1XUIA

Trypsin-keto-babim, zn+2-free, ph 8.2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Serine protease
molecule keywords TRYPSIN
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuiA02
4K8BA 2V3HH 1EAXA 1QA0A 1O2YA 3FVFB 3VGCB 4X6PA 3FFGA 4H42U 2ODYB 1DICA 1O32A 2HGTH 5DPAA 2ODQA 1TRYA 2FOHA 3SUEA 1KDQB 3HGPA 2ZG0H 3K2UA 2ZC9H 4YOGA 2WPKS 4CRFA 1HFDA 3KNXA 1Y5UT 3SV2H 5FPSA 3A83A 2SNVA 2XW9A 5ETXA 1IQHA 3RXQA 1GHWH 3ATKA 4DVAU 5JB9S 4FUIA 1XVMA 1N6YA 1HAVB 3EA8A 3OU0A 1F92A 1FN8A 1QB1A 2G00A 2XNIA 3F68H 3HPTB 3OYPA 3R3GB 3RXKA 4JZDH 2GKVE 2OQ5A 1YPKH 2A5KA 2WYJA 2EEKA 1UTQA 1VJAU 1WUNH 1WTHD 1SBWA 1D6RA 3VPKA 3GCHC 3RP2A 4MDSA 1WTGH 1UO6A 1HJAC 3BG4B 4JMYA 3U8RH 2QXJA 3UY9A 4TYDA 1KSNA 4X6NA 4D7GA 1PPCE 1P0SH 4WMDA 4Q7XA 2V35A 5GCHG 3ATLA 2WV4A 2R2WU 1P2JA 2D2DA 1MD7A 3SW2B 5HGGA 1FY1A 2PLXA 1BTUA 3ZVBA 3A89A 1G3BA 5GWZA 2FO9A 3K6ZA 1U6QA 5CMXH 1UCYE 1CBWC 4X8VH 1UTKA 2BYAX 1HDTH 2I6SA 3Q77A 1TNJA 4Y76A 3SI3H 1UVUH 1ZLRA 3EGKH 4ISNA 1G37A 1LHFH 4Z6AH 2Z9KA 4NFEA 4ZXXH 1C1OA 2QGRA 4JK6A 1W8BH 3SQHE 4BAHB 2ZPSA 5C1YA 1AVGH 1J15A 3RMLH 1MBQA 3Q76A 2ZU1A 1AVWA 1WU1A 5EU8A 2I6QA 1VCQA 3RLYH 1PJPA 3PWBA 3AW0A 1KTTB 1V6DA 2BY5X 1KLIH 1EJAA 2B9LA 2Y7XA 4CRBA 1TNGA 2WPLS 2XYAA 4KKDA 1GHAF 3QWCH 1SGRE 1ELCA 3ZYEA 8LPRA 1BMMH 3RXFA 2NU4E 2BXTH 4X1RU 4ISHH 6GCHG 3SNEA 3V7TA 3A80A 1NRPH 3BEIB 5GCHF 4Y0ZE 3I78A 1DM4B 3PO1B 2Z3CA 3STIA 3T28A 1QB9A 4IMZA 4F49A 2ZQ2A 3RXEA 1GBMA 2B5TB 2F9OA 2D26C 1ZPCA 1TGNA 1P04A 1WYKA 5ESBA 3SQEE 4YTAA 2M5TA 1G2LA 1O2TA 1TGTA 2A0QB 4ZKNU 1P9SA 2VH6A 1MTUA 1HAIH 5FX5A 1DS2E 1FY5A 4XBBA 1HCGA 1P2QA 1KXCA 1GI5A 1EZXC 2C93B 2XWAA 1QNJA 3UNQA 5DO4H 3NUMA 3BTEE 1MCVA 4AFSA 4I8HA 1UCYK 3MU1A 2A1DB 3H7TA 3GY2A 3PTBA 1DXPA 3MH5A 1IQIA 1NESE 2QIQA 5T6GA 1TONA 3MH6A 3MU5A 3VB3A 1IQMA 5FXLA 3ZVFA 1P2MA 1EP5A 3SU0A 4AORA 1GBHA 1Z8RA 2GMTB 1K1NA 2UUKB 1ANCA 3KGPA 5EXNA 1GHBF 1S82A 4AOQA 1GG6B 1W0ZU 5T6FA 1P12E 1IOEA 3RM0H 4NWLA 5A8ZA 1OOKB 3RMOH 1W3CA 4H6TA 3E0PB 1YCPM 1P03A 5H4IB 1BHXF 6GCHF 1IAUA 5DP9A 1BT7A 2FZZA 3ZVCA 1RFNA 1OWHA 3H7OA 1TMUH 1AHTH 1GMCF 5LPEA 1A0JA 1C1VH 1LHDH 2PTCE 3PLBA 4MNWA 1OPHB 3D23A 2FI3E 4GPGA 1SC8U 3GYLB 1VITG 5GDSH 1O3MA 2BM2A 4OS6A 2A7CA 2QV1A 3CP7A 2BXUH 2PHBA 3SV7A 1ZYOA 3SJOA 1ELDE 2WV5A 1ANBA 2ANWA 1SHYA 2O8TA 2BLVA 3ZZ3A 1CBWB 2XWBI 1AQ7A 1C5RA 4K1SA 1EP6A 1NFYA 1HAXB 1AE5A 4GLYA 2ZEBA 1N6XA 2Z3EA 4JZFH 4WH8A 4GCHG 3T25A 3K6YA 2C8XB 2AGIX 1RS0A 4OS4A 3LGYA 4GHTA 4FVBA 1UJ1A 3RXOA 1K1IA 4I8GA 2HLCA 3MWIU 4NA7A 1C1QA 1BTHH 1A46H 3NPSA 4AFZA 1DWDH 1GHZA 2ALVA 2SGEE 4WJG2 1UHBB 2A2XH 1ELFA 4A1XA 1O5EH 1S6FA 3PLKA 1J9CH 3RLWH 1MTVA 3T2NA 1YPLH 1EXFA 1CSOE 1HIAB 1O2SA 1HNEE 4RKOB 4FXGH 1FAXA 4ZHLU 2OQUA 1MZDA 3MMGA 3BEFB 2KAIA 1HJ8A 1TBRH 1ZPZA 1IQNA 1T8NA 3EQ0H 4E06H 1JBUH 1MTSA 5FCRA 1SGYE 4ZHAA 5DG6A 3P70B 3OY6U 3SO3A 1GHAG 1XXDA 3GDSA 3GDUA 1G3CA 1GJCB 3M36A 3TLOA 4TPIZ 1H9LB 1ZSJA 3SUGA 1T8MA 1GJ5H 1P3EA 1AD8H 1DVAH 3M3TA 5HYOA 1GBAA 3VB4A 1DWBH 3NCLA 1O3AA 1NFWA 1HB0B 1Y3VA 1E35B 2GT8A 1A7SA 2BDCA 4D8NA 2F9UA 2XBXA 1XXFA 1SGFG 3LH3A 1P2KA 3U69H 2VJ1A 2ZHWH 4GVUA 3EE0B 1QQUA 1C1WH 4K1TA 1HXFH 3URCA 3VB6A 1CT4E 3BTME 5JYIA 1HAGE 3IG6B 1HAYB 4LOYH 1QR3E 3BV9B 4ABBA 3NXPA 1TNHA 2J9NA 4ABEA 3L3TA 1HAZB 5T6DA 2C8ZB 2ZPQA 1ELGA 1P05A 5LPFA 1XM1A 4KTSA 2C8WB 4JYUH 3F6UH 2UWPA 3UFAA 1TGSZ 3LC5A 3O8RA 1C1NA 3SBKA 1DWEH 1KLTA 4AFQA 3S7KB 3TPIZ 5I46H 1OWKA 1C2GA 5LH8A 5DP5A 1O5GH 2CF8H 4CRCA 2GCHF 1EAUA 4FUGA 5C2ZA 4DGJA 5G4BA 2XXLA 1C4Y2 1EASA 3GCNA 4WXIA 1THSH 1W0YH 2BD3A 1SOZA 1RJXB 4E7NA 5C20A 2ZNKH 2BD2A 2OCVB 2A5IA 5E0GA 3M35A 4BXWA 2OC8A 1GGDC 2BVRH 3V3MA 3RM2H 2VWMA 2FODA 4IMQA 1O3FA 1SGQE 1PPGE 2J4IA 5EG4A 1GMHG 3P8OA 4INLA 4B71A 1F0SA 4INHA 2QXHA 2FMJA 1L1NA 1O3JA 3KEEA 1UK3A 1EATA 1KXDA 3LKWA 4YLQH 5FBIA 3P8NA 5BPEA 4MNYA 1VZQH 5C67A 1QBVH 3CS7A 1C1UH 1AFQC 2LNCA 3MNCA 3HKJB 2ZFQH 4IN2A 5IYTA 2BQWB 1PQAA 1W10U 4I8KA 2TIOA 4YM9A 4DY7B 4CRDA 2TBSA 4DOQA 5L2ZH 5FPTA 3PV4A 1YPGH 2PSYA 4CBOA 4ZMAH 1IQKA 1AB9B 2JETB 2WPIS 1HYLA 1K1JA 2KAIB 4X2XA 2A5AA 2FPZA 2O8LA 4ZKSU 1WSSH 1DUAA 5JDUB 1ACBE 1UTMA 3CENA 1ARBA 4NGAH 1DE7H 4Q2KA 5DGJA 3RXSA 2Q1JA 5B6OA 3L33A 1ANEA 4KTUA 2STAE 2ZZUH 1LVYA 1MU8B 1O2QA 2ZFRH 1O3CA 3SZNA 1NROH 1T7CA 1BTYA 3Q00A 1FY8E 1NU9A 3TK9A 5GXPA 2A7HA 2Z94A 1XUKA 1GHYH 1CA0B 1BDAA 3RU4T 1AN1E 2GT7A 1A5GH 2IPHA 1GDQA 3E3TA 4MNXA 1SLWB 1F0UA 2AIPA 1W7GH 2ZF0H 3ZV8A 3JZ1B 4BAQB 1JXPA 2ZHEH 1GI0A 1GGDB 3TH2H 1C5VA 1ZHPA 1FIZA 1FZZA 1F0TA 1ZR0A 4K1EA 1QB6A 1O2LA 1HUTH 1D4PB 2OLGA 1TWXB 4AB8A 1ZPBA 3ATMA 4ABJA 3KQCA 1BB0B 3F9HA 4AYVB 5JB8S 1CHGA 1F5RA 4O97A 1UK4A 2O8MA 1EJNA 1XMNB 1EUFA 3MH7A 2EA3A 1SGFA 3LT3A 4CBNA 2FYQA 3E6PH 3TH4H 2OXSA 1GHBG 2NU1E 2WPMS 4JK5A 4X2YA 1RRKA 2Y82A 3FP8E 9ESTA 5FAHA 3NWUA 4GHQA 1GVKB 1P8VC 1G9IE 4AGKA 5C1XA 1Y3XA 1O2JA 1YPHC 4FVDA 3MI4A 1GHVH 4B1TA 1HGTH 1D3PB 3O8BA 2UUFB 1T4VH 2W26A 2ILNA 1MQ6A 2FOBA 1TA2A 3SU6A 1W11U 2STBE 1JIRA 5C5NA 1XUGA 2ZU4A 1BTZA 2ZGHA 1J16A 1GVZA 2H2ZA 2GZ7A 1UVSH 1C2FA 5JBBS 