1XUIA

Trypsin-keto-babim, zn+2-free, ph 8.2
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Serine protease
total genus 52
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xuiA02
4BTIB 1Z6JH 3UFAA 4ABIA 4VGCC 1P10A 2GVFA 1KDQB 1BTUA 3GCNA 3V13A 4AZ2B 5F8XA 1HAZB 1AVGH 4NG9H 1O3HA 2CHAC 1ELDE 1INCA 3BTME 1P2NA 1G32B 1C5XB 1BZXE 2DE9A 4MG3A 1TGNA 3A7ZA 1J15A 1TGSZ 1T32A 2ZDKA 3EA8A 2ZHDA 1O33A 4FUBA 4O03A 1F0UA 4O97A 1E34B 4UONA 1GCTB 2G4UA 1TABE 3RP2A 1DUAA 4K1SA 1EP5A 4Q7YA 5AF9H 5FXLA 2ZA5A 4DCDA 1IQJA 1FQ3A 2FIRH 2QAAA 1C2MA 1MQ6A 1JIMA 4K3JA 2V3OH 3RU4D 3CENA 3S9AA 3TK9A 3SU3A 4UFGH 3STIA 3CS0A 1TOCB 3VGCB 4FUJA 1D3QB 3LGVA 1GJ5H 1ANBA 3GCTF 4K2YA 4NGAH 4NZQA 1TGTA 2Z9JA 1TBZH 1HAVB 1EB2A 1T8LA 3RXTA 1K22H 2FPZA 1YPHE 4HI3A 2ZTXA 4X2WA 2W3IA 4FUHA 1ZMNA 1SHYA 2TPIZ 4AX9H 1O32A 2ZO3H 1UCYH 1P8VC 3A86A 1L1GA 1C5LH 2FO9A 3GCOA 1P2IA 1PPHE 2WV4A 3DUXH 2CMYA 2FS9A 1P04A 1JRTA 2XRCA 4SGAE 1O5GH 2AMPA 3T29A 1SFIA 4LZ4B 1B0FA 3MOCA 3LU9B 4WMDA 2QC2A 4VGCB 4CH2B 3MU0A 3HKJB 3BIUH 1UTMA 4IMZA 4MVNA 3M5OA 4WVPE 4OGXA 3TH2H 3BTTE 4HZHA 2VVCA 1L1NA 2FLRH 3NCLA 3GY4A 3ZZ9A 3U1IB 1GMHG 3NUMA 3QO6A 1AO5A 1G9IE 2J38A 1OWJA 4NZLA 2C93B 4PROA 1V2WT 4ZUHA 1DOJA 1PPBH 4XBCA 4K69A 1GBJA 1ZYOA 2ESTE 1FY3A 4O3UA 1THRH 3BTQE 1G36A 2TBSA 5ESBA 4Y79A 1B5GH 3M3SA 2XW9A 3F68H 1O5DH 4TYDA 1VR1H 1C5MD 1SGTA 1UVOA 3SJOA 1TIOA 2VWNA 4WY3A 4YLQH 2ZHQH 1HNEE 4KGAA 5A09A 8GCHF 1S0RA 1VGCC 1NROH 3OX7U 3BEFB 4Y7BA 5G4BA 4WWYA 2SFAA 1MZAA 1EJNA 1Y3WA 1T31A 1F0TA 3TNSA 1DLKB 1A61H 3RC6A 5E0JA 4FVBA 3SV2H 1GBFA 1G3BA 3QLPH 2C8YB 1E38B 4O3TA 3Q77A 1LPKB 2BQ7B 5BRRE 3M61U 5DP5A 3RXCA 4IN2A 1MBQA 3W94A 1C1UH 1GHAG 2ULLA 5AHGH 3SNCA 2SGFE 3JZ2B 1YLDA 1D4PB 4NFFA 2P3TB 3RXQA 1HAHH 1BBRK 1C5PA 4FUEA 4KP0A 1MKWH 4Y0YE 1GJCB 2P16A 1SPJA 3TVJB 1PYTC 1MTVA 1AWHB 3KHVA 1DM4B 1Y5AT 3VB7A 3P92A 1O2JA 1Y3UA 2PKAA 3K65B 4JYVH 2B0FA 3KNXA 1O2TA 4E05H 2ZTYA 4MLFB 4ZXXH 1ARCA 1BJVA 1MU6B 2BMGB 1YKTA 1O5FH 1ZGVA 4RKOB 2G5NA 1J17T 3P17H 1W7XH 5EW2H 1ZPZA 2Y81A 3U98H 3QUMP 2FTMA 1XUHA 1BITA 1AVXA 2AS9A 4MNVA 1AIXH 2Z3DA 4ZHLU 3S9CA 2ILNA 1AKSA 4SGBE 1O2MA 1DE7H 1VGCB 1ESBA 2V35A 1H9HE 4UDWH 5JYIA 1AY6H 3OY5U 3E16B 1GBKA 3Q00A 4YM9A 3LH3A 4FVDA 3ODFA 5CE1A 5E2PA 1LHFH 2A2QH 1CGJE 2XC4A 4X8VH 1C1NA 2ZQ2A 1T7CA 1UMAH 3BTDE 5HYOA 1RJXB 2WPHS 1DT2A 2Y80A 3A84A 4JZ1A 3U1JB 1TNKA 3E6PH 3SNBA 1A0JA 1LPGB 3UOPA 1CA0B 5AFZH 4B2CA 1HJAC 5FPSA 1GI8B 2G55A 2BTCE 1EPTC 1THPB 1MZDA 1W7GH 2PSXA 2TRMA 1AGJA 1AFQC 1P2JA 5LPEA 5L6NH 1YCPH 4ABAA 4I7YH 3W95A 3R0FA 3MU4A 4B73A 3RMNH 3BG4B 1SI5H 2QXIA 5A0CA 1EAIA 2ZTZA 2H5CA 5EXNA 3ZZDA 1C5VA 2Y7XA 3K9XB 2XC0A 1TRYA 5J4SA 4K60A 5F8TA 2FOHA 2QCYA 1Z8JB 3TK6A 5DO4H 1U6QA 1C1SA 1O38A 5EQRA 2QV1A 2C3SA 1ZRKA 2YNAA 2LPRA 2BZ6H 2XCNA 3OY6U 4NA9H 3SU5A 3STJA 2A0QB 3EQ0H 1GJ4H 3SO3A 3A81A 2BVSH 1W11U 2HLCA 4IC6A 1HIAB 1D3PB 1DXPA 1SSXA 2QF3A 1OWKA 3FP7E 3RXOA 5IYTA 4X8TH 5DG6A 1TX8A 2EC9H 4INKA 5ESTE 2UWLA 1IQKA 1HJ8A 1AN1E 3O8RA 1XKAC 4KKDA 1LVMA 1Z6EA 1DWDH 1O2ZA 1UK4A 3FVFB 1TMUH 3Q3XA 2VNTA 1P9UA 2BZAA 4I8HA 1A0HB 2JH6D 3PMJA 1LMWB 4NA8A 3KQEA 1XXDA 2QA9E 1BTYA 1JIRA 1J8AA 2F91A 4YT6H 3TNTA 3RXVA 1QY6A 1UK2A 3PTBA 1HJAB 4K5ZA 1O5CB 5E8EH 4E06H 3TITA 7GCHF 2KAIB 2C90B 1EPTB 1W0ZU 4NSVA 4I8JA 4BAQB 1FV9A 1H8DH 1C5RA 3FANA 1O2GH 3LC5A 2VGCC 4DGJA 1ZMJA 2ZG0H 2ZPQA 1S0QA 1AFEH 5JBCS 1O2LA 4Q2KA 2ZFPH 4AFZA 4Y7AA 1O3JA 2V3HH 1Y5BT 5C5NA 2FOMB 3LKWA 3URCA 2ZFQH 4Y8XA 1V2QT 2OC8A 3FAOA 1YPMH 4U2WA 1SG8B 3V7TA 3A7WA 6GCHF 1HFDA 1Q31A 5K0HA 3QWCH 3SU4A 9LPRA 2YNBA 5FHTA 3RLWH 3RXRA 3ZV9A 1KXFA 1A46H 4FU9A 1QCPA 1EP6A 5TCAA 4BAOB 1ELCA 3TU7H 1TNLA 4AG1A 1GJAB 4J1YA 3TJVA 5T6GA 4MPUA 2GTBA 2XBVA 1QTFA 4ABFA 3PWBA 4B75A 2FM2A 1WUNH 3H5CB 1OXGA 5SGAE 2IOTA 1HB0B 5GIBA 4FUIA 3P70B 2A4OA 4NWKA 3SUFA 6ESTA 5AVDA 1XKBC 3TJUA 1UHBB 2G4TA 1IAUA 3JZ1B 2QXHA 1ARBA 3T62A 1N1LA 2G5VA 2ZU3A 3MNCA 2AIQA 1O3EA 2XNIA 1LVOA 1FAKH 2SGEE 1S6FA 2Z9GA 2ZU2A 2Z9KA 2BDHA 1GBDA 3ZVBA 3GY7A 1CVWH 2BYAX 3M36A 1YC0A 4FUGA 1BHXF 5A0AE 4RKJB 2VGCB 2W7SA 1WQVH 1V2RT 4DW2U 2ZHWH 1HUTH 1NFUA 4GHQA 3ZZBA 1FLEE 3UQOA 1MMJN 1BJUA 4NIWA 2SNVA 1MAXA 2BQ6B 1TQ7B 2OTVA 2GMTC 1PPFE 2J2UA 4YZUA 2BD7A 3ZYEA 1ZTLA 3ATMA 1IHTH 3RXGA 1SGIB 1O2IA 1TBQH 1OWEA 1DY8A 1O37A 3F9HA 1OSSA 3SU2A 3VB3A 1SGYE 2Q6FA 5JB8S 4NCYA 4GCHF 2OBQA 4ISOA 4K1TA 3FFGA 1C5ZB 1CHOG 1EASA 3GY3A 4M7GA 4O9VA 4RN6A 1BBRE 5LGOA 5GCHG 1HRTH 3MH5A 1YCPK 1ELEE 1FUJA 5DP6A 1O3PB 2BXTH 2JKHA 2PHBA 2HPQH 1ESTA 3RXAA 1O2NA 1LHEH 4YLUA 1SGDE 2ODYB 1T8NA 3A8BA 2PWXA 3NZIA 1UVTH 4A6LA 3BTGE 2ZF0H 2XWBI 1LQEA 1BMMH 5C1UA 2G8TA 3PROA 1LCYA 5FX5A 1BTPA 1A4WH 2RA0A 1E35B 4WJG2 3RMLH 2R0KA 1O2UA 1LHDH 1P2KA 2UUFB 5DJ7A 1K1MA 4INHA 4XOJA 2OBOA 3RMOH 1O3DA 1C2JA 4AFQA 3EDXB 1F5LA 1IHSH 3IG6B 3MTYA 1BBRH 1NFWA 4JZEH 2BB4A 1PQ5A 1O34A 1O2HA 2BQWB 2GDDA 4IMQA 3SV6A 2BX4A 4A92A 3D62A 1PFXC 2Z7FE 1SFQB 2GMTB 4JCNA 4X6NA 2AH4X 2WV5A 2GD4B 3TH3H 3GYMA 1QFKH 2O8MA 3TJOA 1BRAA 4K8BA 3SUEA 6CHAB 1P3CA 2XBYA 1K1OA 1TGCA 1Y5UT 