4B6FA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 196
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6fA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA02
4KJZA 4PZLA 3QE0A 1WBBA 1KJZA 1TUIA 5FTNA 3SU1A 5G3YA 1KK3A 4C0LA 3SN6A 3BB3A 2GWHA 3ETLA 4B3DA 1YE8A 5HPYB 2CLCX 3L8ZA 2BIFA 2NO1A 3K0FB 4JLJA 1W47A 1Z0KA 1MO3A 4TWZA 4C0HA 2GJAA 5IF9A 4DLWA 2ATXA 2GTPA 4MUAA 1EWRA 4BFSA 4LYJA 2CBZA 2BJWA 3HWSA 3MAAC 3MG9A 4RFVA 1GILA 2RAPA 3RDPA 4PX9A 1E2MA 2ZANA 1HE1C 3O47A 5B2ZA 1N0WA 3MRSA 3TLXA 4QGGA 3PV2A 4C0KA 1VCMA 2IJD1 1D2EA 1D8TA 1FTNA 3QUSA 4EFMA 1K8RA 4GRAA 1JJVA 1FNMA 3RHFA 5FOSA 3WY9A 3BS4A 1I4TD 5L3QB 4J0QA 2BEKA 3THWA 2K5UA 4B32A 2EU8A 2YINC 3TAHA 1P6XA 2A2ZA 5FOXA 4MGIR 3P27A 4D81A 2J5XA 2ZVQX 1EESA 2V3CC 3AVVA 4JBXA 3WBJA 3TSWA 2VP6A 2ZE6A 3MWJA 3WHLA 3K9GA 5IDVA 4RD0A 3GLGE 3LWNA 3U61B 1ELOA 3LLUA 3ZDQA 3VAAA 1ZM2A 4N0DA 3VR2A 2EYUA 1CBUA 2DFKB 4D82A 4DWJA 1IY1A 1N5IA 1U0LA 4D0LB 4O2LA 2YVUA 1LV7A 3BJIC 3QKTA 3WP0A 3GEEA 2VP0A 4PPQA 2HV8A 1L4UA 3SFZA 5AUOB 1GL9B 2ZXUA 2OEPA 2QORA 1FQJA 2EFHB 3NH6A 4G5GA 4GOKA 4II7A 3N2IA 2O5VA 3EIEA 1Q20A 3FMFA 4UJ5A 2WJGA 3ZVMA 1FUKA 4H1VA 5C46F 3VFDA 1VKJA 2ZJBA 1VYTA 3A6PC 3WYAA 3RC4A 3L2OB 2FP7B 2YOHA 4C30A 2AL7A 1NBMD 5GPIB 1HEIA 4M9ZA 4CT5A 1NBMA 3C7KA 4GPTA 4UNSA 2RGDA 1RGQA 3SV9A 4RKEA 5C2JB 2I1VB 2DWPA 4JBWA 1CR4A 3U1IB 4DLTA 2IHBA 1Z0AA 1COWD 1OXSC 2Q3HA 2PEZA 4JJKA 2ZETA 1BIFA 1COWA 1I2MA 4QBFA 3GLIB 2J9RA 4BUJA 1OH8A 1Z2AA 2SHKA 1TUEA 3P1JA 2OC1A 1HQYE 1W44A 3W6OA 3ADBA 2YHSA 5FL7A 4GMXA 4IVQA 5FBRB 1RFLA 3AVPA 3MCAA 2PJZA 3EX7C 2GETA 4DLRA 1G3QA 1VHTA 1ZU4A 3NBXX 4M21A 5DHFA 3T1OA 2FFAA 2WWGA 3AM1A 3W5IA 1HE8B 1NS3A 1NVUQ 2Q3FA 3CO5A 2IUUA 4DXAA 