1W13U 1J17T 1UTJA 3UPEA 1F7ZA 2VIWA 2B8OH 3ZVAA 3ZZDA 3TGKE 1MBMA 1T8OA 3T29A 2ZPRA 1AWFH 2OINA 3DD2H 4Y8YA 1A61H 2RA0A 1G2MA 2BLQA 1IQFA 1KXBA 1TNLA 1O3DA 3FZDA 4K60A 1CT0E 2Y80A 3GCOA 2W7SA 1YPJH 1GMCG 1MTNB 1S81A 3RU4E 3S0NA 4XSKU 4CHAC 9LPRA 1O30A 3EA9A 1THPB 3OTJE 2CGAA 2FOFA 4SGBE 1THRH 1EX3A 3RXBA 1KXEA 5EQRA 1HPGA 4UFEH 2H9HA 2ZGBH 1FN6A 1MTWA 1GBIA 1Z71A 2NWNA 1S85A 1QTFA 1TPSA 2UWLA 3AW1A 4B74A 1GMHF 4ZH8A 2Z9JA 3RXCA 1Y3WA 2ANYA 1KXFA 3GY3A 4QT8C 4NCYA 3BTWE 5DP8A 2W3IA 4A5TS 3O8DA 2G5VA 1FNIA 1H8DH 3D65E 3ZVDA 1TOMH 1CVWH 3VXEH 1VCPA 1F0RA 1SFQB 1GCDA 1QA7A 1ZTJA 3ZZ7A 1SB1H 1AY6H 2ZFTA 1C5ZB 1LPGB 2H5CA 1O3GA 2FESH 1S84A 2GCHG 2AH4X 4MLFB 1BMLA 1BTXA 2PKAB 4X1NU 1GJ7B 3A7ZA 1NRRH 3GCHB 1ZJDA 2RCEA 5DP3A 3WY8A 4XE4A 2BZAA 1IHTH 2HRVA 3A7YA 1FI8A 4U32A 3RXRA 1UMAH 4NIWA 5PTPA 3HK3B 2BDYA 1JWTA 1P09A 2Y81A 2QY0B 1XVOA 1EZSC 1PPHE 1VITH 1AKSB 2SGAA 2VIPA 2QF0A 1RTKA 3SJKA 5A0AE 1EAIA 4NZLA 1EQ9A 2SGPE 3Q3KA 1GVLA 1Z6EA 3A8CA 3LONA 4I7YH 5FX6A 1MTNC 1O2KA 3QN7A 1TE0A 4I8LA 1DY8A 2ZDNA 1O2ZA 1JRTA 1TPAE 3BTDE 1V2KT 3TU7H 1LQDB 3RMMH 2EI7A 3ODFA 4X1PU 1GBBA 2Y5GA 3RC4A 5L2YH 3V13A 3CS0A 2QYIA 3E91A 1SLUB 5A0CA 1KY9A 3RUOA 5JBCS 1OWEA 2IN2A 1C1MA 8GCHG 1CQQA 1E38B 2OC7A 1TX6A 4IC6A 1MU6B 3RXTA 4A7IB 1UVTH 4B73A 1SHHB 1C2KA 2A4RA 1IQGA 5HM9A 1GJ4H 3MU8A 1ABJH 3SU3A 1N8OC 2FP7B 1J14A 3QO6A 4FU7A 1VITF 2BX4A 2GTBA 1O37A 1AGJA 1O3PB 2B0FA 3A7VA 3QK1A 2GV6A 5AHGH 3M3VA 3SNDA 1YF4A 3KN2A 4BTUB 3OY5U 2BD7A 1C5WB 1GBLA 1V2MT 3BEUA 1SGPE 2BTCE 5EXLA 1BBRK 1TOCB 4JZEH 4BTTB 1CGHA 4DURA 4Y11E 3QX5H 2OP9A 1ID5H 1YGCH 1QRXA 3SNCA 1PYTC 1OXGA 2WPHS 2BQ6B 4UFFH 4MG3A 1C5LH 4D76A 3EA7A 3ZZ8A 3PLPA 3PTNA 3O8CA 1EJMA 2AGGX 2P95A 2TGDA 4MTBA 1CHOG 1ZTKA 2VIDA 3M7UA 3FP7E 3UWIA 1MKXK 1O3KA 1MH0A 1H9HE 1G3EA 1VGCC 4NSVA 3LJJA 2G8TA 4X8UH 1N1LA 4NFFA 3SU1A 3VEQB 5DP7A 5J4QA 1FJSA 2AEIH 1DXWA 4UONA 1GI2A 3TNSA 1YPEH 3ZVEA 4VGCC 1GL0E 2VWLA 4TY7A 4OS5A 1OYTH 3DUXH 2BD9A 1FV9A 4Z0KA 6CHAC 1QY6A 2Y5HA 2RDLA 5DJ7A 1YKTA 1LKBA 2O9QA 2A32A 3LGWA 2Q6DA 2R3UA 3T62A 2BMGB 2PUXB 2BLWA 3E90B 2ANKH 3UNSA 1MAYA 1V2UT 2WPJS 3U8OH 3UQVA 4AYYB 2Q6GA 1SMFE 2ZWLH 1ELEE 1C5TA 1HAHH 1ZRBA 3U98H 1AMHA 3I29A 5TCAA 4O9VA 1GBTA 3V12A 5EQSA 3ZZ9A 1CA0C 1DFPA 1HJAB 2QXIA 1YLDA 3ZZ5A 1SSXA 2P3TB 1ZSKA 2O8UA 3VB5A 1LKAA 1NRSH 3PMJA 1BJUA 5ESTE 3A8AA 1D9IA 1UCYH 1X7AC 2R9PA 3KCGH 1O3OA 4KTCA 1NZQH 2VGCB 4D9QA 3T26A 1VGCB 3EAJA 1MD8A 3RU4D 1XUJA 5EPNA 1V2PT 3C27B 1AWHB 4LXBH 1L1JA 1FPHH 1YCPH 1GBKA 2H9TH 1PQ7A 1AFEH 2O8WA 2VVCA 4TWYA 1GCTB 4A1TA 3UIRA 2F9NA 3RXDA 1GBFA 1P10A 4WMFA 2PFEA 4A1VA 3S9BA 4X1QU 1WAYB 1SPJA 4HTCH 1ANDA 1CT2E 1O31A 4YLUA 4J2YB 1ZJKA 1O33A 5E2OA 4D7FA 3ZVGA 1YM0A 3W94A 3LDXH 4I31A 5FCKA 1T8LA 5F6MA 4FUDA 4X6OA 2H9EH 1GWAA 4NIVA 2FOGA 3BIUH 1GJBB 1TX8A 2G51A 4AZ2B 2CJIA 2XTTB 1EZUC 3D62A 1HXEH 1BZXE 2QN5T 4MPXA 1FLEE 1G32B 1ELVA 1BTPA 1OYQA 3SU2A 3MU4A 1K1PA 5E0JA 1KIGH 1EB1H 2UUJB 3DFJA 2BB4A 2GZ8A 2PKSC 2A2QH 1DSUA 4NIYA 2ZU2A 6CHAB 1UVPA 2EI8A 2V0BA 1FPCH 3MO3A 1OS8A 3A8BA 3RXPA 2NU3E 2F9BH 3UREA 4INKA 1Y8TA 1O2WA 2D1JA 4BAOB 1TGBA 1AO5A 1DWCH 1BQYA 2ZFFH 3TIUA 3TK6A 2VVUA 1ETSH 2J34A 1HJ9A 3TK5A 4ZKOU 5HMAA 1L1GA 4HZHA 2BD8A 1O2OA 1GI7B 1OWIA 3MFJA 1BIOA 1IHSH 1T31A 2OC1A 1H1BA 1ZRKA 1E34B 1RD3B 3MNXA 4ABHA 2H5DA 2HNTC 3LC3A 2F83A 3T5FH 4YT7H 1DT2A 3KHVA 4O3UA 1CGJE 2A31A 3KIDU 5HM2A 3GOVB 1G30B 4YO9A 4IW4E 1SFIA 4Y0YE 1AFQB 1O38A 1BJVA 1BTWA 3EYDA 3M5MA 2JH0D 2J2UA 4Y10E 1BITA 2WUCA 4X2WA 1Z8GA 1DDJA 3ZZAA 4KGAA 2FX4A 2A45B 2VVVA 1VR1H 2Z7FE 3I77A 2ZCLP 3K65B 2CN0H 4SGAE 1AIXH 4UEHH 1SL3A 4DT7B 4YOIA 4O03A 2WYGA 1C2HA 4FUHA 1GBDA 4FU8A 2CV3A 4Y79A 2XC5A 4K3JA 2VIQA 1GBJA 1HIAA 1C2LA 4YT6H 5EW2H 3RXJA 1L4DA 1EPTA 1P2OA 2FI4E 1GBCA 1Z7KA 4CREA 3SV6A 5E8EH 7GCHF 1AKSA 1MCTA 2C3SA 2ZP0H 2VB0A 2F91A 3HKIB 4OGYA 5HXFA 2XBVA 2ZFSA 1V2ST 3L6PA 2BDAA 3A85A 2V3OH 3MH4A 2ZDVH 4X2VA 4JZ1A 2P8OC 1QBNA 2EC9H 1GI9B 2Y5FA 3SOSA 3SGQE 4UFGH 3SN8A 2VGCC 3QGNB 2P16A 2AERH 1ELTA 1NFXA 4AX9H 3MOCA 5EXMA 1JIMA 5FPYA 2XBWA 2Y6TA 5CE1A 1O2XA 2F9VA 1GCTC 2G52A 1D3TB 2BHGA 4Y7BA 2A4QA 4HI3A 1GJ6A 1NC6A 1C1SA 2SGQE 4CH8B 1CU1A 5L30H 4ISLA 4XBDA 2Z3DA 3MNBA 1SGDE 4XOJA 3A81A 2FTLE 3LJOA 1TRNA 3RDZA 3GICB 2ODPA 5AFZH 1TNKA 4H6SB 4WWYA 1TLDA 3TITA 1BA8B 1C2EA 3G01A 2AFQB 1BMNH 2BD5A 1SVPA 4LZ1H 3AAUA 1NM6A 1TAWA 2CHAB 3ZZBA 1AB9C 2JETC 3GY4A 2AMPA 1GJ9B 4R8TB 1GJ8B 2PGQB 1PQ5A 1IQEA 2VH0A 3QLPH 2EI6A 2SGDE 2P8OB 2G4TA 1KYNA 1MKWH 2FYRA 4BXSA 2VWNA 7KMEH 1O5BB 1Z8IB 1MQ5A 3SNAA 1Z1JA 8ESTE 5LPRA 2PW8H 3ESTA 3SJ9A 1GI3A 4K2YA 4DJZB 5GPIB 2OD3B 1L0ZA 1QCPA 3M5OA 1LPKB 2ZCHP 2P3FH 3GISB 1SQAA 2VU8E 3QTOH 5IDKA 1TQ7B 4NSYA 4CRAA 1BRAA 2ANMH 3MO6A 1RIWB 1H9IE 1SQTA 2ZECA 3S7HB 1GI8B 1W2KH 2P59A 1C1RA 4F4OC 3ZV9A 2K1QA 1C1TA 3BTKE 1O5DH 3UNRA 1YLCA 1NS3A 2P93A 4YZUA 2ZGJA 3TJUA 1HAOH 4K69A 5SGAE 1BBRE 2QAAA 2YNAA 3M37A 2OTVA 1O36A 1TA6A 1YPHE 1A5HA 3ITIA 3HATH 4BOHA 4GUXA 2XC0A 3S69A 1O2GH 1HRTH 5F8ZA 3OX7U 3A84A 3BSQA 2FX6A 1TX7A 3UTUH 3BF6H 1H8IH 