1O3HA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3hA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3hA02
1HAVA 1TOMH 2I6QA 1X7AC 1GJAB 3UPEA 1C2IA 5EQQA 1N6YA 4Y7AA 4O3UA 5FBEA 1OS8A 2EEKA 1O5DH 1O2RA 1BRUP 2Y81A 2SGPE 3ENSB 2ZU2A 2EI6A 2ANKH 5JBAS 3UWJH 1FY3A 2CXVA 2XCFA 1EX3A 4ISOA 1ZHMA 2JETB 3UQOA 1CGJE 2O8WA 3QX5H 4X6OA 1FPCH 1TPAE 3BEUA 2ANWA 2FS8A 5ESTE 1FY5A 1TA6A 1ABJH 2ZGHA 3BN9A 2QY0B 1D3DB 3LONA 4H6TA 1TLDA 1O2UA 2HVXA 3HGNA 2PKAA 5I46H 1SFIA 1SGDE 1SQOA 1DSTA 1SLXB 2OUAA 4Y7BA 1E0FD 3QGJA 4PROA 3A8AA 1LHCH 4WH8A 3M61U 5HM2A 1C1OA 3TGIE 1ZPZA 3KNXA 1PPGE 1UK2A 2WV4A 1TRYA 2ZHEH 1DFPA 1DXWA 1DY9A 4Z0KA 1OYQA 5E0JA 1EKBB 1SLUB 1U6QA 1ORFA 4FUJA 1DY8A 2FM2A 1VITG 4I31A 5E8EH 1TBZH 3ZVBA 1DVAH 3SGBE 1ANBA 1UTMA 5TCCA 4K3JA 2FOMB 4ZXXH 4O97A 1FLEE 5A8YA 4NZQA 1YGCH 1A1RA 3RXVA 1ESBA 1O5FH 4VGCC 2RDLA 3RXOA 2ILNA 1EB2A 1QB1A 3Q3XA 5T6GA 2M5TA 1P57B 1BMLA 1P06A 1S83A 2W5EA 1FN8A 2QF3A 4Q7YA 1H8IH 1ANCA 1J17T 3SV7A 1FIZA 2PW8H 1EJAA 2QA9E 2NU2E 1AVGH 4XOJA 3UTUH 4AB9A 1Y5BT 2BMGB 5C2ZA 1QNJA 3K9XB 1AQ7A 5F8ZA 4YM9A 1P2QA 4CHAB 1EUFA 1SOTA 2GT7A 2QIQA 1S6HA 1O2GH 3EE0B 3GY3A 1C2DA 1AN1E 1YF4A 4B1TA 2FZZA 1KDQB 4ISLA 4XE4A 1NROH 1RIWC 1EAIA 4IW4E 1P11E 2F9VA 1PQ8A 5EU8A 2XWBI 5GPIB 2OBQA 3TK6A 5FXLA 1XUIA 4A5TS 3MHWU 1S6FA 3RC4A 4OS2A 1BTPA 1ZR0A 2PUXB 4MPXA 1SQAA 2OQUA 5L6NH 1C1RA 3MNXA 3RDZA 1IQEA 1O35A 1QL9A 1KTTB 2BQ7B 2SGFE 3GY6A 5DO4H 2LPRA 3ITIA 3ZZ9A 1P3EA 5GXPA 1AGJA 1HRTH 1FY1A 1FUJA 1QCPA 5JBBS 4BNRA 3STIA 2GV7A 4I7YH 4Y11E 1O3EA 1HLTH 2A7HA 3FZZA 1EXFA 4THNH 1GG6C 2QV1A 1PQAA 3MNCA 1TABE 3BTQE 3S69A 1LVMA 5FX6A 1H9LB 5AVDA 2JH5D 1TGSZ 3VEQB 4X1NU 1JRSA 2O8UA 1YBWA 1BMMH 1TAWA 3SU6A 2ZPQA 1CHOF 2UWOA 3F6UH 1YCPM 1O39A 2Z3CA 1GI5A 1XUKA 1GBKA 1XKAC 5FPYA 4Y76A 1SGRE 4Y10E 2FX6A 2GMTB 1BRAA 1KLIH 3RMLH 1O37A 3VGCC 2HGTH 1P0SH 1RTFB 2BLQA 3Q3KA 1UCYE 2XBYA 3KCGH 1DWBH 2OC0A 2Q1JA 1K1NA 1SGFA 6GCHG 1ZLRA 3PO1C 1GI7B 1FMGA 1O3HA 2NU1E 3BTDE 1UHBA 3MWIU 3D49H 2ZEBA 4X8UH 8ESTE 3O8DA 1DWCH 2I6SA 3CS7A 4NWKA 3HATH 1TGTA 1H9HE 2FS9A 3URCA 1W12U 4AYYB 2P8OC 5TCAA 1P01A 1ZTJA 1GCTC 3M36A 3TGJE 1C4U2 3SQEE 4D7FA 4FUCA 2BLVA 5JBCS 2AGEX 1XX9A 2IJOB 3BG4B 4O3TA 2ZCKP 4QT8C 1O3MA 3ELAH 1GI9B 3FP8E 1GHXH 3K2UA 2BDHA 6LPRA 2ZKSA 1AFEH 3DA9B 4X1SU 1GHWH 1A46H 3OY5U 1KXEA 5ETXA 1HCGA 1VITF 1V2ST 4Q2KA 2Q6DA 2AIQA 2SFAA 1GL0E 1AI8H 1E37B 2B5TB 1ZGIA 2VWNA 2ZGJA 3SV9A 1SI5H 4BAOB 7KMEH 4NIXA 5A8ZA 4NIYA 3A7VA 3ZZCA 3E16B 3FVFB 3RC5A 2BVSH 2Z94A 2Y80A 1J8AA 1JRTA 2EC9H 4BAMB 1LVBA 4MNVA 2GTBA 4K1TA 1SSXA 1Y3XA 4J2YB 3FFGA 2ZGXH 2SGEE 4E7NA 1QQ4A 4XBDA 1HAYB 1CA0C 1TOCB 5A2MH 5JPMH 3UY9A 4GPGA 1O3NA 3A8CA 3UUZA 2C4FH 2H9HA 5PTPA 2A5IA 1DITH 3SV8A 3V3MA 4ESTE 2Y6TA 1ZTKA 2HNTF 1TA2A 3E0PB 1SHYA 1IQMA 7ESTE 3A86A 1DWEH 1C5SA 2Z9LA 3MU5A 2G8TA 2ZA5A 1TMUH 2BD8A 1D3QB 1YC0A 1P2KA 2HOBA 1CT0E 1BRBE 4ZKNU 1MD8A 3FAOA 4GVUA 1W14U 1AUJA 1NU7B 3LIWA 1RTLA 1PPCE 3HK3B 3F9GA 1E34B 5ABWA 1K2I1 2FOBA 2STAE 2BDIA 3OSYA 1V2TT 1DUEA 5DKMA 2TGTA 1LTOA 3HPTB 2PSYA 1A5HA 5A0AE 4LZ1H 1S85A 1KY9A 3AW0A 1BZXE 3TGKE 2D26C 2WPJS 4FVDA 1K1IA 3A7WA 1GBCA 2B0FA 4AN7A 1TBQH 3RXBA 1PYTC 2PKSC 1T8OA 5DP6A 4Y8XA 3VB3A 3GCHB 1C5LH 2WPIS 3AASA 1DS2E 4WXVA 1SGEE 1YCPH 2JH6D 1SR5C 1ZHPA 2A4GA 2ZFFH 3S7KB 1C1SA 2ZECA 3DT0H 1LKBA 4FUBA 1S0QA 4TPIZ 2PFEA 1ARCA 1SGCA 1Z8GA 2GKVE 1TX6A 5T3HA 2NU3E 1T8NA 2ZHDA 2BY9X 1BCUH 1TPPA 5EXNA 3TJVA 1LQDB 1G36A 2PSXA 4Y0YE 4X8VH 1QL8A 4ABDA 5F03A 1VJAU 2RA0A 1O2WA 5FBIA 5DK1A 1EOJA 4RSPA 1NO9H 1ANDA 1TONA 2ZDLA 1SGFG 2TGAA 3ZZ4A 1A5IA 4IBLH 1SLWB 1G30B 1BDAA 2ZC9H 1TGBA 1Q3XA 3R3GB 1O34A 2GCHG 3LU9B 1TGCA 3A82A 2G4TA 2G51A 6GCHF 1K1OA 4KTSA 8GCHG 1OX1A 1HBTH 2C93B 4A1VA 2A4OA 1G32B 1O2HA 2P3UB 3U1IB 2BDCA 2WPKS 1HYLA 1EPTA 1O32A 1ZSKA 2EA3A 3MOCA 3TH4H 3F9FA 1YCPK 2Y5HA 4OS4A 1HXFH 5EODA 5GWZA 1EOLA 2BY5X 4FUIA 1BB0B 2F9BH 1VGCC 2R3UA 2AGIX 1MMJN 1MKXK 4M7GA 1Z8IB 1QA0A 3RXSA 1O5CB 1QRXA 4YO9A 1GJ7B 4WF8A 1O38A 4MPUA 3SJ8A 3A8BA 1MU8B 1HJAC 1MBQA 3ATMA 4X6NA 3T29A 1C9TA 5LGOA 1V2WT 1G9IE 1UCYH 4FXGH 4WH6A 4ZXYH 4KP0A 4E05H 1BJUA 1TE0A 5A0CA 4ZH8A 4OS1A 4MVNA 2BDYA 2BD4A 3DHKH 2FX4A 2Z6BD 2FI4E 1D6RA 2VWLA 1N6XA 1V2PT 1P2NA 1W7GH 3OY6U 1C9PA 1AKSB 4B75A 1V2QT 3BV9B 4ZHLU 3M5NA 4IC5A 5B6OA 1C5YB 1V2JT 2A0QB 2ZFSA 4WMFA 2EI7A 1AVXA 1WU1A 2IN2A 2VGCB 1C5PA 1AFQC 2ZU3A 2SGAA 3I77A 3M5MA 2OLGA 1DDJA 4CBOA 3B8JA 1OYTH 2VVVA 1NC6A 1FN6A 2QF0A 2ZHWH 4HZHA 4NIWA 2VH6A 2H1UA 2Z9JA 1GJ9B 1TMBH 1F0RA 1DM4B 1K9OE 1Y3YA 1ELAA 3A89A 1PJPA 3H5CB 3DUXH 4AG2A 2FMJA 3M7TA 1GWAA 3P92A 1P2OA 6CHAC 1UVOA 3Q77A 4A6LA 4BOHA 2ALVA 3RXIA 4MNXA 2XW9A 1SGNE 3SI3H 1UVPA 2RA3A 1Z1IA 1QURH 2XBXA 1GDUA 1GGDB 3GOVB 4D9QA 4HI3A 2CN0H 2Z9IA 3ODDA 3PROA 2R2WU 1TNJA 2FWWA 3LH3A 1GL1A 4FU7A 1Z8JB 1N8OC 4OGYA 2JH0D 1ETSH 1ELCA 2Z7FE 1K21H 3DFLA 3AAUA 1O3CA 1DICA 3P70B 1P2MA 4MDSA 3T62A 1THPB 7GCHG 2ZP0H 1B0FA 1OWKA 4ZAEA 2FP7B 4BAHB 3Q3YA 2Y5GA 2KAIA 1BQYA 1NESE 3MH7A 3KN2A 1O30A 1GI8B 1NS3A 3M3TA 1O2YA 2QC2A 2W26A 