3ENSB 1Z8GA 2F9OA 3LPRA 4YOJA 5HXFA 1A3EH 1F0RA 3GISB 3ZZ3A 2Q6GA 1V2MT 1BUIA 3MO6A 1HBTH 1ZHMA 4ISNA 3KQCA 2WYJA 3RXDA 1KTTB 1GCDA 1DY9A 1V2KT 1A0LA 1C5SA 2GCHF 3GDSA 1GBEA 2Y5FA 2GZ9A 4H4FA 2ZCLP 4I8LA 2H2ZA 2FZZA 1HXFH 1C5TA 1WV7H 4XDEA 3F9EA 1QJ6B 1W2KH 1P2QA 2VIWA 4H6TA 3T26A 4ASHA 3LGWA 4BAMB 5LH8A 3EYDA 4GPGA 2Y5GA 1D6WA 2ZEBA 2EI6A 3A87A 1Q2WA 2EEKA 2V6NA 2ZGCA 4H42U 3LH1A 2ZFFH 1SGRE 1HXEH 2XYAA 2HPPH 2QYIA 1S6HA 4YESB 1GVZA 1QB9A 3TLOA 2BY9X 4E7RG 4Y76A 4NWLA 1HIAA 1O3AA 1N6XA 1V2PT 3BEUA 2EI8A 3BTKE 1GBCA 1KXEA 4NFEA 2PKSC 1V2ST 2UWOA 2IN2A 1IQNA 2THFB 4B71A 2ANYA 2FODA 2PSYA 5FBEA 4ZHMU 1Z8RA 1IQGA 2ASUB 1KXBA 1TPAE 3A7TA 1C2EA 3G01A 1OP0A 1SQAA 1SBWA 1Z1IA 1WQSA 3SQHE 7ESTE 2OCVB 1KY9A 1TA6A 1V2VT 1Z8IB 3UIRA 2FX6A 2GGVB 1GJDB 1QB6A 1CBWB 4ZMAH 3QGJA 1C9PA 1TYNA 1TAWA 3PLBA 4ZKNU 2ANMH 1EOJA 1IQFA 2D26C 1O3OA 2FS8A 1C5YB 3SBKA 1FONA 1EPTA 2FX4A 1BMNH 1C1OA 3MWIU 3V0XA 5E0GA 2ZP0H 2VIVA 3P8FA 4Y10E 4KELA 3TJNA 5I46H 2G51A 3AW1A 1GPZA 1YPEH 1A7SA 1GHAF 4AGKA 1BCUH 4DOQA 1C5UA 2GP9B 2NU0E 1AUJA 5GDSH 2HNTE 2VU8E 1BDAA 1O0DH 1FY8E 3SQEE 1CE5A 1ZRBA 1DWBH 1O2SA 2A4QA 4CHAC 1MTNC 2WPIS 2SNWA 1SLWB 1EX3A 1MTWA 1OWHA 4FUFA 3SNDA 2F9NA 4OS5A 4MTBA 1AUTC 2Z3EA 2HOBA 4Q80A 5CHAC 1EJAA 2FOGA 2AERH 2PTCE 3ZZ7A 1YPGH 3N7OA 1O3NA 8LPRA 2SGAA 2ANWA 3ZVGA 1F7ZA 2PKSB 1AHTH 1W8BH 4R8TB 2BDCA 3HGNA 2ZDVH 2WPKS 1YCPM 2VIOA 3IITA 1ZTJA 3UREA 2FESH 1TOMH 1NFXA 3SJ9A 1LKBA 2GKVE 3BF6H 4ZKOU 2FOAA 1XMNB 2W3KA 1UHBA 1ACBE 2ZU4A 2CF8H 1LVYA 1O2XA 2VWLA 3C1KA 3HK6B 9ESTA 1P05A 3M7QA 3RXKA 1CA0C 2SGPE 1MUEB 4UD9H 2VJ1A 3VB5A 4GVUA 1FIZA 4ABHA 1O36A 1GI4A 4AOQA 1DVAH 5DP9A 5HM2A 2GV6A 1NRRH 1ZTKA 1NPMA 2B5TB 1EZQA 1MTUA 2Z9IA 1YPKH 3RM0H 2Z9LA 1P57B 1DPOA 3PLKA 8KME2 3BG4C 3QDZB 1BIOA 4ABGA 1SGEE 3E3TA 4UFDH 1SL3A 4CREA 3GYLB 4Z6AH 3UNSA 3SUGA 4JZIA 2J92A 4CHAB 1MTNB 1WTGH 3O8CA 1YLCA 2W5EA 1K21H 1ZR0A 2BY8X 1ELGA 1GI5A 1T8MA 1ZHPA 4X8SH 4AB8A 3NK8A 3QX5H 5CHAB 3RXBA 1GMDG 1LO6A 2GT7A 3LDXH 2A31A 4BNRA 2R9PA 1FDPA 3EE0B 1SGCA 1MU8B 1GG6C 1TRMA 4ABDA 4A7IB 1AE8H 1M9UA 4CRAA 4KTUA 1NC6A 1ZSLA 1AQ7A 4ISLA 2TGTA 4MPWA 1C5QA 3EA7A 5JBTA 3ESTA 1NU9A 8GCHG 4UFEH 1V6DA 2BX3A 3VB4A 4I8GA 2NWNA 3RXEA 1SOZA 1GI0A 4YT7H 2GV7A 3GY6A 3RXJA 3A7XA 1TA2A 2F9VA 2WPJS 1SGQE 4KTSA 3V12A 1AWFH 1DITH 4LK4A 1C1QA 1PPEE 2R0LA 2Z6BD 1LPZB 1WCZA 5FAHA 2F3CE 2O8LA 1QJ1B 1UTLM 4BOHA 8ESTE 2BHGA 2ZZUH 2A1DB 1GI6A 3L6PA 2Y82A 1LDTT 3Q3KA 1UK3A 1XXFA 3D49H 4X1QU 1P9SA 4K8YA 4I8KA 4NIXA 1HYLA 4MNXA 1C1WH 2JH5D 5EPYA 3A8CA 3TGKE 2AGEX 4X6MA 4AYVB 1NFYA 1UTNA 4UEHH 2BM2A 3GOVB 1MQ5A 1P03A 1QBNA 1SGFG 1IQMA 2I6QA 1C1PA 3IWMA 1T4UH 1TALA 4CRFA 2ZFTA 2VINA 1DSTA 4CBNA 1KLJH 3HATH 1C5NH 1LVBA 3ZVEA 1F5RA 1L4DA 3U69H 1SGNE 3P95A 2C8WB 5C5OA 4X2VA 1JBUH 3S9BA 2C4FH 1GDQA 4JK5A 1HDTH 2UUKB 3KN2A 4GAWA 5E0HA 2O8UA 1KDQA 1GG6B 2GDEH 2QF0A 1P3EA 2GT8A 4F49A 4CH8B 1DS2E 1PQ8A 2OC0A 3SGAE 3SV9A 1V2JT 1ZGIA 3RC4A 2TIOA 5HM9A 1L0ZA 1BHXB 1TPOA 5JBAS 3A83A 5TJXA 1YYY1 2OP9A 5C67A 2AGIX 2SGQE 1B0EA 1OYQA 1DANH 5T6DA 5FBIA 1GL1A 4YTAA 4LXBH 1VITG 1K1PA 2ZGBH 2ZFSA 3RM2H 1P01A 2ZHFH 2A7JA 1AZ8A 2H9EH 1TX7A 1SR5C 3NXPA 4ZKRU 1UJ1A 1GVLA 5DP8A 3DT0H 3ZZ4A 1QQ4A 5HMAA 2W26A 1O30A 5DK1A 2ZGXH 1NZQH 1RD3B 1ELAA 1QGFA 3S7KB 1KSNA 3RXHA 1C2IA 3MO3A 1P09A 3P8GA 1ZPCA 1ETTH 3SHAH 3GY8A 1D9IA 4UE7H 1V2UT 5B6OA 1ID5H 1XUGA 4WH6A 1PQ7A 1J16A 1ABJH 1LQDB 1TGBA 2OUAA 1UVPA 3ZZAA 3TK5A 4CRGA 3E0PB 4ZXYH 1HAVA 1NESE 1O31A 1WSSH 3UY9A 4BTTB 4MDSA 4MNYA 1FIWA 3FP8E 4D76A 2RG3A 1XUFA 4X6PA 1QRXA 3E90B 1E0FD 1C2DA 2FI5E 2FOCA 2OC7A 1ORFA 4WXIA 3SZNA 1HAGE 1MBMA 4ZROA 2ZQ1A 1ETSH 1BRCE 1RFNA 3A7YA 1ZLRA 2WUCA 2W7UA 1L4ZA 3A8DA 5FCRA 1W10U 3UUZA 3NPSA 2QGRA 1GBHA 3SI4H 3AVZA 4YO9A 1LKAA 1OX1A 1P0SH 2P3UB 2PGBB 3L33A 2ZHEH 3O8BA 3UOUA 2RA3A 1AD8H 1UTPA 1A5HA 4U30A 4TY7A 2C8ZB 2NU2E 5T6FA 1ZJKA 4YOGA 1WAYB 2P95A 1BTHH 2WPLS 3S7HB 4XFQA 3VEQB 1C2GA 4OGYA 2PTNA 1FN8A 5GPIB 4INLA 1NO9H 1GJ6A 1MCTA 1HCGA 5F8ZA 2R3YA 1KXAA 1BQYA 2D8WA 1SC8U 1FPCH 1G2MA 3SHCH 1THSH 2O8TA 3TIUA 2EI7A 1TWXB 4YOIA 2ZCHP 3BTEE 2WYGA 1FI8A 1QNJA 5EG4A 1GHVH 1TPSA 1HAXB 2A4GA 4IC5A 3BTWE 3MH7A 4GUXA 1V3XA 1QB1A 1ANDA 2D1JA 3QZQA 1CHGA 2FMJA 1UVUH 5E2OA 2G00A 4H6SB 2P8OC 2OINA 1ETRH 1H8IH 6CHAC 3U8TH 2OQ5A 1MD7A 4WH8A 1BRBE 4BTUB 1EUFA 4D8NA 1T4VH 3RDZA 5DKMA 1Y3YA 1G3CA 3A85A 2Q6DA 1IQIA 1G3DA 1C4Y2 2QN5T 2Z3CA 2Y5HA 2CN0H 2R3UA 4AORA 1S84A 5F03A 3ZVDA 4DURA 1NM6A 5EPNA 1F0SA 2GCTC 1J9CH 2PKAB 4Y71A 3E0NB 1QA7A 1ZSKA 2O8WA 4WF8A 4MPXA 1Q3XA 3PWCA 4XBBA 1DXWA 3P6ZB 5C1XA 5L30H 3ZVCA 5A8XA 3MNBA 1QL7A 3SUDA 4DIIH 3Q3YA 1YPLH 1EAWA 3OYPA 4A1TA 1GMCG 4HGCA 1FJSA 2H9TH 1HAYB 2ZKSA 4KTCA 4U01A 2C8XB 1H1BA 1O5AB 3ATWA 2G81E 1Y59T 3MU5A 1C9TA 1FY1A 3A89A 1AKSB 1Y3XA 1DSUA 1O39A 3Q76A 5JDUB 4HTCH 4CRBA 3RLYH 3ZVAA 3RXPA 1O3MA 1JOUB 2H9HA 2A5IA 3ODDA 5TCCA 4X1NU 2PUXB 3F6UH 1QHRB 1K1JA 3ZZ8A 1AZZA 4DY7B 2VVVA 1XUJA 1TONA 2FI4E 3RXIA 3SORA 3KGPA 1F2SE 1ZPBA 1FY5A 3EAJA 1W13U 1OOKB 3T27A 2EA3A 3GY5A 1DWCH 1QR3E 3FZDA 1O3FA 