3OU0A 4AFSA 5DP9A 1AUJA 3B8JA 4DIHH 4O3TA 1LO6A 1GI2A 2WYJA 3GY5A 1TOCB 2PKSB 4FVBA 3SU0A 1G30B 1GJ8B 4FXGH 1C5XB 3CP7A 3CS7A 1UTPA 3LJOA 2WPLS 2HPQH 3GICB 4A5TS 1GBIA 1D6WA 4KP0A 3P92A 4AB8A 1YCPM 2ZHDA 4BOHA 1NRRH 1V2MT 2BD7A 3KN2A 4Q7XA 1K1PA 1XKBC 1HAGE 1S84A 5A8ZA 1AVGH 5EQSA 1C1WH 2VVVA 2IOTA 4RSPA 3KCGH 1V2PT 1QB9A 5EQRA 1HAPH 3BEFB 4IC6A 4NIYA 4RKOB 2PLXA 1QQUA 2Y81A 1SSXA 3E0NB 3M7QA 1ZGVA 4O3UA 1AUTC 4R8TB 4AG2A 1DFPA 1PPZA 1C9TA 8GCHG 5J4SA 1GI3A 1QIXB 2FX6A 1C5VA 1C2MA 1Z8GA 1WU1A 1OP8A 1MD7A 2W26A 1LKBA 1HIAB 2JETB 2BD4A 3SHCH 3S9AA 2Q1JA 1UCYK 1NO9H 5ABWA 1CA8B 2A5IA 3SO3A 2HVXA 1UTOA 5C20A 5CE1A 9LPRA 3RXMA 1ZPCA 4GAWA 3RMLH 1V2QT 3TK9A 1ELDE 2FPZA 3ZV8A 1BITA 1IAUA 1TE0A 3ESTA 3UREA 1S82A 1TQ0B 3GCNA 4XDEA 2A5AA 2UUJB 1EP6A 1ANEA 4CRBA 1XVMA 3VB4A 1J8AA 1O2MA 2SNWA 1C1NA 1GMHG 1YPEH 4J1YA 1AFQC 2BXTH 3SOSA 5JYIA 2FOGA 3SNDA 2Z9GA 4MPXA 3KGPA 3A84A 5C5NA 2VVUA 1BTYA 1N8OC 4MPVA 3SZNA 1C5ZB 1TNIA 3STIA 1C1SA 4ZXYH 2BDHA 2Y6TA 4X0WU 3RXLA 1ZOMA 2XCFA 1DSUA 3SU1A 8KME2 2F9PA 4NCYA 5JBCS 3BSQA 3PTNA 1P2IA 1O37A 1TABE 3RC4A 4I7YH 3P8NA 2ZHQH 4WVPE 3P95A 3QK1A 3MOCA 1VCPA 2PSYA 1C2JA 1P12E 3RC6A 3DHKH 4Y71A 1K9OE 1GBEA 1IHTH 1GMDG 4X1RU 5E0GA 1NZQH 4BXWA 1UVPA 2GCTB 1XXFA 4Y8XA 2W3IA 1AI8H 1O3DA 1J9CH 4MNWA 2TGAA 2Z6BD 1IQGA 3TITA 1F0UA 3GCHB 5DP3A 1VCWA 3AVZA 1LHDH 2BTCE 4ABHA 3SI3H 1K22H 1O2OA 1P01A 3HGNA 1O31A 1TRYA 1LQDB 4CRFA 2RA0A 4K1TA 4UFFH 5JBAS 4MPUA 1SQAA 5EXLA 1VGCB 1AKSA 2BD8A 2WPIS