2ZTYA 5C5OA 2BTCE 1C1TA 5F8TA 1IAUA 1W10U 3ZVGA 3FZDA 4O9VA 3PMJA 1MQ5A 2G5NA 2V3OH 3PMHB 4JZDH 3TJOA 2W3IA 3P8NA 1GHBG 1GPZA 1OP0A 1GHAG 1ZJKA 4UD9H 3V12A 2THFB 1AD8H 4Q80A 2AERH 2UUJB 2YNAA 1O2LA 1Z6JH 2ODPA 1LPGB 2GCHF 3BTWE 1TQ7B 3RU4D 3PMAB 2PHBA 1ZPBA 3P8GA 8GCHF 1ZZZA 3T27A 2FXRA 1DOJA 1VCQA 1P2JA 1FV9A 2XRCA 1FIWA 1RJXB 3RM0H 3E3TA 4B73A 1EZXC 2ULLA 4X6MA 4I33A 1Y3VA 2VIVA 4Y8ZA 4YTAA 1W2KH 1YKTA 3M7QA 4H6SB 4YLQH 1LHFH 2JKHA 4LXBH 5BPEA 1IHTH 1LCYA 3RXEA 1HAIH 4F4OC 3BTKE 2WYGA 3A7YA 2HALA 5DP9A 4K69A 1TX7A 2CHAB 1LPKB 5HGGA 1MTNC 1JXPA 1F0UA 3TVJB 3AAVA 4WY3A 1AY6H 1TFXA 4E06H 3GDUA 1O2ZA 4INLA 2RCEA 3SU1A 2XXLA 3ZV8A 3V7TA 1HAHH 1LMWB 3PTBA 5C20A 1TQ0B 4ZKSU 4DCDA 3TJUA 2H5CA 3BEFB 3VB7A 1D9IA 4U2WA 1WTHD 3NKKA 1OWHA 9ESTA 3M5LA 3IG6B 2BM2A 1GI4A 1GVLA 3RU4T 3UR6A 1BHXB 2AMPA 1S5SA 1T8MA 1EATA 1MKWK 2ZDNA 1L4ZA 3BTHE 3PV4A 5JDUB 7LPRA 3LGUA 1CSOE 1AO5A 3K6ZA 4FUGA 3EA7A 1TNGA 1DPOA 1NFWA 2VWMA 4XFQA 4DIHH 4AFQA 3MU8A 1YYY1 4UEHH 1ZPCA 3A81A 5FCRA 3GCTG 1GJBB 1QA7A 2WYJA 2D2DA 4AX9H 4K8BA 2GDEH 1QQUA 2OC1A 2ZDVH 5C1XA 2H9TH 3ZV9A 1SOZA 1O2JA 3SQHE 1TNLA 1JIRA 1OWJA 4GHTA 3KEEA 1O3BA 2VVUA 4R8TB 2BY8X 4Y6DA 2TPIZ 1NM6A 2ZF0H 3LGWA 3KF2A 3ZVCA 3BIUH 2FTLE 4JK6A 3M3VA 3RLWH 2PKSB 1TNIA 2A5AA 2F9UA 2FI5E 2AGGX 1GJ4H 3CENA 1D3PB 3SN8A 3PLPA 4H42U 1G3DA 1C1VH 1B0EA 1V2UT 7GCHF 2Z9GA 5J4QA 1CBWC 2GCTB 2QXHA 2BHGA 1L4DA 3TH3H 5LPRA 3A7XA 3ZYDA 1ELVA 1NFXA 2A45B 4WXIA 1TMTH 3ZZ8A 2OC8A 1ZHRA 3SI4H 1A0JA 1ZJDA 1F5KU 3T28A 1K1PA 4CRBA 3U9AH 3BSQA 1SGTA 3ZZ6A 5DP8A 4AYVB 5CE1A 1XUGA 1UTPA 2J94A 1O3PB 1CT2E 2XC4A 1GHBF 1HJ8A 2Y5FA 1GHAF 3HGPA 3KQDA 2ZCHP 1FAKH 3IITA 1IQHA 1P3CA 2Q6GA 1LPZB 3M5OA 4BAKB 2FODA 5DPAA 2BYAX 3T26A 3F1SB 4K1SA 4ISNA 1PQ5A 1ZRKA 1ZMJA 3IWMA 5DGJA 4I8LA 1GMDG 2ZQ2A 4XSKU 3T5FH 5L30H 3A8DA 4FU8A 2BD5A 3TNTA 2BZAA 4FUFA 2ZGBH 1BMAA 1P10A 3A87A 4ZKOU 1C2EA 1Y3WA 6ESTA 1LHDH 1XUFA 2GT8A 1Y3UA 4CR5A 2DE8A 2CF9H 3RXUA 1C2KA 1UVTH 4LZ4B 1GBEA 1GI1A 2XC5A 1ELEE 1O36A 1KLJH 1O3KA 5JBTA 1UK4A 1EQ9A 3H7OA 3RXPA 1MZAA 2ZNKH 1A5GH 3D65E 3QDZB 3HKIB 1GJ8B 2J9NA 1O2TA 1QJ6B 2K1QA 2PR3A 3LGIA 2CJIA 3QZRA 1O5GH 3A80A 1GBFA 3P8FA 1E36B 3CS0A 5L2ZH 1HJ9A 3SUEA 1GBJA 2A2XH 3TNSA 1NT1A 1CGIE 3TPIZ 1KXCA 2VINA 1QTFA 1OKXA 2GZ8A 3W94A 4INHA 4ZHAA 3MO9A 3VXEH 2BXTH 2R3YA 1YPHE 2QXGA 1GJ6A 4UE7H 3PWBA 2ZFTA 3QN7A 3RXTA 1AHTH 2D1JA 1Y8TA 3LC5A 4K5ZA 8KME2 1NPMA 4D8NA 1AE8H 1DWDH 2XNIA 2G4UA 1C1QA 4NSVA 1E35B 1UVSH 3A7TA 3MNBA 1PPZA 4AORA 4AOQA 2ZQ1A 1S84A 3P6ZB 1NRPH 5FPSA 3VXFH 4K2YA 1W7XH 4LK4A 1DT2A 3SORA 4X2WA 1YLDA 2ZPSA 1HFDA 1C2MA 1QIXB 1FDPA 2VVCA 3KHVA 5TJXA 1MTVA 3GCTF 5FPTA 5EW1H 2JETC 1HGTH 3B9FH 1C5VA 1B5GH 4UFEH 1W8BH 3L6PA 1H8DH 1BTXA 4FVBA 3GICB 1ARBA 2BVXH 1W0YH 2P95A 3N7OA 1EJNA 1HNEE 1PPFE 2NU0E 2Z3DA 2BX4A 2HWLB 3GISB 2VB0A 2P93A 4B2AA 1TPOA 2BVRH 4HGCA 4BXSA 1AE5A 1F5RA 1HB0B 1H1BA 2XC0A 1K1LA 4FU9A 2CGAA 2QAAA 2R0KA 2F3CE 5EQRA 1YM0A 5DP7A 2DE9A 2NU4E 1DANH 2FPZA 3A88A 1V2VT 1PPEE 1MTSA 3SU3A 4NA9H 1C1PA 1O2SA 1V2LT 1RRKA 1AB9B 1YPKH 4CRDA 4FUEA 3U98H 3BTEE 1GHVH 1ELTA 4MLFB 5CHAC 3SGQE 3SHCH 2BD9A 1YPMH 4MQAA 1T4UH 3EQ0H 5E2PA 3SGAE 5CMXH 3DD2H 1PYTD 3M3SA 4IS5A 2XTTB 1C2JA 5EPNA 1WAYB 3L33A 1SBWA 1UO6A 2W7UA 3KL6A 1QB6A 1O5AB 1QL7A 4A1XA 1Z6EA 1HAGE 2P3TB 4DW2U 2BD3A 2ZDKA 3L3TA 1UVUH 4I8GA 2ODQA 4ISHH 2F9OA 2A32A 4B2BA 4ZMAH 3Q00A 1MKXH 3SUFA 4UDWH 2Z3EA 3PLBA 1KDQA 1GMDF 2O8LA 2WV5A 2ZFQH 2ZI2H 2FO9A 3UNSA 4AB8A 4CRGA 1HAVB 3UFAA 1WSSH 2ANMH 1K1JA 2CMYA 3QK1A 5FHTA 4ABEA 1GHZA 1XVOA 3DFJA 5AF9H 1K28D 1AUTC 4H4FA 4CH2B 4TY6A 3RXLA 2XBVA 2LNCA 1MAXA 3ZZDA 4XDEA 1FAXA 5ESBA 2VIWA 2HRVA 1BOQA 1OWEA 1WYKA 3SUDA 5F6MA 3SV6A 2ZCLP 1F0TA 4DG4A 2B9LA 1G2MA 1MTNB 2FLBH 1A0LA 2GZ9A 4MPVA 1BBRK 1MCVA 1NFUA 1O2OA 3LJJA 1RXPA 5HMAA 1YLCA 2SNVA 4AZ2B 1P2IA 1BTWA 4WJG2 1LVYA 2PKAB 4CRAA 2XWAA 3LGVA 1J14A 3OX7U 1GI2A 1Q31A 5G4BA 1EPTC 3RXQA 1EAUA 1BT7A 3MH5A 4A92A 1FONA 4DVAU 1YPEH 4SGBE 1FJSA 1IQFA 3M37A 1SGYE 1YPHC 1C2LA 3GDSA 3K65B 4I8HA 4IMZA 5LPFA 1IQJA 2VIDA 3TITA 1QHRB 2ZZUH 2WPMS 1VJ9U 3F9EA 2GX4A 2B7DH 2FIRH 1ZYOA 3SNDA 3U1JB 1ZSJA 2QN5T 4VGCB 2IOTA 4DGJA 5K0HA 1C5OH 1DXPA 1NY22 1UTLM 4KELA 3TJNA 1TGNA 4GSOA 1FY8E 1A61H 1UTNA 3UREA 4JCNA 4MNYA 1P9UA 1QY6A 5BRRE 2GDDA 4D76A 2ZPRA 1V2KT 2XCNA 4NFFA 2R0LA 3EDXB 3QTVH 3G01A 3GCOA 4JZ1A 3URDA 1AWFH 4SGAE 4X2XA 2OQ5A 5LH8A 4NGAH 3QO6A 1C4V2 2UUYA 3GY8A 5GIBA 1DUAA 1G2LA 1ID5H 4JYVH 1THSH 1WUNH 4X1QU 5C5NA 1C5NH 5EG4A 5JB9S 1KSNA 1RIWB 2BZ6H 1YPGH 2Y7ZA 1MZDA 1RFNA 3SV2H 4UONA 3ZVFA 1EZQA 1J16A 2GV6A 1VCPA 1ANEA 1O3JA 4AFUA 2ZO3H 3K6YA 1GI6A 1LHGH 1ZTLA 3BG4C 2ESTE 5C1UA 5K7RA 4NCYA 1C5TA 4Z6AH 2ALPA 3SNBA 1FNIA 3V13A 4GCHG 1FQ3A 3PYHA 3MU4A 3SJIA 5DJ7A 1QJ7B 4TWYA 1A4WH 1SGIB 2OXSA 3MU1A 2PLXA 3PB1E 4ABJA 2C8XB 1XXDA 1GG6B 1C5RA 1NRRH 2F91A 1LHEH 3BIVH 2V6NA 2BQ6B 2D8WA 3TK5A 1YPLH 1CHGA 2RG3A 1THRH 2VIOA 2WINI 4D7GA 3LGYA 1TNHA 4B71A 4BANB 3RXHA 3RXAA 1C5UA 1D3TB 2STBE 3NXPA 1TPSA 1GBAA 4X2VA 5A0BA 2A4QA 1HAZB 3A85A 4TY7A 