1ELBA 1O3BA 2P8OB 1SHHB 2PUQH 2XC5A 1PYTD 4CBOA 2TGDA 3MO9A 1O3CA 2AYWA 1ELFA 1S83A 2AGGX 5FPTA 1A3BH 1CBWC 2AIPA 1GI1A 2ZU5A 4MNWA 1EZSC 1NRQH 5ABWA 2QXJA 2BY7X 3SJKA 1V2NT 5JPMH 2H6MA 4A1VA 3SNAA 2K1QA 1IQEA 4J2YB 3PM3A 5H4IB 3FP6E 4THNH 1MCVA 3KF2A 4DG4A 2GCTB 1TNJA 1L2EA 2PW8H 3T25A 1W14U 4AFUA 1RTKA 1C2HA 1AB9B 4B1TA 1GI3A 3PLPA 3MH6A 4TPIZ 3F1SB 1Z1JA 2OQUA 2VVUA 3I77A 2J9NA 3GDUA 1AE5A 3SN8A 1VCWA 2BD8A 2CGAA 2J4IA 1D6RA 2F9BH 2AMQA 2VIPA 1SQTA 2ZIQH 3KIDU 1WTHD 1LHCH 1O5BB 1IQLA 1GHBG 2CV3A 1NRSH 1FY4A 2PLXA 3OSYA 3VPKA 1K2I1 3PMAB 1O2VA 5F6MA 1XVOA 2VIQA 4IGDA 1GMHF 1BTXA 3MHWU 1DX5M 2CJIA 3GY2A 3HKIB 4JZDH 1VZQH 2HNTF 3LT3A 1CQQA 5PTPA 5FX6A 1S82A 2CXVA 1ELVA 1K1LA 1DFPA 2G52A 1O2PA 2FWWA 1OKXA 4X1SU 1SGPE 1AI8H 1FNIA 1UCYE 1V2OT 3BV9B 3B23B 3KQDA 3PV4A 4ISIH 4F4OC 3RU4T 1WU1A 1AVWA 1ABIH 2BD3A 2A5AA 2VWMA 3BSQA 4IBLH 1KLTA 2BD2A 2QIQA 1QL8A 1F92A 5C3NA 1XUKA 3CS7A 1ZSJA 1F5KU 4RSPA 1O2RA 3TH4H 2BOHB 1BOQA 3M37A 3SV7A 2ALPA 4GSOA 5T3HA 1GHWH 3UWJH 3M7TA 4NIVA 3HPTB 4B2AA 1LTOA 2XBWA 1CSOE 2STBE 2OLGA 1HGTH 2Y7ZA 1DWEH 2KAIA 1ESAA 3PO1C 1CGIE 1A2CH 2OXSA 1VJAU 3KCGH 3SOSA 1SVPA 2I6SA 1BMAA 1GHXH 3SGQE 1KLIH 2F9PA 1K9OE 4IS5A 1GBMA 1N6YA 2GCHG 2WUBA 4CRCA 5HGGA 7KMEH 3AW0A 3SGBE 2CHAB 4BAKB 1RGQA 1T8OA 1EAUA 5EOKA 4NSYA 5EQSA 3UQVA 2ODPA 3MYWA 1K28D 3L3TA 5DP7A 1E36B 1XX9A 3M3TA 1GVKB 1FN6A 1H4WA 4FU8A 2FOEA 1PQAA 1MKXK 2FXRA 2NU1E 4NA7A 3MU8A 1BTWA 3SJ8A 2ZDNA 2WINI 1ZHRA 4FUDA 1ZZZA 5JBBS 1DDJA 5EGMA 1V2LT 2H1UA 1EQ9A 2BDAA 1GMDF 2ZECA 3GCTG 3M5LA 1JRSA 1G2LA 2B7DH 4ESTE 5EXLA 3UPEA 3HK3B 1E37B 1QIXB 5EODA 2FOBA 1KIGH 2FYQA 4D7GA 1CT2E 3T5FH 3LIWA 2VB0A 3RXLA 1CU1A 2BLOA 3KQBA 1VJ9U 4BXSA 1UO6A 5ETXA 2CF9H 4GLYA 1XM1A 4NIYA 2DE8A 2ZC9H 1SOTA 3PO1B 4MPVA 1SQOA 1G37A 3DFLA 1P2OA 1EB1H 2ZWLH 1O5EH 2A7CA 2BDBA 3RXUA 2A7HA 2UUYA 1QRZA 3URDA 2BLVA 2BD5A 1W0YH 5GJ4B 3ZV8A 1OWIA 1MD8A 1FXYA 4DT7B 1BB0B 3VXEH 1TNHA 1GJ7B 1O2QA 1O3KA 3FZZA 5AFYH 2DUCA 1SB1H 3O8DA 3GICB 1GI9B 3K2UA 3OTJE 1TBRH 1GBTA 1WYKA 2BXUH 4AN7A 2RCEA 1D3TB 4CR9A 4ABJA 5L2YH 4OS2A 4X0WU 3TGIE 3LGTA 2LNCA 1AMHA 4X6OA 3RXSA 2FYRA 1BTZA 4A5TS 4X2YA 1O3IA 2BVRH 2IPHA 3DA9B 1G3EA 1X7AC 1P02A 4TWYA 3MMGA 1NRPH 4OS1A 3SNEA 1S81A 4QT8C 1JXPA 1A5IA 3ZZCA 3BEIB 2OC1A 1P11E 3S0NA 1C4U2 1FPHH 4GHTA 5DP3A 3E91A 1C2KA 1QURH 1ZMLA 4Z0KA 1RTLA 2JH0D 2VWOA 1DLEA 4LZ1H 1B7XB 2ZU1A 1KTSB 2STAE 1BRUP 2XXLA 2HRVA 3BTHE 1BT7A 3RXMA 6LPRA 3S69A 1JMOH 3TPIZ 2FEQH 3UNRA 2BY5X 5EXMA 3UTUH 3PMHB 1VITF 2V0BA 3KL6A 1GWAA 1CT4E 1PPGE 4AG2A 2PV9B 3E8LA 4Y8YA 3UWIA 1EAXA 1TX6A 1ZJDA 1UTOA 2ZPRA 1AU8A 3DFJA 1HAIH 2ZFRH 2FTLE 3QN7A 2BDIA 4I33A 3GCHC 7LPRA 2QXGA 3T28A 4AFSA 1YF4A 3M7UA 2RDLA 1TNIA 2GX4A 2Q1JA 2XCFA 4K1EA 4FU7A 1Y8TA 4Y0ZE 1RIWC 2YOLA 5A2MH 5BPEA 1O2WA 4JZFH 1RS0A 1K1IA 2J95A 2NU4E 4WMEA 2M5TA 1XUIA 1LHGH 2FLBH 1QRWA 2ZDAH 3ELAH 2ALVA 3NKKA 4DJZB 1ANCA 1DICA 3RXFA 1QQUA 2BDYA 1DUEA 1UTJA 3OU0A 2BLQA 1HLTH 1O35A 1KYNA 1S5SA 2P59A 4Y11E 1UVSH 3ITIA 4BAHB 3EA9A 2ZDMA 1EKBB 3H7TA 5A8ZA 2B8OH 2FP7B 1GI2A 2ZGJA 1UCYK 1RXPA 1C1TA 4X1PU 4JK6A 3ATIA 2ZPSA 4AYYB 1PJPA 1QA0A 1W12U 1O2OA 1O3LA 2SGDE 1GHYH 5A8YA 2R2WU 2BD4A 5J4QA 1K1NA 1TMTH 3M3VA 3ZZ6A 1NS3A 1WBGB 2AEIH 2PGQB 4BXWA 4BANB 1SLUB 2XTTB 2O9QA 3F9GA 3PMBB 2VH6A 3KEEA 2JETC 3M5NA 5K7RA 1HAOH 1EJMA 1EZUC 4HFPB 1FZZA 1C1MA 1HJ9A 1A1RA 4AB9A 1GL0E 5C1YA 2VIDA 1C1VH 4D9QA 1UTQA 2HVXA 2QY0B 2Z94A 2F83A 3MI4A 4I32A 3MNXA 2BD9A 1OS8A 1C2FA 3H7OA 1XVMA 3EGKH 3P8OA 1CO7E 5I25A 2A4RA 2P3FH 3B8JA 1VCQA 2J94A 1KXDA 3QTVH 2ZI2H 2BY6X 1YPHC 3GCHB 1J14A 3M5MA 3SU0A 1ANEA 2R2MB 3E1XB 3MNSA 3LONA 1Y3VA 1HV7A 1PPCE 3VFEA 1RIWB 1AFQB 2HWLB 1GGDC 1GI7B 1VITH 1BA8B 2ZNKH 2FDAA 1NY22 3RUOA 1C1RA 1MAYA 2F9UA 1SGFA 3V3MA 4IN1A 3MU1A 2B9LA 4OS4A 4Y8ZA 3RC5A 3LOXA 4ZKSU 3AAVA 2AMDA 4JMYA 1OP8A 1CT0E 3BIVH 2ZCKP 2GZ7A 1D3DB 1W3CA 1EOLA 1N8OC 1SLVB 1UTKA 2FOFA 1O3GA 3T2NA 1OWDA 1TNGA 1RTFB 3LJOA 3LGUA 3MFJA 3SW2B 3A80A 4ISHH 1TB6H 2HNTC 2XWAA 1Z7KA 1G30B 1CHOF 5DPAA 5GCHF 4ABBA 1FMGA 3RMMH 5DP4A 1TMBH 1YM0A 1IOEA 1H9LB 3WY8A 4X8UH 2JETB 5FCKA 1GMCF 1QL9A 1O2YA 1EATA 3PYHA 1GBLA 1MKWK 3F9FA 1EZXC 5JB9S 5L2ZH 1ELTA 1IQHA 4Q7XA 4WXVA 4IW4E 1FAXA 4R0IA 3R3GB 7GCHG 5IDKA 1GJ9B 1QJ7B 2A32A 1RRKA 5C20A 1V2TT 2PFEA 3BN9A 3PB1E 1YBWA 2Y6TA 2FI3E 3I78A 4FXGH 1GDUA 2TGAA 3VXFH 5CMXH 3GDVA 5GXPA 1GDNA 1H9IE 3SI3H 4E7NA 3SJIA 1OYTH 3QGNB 3QZRA 2BLWA 1GHZA 3A82A 3ZZ5A 1GGDB 5LPFA 2BOKA 3ZVFA 3UNQA 4OS6A 4CRDA 3TGJE 3LJJA 4XSKU 3AASA 1OP2A 1JWTA 3SU1A 6GCHG 1NRNH 4X2XA 1MKXH 4AGJA 3HGPA 3CP7A 3M35A 2NU3E 3C27B 5DGJA 5EU8A 4A1XA 4FUCA 2ANKH 5FPYA 3BG8A 1NU7B 2HALA 1TRNA 1NTPA 3U9AH 3I29A 3LC3A 1NN6A 3QK1A 1EXFA 1N8OB 1P06A 3ATLA 1GBAA 1P2MA 4Q7ZA 3AAUA 3U8OH 3QTOH 4D7FA 2WPMS 3UR6A 2A5KA 1TQ0B 1YGCH 1OPHB 1AB9C 2BVXH 3PTNA 3ATKA 4D9RA 4UFFH 2PR3A 4ZHAA 5EQQA 1MH0A 1TLDA 4DIHH 4CR5A 3LGYA 4OS7A 3K6ZA 1KXCA 1HAPH 2ZGHA 1YP9A 3K6YA 3P8NA 2ODQA 4ZH8A 1CA8B 4B76A 1C4V2 1GBIA 2D2DA 2J34A 4Y6DA 3A8AA 4JYTA 1SMFE 4B74A 1CGHA 2OD3B 2VH0A 3MH4A 1GHBF 1L1JA 2GZ8A 1O2KA 2H5DA 4TWWA 4XBDA 2UWPA 1TPPA 2P94A 1GCTC 2IJOB 4ABEA 3DHKH 4WMFA 1VCPA 3LGIA 1A5GH 1C5WB 3VB6A 3D65E 3BTFE 5LPRA 4XE4A 1QBVH 4TPYA 2XBXA 3ZYDA 4DVAU 1GBBA 2BDGA 5C2ZA 1MTSA 1NT1A 4X1RU 1TFXA 4TY6A 3UR9A 2ZDLA 4I31A 1TE0A 2P93A 2A2XH 3SU6A 1GJBB 3VGCC 5A0BA 1ZOMA 1YPJH 2HGTH 4ZAEA 2AFQB 3D23A 1C2LA 2TGPZ 1PPZA 1WOFA 3B9FH 1C5OH 1P12E 3NWUA 4MQAA 2A45B 3A7VA 3A88A 4JYUH 3SV8A 1GJ8B 4GCHG 3RU4E 1SLXB 3U8RH 5GWZA 3DD2H 4U32A 5EW1H 1Z71A 1HPGA 1QBOA 1BMLA 2UUJB 4B2BA 1S85A 4LOYH
