1XUIA

Trypsin-keto-babim, zn+2-free, ph 8.2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuiA02
1CQQA 1ESTA 1Y5AT 2BD8A 1O2IA 2GD4B 3FANA 3BTDE 1EJAA 4OS2A 1MTNB 4MLFB 4B1TA 3SJIA 1GDNA 4CRCA 3HATH 3LGIA 1HJAC 1BMAA 1SGEE 2FTLE 2QV1A 1O5GH 4ZUHA 1KYNA 2C93B 1F0RA 1BUIA 1XVMA 2TRMA 2ZDMA 4LOYH 2BTCE 1SQTA 1UCYH 1CU1A 2Q1JA 3RC4A 2V3OH 3RXLA 3AW1A 4BAMB 1SC8U 1TOMH 1UCYE 2ZEBA 1GI7B 2QF3A 1AVGH 1NU7B 3UY9A 1TALA 1J16A 1ZRBA 6LPRA 1AUTC 2FOGA 2ZDKA 3RP2A 3DUXH 1SR5C 5DGJA 5EU8A 4HFPB 2VVVA 3D23A 2PR3A 3RXOA 4IC6A 2TIOA 3ZZ7A 2BDBA 4ABAA 2R3YA 4ABEA 1Y3UA 5A8ZA 2EI7A 3MHWU 4FVDA 4WMDA 1HIAB 1Y3YA 3LGTA 4UEHH 5EW2H 1J17T 4DCDA 3BEFB 2QAAA 4B76A 3U69H 5A0AE 1DY9A 1QRXA 4B2CA 3V13A 5FCKA 3JZ2B 3MI4A 2TGDA 2Y7XA 4K3JA 5G4BA 1THPB 1A61H 1TNJA 1EB1H 1TGSZ 4NA9H 2AFQB 4Z6AH 4O97A 1UK3A 1N1LA 2BDAA 1KXBA 2OQ5A 1GI6A 1LHFH 2QF0A 1K2I1 2ZF0H 1TYNA 1XUJA 4BTUB 4ABJA 4I31A 1Z6EA 1LVMA 2JETC 1C2HA 1S0QA 2UWPA 3GY4A 1HPGA 1MTWA 2A45B 4Y10E 5E2OA 3O8BA 1GBDA 3LONA 4CR9A 1NRNH 1QJ6B 1U6QA 5C67A 1T8NA 1GHAG 4XE4A 1XMNB 2J92A 1TPSA 5C2ZA 1BTZA 1GJ7B 2F9BH 4E7NA 1TNKA 1EJNA 2F91A 1QBNA 2GDDA 1MAYA 4RKOB 3WY8A 2BLWA 2W5EA 2A2QH 5EG4A 5GXPA 1FY3A 4BNRA 3TGJE 5C1XA 3SV6A 2BLOA 2GKVE 5GWZA 1ANDA 1TB6H 3STJA 4TYDA 2PKSC 1O30A 2XBVA 2C3SA 3A85A 4NCYA 3PWCA 1NFWA 3RXVA 2Z3DA 3RC5A 1YPLH 4TPYA 3SNBA 4Y71A 1RRKA 3QGNB 2R0KA 1BMLA 2PGBB 2BVXH 2V3HH 1SMFE 3RXPA 3GY3A 1ZPBA 3RXUA 1ELDE 3BG4B 3OU0A 1J8AA 5DO4H 2G4TA 2UUYA 1VGCC 4Y8YA 2EEKA 2BX3A 2WYGA 3UFAA 1HFDA 1HAOH 2RA3A 1NZQH 4JZFH 3RMNH 3T62A 1TNHA 5A0BA 4JCNA 3RUOA 3ZZDA 2ZCKP 4ISHH 3MYWA 1EUFA 1H9IE 1L2EA 1O36A 2Y7ZA 2ZECA 1IHSH 1AGJA 2NWNA 3VEQB 2THFB 1ID5H 1BZXE 1M9UA 1ZSJA 1SQAA 2BDIA 1LHEH 1WTHD 1GBHA 1UVUH 1YYY1 1PQ5A 1GHBG 1V2RT 3QWCH 1RTFB 2AMDA 1MU8B 2CHAB 2IJOB 8LPRA 1QJ1B 3LJOA 3LGVA 1HAGE 2GT8A 4WH6A 4ABHA 2ANMH 5DP9A 1O2UA 2QN5T 2QCYA 2ZGJA 1DUAA 2EI8A 2P3TB 1C5PA 3LGWA 1C5ZB 4Q80A 1TPAE 4XBBA 3TVJB 4X8VH 1KTTB 4CRDA 1RS0A 1DUEA 1ETSH 2FOMB 3AAVA 4FXGH 4INKA 1O3DA 3MNBA 3EA9A 2SNVA 1DLKB 4AG2A 1G3DA 3VGCC 1B5GH 1FPHH 2ZNKH 2H9EH 5F6MA 1EAWA 1F0UA 1YF4A 8ESTE 5L6NH 1A7SA 1GBBA 1BBRH 1AFQC 1AVWA 1K1PA 4X2YA 1ZJDA 4Q2KA 2VGCC 1BBRE 1EAIA 1DE7H 2ZCHP 4CHAB 2PLXA 2FOCA 3MH5A 4I8GA 3MU4A 5JB9S 3SGAE 4OS5A 4GCHG 2JH0D 1MTSA 1FY8E 2ZFPH 1UTKA 2BQ7B 1IQKA 4XSKU 1EOJA 1VJ9U 2GCHF 3SGQE 1SGFA 4M7GA 3U8OH 5ESTE 3HPTB 1UTLM 4X6MA 2P16A 1ANEA 3RXTA 2IN2A 4IN1A 1YPHE 1WCZA 4B75A 1O2OA 3FZDA 3Q76A 4NA7A 4X0WU 5CHAC 1P02A 2G00A 1DWCH 2W26A 1YCPK 1C2KA 1V2VT 4K8BA 1MQ6A 2BD4A 3SHCH 1C1SA 4WF8A 3ODDA 2NU4E 4IMZA 1P2OA 4MTBA 1UTQA 1HXEH 5EXMA 3U1JB 2YNAA 4LZ1H 3SUDA 1ELTA 2Z3EA 1BBRK 1MCVA 3IG6B 1CE5A 1T31A 3MH4A 3S69A 1F92A 3EE0B 1FY4A 1SLXB 1Z71A 4MPXA 2Z94A 4X1RU 1NN6A 3A7XA 1JMOH 1VCWA 1GI0A 1A5IA 2RG3A 4NSVA 2OC0A 1MH0A 1MCTA 1Q31A 4DGJA 3MH7A 4FU7A 1KDQB 3LH1A 1VCPA 1C4V2 2QXJA 2BVRH 1D4PB 1GCTC 1D3PB 1IQLA 1NS3A 3PTNA 3GYMA 1O3PB 2F9OA 1BITA 1HV7A 3O8RA 1K9OE 5LPRA 2Z9JA 1V2TT 1V3XA 4TY7A 1VITF 3PV4A 2C4FH 3U98H 1GJ5H 1DS2E 3M5OA 1BB0B 1EZSC 1K1NA 4BAOB 7ESTE 3A82A 1HAXB 3ZZAA 4INHA 2A5KA 1SGNE 1ABJH 3TJNA 1DM4B 1YGCH 1P01A 1TPOA 2ZHQH 1P3EA 4NIXA 4A92A 4MNYA 1O33A 4R0IA 1K1IA 1LVBA 3W95A 1OWIA 1SB1H 2WV5A 1C1MA 2B5TB 2TGAA 1O3LA 3TNSA 3NKKA 3EAJA 3UR9A 2ZQ2A 4YLUA 3MFJA 3MU0A 2ZIQH 2FM2A 1XUKA 4Y7AA 3BIUH 4CRGA 1MD8A 3PB1E 1ZSKA 3RXQA 2BDGA 4X8SH 1O2XA 4NZQA 1ESBA 1YLCA 4I8KA 2FIRH 3ESTA 1FQ3A 1AKSB 1GJBB 1C1TA 4SGAE 1TNIA 9LPRA 1L4ZA 4JYVH 2Z6BD 2ZGXH 2NU1E 4K69A 1GBTA 1KXCA 4GLYA 3GY5A 2VVCA 1LVYA 2J34A 3MO6A 3GY6A 3QDZB 5DP4A 4JYTA 1Y3VA 4KP0A 3SU1A 2CMYA 2JH5D 4Y7BA 1AB9B 4GAWA 3F9FA 3RXJA 4A1TA 3HGPA 3MU5A 3P70B 1OP0A 1VZQH 1A5HA 2BQ6B 2WV4A 5AF9H 1C5VA 1CBWC 4B2AA 3A83A 1OWDA 4TWYA 1DSTA 1PPEE 5JYIA 2SNWA 1S5SA 1CGHA 3SORA 5LGOA 5A2MH 3U8RH 3ZVCA 1LPGB 1GBJA 2O8LA 2V0BA 3M35A 4AYVB 3QZQA 1P06A 3RMLH 3B8JA 1ZMJA 2GDEH 3GOVB 4RN6A 5AFZH 3GY8A 3GY7A 1E34B 1Y3XA 4OS1A 1CGJE 1DXWA 1BHXB 1RIWC 2TGPZ 1AMHA 1QB9A 1AE5A 1KTSB 5E0HA 1ELFA 2ULLA 1SHYA 4MPWA 1S83A 2AERH 2ASUB 1DOJA 3A7TA 3A88A 1C2EA 3LIWA 4JYUH 1LDTT 3TK6A 2BDYA 1DDJA 3FAOA 2XWBI 1ZRKA 2FS9A 4KELA 2FDAA 4NGAH 1PPGE 2B7DH 2PSYA 4ZHLU 1HAHH 1EAXA 5EQRA 4WMFA 4ZH8A 3GY2A 4WWYA 4KGAA 2XNIA 2AGEX 1YPGH 3PMAB 2AH4X 1RD3B 1MKWH 4ISNA 1QQ4A 2OLGA 4F49A 1SG8B 1TAWA 1A3EH 3NPSA 3F6UH 1ZHPA 1UJ1A 1DANH 1FY5A 4WY3A 4Y11E 2IOTA 1YPEH 2GCTC 4Y8ZA 4YO9A 5FPYA 2H2ZA 3MU1A 5TCCA 4AN7A 4A1VA 4CBNA 1ZSLA 4DIHH 4GHTA 4DT7B 1A0HB 1KDQA 4ABFA 1J14A 1V2UT 2R3UA 3TGKE 1O2TA 2ZCLP 5C3NA 3T27A 1AD8H 3RXBA 1CHGA 2VNTA 1VITG 2BMGB 2ANYA 2OP9A 1ARBA 1WQSA 1O34A 1MQ5A 1S82A 4KKDA 3S9BA 2H9HA 2BD2A 4X8TH 1Q3XA 1ANCA 1OXGA 1SLUB 4FUFA 1K22H 3B9FH 4OGXA 3T2NA 4GPGA 3P8NA 2FLRH 1GHAF 8GCHG 3A87A 5JBTA 1T8LA 2OCVB 4IN2A 2ZO3H 1DWBH 4VGCB 2HALA 1PQ8A 3SJ8A 1JIMA 1O2HA 1Y59T 1WYKA 1GI1A 4KTUA 2QA9E 1HLTH 4F4OC 1TMUH 3Q3XA 4I8HA 2ZDLA 1E35B 3LOXA 1GJ6A 1YP9A 5A09A 3IWMA 3VPKA 1ELEE 3TGIE 1ZTKA 1SGRE 1NRQH 3E6PH 1HXFH 1HB0B 3U1IB 