3A84A 5AFYH 5C3NA 2UUFB 3PMBB 3SHAH 1GMCG 1ETTH 1O3LA 3R0FA 3M7UA 1O3IA 4MTBA 2TGDA 2HPQH 2P94A 3BG8A 2TBSA 3RXDA 3ATLA 3ZZAA 2ZHQH 1T31A 2A7CA 3VGCB 4ISIH 4KTCA 4U30A 8LPRA 1A3EH 3EAJA 3ODFA 3FP7E 1O2VA 1V2MT 4R0IA 2F83A 1V2NT 1GJDB 1LO6A 3PO1B 4Q7ZA 1W11U 3NCLA 1M9UA 3A7ZA 3QTOH 4NA8A 5GCHG 3SNCA 1Z8RA 3MH6A 3PLKA 3FP6E 1HUTH 1BTUA 1UTJA 2XYAA 1UHBB 1XUJA 1O0DH 1L2EA 3AVZA 1KXAA 1P9SA 2WUCA 4WWYA 4DOQA 2AEIH 1MD7A 2P8OB 2SGQE 4YOIA 2ZWLH 2Y82A 4E7RG 3LKWA 3TLOA 1DLKB 1GCTB 4X6PA 1FXYA 2AMQA 1BTZA 2GP9B 4NZLA 1OOKB 5FAHA 4KGAA 1MKWH 2P59A 1H4WA 4NIVA 3C27B 3GCHC 1L1GA 3HK6B 2J95A 4NA7A 5JYIA 3UQVA 4IGDA 3LJOA 1J15A 1C1MA 1BTHH 4AFSA 2O8TA 3U69H 3TK9A 1MAYA 2R2MB 3SU0A 3S9BA 3MO3A 4FUHA 2A4RA 4X8SH 1D6WA 4KTUA 4I32A 4XBBA 1NZQH 2ZDAH 1XKBC 3GYLB 1O5BB 4U01A 2TGPZ 3JZ1B 4JZFH 1QFKH 1J9CH 1PPBH 2A31A 2FOEA 3UOPA 5DP4A 1CA0B 4U32A 3SO3A 4BTUB 1EZUC 3B23B 3EA8A 4CREA 1BUIA 3MO6A 2WUBA 2C90B 1CT4E 1S82A 1AZZA 2BOHB 1OXGA 3RMNH 2FI3E 5DG6A 2FOAA 1O2MA 2ZU1A 2QXJA 1KXBA 1LKAA 1BHXF 3MTYA 5GJ4B 3ZVAA 4ZHMU 2ZDMA 4HFPB 4JYUH 1ELDE 1JIMA 3Q76A 4XBCA 4B2CA 1MUEB 2GGVB 3I29A 1QJ1B 1P8VC 1VZQH 2G55A 2YNBA 4ZROA 5IYTA 4OS7A 3VPKA 1Z7KA 3MI4A 1ESAA 1HV7A 1G37A 2BB4A 1K22H 3RMOH 5EW2H 1V3XA 5CHAB 3RUOA 4JYTA 4GCHF 5EXMA 3SBKA 4AGJA 5T6FA 2W7SA 1A3BH 3RXFA 1AKSA 2VH0A 1F92A 1OPHB 1HXEH 3U8RH 1BBRE 1EAWA 3SU5A 1N1LA 1MH0A 4NFEA 3QWCH 2PTCE 1OP2A 3NK8A 4UFFH 4YESB 4ZUHA 5EQSA 4X8TH 1C2FA 1F0SA 1UMAH 4O03A 9LPRA 1HAPH 1BRCE 5T6DA 5EOKA 2VGCC 2FOCA 5HYOA 1KXFA 3VB4A 2FYRA 4IMQA 4K8YA 1CO7E 1OP8A 3QGNB 5E0HA 1F2SE 3NZIA 3FANA 4GUXA 4DY7B 1AWHB 2J92A 1TX8A 4Y8YA 1GMCF 4BXWA 1WCZA 1GDNA 1HAOH 3NUMA 1PFXC 4YT7H 1SLVB 1FI8A 1JMOH 3ATWA 3MYWA 2BDAA 1GBTA 1V2RT 4GLYA 3RXGA 1QB9A 1G3CA 3ZYEA 1T32A 1BA8B 2Z9KA 5H4IB 3S0NA 2ZU4A 5DP5A 1QGFA 3LT3A 1GGDC 3QLPH 2P3FH 3STJA 1EP6A 1IQGA 1DLEA 2OP9A 2SNWA 3U8TH 3UOUA 1ZOMA 3D23A 1Z1JA 5GCHF 1UK3A 3KQBA 4ABAA 1P05A 4CR9A 3AW1A 1QBNA 2V35A 3LGTA 3O8BA 1EPTB 3O8RA 1MTUA 1C2GA 1O3AA 5GDSH 1QRZA 4ZKRU 1VGCB 1O33A 2VIPA 3E0NB 1Y59T 3MU0A 1C5WB 4JK5A 3GY7A 1ELBA 1GVKB 2BY7X 1AU8A 1HIAB 1O2PA 1O3OA 2H2ZA 2QXIA 4YZUA 2C3SA 5C67A 1HJAB 3I78A 4RKJB 2FEQH 2C8YB 4DT7B 3O8CA 2FDAA 1BMNH 1IQNA 2VNTA 1GI3A 1CVWH 1E38B 3RP2A 2UWLA 1YP9A 4OS5A 4F49A 4CRFA 3PTNA 3GDVA 2SGDE 1QR3E 4DJZB 1WQSA 1GBDA 2O8MA 2BLWA 1Q2WA 1C1WH 4CRCA 1LDTT 2FOFA 3GY5A 5LPEA 1IOEA 2FOGA 2GD4B 2BX3A 5C1YA 3KQCA 1EZSC 1VR1H 1ETRH 3SU4A 1EASA 1O3GA 1AFQB 2EI8A 1PQ7A 3OU0A 5EXLA 3SNEA 1ZSLA 4ABHA 3UNRA 1INCA 3NWUA 2GZ7A 1TBRH 2NWNA 1SB1H 2BXUH 3BTFE 2ZIQH 2ZFRH 1MQ6A 1D4PB 1TRMA 2Q6FA 1IHSH 1A7SA 1XM1A 2HLCA 3ZZ5A 4IN2A 2VJ1A 2ZU5A 2FOHA 4A7IB 1O31A 3E6PH 1ZRBA 1WV7H 6CHAB 2OTVA 3RXRA 5JB8S 2H5DA 5FX5A 1NRSH 3RXMA 1AIXH 1SC8U 1EAXA 2BQWB 1MCTA 1SQTA 2ZG0H 1SFQB 2V3HH 3QZQA 1YPJH 3EYDA 1GVZA 1ZGVA 3SW2B 3F68H 2CHAC 1CA8B 2ZHFH 1N8OB 2G5VA 4HTCH 3BF6H 3ZVEA 1KLTA 4NSYA 1SVPA 4AGKA 4X0WU 2AH4X 3BTTE 3E91A 1GMHG 4YOGA 4JZEH 4INKA 1CQQA 4JMYA 4X1PU 1NTPA 2DUCA 2VIQA 3KIDU 3P8OA 4BTTB 4BAQB 3LC3A 1O2QA 5A09A 1SMFE 5A8XA 1K1MA 4GAWA 1UJ1A 1KIGH 2KAIB 1HAXB 1MBMA 2FESH 4TWWA 2YOLA 1EJMA 2WPHS 2BDBA 1GI0A 3P17H 3ZZBA 3D62A 4OS6A 2A2QH 1HPGA 1NU9A 5E0GA 1GCDA 3LOXA 4ABFA 3ESTA 3RMMH 1KTSB 2ZGCA 3SUGA 4WVPE 1SG8B 4CH8B 4IN1A 2PGBB 3BEIB 1OWDA 1BBRH 4YT6H 3SJOA 1VCWA 5EGMA 1T8LA 3F9HA 3OYPA 3GY2A 1UTQA 4K60A 4A1TA 1L1NA 1SHHB 2G00A 2AS9A 4IC6A 1C4Y2 3E90B 1AMHA 3BTGE 4KKDA 1PPHE 3TH2H 1Z71A 1O2NA 1ESTA 3NPSA 1TWXB 2TRMA 1XVMA 4YLUA 1SGQE 4CHAC 1AZ8A 4MPWA 1O2IA 1P09A 1C5MD 3V0XA 1C1UH 2OBOA 1SGPE 3RXJA 3A83A 3JZ2B 1WOFA 1GHYH 1QBOA 1W13U 2ANYA 2HNTE 4ABGA 1MU6B 3MH4A 5E2OA 2BY6X 1JBUH 1NRQH 1UTKA 2UWPA 4JZIA 2GCTC 1NFYA 1XMNB 4UFGH 4MNWA 1IQKA 4RKOB 1WTGH 2WPLS 4X1RU 2FYQA 1V2OT 3E8LA 2FLRH 3RXCA 2AFQB 1GJCB 1O3DA 1RGQA 3OTJE 1JWTA 2FTMA 1RS0A 2BLOA 1B7XB 3KGPA 2AIPA 2PWXA 1L0ZA 1TIOA 2CF8H 1RTKA 4Y79A 1G3BA 5F8XA 1HDTH 1W0ZU 3SJ9A 4DURA 2UUKB 1ZMLA 3SOSA 1SL3A 3RU4E 3RLYH 2C8ZB 5HXFA 5EPYA 1T7CA 1MTWA 1ZMNA 4OGXA 2ZFPH 1CE5A 4Y0ZE 3RC6A 3KQEA 5HM9A 1O5EH 4MG3A 5L2YH 1HIAA 2OINA 3RXKA 2A1DB 1KXDA 2AYWA 2W3KA 1CGHA 1Y5AT 1GBHA 2J34A 1P04A 3UNQA 3BTME 3E1XB 1EB1H 2GMTC 2IPHA 2PUQH 3LH1A 1S0RA 4Q7XA 1DX5M 1DE7H 3GCNA 5DP3A 3U8OH 2G52A 3UR9A 1GBIA 1C2HA 2OCVB 3SU2A 2AMDA 2PV9B 1QBVH 1P03A 1AVWA 2H9EH 4B74A 2F9PA 2A7JA 1GBLA 3GY4A 4WMDA 5I25A 4YOJA 4NWLA 1XXFA 2BD2A 1GMHF 3S9CA 1BJVA 1O2KA 4CBNA 1C1NA 3UIRA 2G81E 3GYMA 2BD7A 1GBMA 1GBBA 1TYNA 3W95A 1GJ5H 2J2UA 1CBWB 3SZNA 2BDGA 4AG1A 1T4VH 4ASHA 1BTYA 1FY4A 2F9NA 3S9AA 1RD3B 1WBGB 1A0HB 3MMGA 1C5XB 1UTOA 3SJKA 2BOKA 1FZZA 5IDKA 4WMEA 4ABIA 4DIIH 1F7ZA 3ZZ3A 3SNAA 2VWOA 4I8JA 1LQEA 1UCYK 2ODYB 3ATIA 1KYNA 4I8KA 3TIUA 1ABIH 1TB6H 3VB5A 4BTIB 2P16A 1TRNA 3M35A 3CP7A 1C5ZB 1LVOA 4TPYA 5J4SA 1BITA 4GHQA 2QYIA 1C5QA 1WQVH 1OSSA 1TNKA 2B8OH 3C1KA 2A5KA 1CU1A 3PM3A 3T2NA 3RM2H 1FPHH 3ZVDA 2C8WB 4D9RA 1IQIA 1NN6A 4Y71A 5AFZH 5SGAE 1EP5A 4RN6A 2V0BA 3UWIA 4TYDA 4UFDH 3WY8A 2O9QA 1OWIA 1F5LA 2ZTZA 3HKJB 1O2XA 1VITH 2J4IA 3MFJA 1O3FA 1A2CH 2PTNA 1QRWA 1W3CA 3LDXH 2H6MA 1JOUB 5AHGH 2OC7A 3QUMP 2ZTXA 1DSUA 2HNTC 1H9IE 4ABBA 1SPJA 4B76A 2ASUB 2HPPH 2Y7XA 2J38A 2OD3B 5FCKA 3VB6A 1ACBE 3T25A 3EGKH 1BIOA 3PWCA 2CV3A 1V6DA 4FUDA 1Y5UT 2TIOA 1AB9C 3S7HB 3ATKA 1G3EA 1TALA 4LOYH 2GVFA 3H7TA 3VFEA 3MNSA 4J1YA 1P02A 2XBWA 1XUHA 3EA9A 3LPRA 2QGRA 4K1EA 1ELGA 1S81A 1ELFA 4AFZA 2VU8E 1IQLA 4NG9H 1GDQA 1L1JA 4X2YA 1CHOG 2QCYA 1P12E 2PGQB 2R9PA 1NRNH 3TU7H 3ZZ7A 3P95A