chains in the Genus database with same CATH superfamily
4BTIB 1Z6JH 3UFAA 4ABIA 4VGCC 1P10A 2GVFA 1KDQB 1BTUA 3GCNA 3V13A 4AZ2B 5F8XA 1HAZB 1AVGH 4NG9H 1O3HA 2CHAC 1ELDE 1INCA 3BTME 1P2NA 1G32B 1C5XB 1H8ED 1BZXE 2DE9A 4MG3A 1TGNA 2RDEA 1E79D 3A7ZA 1J15A 1TGSZ 1T32A 2ZDKA 3EA8A 2ZHDA 1O33A 4FUBA 4O03A 1F0UA 4O97A 1E34B 4UONA 1GCTB 4XRNA 2G4UA 1TABE 3RP2A 1DUAA 4K1SA 1EP5A 4Q7YA 5AF9H 5FXLA 2ZA5A 4DCDA 1IQJA 1FQ3A 2FIRH 2QAAA 1C2MA 1MQ6A 1JIMA 4K3JA 2V3OH 1H8HD 3RU4D 3CENA 3S9AA 3TK9A 3SU3A 4UFGH 3STIA 3CS0A 1TOCB 3VGCB 4FUJA 1D3QB 5KEDA 3LGVA 1GJ5H 1ANBA 3GCTF 4K2YA 4NGAH 4NZQA 1MABB 1TGTA 2Z9JA 1TBZH 1HAVB 1EB2A 1YY3A 1T8LA 3RXTA 1K22H 2FPZA 1YPHE 4HI3A 2ZTXA 4X2WA 2W3IA 4FUHA 1ZMNA 1SHYA 2TPIZ 4AX9H 1O32A 2ZO3H 1UCYH 1P8VC 3A86A 1L1GA 1C5LH 2FO9A 3GCOA 1P2IA 1PPHE 2WV4A 3DUXH 2CMYA 2FS9A 1P04A 1JRTA 2XRCA 4SGAE 1O5GH 2AMPA 3T29A 1SFIA 4LZ4B 1B0FA 3MOCA 3LU9B 4WMDA 2QC2A 4VGCB 4CH2B 3MU0A 3HKJB 3BIUH 2AHME 3N7EA 1UTMA 4IMZA 4MVNA 3M5OA 4WVPE 4OGXA 3TH2H 3BTTE 4HZHA 2VVCA 1L1NA 2FLRH 3NCLA 3GY4A 3ZZ9A 3U1IB 1GMHG 3NUMA 3QO6A 1AO5A 1G9IE 2J38A 1OWJA 4NZLA 2C93B 4PROA 1V2WT 4ZUHA 1DOJA 3SZEA 1PPBH 4XBCA 4K69A 1GBJA 1ZYOA 2ESTE 1FY3A 4O3UA 1THRH 3BTQE 1G36A 2TBSA 5ESBA 4Y79A 1B5GH 3M3SA 2XW9A 3F68H 1O5DH 4TYDA 1VR1H 1C5MD 1SGTA 1UVOA 3SJOA 1TIOA 2VWNA 4WY3A 4YLQH 2ZHQH 1HNEE 4KGAA 5A09A 8GCHF 1S0RA 1VGCC 1NROH 3OX7U 3BEFB 4Y7BA 5G4BA 4WWYA 2SFAA 1MZAA 2WZQA 1EJNA 1Y3WA 2J98A 1T31A 1F0TA 3TNSA 1DLKB 1A61H 3RC6A 5E0JA 4FVBA 3SV2H 1GBFA 1G3BA 3QLPH 2C8YB 1E38B 4O3TA 3Q77A 1LPKB 2BQ7B 5BRRE 3M61U 5DP5A 3RXCA 4IN2A 1MBQA 3W94A 1C1UH 1GHAG 2ULLA 5AHGH 3SNCA 2SGFE 3JZ2B 1YLDA 1D4PB 4NFFA 2P3TB 3RXQA 1HAHH 1BBRK 1W0KD 1C5PA 4FUEA 4KP0A 1MKWH 4Y0YE 1GJCB 2P16A 1SPJA 3TVJB 1PYTC 1MTVA 1AWHB 3KHVA 1DM4B 1Y5AT 3VB7A 3P92A 1O2JA 1Y3UA 2PKAA 3K65B 4JYVH 2B0FA 3KNXA 1O2TA 4E05H 2ZTYA 4MLFB 4ZXXH 1ARCA 1BJVA 1MU6B 2BMGB 1YKTA 1O5FH 1ZGVA 4RKOB 2G5NA 1J17T 3P17H 1W7XH 5EW2H 1ZPZA 2Y81A 3U98H 3QUMP 2FTMA 1XUHA 1BITA 3OEHD 1AVXA 2AS9A 4MNVA 1AIXH 2Z3DA 4ZHLU 3S9CA 2ILNA 1AKSA 4SGBE 1O2MA 1DE7H 1VGCB 1ESBA 2V35A 1H9HE 4UDWH 5JYIA 1AY6H 3OY5U 3E16B 2LP6A 1GBKA 3Q00A 4YM9A 3NRLA 3LH3A 4FVDA 3DSPA 3ODFA 5HIZA 5CE1A 5E2PA 1LHFH 2A2QH 1CGJE 2XC4A 4X8VH 1C1NA 2ZQ2A 3MQKC 1T7CA 1UMAH 3BTDE 5HYOA 1RJXB 2W6JD 2WPHS 1DT2A 2Y80A 3A84A 4JZ1A 3U1JB 1TNKA 3E6PH 3SNBA 1A0JA 1LPGB 3UOPA 1CA0B 5AFZH 3UAIC 4B2CA 1HJAC 2XNDD 5FPSA 1GI8B 2G55A 2BTCE 1EPTC 1THPB 3WW7A 1YWUA 1MZDA 1W7GH 2PSXA 2TRMA 1AGJA 1AFQC 1P2JA 5LPEA 5L6NH 1YCPH 4ABAA 4I7YH 3W95A 3R0FA 3MU4A 4B73A 3RMNH 3BG4B 1SI5H 2QXIA 5A0CA 1EAIA 2ZTZA 2H5CA 5EXNA 3W1EA 3ZZDA 1C5VA 2Y7XA 3K9XB 2XC0A 1TRYA 5J4SA 4K60A 5F8TA 2FOHA 2QCYA 1Z8JB 3TK6A 5DO4H 1U6QA 1C1SA 1O38A 5EQRA 2QV1A 2C3SA 1ZRKA 2YNAA 2LPRA 2BZ6H 2XCNA 3OY6U 4NA9H 3SU5A 3STJA 2A0QB 3EQ0H 1GJ4H 2LELA 3SO3A 3A81A 2BVSH 1W11U 2HLCA 4IC6A 1HIAB 3F0OA 1D3PB 1DXPA 1SSXA 2QF3A 1OWKA 3FP7E 3RXOA 5IYTA 4X8TH 5DG6A 1TX8A 2EC9H 4INKA 5ESTE 2UWLA 1IQKA 1HJ8A 1AN1E 3O8RA 1XKAC 4KKDA 4B6FA 1LVMA 1Z6EA 1DWDH 1O2ZA 1UK4A 3FVFB 1TMUH 3Q3XA 2VNTA 1P9UA 2BZAA 4I8HA 4ASUD 1A0HB 2JH6D 3PMJA 1LMWB 4NA8A 3KQEA 1XXDA 2QA9E 1BTYA 3OAAD 1JIRA 1J8AA 2F91A 4YT6H 3TNTA 3RXVA 1QY6A 1UK2A 3PTBA 1HJAB 4K5ZA 1O5CB 5E8EH 4E06H 3TITA 5EJZA 7GCHF 2KAIB 2C90B 1EPTB 1W0ZU 4NSVA 4I8JA 4BAQB 1FV9A 1H8DH 1C5RA 3FANA 1O2GH 3LC5A 2VGCC 4DGJA 1ZMJA 2ZG0H 2ZPQA 1S0QA 1AFEH 5JBCS 1O2LA 4Q2KA 2ZFPH 3OFND 4AFZA 2WV9A 4Y7AA 1O3JA 2V3HH 1Y5BT 5C5NA 2FOMB 2JDID 3LKWA 3URCA 2JJ1D 2ZFQH 4Y8XA 1V2QT 2OC8A 3FAOA 1YPMH 4U2WA 1SG8B 3V7TA 3A7WA 6GCHF 2EY4C 1HFDA 1Q31A 5K0HA 3QWCH 3SU4A 9LPRA 2YNBA 5FHTA 3RLWH 3RXRA 3ZV9A 1KXFA 1A46H 4FU9A 1QCPA 5FL7D 1EP6A 5TCAA 4BAOB 1ELCA 3TU7H 1TNLA 4AG1A 2YMSC 1GJAB 2V3MA 4J1YA 3TJVA 5T6GA 4MPUA 2GTBA 2XBVA 4RT1A 1QTFA 4ABFA 3PWBA 4B75A 2FM2A 1WUNH 3H5CB 1OXGA 3WWBA 5SGAE 2IOTA 1HB0B 5GIBA 4FUIA 3P70B 2A4OA 4NWKA 3SUFA 3F2FA 6ESTA 5AVDA 1XKBC 3TJUA 1UHBB 2G4TA 1IAUA 3JZ1B 2JJ2D 2QXHA 1ARBA 3T62A 1N1LA 4F55A 2G5VA 2ZU3A 3MNCA 2AIQA 1O3EA 2XNIA 1LVOA 1FAKH 2SGEE 1S6FA 2Z9GA 2ZU2A 2Z9KA 2BDHA 1GBDA 3ZVBA 3GY7A 1CVWH 2BYAX 3M36A 1YC0A 4FUGA 1BHXF 5A0AE 4RKJB 2VGCB 2W7SA 1WQVH 1V2RT 4DW2U 2ZHWH 1HUTH 1NFUA 4GHQA 3ZZBA 1FLEE 3UQOA 3F0PA 1MMJN 1BJUA 4NIWA 2SNVA 1MAXA 2BQ6B 1TQ7B 2OTVA 2GMTC 1PPFE 2J2UA 4YZUA 2BD7A 3ZYEA 1ZTLA 3ATMA 1IHTH 3RXGA 1SGIB 1O2IA 1TBQH 1OWEA 1DY8A 1O37A 3F9HA 1OSSA 3SU2A 1QZ8A 4TSFD 3VB3A 1SGYE 2Q6FA 2OK5A 5JB8S 4NCYA 