3TH3H 1VCWA 3EDXB 1EAWA 1GI6A 2AGEX 3QDZB 4AN7A 2ZCKP 1TGCA 1O3LA 3NZIA 2J92A 4MPVA 4NIXA 3KQEA 5A0BA 4FUFA 1QQ4A 4FUCA 5EW1H 2NU2E 3SU4A 1FAKH 1K28D 1VJ9U 1LO6A 2P94A 3KF2A 3M5LA 1O5FH 1A2CH 2BD4A 3ATWA 3ODDA 4AB9A 3BTHE 1RTFB 3PMBB 3BTTE 1C5PA 4U30A 1AZ8A 1O2MA 3W95A 3TGJE 1ZSLA 3U9AH 1JMOH 4Q7ZA 2AYWA 2GVFA 1S0QA 5C5OA 3TJNA 1ZGIA 1NY22 1AU8A 1WBGB 3FANA 3GY5A 2AMDA 3AVZA 3P95A 4IC5A 3DFLA 4JCNA 4WVPE 2J38A 4ASHA 2W5EA 1D6WA 1WOFA 1V2QT 1W7XH 1P2NA 1GDNA 4CR9A 1DITH 1Z8JB 1O2HA 1PPBH 2ALPA 4WF8A 4BAKB 1LDTT 3F9EA 1AZZA 2NU0E 3RXUA 4OS2A 4A92A 3U1JB 5A2MH 1TPPA 4Y6DA 1C5NH 3ZZCA 4BTIB 2VIOA 3FZZA 3FAOA 5AFYH 1A5IA 4B2AA 1QGFA 1XUFA 3MTYA 1TALA 4K5ZA 2IJOB 2BZ6H 1WQSA 1XUHA 1TIOA 3DA9B 1DX5M 2XCNA 3QGJA 4HGCA 5JPMH 1DUEA 1G3DA 2JH6D 2V6NA 1C2DA 5K7RA 1HLTH 1L2EA 2PKSB 3BG8A 4XBCA 1QRWA 3E8LA 1OP0A 1RTLA 1NPMA 3P6ZB 2HOBA 2ZTZA 1B0FA 3UWJH 5AF9H 2DE9A 1GMDF 5K0HA 2FS9A 4ZUHA 1AE8H 1F2SE 1UHBA 2FLBH 4NA8A 3GYMA 1MMJN 5J4SA 2H1UA 1ESAA 1MAXA 1O2RA 2Q6FA 1C2JA 1TB6H 2GD4B 1E0FD 3MYWA 1K1OA 4PROA 1ZTLA 4I8JA 2ZGXH 4OGXA 2C4FH 2C90B 4GCHF 4MPUA 1SGIB 3LGIA 5GJ4B 1NU7B 1RIWC 1LHEH 1UTNA 2QCYA 2FDAA 1ZMJA 2G55A 4NA9H 1F5KU 1A0LA 2TGTA 4TWWA 4ZAEA 1YP9A 1UTOA 1IQLA 2AMQA 2CXVA 4DG4A 2OC0A 3SJ8A 1UK2A 2B7DH 1F5LA 4BNRA 1LVBA 1SGCA 1O39A 4YOJA 4B76A 4R0IA 4ABIA 4CR5A 1LTOA 5JBAS 5TCCA 2ZDKA 4B2BA 1Z1IA 1EOLA 4AGJA 1A0HB 1CGIE 2Z6BD 3M3SA 1SGTA 1P11E 4OS7A 4UDWH 2C8YB 3FP6E 4Q80A 1AUTC 4CRGA 3E16B 1PPFE 3A82A 1SI5H 4NWKA 1C5XB 2BDHA 2ZA5A 3TNTA 1SG8B 2TGAA 1W14U 3GY8A 3UOUA 5T3HA 1V3XA 2SNWA 1SLXB 3URDA 4X8SH 2ZHFH 1O2NA 3A8DA 3LIWA 2P3UB 2FOMB 1D3DB 1N8OB 3A88A 3DT0H 3M5NA 2TGPZ 3QUMP 1LMWB 1QRZA 3RXMA 2GMTC 3MNSA 4IBLH 3SNBA 1EPTC 1HV7A 4U2WA 1BRBE 2ZU3A 3C1KA 3LGUA 4KELA 2Z9GA 3TJVA 3UQOA 1S83A 5DKMA 1UTLM 3M61U 2CF9H 2HPQH 1WV7H 1Q2WA 1V2OT 2PKAA 3BN9A 3PB1E 1DPOA 4CHAB 2XRCA 3PYHA 2PR3A 1G36A 1UTPA 2HVXA 1TRMA 4THNH 2CMYA 1FIWA 1B5GH 5EPYA 3H5CB 1DSTA 3GCTF 4X1SU 5FBEA 1C5OH 3SI4H 4UE7H 1GMDG 3TGIE 1Y3YA 5EOKA 1NN6A 2FS8A 4Y8XA 2XBYA 2PUQH 1O0DH 5DP6A 4A6LA 3LOXA 4ABDA 2QXGA 3PM3A 2ZTYA 1C1PA 2H6MA 3ELAH 5CHAB 4AG1A 5L6NH 2BOKA 7LPRA 1TFXA 2GX4A 2PSXA 1O3IA 3UOPA 2BVSH 4ISOA 1TYNA 4M7GA 3F9FA 3N7OA 1H4WA 1TQ0B 4IN1A 2JH5D 3RC6A 4DIIH 3B8JA 3AASA 1BUIA 4XDEA 3QZRA 3MU0A 6LPRA 1EPTB 2OBOA 1QURH 4NZQA 4WMEA 1Q3XA 3P8FA 1LVOA 3SHCH 3SHAH 3QZQA 2RG3A 1XKAC 1LHCH 3LU9B 4ABGA 3S9AA 4JZIA 1D3QB 3HK6B 2YOLA 3LH1A 1HBTH 2G81E 2PGBB 1QFKH 1C5UA 3RXIA 1ZZZA 3Q3XA 4B75A 1MZAA 1NO9H 5BRRE 2ZU5A 1CO7E 1W12U 1OWJA 1GJAB 2VINA 1UVOA 1ZHMA 2DUCA 4O3TA 1SR5C 2QF3A 3P92A 2ZHDA 3ZZ4A 1GBEA 5E2PA 3SJIA 2XCFA 4GSOA 1EZQA 2BLOA 3BTQE 4MVNA 6ESTA 1YCPK 1S6HA 1EB2A 2ASUB 1O3EA 2Y7ZA 1WQVH 2BX3A 3NK8A 3B23B 1FY3A 1ZOMA 2G4UA 1GL1A 1QJ6B 3NKKA 5TJXA 5A09A 2HALA 5C1UA 1Y5BT 1C4U2 1E36B 2ZHQH 2ZFPH 1DLKB 3LGTA 3BIVH 1ESTA 3BG4C 3ZYDA 1HAVA 1P06A 1O34A 3VB7A 2Z9IA 2OUAA 2ZO3H 3B9FH 1YPMH 3GY7A 5EGMA 3K9XB 1DLEA 3LPRA 3KL6A 1O3BA 3E0NB 1GHXH 1O35A 3ATIA 1C4V2 1Q31A 5LGOA 1KDQA 2PV9B 1ABIH 1V2LT 4I33A 2GGVB 4OS1A 2BY7X 1C2MA 3STJA 1OX1A 4BAMB 1YBWA 4RKJB 2FIRH 1O5CB 2WINI 2FEQH 4WXVA 1QBOA 1TMBH 1LVMA 1K21H 1NRQH 1V2NT 2W3KA 1XUIA 1ESBA 3T27A 5I25A 5DK1A 1M9UA 2FOCA 2G5NA 1BRUP 1NT1A 4ZHMU 1OSSA 4BANB 2AS9A 1C5YB 2R2MB 4WY3A 1LHGH 4X8TH 1MUEB 1ORFA 4LZ4B 4E05H 1C5SA 1SLVB 2VWOA 5C3NA 2LPRA 1O2VA 2QC2A 1AUJA 3RXGA 3SGAE 4DCDA 2GP9B 1ETTH 4GAWA 1GJDB 2IOTA 2PWXA 3RMNH 2FI5E 2GDDA 1BOQA 2VNTA 4ISIH 1GI4A 2ZIQH 3SV9A 1C2IA 2R3YA 1K22H 4ZROA 4U01A 1T4UH 4JYVH 1O2PA 3PROA 5F03A 1OWDA 3BTFE 4UFDH 5F8XA 5ABWA 5F8TA 1XX9A 5AVDA 2QA9E 1OKXA 2W7UA 1P9UA 3MHWU 4YESB 2HPPH 2FOEA 3P17H 1ARCA 1PFXC 2J95A 2SFAA 1K1LA 3JZ2B 1MKWK 1HAPH 2CHAC 1P2IA 5A8XA 4FU9A 2BY6X 3PO1C 1NRNH 4VGCB 3GY6A 1FXYA 3VGCC 1K2I1 3RXLA 1ELBA 5A8YA 1AVXA 3SGBE 2ZTXA 5FHTA 4RSPA 1L4ZA 3A87A 3P8GA 4ESTE 4HFPB 1T32A 1Z6JH 2HNTE 2TRMA 4Y7AA 1FONA 2F3CE 4UD9H 2FM2A 1K1MA 3UUZA 1DY9A 1Y5AT 1V2WT 1CA8B 2AIQA 2FLRH 4RN6A 1QL9A 2THFB 2WUBA 1A1RA 1TPOA 2D8WA 4X6MA 3ZZ6A 2A4OA 1SQOA 3M7TA 1J8AA 3A7TA 4I32A 1C5QA 3UR6A 4LK4A 4MPWA 3VFEA 1O2IA 3U8TH 3OSYA 1QJ1B 1SGNE 3A86A 4IS5A 1KTSB 1GPZA 1PQ8A 2FWWA 2GV7A 1V2RT 1O3HA 1O2UA 1FY4A 1V2TT 3F9GA 7ESTE 2GDEH 1V2JT 1K9OE 1Y59T 3TJOA 5JBTA 1FQ3A 2DE8A 1C9PA 1Y3UA 1ELAA 1EOJA 5E0HA 4K8YA 1LCYA 1A3EH 4X0WU 3V0XA 1KLJH 1GG6C 2BDBA 1C9TA 3PMHB 3A7XA 4KP0A 1TBQH 3DHKH 2SGFE 3ENSB 2ZDAH 1QL8A 2F9PA 3GCTG 4FUJA 2A7JA 1AI8H 3M7QA 2FTMA 5GIBA 4FUBA 1NTPA 1S5SA 3BTGE 3A7WA 1ZHRA 1S0RA 1QJ7B 1FUJA 5DP4A 1BRCE 5EQQA 4FUEA 1TMTH 8KME2 2ZKSA 1SGEE 1YYY1 1LPZB 4JYTA 4D9RA 1BHXB 4E7RG 1GDUA 1A4WH 3U1IB 4DIHH 1QHRB 1FMGA 3PWCA 2A4GA 3KQDA 1A3BH 1INCA 1OP2A 1O3NA 3Q3YA 2UWOA 4TPYA 3SV8A 2GCTB 1SOTA 5EODA 2RA3A 2BVXH 1TNIA 3SUFA 4DW2U 3PMAB 4TY6A 1QIXB 3R0FA 4H4FA 2VIVA 1P57B 2YNBA 3E1XB 3SORA 4ZXYH 1O5AB 3QTVH 2Z9LA 1ZGVA 3RXVA 1NFUA 4MQAA 4Q7YA 1DOJA 1ETRH 2UUYA 2HNTF 2ZGCA 1TABE 1WCZA 1P02A 2J94A 4MNVA 3SU5A 2FOAA 3SUDA 4WH6A 4Y8ZA 3IITA 2JKHA 2OBQA 4IGDA 1OP8A 1BMAA 1RXPA 4NG9H 1C5MD 4AFUA 1ZMLA 2ZDMA 2R0LA 2ESTE 1TBZH 1V2VT 3LGVA 3IWMA 1B0EA 1PYTD 4CH2B 3D49H 4AG2A 1EKBB 1JRSA 1P3CA 3RXAA 2HWLB 2R0KA 1GI1A 1KXAA 3KQBA 1MKXH 1PPZA 8GCHF 3HGNA 2BQ7B 2BY9X 1JOUB 1IQJA 3RC5A 1QL7A 1B7XB 2ZI2H 3F1SB 3GDVA 4ABFA 4Y71A 1DANH 2ULLA 1RGQA 2FXRA 2BDGA 3TVJB 1XKBC 7GCHG 3S9CA 1FDPA 1CHOF 3MO9A 3VXFH 3RXHA 1YC0A 3AAVA 4J1YA 2TPIZ 1PPEE 1CE5A 1ZMNA 1BCUH 4ZKRU 4ABAA 2XC4A 2PTNA 1E37B 2GCTC 2BOHB 1P01A 2BY8X 2GZ9A 2ZDLA 2ZQ1A 5CHAC 1BBRH 4XFQA 1LQEA 2BDIA 4B2CA 3UR9A