chains in the Genus database with same CATH superfamily
1HAVA 1TOMH 2I6QA 1X7AC 1GJAB 3UPEA 1C2IA 5EQQA 1N6YA 4Y7AA 4O3UA 5FBEA 1OS8A 2EEKA 1O5DH 1O2RA 1BRUP 2Y81A 2SGPE 3ENSB 2ZU2A 2EI6A 2ANKH 5JBAS 3UWJH 1FY3A 2CXVA 2XCFA 1EX3A 4ISOA 1ZHMA 2JETB 3UQOA 1CGJE 2O8WA 3QX5H 4X6OA 1FPCH 1TPAE 3BEUA 2ANWA 2FS8A 5ESTE 1FY5A 2YMSB 1TA6A 1ABJH 2ZGHA 3BN9A 2QY0B 2XNDD 1D3DB 3LONA 4H6TA 1TLDA 1O2UA 2HVXA 3HGNA 2PKAA 5I46H 1SFIA 1SGDE 1SQOA 1DSTA 1SLXB 2OUAA 4Y7BA 1E0FD 3QGJA 4PROA 3A8AA 1LHCH 4WH8A 3M61U 5HM2A 1C1OA 2KCPA 3TGIE 1ZPZA 3KNXA 1PPGE 1UK2A 2WV4A 1TRYA 2ZHEH 1DFPA 1DXWA 1DY9A 4Z0KA 1OYQA 5E0JA 1EKBB 1SLUB 1U6QA 1ORFA 3OE7D 4FUJA 1DY8A 2FM2A 1VITG 4I31A 5E8EH 1TBZH 5KGOA 3ZVBA 1DVAH 3SGBE 1ANBA 1UTMA 5TCCA 4K3JA 2FOMB 4ZXXH 4O97A 1FLEE 5A8YA 4NZQA 1YGCH 1A1RA 3RXVA 3WWFA 1ESBA 1O5FH 4VGCC 2RDLA 3RXOA 2ILNA 1EB2A 1QB1A 3Q3XA 5T6GA 2M5TA 1P57B 1BMLA 1P06A 1S83A 2W5EA 1FN8A 2QF3A 4Q7YA 1H8IH 1ANCA 1J17T 3SV7A 1FIZA 2JDID 2PW8H 4Q4LA 1EJAA 2QA9E 2NU2E 1AVGH 4XOJA 3UTUH 4AB9A 1Y5BT 2BMGB 5C2ZA 1QNJA 3K9XB 1AQ7A 5F8ZA 4YM9A 1P2QA 4CHAB 1EUFA 1SOTA 5IK2D 2GT7A 2QIQA 1S6HA 1O2GH 3EE0B 3GY3A 1C2DA 1AN1E 1YF4A 4B1TA 4YXWD 2FZZA 1KDQB 4ISLA 4XE4A 1NROH 1RIWC 4ACBA 3KQ5A 1EAIA 4IW4E 1P11E 2J97A 2F9VA 1PQ8A 5EU8A 2XWBI 5GPIB 2OBQA 3TK6A 5FXLA 2AHME 1XUIA 4A5TS 3MHWU 1S6FA 3RC4A 4OS2A 1BTPA 1ZR0A 2PUXB 4MPXA 1SQAA 2OQUA 5L6NH 1C1RA 3MNXA 3RDZA 1IQEA 1O35A 1QL9A 1KTTB 2BQ7B 2SGFE 3GY6A 5DO4H 2LPRA 3ITIA 3ZZ9A 1P3EA 1BMFD 5GXPA 1AGJA 1HRTH 1FY1A 1FUJA 1QCPA 5JBBS 4BNRA 3STIA 2GV7A 4I7YH 4Y11E 1O3EA 1HLTH 2A7HA 3FZZA 1EXFA 4THNH 1GG6C 2QV1A 1PQAA 3MNCA 1TABE 3BTQE 3S69A 1LVMA 5FX6A 3ZIAD 1H9LB 5AVDA 2JH5D 1TGSZ 3VEQB 4X1NU 1JRSA 2O8UA 1YBWA 1BMMH 1TAWA 3SU6A 2ZPQA 4XD7D 1CHOF 2UWOA 4DT4A 3F6UH 1YCPM 1O39A 2Z3CA 1GI5A 1XUKA 1GBKA 1XKAC 5FPYA 4Y76A 1SGRE 4Y10E 2FX6A 2GMTB 1BRAA 1KLIH 3RMLH 1O37A 3VGCC 2HGTH 1P0SH 1RTFB 2BLQA 3Q3KA 1UCYE 2XBYA 3KCGH 1DWBH 2OC0A 2Q1JA 1K1NA 1SGFA 6GCHG 1ZLRA 3PO1C 1GI7B 1FMGA 1O3HA 2NU1E 2KCOA 3BTDE 1UHBA 2QF4A 3MWIU 3D49H 2ZEBA 4X8UH 8ESTE 3O8DA 1DWCH 2I6SA 3CS7A 4NWKA 3HATH 1TGTA 3OTPA 1H9HE 2FS9A 3URCA 1W12U 4AYYB 2P8OC 5TCAA 1P01A 1ZTJA 1UW7A 1GCTC 3M36A 3TGJE 4TT3D 1C4U2 3SQEE 4D7FA 4FUCA 2BLVA 3H09A 2AGEX 1XX9A 2IJOB 5JBCS 3BG4B 4O3TA 2ZCKP 4QT8C 1O3MA 3ELAH 1GI9B 3FP8E 1W0JD 1GHXH 3K2UA 2BDHA 6LPRA 2YMSD 1AFEH 2ZKSA 3DA9B 1GHWH 4X1SU 1A46H 3OY5U 1KXEA 5ETXA 1HCGA 2L6OA 1VITF 1V2ST 4Q2KA 2Q6DA 4ACAA 2AIQA 2SFAA 1GL0E 1AI8H 1E37B 2B5TB 1ZGIA 2VWNA 2ZGJA 4F48B 1SI5H 3SV9A 4BAOB 7KMEH 4NIXA 5A8ZA 4NIYA 3A7VA 3ZZCA 3E16B 3FKSD 3FVFB 3RC5A 2BVSH 2Z94A 2Y80A 5GNDA 1J8AA 1JRTA 2EC9H 4BAMB 1LVBA 4MNVA 3WWBA 2GTBA 4K1TA 1SSXA 1Y3XA 4J2YB 3FFGA 2ZGXH 2SGEE 4E7NA 1QQ4A 4XBDA 1HAYB 1CA0C 1TOCB 5A2MH 5JPMH 3UY9A 4GPGA 1O3NA 3A8CA 3UUZA 2C4FH 2H9HA 5PTPA 2A5IA 1DITH 3SV8A 3V3MA 4ESTE 2Y6TA 1ZTKA 2HNTF 1TA2A 3E0PB 1SHYA 1IQMA 7ESTE 3A86A 1DWEH 1C5SA 5KEDA 3PRBA 2Z9LA 3MU5A 2G8TA 2ZA5A 1TMUH 2BD8A 1D3QB 1YC0A 1P2KA 1NBME 1CT0E 2HOBA 1BRBE 4ZKNU 1MD8A 3FAOA 2IPQX 4GVUA 1W14U 1AUJA 1NU7B 3LIWA 1RTLA 1PPCE 3HK3B 3F9GA 1E34B 2WPDD 5ABWA 1K2I1 2FOBA 2STAE 2BDIA 3OSYA 1V2TT 1DUEA 5DKMA 2TGTA 1LTOA 3HPTB 2PSYA 1A5HA 5A0AE 4LZ1H 1S85A 1KY9A 2K0QA 3AW0A 1BZXE 3TGKE 2D26C 2WPJS 4FVDA 1K1IA 3A7WA 1GBCA 2B0FA 4AN7A 1TBQH 3RXBA 1PYTC 2PKSC 1T8OA 5DP6A 4Y8XA 3VB3A 3GCHB 1C5LH 2WPIS 3AASA 1DS2E 4WXVA 1SGEE 1YCPH 2JH6D 1SR5C 1ZHPA 2A4GA 2ZFFH 3S7KB 1C1SA 3F0OA 5C17A 2ZECA 3DT0H 1LKBA 4FUBA 4B6FA 1S0QA 4TPIZ 2PFEA 1ARCA 1SGCA 1Z8GA 2GKVE 1TX6A 3N7EA 2NU3E 1T8NA 2ZHDA 5T3HA 2BY9X 1BCUH 1TPPA 5EXNA 3TJVA 1LQDB 1G36A 2PSXA 4Y0YE 4X8VH 1QL8A 4ABDA 5F03A 1VJAU 2RA0A 1O2WA 5FBIA 5DK1A 1EOJA 4RSPA 1NO9H 1ANDA 1TONA 2ZDLA 1SGFG 2TGAA 3ZZ4A 1A5IA 4IBLH 1SLWB 1G30B 1BDAA 2ZC9H 1TGBA 1Q3XA 3R3GB 1O34A 2GCHG 1E1RD 1TGCA 3LU9B 3DCLA 3A82A 2G4TA 2G51A 6GCHF 1K1OA 4KTSA 8GCHG 1OX1A 1HBTH 2C93B 4A1VA 2A4OA 1G32B 1O2HA 2P3UB 3U1IB 2BDCA 2WPKS 1HYLA 1EPTA 1O32A 1ZSKA 2EA3A 3MOCA 3TH4H 3F9FA 1YCPK 2Y5HA 4OS4A 1HXFH 5EODA 5GWZA 1EOLA 2BY5X 4FUIA 1BB0B 2F9BH 2J98A 1VGCC 2R3UA 2AGIX 1MMJN 1MKXK 4M7GA 1Z8IB 1QA0A 3RXSA 1O5CB 1QRXA 4YO9A 1GJ7B 4WF8A 1O38A 4MPUA 3SJ8A 3A8BA 1MU8B 1HJAC 1MBQA 3ATMA 4X6NA 3T29A 1C9TA 5LGOA 1V2WT 1G9IE 1UCYH 4FXGH 4WH6A 4ZXYH 4KP0A 4E05H 1BJUA 1TE0A 5A0CA 4ZH8A 4OS1A 4MVNA 2BDYA 2BD4A 3DHKH 2FX4A 2Z6BD 2FI4E 1D6RA 2VWLA 1N6XA 1V2PT 1P2NA 1W7GH 3OY6U 1C9PA 1AKSB 4B75A 1V2QT 3BV9B 4ZHLU 3M5NA 4IC5A 5B6OA 1C5YB 1V2JT 3SZEA 2A0QB 2ZFSA 