4GCHF 2OBQA 4ISOA 4K1TA 3FFGA 1C5ZB 2YMSB 1CHOG 1EASA 3GY3A 4M7GA 4ACAA 4O9VA 4RN6A 1BBRE 5LGOA 5GCHG 1HRTH 3MH5A 1YCPK 1ELEE 1FUJA 5DP6A 1O3PB 2BXTH 2JKHA 2PHBA 2HPQH 1ESTA 3RXAA 1O2NA 1LHEH 4YLUA 1SGDE 2ODYB 1T8NA 3A8BA 2PWXA 5EIYA 3NZIA 1UVTH 4A6LA 3BTGE 2ZF0H 2XWBI 1LQEA 1BMMH 5C1UA 2G8TA 3PROA 1LCYA 5FX5A 1BTPA 1A4WH 2RA0A 1E35B 4WJG2 3RMLH 2R0KA 1O2UA 1LHDH 1P2KA 2UUFB 5DJ7A 1K1MA 4INHA 4XOJA 2OBOA 3RMOH 1O3DA 1C2JA 4AFQA 4RI0A 3EDXB 3OTPA 2WPDD 1F5LA 1IHSH 3IG6B 3MTYA 1BBRH 1NFWA 4JZEH 2BB4A 1PQ5A 1O34A 1O2HA 2BQWB 2GDDA 4IMQA 3SV6A 2BX4A 2EQNA 3D62A 4A92A 1PFXC 2Z7FE 1SFQB 2GMTB 4JCNA 4X6NA 2AH4X 2WV5A 2GD4B 2K0QA 3TH3H 3GYMA 1QFKH 2O8MA 3TJOA 1BRAA 4K8BA 3SUEA 6CHAB 1P3CA 2XBYA 1K1OA 1TGCA 1Y5UT 3ENSB 1Z8GA 3KYFA 2F9OA 3LPRA 4YOJA 5HXFA 1A3EH 1F0RA 3GISB 3ZZ3A 2Q6GA 1V2MT 1BUIA 3MO6A 1HBTH 1ZHMA 4ISNA 4AC9A 3KQCA 2WYJA 3RXDA 1KTTB 4P02A 1GCDA 1DY9A 1V2KT 1A0LA 1C5SA 2GCHF 3GDSA 1GBEA 2IPQX 2Y5FA 2GZ9A 4H4FA 2ZCLP 4I8LA 2H2ZA 2FZZA 3UB0A 1HXFH 1C5TA 1WV7H 4XDEA 3F9EA 1QJ6B 1W2KH 5B6LA 1UW7A 1P2QA 2VIWA 4H6TA 3T26A 3VG8A 4ASHA 3LGWA 4BAMB 5LH8A 3EYDA 4GPGA 2Y5GA 1D6WA 2J97A 2KZ4A 2ZEBA 2EI6A 3A87A 1Q2WA 2EEKA 2V6NA 2ZGCA 4H42U 3LH1A 2ZFFH 3PV2A 1SGRE 1HXEH 2XYAA 2HPPH 2QYIA 1S6HA 1S6LA 1GVZA 4YESB 1QB9A 3TLOA 2BY9X 4E7RG 4Y76A 4OM9A 4NWLA 1HIAA 1O3AA 1N6XA 1V2PT 3BEUA 2EI8A 3BTKE 1GBCA 1KXEA 4NFEA 2PKSC 1V2ST 2UWOA 2IN2A 1IQNA 2THFB 4B71A 3PV5A 2ANYA 2FODA 2PSYA 5FBEA 4ZHMU 1Z8RA 1IQGA 2ASUB 1KXBA 1TPAE 3A7TA 1C2EA 3G01A 1OP0A 3EE7A 1SQAA 1SBWA 1Z1IA 1WQSA 3FKSD 3SQHE 7ESTE 2OCVB 1KY9A 1TA6A 1V2VT 1Z8IB 3UIRA 2FX6A 2GGVB 1GJDB 1QB6A 1CBWB 4ZMAH 3QGJA 1C9PA 1TYNA 1TAWA 3PLBA 4ZKNU 2ANMH 1EOJA 1IQFA 2D26C 1O3OA 2FS8A 1C5YB 1VKYA 3SBKA 1FONA 1EPTA 2FX4A 1WDIA 1BMNH 1C1OA 3MWIU 3V0XA 5E0GA 2ZP0H 2VIVA 3P8FA 4Y10E 4KELA 3TJNA 5I46H 2G51A 3AW1A 1GPZA 1YPEH 1A7SA 1GHAF 4AGKA 1BCUH 4DOQA 1C5UA 5DSFA 2GP9B 2NU0E 1AUJA 5GDSH 2HNTE 2VU8E 1BDAA 1O0DH 1FY8E 2J5UA 3SQEE 1CE5A 1ZRBA 1DWBH 1O2SA 2A4QA 4CHAC 1MTNC 2WPIS 2SNWA 1SLWB 1EX3A 1MTWA 1OWHA 4FUFA 3SNDA 3OE7D 2F9NA 4OS5A 4MTBA 1AUTC 2Z3EA 2HOBA 4Q80A 5CHAC 1EJAA 2FOGA 2AERH 2PTCE 4DT4A 3ZZ7A 1YPGH 3N7OA 2KCYA 1O3NA 8LPRA 2SGAA 2ANWA 3ZVGA 1F7ZA 2PKSB 1AHTH 1W8BH 4R8TB 2BDCA 3HGNA 2ZDVH 2WPKS 1YCPM 2VIOA 3IITA 1ZTJA 3UREA 2FESH 1TOMH 1NFXA 3SJ9A 1LKBA 2GKVE 3BF6H 4ZKOU 2FOAA 1XMNB 4ZCNA 2W3KA 1UHBA 1ACBE 2ZU4A 2CF8H 1LVYA 1O2XA 2VWLA 3C1KA 3HK6B 9ESTA 1P05A 3M7QA 3RXKA 1CA0C 2SGPE 1MUEB 4UD9H 2VJ1A 3VB5A 4GVUA 1FIZA 4ABHA 1O36A 1GI4A 4AOQA 1DVAH 5DP9A 5HM2A 2GV6A 1NRRH 1ZTKA 1NPMA 2B5TB 1EZQA 1MTUA 2Z9IA 1YPKH 3RM0H 2Z9LA 1P57B 1DPOA 3PLKA 4F48B 8KME2 3BG4C 3QDZB 4Q63A 1BIOA 5C17A 4ABGA 1SGEE 3E3TA 4UFDH 1SL3A 4CREA 3GYLB 4Z6AH 3UNSA 3SUGA 4JZIA 2J92A 4CHAB 1MTNB 1WTGH 3O8CA 1YLCA 2W5EA 5C94A 1K21H 1ZR0A 2BY8X 1ELGA 1KMHB 1GI5A 5EJLA 1T8MA 1ZHPA 4X8SH 1YLNA 4AB8A 3NK8A 3QX5H 5CHAB 3RXBA 1GMDG 1LO6A 2GT7A 3LDXH 2A31A 1E1RD 4BNRA 2R9PA 3SYJA 1FDPA 3EE0B 1SGCA 1MU8B 1GG6C 1TRMA 4ABDA 4A7IB 1AE8H 1M9UA 4CRAA 4KTUA 1NC6A 1ZSLA 1AQ7A 4P00A 4ISLA 2TGTA 4MPWA 1C5QA 3EA7A 5JBTA 3ESTA 1NU9A 8GCHG 4UFEH 1V6DA 2BX3A 3VB4A 4I8GA 2NWNA 5T1VA 3RXEA 5DN6D 1SOZA 1GI0A 4YT7H 2GV7A 3GY6A 3RXJA 3A7XA 1TA2A 2F9VA 2WPJS 1SGQE 4KTSA 3V12A 1AWFH 5EJ1A 1DITH 4LK4A 1C1QA 1PPEE 2R0LA 2Z6BD 1LPZB 1WCZA 5FAHA 2F3CE 2O8LA 1QJ1B 1UTLM 4BOHA 8ESTE 2BHGA 2ZZUH 2A1DB 1GI6A 3L6PA 2Y82A 1LDTT 3Q3KA 5CDFE 1UK3A 1XXFA 3D49H 4X1QU 1P9SA 4K8YA 4I8KA 4NIXA 1HYLA 4MNXA 1C1WH 2JH5D 5EPYA 3A8CA 3TGKE 2AGEX 4X6MA 4AYVB 2HLDD 1NFYA 1UTNA 4UEHH 2BM2A 3GOVB 1MQ5A 1P03A 1QBNA 1SGFG 2QF5A 1IQMA 2I6QA 1C1PA 3IWMA 1T4UH 1TALA 4CRFA 2ZFTA 2VINA 1DSTA 4CBNA 1KLJH 3HATH 1C5NH 1LVBA 3ZVEA 1F5RA 1L4DA 3U69H 1SGNE 3P95A 2C8WB 5C5OA 4X2VA 3PRBA 1JBUH 3S9BA 2C4FH 1GDQA 4JK5A 1HDTH 2UUKB 3KN2A 4GAWA 5E0HA 2K8IA 2KX4A 2O8UA 1KDQA 1GG6B 2GDEH 2QF0A 1P3EA 2GT8A 4F49A 4CH8B 1DS2E 1PQ8A 2OC0A 3SGAE 3SV9A 1V2JT 1ZGIA 3KYGA 2KCOA 3RC4A 2TIOA 5C0TA 5HM9A 1L0ZA 1BHXB 1TPOA 5JBAS 3A83A 5TJXA 1YYY1 2OP9A 5C67A 2AGIX 2SGQE 1B0EA 1OYQA 1DANH 5T6DA 5FBIA 1GL1A 4YTAA 4LXBH 1VITG 1K1PA 2ZGBH 2ZFSA 3RM2H 1P01A 2ZHFH 2A7JA 1AZ8A 2H9EH 1TX7A 1SR5C 3NXPA 4ZKRU 1UJ1A 1GVLA 5DP8A 3DT0H 3ZZ4A 2QE7D 1QQ4A 5HMAA 2W26A 1O30A 5DK1A 2ZGXH 1NZQH 1RD3B 1ELAA 1QGFA 4Q4LA 3S7KB 1KSNA 3RXHA 1C2IA 3MO3A 1P09A 4M9FA 3P8GA 1ZPCA 1ETTH 3SHAH 3GY8A 1D9IA 4UE7H 1V2UT 5B6OA 1ID5H 1XUGA 4WH6A 1PQ7A 1J16A 1ABJH 1LQDB 1TGBA 2OUAA 1UVPA 3ZZAA 3TK5A 4CRGA 3E0PB 4ZXYH 1HAVA 1NESE 1O31A 1WSSH 3UY9A 4BTTB 4MDSA 4MNYA 1FIWA 3FP8E 4D76A 2RG3A 1XUFA 4X6PA 1QRXA 3E90B 1E0FD 1C2DA 2FI5E 2FOCA 2OC7A 1ORFA 4WXIA 3SZNA 1HAGE 1MBMA 4ZROA 2ZQ1A 1ETSH 1BRCE 1RFNA 3A7YA 1ZLRA 2WUCA 2W7UA 1L4ZA 3A8DA 5FCRA 1W10U 3UUZA 3NPSA 2QGRA 1GBHA 2JIZD 3SI4H 3AVZA 4YO9A 1LKAA 1OX1A 1P0SH 2P3UB 2PGBB 3L33A 2ZHEH 3O8BA 3UOUA 2RA3A 1AD8H 1UTPA 1A5HA 4U30A 4TY7A 2C8ZB 2NU2E 5T6FA 1ZJKA 4YOGA 1WAYB 2P95A 1BTHH 2WPLS 3S7HB 4XFQA 3VEQB 1C2GA 4OGYA 2PTNA 4Z1MD 1FN8A 5GPIB 4INLA 