3BH6A 4HZIA 4JJZA 4C0QC 5FOTA 2ORVA 2ZITA 1OW3B 3GLHE 1E9DA 3ZLJA 3JZMA 3PV0A 1U99A 2PMDA 4QBHA 1EG7A 1GRNA 2GJ9A 1W5SA 1N1LA 1SXJC 1KJYA 1R6BX 1RTLA 4F4JA 1AIPA 3UXMA 4GMDA 1Q0UA 3MWYW 4FN5A 1N6NA 2LWIA 2ZE5A 2D2EA 1NMZA 4M4SA 1XMIA 2QV1A 1O87A 3N70A 1E9BA 3D31A 3RSOA 3QSYA 3K09A 5KSOA 2JLZA 3WMFA 3AF2A 3OIWA 4KFRA 5SZHB 5JCZA 4Q9KA 1YR9A 4NYJQ 1N0UA 2YWEA 1SVOA 2Z5FA 3QXCA 4LJAA 4OM9A 2FFQA 4IXNA 1KOFA 4N1AA 1XTRA 1QVAA 3FMIA 3GLGB 5GNDA 2JLVA 1X8LA 4TZ6A 3GLFB 1MV5A 4JMYA 1QDEA 4UNQA 4DLUA 3OTPA 6Q21A 1W4AA 1X8KA 2GXAA 4OYHA 2GCPA 2IYSA 1CF4A 1JR3E 4F92B 1KZGB 5EP3A 5JWOA 1ZNXA 4US2R 2IWHA 2WWHA 1EX6A 4K81B 2Z4SA 2GAOA 4B73A 4A8JB 2WSMA 1Q1BA 1UFQA 5ANRB 1NG1A 5E95A 3THXA 2QQEA 3SUFA 1CJMA 5CB6A 1JALA 2ZI7A 4C7OA 2JGNA 1RYFA 1XP8A 4LPKA 2GNOA 3B1WA 4K8BA 2KE5A 1XBTA 3AVWA 1M6NA 2P5TB 1XXHA 1E9RA 3CRW1 5JBQA 1Z6AA 3QBTA 5DISB 2JLQA 2CCGA 2F4LA 2P3SA 2QU8A 5AUQA 1VYUA 2IUSA 2OINA 1GRRA 3VR6A 1KJWA 3I72A 3UG6A 4ACAA 1G291 4EPXA 1U0HC 3LAWA 2W2TA 3W3ZB 2OESA 3GPLA 3T35A 4Q9LA 4I1UA 1NJGA 3ZGXA 2QSZA 5GJ4B 3U7EB 1X6VA 1DAGA 4URYR 8OHMA 1N0VC 4BLOA 4M22A 4ACBA 2J46A 2ZUDA 2HCJB 3FB4A 3NHAA 1G7CA 1G5PA 1W4RA 4IRUB 2RGEA 4W7SA 2I3BA 2GJ8A 2PZGA 4LSGA 2PT7A 1GKUB 2KWIA 4E03A 1FOEB 3QKSA 3KKNA 2KB0A 2ZJYA 1EXMA 4B76A 5EP1A 3GLHB 3V4FA 3E5HA 1GL7A 4DEXA 3HJNA 3BFVA 1BMFD 1MR3F 3UG7A 3IQXA 3ZH9B 1W5TA 1BMFA 1NLFA 1OHHD 1ZCBA 3SEAA 1YZLA 4WXPA 2F9VA 4EPTA 2IW3A 2IJOB 1OHHA 1E96A 4YMWA 4A0HA 4I4LA 2IWRA 4IKEA 1K5GA 2ZJ5A 1NG9A 2XNIA 2ODEA 4L9SA 2HXSA 4HLQB 1NNEA 2BMFA 2CJWB 2YC4C 4OBEA 5F3WB 2A5YB 3GFOA 1EFCA 1P9WA 2QP9X 3QI2A 5JWHA 4PANA 2V55B 2K1QA 4CEHB 4A6XA 2OFXA 2IYTA 1XMJA 1QF9A 3SV7A 1H8HA 4IJMA 2O0KA 1X1RA 3M5LA 5L3RA 