4WMFA 2EI7A 1AVXA 1WU1A 2IN2A 2VGCB 1C5PA 1AFQC 2ZU3A 2SGAA 3I77A 3M5MA 2OLGA 1DDJA 4CBOA 3B8JA 1OYTH 2VVVA 1NC6A 1FN6A 2QF0A 2ZHWH 3N7DA 4HZHA 4NIWA 2RFKC 2VH6A 2H1UA 2Z9JA 1GJ9B 1TMBH 1F0RA 1DM4B 1K9OE 1Y3YA 1ELAA 3A89A 1PJPA 3H5CB 3DUXH 4AG2A 2FMJA 3M7TA 1GWAA 3P92A 1P2OA 6CHAC 1UVOA 3Q77A 4A6LA 4BOHA 2ALVA 3RXIA 4MNXA 2XW9A 1SGNE 3SI3H 1UVPA 2RA3A 1Z1IA 1QURH 2XBXA 1GDUA 1GGDB 3GOVB 4D9QA 4HI3A 2CN0H 2Z9IA 3ODDA 3PROA 2R2WU 1TNJA 2FWWA 3LH3A 1GL1A 4FU7A 1Z8JB 1N8OC 4OGYA 2JH0D 1ETSH 1ELCA 2Z7FE 1K21H 3DFLA 3AAUA 1O3CA 1DICA 3P70B 1P2MA 4MDSA 3T62A 1THPB 7GCHG 2ZP0H 1B0FA 1OWKA 4ZAEA 2FP7B 4BAHB 2M2AA 3Q3YA 2Y5GA 2KAIA 1BQYA 1NESE 3MH7A 3KN2A 1O30A 1GI8B 1NS3A 2WSSD 3M3TA 1O2YA 2QC2A 2W26A 2ZTYA 5C5OA 1WXRA 2BTCE 1C1TA 5F8TA 1IAUA 1W10U 3ZVGA 3FZDA 4O9VA 3PMJA 1MQ5A 2G5NA 2V3OH 2IJD1 3PMHB 4JZDH 3TJOA 2W3IA 3FOAA 3P8NA 1GHBG 1GPZA 1OP0A 1GHAG 1ZJKA 4UD9H 3V12A 2THFB 1AD8H 1SKYE 4Q80A 2AERH 2UUJB 2YNAA 3KYGA 1O2LA 1Z6JH 2ODPA 1WDIA 1LPGB 2GCHF 3BTWE 1TQ7B 3RU4D 3PMAB 2PHBA 1ZPBA 3P8GA 8GCHF 1ZZZA 3T27A 2FXRA 1DOJA 1VCQA 1P2JA 1FV9A 2XRCA 1FIWA 1RJXB 3RM0H 3E3TA 4B73A 1EZXC 2ULLA 4X6MA 4I33A 1Y3VA 2VIVA 4Y8ZA 4YTAA 1W2KH 1YKTA 3M7QA 4H6SB 4YLQH 1LHFH 2JKHA 4LXBH 5BPEA 1IHTH 1LCYA 3RXEA 1HAIH 4F4OC 3FN8A 3BTKE 2W6JD 2WYGA 3A7YA 2HALA 3PV5A 5DP9A 4K69A 1TX7A 2CHAB 1LPKB 5HGGA 1MTNC 1JXPA 1F0UA 3TVJB 3AAVA 2WHXA 4WY3A 1AY6H 1TFXA 4E06H 3GDUA 4RT0A 1O2ZA 4INLA 2RCEA 3OEED 3SU1A 2XXLA 3ZV8A 3V7TA 1HAHH 1LMWB 3PTBA 5C20A 1TQ0B 4ZKSU 4DCDA 3TJUA 2H5CA 3BEFB 3VB7A 1D9IA 4U2WA 3UAIC 1WTHD 3NKKA 1OWHA 9ESTA 3M5LA 3IG6B 2BM2A 1GI4A 1GVLA 3RU4T 3UR6A 1BHXB 2AMPA 1S5SA 1T8MA 1EATA 1MKWK 2ZDNA 1L4ZA 3BTHE 3PV4A 5JDUB 7LPRA 3LGUA 1CSOE 1AO5A 3K6ZA 4FUGA 3EA7A 1TNGA 1DPOA 1NFWA 2VWMA 4XFQA 4DIHH 4AFQA 3MU8A 1YYY1 4UEHH 1ZPCA 3A81A 5FCRA 3GCTG 3W1EA 1GJBB 1QA7A 2WYJA 2D2DA 4AX9H 4K8BA 2GDEH 1QQUA 2OC1A 2ZDVH 5C1XA 2H9TH 3ZV9A 1SOZA 1O2JA 5FL7D 3SQHE 1TNLA 1JIRA 1OWJA 4GHTA 3KEEA 1O3BA 2VVUA 4R8TB 2BY8X 4Y6DA 2TPIZ 1NM6A 2ZF0H 3LGWA 3KF2A 3ZVCA 3BIUH 2FTLE 4JK6A 1SQRA 3M3VA 3RLWH 2PKSB 1TNIA 2A5AA 2F9UA 2FI5E 2AGGX 1GJ4H 3CENA 4HG6A 1D3PB 3SN8A 3PLPA 4H42U 1G3DA 1C1VH 1B0EA 1V2UT 7GCHF 2Z9GA 5J4QA 1CBWC 2GCTB 2QXHA 2BHGA 3F2HA 1L4DA 3TH3H 3PV2A 5LPRA 3A7XA 3ZYDA 1ELVA 1NFXA 2A45B 4WXIA 1TMTH 3ZZ8A 2OC8A 1ZHRA 3SI4H 1A0JA 1ZJDA 1F5KU 3T28A 1K1PA 4CRBA 3U9AH 3BSQA 2JJ2D 1SGTA 3ZZ6A 5DP8A 4AYVB 5CE1A 1XUGA 1UTPA 2J94A 1O3PB 1CT2E 2XC4A 1GHBF 1HJ8A 2Y5FA 1GHAF 3HGPA 3KQDA 2ZCHP 1FAKH 3IITA 1IQHA 1P3CA 2Q6GA 1LPZB 3M5OA 1MABB 4BAKB 2FODA 5DPAA 2BYAX 3DSOA 3F1SB 4K1SA 4ISNA 3T26A 1PQ5A 1ZRKA 1ZMJA 3IWMA 5DGJA 4I8LA 1GMDG 1QZ8A 2ZQ2A 4XSKU 3T5FH 5L30H 3A8DA 4FU8A 5EIYA 2BD5A 3TNTA 2BZAA 4FUFA 2ZGBH 1BMAA 1H8ED 1P10A 3A87A 4ZKOU 1C2EA 1Y3WA 2KX4A 6ESTA 1LHDH 1XUFA 2GT8A 1Y3UA 4CR5A 2DE8A 2CF9H 3RXUA 1C2KA 1UVTH 4LZ4B 1GBEA 1GI1A 2XC5A 1ELEE 5EJZA 1O36A 1KLJH 1O3KA 5JBTA 1UK4A 1EQ9A 3H7OA 3RXPA 1MZAA 2ZNKH 1A5GH 3D65E 3QDZB 3HKIB 1GJ8B 2J9NA 1O2TA 1QJ6B 2K1QA 2PR3A 3LGIA 2CJIA 3QZRA 1O5GH 3A80A 1GBFA 3P8FA 1E36B 3CS0A 5L2ZH 1HJ9A 3SUEA 1GBJA 2A2XH 3TNSA 1NT1A 1CGIE 3TPIZ 1KXCA 4FETA 2VINA 1QTFA 1OKXA 2GZ8A 3W94A 4INHA 4ZHAA 3MO9A 3VXEH 2BXTH 2R3YA 1YPHE 2QXGA 1GJ6A 2HVYB 4UE7H 3PWBA 2ZFTA 3QN7A 3RXTA 1AHTH 2D1JA 1Y8TA 3LC5A 4K5ZA 8KME2 1NPMA 3AK5A 4D8NA 1AE8H 1DWDH 2XNIA 2G4UA 1C1QA 4NSVA 1E35B 1UVSH 3A7TA 3MNBA 1PPZA 4AORA 4AOQA 2ZQ1A 1S84A 3P6ZB 1NRPH 5FPSA 3VXFH 4K2YA 1W7XH 4LK4A 1DT2A 3SORA 4X2WA 1YLDA 2ZPSA 1HFDA 1C2MA 1QIXB 4M9FA 1FDPA 2VVCA 3KHVA 5TJXA 1MTVA 3GCTF 5FPTA 5EW1H 2JETC 1HGTH 3B9FH 1C5VA 1B5GH 4UFEH 1W8BH 2YMSC 3L6PA 1H8DH 3KYFA 1BTXA 4FVBA 3GICB 1ARBA 2BVXH 1W0YH 2P95A 3N7OA 1EJNA 1HNEE 1PPFE 2NU0E 2Z3DA 2BX4A 2HWLB 3GISB 2VB0A 5EJLA 2P93A 4B2AA 1TPOA 2BVRH 4HGCA 4BXSA 1AE5A 1F5RA 1HB0B 1H1BA 2XC0A 1K1LA 4FU9A 2CGAA 2QAAA 2R0KA 2F3CE 5EQRA 1YM0A 5DP7A 2DE9A 2NU4E 1DANH 2FPZA 3A88A 1V2VT 1PPEE 1MTSA 3SU3A 4NA9H 1C1PA 1O2SA 1V2LT 1RRKA 1AB9B 1YPKH 4CRDA 4FUEA 3U98H 3BTEE 1GHVH 1ELTA 4MLFB 5CHAC 3SGQE 3SHCH 2BD9A 1YPMH 4MQAA 2GJGA 1T4UH 3EQ0H 5E2PA 3SGAE 5CMXH 3DD2H 1PYTD 3M3SA 4IS5A 2XTTB 1C2JA 5EPNA 1WAYB 3L33A 1SBWA 1UO6A 2W7UA 3KL6A 1QB6A 1O5AB 3VG8A 1QL7A 4A1XA 1Z6EA 1HAGE 2P3TB 4DW2U 2BD3A 2ZDKA 3L3TA 1S6LA 1UVUH 4I8GA 2ODQA 4ISHH 2F9OA 2A32A 3F0PA 4B2BA 4ZMAH 3Q00A 1MKXH 3SUFA 4UDWH 2Z3EA 2WZQA 1KDQA 1GMDF 2O8LA 2WV5A 2ZFQH 2ZI2H 3PLBA 2FO9A 3UNSA 4AB8A 4CRGA 2V7QD 1HAVB 3UFAA 1WSSH 2ANMH 1K1JA 1H8HD 2CMYA 3QK1A 5FHTA 4ABEA 1GHZA 1XVOA 3DFJA 5AF9H 2VBCA 1K28D 1AUTC 4H4FA 4CH2B 4TY6A 3RXLA 2XBVA 2LNCA 1MAXA 3ZZDA 4XDEA 1FAXA 5ESBA 2VIWA 2HRVA 1BOQA 1OWEA 1WYKA 3SUDA 5F6MA 3SV6A 2ZCLP 1F0TA 4DG4A 2B9LA 1G2MA 1MTNB 2FLBH 1A0LA 2GZ9A 4MPVA 1BBRK 1MCVA 1NFUA 1O2OA 3LJJA 1RXPA 5C0UA 5HMAA 1YLCA 2SNVA 4AZ2B 1P2IA 1BTWA 4WJG2 1LVYA 2PKAB 4CRAA 2XWAA 3LGVA 1J14A 3OX7U 1GI2A 1Q31A 5G4BA 1EPTC 3RXQA 1EAUA 1BT7A 3MH5A 4A92A 1FONA 4DVAU 3EE7A 1YPEH 4SGBE 1FJSA 1IQFA 3M37A 1SGYE 1YPHC 1C2LA 3GDSA 