3BV9B 5JB8S 3OSYA 1THSH 5HYOA 1O2KA 2A7HA 1HBTH 1AKSA 1EZUC 3ODFA 4ZXXH 2FI5E 3TJOA 1NM6A 2XBXA 2ZP0H 3M7TA 1THRH 1IAUA 1CA0C 1XKAC 3ZYDA 2A4GA 2VU8E 1O5BB 5BPEA 3ATLA 1V2JT 3EA7A 4U01A 3ZV8A 2BB4A 1P03A 3LU9B 3ZVAA 1BTUA 2HGTH 1AFEH 3STIA 1ZJKA 1O3JA 1A0JA 1ZHRA 5DKMA 5T6FA 1TGBA 3M61U 4YTAA 1K28D 1FONA 1O3GA 3BTHE 4RSPA 1IOEA 3AAUA 1ARCA 1VR1H 3MMGA 3UR6A 4DOQA 3I77A 1HCGA 1W0YH 2XXLA 1D3QB 1CHOG 3E16B 1TGTA 4YT6H 4ZKSU 2ZTZA 4ZHAA 3O8DA 4CREA 5DG6A 1BCUH 1QBVH 1LVOA 1VCQA 2NU3E 1JBUH 2OBQA 3MO3A 3MWIU 3RMMH 1N8OC 2BOHB 2P95A 2FODA 3URDA 1OWEA 1GHBF 1ZTLA 1MTUA 2F9VA 1QA0A 1C5NH 2W3KA 2STBE 3ZZCA 1P8VC 2SFAA 1BHXF 1FJSA 1TOCB 1FV9A 2PUQH 1H4WA 3P95A 4H4FA 1AZ8A 4H6SB 3FP7E 1G3EA 1A0LA 1IQMA 2KAIB 2ZFRH 1D6RA 3LT3A 1J15A 1YM0A 2O9QA 3SHAH 3TLOA 2P8OB 1A4WH 3MNXA 4OGYA 1V2QT 2F9NA 3ZZ3A 4MPUA 5H4IB 4HI3A 1HAPH 1G3BA 1K1OA 5HGGA 2OC7A 1TA6A 2ESTE 4X6OA 3RU4T 4J2YB 2WPLS 2GMTB 1EZXC 1P0SH 1C4Y2 1DWDH 5DP8A 1E0FD 3QTVH 4K5ZA 5DJ7A 1O2JA 1BMMH 4GHQA 4BOHA 1EPTB 1O3MA 4B73A 3PROA 1A2CH 4MPVA 1HRTH 3EYDA 4X8UH 2ZG0H 3PM3A 2ZFFH 4OS7A 2QYIA 2HNTF 4MDSA 1OWKA 4UDWH 6CHAC 1NRPH 1W7XH 1GMHG 4MNWA 2C8YB 1OPHB 3LDXH 3SUGA 4AFSA 3A86A 2A0QB 2A5AA 1HAVB 4GCHF 3EQ0H 1C1NA 1YPHC 4ABIA 3UNSA 3U8TH 4NWKA 1BTHH 1UCYK 3AW0A 3A8DA 1SFIA 4K60A 1QA7A 1J9CH 1P05A 1BRCE 1XUHA 3D49H 1TBQH 2A32A 2ZTYA 1BTYA 1GBKA 3HK6B 2C8ZB 1XXFA 5CE1A 1C4U2 1JIRA 1XM1A 2ZWLH 1BRBE 5C5NA 2AIQA 1G3CA 1G2LA 1SSXA 2Y5GA 1GJCB 3RM0H 2ZFTA 1TONA 2ZTXA 1CT0E 3P6ZB 4FUHA 1ZMLA 1V2ST 1Z8RA 4GVUA 3SI4H 4K1SA 3SQHE 1Z1IA 4I33A 3D65E 3LJJA 2PTNA 1C5XB 3ATKA 1E36B 3RXKA 4UONA 1D3TB 1GI9B 2QXIA 1AUJA 4HZHA 3UIRA 1MZAA 1KLJH 1TQ0B 4Y76A 1MBMA 1MBQA 2Y6TA 1V2KT 4FUGA 4K1TA 4AG1A 3UQVA 1SGTA 1ELVA 1FNIA 1H9HE 1Y5UT 1WU1A 2GV7A 3SU2A 1FPCH 3P8FA 3CS7A 3A7WA 3V0XA 1E38B 3SNDA 3DFJA 2P94A 2ZFQH 3M3VA 4BAKB 3TK5A 2ZGHA 2Q6GA 4AFQA 1LKBA 5EXNA 4DG4A 4IBLH 4XBCA 1S0RA 1D3DB 1O39A 1ZGVA 2ZC9H 4ZHMU 5C5OA 4X6PA 1O38A 1P2KA 2STAE 3M7QA 3RXDA 1G37A 4SGBE 2VIQA 1F0SA 2OUAA 1VJAU 1W3CA 5ABWA 1GG6B 3F9GA 1TNGA 3GYLB 4IMQA 5T6DA 4DURA 1KSNA 3TH2H 2BY5X 2ILNA 1C5MD 1P9SA 5IYTA 3UOPA 1JWTA 9ESTA 1GMCG 4I32A 3GDSA 1YKTA 1EATA 3M5MA 4NG9H 1TE0A 1JOUB 2TBSA 1HJAB 1W11U 2OBOA 2R9PA 2BLVA 2GX4A 1ESAA 1NO9H 2Y80A 2W3IA 3I29A 3SJ9A 3ZVEA 1P10A 2B8OH 1NT1A 3A80A 4UFFH 2OQUA 2OINA 1T4VH 1L4DA 3KQBA 2LPRA 2BY6X 1F7ZA 1FN6A 1ZZZA 3DFLA 2HRVA 4IC5A 3DT0H 2KAIA 2Y81A 1O3NA 3ZVDA 6ESTA 1LKAA 1P2MA 3Q3KA 2ALPA 3QN7A 4J1YA 2W7UA 3NCLA 2GZ8A 1SLWB 3PMBB 3PTBA 3BTTE 1BIOA 1FIZA 3ZYEA 2FWWA 1NY22 2FX6A 3VFEA 1GJAB 1LPKB 3KIDU 4NA8A 1Z8JB 2I6SA 1C5QA 4E7RG 2PFEA 1O5EH 2FP7B 5E0JA 2TGTA 1GDQA 3S9CA 1IQNA 2FOHA 3RU4E 2BZ6H 4E06H 3KN2A 1JRTA 1MD7A 2A4QA 2H9TH 3E91A 3T28A 2XRCA 2OD3B 1EPTA 4UFGH 1O2WA 1O2PA 5A8YA 1LCYA 1O35A 1Z6JH 1S6FA 1FXYA 1SLVB 5DP6A 3BN9A 2ZHEH 1OKXA 2AIPA 3OX7U 2JETB 1HAVA 1B0FA 4Q7ZA 3ZVFA 1KLTA 1BRAA 2PKAB 3F9EA 1AWFH 2ZPRA 2FYRA 2A7CA 3H7TA 3UNRA 1O0DH 3AASA 2VJ1A 5HMAA 2CF8H 1TRNA 1TRYA 2VIVA 2UUFB 1SGCA 1ZOMA 1ZPCA 2OC1A 2FI3E 2AMQA 4TPIZ 3KNXA 4DVAU 2OTVA 3UOUA 3LC3A 3E0PB 2F9UA 2W7SA 2QIQA 1D6WA 2ZI2H 3A8BA 4FU9A 3P8GA 1K1LA 1Z8IB 3C1KA 1V2WT 3F9HA 5TCAA 5I25A 3D62A 1C5UA 1F5LA 1T4UH 1ELGA 2AGIX 4XBDA 2PKSB 5F03A 3PYHA 1KXFA 1RFNA 1OYTH 1BJUA 3SOSA 2BD5A 2GT7A 4DW2U 1FDPA 3ZVGA 1P2QA 2F83A 1EZQA 2CJIA 3M5LA 1GJ4H 5HXFA 1HJ9A 1O5CB 4R8TB 1DWEH 3RXRA 4ZMAH 2QXGA 4RKJB 3FFGA 3P92A 3KL6A 1CT2E 1KLIH 1GJDB 3UWJH 2BD9A 1WBGB 5TJXA 4CRAA 3QLPH 3SU5A 1VGCB 2UUJB 1GI8B 4Y6DA 1NFXA 1UVPA 3M3SA 1O2LA 2Q6DA 4NWLA 3BTWE 1HAYB 2ZHFH 1UK4A 4OS6A 5ETXA 5LPEA 2CV3A 1QL8A 4NIYA 1SPJA 2Z7FE 1PFXC 5DK1A 1W14U 3FP6E 2WPHS 3MOCA 3BG8A 1QL7A 1GPZA 3V3MA 1P3CA 4D7GA 5PTPA 1O5AB 2DE9A 4MVNA 8GCHF 3K9XB 3M36A 3JZ1B 4X1SU 1UMAH 2Y5FA 3R3GB 4YZUA 3SO3A 3T25A 2P3FH 1O2MA 2UWOA 4U32A 1Y8TA 3S9AA 1P2IA 3QGJA 1DITH 1ORFA 3E0NB 2HLCA 3GCHC 1DY8A 1EJMA 3UTUH 4NFFA 3LH3A 1GGDC 3M7UA 4KTCA 4ESTE 3TJUA 4GSOA 1W13U 1K1MA 3RXAA 1A46H 2R2MB 1DFPA 1OS8A 1PPBH 3UREA 3VGCB 4MNXA 3ZZ6A 3ATMA 4ZROA 1GL0E 3CS0A 1C2FA 1GVKB 1DVAH 4JK6A 5GJ4B 3BTGE 3VB3A 5FXLA 5JBAS 2NU0E 1AFQB 3H5CB 1NESE 2VGCB 4LZ4B 2BD7A 4FUIA 2G5VA 1NTPA 3BF6H 5GCHG 2ZQ1A 3BIVH 1PYTD 3PLBA 1GI4A 1CHOF 4ISIH 5C20A 1GI5A 2FPZA 1AU8A 1H8IH 3SV8A 3K6YA 2O8WA 1YLDA 3PLPA 4INLA 2QY0B 4MG3A 1T8OA 3PWBA 1FZZA 1Z8GA 1P2NA 3UPEA 2ZZUH 1S81A 4WXVA 2FYQA 3E8LA 5CHAB 2RA0A 1NRSH 2ZDNA 1IQHA 2WYJA 2PKAA 2CGAA 1B7XB 3PO1C 2JH6D 4TY6A 1QY6A 5FBIA 2BVSH 2FXRA 4UFEH 1GHVH 2ODPA 2A5IA 1EASA 3P8OA 2YNBA 1O3FA 5AHGH 3ITIA 1NPMA 3ENSB 2C8WB 1ABIH 3LKWA 5FAHA 1MTNC 5JBCS 5SGAE 3UNQA 1C9TA 1LHGH 3ZV9A 2G52A 1WV7H 1C5LH 1FAXA 1W12U 2FZZA 2BDHA 3BSQA 1KXEA 3SU4A 2BY8X 5F8XA 1V2PT 1QIXB 1BJVA 2VH6A 1GCTB 2ZA5A 3SV7A 1O2QA 1SGDE 1BTPA 3BTFE 3GCOA 1P04A 3LGYA 1GL1A 1RTKA 3VB4A 4YM9A 1GMHF 3K65B 1MUEB 3RM2H 2V6NA 4LXBH 2P93A 2HPPH 2JKHA 4A6LA 1FMGA 2G4UA 2WUCA 1GMDF 1HYLA 1LHDH 1UTOA 2GGVB 2FOEA 1UTNA 2SGPE 3C27B 1AIXH 1DT2A 1TGNA 2XW9A 1KIGH 3SJKA 1TWXB 