chains in the Genus database with same CATH superfamily
4K8BA 2V3HH 1EAXA 3NRLA 1QA0A 1O2YA 3FVFB 3VGCB 4X6PA 3FFGA 4H42U 2ODYB 1DICA 1O32A 2HGTH 5DPAA 3GS9A 2ODQA 1TRYA 2FOHA 3SUEA 1KDQB 3HGPA 1SKYE 2ZG0H 3K2UA 2ZC9H 4YOGA 2WPKS 4CRFA 1HFDA 3KNXA 1Y5UT 3SV2H 5FPSA 3A83A 2SNVA 2XW9A 5C94A 5ETXA 1IQHA 3RXQA 1GHWH 3ATKA 4DVAU 5JB9S 4FUIA 1XVMA 1N6YA 1HAVB 3EA8A 3OU0A 1F92A 1FN8A 1QB1A 2G00A 2XNIA 3F68H 3HPTB 3OYPA 3R3GB 3RXKA 4JZDH 2GKVE 2OQ5A 1YPKH 2A5KA 2WYJA 2EEKA 1UTQA 1VJAU 1WUNH 1WTHD 4Z1MD 1SBWA 1D6RA 3VPKA 3GCHC 3RP2A 4MDSA 1WTGH 1UO6A 1HJAC 3BG4B 4ZCNA 4JMYA 4Q63A 3U8RH 2QXJA 3UY9A 4TYDA 1KSNA 4X6NA 4D7GA 2IJD1 1PPCE 1P0SH 4WMDA 4Q7XA 2V35A 1MABB 2J98B 2W6ID 3ATLA 5GCHG 1FX0B 2WV4A 2R2WU 1P2JA 2D2DA 1MD7A 3SW2B 5HGGA 1FY1A 2LELA 2PLXA 1BTUA 3ZVBA 3A89A 1G3BA 5GWZA 2FO9A 3K6ZA 1U6QA 5CMXH 1UCYE 1CBWC 4X8VH 1UTKA 2BYAX 1HDTH 2I6SA 3Q77A 1TNJA 4Y76A 3SI3H 1UVUH 1ZLRA 3EGKH 3PRBA 4ISNA 1G37A 1LHFH 4Z6AH 2Z9KA 4NFEA 4ZXXH 1C1OA 2QGRA 4JK6A 1W8BH 3SQHE 4BAHB 2ZPSA 5C1YA 1AVGH 1J15A 3RMLH 1MBQA 3Q76A 2ZU1A 1AVWA 1WU1A 5EU8A 2I6QA 1VCQA 3RLYH 1PJPA 3PWBA 3AW0A 4I86A 1KTTB 1V6DA 2BY5X 1KLIH 1EJAA 2B9LA 2Y7XA 4CRBA 1TNGA 2WPLS 2XYAA 4KKDA 1GHAF 3QWCH 1SGRE 1ELCA 3ZYEA 8LPRA 1BMMH 3RXFA 2NU4E 2BXTH 3F3BA 4X1RU 3OEED 4ISHH 6GCHG 3SNEA 3V7TA 3A80A 1NRPH 3BEIB 2L6OA 5GCHF 4Y0ZE 3I78A 1DM4B 3PO1B 2Z3CA 3STIA 3T28A 1QB9A 4IMZA 4F49A 2ZQ2A 3RXEA 1GBMA 2B5TB 5KGOA 2F9OA 2D26C 1ZPCA 1TGNA 1P04A 1WYKA 5ESBA 3SQEE 4YTAA 2M5TA 1G2LA 1O2TA 1TGTA 2A0QB 4ZKNU 1P9SA 2VH6A 1MTUA 5HKKD 1HAIH 5FX5A 1DS2E 1FY5A 4XBBA 1HCGA 1P2QA 5C17A 1KXCA 1GI5A 1EZXC 2C93B 2XWAA 4F48B 1QNJA 3UNQA 5DO4H 3NUMA 3BTEE 1MCVA 4AFSA 4I8HA 1UCYK 3MU1A 2A1DB 3H7TA 3GY2A 3PTBA 1DXPA 3MH5A 1IQIA 1NESE 2QIQA 5T6GA 1TONA 3MH6A 3MU5A 1H8HD 3VB3A 1IQMA 5FXLA 3ZVFA 1P2MA 1EP5A 3SU0A 4AORA 2GMTB 1GBHA 1Z8RA 1K1NA 2UUKB 1ANCA 3KGPA 5EXNA 1GHBF 1S82A 4AOQA 1GG6B 3F0PA 1W0ZU 3CNRA 5T6FA 1P12E 1IOEA 3RM0H 4NWLA 5A8ZA 2KCYA 1OOKB 3RMOH 1W3CA 4H6TA 3E0PB 1YCPM 1P03A 5H4IB 1BHXF 6GCHF 1IAUA 5DP9A 1BT7A 2FZZA 3ZVCA 1RFNA 1OWHA 3H7OA 1TMUH 1AHTH 1GMCF 5LPEA 1A0JA 1C1VH 1LHDH 2PTCE 3PLBA 4MNWA 1OPHB 3D23A 2JDID 2FI3E 4GPGA 1SC8U 3GYLB 1VITG 5GDSH 1O3MA 2BM2A 4OS6A 2A7CA 2QV1A 3CP7A 2BXUH 2PHBA 3SV7A 1ZYOA 4P02A 3SJOA 1ELDE 2WV5A 1ANBA 2ANWA 1SHYA 2O8TA 2BLVA 3ZZ3A 1CBWB 2XWBI 1AQ7A 1C5RA 2KX4A 1EP6A 1NFYA 1HAXB 1AE5A 4GLYA 2ZEBA 4K1SA 1N6XA 2Z3EA 4JZFH 4WH8A 2WPDD 4GCHG 3T25A 3K6YA 2C8XB 2AGIX 1RS0A 1W0KD 4OS4A 3LGYA 4GHTA 4FVBA 1UJ1A 3RXOA 1K1IA 4I8GA 2HLCA 2K0QA 3MWIU 4NA7A 1C1QA 1BTHH 1A46H 3NPSA 4AFZA 1DWDH 1GHZA 2ALVA 2SGEE 4WJG2 1UHBB 2A2XH 1ELFA 4A1XA 1O5EH 1S6FA 3PLKA 1J9CH 3RLWH 1MTVA 3T2NA 1YPLH 1EXFA 1CSOE 1HIAB 1O2SA 1HNEE 4RKOB 4FXGH 1FAXA 4ZHLU 2OQUA 3UAIC 1MZDA 3MMGA 3BEFB 2KAIA 1HJ8A 1TBRH 1ZPZA 3F2HA 1IQNA 1T8NA 3DSGA 3EQ0H 4E06H 1JBUH 1MTSA 5FCRA 1SGYE 4HG6A 4ZHAA 5DG6A 3P70B 3OY6U 3SO3A 1GHAG 1XXDA 3GDSA 3GDUA 1G3CA 1GJCB 2WHXA 3M36A 3TLOA 4TPIZ 1H9LB 1ZSJA 3SUGA 1T8MA 1GJ5H 1P3EA 1AD8H 1DVAH 3M3TA 5HYOA 1GBAA 3VB4A 1DWBH 3NCLA 1O3AA 1NFWA 1HB0B 1Y3VA 1E35B 2GT8A 1A7SA 2BDCA 2J5UA 4D8NA 2F9UA 2XBXA 1XXFA 1SGFG 3LH3A 1P2KA 3U69H 2VJ1A 5IK2D 2ZHWH 4GVUA 2IPQX 3EE0B 1QQUA 1C1WH 4K1TA 1HXFH 3URCA 3VB6A 1CT4E 3BTME 5JYIA 1HAGE 3IG6B 2EY4C 1HAYB 4LOYH 1QR3E 3BV9B 4ABBA 3WW7A 3NXPA 1TNHA 2J9NA 4ABEA 3L3TA 1HAZB 5T6DA 2C8ZB 2ZPQA 1ELGA 1P05A 5LPFA 1XM1A 4KTSA 2C8WB 4JYUH 3F6UH 2UWPA 3UFAA 1TGSZ 2VBCA 3LC5A 3O8RA 1C1NA 3SBKA 1DWEH 1KLTA 3N99A 4AFQA 3S7KB 3TPIZ 5I46H 1OWKA 1C2GA 4FETA 5LH8A 5DP5A 1O5GH 2CF8H 3U28C 4CRCA 2GCHF 1EAUA 4FUGA 5C2ZA 4DGJA 5G4BA 2XXLA 1C4Y2 2KZ4A 1EASA 3GCNA 3SZEA 4WXIA 1THSH 1W0YH 2BD3A 1SOZA 1RJXB 2GJGA 4E7NA 5C20A 2ZNKH 2BD2A 2OCVB 2A5IA 3PV5A 2RFKC 5E0GA 3M35A 5DSFA 4BXWA 2OC8A 1GGDC 1W0JD 3EE7A 2BVRH 3V3MA 3RM2H 2VWMA 2FODA 4IMQA 1O3FA 1SGQE 1PPGE 2J4IA 5EG4A 1GMHG 3P8OA 2WZQA 4INLA 4B71A 1F0SA 4INHA 2QXHA 2FMJA 1L1NA 1O3JA 3KEEA 1UK3A 1EATA 1KXDA 3LKWA 4YLQH 5FBIA 2EQNA 3P8NA 5BPEA 4MNYA 1VZQH 5C67A 1QBVH 3CS7A 1C1UH 1AFQC 3SYJA 2LNCA 3MNCA 3HKJB 2ZFQH 4IN2A 5IYTA 2BQWB 1PQAA 1W10U 4I8KA 2TIOA 4YM9A 4DY7B 4CRDA 2TBSA 4DOQA 5L2ZH 5FPTA 3PV4A 1YPGH 2PSYA 4CBOA 4ZMAH 1IQKA 1AB9B 2JETB 2WPIS 1HYLA 1K1JA 2KAIB 4X2XA 2A5AA 2FPZA 2O8LA 4ZKSU 1WSSH 1DUAA 5JDUB 1ACBE 1UTMA 3CENA 1ARBA 4NGAH 1DE7H 4Q2KA 5DGJA 3RXSA 2Q1JA 5B6OA 3L33A 1ANEA 4KTUA 2STAE 2ZZUH 1LVYA 1MU8B 1O2QA 2ZFRH 1O3CA 3SZNA 1NROH 1T7CA 1BTYA 3Q00A 1FY8E 