3DSGA 1NO9H 1GJ6A 1MCTA 1HCGA 5F8ZA 2R3YA 1KXAA 1BQYA 2D8WA 1SC8U 1FPCH 1G2MA 4FETA 3SHCH 2J98B 4I86A 1THSH 2O8TA 3TIUA 2EI7A 2KCAA 1TWXB 3DCLA 4YOIA 3AK5A 2ZCHP 3BTEE 2WYGA 1FI8A 1QNJA 5EG4A 1GHVH 1TPSA 1HAXB 2A4GA 4IC5A 3BTWE 3MH7A 4GUXA 1V3XA 1QB1A 1ANDA 2QF4A 2D1JA 3QZQA 1CHGA 2FMJA 1UVUH 5E2OA 2G00A 4H6SB 2P8OC 2OINA 1ETRH 1H8IH 6CHAC 3U8TH 2OQ5A 1MD7A 4WH8A 1BRBE 4BTUB 1EUFA 4D8NA 1T4VH 3RDZA 5DKMA 4YXWD 1Y3YA 1G3CA 3A85A 2Q6DA 1IQIA 1G3DA 1C4Y2 2QN5T 2Z3CA 2Y5HA 2CN0H 2R3UA 4AORA 1S84A 5F03A 5C0UA 3ZVDA 4DURA 1NM6A 5EPNA 1F0SA 2GCTC 1J9CH 2PKAB 4Y71A 3E0NB 1QA7A 1ZSKA 2O8WA 4WF8A 4MPXA 1Q3XA 3PWCA 4XBBA 1DXWA 3P6ZB 5C1XA 5L30H 4FOUC 3ZVCA 5A8XA 3MNBA 1QL7A 3SUDA 3F3BA 2KFWA 4DIIH 3Q3YA 1YPLH 1EAWA 3OYPA 4A1TA 1GMCG 4HGCA 1FJSA 2H9TH 1HAYB 2ZKSA 1E1QD 4KTCA 4U01A 2C8XB 1H1BA 1O5AB 3ATWA 2G81E 1Y59T 3MU5A 1C9TA 1FY1A 3A89A 1AKSB 1Y3XA 1DSUA 1O39A 3Q76A 5JDUB 4HTCH 4CRBA 3RLYH 3ZVAA 3RXPA 1O3MA 1JOUB 2H9HA 2A5IA 3ODDA 5TCCA 4X1NU 2PUXB 3F6UH 1QHRB 1K1JA 3ZZ8A 1AZZA 4DY7B 1COWD 2VVVA 1XUJA 1TONA 2FI4E 3RXIA 3SORA 3KGPA 1F2SE 1ZPBA 1FY5A 1BMFD 3EAJA 1W13U 1OOKB 3T27A 2EA3A 3GY5A 1DWCH 1QR3E 3FZDA 1O3FA 1ELBA 1O3BA 2P8OB 1SHHB 2PUQH 2XC5A 1PYTD 4CBOA 2TGDA 3MO9A 1O3CA 2AYWA 1ELFA 1S83A 2AGGX 5FPTA 1A3BH 1CBWC 2AIPA 1GI1A 2ZU5A 1WXRA 4MNWA 1EZSC 1NRQH 5ABWA 2QXJA 2BY7X 3SJKA 1V2NT 5JPMH 2H6MA 4A1VA 3SNAA 2K1QA 1IQEA 4J2YB 3PM3A 5H4IB 3FP6E 4THNH 1MCVA 3KF2A 4DG4A 2GCTB 1TNJA 1L2EA 2PW8H 3T25A 1W14U 4AFUA 1RTKA 1C2HA 1AB9B 4B1TA 1GI3A 3PLPA 3MH6A 4TPIZ 3F1SB 1Z1JA 3U28C 2OQUA 2VVUA 3I77A 5KECA 2J9NA 3GDUA 1AE5A 3SN8A 1VCWA 2BD8A 2CGAA 2J4IA 1D6RA 2F9BH 3ZIAD 2AMQA 2VIPA 1SQTA 2ZIQH 3KIDU 1WTHD 1LHCH 1O5BB 1IQLA 1GHBG 2CV3A 1NRSH 1FY4A 2PLXA 3OSYA 3VPKA 1K2I1 3PMAB 1O2VA 5F6MA 1XVOA 2VIQA 4IGDA 1GMHF 1OHHD 1BTXA 3MHWU 1DX5M 2CJIA 3GY2A 3HKIB 4JZDH 1VZQH 2HNTF 3LT3A 1CQQA 5PTPA 5FX6A 1S82A 2CXVA 1ELVA 1K1LA 1DFPA 2G52A 1O2PA 2FWWA 1OKXA 4X1SU 1SGPE 1AI8H 1FNIA 1UCYE 1V2OT 3BV9B 3KQ5A 3B23B 3KQDA 3PV4A 4ISIH 4F4OC 3RU4T 1WU1A 1AVWA 1ABIH 2BD3A 5F53A 2A5AA 2VWMA 3BSQA 4IBLH 1NBME 1KLTA 2BD2A 2QIQA 1QL8A 1F92A 5C3NA 1XUKA 3CS7A 1ZSJA 1F5KU 4RSPA 1O2RA 4HG6A 3TH4H 2BOHB 1BOQA 3M37A 3SV7A 2ALPA 4GSOA 5T3HA 1GHWH 3UWJH 3M7TA 4NIVA 3HPTB 4B2AA 1LTOA 2XBWA 1CSOE 2STBE 2OLGA 1HGTH 2Y7ZA 5GNDA 1DWEH 2KAIA 1ESAA 3PO1C 1CGIE 1A2CH 2OXSA 1VJAU 3KCGH 3SOSA 1FX0B 1SVPA 2I6SA 1BMAA 1GHXH 3SGQE 1KLIH 2F9PA 1K9OE 4IS5A 1GBMA 1N6YA 2GCHG 2WUBA 4CRCA 5HGGA 7KMEH 2KM0A 3AW0A 3SGBE 2CHAB 4BAKB 1RGQA 1T8OA 1EAUA 5EOKA 4NSYA 5EQSA 3UQVA 1NBMD 2ODPA 1K28D 3MYWA 3L3TA 5DP7A 1E36B 1XX9A 3M3TA 1GVKB 1FN6A 1H4WA 4FU8A 2FOEA 1PQAA 1MKXK 2FXRA 2NU1E 4NA7A 3MU8A 1BTWA 3H09A 3SJ8A 2ZDNA 2WINI 1ZHRA 4FUDA 1ZZZA 5JBBS 1DDJA 5EGMA 1V2LT 2H1UA 1EQ9A 5IK2D 2BDAA 1GMDF 2ZECA 3GCTG 3M5LA 1JRSA 3GS9A 1G2LA 2B7DH 4ESTE 5EXLA 3UPEA 3HK3B 3FN8A 1E37B 1QIXB 5EODA 2FOBA 1KIGH 2FYQA 4D7GA 1CT2E 3T5FH 3LIWA 2VB0A 3RXLA 1CU1A 2BLOA 3KQBA 1VJ9U 4BXSA 1UO6A 5ETXA 2CF9H 2WSSD 4GLYA 2HVYB 1XM1A 4NIYA 2DE8A 1K0HA 2ZC9H 3FO8D 1SOTA 2YMSD 3PO1B 4MPVA 2RFKC 1SQOA 1G37A 3DFLA 1P2OA 1EB1H 2ZWLH 1O5EH 2A7CA 2BDBA 3RXUA 2A7HA 2UUYA 1QRZA 3URDA 2BLVA 2BD5A 1W0YH 5GJ4B 3ZV8A 1OWIA 1MD8A 1FXYA 4DT7B 1BB0B 3VXEH 2W6ID 1TNHA 1GJ7B 1O2QA 1O3KA 3WWFA 3FZZA 2L6OA 5AFYH 2DUCA 1SB1H 3O8DA 3GICB 1GI9B 3K2UA 3OTJE 1TBRH 2KCPA 3N7DA 1GBTA 1WYKA 2BXUH 4AN7A 2RCEA 1D3TB 4CR9A 4ABJA 1SKYE 5L2YH 4OS2A 4X0WU 3TGIE 3LGTA 2LNCA 1AMHA 4X6OA 3RXSA 2FYRA 2IJD1 1BTZA 4A5TS 4X2YA 1O3IA 2BVRH 2IPHA 3DA9B 1G3EA 1X7AC 1P02A 4TWYA 3MMGA 1NRPH 4OS1A 3SNEA 1S81A 4QT8C 1JXPA 1A5IA 3ZZCA 3BEIB 2OC1A 1P11E 3S0NA 1C4U2 1FPHH 4GHTA 5DP3A 3E91A 1C2KA 1QURH 1ZMLA 1SQRA 2WHXA 4Z0KA 1RTLA 2JH0D 2VBCA 2VWOA 1DLEA 4LZ1H 1B7XB 2ZU1A 1KTSB 2STAE 1BRUP 2XXLA 2HRVA 3BTHE 1BT7A 3RXMA 6LPRA 3S69A 1JMOH 1W0JD 3TPIZ 2FEQH 3UNRA 2BY5X 5EXMA 3UTUH 4TT3D 3PMHB 1VITF 2V0BA 3KL6A 1GWAA 2F4LA 1CT4E 1PPGE 4AG2A 2PV9B 3E8LA 4Y8YA 3UWIA 1EAXA 1TX6A 1ZJDA 5HIYA 1UTOA 2ZPRA 1AU8A 3DFJA 1HAIH 2ZFRH 2FTLE 3QN7A 2BDIA 4I33A 2KR7A 3GCHC 7LPRA 2QXGA 3T28A 4AFSA 5HKKD 1YF4A 3M7UA 2RDLA 1TNIA 2GX4A 2Q1JA 2XCFA 4K1EA 4FU7A 1Y8TA 4Y0ZE 1RIWC 2YOLA 5A2MH 5BPEA 1O2WA 4JZFH 1RS0A 1K1IA 2J95A 2NU4E 5CHBA 4WMEA 2M5TA 1XUIA 1LHGH 2FLBH 1QRWA 2ZDAH 3ELAH 2ALVA 3NKKA 4DJZB 1ANCA 1DICA 4RT0A 3RXFA 1QQUA 2BDYA 1DUEA 1UTJA 2V7QD 3OU0A 2BLQA 1HLTH 1O35A 1KYNA 1S5SA 2P59A 4Y11E 3F2GA 1UVSH 3ITIA 4BAHB 3EA9A 2ZDMA 1EKBB 3H7TA 5A8ZA 2B8OH 2FP7B 1GI2A 2ZGJA 1UCYK 1RXPA 1C1TA 4X1PU 4JK6A 3ATIA 2ZPSA 4AYYB 1PJPA 1QA0A 1W12U 1O2OA 1O3LA 2SGDE 1GHYH 5A8YA 2R2WU 2BD4A 5J4QA 1K1NA 1TMTH 3M3VA 3ZZ6A 1NS3A 1WBGB 2AEIH 2PGQB 4BXWA 4BANB 1SLUB 2XTTB 2O9QA 3F9GA 3PMBB 2VH6A 3KEEA 2JETC 3M5NA 5K7RA 1HAOH 1EJMA 1EZUC 4HFPB 1FZZA 1C1MA 1HJ9A 1A1RA 4AB9A 1GL0E 5C1YA 2VIDA 1C1VH 4D9QA 1UTQA 2HVXA 2QY0B 2Z94A 2F83A 3MI4A 4I32A 3MNXA 2BD9A 1OS8A 1C2FA 3H7OA 1XVMA 3EGKH 3P8OA 1CO7E 5I25A 2A4RA 2P3FH 3B8JA 1VCQA 2J94A 1KXDA 3QTVH 2ZI2H 2BY6X 1YPHC 1EFRD 3GCHB 