1QJ7B 4ABBA 4NSYA 3RXMA 4B74A 1HAIH 1MKWK 1IQIA 1GBFA 2GV6A 2WINI 3BTQE 4GUXA 1O2VA 1O3OA 2HNTE 2I6QA 4JZEH 1ACBE 1EXFA 2H6MA 2VWMA 5FPTA 3TIUA 1QR3E 2VIOA 4AGJA 1G9IE 1PPHE 1Y3WA 4U30A 2QXHA 1V2OT 2BHGA 2BQWB 5EXLA 2ANKH 1BTWA 2EC9H 3KQCA 2F9PA 3GDVA 3SBKA 2ZU5A 3SW2B 2D2DA 3BEIB 2G8TA 2RDLA 2D1JA 5C1YA 1IQJA 1Z1JA 4FUBA 5DP7A 1D9IA 2WPKS 1YPJH 1L0ZA 1O3CA 1SOZA 2QC2A 1DSUA 5DP5A 1WQVH 3SI3H 1EX3A 3QX5H 1QCPA 1C5TA 2BOKA 5L2YH 5C1UA 1SVPA 1CBWB 1P2JA 1ZPZA 2AEIH 2VWLA 3BTKE 4AB8A 1YPMH 5FHTA 1GI2A 5A8XA 3LGUA 2BLQA 2CF9H 3K6ZA 2ZFSA 3CP7A 3F1SB 5AVDA 1WAYB 1C2MA 3BG4C 3URCA 3UUZA 1GHZA 1HAZB 3BEUA 5GPIB 4AOQA 1GMCF 1G2MA 1RIWB 1INCA 4WH8A 4Y0YE 2BYAX 2GZ7A 1EOLA 3GICB 4NFEA 4AX9H 3VXEH 3VB6A 2VB0A 4I8LA 2GVFA 1GI3A 2WPMS 5HM2A 1W10U 1FI8A 2G55A 1NRRH 5HM9A 1C2DA 1HGTH 1C5OH 4YT7H 3OY5U 1C2LA 3DA9B 1C9PA 1MKXH 5DPAA 4NIVA 1PJPA 4Y8XA 4Q7XA 2A7JA 7GCHG 2FEQH 5BRRE 3KEEA 4QT8C 1H1BA 2CHAC 4FUDA 4CRBA 3SJOA 1BT7A 3KHVA 1KY9A 1O2NA 2AS9A 4CR5A 1LHCH 2VIDA 1V2MT 2GCTB 1HJ8A 2J9NA 5DP3A 1LQDB 1SGPE 1QFKH 2ZKSA 1TX6A 1UK2A 4X1NU 3A7VA 5EPNA 3A8AA 1GVLA 3GCTG 4A1XA 1SHHB 1GVZA 3PLKA 1V2NT 3SU0A 1GBLA 2PW8H 4UFDH 3VXFH 1OWHA 2DUCA 2Z9KA 2J4IA 3W94A 2XCNA 1FLEE 1CA8B 4AB9A 1GMDG 1MKXK 3SNAA 3MO9A 7KMEH 3RXFA 1ZHMA 2Q6FA 4CHAC 2EA3A 2F3CE 1NFYA 1LO6A 2O8MA 2Z9IA 2VWNA 1AQ7A 3LPRA 4BANB 4NZLA 1ZGIA 2PSXA 2GP9B 4X1QU 4JZ1A 3IITA 5EW1H 1ZR0A 2HWLB 3VB7A 1B0EA 3KF2A 3S0NA 3GISB 3QZRA 3UWIA 2FOFA 2P59A 2J38A 1S84A 2Z3CA 5EGMA 4ZXYH 3KCGH 1OYQA 1TA2A 1XVOA 1IHTH 3NWUA 4X2WA 4XFQA 3TK9A 4JMYA 4UE7H 4ASHA 4XDEA 3SQEE 5JPMH 1UVTH 1WUNH 2VINA 3SGBE 2ZGCA 1GHXH 2BXTH 1CA0B 1DPOA 1XXDA 4AFZA 4XOJA 2HOBA 4ZAEA 5T6GA 1G30B 1AVXA 3ATWA 3FP8E 3SUEA 2ZU1A 2PWXA 4X6NA 3OYPA 4FUCA 1LTOA 1UHBB 1AI8H 1ETTH 4D9RA 2IPHA 1JRSA 1O3IA 2H1UA 1O3KA 1MZDA 1AE8H 1DXPA 3A81A 3A7ZA 2ZU2A 1P12E 2B9LA 5JDUB 4AFUA 4YESB 1T8MA 3KGPA 3RXIA 2R2WU 4H6TA 2BY7X 5EQSA 4FUEA 2UUKB 1TMBH 2J94A 3DD2H 3NXPA 1TRMA 3HK3B 1N8OB 2ZPSA 3HKIB 1OP2A 1RJXB 5AFYH 1QL9A 1SBWA 2H5DA 4DJZB 3G01A 3OTJE 5F8TA 1RTLA 3GCNA 3Q77A 5GIBA 2VWOA 3RLYH 2CXVA 2HVXA 1PYTC 1VITH 2FOAA 4JZDH 1TX7A 2C8XB 1SFQB 1TQ7B 1O3BA 1S6HA 2FTMA 1TBRH 4K8YA 3ZZBA 1C5RA 2Y82A 1C2GA 4BXWA 4K1EA 1O37A 4YOJA 1AZZA 2G5NA 4Y79A 1EP6A 4FU8A 3NZIA 1SGQE 1C5YB 1QB6A 1YC0A 2PUXB 2V35A 1DLEA 2YOLA 4X1PU 1C5SA 1TBZH 2FESH 2PV9B 4ZKOU 4A7IB 2A1DB 3Q3YA 1HDTH 1QBOA 3ZZ4A 4OS4A 4X2VA 4NIWA 2A31A 3HGNA 4KTSA 1V6DA 4BTIB 1CVWH 3Q00A 6CHAB 3TU7H 1O3HA 1BQYA 1K21H 2BM2A 3PMHB 1YCPH 6GCHF 5GCHF 4CBOA 3L33A 2ZU4A 2J2UA 1W7GH 5FPSA 4H42U 1CO7E 1TIOA 1T32A 4HTCH 4AYYB 1XKBC 1FN8A 1LPZB 1A3BH 4IS5A 1AB9C 1UO6A 1ZLRA 1HIAA 1SI5H 3S7KB 4YOGA 1YPKH 2SGDE 2UWLA 3OY6U 4K2YA 1P9UA 1O31A 2WPIS 1AY6H 1K1JA 1E37B 1QGFA 1QURH 1SGIB 3A89A 1C1VH 4JZIA 1AHTH 2LNCA 3RU4D 1BTXA 1MTVA 3SV2H 7LPRA 3QTOH 4ABGA 3DHKH 2ZHDA 3ZZ8A 3RXSA 1NC6A 3ZVBA 1C1RA 1KXDA 2XCFA 4UD9H 1P09A 2K1QA 4O9VA 5B6OA 1BRUP 1FAKH 1GCDA 1Z7KA 2SGFE 2FO9A 2M5TA 1EKBB 1NFUA 2Z9LA 1AWHB 1C1WH 1C1UH 1GJ8B 5E8EH 1CSOE 1TABE 1OP8A 2A4OA 1G36A 3F68H 5EQQA 3RXHA 1TLDA 1AN1E 3RXGA 1GBIA 3TNTA 2Y5HA 1V2LT 3HKJB 1XX9A 3L3TA 3P17H 2BX4A 3RDZA 1ELCA 5T3HA 1PQAA 1CT4E 1DX5M 1BOQA 1H9LB 3E90B 4IGDA 1F2SE 1WOFA 2ZHWH 2OC8A 5E2PA 2HPQH 3FVFB 3MH6A 1ZMNA 1TFXA 5L2ZH 4E05H 1XUIA 1MAXA 3A84A 1EAUA 3SU3A 1UHBA 2NU2E 1A1RA 1GBEA 2O8TA 4WJG2 4D8NA 2J95A 5L30H 2P3UB 8KME2 1QQUA 3EDXB 1TPPA 1LMWB 2O8UA 5A0CA 4ISLA 4O3UA 1S85A 1IQGA 2HNTC 2EI6A 3H7OA 2ODYB 4I8JA 4ABDA 4YLQH 4O3TA 3TPIZ 4D9QA 1OOKB 2FI4E 1NU9A 2Z9GA 2RCEA 1DICA 1O3AA 2ODQA 2ANWA 1QB1A 3FZZA 3UQOA 3B23B 1C5WB 1H8DH 4THNH 4Z0KA 3TH3H 2G81E 1A5GH 1FUJA 1SL3A 1ETRH 1TMTH 1P11E 2DE8A 5F8ZA 4HGCA 2XC4A 4AGKA 3SZNA 1C2JA 4VGCC 1UVOA 2VIWA 1IQFA 1C1QA 1EP5A 1W8BH 2VH0A 2VIPA 3MNCA 4WVPE 3AVZA 5FX5A 5I46H 3QO6A 1ELAA 5CMXH 4U2WA 1FY1A 2XBWA 1HNEE 1ANBA 1YBWA 2SGEE 1KXAA 5J4SA 1W0ZU 3SNEA 5LPFA 4IW4E 2SGQE 1PQ7A 1OSSA 1QNJA 2OXSA 1SOTA 2QGRA 2A4RA 3A8CA 4Y0ZE 4BAQB 2WUBA 4CRFA 6GCHG 1PPCE 4CH8B 2ALVA 2WPJS 3ATIA 1F5RA 1WTGH 1PPFE 2PGQB 4Q7YA 3SV9A 3A7YA 2GZ9A 1L1GA 3MU8A 4FVBA 1O3EA 3RXEA 4ISOA 2AMPA 4DIIH 5K7RA 1N6XA 3QK1A 1ZTJA 4LK4A 1C1PA 5GDSH 3E3TA 3LC5A 5FCRA 3TITA 1GBAA 5EOKA 2TPIZ 3SNCA 5JBBS 3O8CA 2B0FA 1GHYH 3MNSA 1SGFG 2GCHG 1GHWH 2XWAA 2BXUH 1G32B 4B71A 1O2YA 1UTPA 1C2IA 4WMEA 3QUMP 3VB5A 3TJVA 2BZAA 7GCHF 4O03A 2XC0A 1MU6B 3ZZ5A 4DY7B 1O5FH 4FUJA 3S7HB 1T7CA 4AORA 5FBEA 1OX1A 2PTCE 3KQEA 1TX8A 1QHRB 1N6YA 3PMJA 3KQDA 1F0TA 2XTTB 2P8OC 3GDUA 1RXPA 2AGGX 3T5FH 4A5TS 5EPYA 1XUGA 2FS8A 1X7AC 3RMOH 3GCTF 1GBCA 1EQ9A 2ZDAH 1CGIE 2GMTC 1GBMA 4X2XA 2FMJA 2GTBA 1NROH 3RXCA 4ZKNU 2A2XH 1GJ9B 3EGKH 1OWJA 4AZ2B 2FOBA 3ELAH 5EODA 1AO5A 4B2BA 1EPTC 3L6PA 1JXPA 1Y5BT 4CH2B 1ELBA 1WSSH 1TGCA 3SN8A 4BXSA 2XYAA 2CN0H 2D26C 1P57B 1L1JA 1BMNH 3R0FA 4D76A 2AYWA 1GDUA 4TWWA 3I78A 4I7YH 1QRZA 1O2ZA 1YCPM 2ZGBH 3GCHB 3M3TA 3V7TA 1C1OA 3MTYA 1IQEA 1O2SA 1PPZA 3SUFA 1BDAA 1Q2WA 4BAHB 3NUMA 4D7FA 1ZYOA 3T29A 3BTME 2VVUA 1BA8B 1GGDB 3U9AH 1F5KU 5IDKA 5E0GA 2C90B 2XC5A 4WXIA 3T26A 3RLWH 5K0HA 1QRWA 2XBYA 1FIWA 2BY9X 3RC6A 4PROA 3NK8A 4BTTB 2FX4A 3M5NA 2H5CA 1SGYE 1MMJN 1GWAA 1UTJA 1O2GH 1TNLA 1RGQA 1LQEA 2SGAA 1UVSH 4ZKRU 2ZDVH 3ZZ9A 2PHBA 3E1XB 1O32A 1O5DH 1SQOA 3CENA 3SU6A 3EA8A 3M37A 3BTEE 4MNVA 2ZU3A 2BDCA 1QTFA 3N7OA 2R0LA 1UTMA 1HUTH 5LH8A 2D8WA 2ZPQA 4JK5A 4MQAA 3PO1B 2BD3A 5FX6A 1EB2A 2FLBH 1GG6C 5ESBA 1XUFA 1O2RA 1W2KH 2G51A 3V12A 5J4QA 4YOIA 3TH4H 1L1NA 3K2UA