1NU9A 3TK9A 5GXPA 2A7HA 2Z94A 1XUKA 1GHYH 1CA0B 1BDAA 3RU4T 1AN1E 2GT7A 5CDFE 3F0OA 1A5GH 2IPHA 1GDQA 3E3TA 4MNXA 1SLWB 1F0UA 2AIPA 1W7GH 2ZF0H 3ZV8A 3JZ1B 4BAQB 1JXPA 2ZHEH 1GI0A 1GGDB 3TH2H 1C5VA 1ZHPA 1FIZA 1FZZA 1F0TA 1ZR0A 4K1EA 1QB6A 1O2LA 1HUTH 1D4PB 2OLGA 1TWXB 4AB8A 1ZPBA 3ATMA 4ABJA 3KQCA 1BB0B 3F9HA 4AYVB 5JB8S 1CHGA 1F5RA 4O97A 1UK4A 2O8MA 1EJNA 1XMNB 1EUFA 3MH7A 2EA3A 1SGFA 3LT3A 4CBNA 2FYQA 3E6PH 3TH4H 2OXSA 1GHBG 2F43B 2NU1E 2WPMS 4JK5A 4X2YA 4RT0A 1RRKA 2Y82A 3FP8E 9ESTA 5FAHA 3NWUA 4GHQA 1GVKB 1P8VC 2KR7A 1G9IE 4AGKA 5C1XA 1Y3XA 1O2JA 1YPHC 4FVDA 3MI4A 1GHVH 4B1TA 1HGTH 1D3PB 3O8BA 2UUFB 1T4VH 2W26A 2ILNA 1MQ6A 2FOBA 1TA2A 3SU6A 1W11U 2STBE 1JIRA 5C5NA 1XUGA 2ZU4A 1BTZA 2ZGHA 1J16A 1GVZA 2H2ZA 2GZ7A 1UVSH 1C2FA 5JBBS 1W13U 1J17T 1UTJA 3UPEA 1F7ZA 2VIWA 2B8OH 3ZVAA 3ZZDA 3TGKE 1MBMA 1T8OA 3T29A 2ZPRA 1AWFH 2OINA 3DD2H 4Y8YA 1A61H 2RA0A 1G2MA 1COWD 2BLQA 2QE7D 1IQFA 3DSOA 1KXBA 1TNLA 1O3DA 3FZDA 4K60A 1CT0E 2Y80A 3GCOA 2W7SA 1YPJH 1GMCG 1MTNB 1S81A 3RU4E 3S0NA 4XSKU 4CHAC 9LPRA 1O30A 3EA9A 1THPB 3OTJE 2CGAA 2FOFA 4SGBE 1THRH 1EX3A 3RXBA 1WXRA 1KXEA 5EQRA 1HPGA 4UFEH 2H9HA 2ZGBH 1FN6A 1MTWA 1GBIA 1Z71A 2NWNA 1S85A 1QTFA 1TPSA 2UWLA 3AW1A 4B74A 1GMHF 4ZH8A 2LP6A 2Z9JA 5EJLA 3RXCA 1Y3WA 2ANYA 1KXFA 3GY3A 4Q4LA 4QT8C 4NCYA 3BTWE 5DP8A 2W3IA 4A5TS 3O8DA 2G5VA 1FNIA 1H8DH 5B6LA 3D65E 3ZVDA 1TOMH 1CVWH 3VXEH 3WWFA 1VCPA 1F0RA 1SFQB 1GCDA 1QA7A 5CHBA 1ZTJA 3ZZ7A 1SB1H 1AY6H 2ZFTA 1WDIA 1C5ZB 1LPGB 2H5CA 1O3GA 2FESH 1S84A 2GCHG 2AH4X 4MLFB 1VKYA 1BMLA 1BTXA 2PKAB 4X1NU 1GJ7B 3A7ZA 3VG8A 1NRRH 3GCHB 1ZJDA 2RCEA 5DP3A 3WY8A 4XE4A 2BZAA 1IHTH 2HRVA 3A7YA 1FI8A 4U32A 3RXRA 1UMAH 4NIWA 5PTPA 3HK3B 2BDYA 3W1EA 1JWTA 1P09A 2Y81A 2QY0B 1XVOA 1EZSC 1PPHE 1VITH 1AKSB 2SGAA 2VIPA 3FN8A 2QF0A 1RTKA 3SJKA 5A0AE 1EAIA 4NZLA 1EQ9A 2SGPE 3Q3KA 1GVLA 1Z6EA 3A8CA 3LONA 4I7YH 5FX6A 1MTNC 1O2KA 3QN7A 1TE0A 4I8LA 1DY8A 2ZDNA 1O2ZA 1JRTA 1TPAE 3BTDE 1V2KT 3TU7H 1LQDB 3RMMH 2EI7A 3ODFA 4X1PU 1GBBA 2Y5GA 3RC4A 5L2YH 3V13A 3CS0A 2QYIA 3E91A 3OAAD 1SLUB 5A0CA 1KY9A 3RUOA 2JIZD 5JBCS 1OWEA 2IN2A 1C1MA 8GCHG 4B6FA 1CQQA 1E38B 3F2GA 2OC7A 1TX6A 4IC6A 1MU6B 3RXTA 4A7IB 1UVTH 4B73A 1SHHB 1C2KA 2A4RA 1IQGA 5HM9A 1GJ4H 3MU8A 1ABJH 3SU3A 1N8OC 2FP7B 1J14A 3QO6A 4FU7A 2GTBA 1VITF 2BX4A 1O37A 1AGJA 1O3PB 2B0FA 3A7VA 3QK1A 2GV6A 5AHGH 3M3VA 3SNDA 2M2AA 1YF4A 3KN2A 4BTUB 3OY5U 2BD7A 1C5WB 1GBLA 1V2MT 3BEUA 1SGPE 2BTCE 5EXLA 1BBRK 1TOCB 4JZEH 4BTTB 1CGHA 4DURA 4Y11E 3QX5H 2OP9A 1ID5H 1YGCH 1QRXA 2OK5A 3SNCA 1PYTC 1OXGA 2WPHS 2BQ6B 3MQKC 4UFFH 4MG3A 1C5LH 4D76A 3EA7A 3ZZ8A 3PLPA 3PTNA 3O8CA 1EJMA 2AGGX 2P95A 2TGDA 4MTBA 1CHOG 1ZTKA 2VIDA 3M7UA 3FP7E 3UWIA 1MKXK 1O3KA 1MH0A 1H9HE 1G3EA 1VGCC 4NSVA 4M9FA 2WV9A 3LJJA 2G8TA 4X8UH 1N1LA 4NFFA 3SU1A 2QF4A 3VEQB 2HLDD 2XOKD 5DP7A 5J4QA 1FJSA 2AEIH 1DXWA 4UONA 1GI2A 3TNSA 1YPEH 3ZVEA 4VGCC 1GL0E 2VWLA 4TY7A 4OS5A 1OYTH 3DUXH 2BD9A 1FV9A 4Z0KA 6CHAC 1QY6A 2Y5HA 2RDLA 5DJ7A 1YKTA 1LKBA 2O9QA 2A32A 3LGWA 2Q6DA 2R3UA 3T62A 2BMGB 2PUXB 2BLWA 3E90B 2ANKH 3UNSA 1MAYA 1V2UT 2WPJS 3U8OH 3UQVA 4AYYB 2Q6GA 1SMFE 2ZWLH 1ELEE 1C5TA 1HAHH 1ZRBA 3U98H 1AMHA 3I29A 5TCAA 4O9VA 1GBTA 3V12A 5EQSA 3ZZ9A 1CA0C 1DFPA 1HJAB 3KYFA 2YMSD 4FOUC 2QXIA 1KMHB 2JJ2D 1YLDA 3ZZ5A 1SSXA 2P3TB 1ZSKA 2O8UA 3VB5A 1LKAA 1NRSH 3PMJA 1BJUA 5ESTE 3A8AA 1D9IA 1UCYH 1X7AC 2R9PA 3KCGH 1O3OA 4KTCA 1NZQH 2VGCB 4D9QA 3T26A 1VGCB 3EAJA 1MD8A 3RU4D 1XUJA 5EPNA 1V2PT 3C27B 1AWHB 4LXBH 1L1JA 1FPHH 1YCPH 1GBKA 2H9TH 1PQ7A 1AFEH 2O8WA 2VVCA 4TWYA 1GCTB 4A1TA 3UIRA 2F9NA 3RXDA 1GBFA 1P10A 4WMFA 2PFEA 3OFND 4A1VA 3S9BA 4X1QU 3H09A 1WAYB 1SPJA 4HTCH 1ANDA 1CT2E 1O31A 4YLUA 4J2YB 1ZJKA 1O33A 5E2OA 4D7FA 3ZVGA 1YM0A 3W94A 3LDXH 4I31A 5FCKA 2KCAA 1T8LA 5F6MA 2L74A 4FUDA 4X6OA 1OHHD 2H9EH 1GWAA 5DN6D 4NIVA 2FOGA 3BIUH 1GJBB 1TX8A 2G51A 4AZ2B 2CJIA 2XTTB 1EZUC 3D62A 1HXEH 1BZXE 2QN5T 4MPXA 3N7DA 1FLEE 1G32B 1ELVA 1BTPA 1OYQA 3SU2A 3MU4A 1K1PA 5E0JA 1KIGH 1EB1H 2UUJB 3DFJA 2BB4A 2GZ8A 2PKSC 2A2QH 1DSUA 4NIYA 2ZU2A 5T1VA 6CHAB 1UVPA 2EI8A 2AHME 2V0BA 1FPCH 3MO3A 1OS8A 3A8BA 3RXPA 2NU3E 2F9BH 3UREA 4INKA 1Y8TA 1O2WA 2D1JA 4ACBA 4BAOB 1TGBA 1AO5A 1DWCH 1BQYA 4RT1A 2ZFFH 3TIUA 3TK6A 2VVUA 1ETSH 2J34A 1HJ9A 3TK5A 4ZKOU 2RDEA 4RI0A 5HMAA 1L1GA 4HZHA 2BD8A 1O2OA 5EIYA 1GI7B 1OWIA 3MFJA 1BIOA 1IHSH 1T31A 2OC1A 1H1BA 1ZRKA 1E34B 5KECA 1RD3B 3MNXA 4ABHA 2H5DA 2HNTC 3LC3A 2F83A 3T5FH 4YT7H 1DT2A 3KHVA 4O3UA 1CGJE 2A31A 3KIDU 5HM2A 3KQ5A 5F53A 3GOVB 1G30B 4YO9A 4IW4E 1SFIA 4Y0YE 1AFQB 1O38A 1BJVA 1BTWA 3EYDA 3M5MA 2JH0D 2J2UA 4Y10E 1BITA 2WUCA 4X2WA 1Z8GA 1DDJA 3ZZAA 4KGAA 2FX4A 2A45B 2VVVA 1VR1H 2Z7FE 3I77A 2ZCLP 3K65B 2CN0H 4SGAE 1AIXH 4UEHH 1SL3A 4DT7B 4YOIA 4O03A 2WYGA 1C2HA 4FUHA 1GBDA 4FU8A 4ACAA 2CV3A 4Y79A 2XC5A 4K3JA 2VIQA 1GBJA 1HIAA 1C2LA 1UW7A 4YT6H 5EW2H 3RXJA 1L4DA 1EPTA 1P2OA 2FI4E 1GBCA 1Z7KA 4CREA 3SV6A 5E8EH 7GCHF 1AKSA 1MCTA 2C3SA 2ZP0H 2VB0A 2F91A 3HKIB 4OGYA 5HXFA 2XBVA 2ZFSA 1V2ST 3L6PA 2BDAA 3A85A 2V3OH 3MH4A 2ZDVH 4X2VA 4JZ1A 2P8OC 