5C0TA 3K65B 3OFND 4I8HA 4IMZA 5LPFA 1IQJA 2VIDA 3TITA 1QHRB 2ZZUH 2WPMS 1VJ9U 3F9EA 2GX4A 2B7DH 2FIRH 1ZYOA 3SNDA 3U1JB 1ZSJA 2QN5T 4VGCB 2IOTA 1FX0B 4DGJA 5K0HA 1C5OH 1DXPA 1NY22 1E79D 1UTLM 4KELA 5CHBA 3TJNA 1TGNA 4GSOA 1FY8E 1A61H 1UTNA 3UREA 4JCNA 4MNYA 1P9UA 1QY6A 5BRRE 2GDDA 4D76A 2ZPRA 1V2KT 2XCNA 4NFFA 2R0LA 3EDXB 3QTVH 3G01A 3F3BA 3GCOA 4JZ1A 3URDA 1AWFH 4SGAE 4X2XA 2OQ5A 5LH8A 4NGAH 3QO6A 1C4V2 3SYJA 2UUYA 3GY8A 5GIBA 1DUAA 1G2LA 1ID5H 4JYVH 1THSH 1YWUA 1WUNH 4X1QU 5C5NA 1C5NH 5EG4A 5JB9S 1KSNA 1RIWB 2BZ6H 1YPGH 2Y7ZA 1MZDA 1RFNA 3SV2H 4UONA 3ZVFA 1EZQA 1J16A 2GV6A 1VCPA 1ANEA 1O3JA 4AFUA 2ZO3H 3K6YA 1VKYA 1GI6A 1LHGH 1ZTLA 3BG4C 2ESTE 1NBMD 5C1UA 5K7RA 4NCYA 1C5TA 4Z6AH 2ALPA 3SNBA 1FNIA 3V13A 4GCHG 1FQ3A 3PYHA 3MU4A 3SJIA 5DJ7A 1QJ7B 2KFWA 4TWYA 1A4WH 1SGIB 2OXSA 3MU1A 2PLXA 3PB1E 4ABJA 2C8XB 1XXDA 1GG6B 1C5RA 1NRRH 2F91A 1LHEH 3BIVH 2V6NA 2BQ6B 2D8WA 3TK5A 1YPLH 1CHGA 2RG3A 1THRH 2VIOA 2WINI 4D7GA 3LGYA 3U28C 1TNHA 4B71A 4BANB 3RXHA 3RXAA 1C5UA 1D3TB 2STBE 3NXPA 1TPSA 1GBAA 4X2VA 5A0BA 2A4QA 1HAZB 3A85A 4TY7A 3A84A 5AFYH 5C3NA 2UUFB 3PMBB 3SHAH 1GMCG 1ETTH 1O3LA 3R0FA 3M7UA 1O3IA 4MTBA 2TGDA 3WW7A 2HPQH 2P94A 3BG8A 2TBSA 3RXDA 3ATLA 3ZZAA 3CNRA 2ZHQH 1T31A 2A7CA 3VGCB 4ISIH 4KTCA 4U30A 1KMHB 8LPRA 1A3EH 3EAJA 3ODFA 3FP7E 1O2VA 1V2MT 4R0IA 4RT1A 2F83A 1V2NT 1GJDB 1LO6A 3PO1B 4Q7ZA 1W11U 3NCLA 1M9UA 3A7ZA 3QTOH 4NA8A 5GCHG 3SNCA 1Z8RA 3MH6A 3PLKA 3FP6E 1HUTH 1BTUA 1UTJA 2XYAA 1UHBB 1XUJA 1O0DH 1L2EA 3AVZA 1KXAA 1P9SA 2WUCA 4WWYA 4DOQA 2AEIH 1MD7A 2P8OB 2SGQE 3DSGA 4YOIA 2ZWLH 2Y82A 4E7RG 3LKWA 3TLOA 1DLKB 1GCTB 4X6PA 1FXYA 2AMQA 1BTZA 2GP9B 4NZLA 1OOKB 5FAHA 4KGAA 5DSFA 1MKWH 2P59A 1H4WA 4NIVA 3C27B 3GCHC 1L1GA 3HK6B 2J95A 4NA7A 5JYIA 3UQVA 4IGDA 3LJOA 5CDFE 1COWD 1J15A 1C1MA 1BTHH 4AFSA 2O8TA 3U69H 3TK9A 1MAYA 2R2MB 3SU0A 3S9BA 3MO3A 4FUHA 2A4RA 4X8SH 1D6WA 4KTUA 4I32A 4XBBA 1NZQH 2ZDAH 1W0KD 1XKBC 3GYLB 1O5BB 4U01A 2TGPZ 3JZ1B 4JZFH 1QFKH 2KM0A 1J9CH 1PPBH 2A31A 2FOEA 2OK5A 2K8IA 3UOPA 5C94A 5DP4A 1CA0B 4U32A 3SO3A 4BTUB 1EZUC 3B23B 3EA8A 4CREA 1BUIA 3MO6A 2HLDD 2WUBA 4AC9A 2C90B 1CT4E 1S82A 1AZZA 2BOHB 1OXGA 2QE7D 2WV9A 3RMNH 2FI3E 5DG6A 2FOAA 4I86A 1O2MA 2KR7A 2ZU1A 4XRNA 2QXJA 3UB0A 1KXBA 2QF5A 1LKAA 1BHXF 3MTYA 5GJ4B 3ZVAA 4ZHMU 2ZDMA 4HFPB 4JYUH 1ELDE 1JIMA 3Q76A 4XBCA 4B2CA 1MUEB 2GGVB 3I29A 1QJ1B 1P8VC 1VZQH 2G55A 2YNBA 4ZROA 5IYTA 4OS7A 3VPKA 1Z7KA 3MI4A 1ESAA 1HV7A 1G37A 2BB4A 1K22H 3RMOH 5EW2H 1V3XA 5CHAB 3RUOA 4JYTA 4GCHF 5EXMA 3SBKA 4AGJA 5T6FA 2W7SA 1A3BH 3RXFA 1AKSA 2VH0A 1F92A 1OPHB 2KCAA 1HXEH 3U8RH 1BBRE 1EAWA 3SU5A 1N1LA 1MH0A 4NFEA 3QWCH 2PTCE 1OP2A 3NK8A 4UFFH 4YESB 4ZUHA 3F2GA 5EQSA 4X8TH 1C2FA 2RDEA 1F0SA 1UMAH 4O03A 9LPRA 1HAPH 1BRCE 5T6DA 5EOKA 2VGCC 2FOCA 5HYOA 1KXFA 3VB4A 2FYRA 4IMQA 4K8YA 1CO7E 1OP8A 3QGNB 5E0HA 1F2SE 3NZIA 2KZ4A 3FANA 4GUXA 4DY7B 2LELA 1AWHB 2J92A 1TX8A 4Y8YA 1GMCF 4BXWA 1WCZA 1GDNA 1HAOH 3NUMA 1PFXC 4YT7H 1SLVB 2F4LA 1FI8A 1JMOH 3ATWA 3MYWA 2BDAA 2LP6A 1GBTA 1V2RT 4GLYA 3RXGA 1QB9A 4P00A 1G3CA 3ZYEA 5T1VA 1T32A 1BA8B 2Z9KA 5H4IB 3S0NA 2ZU4A 5DP5A 3FO8D 1QGFA 3LT3A 1GGDC 3QLPH 2P3FH 3STJA 1EP6A 1IQGA 1DLEA 2OP9A 2SNWA 3U8TH 3UOUA 1ZOMA 3D23A 1Z1JA 5GCHF 1UK3A 3KQBA 4ABAA 1P05A 4RI0A 4CR9A 3AW1A 1QBNA 2V35A 3LGTA 3O8BA 1EPTB 3O8RA 1MTUA 1C2GA 1O3AA 5GDSH 1QRZA 4ZKRU 1VGCB 1O33A 2VIPA 3E0NB 1YLNA 1Y59T 3MU0A 1C5WB 4JK5A 3GY7A 1ELBA 5DN6D 1GVKB 2BY7X 1AU8A 2J98B 1HIAB 1O2PA 1O3OA 2H2ZA 2QXIA 4YZUA 2C3SA 5C67A 1HJAB 3I78A 3OAAD 4RKJB 2FEQH 2C8YB 4DT7B 3O8CA 2FDAA 1BMNH 1IQNA 2VNTA 1GI3A 1CVWH 1E38B 3RP2A 2UWLA 2L74A 1YP9A 3OEHD 4F49A 4OS5A 4CRFA 3PTNA 4F55A 3GDVA 2SGDE 4Z1MD 1QR3E 4DJZB 1WQSA 1GBDA 2O8MA 4B6EA 2BLWA 1Q2WA 1C1WH 4CRCA 1LDTT 2FOFA 3GY5A 4TSFD 5LPEA 1IOEA 2FOGA 2GD4B 2BX3A 5C1YA 3KQCA 1EZSC 5KECA 1VR1H 1ETRH 3SU4A 1EASA 1O3GA 1AFQB 2EI8A 1PQ7A 3OU0A 5EXLA 3SNEA 1ZSLA 4ABHA 3UNRA 1INCA 3NWUA 2GZ7A 1TBRH 2JJ1D 2NWNA 1SB1H 2BXUH 3BTFE 2ZIQH 2ZFRH 1MQ6A 1D4PB 1TRMA 2Q6FA 1IHSH 1A7SA 1XM1A 2HLCA 3MQKC 3ZZ5A 4IN2A 2VJ1A 2ZU5A 2FOHA 4A7IB 1O31A 3E6PH 1ZRBA 1WV7H 6CHAB 2OTVA 3RXRA 5JB8S 2H5DA 5FX5A 1NRSH 3RXMA 1AIXH 1SC8U 1EAXA 2BQWB 1MCTA 1SQTA 2ZG0H 1SFQB 2V3HH 3QZQA 1YPJH 3EYDA 1GVZA 5HIYA 1ZGVA 3SW2B 3F68H 2CHAC 1CA8B 2ZHFH 1N8OB 2G5VA 4HTCH 3BF6H 3ZVEA 1KLTA 4NSYA 1SVPA 4AGKA 4X0WU 3N99A 2AH4X 3BTTE 3E91A 1GMHG 4YOGA 4JZEH 4INKA 1CQQA 4JMYA 4X1PU 1NTPA 2DUCA 2VIQA 3KIDU 3P8OA 2PP6A 4FOUC 4BTTB 4BAQB 3LC3A 1O2QA 5A09A 1SMFE 5A8XA 1K1MA 4GAWA 1UJ1A 1E1QD 1KIGH 2KAIB 1HAXB 1MBMA 2FESH 4TWWA 2YOLA 1EJMA 2WPHS 2BDBA 5EJ1A 1GI0A 3P17H 3ZZBA 3D62A 4OS6A 2A2QH 1HPGA 2XOKD 1NU9A 5E0GA 1GCDA 3LOXA 2JIZD 4ABFA 3ESTA 3RMMH 1KTSB 2ZGCA 3SUGA 4WVPE 1SG8B 4CH8B 4IN1A 2PGBB 3BEIB 1OWDA 1BBRH 4YT6H 3SJOA 1VCWA 5EGMA 1T8LA 3F2FA 3F9HA 3OYPA 3GY2A 1UTQA 4K60A 4A1TA 1L1NA 1SHHB 2G00A 2AS9A 2KCYA 4IC6A 1C4Y2 3E90B 1AMHA 3BTGE 4KKDA 1PPHE 3TH2H 1Z71A 1O2NA 1ESTA 3NPSA 1TWXB 2TRMA 1XVMA 4YLUA 1SGQE 4CHAC 1AZ8A 1EFRD 5F53A 4MPWA 1O2IA 1P09A 