chains in the Genus database with same CATH superfamily
1CQQA 1ESTA 1Y5AT 2BD8A 1O2IA 2GD4B 3FANA 2J5UA 3BTDE 1EJAA 4OS2A 1MTNB 4MLFB 4B1TA 3SJIA 1GDNA 4CRCA 3HATH 3LGIA 1HJAC 1BMAA 1SGEE 2FTLE 2QV1A 1O5GH 4ZUHA 1KYNA 2C93B 1F0RA 1BUIA 1XVMA 1YY3A 2TRMA 2ZDMA 4LOYH 2BTCE 1SQTA 1UCYH 3DCLA 1CU1A 2Q1JA 4Q63A 3RC4A 2V3OH 3RXLA 3AW1A 4BAMB 1SC8U 1TOMH 1UCYE 2ZEBA 1GI7B 2QF3A 1AVGH 1NU7B 3UY9A 1TALA 1J16A 1ZRBA 6LPRA 1AUTC 2FOGA 1UW7A 2ZDKA 3RP2A 3DUXH 1SR5C 5DGJA 5EU8A 4HFPB 2VVVA 3D23A 2PR3A 3RXOA 1FX0B 4IC6A 2TIOA 3ZZ7A 2BDBA 4ABAA 2R3YA 4ABEA 1Y3UA 5A8ZA 2EI7A 3MHWU 4FVDA 4WMDA 1HIAB 1Y3YA 3LGTA 4UEHH 5EW2H 1J17T 4DCDA 3BEFB 2QAAA 4B76A 3U69H 3F2FA 5A0AE 1DY9A 1QRXA 4B2CA 3V13A 5FCKA 3JZ2B 3MI4A 2TGDA 2Y7XA 1NBME 4K3JA 5G4BA 1THPB 1A61H 1TNJA 1EB1H 1TGSZ 4NA9H 2AFQB 4Z6AH 4O97A 1UK3A 1N1LA 2BDAA 1KXBA 2OQ5A 2KM0A 1GI6A 1LHFH 2QF0A 1K2I1 2ZF0H 1TYNA 1XUJA 4BTUB 4ABJA 4I31A 1Z6EA 1LVMA 2JETC 1C2HA 1S0QA 2UWPA 3GY4A 1HPGA 1MTWA 2A45B 4Y10E 5E2OA 3O8BA 1GBDA 3LONA 4CR9A 1NRNH 1QJ6B 1U6QA 5C67A 1T8NA 1GHAG 4XE4A 1XMNB 2J92A 1TPSA 1NBMD 5C2ZA 2KCAA 1BTZA 1GJ7B 2F9BH 4E7NA 1TNKA 1EJNA 2F91A 1QBNA 2GDDA 1MAYA 4RKOB 3WY8A 2BLWA 2W5EA 2A2QH 5EG4A 5GXPA 1FY3A 4BNRA 3TGJE 5C1XA 3SV6A 2BLOA 2GKVE 5GWZA 1ANDA 1TB6H 3STJA 4TYDA 2PKSC 1O30A 2XBVA 2C3SA 3A85A 2WV9A 4NCYA 3PWCA 1NFWA 3RXVA 2Z3DA 3RC5A 1YPLH 4TPYA 3SNBA 4Y71A 1RRKA 3QGNB 2R0KA 3CNRA 1BMLA 2PGBB 2BVXH 2V3HH 1SMFE 3RXPA 3GY3A 1ZPBA 3RXUA 1ELDE 3BG4B 3OU0A 1J8AA 5DO4H 2G4TA 2UUYA 1VGCC 4Y8YA 2EEKA 2BX3A 2WYGA 3UFAA 1HFDA 1HAOH 2RA3A 1NZQH 4JZFH 3RMNH 3T62A 1TNHA 5A0BA 4JCNA 3RUOA 3ZZDA 2ZCKP 4ISHH 3MYWA 1EUFA 1H9IE 1L2EA 1O36A 2Y7ZA 2ZECA 1IHSH 1AGJA 2NWNA 3VEQB 2THFB 1ID5H 1BZXE 1M9UA 1K0HA 1ZSJA 1SQAA 2BDIA 1LHEH 1WTHD 1GBHA 1UVUH 3UAIC 1YYY1 1PQ5A 1GHBG 1V2RT 3QWCH 1RTFB 2AMDA 1MU8B 2CHAB 2IJOB 8LPRA 1QJ1B 5HIZA 3LJOA 3LGVA 1HAGE 2GT8A 4WH6A 4ABHA 2ANMH 5DP9A 1O2UA 2QN5T 2QCYA 2ZGJA 1DUAA 2EI8A 2P3TB 1C5PA 4F55A 3LGWA 2JJ2D 1C5ZB 4Q80A 1TPAE 4XBBA 3TVJB 4X8VH 1KTTB 4CRDA 1RS0A 1DUEA 1ETSH 2FOMB 3AAVA 4FXGH 4INKA 1O3DA 3MNBA 3EA9A 4AC9A 2SNVA 1DLKB 1BMFD 4AG2A 1G3DA 3VGCC 1B5GH 1FPHH 2ZNKH 2H9EH 5F6MA 1EAWA 1F0UA 1YF4A 8ESTE 5L6NH 1A7SA 1GBBA 1BBRH 1AFQC 1AVWA 1K1PA 4X2YA 1ZJDA 4Q2KA 2VGCC 1BBRE 1EAIA 1DE7H 2ZCHP 4CHAB 2PLXA 2FOCA 3MH5A 4I8GA 3MU4A 5JB9S 3SGAE 4OS5A 4GCHG 2JH0D 1MTSA 1FY8E 2ZFPH 1UTKA 2BQ7B 1IQKA 4XSKU 1EOJA 1VJ9U 2GCHF 3SGQE 1SGFA 4M7GA 3U8OH 5ESTE 3HPTB 1UTLM 4X6MA 2P16A 1ANEA 3RXTA 2IN2A 4IN1A 1YPHE 1WCZA 4B75A 1O2OA 3FZDA 3Q76A 4NA7A 4X0WU 5CHAC 1P02A 2G00A 1DWCH 2W26A 1YCPK 1C2KA 1V2VT 4K8BA 2CK3D 1MQ6A 2BD4A 3SHCH 1C1SA 4WF8A 3ODDA 2NU4E 4IMZA 1P2OA 4MTBA 1UTQA 1HXEH 5EXMA 3U1JB 2YNAA 4LZ1H 3SUDA 1ELTA 2Z3EA 1BBRK 1MCVA 3IG6B 1CE5A 1T31A 3MH4A 3S69A 1F92A 3EE0B 1FY4A 1SLXB 1Z71A 4MPXA 2Z94A 2YMSC 2K8IA 4X1RU 1NN6A 3A7XA 1JMOH 1VCWA 1GI0A 1A5IA 2RG3A 4NSVA 2OC0A 1MH0A 1MCTA 1Q31A 4DGJA 3MH7A 4FU7A 1KDQB 3LH1A 1VCPA 1C4V2 2QXJA 2BVRH 1D4PB 1GCTC 1D3PB 1IQLA 1NS3A 3PTNA 3GYMA 1O3PB 2F9OA 1BITA 1HV7A 3O8RA 1K9OE 2WPDD 5LPRA 2Z9JA 4M9FA 1V2TT 1V3XA 4TY7A 1VITF 3PV4A 2C4FH 3U98H 1GJ5H 1DS2E 4TSFD 3M5OA 1BB0B 1EZSC 1K1NA 4BAOB 7ESTE 3A82A 1HAXB 3ZZAA 4INHA 2A5KA 1SGNE 1ABJH 3TJNA 1DM4B 1YGCH 1P01A 1TPOA 2ZHQH 1P3EA 4NIXA 2JJ1D 4A92A 4MNYA 1O33A 4R0IA 1K1IA 1LVBA 3W95A 1OWIA 1SB1H 2WV5A 1C1MA 2B5TB 2TGAA 1O3LA 3TNSA 3NKKA 3EAJA 3UR9A 2ZQ2A 4YLUA 3MFJA 3MU0A 2ZIQH 2FM2A 1XUKA 4Y7AA 3BIUH 4CRGA 1MD8A 3PB1E 1ZSKA 3RXQA 2BDGA 4X8SH 1O2XA 4NZQA 1ESBA 1YLCA 4I8KA 2FIRH 3ESTA 1FQ3A 1AKSB 1GJBB 1C1TA 4SGAE 2F4LA 1TNIA 9LPRA 1L4ZA 4JYVH 2Z6BD 2ZGXH 2NU1E 4K69A 1GBTA 1KXCA 4GLYA 3GY5A 2VVCA 1LVYA 2J34A 3MO6A 1COWD 3GY6A 3QDZB 5DP4A 4JYTA 1Y3VA 1YWUA 4KP0A 3SU1A 2CMYA 2JH5D 4Y7BA 1AB9B 4GAWA 3F9FA 3RXJA 4A1TA 3HGPA 3MU5A 3P70B 1OP0A 1VZQH 1A5HA 2BQ6B 2WV4A 5EJLA 1C5VA 5AF9H 1CBWC 4B2AA 1S6LA 3A83A 1OWDA 4TWYA 1DSTA 1PPEE 5JYIA 2SNWA 1S5SA 2QF5A 1CGHA 3SORA 5LGOA 5A2MH 3U8RH 3ZVCA 1LPGB 1GBJA 2O8LA 2V0BA 3M35A 4AYVB 3QZQA 1P06A 3RMLH 3B8JA 1ZMJA 2GDEH 3GOVB 4RN6A 5AFZH 3GY8A 3H09A 3GY7A 1E34B 1Y3XA 4OS1A 1CGJE 1DXWA 1BHXB 1RIWC 2TGPZ 1AMHA 1QB9A 3AK5A 1AE5A 1KTSB 5E0HA 1ELFA 2ULLA 1SHYA 4MPWA 1S83A 2AERH 2ASUB 1DOJA 3A7TA 3A88A 1C2EA 3LIWA 4JYUH 1LDTT 3TK6A 2BDYA 1DDJA 3FAOA 2XWBI 1ZRKA 2FS9A 4KELA 2FDAA 4NGAH 1PPGE 2B7DH 2PSYA 4ZHLU 1HAHH 1EAXA 2JIZD 5EQRA 4WMFA 4ZH8A 3GY2A 4WWYA 4KGAA 2XNIA 2AGEX 1YPGH 3PMAB 2AH4X 1RD3B 1MKWH 4ISNA 1QQ4A 2OLGA 4F49A 1SG8B 1TAWA 1A3EH 3NPSA 3F6UH 1ZHPA 