1QBNA 2EC9H 1GI9B 2Y5FA 3SOSA 3SGQE 4UFGH 3SN8A 2VGCC 2XNDD 3QGNB 2P16A 2AERH 1ELTA 1NFXA 4AX9H 3MOCA 5EXMA 1JIMA 5FPYA 2XBWA 2Y6TA 5CE1A 1O2XA 2F9VA 1GCTC 2G52A 1D3TB 3PRDA 2BHGA 4Y7BA 2A4QA 4HI3A 1GJ6A 1NC6A 1C1SA 2SGQE 4CH8B 1CU1A 5L30H 5EJZA 4ISLA 4XBDA 2Z3DA 3MNBA 1SGDE 4XOJA 3A81A 2FTLE 3LJOA 1TRNA 3RDZA 3GICB 2ODPA 5AFZH 1TNKA 4H6SB 4WWYA 1TLDA 3TITA 1BA8B 1C2EA 1NBMD 3G01A 2AFQB 1BMNH 2BD5A 1SVPA 4LZ1H 3AAUA 1NM6A 1TAWA 2CHAB 3ZZBA 1AB9C 2JETC 3GY4A 2AMPA 1GJ9B 4R8TB 1GJ8B 2PGQB 1PQ5A 1IQEA 2VH0A 3QLPH 2EI6A 2SGDE 2P8OB 1BMFD 2G4TA 1KYNA 1MKWH 2FYRA 4BXSA 2VWNA 7KMEH 1O5BB 1Z8IB 1MQ5A 3SNAA 1Z1JA 8ESTE 5LPRA 2PW8H 3ESTA 3SJ9A 1GI3A 4K2YA 4DJZB 5GPIB 3DSPA 4B6EA 2OD3B 1L0ZA 1QCPA 3M5OA 1LPKB 2ZCHP 2P3FH 3GISB 1SQAA 2VU8E 3QTOH 5IDKA 4TT3D 1TQ7B 4NSYA 4CRAA 1BRAA 2ANMH 3MO6A 1RIWB 1H9IE 1SQTA 2ZECA 3S7HB 1GI8B 1W2KH 2P59A 1C1RA 4F4OC 3ZV9A 2K1QA 1C1TA 3BTKE 1O5DH 3UNRA 1YLCA 1NS3A 2P93A 4YZUA 2ZGJA 3TJUA 1HAOH 4K69A 5SGAE 1BBRE 2QAAA 2YNAA 3M37A 2OTVA 1O36A 1TA6A 1YPHE 1A5HA 3ITIA 3HATH 4BOHA 4GUXA 2XC0A 3S69A 1EFRD 1O2GH 1HRTH 5F8ZA 3OX7U 3A84A 3BSQA 2FX6A 1QZ8A 4AC9A 1TX7A 3UTUH 3BF6H 1H8IH 3TH3H 1VCWA 3EDXB 1EAWA 1GI6A 2AGEX 3QDZB 4AN7A 2ZCKP 1TGCA 1O3LA 3NZIA 2J92A 4MPVA 4NIXA 3KQEA 5A0BA 4FUFA 3ZIAD 1QQ4A 4FUCA 5EW1H 2NU2E 3SU4A 1FAKH 1K28D 1VJ9U 1LO6A 2P94A 3KF2A 3M5LA 1O5FH 1A2CH 2BD4A 3ATWA 3ODDA 4AB9A 3BTHE 1RTFB 3PMBB 3BTTE 1C5PA 4U30A 1AZ8A 1O2MA 3W95A 3TGJE 1ZSLA 3U9AH 1JMOH 2JJ1D 4Q7ZA 2AYWA 2GVFA 1S0QA 5C5OA 3TJNA 1ZGIA 1NY22 1AU8A 1WBGB 3FANA 3GY5A 2AMDA 3AVZA 4XRNA 3P95A 4IC5A 3DFLA 4JCNA 4WVPE 2J38A 4ASHA 2W5EA 1D6WA 1WOFA 1V2QT 1W7XH 1P2NA 1GDNA 4CR9A 3WWBA 1DITH 1Z8JB 1O2HA 1PPBH 2ALPA 4WF8A 4BAKB 1LDTT 3F9EA 1AZZA 2NU0E 3RXUA 3OTPA 3UB0A 4OS2A 4A92A 3U1JB 5A2MH 1TPPA 4Y6DA 1C5NH 3ZZCA 4BTIB 2VIOA 3FZZA 3FAOA 5AFYH 1A5IA 4B2AA 1QGFA 1XUFA 2KCPA 3MTYA 1TALA 4K5ZA 2IJOB 2BZ6H 1WQSA 1XUHA 1TIOA 3DA9B 3DCLA 1DX5M 2XCNA 3QGJA 4HGCA 5JPMH 1DUEA 1G3DA 2JH6D 2V6NA 1YY3A 1K0HA 1C2DA 5K7RA 1HLTH 1L2EA 2PKSB 3BG8A 4XBCA 1QRWA 3E8LA 1OP0A 1RTLA 1NPMA 3P6ZB 2HOBA 2ZTZA 1B0FA 3UWJH 5AF9H 2DE9A 1GMDF 5K0HA 2FS9A 4ZUHA 1AE8H 1F2SE 1UHBA 2FLBH 4NA8A 3GYMA 1MMJN 5J4SA 2H1UA 1ESAA 1MAXA 1O2RA 2Q6FA 1C2JA 1TB6H 2GD4B 1E0FD 3MYWA 1K1OA 4PROA 1ZTLA 5HIYA 4I8JA 2ZGXH 4OGXA 2C4FH 2C90B 4GCHF 4MPUA 1SGIB 3LGIA 2CK3D 5GJ4B 1NU7B 1RIWC 1LHEH 1UTNA 2QCYA 2FDAA 1ZMJA 2G55A 4NA9H 1F5KU 1A0LA 2TGTA 4TWWA 4ZAEA 1YP9A 1UTOA 1IQLA 2AMQA 2CXVA 4DG4A 2OC0A 3FOAA 3SJ8A 1UK2A 2B7DH 1F5LA 4BNRA 1LVBA 1SGCA 1O39A 4YOJA 4B76A 4R0IA 2KFWA 4ABIA 4CR5A 1LTOA 2YMSB 5JBAS 5TCCA 2ZDKA 4B2BA 1Z1IA 1EOLA 4YXWD 4AGJA 1A0HB 1CGIE 2Z6BD 3M3SA 3OE7D 1SGTA 1P11E 4OS7A 4UDWH 2C8YB 3FP6E 4Q80A 1AUTC 4CRGA 4DT4A 3E16B 1PPFE 2K8IA 3A82A 1SI5H 4NWKA 1C5XB 2BDHA 4P00A 2ZA5A 3TNTA 1SG8B 2TGAA 1W14U 3GY8A 3UOUA 3N7EA 5T3HA 1V3XA 2SNWA 1SLXB 3URDA 1NBME 4X8SH 2ZHFH 5FL7D 1O2NA 3A8DA 3LIWA 2P3UB 2FOMB 1D3DB 1N8OB 3A88A 3DT0H 3M5NA 2TGPZ 3QUMP 1LMWB 1QRZA 3RXMA 2GMTC 3MNSA 4IBLH 3SNBA 1EPTC 1HV7A 4U2WA 1BRBE 2ZU3A 3C1KA 1H8ED 3LGUA 2Z9GA 4KELA 3TJVA 3UQOA 1S83A 5DKMA 1UTLM 3M61U 2CF9H 2HPQH 1WV7H 1Q2WA 1V2OT 2PKAA 3BN9A 2YMSC 3PB1E 1DPOA 4CHAB 2XRCA 3PYHA 2PR3A 1G36A 1UTPA 2HVXA 1TRMA 4THNH 2CMYA 1FIWA 1B5GH 5EPYA 3H5CB 1DSTA 3GCTF 4X1SU 3KYGA 5FBEA 1C5OH 3SI4H 4UE7H 2V3MA 1GMDG 3TGIE 1Y3YA 5EOKA 1NN6A 2FS8A 4Y8XA 2XBYA 2PUQH 1O0DH 5DP6A 4A6LA 3LOXA 4ABDA 2QXGA 3PM3A 2ZTYA 1C1PA 2H6MA 3ELAH 5CHAB 4AG1A 2KCOA 5L6NH 2BOKA 7LPRA 1TFXA 2GX4A 2PSXA 1O3IA 3UOPA 2BVSH 1E1QD 4ISOA 1TYNA 4M7GA 2WSSD 3F9FA 3N7OA 1H4WA 1TQ0B 4IN1A 2JH5D 3RC6A 4DIIH 3B8JA 3AASA 1BUIA 4XDEA 3QZRA 3MU0A 1E1RD 6LPRA 1EPTB 2OBOA 1QURH 4NZQA 4WMEA 4ASUD 1Q3XA 3P8FA 1LVOA 3SHCH 5GNDA 3SHAH 3QZQA 2RG3A 1XKAC 1LHCH 3LU9B 4ABGA 3S9AA 4JZIA 1D3QB 3HK6B 2YOLA 3LH1A 1HBTH 1YWUA 2G81E 2PGBB 1QFKH 1C5UA 3RXIA 1ZZZA 3Q3XA 4B75A 1MZAA 1NO9H 5BRRE 2ZU5A 1CO7E 1W12U 1OWJA 1GJAB 2VINA 1UVOA 1ZHMA 2DUCA 4O3TA 1SR5C 2QF3A 3P92A 2ZHDA 3ZZ4A 1GBEA 5E2PA 3SJIA 2XCFA 4GSOA 1EZQA 2BLOA 3BTQE 4MVNA 6ESTA 1YCPK 1S6HA 1EB2A 2ASUB 1O3EA 2Y7ZA 1WQVH 2BX3A 3NK8A 3B23B 1FY3A 2J98A 1ZOMA 2G4UA 1GL1A 1QJ6B 3NKKA 5TJXA 5A09A 2HALA 5C1UA 1Y5BT 1C4U2 1E36B 2ZHQH 2HVYB 2ZFPH 1DLKB 3LGTA 3BIVH 1ESTA 3BG4C 3ZYDA 5C0TA 1HAVA 1P06A 1O34A 3VB7A 2Z9IA 2QF5A 2OUAA 2ZO3H 3B9FH 1YPMH 3GY7A 5EGMA 3K9XB 1DLEA 3LPRA 3KL6A 1O3BA 3E0NB 1GHXH 1O35A 3ATIA 1C4V2 1Q31A 5LGOA 1KDQA 2PV9B 1ABIH 1V2LT 4I33A 2GGVB 4OS1A 2BY7X 1SQRA 1C2MA 3STJA 1OX1A 4BAMB 1YBWA 4RKJB 2FIRH 1O5CB 2WINI 2FEQH 4WXVA 1QBOA 1TMBH 1LVMA 1K21H 1NRQH 1V2NT 2W3KA 1XUIA 1ESBA 3T27A 5I25A 5DK1A 1M9UA 2FOCA 2G5NA 1BRUP 1NT1A 4ZHMU 5HIZA 1OSSA 4BANB 2AS9A 1C5YB 2R2MB 4WY3A 1LHGH 4X8TH 1MUEB 1ORFA 4LZ4B 4E05H 1C5SA 4XD7D 1SLVB 2VWOA 5C3NA 2LPRA 1O2VA 2QC2A 1AUJA 3RXGA 3SGAE 4DCDA 2GP9B 1ETTH 4GAWA 1GJDB 2IOTA 2PWXA 3RMNH 4F55A 2FI5E 2GDDA 1BOQA 2VNTA 4ISIH 1GI4A 2ZIQH 3OEHD 3SV9A 1C2IA 2R3YA 1K22H 4ZROA 4U01A 1T4UH 4JYVH 1O2PA 3PROA 5F03A 1OWDA 4TSFD 