3L0PA 1R0ZA 2ZI5A 5JRJA 3TSZA 3K0EA 1M7GA 2G83A 2XAUA 4ZIRB 4HB2A 1F2TB 2OCPA 5KSYA 4NH0A 3GQBA 5GJBA 2H18A 4XVQA 1OV4A 1XJ0A 3SYJA 4UQOA 1CXZA 3QEOA 2VP9A 5CIWA 4OHXA 1EFUA 4UNNA 2BMEA 2ATVA 3AUYA 2OBQA 3RS5A 1AKEA 2I4IA 3TUZC 4Q7MB 4JSTA 2YWGA 2OG2A 2QGZA 1FL9A 1Z22A 2W6JA 3DMNA 3NKVA 3O8CA 5L3SB 3AUXA 3G82C 2GHIA 4RI0A 2Q9AA 2PCJA 1R5BA 2XEXA 3OEED 2X19A 3AVUA 1XDBA 3OEEA 4C0BA 1P60A 4D4JA 2Y8EA 4D4MA 4WIAA 4PHTA 1Z47A 4B6EA 1W1WA 4LOAA 1VHLA 1SVLA 4JL5A 4F4IA 4QHTA 5JJLA 1G17A 2A5FA 1KAGA 1EFRA 2ODWA 3NXSA 1X86B 3EPHA 3KQKA 3R9XA 3FPAA 1TQ6A 1KK0A 2FSHA 4Q02A 4WA7A 1UEIA 1XFAA 4M1SA 4H1UA 3ZQJA 3TK1A 2V9PA 2BCGY 2QM8A 3UK6A 3LBHA 1RRGA 2JLWA 3F5FA 2F1HA 4KI0A 1IXSB 4JL8A 2VO1A 4LHVA 4Q9IA 4D25A 5HZHA 1ZUNB 4ITRC 2ZREA 5LB4A 3ZIAD 4P4SA 3D6TB 3TKLA 2NGRA 3ZIAA 3CUEF 2RGNC 1YU9A 2XCNA 2JLUA 2WJHA 3QPWA 1WXRA 3M0EA 2OBOA 1XEXB 3AF3A 1GG2A 3X1YA 3B6EA 1JPNA 1KMHB 1G1MA 2EYQA 1OFHA 1R0WA 3HU1A 1Q22A 1A2BA 1W3CA 4FWTA 1WP9A 3TIFA 4URWR 1U9IC 1AKYA 2IA5A 5AUPB 1E1QD 2HJVA 2JLXA 2CMKA 3QKRB 2WIBA 2BBOA 4AY2A 2EFEB 3P26A 2DCUA 3TR5A 5KPJA 2J87A 1X8JA 3VU9A 4QKQA 4Q7KA 3NDBB 1GDDA 2IF2A 4X8HA 4XWKA 2J7KA 2OK5A 3QEJA 1G4AE 2XXAB 2BCJQ 1WBDA 2OCYC 4EAQA 1NF3A 4TL9A 1D9ZA 4TT3D 4LJ8A 4D0GA 1ZYUA 4TT3A 1MT0A 1KO1A 2A4QA 3D8BA 1ZM4A 3CF2A 2RMKA 1E9CA 1SZPA 5J4KA 2FDCA 2YWHA 1E99A 2IYVA 3E1SA 3B60A 4JSYA 2YOLA 3C8UA 1KDRA 1U2RA 3K0CA 3U44B 1OH7A 4M9QA 5EE3A 1Z08A 2OSBA 3JVUA 3SI7A 4ESHA 1W0JD 1E9FA 4A2WA 4HUTA 3UWOA 3FHTA 2H57A 4JLBA 1ZIOA 4YC7A 3TJZA 1G8GA 4B74A 4Q1FA 3QF7A 3LO5A 4A0GA 1NVVQ 3QF4B 2ZSDA 2XOKA 2YKGA 3VNVA 4HB0A 4IVRA 3QG5A 1G8HA 1ZNZA 1E1RD 3CF0A 3TUIC 3AK5A 3PUZA 2WBLC 3E2IA 3KKQA 3U4QB 1U8YA 5FH9A 1N6RA 2QMHA 