1J14A 3M5MA 3SU0A 1ANEA 2R2MB 3E1XB 3MNSA 3LONA 1Y3VA 1HV7A 1PPCE 3VFEA 1RIWB 1AFQB 2HWLB 1GGDC 1GI7B 1VITH 1BA8B 2ZNKH 2FDAA 1NY22 5KGOA 3RUOA 1C1RA 1MAYA 3CNRA 3PRDA 2CK3D 2F9UA 1SGFA 3V3MA 4IN1A 3MU1A 2B9LA 4OS4A 4Y8ZA 3RC5A 3LOXA 4ZKSU 3AAVA 2AMDA 4JMYA 1OP8A 1CT0E 3N99A 3BIVH 2ZCKP 2GZ7A 1D3DB 1W3CA 1EOLA 1N8OC 1SLVB 1UTKA 2FOFA 1O3GA 3T2NA 3DSOA 1OWDA 4XD7D 1TNGA 1RTFB 3LJOA 3LGUA 3MFJA 3SW2B 3A80A 4ISHH 1TB6H 2HNTC 2XWAA 1Z7KA 1G30B 1CHOF 5DPAA 5GCHF 4ABBA 1FMGA 3RMMH 5DP4A 1TMBH 3FOAA 1YM0A 1IOEA 1H9LB 3WY8A 3F2HA 4X8UH 2JETB 5FCKA 1GMCF 2F43B 1QL9A 1O2YA 1EATA 3PYHA 1GBLA 1MKWK 3F9FA 1EZXC 5JB9S 5L2ZH 1ELTA 1IQHA 4Q7XA 4WXVA 4IW4E 1FAXA 4R0IA 3R3GB 7GCHG 5IDKA 1GJ9B 1QJ7B 2A32A 1RRKA 5C20A 1V2TT 2PFEA 3BN9A 3PB1E 1YBWA 2Y6TA 2FI3E 3I78A 4FXGH 1GDUA 2TGAA 3VXFH 2XOKD 5CMXH 3GDVA 5GXPA 1GDNA 1H9IE 3SI3H 4E7NA 3SJIA 2GJGA 1OYTH 3QGNB 3QZRA 2BLWA 1GHZA 3A82A 3ZZ5A 1GGDB 5LPFA 2BOKA 3ZVFA 4B6EA 3UNQA 4OS6A 4CRDA 3TGJE 3LJJA 4XSKU 3AASA 1OP2A 1JWTA 3SU1A 6GCHG 1NRNH 4X2XA 1MKXH 4AGJA 3HGPA 3CP7A 3M35A 2NU3E 3C27B 5DGJA 5EU8A 4A1XA 4FUCA 2ANKH 5FPYA 3BG8A 1NU7B 2HALA 1TRNA 1NTPA 3U9AH 3I29A 3LC3A 1NN6A 3QK1A 1EXFA 1N8OB 1P06A 3ATLA 1GBAA 1P2MA 4Q7ZA 3AAUA 3U8OH 3QTOH 4D7FA 2WPMS 3UR6A 2A5KA 1TQ0B 1YGCH 1OPHB 1AB9C 2BVXH 3PTNA 3ATKA 4D9RA 4UFFH 2PR3A 4ZHAA 2PP6A 5EQQA 1MH0A 1TLDA 4DIHH 4CR5A 3LGYA 4OS7A 3K6ZA 1KXCA 1HAPH 2ZGHA 1YP9A 3K6YA 3P8NA 2ODQA 4ZH8A 1CA8B 4B76A 1C4V2 1GBIA 2D2DA 2J34A 2L74A 4Y6DA 3A8AA 4JYTA 1SMFE 4B74A 1CGHA 2OD3B 2VH0A 3MH4A 3OEED 1GHBF 1L1JA 2GZ8A 1O2KA 2H5DA 4TWWA 4XBDA 2UWPA 1TPPA 2P94A 4ACBA 1GCTC 2IJOB 4ABEA 3DHKH 4WMFA 1VCPA 3LGIA 1A5GH 1C5WB 3VB6A 3D65E 3BTFE 5LPRA 4XE4A 1QBVH 4TPYA 2XBXA 3ZYDA 4DVAU 1GBBA 2BDGA 5C2ZA 1MTSA 1NT1A 4X1RU 1TFXA 4TY6A 3UR9A 2ZDLA 4I31A 1TE0A 2P93A 2A2XH 3SU6A 1GJBB 3VGCC 5A0BA 1ZOMA 1YPJH 2HGTH 4ZAEA 2AFQB 3D23A 1C2LA 2M2AA 2TGPZ 1PPZA 1WOFA 3B9FH 1C5OH 1P12E 3NWUA 4MQAA 2A45B 3A7VA 3A88A 4JYUH 3SV8A 1GJ8B 4GCHG 3RU4E 1SLXB 3U8RH 5GWZA 3DD2H 4U32A 5EW1H 1Z71A 1HPGA 1QBOA 1BMLA 2UUJB 4B2BA 1S85A 4LOYH
chains in the Genus database with same CATH topology
4BTIB 1Z6JH 3UFAA 4ABIA 4VGCC 1P10A 2GVFA 1KDQB 1BTUA 3GCNA 3V13A 4AZ2B 5F8XA 1HAZB 1AVGH 4NG9H 1O3HA 2CHAC 1ELDE 1INCA 3BTME 1P2NA 1G32B 1C5XB 1BZXE 2DE9A 4MG3A 1TGNA 3A7ZA 1J15A 1TGSZ 1T32A 2ZDKA 3EA8A 2ZHDA 1O33A 4FUBA 4O03A 1F0UA 4O97A 1E34B 4UONA 1GCTB 2G4UA 1TABE 3RP2A 1DUAA 4K1SA 1EP5A 4Q7YA 5AF9H 5FXLA 2ZA5A 4DCDA 1IQJA 1FQ3A 2FIRH 2QAAA 1C2MA 1MQ6A 1JIMA 4K3JA 2V3OH 3RU4D 3CENA 3S9AA 3TK9A 3SU3A 4UFGH 3STIA 3CS0A 1TOCB 3VGCB 4FUJA 1D3QB 3LGVA 1GJ5H 1ANBA 3GCTF 4K2YA 4NGAH 4NZQA 1TGTA 2Z9JA 1TBZH 1HAVB 1EB2A 1T8LA 3RXTA 1K22H 2FPZA 1YPHE 4HI3A 2ZTXA 4X2WA 2W3IA 4FUHA 1ZMNA 1SHYA 2TPIZ 4AX9H 1O32A 2ZO3H 1UCYH 1P8VC 3A86A 1L1GA 1C5LH 2FO9A 3GCOA 1P2IA 1PPHE 2WV4A 3DUXH 2CMYA 2FS9A 1P04A 1JRTA 2XRCA 4SGAE 1O5GH 2AMPA 3T29A 1SFIA 4LZ4B 1B0FA 3MOCA 3LU9B 4WMDA 2QC2A 4VGCB 4CH2B 3MU0A 3HKJB 3BIUH 1UTMA 4IMZA 4MVNA 3M5OA 4WVPE 4OGXA 3TH2H 3BTTE 4HZHA 2VVCA 1L1NA 2FLRH 3NCLA 3GY4A 3ZZ9A 3U1IB 1GMHG 3NUMA 3QO6A 1AO5A 1G9IE 2J38A 1OWJA 4NZLA 2C93B 4PROA 1V2WT 4ZUHA 1DOJA 1PPBH 4XBCA 4K69A 1GBJA 1ZYOA 2ESTE 1FY3A 4O3UA 1THRH 3BTQE 1G36A 2TBSA 5ESBA 4Y79A 1B5GH 3M3SA 2XW9A 3F68H 1O5DH 4TYDA 1VR1H 1C5MD 1SGTA 1UVOA 3SJOA 1TIOA 2VWNA 4WY3A 4YLQH 2ZHQH 1HNEE 4KGAA 5A09A 8GCHF 1S0RA 1VGCC 1NROH 3OX7U 3BEFB 4Y7BA 5G4BA 4WWYA 2SFAA 1MZAA 1EJNA 1Y3WA 1T31A 1F0TA 3TNSA 1DLKB 1A61H 3RC6A 5E0JA 4FVBA 3SV2H 1GBFA 1G3BA 3QLPH 2C8YB 1E38B 4O3TA 3Q77A 1LPKB 2BQ7B 5BRRE 3M61U 5DP5A 3RXCA 4IN2A 1MBQA 3W94A 1C1UH 1GHAG 2ULLA 5AHGH 3SNCA 2SGFE 3JZ2B 1YLDA 1D4PB 4NFFA 2P3TB 3RXQA 1HAHH 1BBRK 1C5PA 4FUEA 4KP0A 1MKWH 4Y0YE 1GJCB 2P16A 1SPJA 3TVJB 1PYTC 1MTVA 1AWHB 3KHVA 1DM4B 1Y5AT 3VB7A 3P92A 1O2JA 1Y3UA 2PKAA 3K65B 4JYVH 2B0FA 3KNXA 1O2TA 4E05H 2ZTYA 4MLFB 4ZXXH 1ARCA 1BJVA 1MU6B 2BMGB 1YKTA 1O5FH 1ZGVA 4RKOB 2G5NA 1J17T 3P17H 1W7XH 5EW2H 1ZPZA 2Y81A 3U98H 3QUMP 2FTMA 1XUHA 1BITA 1AVXA 2AS9A 4MNVA 1AIXH 2Z3DA 4ZHLU 3S9CA 2ILNA 1AKSA 4SGBE 1O2MA 1DE7H 1VGCB 1ESBA 2V35A 1H9HE 4UDWH 5JYIA 1AY6H 3OY5U 3E16B 1GBKA 3Q00A 4YM9A 3LH3A 4FVDA 3ODFA 5CE1A 5E2PA 1LHFH 2A2QH 1CGJE 2XC4A 4X8VH 1C1NA 2ZQ2A 1T7CA 1UMAH 3BTDE 5HYOA 1RJXB 2WPHS 1DT2A 2Y80A 3A84A 4JZ1A 3U1JB 1TNKA 3E6PH 3SNBA 1A0JA 1LPGB 3UOPA 1CA0B 5AFZH 4B2CA 1HJAC 5FPSA 1GI8B 2G55A 2BTCE 1EPTC 1THPB 1MZDA 1W7GH 2PSXA 2TRMA 1AGJA 1AFQC 1P2JA 5LPEA 5L6NH 1YCPH 4ABAA 4I7YH 3W95A 3R0FA 3MU4A 4B73A 3RMNH 3BG4B 1SI5H 2QXIA 5A0CA 1EAIA 2ZTZA 2H5CA 5EXNA 3ZZDA 1C5VA 2Y7XA 3K9XB 2XC0A 1TRYA 5J4SA 4K60A 5F8TA 2FOHA 2QCYA 1Z8JB 3TK6A 5DO4H 1U6QA 1C1SA 1O38A 5EQRA 2QV1A 2C3SA 1ZRKA 2YNAA 2LPRA 2BZ6H 2XCNA 3OY6U 4NA9H 3SU5A 3STJA 2A0QB 3EQ0H 1GJ4H 3SO3A 3A81A 2BVSH 1W11U 2HLCA 4IC6A 1HIAB 1D3PB 1DXPA 1SSXA 2QF3A 1OWKA 3FP7E 3RXOA 5IYTA 4X8TH 5DG6A 1TX8A 2EC9H 4INKA 5ESTE 2UWLA 1IQKA 1HJ8A 1AN1E 3O8RA 1XKAC 4KKDA 1LVMA 1Z6EA 1DWDH 1O2ZA 1UK4A 3FVFB 1TMUH 3Q3XA 2VNTA 