3BTFE 4UFDH 5F8XA 5ABWA 5F8TA 1XX9A 5AVDA 2QA9E 1OKXA 2W7UA 1P9UA 3MHWU 4YESB 2HPPH 2FOEA 2F4LA 1ARCA 1PFXC 3P17H 1YLNA 2J95A 2SFAA 1K1LA 3JZ2B 1MKWK 2V7QD 1HAPH 2CHAC 1P2IA 5A8XA 4FU9A 2BY6X 3PO1C 1NRNH 4VGCB 3GY6A 1FXYA 3VGCC 1K2I1 3RXLA 1ELBA 5A8YA 1AVXA 3SGBE 2ZTXA 5FHTA 4RSPA 1L4ZA 3A87A 3P8GA 4ESTE 4HFPB 1T32A 1Z6JH 2HNTE 2TRMA 4Y7AA 1FONA 2F3CE 4UD9H 2FM2A 1K1MA 3UUZA 1DY9A 1Y5AT 1V2WT 1CA8B 2AIQA 2FLRH 4RN6A 1QL9A 2THFB 2WUBA 1A1RA 1TPOA 2D8WA 4X6MA 3ZZ6A 2A4OA 1SQOA 3M7TA 1J8AA 3A7TA 4I32A 1C5QA 3UR6A 4LK4A 4MPWA 3VFEA 1O2IA 3U8TH 3OSYA 1QJ1B 1SGNE 3A86A 4IS5A 1KTSB 1S6LA 1GPZA 1PQ8A 2FWWA 2GV7A 1E79D 1V2RT 1O3HA 1O2UA 1FY4A 1V2TT 3F9GA 7ESTE 2GDEH 1V2JT 1K9OE 1Y59T 3TJOA 5JBTA 1FQ3A 2DE8A 1C9PA 1Y3UA 1ELAA 1EOJA 3F2FA 5E0HA 4K8YA 1LCYA 1A3EH 4X0WU 3V0XA 1KLJH 1GG6C 2BDBA 1C9TA 3PMHB 3A7XA 4KP0A 1TBQH 5KEDA 3DHKH 2SGFE 3ENSB 2ZDAH 1QL8A 2F9PA 3GCTG 4FUJA 2A7JA 1AI8H 3M7QA 2FTMA 3AK5A 5GIBA 4FUBA 1NTPA 1S5SA 2PP6A 3A7WA 1ZHRA 3BTGE 1S0RA 1QJ7B 1FUJA 5DP4A 1BRCE 5EQQA 4FUEA 1TMTH 8KME2 2ZKSA 1SGEE 1YYY1 1LPZB 4JYTA 4D9RA 1BHXB 4E7RG 1GDUA 1A4WH 3U1IB 4DIHH 5EJ1A 1QHRB 2J97A 1FMGA 3PWCA 2A4GA 3KQDA 1A3BH 1INCA 1OP2A 1O3NA 3Q3YA 2UWOA 4TPYA 3SV8A 2GCTB 3PV2A 1SOTA 5EODA 2RA3A 2BVXH 1TNIA 3SUFA 4DW2U 3PMAB 4TY6A 1QIXB 3R0FA 4H4FA 2VIVA 1P57B 2YNBA 3E1XB 3SORA 4ZXYH 1O5AB 3QTVH 2Z9LA 1ZGVA 3RXVA 1NFUA 4MQAA 4Q7YA 1DOJA 1ETRH 2UUYA 2HNTF 2ZGCA 1TABE 1WCZA 1P02A 2J94A 4MNVA 3SU5A 2FOAA 3FKSD 3SUDA 4WH6A 4Y8ZA 3IITA 2JKHA 2OBQA 4IGDA 1OP8A 1BMAA 1RXPA 4NG9H 1C5MD 4AFUA 1ZMLA 2ZDMA 2R0LA 2ESTE 1TBZH 1V2VT 3LGVA 3IWMA 1B0EA 1PYTD 4CH2B 3D49H 4AG2A 1EKBB 1JRSA 2KM0A 1P3CA 3RXAA 2HWLB 2R0KA 1GI1A 1KXAA 3FO8D 4OM9A 3KQBA 1MKXH 1PPZA 8GCHF 3HGNA 2BQ7B 2BY9X 1JOUB 1IQJA 3RC5A 1QL7A 1B7XB 2ZI2H 3F1SB 3GDVA 4ABFA 4Y71A 1DANH 2ULLA 1RGQA 2FXRA 2BDGA 3TVJB 1XKBC 7GCHG 3S9CA 1FDPA 1CHOF 3MO9A 3VXFH 3RXHA 1YC0A 3AAVA 4J1YA 2TPIZ 1PPEE 1CE5A 1ZMNA 1BCUH 4ZKRU 4ABAA 2XC4A 2PTNA 1E37B 2GCTC 2BOHB 1P01A 2BY8X 2GZ9A 2ZDLA 2ZQ1A 5CHAC 1BBRH 4XFQA 1LQEA 2BDIA 5C0UA 4B2CA 3UR9A 2W6JD
chains in the Genus database with same CATH topology
4K8BA 2V3HH 1EAXA 1QA0A 1O2YA 3FVFB 3VGCB 4X6PA 3FFGA 4H42U 2ODYB 1DICA 1O32A 2HGTH 5DPAA 2ODQA 1TRYA 2FOHA 3SUEA 1KDQB 3HGPA 2ZG0H 3K2UA 2ZC9H 4YOGA 2WPKS 4CRFA 1HFDA 3KNXA 1Y5UT 3SV2H 5FPSA 3A83A 2SNVA 2XW9A 5ETXA 1IQHA 3RXQA 1GHWH 3ATKA 4DVAU 5JB9S 4FUIA 1XVMA 1N6YA 1HAVB 3EA8A 3OU0A 1F92A 1FN8A 1QB1A 2G00A 2XNIA 3F68H 3HPTB 3OYPA 3R3GB 3RXKA 4JZDH 2GKVE 2OQ5A 1YPKH 2A5KA 2WYJA 2EEKA 1UTQA 1VJAU 1WUNH 1WTHD 1SBWA 1D6RA 3VPKA 3GCHC 3RP2A 4MDSA 1WTGH 1UO6A 1HJAC 3BG4B 4JMYA 3U8RH 2QXJA 3UY9A 4TYDA 1KSNA 4X6NA 4D7GA 1PPCE 1P0SH 4WMDA 4Q7XA 2V35A 5GCHG 3ATLA 2WV4A 2R2WU 1P2JA 2D2DA 1MD7A 3SW2B 5HGGA 1FY1A 2PLXA 1BTUA 3ZVBA 3A89A 1G3BA 5GWZA 2FO9A 3K6ZA 1U6QA 5CMXH 1UCYE 1CBWC 4X8VH 1UTKA 2BYAX 1HDTH 2I6SA 3Q77A 1TNJA 4Y76A 3SI3H 1UVUH 1ZLRA 3EGKH 4ISNA 1G37A 1LHFH 4Z6AH 2Z9KA 4NFEA 4ZXXH 1C1OA 2QGRA 4JK6A 1W8BH 3SQHE 4BAHB 2ZPSA 5C1YA 1AVGH 1J15A 3RMLH 1MBQA 3Q76A 2ZU1A 1AVWA 1WU1A 5EU8A 2I6QA 1VCQA 3RLYH 1PJPA 3PWBA 3AW0A 1KTTB 1V6DA 2BY5X 1KLIH 1EJAA 2B9LA 2Y7XA 4CRBA 1TNGA 2WPLS 2XYAA 4KKDA 1GHAF 3QWCH 1SGRE 1ELCA 3ZYEA 8LPRA 1BMMH 3RXFA 2NU4E 2BXTH 4X1RU 4ISHH 6GCHG 3SNEA 3V7TA 3A80A 1NRPH 3BEIB 5GCHF 4Y0ZE 3I78A 1DM4B 3PO1B 2Z3CA 3STIA 3T28A 1QB9A 4IMZA 4F49A 2ZQ2A 3RXEA 1GBMA 2B5TB 2F9OA 2D26C 1ZPCA 1TGNA 1P04A 1WYKA 5ESBA 3SQEE 4YTAA 2M5TA 1G2LA 1O2TA 1TGTA 2A0QB 4ZKNU 1P9SA 2VH6A 1MTUA 1HAIH 5FX5A 1DS2E 1FY5A 4XBBA 1HCGA 1P2QA 1KXCA 1GI5A 1EZXC 2C93B 2XWAA 1QNJA 3UNQA 5DO4H 3NUMA 3BTEE 1MCVA 4AFSA 4I8HA 1UCYK 3MU1A 2A1DB 3H7TA 3GY2A 3PTBA 1DXPA 3MH5A 1IQIA 1NESE 2QIQA 5T6GA 1TONA 3MH6A 3MU5A 3VB3A 1IQMA 5FXLA 3ZVFA 1P2MA 1EP5A 3SU0A 4AORA 1GBHA 1Z8RA 2GMTB 1K1NA 2UUKB 1ANCA 3KGPA 5EXNA 1GHBF 1S82A 4AOQA 1GG6B 1W0ZU 5T6FA 1P12E 1IOEA 3RM0H 4NWLA 5A8ZA 1OOKB 3RMOH 1W3CA 4H6TA 3E0PB 1YCPM 1P03A 5H4IB 1BHXF 6GCHF 1IAUA 5DP9A 1BT7A 2FZZA 3ZVCA 1RFNA 1OWHA 3H7OA 1TMUH 1AHTH 1GMCF 5LPEA 1A0JA 1C1VH 1LHDH 2PTCE 3PLBA 4MNWA 1OPHB 3D23A 2FI3E 4GPGA 1SC8U 3GYLB 1VITG 5GDSH 1O3MA 2BM2A 4OS6A 2A7CA 2QV1A 3CP7A 2BXUH 2PHBA 3SV7A 1ZYOA 3SJOA 1ELDE 2WV5A 1ANBA 2ANWA 1SHYA 2O8TA 2BLVA 3ZZ3A 1CBWB 2XWBI 1AQ7A 1C5RA 4K1SA 1EP6A 1NFYA 1HAXB 1AE5A 4GLYA 2ZEBA 1N6XA 2Z3EA 4JZFH 4WH8A 4GCHG 3T25A 3K6YA 2C8XB 2AGIX 1RS0A 4OS4A 3LGYA 4GHTA 4FVBA 1UJ1A 3RXOA 1K1IA 4I8GA 2HLCA 3MWIU 4NA7A 1C1QA 1BTHH 1A46H 3NPSA 4AFZA 1DWDH 1GHZA 2ALVA 2SGEE 4WJG2 1UHBB 2A2XH 1ELFA 4A1XA 1O5EH 1S6FA 3PLKA 1J9CH 3RLWH 1MTVA 3T2NA 1YPLH 1EXFA 1CSOE 1HIAB 1O2SA 1HNEE 4RKOB 4FXGH 1FAXA 4ZHLU 2OQUA 1MZDA 3MMGA 3BEFB 2KAIA 1HJ8A 1TBRH 1ZPZA 1IQNA 1T8NA 3EQ0H 4E06H 1JBUH 1MTSA 5FCRA 1SGYE 4ZHAA 5DG6A 3P70B 3OY6U 3SO3A 1GHAG 1XXDA 3GDSA 3GDUA 1G3CA 1GJCB 3M36A 3TLOA 4TPIZ 1H9LB 1ZSJA 3SUGA 1T8MA 1GJ5H 1P3EA 1AD8H 1DVAH 3M3TA 5HYOA 1GBAA 3VB4A 1DWBH 3NCLA 1O3AA 1NFWA 1HB0B 1Y3VA 1E35B 2GT8A 1A7SA 2BDCA 4D8NA 2F9UA 2XBXA 1XXFA 