1UJ1A 1DANH 1FY5A 4WY3A 4Y11E 2IOTA 1YPEH 2GCTC 4Y8ZA 4YO9A 5FPYA 2H2ZA 3MU1A 5TCCA 4AN7A 4A1VA 4CBNA 1H8ED 1ZSLA 4DIHH 4GHTA 4DT7B 1A0HB 1KDQA 4ABFA 1J14A 1V2UT 2R3UA 3TGKE 1O2TA 2ZCLP 5C3NA 3T27A 1AD8H 3RXBA 1CHGA 2VNTA 1VITG 2BMGB 2ANYA 2OP9A 2W6JD 1ARBA 1WQSA 1O34A 1MQ5A 1S82A 4KKDA 3S9BA 2H9HA 2BD2A 4X8TH 5HIYA 1Q3XA 1ANCA 1OXGA 1SLUB 4FUFA 5IK2D 1K22H 3B9FH 4OGXA 3T2NA 4GPGA 3P8NA 2FLRH 1GHAF 8GCHG 3A87A 5JBTA 1T8LA 2OCVB 3FOAA 4IN2A 2ZO3H 1DWBH 4VGCB 2HALA 1PQ8A 3SJ8A 1JIMA 1O2HA 1Y59T 1WYKA 1GI1A 4KTUA 5CDFE 3NRLA 2QA9E 1HLTH 4F4OC 1TMUH 3Q3XA 4I8HA 2ZDLA 1E35B 3LOXA 1GJ6A 1YP9A 5A09A 3IWMA 3VPKA 1ELEE 3TGIE 1ZTKA 1SGRE 1NRQH 3E6PH 1HXFH 1HB0B 3U1IB 3BV9B 5JB8S 3OSYA 1THSH 5HYOA 1O2KA 2A7HA 3F0PA 1HBTH 1AKSA 1EZUC 3F2GA 3ODFA 4ZXXH 2FI5E 3TJOA 1NM6A 2XBXA 2ZP0H 3M7TA 1THRH 1IAUA 4YXWD 1CA0C 1XKAC 3ZYDA 2A4GA 2VU8E 1O5BB 5BPEA 3ATLA 1V2JT 3EA7A 4U01A 3ZV8A 2BB4A 1P03A 3LU9B 3ZVAA 1BTUA 2HGTH 1AFEH 3STIA 1ZJKA 1O3JA 1A0JA 1ZHRA 5DKMA 5T6FA 5C0UA 1TGBA 3M61U 4YTAA 1K28D 1FONA 1O3GA 3BTHE 3PV2A 4RSPA 1IOEA 3AAUA 1ARCA 5CHBA 1VR1H 3MMGA 3UR6A 3PV5A 4DOQA 3I77A 1HCGA 1W0YH 2XNDD 2XXLA 1D3QB 1CHOG 3E16B 1TGTA 4YT6H 4ZKSU 2ZTZA 4ZHAA 3O8DA 4CREA 5DG6A 1BCUH 1QBVH 1LVOA 1VCQA 2NU3E 1JBUH 2OBQA 2KX4A 3MO3A 3MWIU 3RMMH 1N8OC 2BOHB 2FODA 2P95A 3URDA 1OWEA 1GHBF 1ZTLA 1MTUA 2F9VA 1QA0A 1C5NH 2W3KA 2STBE 3ZZCA 1P8VC 2SFAA 1BHXF 1FJSA 1E1QD 1TOCB 1FV9A 2PUQH 1H4WA 3P95A 4H4FA 1AZ8A 4H6SB 3FP7E 1G3EA 1A0LA 1IQMA 2KAIB 2ZFRH 1D6RA 3LT3A 1J15A 1YM0A 2O9QA 3SHAH 3TLOA 2P8OB 1A4WH 1KMHB 3MNXA 1V2QT 2F9NA 4OGYA 4MPUA 5H4IB 4HI3A 3ZZ3A 1HAPH 1G3BA 1K1OA 5HGGA 2OC7A 3GS9A 1TA6A 2ESTE 4X6OA 3RU4T 3MQKC 4J2YB 2WPLS 2K0QA 2GMTB 1EZXC 1P0SH 1C4Y2 1DWDH 5DP8A 1E0FD 3QTVH 4K5ZA 5DJ7A 1O2JA 1BMMH 4GHQA 4BOHA 1EPTB 3W1EA 1O3MA 3PRDA 4B73A 3PROA 1A2CH 4MPVA 1HRTH 3EYDA 4X8UH 2ZG0H 3PM3A 2ZFFH 4OS7A 2QYIA 2HNTF 4MDSA 1OWKA 4UDWH 6CHAC 1NRPH 1W7XH 2JDID 1GMHG 4MNWA 2C8YB 1OPHB 3LDXH 3SUGA 4AFSA 3A86A 2A0QB 2A5AA 1HAVB 4GCHF 3EQ0H 1C1NA 1YPHC 4ABIA 3UNSA 3U8TH 4NWKA 2KFWA 1BTHH 1UCYK 3AW0A 3A8DA 1SFIA 4K60A 2EY4C 1QA7A 1J9CH 1P05A 1BRCE 1XUHA 3D49H 1TBQH 2A32A 2ZTYA 1BTYA 1GBKA 3HK6B 2C8ZB 1XXFA 5CE1A 1C4U2 1JIRA 1XM1A 2ZWLH 1BRBE 5C5NA 2AIQA 1G3CA 1G2LA 1SSXA 2Y5GA 1GJCB 3RM0H 2ZFTA 1TONA 2ZTXA 1CT0E 2AHME 3P6ZB 1ZMLA 1V2ST 1Z8RA 4FUHA 4GVUA 3SI4H 4K1SA 3SQHE 1Z1IA 4I33A 3D65E 3LJJA 2PTNA 1C5XB 3ATKA 1E36B 3RXKA 4F48B 4UONA 1D3TB 1GI9B 2QXIA 1AUJA 4HZHA 3UIRA 1MZAA 1KLJH 1TQ0B 4Y76A 1MBMA 1MBQA 2Y6TA 1V2KT 4FUGA 4K1TA 4AG1A 5EJ1A 3UQVA 1SGTA 1ELVA 1FNIA 1H9HE 1Y5UT 1WU1A 2GV7A 4FETA 3SU2A 1FPCH 3P8FA 3CS7A 2HLDD 3A7WA 3V0XA 1E38B 3SNDA 3DFJA 2P94A 2ZFQH 3M3VA 4BAKB 3TK5A 2ZGHA 2Q6GA 4AFQA 1LKBA 5EXNA 4DG4A 4IBLH 5DN6D 4XBCA 1S0RA 1D3DB 1O39A 1ZGVA 2ZC9H 4ZHMU 5C5OA 4X6PA 1O38A 1P2KA 2STAE 3M7QA 3RXDA 1G37A 4SGBE 2VIQA 1F0SA 2OUAA 1VJAU 1W3CA 5ABWA 1GG6B 3F9GA 1TNGA 3GYLB 4IMQA 5T6DA 4DURA 1KSNA 3TH2H 2BY5X 2ILNA 1C5MD 5HKKD 1P9SA 5IYTA 3UOPA 1JWTA 9ESTA 1GMCG 4I32A 3GDSA 1YKTA 1EATA 3M5MA 4NG9H 1TE0A 1JOUB 2TBSA 1HJAB 1W11U 2OBOA 2R9PA 2BLVA 2GX4A 1ESAA 1NO9H 2Y80A 2W3IA 3I29A 4ZCNA 3OTPA 3SJ9A 3ZVEA 1P10A 2B8OH 1NT1A 3A80A 4UFFH 2OQUA 2OINA 2KCOA 1MABB 1T4VH 1L4DA 4P00A 3KQBA 2LPRA 2BY6X 1F7ZA 1FN6A 1ZZZA 3DFLA 2HRVA 4IC5A 3DT0H 5EJZA 2KAIA 2Y81A 1O3NA 3ZVDA 6ESTA 1LKAA 1P2MA 3Q3KA 2ALPA 3QN7A 4J1YA 2W7UA 1YLNA 3NCLA 2GZ8A 1SLWB 3PMBB 3PTBA 3BTTE 1BIOA 1FIZA 3ZYEA 2FWWA 1NY22 2FX6A 3VFEA 1GJAB 1LPKB 3KIDU 4NA8A 1Z8JB 2I6SA 1C5QA 4E7RG 2PFEA 1O5EH 2FP7B 5E0JA 2TGTA 1GDQA 3S9CA 1IQNA 2FOHA 4TT3D 3RU4E 2BZ6H 4E06H 3KN2A 1JRTA 1MD7A 2A4QA 2H9TH 3E91A 3T28A 2XRCA 2OD3B 1EPTA 4UFGH 1E79D 1O2WA 1O2PA 5A8YA 1LCYA 3ZIAD 1O35A 4B6FA 1Z6JH 1S6FA 1FXYA 1SLVB 5DP6A 3BN9A 2ZHEH 1OKXA 2AIPA 2F43B 2JETB 3OX7U 1HAVA 1B0FA 4Q7ZA 3ZVFA 1KLTA 1BRAA 2PKAB 3F9EA 1AWFH 2ZPRA 2FYRA 2A7CA 3H7TA 3UNRA 1O0DH 3AASA 2VJ1A 5HMAA 2CF8H 1TRNA 1TRYA 2VIVA 2UUFB 1SGCA 1ZOMA 1ZPCA 2OC1A 2FI3E 2AMQA 4TPIZ 3KNXA 4DVAU 2OTVA 3UOUA 3LC3A 3E0PB 2F9UA 2W7SA 2QIQA 1D6WA 2ZI2H 3A8BA 4FU9A 3P8GA 1K1LA 1Z8IB 3C1KA 1V2WT 3F9HA 5TCAA 5I25A 3D62A 5C94A 1C5UA 1F5LA 1T4UH 1ELGA 2AGIX 4XBDA 2PKSB 5F03A 3PYHA 1KXFA 1RFNA 1WDIA 1OYTH 5C0TA 1BJUA 3SOSA 2BD5A 2GT7A 4DW2U 1FDPA 3ZVGA 1P2QA 2F83A 1EZQA 2CJIA 3M5LA 1GJ4H 5HXFA 1HJ9A 1O5CB 4R8TB 1DWEH 3RXRA 4ZMAH 2QXGA 4RKJB 5DSFA 3FFGA 3P92A 3KL6A 1CT2E 1KLIH 1GJDB 3UWJH 3VG8A 2BD9A 1WBGB 5TJXA 4CRAA 5GNDA 3QLPH 3SU5A 1VGCB 2L6OA 2UUJB 1GI8B 4Y6DA 1NFXA 1UVPA 3M3SA 1O2LA 2Q6DA 4NWLA 3BTWE 1HAYB 2ZHFH 1UK4A 4OS6A 5ETXA 5LPEA 2CV3A 1QL8A 4NIYA 1SPJA 2Z7FE 1PFXC 5DK1A 1W14U 3FP6E 2WPHS 3MOCA 3BG8A 1QL7A 3PRBA 1GPZA 3V3MA 1P3CA 4D7GA 2L74A 5PTPA 1O5AB 2DE9A 4MVNA 8GCHF 3K9XB 3M36A 3JZ1B 4X1SU 1UMAH 2Y5FA 3R3GB 4YZUA 3SO3A 3T25A 2P3FH 2QE7D 1O2MA 2UWOA 4U32A 1Y8TA 3S9AA 1P2IA 3QGJA 1DITH 1ORFA 3E0NB 2HLCA 3GCHC 1DY8A 1EJMA 3UTUH 2LP6A 4NFFA 3FO8D 3LH3A 1GGDC 3M7UA 4KTCA 4ESTE 3TJUA 4GSOA 1W13U 1K1MA 5EIYA 3RXAA 1A46H 