1C5MD 3V0XA 1C1UH 2OBOA 1SGPE 3RXJA 3A83A 3JZ2B 1WOFA 1GHYH 1QBOA 1W13U 2ANYA 2HNTE 4ABGA 1MU6B 3MH4A 5E2OA 2BY6X 1JBUH 4P02A 1NRQH 1UTKA 1YY3A 2UWPA 4JZIA 2GCTC 1NFYA 1XMNB 4UFGH 4MNWA 1IQKA 4RKOB 1WTGH 2WPLS 4X1RU 2FYQA 1V2OT 3E8LA 2FLRH 3RXCA 2AFQB 1GJCB 1O3DA 1RGQA 2W6ID 3OTJE 1JWTA 2FTMA 1RS0A 2BLOA 1B7XB 3KGPA 4Q63A 2AIPA 2PWXA 1L0ZA 1TIOA 2CF8H 1RTKA 4Y79A 4OM9A 1G3BA 5F8XA 1HDTH 1W0ZU 3SJ9A 4DURA 2UUKB 1ZMLA 3SOSA 1SL3A 3RU4E 3RLYH 3DSPA 2C8ZB 5HXFA 5EPYA 1T7CA 1MTWA 2V3MA 1ZMNA 4OGXA 2ZFPH 1CE5A 5HIZA 4Y0ZE 3RC6A 3KQEA 5HM9A 1O5EH 4MG3A 5L2YH 1HIAA 2OINA 3RXKA 2A1DB 1KXDA 2AYWA 2W3KA 1CGHA 1Y5AT 1GBHA 2J34A 1P04A 3UNQA 3BTME 3E1XB 1K0HA 1EB1H 2GMTC 2IPHA 2PUQH 1OHHD 4ZCNA 3LH1A 1S0RA 4Q7XA 1DX5M 1DE7H 3GCNA 5DP3A 3U8OH 2G52A 3UR9A 1GBIA 1C2HA 2OCVB 3SU2A 2AMDA 2PV9B 1QBVH 1P03A 1AVWA 2H9EH 4B74A 2F9PA 2A7JA 1GBLA 3GY4A 4WMDA 5I25A 4YOJA 2EQNA 4NWLA 1XXFA 2BD2A 1GMHF 3S9CA 1BJVA 1O2KA 4CBNA 1C1NA 3UIRA 2G81E 3GYMA 2BD7A 1GBMA 1GBBA 1TYNA 3W95A 1GJ5H 2J2UA 1CBWB 3SZNA 2BDGA 3PRDA 4AG1A 1T4VH 4ASHA 1BTYA 5HKKD 1FY4A 2F9NA 3S9AA 1RD3B 1WBGB 1A0HB 4ASUD 3MMGA 1C5XB 1UTOA 3SJKA 2BOKA 2J5UA 1FZZA 5IDKA 4WMEA 4ABIA 4DIIH 1F7ZA 3ZZ3A 3SNAA 2VWOA 4I8JA 1LQEA 1UCYK 2ODYB 3ATIA 1KYNA 4I8KA 3TIUA 1ABIH 1TB6H 3VB5A 4BTIB 2P16A 1TRNA 3M35A 3CP7A 1C5ZB 1LVOA 4TPYA 5J4SA 1BITA 4GHQA 2QYIA 1C5QA 1WQVH 1OSSA 1TNKA 2B8OH 3C1KA 2A5KA 3NRLA 1CU1A 3PM3A 3T2NA 5B6LA 3RM2H 1FPHH 3ZVDA 2C8WB 4D9RA 1IQIA 1NN6A 4Y71A 2F43B 5AFZH 5SGAE 1EP5A 4RN6A 2V0BA 2EY4C 3UWIA 4TYDA 4UFDH 3WY8A 2O9QA 1OWIA 1F5LA 2ZTZA 3HKJB 1O2XA 1VITH 2J4IA 3MFJA 1O3FA 1A2CH 2PTNA 1QRWA 1W3CA 3LDXH 2H6MA 1JOUB 5AHGH 2OC7A 3QUMP 2ZTXA 1DSUA 2HNTC 1H9IE 4ABBA 1SPJA 4B76A 2ASUB 2HPPH 2Y7XA 2J38A 2OD3B 5FCKA 3VB6A 1ACBE 3T25A 3EGKH 1BIOA 3PWCA 2CV3A 1V6DA 4FUDA 1Y5UT 2TIOA 1AB9C 3S7HB 3ATKA 1G3EA 1TALA 4LOYH 2GVFA 3H7TA 3VFEA 3MNSA 4J1YA 1P02A 2XBWA 1XUHA 3EA9A 3LPRA 2QGRA 4K1EA 1ELGA 1S81A 1ELFA 4AFZA 2VU8E 1IQLA 4NG9H 3GS9A 1GDQA 1L1JA 4X2YA 1CHOG 2QCYA 1P12E 2PGQB 2R9PA 1NRNH 3TU7H 3ZZ7A 3P95A 2CK3D
chains in the Genus database with same CATH topology
1HAVA 1TOMH 2I6QA 1X7AC 1GJAB 3UPEA 1C2IA 5EQQA 1N6YA 4Y7AA 4O3UA 5FBEA 1OS8A 2EEKA 1O5DH 1O2RA 1BRUP 2Y81A 2SGPE 3ENSB 2ZU2A 2EI6A 2ANKH 5JBAS 3UWJH 1FY3A 2CXVA 2XCFA 1EX3A 4ISOA 1ZHMA 2JETB 3UQOA 1CGJE 2O8WA 3QX5H 4X6OA 1FPCH 1TPAE 3BEUA 2ANWA 2FS8A 5ESTE 1FY5A 1TA6A 1ABJH 2ZGHA 3BN9A 2QY0B 1D3DB 3LONA 4H6TA 1TLDA 1O2UA 2HVXA 3HGNA 2PKAA 5I46H 1SFIA 1SGDE 1SQOA 1DSTA 1SLXB 2OUAA 4Y7BA 1E0FD 3QGJA 4PROA 3A8AA 1LHCH 4WH8A 3M61U 5HM2A 1C1OA 3TGIE 1ZPZA 3KNXA 1PPGE 1UK2A 2WV4A 1TRYA 2ZHEH 1DFPA 1DXWA 1DY9A 4Z0KA 1OYQA 5E0JA 1EKBB 1SLUB 1U6QA 1ORFA 4FUJA 1DY8A 2FM2A 1VITG 4I31A 5E8EH 1TBZH 3ZVBA 1DVAH 3SGBE 1ANBA 1UTMA 5TCCA 4K3JA 2FOMB 4ZXXH 4O97A 1FLEE 5A8YA 4NZQA 1YGCH 1A1RA 3RXVA 1ESBA 1O5FH 4VGCC 2RDLA 3RXOA 2ILNA 1EB2A 1QB1A 3Q3XA 5T6GA 2M5TA 1P57B 1BMLA 1P06A 1S83A 2W5EA 1FN8A 2QF3A 4Q7YA 1H8IH 1ANCA 1J17T 3SV7A 1FIZA 2PW8H 1EJAA 2QA9E 2NU2E 1AVGH 4XOJA 3UTUH 4AB9A 1Y5BT 2BMGB 5C2ZA 1QNJA 3K9XB 1AQ7A 5F8ZA 4YM9A 1P2QA 4CHAB 1EUFA 1SOTA 2GT7A 2QIQA 1S6HA 1O2GH 3EE0B 3GY3A 1C2DA 1AN1E 1YF4A 4B1TA 2FZZA 1KDQB 4ISLA 4XE4A 1NROH 1RIWC 1EAIA 4IW4E 1P11E 2F9VA 1PQ8A 5EU8A 2XWBI 5GPIB 2OBQA 3TK6A 5FXLA 1XUIA 4A5TS 3MHWU 1S6FA 3RC4A 4OS2A 1BTPA 1ZR0A 2PUXB 4MPXA 1SQAA 2OQUA 5L6NH 1C1RA 3MNXA 3RDZA 1IQEA 1O35A 1QL9A 1KTTB 2BQ7B 2SGFE 3GY6A 5DO4H 2LPRA 3ITIA 3ZZ9A 1P3EA 5GXPA 1AGJA 1HRTH 1FY1A 1FUJA 1QCPA 5JBBS 4BNRA 3STIA 2GV7A 4I7YH 4Y11E 1O3EA 1HLTH 2A7HA 3FZZA 1EXFA 4THNH 1GG6C 2QV1A 1PQAA 3MNCA 1TABE 3BTQE 3S69A 1LVMA 5FX6A 1H9LB 5AVDA 2JH5D 1TGSZ 3VEQB 4X1NU 1JRSA 2O8UA 1YBWA 1BMMH 1TAWA 3SU6A 2ZPQA 1CHOF 2UWOA 3F6UH 1YCPM 1O39A 2Z3CA 1GI5A 1XUKA 1GBKA 1XKAC 5FPYA 4Y76A 1SGRE 4Y10E 2FX6A 2GMTB 1BRAA 1KLIH 3RMLH 1O37A 3VGCC 2HGTH 1P0SH 1RTFB 2BLQA 3Q3KA 1UCYE 2XBYA 3KCGH 1DWBH 2OC0A 2Q1JA 1K1NA 1SGFA 6GCHG 1ZLRA 3PO1C 1GI7B 1FMGA 1O3HA 2NU1E 3BTDE 1UHBA 3MWIU 3D49H 2ZEBA 4X8UH 8ESTE 3O8DA 1DWCH 2I6SA 3CS7A 4NWKA 3HATH 1TGTA 1H9HE 2FS9A 3URCA 1W12U 4AYYB 2P8OC 5TCAA 1P01A 1ZTJA 1GCTC 3M36A 3TGJE 1C4U2 3SQEE 4D7FA 4FUCA 2BLVA 5JBCS 2AGEX 1XX9A 2IJOB 3BG4B 4O3TA 2ZCKP 4QT8C 1O3MA 3ELAH 1GI9B 3FP8E 1GHXH 3K2UA 2BDHA 6LPRA 2ZKSA 1AFEH 3DA9B 4X1SU 1GHWH 1A46H 3OY5U 1KXEA 5ETXA 1HCGA 1VITF 1V2ST 4Q2KA 2Q6DA 2AIQA 2SFAA 1GL0E 1AI8H 1E37B 2B5TB 1ZGIA 2VWNA 2ZGJA 3SV9A 1SI5H 4BAOB 7KMEH 4NIXA 5A8ZA 4NIYA 3A7VA 3ZZCA 3E16B 3FVFB 3RC5A 2BVSH 2Z94A 2Y80A 1J8AA 1JRTA 2EC9H 4BAMB 1LVBA 4MNVA 2GTBA 4K1TA 1SSXA 1Y3XA 4J2YB 3FFGA 2ZGXH 2SGEE 4E7NA 1QQ4A 4XBDA 1HAYB 1CA0C 1TOCB 5A2MH 5JPMH 3UY9A 4GPGA 1O3NA 3A8CA 3UUZA 2C4FH 2H9HA 5PTPA 2A5IA 1DITH 3SV8A 3V3MA 4ESTE 2Y6TA 1ZTKA 2HNTF 1TA2A 3E0PB 1SHYA 1IQMA 7ESTE 3A86A 1DWEH 1C5SA 2Z9LA 3MU5A 2G8TA 2ZA5A 1TMUH 2BD8A 1D3QB 1YC0A 1P2KA 2HOBA 1CT0E 1BRBE 4ZKNU 1MD8A 3FAOA 4GVUA 1W14U 1AUJA 1NU7B 3LIWA 1RTLA 1PPCE 3HK3B 3F9GA 1E34B 5ABWA 1K2I1 2FOBA 2STAE 2BDIA 