1SGFG 3LH3A 1P2KA 3U69H 2VJ1A 2ZHWH 4GVUA 3EE0B 1QQUA 1C1WH 4K1TA 1HXFH 3URCA 3VB6A 1CT4E 3BTME 5JYIA 1HAGE 3IG6B 1HAYB 4LOYH 1QR3E 3BV9B 4ABBA 3NXPA 1TNHA 2J9NA 4ABEA 3L3TA 1HAZB 5T6DA 2C8ZB 2ZPQA 1ELGA 1P05A 5LPFA 1XM1A 4KTSA 2C8WB 4JYUH 3F6UH 2UWPA 3UFAA 1TGSZ 3LC5A 3O8RA 1C1NA 3SBKA 1DWEH 1KLTA 4AFQA 3S7KB 3TPIZ 5I46H 1OWKA 1C2GA 5LH8A 5DP5A 1O5GH 2CF8H 4CRCA 2GCHF 1EAUA 4FUGA 5C2ZA 4DGJA 5G4BA 2XXLA 1C4Y2 1EASA 3GCNA 4WXIA 1THSH 1W0YH 2BD3A 1SOZA 1RJXB 4E7NA 5C20A 2ZNKH 2BD2A 2OCVB 2A5IA 5E0GA 3M35A 4BXWA 2OC8A 1GGDC 2BVRH 3V3MA 3RM2H 2VWMA 2FODA 4IMQA 1O3FA 1SGQE 1PPGE 2J4IA 5EG4A 1GMHG 3P8OA 4INLA 4B71A 1F0SA 4INHA 2QXHA 2FMJA 1L1NA 1O3JA 3KEEA 1UK3A 1EATA 1KXDA 3LKWA 4YLQH 5FBIA 3P8NA 5BPEA 4MNYA 1VZQH 5C67A 1QBVH 3CS7A 1C1UH 1AFQC 2LNCA 3MNCA 3HKJB 2ZFQH 4IN2A 5IYTA 2BQWB 1PQAA 1W10U 4I8KA 2TIOA 4YM9A 4DY7B 4CRDA 2TBSA 4DOQA 5L2ZH 5FPTA 3PV4A 1YPGH 2PSYA 4CBOA 4ZMAH 1IQKA 1AB9B 2JETB 2WPIS 1HYLA 1K1JA 2KAIB 4X2XA 2A5AA 2FPZA 2O8LA 4ZKSU 1WSSH 1DUAA 5JDUB 1ACBE 1UTMA 3CENA 1ARBA 4NGAH 1DE7H 4Q2KA 5DGJA 3RXSA 2Q1JA 5B6OA 3L33A 1ANEA 4KTUA 2STAE 2ZZUH 1LVYA 1MU8B 1O2QA 2ZFRH 1O3CA 3SZNA 1NROH 1T7CA 1BTYA 3Q00A 1FY8E 1NU9A 3TK9A 5GXPA 2A7HA 2Z94A 1XUKA 1GHYH 1CA0B 1BDAA 3RU4T 1AN1E 2GT7A 1A5GH 2IPHA 1GDQA 3E3TA 4MNXA 1SLWB 1F0UA 2AIPA 1W7GH 2ZF0H 3ZV8A 3JZ1B 4BAQB 1JXPA 2ZHEH 1GI0A 1GGDB 3TH2H 1C5VA 1ZHPA 1FIZA 1FZZA 1F0TA 1ZR0A 4K1EA 1QB6A 1O2LA 1HUTH 1D4PB 2OLGA 1TWXB 4AB8A 1ZPBA 3ATMA 4ABJA 3KQCA 1BB0B 3F9HA 4AYVB 5JB8S 1CHGA 1F5RA 4O97A 1UK4A 2O8MA 1EJNA 1XMNB 1EUFA 3MH7A 2EA3A 1SGFA 3LT3A 4CBNA 2FYQA 3E6PH 3TH4H 2OXSA 1GHBG 2NU1E 2WPMS 4JK5A 4X2YA 1RRKA 2Y82A 3FP8E 9ESTA 5FAHA 3NWUA 4GHQA 1GVKB 1P8VC 1G9IE 4AGKA 5C1XA 1Y3XA 1O2JA 1YPHC 4FVDA 3MI4A 1GHVH 4B1TA 1HGTH 1D3PB 3O8BA 2UUFB 1T4VH 2W26A 2ILNA 1MQ6A 2FOBA 1TA2A 3SU6A 1W11U 2STBE 1JIRA 5C5NA 1XUGA 2ZU4A 1BTZA 2ZGHA 1J16A 1GVZA 2H2ZA 2GZ7A 1UVSH 1C2FA 5JBBS 1W13U 1J17T 1UTJA 3UPEA 1F7ZA 2VIWA 2B8OH 3ZVAA 3ZZDA 3TGKE 1MBMA 1T8OA 3T29A 2ZPRA 1AWFH 2OINA 3DD2H 4Y8YA 1A61H 2RA0A 1G2MA 2BLQA 1IQFA 1KXBA 1TNLA 1O3DA 3FZDA 4K60A 1CT0E 2Y80A 3GCOA 2W7SA 1YPJH 1GMCG 1MTNB 1S81A 3RU4E 3S0NA 4XSKU 4CHAC 9LPRA 1O30A 3EA9A 1THPB 3OTJE 2CGAA 2FOFA 4SGBE 1THRH 1EX3A 3RXBA 1KXEA 5EQRA 1HPGA 4UFEH 2H9HA 2ZGBH 1FN6A 1MTWA 1GBIA 1Z71A 2NWNA 1S85A 1QTFA 1TPSA 2UWLA 3AW1A 4B74A 1GMHF 4ZH8A 2Z9JA 3RXCA 1Y3WA 2ANYA 1KXFA 3GY3A 4QT8C 4NCYA 3BTWE 5DP8A 2W3IA 4A5TS 3O8DA 2G5VA 1FNIA 1H8DH 3D65E 3ZVDA 1TOMH 1CVWH 3VXEH 1VCPA 1F0RA 1SFQB 1GCDA 1QA7A 1ZTJA 3ZZ7A 1SB1H 1AY6H 2ZFTA 1C5ZB 1LPGB 2H5CA 1O3GA 2FESH 1S84A 2GCHG 2AH4X 4MLFB 1BMLA 1BTXA 2PKAB 4X1NU 1GJ7B 3A7ZA 1NRRH 3GCHB 1ZJDA 2RCEA 5DP3A 3WY8A 4XE4A 2BZAA 1IHTH 2HRVA 3A7YA 1FI8A 4U32A 3RXRA 1UMAH 4NIWA 5PTPA 3HK3B 2BDYA 1JWTA 1P09A 2Y81A 2QY0B 1XVOA 1EZSC 1PPHE 1VITH 1AKSB 2SGAA 2VIPA 2QF0A 1RTKA 3SJKA 5A0AE 1EAIA 4NZLA 1EQ9A 2SGPE 3Q3KA 1GVLA 1Z6EA 3A8CA 3LONA 4I7YH 5FX6A 1MTNC 1O2KA 3QN7A 1TE0A 4I8LA 1DY8A 2ZDNA 1O2ZA 1JRTA 1TPAE 3BTDE 1V2KT 3TU7H 1LQDB 3RMMH 2EI7A 3ODFA 4X1PU 1GBBA 2Y5GA 3RC4A 5L2YH 3V13A 3CS0A 2QYIA 3E91A 1SLUB 5A0CA 1KY9A 3RUOA 5JBCS 1OWEA 2IN2A 1C1MA 8GCHG 1CQQA 1E38B 2OC7A 1TX6A 4IC6A 1MU6B 3RXTA 4A7IB 1UVTH 4B73A 1SHHB 1C2KA 2A4RA 1IQGA 5HM9A 1GJ4H 3MU8A 1ABJH 3SU3A 1N8OC 2FP7B 1J14A 3QO6A 4FU7A 1VITF 2BX4A 2GTBA 1O37A 1AGJA 1O3PB 2B0FA 3A7VA 3QK1A 2GV6A 5AHGH 3M3VA 3SNDA 1YF4A 3KN2A 4BTUB 3OY5U 2BD7A 1C5WB 1GBLA 1V2MT 3BEUA 1SGPE 2BTCE 5EXLA 1BBRK 1TOCB 4JZEH 4BTTB 1CGHA 4DURA 4Y11E 3QX5H 2OP9A 1ID5H 1YGCH 1QRXA 3SNCA 1PYTC 1OXGA 2WPHS 2BQ6B 4UFFH 4MG3A 1C5LH 4D76A 3EA7A 3ZZ8A 3PLPA 3PTNA 3O8CA 1EJMA 2AGGX 2P95A 2TGDA 4MTBA 1CHOG 1ZTKA 2VIDA 3M7UA 3FP7E 3UWIA 1MKXK 1O3KA 1MH0A 1H9HE 1G3EA 1VGCC 4NSVA 3LJJA 2G8TA 4X8UH 1N1LA 4NFFA 3SU1A 3VEQB 5DP7A 5J4QA 1FJSA 2AEIH 1DXWA 4UONA 1GI2A 3TNSA 1YPEH 3ZVEA 4VGCC 1GL0E 2VWLA 4TY7A 4OS5A 1OYTH 3DUXH 2BD9A 1FV9A 4Z0KA 6CHAC 1QY6A 2Y5HA 2RDLA 5DJ7A 1YKTA 1LKBA 2O9QA 2A32A 3LGWA 2Q6DA 2R3UA 3T62A 2BMGB 2PUXB 2BLWA 3E90B 2ANKH 3UNSA 1MAYA 1V2UT 2WPJS 3U8OH 3UQVA 4AYYB 2Q6GA 1SMFE 2ZWLH 1ELEE 1C5TA 1HAHH 1ZRBA 3U98H 1AMHA 3I29A 5TCAA 4O9VA 1GBTA 3V12A 5EQSA 3ZZ9A 1CA0C 1DFPA 1HJAB 2QXIA 1YLDA 3ZZ5A 1SSXA 2P3TB 1ZSKA 2O8UA 3VB5A 1LKAA 1NRSH 3PMJA 1BJUA 5ESTE 3A8AA 1D9IA 1UCYH 1X7AC 2R9PA 3KCGH 1O3OA 4KTCA 1NZQH 2VGCB 4D9QA 3T26A 1VGCB 3EAJA 1MD8A 3RU4D 1XUJA 5EPNA 1V2PT 3C27B 1AWHB 4LXBH 1L1JA 1FPHH 1YCPH 1GBKA 2H9TH 1PQ7A 1AFEH 2O8WA 2VVCA 4TWYA 1GCTB 4A1TA 3UIRA 2F9NA 3RXDA 1GBFA 1P10A 4WMFA 2PFEA 4A1VA 3S9BA 4X1QU 1WAYB 1SPJA 4HTCH 1ANDA 1CT2E 1O31A 4YLUA 4J2YB 1ZJKA 1O33A 5E2OA 4D7FA 3ZVGA 1YM0A 3W94A 3LDXH 4I31A 5FCKA 1T8LA 5F6MA 4FUDA 4X6OA 2H9EH 1GWAA 4NIVA 2FOGA 3BIUH 1GJBB 1TX8A 2G51A 4AZ2B 2CJIA 2XTTB 1EZUC 3D62A 1HXEH 1BZXE 2QN5T 4MPXA 1FLEE 1G32B 1ELVA 1BTPA 1OYQA 3SU2A 3MU4A 1K1PA 5E0JA 1KIGH 1EB1H 2UUJB 3DFJA 2BB4A 2GZ8A 2PKSC 2A2QH 1DSUA 4NIYA 2ZU2A 6CHAB 1UVPA 2EI8A 2V0BA 1FPCH 3MO3A 1OS8A 3A8BA 3RXPA 2NU3E 2F9BH 3UREA