2R2MB 1DFPA 1OS8A 1PPBH 3UREA 3VGCB 4MNXA 3ZZ6A 3ATMA 4ZROA 1GL0E 3CS0A 1C2FA 1GVKB 1DVAH 3N7DA 4JK6A 5GJ4B 3BTGE 3VB3A 5FXLA 5JBAS 2NU0E 1AFQB 3H5CB 1NESE 2VGCB 4LZ4B 2BD7A 4FUIA 2G5VA 1NTPA 3BF6H 3SZEA 5GCHG 2KCPA 2W6ID 2ZQ1A 3BIVH 1PYTD 3PLBA 1GI4A 1CHOF 4ISIH 5C20A 1GI5A 2FPZA 1AU8A 1H8IH 3SV8A 3K6YA 2O8WA 1YLDA 3PLPA 4INLA 2QY0B 4MG3A 1T8OA 3PWBA 1FZZA 1Z8GA 1P2NA 3UPEA 1W0KD 2ZZUH 1S81A 4WXVA 2FYQA 3E8LA 5CHAB 2RA0A 1NRSH 2ZDNA 1IQHA 2WYJA 2PKAA 2CGAA 1B7XB 3PO1C 2JH6D 4TY6A 1QY6A 5FBIA 2BVSH 2FXRA 4XD7D 4UFEH 1GHVH 2ODPA 2A5IA 1EASA 3P8OA 2YNBA 1O3FA 5AHGH 3OEED 3ITIA 1NPMA 3ENSB 2C8WB 1ABIH 3LKWA 5FAHA 3DSPA 1MTNC 5JBCS 5SGAE 3UNQA 1C9TA 1LHGH 3ZV9A 2G52A 1WV7H 1C5LH 2YMSB 1FAXA 1W12U 2FZZA 2BDHA 3EE7A 3BSQA 1KXEA 3SU4A 2BY8X 5F8XA 1V2PT 2KR7A 1QIXB 1BJVA 2VH6A 1GCTB 2ZA5A 3SV7A 1O2QA 2WZQA 1SGDE 1BTPA 3BTFE 3GCOA 1P04A 3LGYA 1GL1A 2J98B 1RTKA 3VB4A 4YM9A 1GMHF 3K65B 1MUEB 3RM2H 2V6NA 4LXBH 2P93A 1SKYE 2HPPH 2JKHA 4A6LA 1FMGA 2G4UA 2WUCA 1GMDF 1HYLA 1LHDH 1UTOA 2GGVB 2FOEA 1UTNA 2SGPE 3C27B 1AIXH 1DT2A 1TGNA 2XW9A 1KIGH 3SJKA 1TWXB 1QJ7B 4ABBA 4NSYA 3RXMA 4B74A 1HAIH 1MKWK 1IQIA 1GBFA 2GV6A 2WINI 3BTQE 2RDEA 4GUXA 1O2VA 1O3OA 2HNTE 2I6QA 4JZEH 1ACBE 1EXFA 2H6MA 5KEDA 2VWMA 5FPTA 2IPQX 3TIUA 1QR3E 2VIOA 4AGJA 1G9IE 1PPHE 1Y3WA 4U30A 2QXHA 2IJD1 1V2OT 2BHGA 2BQWB 5EXLA 2ANKH 1BTWA 2V7QD 2EC9H 2OK5A 3KQCA 2F9PA 3GDVA 3SBKA 5KECA 2ZU5A 3SW2B 2D2DA 3BEIB 2G8TA 2RDLA 2D1JA 5C1YA 1IQJA 1Z1JA 4FUBA 5DP7A 4ASUD 1D9IA 2WPKS 2M2AA 1YPJH 1L0ZA 1O3CA 1SOZA 2QC2A 1DSUA 5DP5A 1WQVH 3SI3H 1EX3A 3QX5H 1QCPA 1C5TA 2BOKA 5L2YH 5C1UA 1SVPA 1CBWB 3F3BA 1P2JA 1ZPZA 2AEIH 2VWLA 3BTKE 4AB8A 1YPMH 5FHTA 1GI2A 5A8XA 3LGUA 2BLQA 2CF9H 3K6ZA 2ZFSA 3CP7A 3F1SB 5AVDA 1EFRD 1WAYB 1C2MA 4RI0A 3BG4C 3URCA 3UUZA 1GHZA 1HAZB 3BEUA 5GPIB 4AOQA 1GMCF 1G2MA 1RIWB 1INCA 4WH8A 4Y0YE 2BYAX 2GZ7A 1EOLA 3GICB 3UB0A 4NFEA 4AX9H 3VXEH 3VB6A 2VB0A 4I8LA 2GVFA 1GI3A 2HVYB 2WPMS 5HM2A 1W10U 1FI8A 2G55A 1NRRH 5HM9A 1C2DA 1HGTH 1C5OH 4YT7H 3OY5U 1C2LA 3DA9B 1C9PA 1MKXH 5DPAA 4NIVA 1PJPA 4Y8XA 4Q7XA 2A7JA 7GCHG 2FEQH 5BRRE 3WWBA 3KEEA 4QT8C 1H1BA 2CHAC 4FUDA 4CRBA 3SJOA 1BT7A 3KHVA 1KY9A 1O2NA 2PP6A 2AS9A 4CR5A 1LHCH 2VIDA 1V2MT 2GCTB 1HJ8A 2J9NA 5DP3A 1LQDB 1SGPE 1QFKH 2ZKSA 1TX6A 1UK2A 3U28C 4X1NU 3A7VA 5EPNA 3A8AA 1GVLA 3GCTG 4A1XA 1SHHB 1GVZA 3PLKA 1V2NT 3SU0A 1GBLA 2PW8H 4UFDH 3VXFH 1OWHA 2DUCA 2J98A 2Z9KA 2J4IA 3W94A 2XCNA 1FLEE 2V3MA 3DSGA 1CA8B 4AB9A 1GMDG 1MKXK 3SNAA 3MO9A 7KMEH 3RXFA 1ZHMA 2Q6FA 4CHAC 2EA3A 2F3CE 1NFYA 1LO6A 2O8MA 2Z9IA 2VWNA 1AQ7A 3LPRA 4BANB 4NZLA 1ZGIA 2PSXA 2GP9B 4X1QU 4JZ1A 3IITA 5EW1H 1ZR0A 2HWLB 3VB7A 5C17A 1B0EA 3KF2A 3S0NA 3GISB 3QZRA 3UWIA 2FOFA 2P59A 2J38A 1S84A 2Z3CA 5EGMA 4ZXYH 3KCGH 1OYQA 1TA2A 1XVOA 1IHTH 3NWUA 4X2WA 4XFQA 3TK9A 4JMYA 4UE7H 4ASHA 4XDEA 3SQEE 4HG6A 5JPMH 1UVTH 1WUNH 2VINA 3SGBE 2ZGCA 4B6EA 1GHXH 2BXTH 1CA0B 1DPOA 1XXDA 4AFZA 4XOJA 4ACBA 2HOBA 4ZAEA 5T1VA 5T6GA 1G30B 1AVXA 3ATWA 3FP8E 3SUEA 2ZU1A 2PWXA 4X6NA 3OYPA 4FUCA 1LTOA 1UHBB 1AI8H 1ETTH 4D9RA 2IPHA 1JRSA 1O3IA 2H1UA 1O3KA 1MZDA 1AE8H 1DXPA 3A81A 4RT0A 3A7ZA 2ZU2A 1P12E 2B9LA 5JDUB 4AFUA 4YESB 1T8MA 3KGPA 3RXIA 2R2WU 4H6TA 2BY7X 5EQSA 4FUEA 2UUKB 1TMBH 2J94A 3DD2H 3NXPA 1TRMA 3HK3B 1N8OB 2RFKC 2ZPSA 3HKIB 1OP2A 1RJXB 5AFYH 1QL9A 1SBWA 2H5DA 4DJZB 3G01A 3OTJE 5F8TA 1RTLA 3GCNA 3OAAD 3Q77A 5GIBA 2VWOA 3RLYH 4FOUC 2CXVA 2HVXA 1PYTC 1VITH 2FOAA 4JZDH 1TX7A 2C8XB 1SFQB 1TQ7B 5F53A 1O3BA 1S6HA 2FTMA 1TBRH 4K8YA 3ZZBA 1C5RA 2Y82A 1C2GA 4BXWA 4K1EA 1O37A 4YOJA 1AZZA 2G5NA 4Y79A 1EP6A 4FU8A 3NZIA 1SGQE 1C5YB 1QB6A 1YC0A 2PUXB 2V35A 1DLEA 2YOLA 4X1PU 1C5SA 1TBZH 2FESH 2PV9B 4ZKOU 4A7IB 2A1DB 3Q3YA 1HDTH 1QBOA 3ZZ4A 4OS4A 4X2VA 4NIWA 2A31A 3HGNA 4KTSA 1H8HD 1V6DA 4BTIB 1CVWH 3N99A 3Q00A 6CHAB 3TU7H 4DT4A 1O3HA 1BQYA 1K21H 2BM2A 3PMHB 1YCPH 6GCHF 5GCHF 5B6LA 4CBOA 3L33A 2ZU4A 2J2UA 1W7GH 5FPSA 4H42U 1CO7E 1TIOA 1T32A 4HTCH 4I86A 4AYYB 1XKBC 1FN8A 1LPZB 1A3BH 4IS5A 1AB9C 1WXRA 1UO6A 1ZLRA 1HIAA 1SI5H 3N7EA 3S7KB 2WHXA 4YOGA 1YPKH 2SGDE 2UWLA 1OHHD 2VBCA 3OY6U 4K2YA 1P9UA 1O31A 2WPIS 1AY6H 1K1JA 1E37B 1QGFA 1QURH 1SGIB 3A89A 1C1VH 4JZIA 1AHTH 2LNCA 3RU4D 1BTXA 1MTVA 3SV2H 7LPRA 3QTOH 4ABGA 3DHKH 2ZHDA 3ZZ8A 3RXSA 1NC6A 3ZVBA 1C1RA 1KXDA 2XCFA 4UD9H 1P09A 2K1QA 4O9VA 5B6OA 1BRUP 1FAKH 1GCDA 1Z7KA 2SGFE 2FO9A 2M5TA 1EKBB 1NFUA 2Z9LA 1AWHB 1C1WH 1C1UH 5KGOA 1GJ8B 3F0OA 5E8EH 1CSOE 1TABE 1OP8A 2A4OA 1G36A 3F68H 5EQQA 3RXHA 1TLDA 1AN1E 1SQRA 3RXGA 1GBIA 3TNTA 2Y5HA 1V2LT 3HKJB 1XX9A 3L3TA 3P17H 2BX4A 3RDZA 1ELCA 5T3HA 1PQAA 1CT4E 1DX5M 1BOQA 1H9LB 3E90B 4IGDA 1F2SE 1WOFA 2ZHWH 2OC8A 5E2PA 2HPQH 3FVFB 3MH6A 1ZMNA 3OFND 1TFXA 5L2ZH 4E05H 1XUIA 1MAXA 1VKYA 3FKSD 3A84A 1EAUA 3SU3A 1UHBA 2NU2E 1A1RA 1GBEA 2O8TA 4WJG2 4D8NA 2J95A 5L30H 2P3UB 8KME2 1QQUA 3EDXB 1TPPA 1LMWB 2O8UA 5A0CA 4ISLA 4O3UA 1S85A 1IQGA 2HNTC 2EI6A 3H7OA 2ODYB 4P02A 4I8JA 4ABDA 4YLQH 4O3TA 3TPIZ 4D9QA 1OOKB 3OEHD 2FI4E 1NU9A 1QZ8A 2Z9GA 2RCEA 1DICA 1O3AA 2ODQA 4RT1A 