1P9UA 2BZAA 4I8HA 1A0HB 2JH6D 3PMJA 1LMWB 4NA8A 3KQEA 1XXDA 2QA9E 1BTYA 1JIRA 1J8AA 2F91A 4YT6H 3TNTA 3RXVA 1QY6A 1UK2A 3PTBA 1HJAB 4K5ZA 1O5CB 5E8EH 4E06H 3TITA 7GCHF 2KAIB 2C90B 1EPTB 1W0ZU 4NSVA 4I8JA 4BAQB 1FV9A 1H8DH 1C5RA 3FANA 1O2GH 3LC5A 2VGCC 4DGJA 1ZMJA 2ZG0H 2ZPQA 1S0QA 1AFEH 5JBCS 1O2LA 4Q2KA 2ZFPH 4AFZA 4Y7AA 1O3JA 2V3HH 1Y5BT 5C5NA 2FOMB 3LKWA 3URCA 2ZFQH 4Y8XA 1V2QT 2OC8A 3FAOA 1YPMH 4U2WA 1SG8B 3V7TA 3A7WA 6GCHF 1HFDA 1Q31A 5K0HA 3QWCH 3SU4A 9LPRA 2YNBA 5FHTA 3RLWH 3RXRA 3ZV9A 1KXFA 1A46H 4FU9A 1QCPA 1EP6A 5TCAA 4BAOB 1ELCA 3TU7H 1TNLA 4AG1A 1GJAB 4J1YA 3TJVA 5T6GA 4MPUA 2GTBA 2XBVA 1QTFA 4ABFA 3PWBA 4B75A 2FM2A 1WUNH 3H5CB 1OXGA 5SGAE 2IOTA 1HB0B 5GIBA 4FUIA 3P70B 2A4OA 4NWKA 3SUFA 6ESTA 5AVDA 1XKBC 3TJUA 1UHBB 2G4TA 1IAUA 3JZ1B 2QXHA 1ARBA 3T62A 1N1LA 2G5VA 2ZU3A 3MNCA 2AIQA 1O3EA 2XNIA 1LVOA 1FAKH 2SGEE 1S6FA 2Z9GA 2ZU2A 2Z9KA 2BDHA 1GBDA 3ZVBA 3GY7A 1CVWH 2BYAX 3M36A 1YC0A 4FUGA 1BHXF 5A0AE 4RKJB 2VGCB 2W7SA 1WQVH 1V2RT 4DW2U 2ZHWH 1HUTH 1NFUA 4GHQA 3ZZBA 1FLEE 3UQOA 1MMJN 1BJUA 4NIWA 2SNVA 1MAXA 2BQ6B 1TQ7B 2OTVA 2GMTC 1PPFE 2J2UA 4YZUA 2BD7A 3ZYEA 1ZTLA 3ATMA 1IHTH 3RXGA 1SGIB 1O2IA 1TBQH 1OWEA 1DY8A 1O37A 3F9HA 1OSSA 3SU2A 3VB3A 1SGYE 2Q6FA 5JB8S 4NCYA 4GCHF 2OBQA 4ISOA 4K1TA 3FFGA 1C5ZB 1CHOG 1EASA 3GY3A 4M7GA 4O9VA 4RN6A 1BBRE 5LGOA 5GCHG 1HRTH 3MH5A 1YCPK 1ELEE 1FUJA 5DP6A 1O3PB 2BXTH 2JKHA 2PHBA 2HPQH 1ESTA 3RXAA 1O2NA 1LHEH 4YLUA 1SGDE 2ODYB 1T8NA 3A8BA 2PWXA 3NZIA 1UVTH 4A6LA 3BTGE 2ZF0H 2XWBI 1LQEA 1BMMH 5C1UA 2G8TA 3PROA 1LCYA 5FX5A 1BTPA 1A4WH 2RA0A 1E35B 4WJG2 3RMLH 2R0KA 1O2UA 1LHDH 1P2KA 2UUFB 5DJ7A 1K1MA 4INHA 4XOJA 2OBOA 3RMOH 1O3DA 1C2JA 4AFQA 3EDXB 1F5LA 1IHSH 3IG6B 3MTYA 1BBRH 1NFWA 4JZEH 2BB4A 1PQ5A 1O34A 1O2HA 2BQWB 2GDDA 4IMQA 3SV6A 2BX4A 4A92A 3D62A 1PFXC 2Z7FE 1SFQB 2GMTB 4JCNA 4X6NA 2AH4X 2WV5A 2GD4B 3TH3H 3GYMA 1QFKH 2O8MA 3TJOA 1BRAA 4K8BA 3SUEA 6CHAB 1P3CA 2XBYA 1K1OA 1TGCA 1Y5UT 3ENSB 1Z8GA 2F9OA 3LPRA 4YOJA 5HXFA 1A3EH 1F0RA 3GISB 3ZZ3A 2Q6GA 1V2MT 1BUIA 3MO6A 1HBTH 1ZHMA 4ISNA 3KQCA 2WYJA 3RXDA 1KTTB 1GCDA 1DY9A 1V2KT 1A0LA 1C5SA 2GCHF 3GDSA 1GBEA 2Y5FA 2GZ9A 4H4FA 2ZCLP 4I8LA 2H2ZA 2FZZA 1HXFH 1C5TA 1WV7H 4XDEA 3F9EA 1QJ6B 1W2KH 1P2QA 2VIWA 4H6TA 3T26A 4ASHA 3LGWA 4BAMB 5LH8A 3EYDA 4GPGA 2Y5GA 1D6WA 2ZEBA 2EI6A 3A87A 1Q2WA 2EEKA 2V6NA 2ZGCA 4H42U 3LH1A 2ZFFH 1SGRE 1HXEH 2XYAA 2HPPH 2QYIA 1S6HA 4YESB 1GVZA 1QB9A 3TLOA 2BY9X 4E7RG 4Y76A 4NWLA 1HIAA 1O3AA 1N6XA 1V2PT 3BEUA 2EI8A 3BTKE 1GBCA 1KXEA 4NFEA 2PKSC 1V2ST 2UWOA 2IN2A 1IQNA 2THFB 4B71A 2ANYA 2FODA 2PSYA 5FBEA 4ZHMU 1Z8RA 1IQGA 2ASUB 1KXBA 1TPAE 3A7TA 1C2EA 3G01A 1OP0A 1SQAA 1SBWA 1Z1IA 1WQSA 3SQHE 7ESTE 2OCVB 1KY9A 1TA6A 1V2VT 1Z8IB 3UIRA 2FX6A 2GGVB 1GJDB 1QB6A 1CBWB 4ZMAH 3QGJA 1C9PA 1TYNA 1TAWA 3PLBA 4ZKNU 2ANMH 1EOJA 1IQFA 2D26C 1O3OA 2FS8A 1C5YB 3SBKA 1FONA 1EPTA 2FX4A 1BMNH 1C1OA 3MWIU 3V0XA 5E0GA 2ZP0H 2VIVA 3P8FA 4Y10E 4KELA 3TJNA 5I46H 2G51A 3AW1A 1GPZA 1YPEH 1A7SA 1GHAF 4AGKA 1BCUH 4DOQA 1C5UA 2GP9B 2NU0E 1AUJA 5GDSH 2HNTE 2VU8E 1BDAA 1O0DH 1FY8E 3SQEE 1CE5A 1ZRBA 1DWBH 1O2SA 2A4QA 4CHAC 1MTNC 2WPIS 2SNWA 1SLWB 1EX3A 1MTWA 1OWHA 4FUFA 3SNDA 2F9NA 4OS5A 4MTBA 1AUTC 2Z3EA 2HOBA 4Q80A 5CHAC 1EJAA 2FOGA 2AERH 2PTCE 3ZZ7A 1YPGH 3N7OA 1O3NA 8LPRA 2SGAA 2ANWA 3ZVGA 1F7ZA 2PKSB 1AHTH 1W8BH 4R8TB 2BDCA 3HGNA 2ZDVH 2WPKS 1YCPM 2VIOA 3IITA 1ZTJA 3UREA 2FESH 1TOMH 1NFXA 3SJ9A 1LKBA 2GKVE 3BF6H 4ZKOU 2FOAA 1XMNB 2W3KA 1UHBA 1ACBE 2ZU4A 2CF8H 1LVYA 1O2XA 2VWLA 3C1KA 3HK6B 9ESTA 1P05A 3M7QA 3RXKA 1CA0C 2SGPE 1MUEB 4UD9H 2VJ1A 3VB5A 4GVUA 1FIZA 4ABHA 1O36A 1GI4A 4AOQA 1DVAH 5DP9A 5HM2A 2GV6A 1NRRH 1ZTKA 1NPMA 2B5TB 1EZQA 1MTUA 2Z9IA 1YPKH 3RM0H 2Z9LA 1P57B 1DPOA 3PLKA 8KME2 3BG4C 3QDZB 1BIOA 4ABGA 1SGEE 3E3TA 4UFDH 1SL3A 4CREA 3GYLB 4Z6AH 3UNSA 3SUGA 4JZIA 2J92A 4CHAB 1MTNB 1WTGH 3O8CA 1YLCA 2W5EA 1K21H 1ZR0A 2BY8X 1ELGA 1GI5A 1T8MA 1ZHPA 4X8SH 4AB8A 3NK8A 3QX5H 5CHAB 3RXBA 1GMDG 1LO6A 2GT7A 3LDXH 2A31A 4BNRA 2R9PA 1FDPA 3EE0B 1SGCA 1MU8B 1GG6C 1TRMA 4ABDA 4A7IB 1AE8H 1M9UA 4CRAA 4KTUA 1NC6A 1ZSLA 1AQ7A 4ISLA 2TGTA 4MPWA 1C5QA 3EA7A 5JBTA 3ESTA 1NU9A 8GCHG 4UFEH 1V6DA 2BX3A 3VB4A 4I8GA 2NWNA 3RXEA 1SOZA 1GI0A 4YT7H 2GV7A 3GY6A 3RXJA 3A7XA 1TA2A 2F9VA 2WPJS 1SGQE 4KTSA 3V12A 1AWFH 1DITH 4LK4A 1C1QA 1PPEE 2R0LA 2Z6BD 1LPZB 1WCZA 5FAHA 2F3CE 2O8LA 1QJ1B 1UTLM 4BOHA 8ESTE 2BHGA 2ZZUH 2A1DB 1GI6A 3L6PA 2Y82A 1LDTT 3Q3KA 1UK3A 1XXFA 3D49H 4X1QU 1P9SA 4K8YA 4I8KA 4NIXA 1HYLA 4MNXA 1C1WH 2JH5D 5EPYA 3A8CA 3TGKE 2AGEX 4X6MA 4AYVB 1NFYA 1UTNA 4UEHH 2BM2A 3GOVB 1MQ5A 1P03A 1QBNA 1SGFG 1IQMA 2I6QA 1C1PA 3IWMA 1T4UH 1TALA 4CRFA 2ZFTA 2VINA 1DSTA 4CBNA 1KLJH 3HATH 1C5NH 1LVBA 3ZVEA 1F5RA 1L4DA 3U69H 1SGNE 3P95A 2C8WB 5C5OA 4X2VA 1JBUH 3S9BA 2C4FH 1GDQA 4JK5A 1HDTH 2UUKB 3KN2A 4GAWA 5E0HA 2O8UA 1KDQA 1GG6B 2GDEH 2QF0A 1P3EA 2GT8A 4F49A 4CH8B 1DS2E 1PQ8A 2OC0A 3SGAE 3SV9A 1V2JT 1ZGIA 3RC4A 2TIOA 5HM9A 1L0ZA 1BHXB 1TPOA 5JBAS 3A83A 5TJXA 1YYY1 2OP9A 5C67A 2AGIX 2SGQE 1B0EA 1OYQA 1DANH 5T6DA 5FBIA 1GL1A 4YTA