3OSYA 1V2TT 1DUEA 5DKMA 2TGTA 1LTOA 3HPTB 2PSYA 1A5HA 5A0AE 4LZ1H 1S85A 1KY9A 3AW0A 1BZXE 3TGKE 2D26C 2WPJS 4FVDA 1K1IA 3A7WA 1GBCA 2B0FA 4AN7A 1TBQH 3RXBA 1PYTC 2PKSC 1T8OA 5DP6A 4Y8XA 3VB3A 3GCHB 1C5LH 2WPIS 3AASA 1DS2E 4WXVA 1SGEE 1YCPH 2JH6D 1SR5C 1ZHPA 2A4GA 2ZFFH 3S7KB 1C1SA 2ZECA 3DT0H 1LKBA 4FUBA 1S0QA 4TPIZ 2PFEA 1ARCA 1SGCA 1Z8GA 2GKVE 1TX6A 5T3HA 2NU3E 1T8NA 2ZHDA 2BY9X 1BCUH 1TPPA 5EXNA 3TJVA 1LQDB 1G36A 2PSXA 4Y0YE 4X8VH 1QL8A 4ABDA 5F03A 1VJAU 2RA0A 1O2WA 5FBIA 5DK1A 1EOJA 4RSPA 1NO9H 1ANDA 1TONA 2ZDLA 1SGFG 2TGAA 3ZZ4A 1A5IA 4IBLH 1SLWB 1G30B 1BDAA 2ZC9H 1TGBA 1Q3XA 3R3GB 1O34A 2GCHG 3LU9B 1TGCA 3A82A 2G4TA 2G51A 6GCHF 1K1OA 4KTSA 8GCHG 1OX1A 1HBTH 2C93B 4A1VA 2A4OA 1G32B 1O2HA 2P3UB 3U1IB 2BDCA 2WPKS 1HYLA 1EPTA 1O32A 1ZSKA 2EA3A 3MOCA 3TH4H 3F9FA 1YCPK 2Y5HA 4OS4A 1HXFH 5EODA 5GWZA 1EOLA 2BY5X 4FUIA 1BB0B 2F9BH 1VGCC 2R3UA 2AGIX 1MMJN 1MKXK 4M7GA 1Z8IB 1QA0A 3RXSA 1O5CB 1QRXA 4YO9A 1GJ7B 4WF8A 1O38A 4MPUA 3SJ8A 3A8BA 1MU8B 1HJAC 1MBQA 3ATMA 4X6NA 3T29A 1C9TA 5LGOA 1V2WT 1G9IE 1UCYH 4FXGH 4WH6A 4ZXYH 4KP0A 4E05H 1BJUA 1TE0A 5A0CA 4ZH8A 4OS1A 4MVNA 2BDYA 2BD4A 3DHKH 2FX4A 2Z6BD 2FI4E 1D6RA 2VWLA 1N6XA 1V2PT 1P2NA 1W7GH 3OY6U 1C9PA 1AKSB 4B75A 1V2QT 3BV9B 4ZHLU 3M5NA 4IC5A 5B6OA 1C5YB 1V2JT 2A0QB 2ZFSA 4WMFA 2EI7A 1AVXA 1WU1A 2IN2A 2VGCB 1C5PA 1AFQC 2ZU3A 2SGAA 3I77A 3M5MA 2OLGA 1DDJA 4CBOA 3B8JA 1OYTH 2VVVA 1NC6A 1FN6A 2QF0A 2ZHWH 4HZHA 4NIWA 2VH6A 2H1UA 2Z9JA 1GJ9B 1TMBH 1F0RA 1DM4B 1K9OE 1Y3YA 1ELAA 3A89A 1PJPA 3H5CB 3DUXH 4AG2A 2FMJA 3M7TA 1GWAA 3P92A 1P2OA 6CHAC 1UVOA 3Q77A 4A6LA 4BOHA 2ALVA 3RXIA 4MNXA 2XW9A 1SGNE 3SI3H 1UVPA 2RA3A 1Z1IA 1QURH 2XBXA 1GDUA 1GGDB 3GOVB 4D9QA 4HI3A 2CN0H 2Z9IA 3ODDA 3PROA 2R2WU 1TNJA 2FWWA 3LH3A 1GL1A 4FU7A 1Z8JB 1N8OC 4OGYA 2JH0D 1ETSH 1ELCA 2Z7FE 1K21H 3DFLA 3AAUA 1O3CA 1DICA 3P70B 1P2MA 4MDSA 3T62A 1THPB 7GCHG 2ZP0H 1B0FA 1OWKA 4ZAEA 2FP7B 4BAHB 3Q3YA 2Y5GA 2KAIA 1BQYA 1NESE 3MH7A 3KN2A 1O30A 1GI8B 1NS3A 3M3TA 1O2YA 2QC2A 2W26A 2ZTYA 5C5OA 2BTCE 1C1TA 5F8TA 1IAUA 1W10U 3ZVGA 3FZDA 4O9VA 3PMJA 1MQ5A 2G5NA 2V3OH 3PMHB 4JZDH 3TJOA 2W3IA 3P8NA 1GHBG 1GPZA 1OP0A 1GHAG 1ZJKA 4UD9H 3V12A 2THFB 1AD8H 4Q80A 2AERH 2UUJB 2YNAA 1O2LA 1Z6JH 2ODPA 1LPGB 2GCHF 3BTWE 1TQ7B 3RU4D 3PMAB 2PHBA 1ZPBA 3P8GA 8GCHF 1ZZZA 3T27A 2FXRA 1DOJA 1VCQA 1P2JA 1FV9A 2XRCA 1FIWA 1RJXB 3RM0H 3E3TA 4B73A 1EZXC 2ULLA 4X6MA 4I33A 1Y3VA 2VIVA 4Y8ZA 4YTAA 1W2KH 1YKTA 3M7QA 4H6SB 4YLQH 1LHFH 2JKHA 4LXBH 5BPEA 1IHTH 1LCYA 3RXEA 1HAIH 4F4OC 3BTKE 2WYGA 3A7YA 2HALA 5DP9A 4K69A 1TX7A 2CHAB 1LPKB 5HGGA 1MTNC 1JXPA 1F0UA 3TVJB 3AAVA 4WY3A 1AY6H 1TFXA 4E06H 3GDUA 1O2ZA 4INLA 2RCEA 3SU1A 2XXLA 3ZV8A 3V7TA 1HAHH 1LMWB 3PTBA 5C20A 1TQ0B 4ZKSU 4DCDA 3TJUA 2H5CA 3BEFB 3VB7A 1D9IA 4U2WA 1WTHD 3NKKA 1OWHA 9ESTA 3M5LA 3IG6B 2BM2A 1GI4A 1GVLA 3RU4T 3UR6A 1BHXB 2AMPA 1S5SA 1T8MA 1EATA 1MKWK 2ZDNA 1L4ZA 3BTHE 3PV4A 5JDUB 7LPRA 3LGUA 1CSOE 1AO5A 3K6ZA 4FUGA 3EA7A 1TNGA 1DPOA 1NFWA 2VWMA 4XFQA 4DIHH 4AFQA 3MU8A 1YYY1 4UEHH 1ZPCA 3A81A 5FCRA 3GCTG 1GJBB 1QA7A 2WYJA 2D2DA 4AX9H 4K8BA 2GDEH 1QQUA 2OC1A 2ZDVH 5C1XA 2H9TH 3ZV9A 1SOZA 1O2JA 3SQHE 1TNLA 1JIRA 1OWJA 4GHTA 3KEEA 1O3BA 2VVUA 4R8TB 2BY8X 4Y6DA 2TPIZ 1NM6A 2ZF0H 3LGWA 3KF2A 3ZVCA 3BIUH 2FTLE 4JK6A 3M3VA 3RLWH 2PKSB 1TNIA 2A5AA 2F9UA 2FI5E 2AGGX 1GJ4H 3CENA 1D3PB 3SN8A 3PLPA 4H42U 1G3DA 1C1VH 1B0EA 1V2UT 7GCHF 2Z9GA 5J4QA 1CBWC 2GCTB 2QXHA 2BHGA 1L4DA 3TH3H 5LPRA 3A7XA 3ZYDA 1ELVA 1NFXA 2A45B 4WXIA 1TMTH 3ZZ8A 2OC8A 1ZHRA 3SI4H 1A0JA 1ZJDA 1F5KU 3T28A 1K1PA 4CRBA 3U9AH 3BSQA 1SGTA 3ZZ6A 5DP8A 4AYVB 5CE1A 1XUGA 1UTPA 2J94A 1O3PB 1CT2E 2XC4A 1GHBF 1HJ8A 2Y5FA 1GHAF 3HGPA 3KQDA 2ZCHP 1FAKH 3IITA 1IQHA 1P3CA 2Q6GA 1LPZB 3M5OA 4BAKB 2FODA 5DPAA 2BYAX 3T26A 3F1SB 4K1SA 4ISNA 1PQ5A 1ZRKA 1ZMJA 3IWMA 5DGJA 4I8LA 1GMDG 2ZQ2A 4XSKU 3T5FH 5L30H 3A8DA 4FU8A 2BD5A 3TNTA 2BZAA 4FUFA 2ZGBH 1BMAA 1P10A 3A87A 4ZKOU 1C2EA 1Y3WA 6ESTA 1LHDH 1XUFA 2GT8A 1Y3UA 4CR5A 2DE8A 2CF9H 3RXUA 1C2KA 1UVTH 4LZ4B 1GBEA 1GI1A 2XC5A 1ELEE 1O36A 1KLJH 1O3KA 5JBTA 1UK4A 1EQ9A 3H7OA 3RXPA 1MZAA 2ZNKH 1A5GH 3D65E 3QDZB 3HKIB 1GJ8B 2J9NA 1O2TA 1QJ6B 2K1QA 2PR3A 3LGIA 2CJIA 3QZRA 1O5GH 3A80A 1GBFA 3P8FA 1E36B 3CS0A 5L2ZH 1HJ9A 3SUEA 1GBJA 2A2XH 3TNSA 1NT1A 1CGIE 3TPIZ 1KXCA 2VINA 1QTFA 1OKXA 2GZ8A 3W94A 4INHA 4ZHAA 3MO9A 3VXEH 2BXTH 2R3YA 1YPHE 2QXGA 1GJ6A 4UE7H 3PWBA 2ZFTA 3QN7A 3RXTA 1AHTH 2D1JA 1Y8TA 3LC5A 4K5ZA 8KME2 1NPMA 4D8NA 1AE8H 1DWDH 2XNIA 2G4UA 1C1QA 4NSVA 1E35B 1UVSH 3A7TA 3MNBA 1PPZA 4AORA 4AOQA 2ZQ1A 1S84A 3P6ZB 1NRPH 5FPSA 3VXFH 4K2YA 1W7XH 4LK4A 1DT2A 3SORA 4X2WA 1YLDA 2ZPSA 1HFDA 1C2MA 1QIXB 1FDPA 2VVCA 3KHVA 5TJXA 1MTVA 3GCTF 5FPTA 5EW1H 2JETC 1HGTH 3B9FH 1C5VA 1B5GH 4UFEH 1W8BH 3L6PA 1H8DH 1BTXA 4FVBA 3GICB 1ARBA 2BVXH 1W0YH 2P95A 3N7OA 1EJNA 1HNEE 1PPFE 2NU0E 2Z3DA 2BX4A 2HWLB 3GISB 2VB0A 2P93A 4B2AA 1TPOA 2BVRH 4HGCA 4BXSA 1AE5A 1F5RA 1HB0B 1H1BA 2XC0A 1K1LA 4FU9A 2CGAA 2QAAA 2R0KA 2F3CE 5EQRA 1YM0A 5DP7A 2DE9A 2NU4E 1DANH 2FPZA 3A88A 1V2VT 1PPEE 1MTSA