2ANWA 1QB1A 3FZZA 3UQOA 2QF4A 2J97A 3B23B 1C5WB 1H8DH 4THNH 4Z0KA 3TH3H 2G81E 1A5GH 1FUJA 1SL3A 1ETRH 1TMTH 1P11E 2DE8A 5F8ZA 4HGCA 2XC4A 4AGKA 3SZNA 1C2JA 4VGCC 1UVOA 2VIWA 1IQFA 1C1QA 1EP5A 1W8BH 2KZ4A 2VH0A 2VIPA 3MNCA 4WVPE 3AVZA 5FX5A 5I46H 3QO6A 1ELAA 5CMXH 4U2WA 1FY1A 2XBWA 2GJGA 1HNEE 1ANBA 1YBWA 2SGEE 3WWFA 1KXAA 5J4SA 1W0ZU 3SNEA 5LPFA 4IW4E 2SGQE 1PQ7A 1OSSA 1QNJA 4XRNA 2OXSA 1SOTA 2QGRA 2A4RA 3A8CA 4Y0ZE 4BAQB 2WUBA 4CRFA 6GCHG 1PPCE 4CH8B 2ALVA 2WPJS 3KYFA 3ATIA 1F5RA 4Z1MD 1WTGH 1PPFE 2PGQB 4Q7YA 3SV9A 3A7YA 2GZ9A 1L1GA 3MU8A 4FVBA 1O3EA 3RXEA 4ISOA 2AMPA 4DIIH 5K7RA 1N6XA 3QK1A 1ZTJA 4LK4A 1C1PA 5GDSH 3E3TA 3LC5A 5FCRA 3TITA 1GBAA 5EOKA 2TPIZ 3SNCA 5JBBS 3O8CA 2B0FA 1GHYH 3MNSA 1SGFG 2GCHG 1GHWH 2XWAA 2BXUH 1G32B 4B71A 1O2YA 1UTPA 1C2IA 4WMEA 3QUMP 3VB5A 3TJVA 2BZAA 7GCHF 4O03A 2XC0A 1MU6B 3ZZ5A 4DY7B 1O5FH 4FUJA 3S7HB 1T7CA 4AORA 5FBEA 1OX1A 2PTCE 3KQEA 1TX8A 1QHRB 4OM9A 1N6YA 1W0JD 3PMJA 3KQDA 1F0TA 3DSOA 2XTTB 2P8OC 3GDUA 1RXPA 2AGGX 3T5FH 4A5TS 5EPYA 1XUGA 2FS8A 1X7AC 2KCYA 3RMOH 3GCTF 1GBCA 1EQ9A 2ZDAH 1CGIE 2GMTC 1GBMA 4X2XA 2FMJA 2GTBA 1NROH 3RXCA 4ZKNU 2A2XH 1GJ9B 3EGKH 1OWJA 4AZ2B 2FOBA 3ELAH 5EODA 1AO5A 4B2BA 1EPTC 3L6PA 1JXPA 3WW7A 1Y5BT 4CH2B 1ELBA 4Q4LA 1WSSH 1TGCA 3SN8A 4BXSA 2XYAA 2CN0H 2D26C 1P57B 1L1JA 1BMNH 3R0FA 4D76A 2AYWA 1GDUA 2LELA 4TWWA 3I78A 4I7YH 3FN8A 1QRZA 1O2ZA 1YCPM 2ZGBH 3GCHB 3M3TA 3V7TA 1C1OA 3MTYA 3KYGA 1IQEA 1O2SA 1PPZA 3SUFA 1BDAA 1Q2WA 4BAHB 3NUMA 4D7FA 2YMSD 1ZYOA 3T29A 3BTME 2VVUA 1BA8B 1GGDB 3U9AH 1F5KU 5IDKA 3SYJA 5E0GA 3F2HA 2C90B 2XC5A 4WXIA 3T26A 3RLWH 5K0HA 1QRWA 2XBYA 2WSSD 1FIWA 2BY9X 3RC6A 4PROA 3NK8A 3OE7D 4BTTB 2FX4A 3M5NA 2H5CA 2EQNA 2XOKD 1SGYE 1MMJN 5FL7D 1GWAA 1UTJA 1O2GH 1TNLA 1RGQA 1LQEA 2SGAA 1UVSH 3KQ5A 4ZKRU 2ZDVH 3ZZ9A 2PHBA 3E1XB 1O32A 1O5DH 1SQOA 3CENA 3SU6A 3EA8A 3M37A 3BTEE 4ACAA 4MNVA 2ZU3A 2BDCA 1QTFA 3N7OA 2R0LA 1UTMA 1HUTH 5LH8A 2D8WA 2ZPQA 4JK5A 4MQAA 3PO1B 2BD3A 5FX6A 1EB2A 2FLBH 1GG6C 5ESBA 1XUFA 1O2RA 1W2KH 2G51A 3V12A 5J4QA 1E1RD 4YOIA 3TH4H 1L1NA 3K2UA
chains in the Genus database with same CATH topology
1CQQA 1ESTA 1Y5AT 2BD8A 1O2IA 2GD4B 3FANA 3BTDE 1EJAA 4OS2A 1MTNB 4MLFB 4B1TA 3SJIA 1GDNA 4CRCA 3HATH 3LGIA 1HJAC 1BMAA 1SGEE 2FTLE 2QV1A 1O5GH 4ZUHA 1KYNA 2C93B 1F0RA 1BUIA 1XVMA 2TRMA 2ZDMA 4LOYH 2BTCE 1SQTA 1UCYH 1CU1A 2Q1JA 3RC4A 2V3OH 3RXLA 3AW1A 4BAMB 1SC8U 1TOMH 1UCYE 2ZEBA 1GI7B 2QF3A 1AVGH 1NU7B 3UY9A 1TALA 1J16A 1ZRBA 6LPRA 1AUTC 2FOGA 2ZDKA 3RP2A 3DUXH 1SR5C 5DGJA 5EU8A 4HFPB 2VVVA 3D23A 2PR3A 3RXOA 4IC6A 2TIOA 3ZZ7A 2BDBA 4ABAA 2R3YA 4ABEA 1Y3UA 5A8ZA 2EI7A 3MHWU 4FVDA 4WMDA 1HIAB 1Y3YA 3LGTA 4UEHH 5EW2H 1J17T 4DCDA 3BEFB 2QAAA 4B76A 3U69H 5A0AE 1DY9A 1QRXA 4B2CA 3V13A 5FCKA 3JZ2B 3MI4A 2TGDA 2Y7XA 4K3JA 5G4BA 1THPB 1A61H 1TNJA 1EB1H 1TGSZ 4NA9H 2AFQB 4Z6AH 4O97A 1UK3A 1N1LA 2BDAA 1KXBA 2OQ5A 1GI6A 1LHFH 2QF0A 1K2I1 2ZF0H 1TYNA 1XUJA 4BTUB 4ABJA 4I31A 1Z6EA 1LVMA 2JETC 1C2HA 1S0QA 2UWPA 3GY4A 1HPGA 1MTWA 2A45B 4Y10E 5E2OA 3O8BA 1GBDA 3LONA 4CR9A 1NRNH 1QJ6B 1U6QA 5C67A 1T8NA 1GHAG 4XE4A 1XMNB 2J92A 1TPSA 5C2ZA 1BTZA 1GJ7B 2F9BH 4E7NA 1TNKA 1EJNA 2F91A 1QBNA 2GDDA 1MAYA 4RKOB 3WY8A 2BLWA 2W5EA 2A2QH 5EG4A 5GXPA 1FY3A 4BNRA 3TGJE 5C1XA 3SV6A 2BLOA 2GKVE 5GWZA 1ANDA 1TB6H 3STJA 4TYDA 2PKSC 1O30A 2XBVA 2C3SA 3A85A 4NCYA 3PWCA 1NFWA 3RXVA 2Z3DA 3RC5A 1YPLH 4TPYA 3SNBA 4Y71A 1RRKA 3QGNB 2R0KA 1BMLA 2PGBB 2BVXH 2V3HH 1SMFE 3RXPA 3GY3A 1ZPBA 3RXUA 1ELDE 3BG4B 3OU0A 1J8AA 5DO4H 2G4TA 2UUYA 1VGCC 4Y8YA 2EEKA 2BX3A 2WYGA 3UFAA 1HFDA 1HAOH 2RA3A 1NZQH 4JZFH 3RMNH 3T62A 1TNHA 5A0BA 4JCNA 3RUOA 3ZZDA 2ZCKP 4ISHH 3MYWA 1EUFA 1H9IE 1L2EA 1O36A 2Y7ZA 2ZECA 1IHSH 1AGJA 2NWNA 3VEQB 2THFB 1ID5H 1BZXE 1M9UA 1ZSJA 1SQAA 2BDIA 1LHEH 1WTHD 1GBHA 1UVUH 1YYY1 1PQ5A 1GHBG 1V2RT 3QWCH 1RTFB 2AMDA 1MU8B 2CHAB 2IJOB 8LPRA 1QJ1B 3LJOA 3LGVA 1HAGE 2GT8A 4WH6A 4ABHA 2ANMH 5DP9A 1O2UA 2QN5T 2QCYA 2ZGJA 1DUAA 2EI8A 2P3TB 1C5PA 3LGWA 1C5ZB 4Q80A 1TPAE 4XBBA 3TVJB 4X8VH 1KTTB 4CRDA 1RS0A 1DUEA 1ETSH 2FOMB 3AAVA 4FXGH 4INKA 1O3DA 3MNBA 3EA9A 2SNVA 1DLKB 4AG2A 1G3DA 3VGCC 1B5GH 1FPHH 2ZNKH 2H9EH 5F6MA 1EAWA 1F0UA 1YF4A 8ESTE 5L6NH 1A7SA 1GBBA 1BBRH 1AFQC 1AVWA 1K1PA 4X2YA 1ZJDA 4Q2KA 2VGCC 1BBRE 1EAIA 1DE7H 2ZCHP 4CHAB 2PLXA 2FOCA 3MH5A 4I8GA 3MU4A 5JB9S 3SGAE 4OS5A 4GCHG 2JH0D 1MTSA 1FY8E 2ZFPH 1UTKA 2BQ7B 1IQKA 4XSKU 1EOJA 1VJ9U 2GCHF 3SGQE 1SGFA 4M7GA 3U8OH 5ESTE 3HPTB 1UTLM 4X6MA 2P16A 1ANEA 3RXTA 2IN2A 4IN1A 1YPHE 1WCZA 4B75A 1O2OA 3FZDA 3Q76A 4NA7A 4X0WU 5CHAC 1P02A 2G00A 1DWCH 2W26A 1YCPK 1C2KA 1V2VT 4K8BA 1MQ6A 2BD4A 3SHCH 1C1SA 4WF8A 3ODDA 2NU4E 4IMZA 1P2OA 4MTBA 1UTQA 1HXEH 5EXMA 3U1JB 2YNAA 4LZ1H 3SUDA 1ELTA 2Z3EA 1BBRK 1MCVA 3IG6B 1CE5A 1T31A 3MH4A 3S69A 1F92A 3EE0B 1FY4A 1SLXB 1Z71A 4MPXA 2Z94A 4X1RU 1NN6A 3A7XA 1JMOH 1VCWA 1GI0A 1A5IA 2RG3A 4NSVA 2OC0A 1MH0A 1MCTA 1Q31A 4DGJA 3MH7A 4FU7A 1KDQB 3LH1A 1VCPA 1C4V2 2QXJA 2BVRH 1D4PB 1GCTC 1D3PB 1IQLA 1NS3A 3PTNA 3GYMA 1O3PB 2F9OA 1BITA 1HV7A 3O8RA 1K9OE 5LPRA 2Z9JA 1V2TT 1V3XA 4TY7A 1VITF 3PV4A 2C4FH 3U98H 1GJ5H 1DS2E 3M5OA 1BB0B 1EZSC 1K1NA 4BAOB 7ESTE 3A82A 1HAXB 3ZZAA 4INHA 2A5KA 1SGNE 1ABJH 3TJNA 1DM4B 1YGCH 1P01A 1TPOA 2ZHQH 1P3EA 4NIXA 4A92A 4MNYA 1O33A 4R0IA 1K1IA 1LVBA 3W95A 1OWIA 1SB1H 2WV5A 1C1MA 2B5TB 2TGAA 1O3LA 3TNSA 3NKKA 3EAJA 3UR9A 2ZQ2A 4YLUA 3MFJA 3MU0A 2ZIQH 2FM2A 1XUKA 4Y7AA 3BIUH 4CRGA 1MD8A 3PB1E 1ZSKA 3RXQA 2BDGA 4X8SH 1O2XA 4NZQA 1ESBA 1YLCA 4I8KA 2FIRH 3ESTA 1FQ3A 1AKSB 1GJBB 1C1TA 4SGAE 1TNIA 9LPRA 1L4ZA 4JYVH 2Z6BD 2ZGXH 2NU1E 4K69A 1GBTA 1KXCA 4GLYA 3GY5A 2VVCA 1LVYA 2J34A 3MO6A 3GY6A 3QDZB 5DP4A 4JYTA 1Y3VA 4KP0A 3SU1A 2CMYA 2JH5D 4Y7BA 1AB9B 4GAWA 3F9FA 3RXJA 4A1TA 3HGPA 3MU5A 3P70B 1OP0A 1VZQH 1A5HA 2BQ6B 2WV4A 5AF9H 1C5VA 1CBWC 4B2AA 3A83A 1OWDA 4TWYA 1DSTA 1PPEE 5JYIA 2SNWA 1S5SA 1CGHA 3SORA 5LGOA 5A2MH 3U8RH 3ZVCA 1LPGB 1GBJA 2O8LA 2V0BA 3M35A 4AYVB 3QZQA 1P06A 3RMLH 3B8JA 1ZMJA 2GDEH 3GOVB 4RN6A 5AFZH 3GY8A 3GY7A 1E34B 1Y3XA 4OS1A 1CGJE 1DXWA 1BHXB 1RIWC 2TGPZ 1AMHA 1QB9A 1AE5A 1KTSB 5E0HA 1ELFA 2ULLA 1SHYA 4MPWA 1S83A 2AERH 2ASUB 1DOJA 3A7TA 3A88A 1C2EA 3LIWA 4JYUH 1LDTT 3TK6A 2BDYA 1DDJA 3FAOA 2XWBI 1ZRKA 2FS9A 4KELA 2FDAA 4NGAH 1PPGE 2B7DH 2PSYA 4ZHLU 1HAHH 1EAXA 5EQRA 4WMFA 4ZH8A 3GY2A 4WWYA 4KGAA 2XNIA 2AGEX 1YPGH 3PMAB 2AH4X 1RD3B 1MKWH 4ISNA 1QQ4A 2OLGA 4F49A 1SG8B 1TAWA 1A3EH 3NPSA 3F6UH 1ZHPA 1UJ1A 1DANH 1FY5A 4WY3A 4Y11E 2IOTA 1YPEH 2GCTC 4Y8ZA 4YO9A 5FPYA 2H2ZA 3MU1A 5TCCA 4AN7A 4A1VA 4CBNA 1ZSLA 4DIHH 4GHTA 4DT7B 1A0HB 1KDQA 4ABFA 1J14A 1V2UT 2R3UA 3TGKE 1O2TA 2ZCLP 5C3NA 3T27A 1AD8H 3RXBA 1CHGA 2VNTA 1VITG 2BMGB 2ANYA 2OP9A 1ARBA 1WQSA 1O34A 1MQ5A 1S82A 4KKDA 3S9BA 2H9HA 2BD2A 4X8TH 1Q3XA 1ANCA 1OXGA 1SLUB 4FUFA 1K22H 3B9FH 4OGXA 3T2NA 4GPGA 3P8NA 2FLRH 1GHAF 8GCHG 3A87A 5JBTA 1T8LA 2OCVB 4IN2A 2ZO3H 1DWBH 4VGCB 2HALA 1PQ8A 3SJ8A 1JIMA 1O2HA 1Y59T 1WYKA 1GI1A 4KTUA 2QA9E 1HLTH 4F4OC 1TMUH 3Q3XA 4I8HA 2ZDLA 1E35B 3LOXA 1GJ6A 1YP9A 5A09A 3IWMA 3VPKA 1ELEE 3TGIE 1ZTKA 1SGRE 1NRQH 3E6PH 1HXFH 1HB0B 3U1IB 3BV9B 5JB8S 3OSYA 1THSH 5HYOA 1O2KA 2A7HA 1HBTH 1AKSA 1EZUC 3ODFA 4ZXXH 2FI5E 3TJOA 1NM6A 2XBXA 2ZP0H 3M7TA 1THRH 1IAUA 1CA0C 1XKAC 3ZYDA 2A4GA 2VU8E 1O5BB 5BPEA 3ATLA 1V2JT 3EA7A 4U01A 3ZV8A 2BB4A 1P03A 3LU9B 3ZVAA 1BTUA 2HGTH 1AFEH 3STIA 1ZJKA 1O3JA 1A0JA 1ZHRA 5DKMA 5T6FA 1TGBA 3M61U 4YTAA 1K28D 1FONA 1O3GA 3BTHE 4RSPA 1IOEA 3AAUA 1ARCA 1VR1H 3MMGA 3UR6A 4DOQA 3I77A 1HCGA 1W0YH 2XXLA 1D3QB 1CHOG 3E16B 1TGTA 4YT6H 4ZKSU 2ZTZA 4ZHAA 3O8DA 4CREA 5DG6A 1BCUH 1QBVH 1LVOA 1VCQA 2NU3E 1JBUH 2OBQA 3MO3A 3MWIU 3RMMH 1N8OC 2BOHB 2P95A 2FODA 3URDA 1OWEA 1GHBF 1ZTLA 1MTUA 2F9VA 1QA0A 1C5NH 2W3KA 2STBE 3ZZCA 1P8VC 2SFAA 1BHXF 1FJSA 1TOCB 1FV9A 2PUQH 1H4WA 3P95A 4H4FA 1AZ8A 4H6SB 3FP7E 1G3EA 1A0LA 1IQMA 2KAIB 2ZFRH 1D6RA 3LT3A 1J15A 1YM0A 2O9QA 3SHAH 3TLOA 2P8OB 1A4WH 3MNXA 4OGYA 1V2QT 2F9NA 3ZZ3A 4MPUA 5H4IB 4HI3A 1HAPH 1G3BA 1K1OA 5HGGA 2OC7A 1TA6A 2ESTE 4X6OA 3RU4T 4J2YB 2WPLS 2GMTB 1EZXC 1P0SH 1C4Y2 1DWDH 5DP8A 1E0FD 3QTVH 4K5ZA 5DJ7A 1O2JA 1BMMH 4GHQA 4BOHA 1EPTB 1O3MA 4B73A 3PROA 1A2CH 4MPVA 1HRTH 3EYDA 4X8UH 2ZG0H 3PM3A 2ZFFH 4OS7A 2QYIA 2HNTF 4MDSA 1OWKA 4UDWH 6CHAC 1NRPH 1W7XH 1GMHG 4MNWA 2C8YB 1OPHB 3LDXH 3SUGA 4AFSA 3A86A 2A0QB 2A5AA 1HAVB 4GCHF 3EQ0H 1C1NA 1YPHC 4ABIA 3UNSA 3U8TH 4NWKA 1BTHH 1UCYK 3AW0A 3A8DA 1SFIA 4K60A 1QA7A 1J9CH 1P05A 1BRCE 1XUHA 3D49H 1TBQH 2A32A 2ZTYA 1BTYA 1GBKA 3HK6B 2C8ZB 1XXFA 5CE1A 1C4U2 1JIRA 1XM1A 2ZWLH 1BRBE 5C5NA 2AIQA 1G3CA 1G2LA 1SSXA 2Y5GA 1GJCB 3RM0H 2ZFTA 1TONA 2ZTXA 1CT0E 3P6ZB 4FUHA 1ZMLA 1V2ST 1Z8RA 4GVUA 3SI4H 4K1SA 3SQHE 1Z1IA 4I33A 3D65E 3LJJA 2PTNA 1C5XB 3ATKA 1E36B 3RXKA 4UONA 1D3TB 1GI9B 2QXIA 1AUJA 4HZHA 3UIRA 1MZAA 1KLJH 1TQ0B 4Y76A 1MBMA 1MBQA 2Y6TA 1V2KT 4FUGA 4K1TA 4AG1A 3UQVA 1SGTA 1ELVA 1FNIA 1H9HE 1Y5UT 1WU1A 2GV7A 3SU2A 1FPCH 3P8FA 3CS7A 3A7WA 3V0XA 1E38B 3SNDA 3DFJA 2P94A 2ZFQH 3M3VA 4BAKB 3TK5A 2ZGHA 2Q6GA 4AFQA 1LKBA 5EXNA 4DG4A 4IBLH 4XBCA 1S0RA 1D3DB 1O39A 1ZGVA 2ZC9H 4ZHMU 5C5OA 4X6PA 1O38A 1P2KA 2STAE 3M7QA 3RXDA 1G37A 4SGBE 2VIQA 1F0SA 2OUAA 1VJAU 1W3CA 5ABWA 1GG6B 3F9GA 1TNGA 3GYLB 4IMQA 5T6DA 4DURA 1KSNA 3TH2H 2BY5X 2ILNA 1C5MD 1P9SA 5IYTA 3UOPA 1JWTA 9ESTA 1GMCG 4I32A 3GDSA 1YKTA 1EATA 3M5MA 4NG9H 1TE0A 1JOUB 2TBSA 1HJAB 1W11U 2OBOA 2R9PA 2BLVA 2GX4A 1ESAA 1NO9H 2Y80A 2W3IA 3I29A 3SJ9A 3ZVEA 1P10A 2B8OH 1NT1A 3A80A 4UFFH 2OQUA 2OINA 1T4VH 1L4DA 3KQBA 2LPRA 2BY6X 1F7ZA 1FN6A 1ZZZA 3DFLA 2HRVA 4IC5A 3DT0H 2KAIA 2Y81A 1O3NA 3ZVDA 6ESTA 1LKAA 1P2MA 3Q3KA 2ALPA 3QN7A 4J1YA 2W7UA 3NCLA 2GZ8A 1SLWB 3PMBB 3PTBA 3BTTE 1BIOA 1FIZA 3ZYEA 2FWWA 1NY22 2FX6A 3VFEA 1GJAB 1LPKB 3KIDU 4NA8A 1Z8JB 2I6SA 1C5QA 4E7RG 2PFEA 1O5EH 2FP7B 5E0JA 2TGTA 1GDQA 3S9CA 1IQNA 2FOHA 3RU4E 2BZ6H 4E06H 3KN2A 1JRTA 1MD7A 2A4QA 2H9TH 3E91A 3T28A 2XRCA 2OD3B 1EPTA 4UFGH 1O2WA 1O2PA 5A8YA 1LCYA 1O35A 1Z6JH 1S6FA 1FXYA 1SLVB 5DP6A 3BN9A 2ZHEH 1OKXA 2AIPA 3OX7U 2JETB 1HAVA 1B0FA 4Q7ZA 3ZVFA 1KLTA 1BRAA 2PKAB 3F9EA 1AWFH 2ZPRA 2FYRA 2A7CA 3H7TA 3UNRA 1O0DH 3AASA 2VJ