3DKPA 3VNUA 3PFIA 1PUJA 2O0HA 1NMYA 1A7JA 4FI3C 4HDQB 1UBGA 3D3QA 4G0NA 1YHNA 5FUXA 1XJQA 4I1SA 1G6OA 2X8AA 3L0OA 5E4FA 2V7QD 1AK2A 1XU4A 5F9HA 2V7QA 1YR6A 1VYVA 1G19A 2A4RA 1W36C 1P75A 5IRCD 3LY5A 2FGKA 4WOPA 4QJ3A 2VQSA 1QHNA 1P3JA 3TUJC 2F1RA 4MRNA 5C4GB 3SYNA 1FMLA 1S8FA 4S35A 2PT5A 1QHSA 2OC8A 4DKXA 5FOVA 1F2UA 3CNLA 5M04A 2H5EA 4MGYR 4B35A 2QMUA 1SXJB 3MJHA 4B3BA 1ESMA 1WCV1 4B3XA 4BZQA 2VRWA 5FPKA 2FM2A 721PA 3CLVA 2GILA 1E2DA 3AKDA 4WVFA 2IUTA 4TTPA 5FBVB 2I1QA 4WAUA 1FTSA 3QY0A 3SYKA 2JJ2D 3NHBA 4TN1A 3MWKA 5H70A 3B1YA 2E9SA 5TXGA 2QP4A 5CYOA 3T12A 1XRJA 1NY6A 5KO2A 4ASUD 5A5GA 3QXXA 3EIQA 4B3FX 3TRFA 3SZRA 1IONA 4DLXA 4ASUA 4KXFB 4P32A 1WDTA 4YMUA 5G3ZA 2ZJOA 2VIIA 3ZD6A 1B0UA 5CM9C 3Q85A 3GJ7A 1XPUA 3EXAA 3KNXA 1HV8A 1IHUA 1RVDA 4P33A 4BFTA 4XVUA 2NMVA 1XD9A 3BORA 2ZRJA 4NP6A 5JHGB 1Q1ZA 3THXB 4CYMA 4XSHA 3W6PA 2IL1A 2P6NA 4LPSA 2WSSD 2ZRFA 1A2KC 1JXMA 4FCWA 2PZEA 3I73A 2CE2X 2WSSA 4BFUA 4OQXA 2D06A 3EIHA 1E2KA 3HPQA 2WOJA 2J7PA 3KFXA 1P62B 1ZUIA 1GKIA 4BFYA 3FOZA 3THOA 4Q01A 4M8NE 5DIFA 4KHZA 5AJVB 1US8B 3LONA 3W5JA 3PCRB 3CPEA 3VR1A 3CBQA 1G8PA 5CK4A 4RZ3A 3SU3A 1OSNA 1E4YA 4Z1MD 1E98A 1XNJA 2AXPA 4Z1MA 4ABYA 4YMTA 2QSYA 3EPKA 4JLAA 1CJUC 4LYFA 2FSGA 4BEBA 1LF5A 2ZEJA 1O3YA 1S3GA 4Z8YA 1IAQA 2XJ4A 4M1YA 3VKGA 3CWZA 2ZE8A 5F2EA 4KTCA 1XTIA 2P6UA 1GKYA 3KB2A 3PIRA 4OQLA 1G3RA 3TW8B 2WJYA 4NPHA 3K0AA 3NH9A 1VMAA 2CLSA 4Q4JA 4PXAA 2BBTA 4BFZA 2ERYA 3PQCA 1N6HA 4R8TB 2Z6VA 4EFLA 4DEYA 1VG9B 2VF8A 1XF9A 3QXHA 3X2SA 1KIMA 1UBFA 1Z28A 2GEUA 4Q47A 4UKDA 1KSGA 4R2HA 3DL0A 4FCTA 1NVWQ 1P5ZB 1QHYA 3K70C 4JBYA 3WXMA 4ON9A 4CRWB 4CDGA 2VF7A 1W7AA 1XPRA 3RC6A 1U90A 3B9PA 3SDZA 1EGAA 2GCOB 3T15A 3DPUA 2BBWA 2KI5A 3SU5A 1N6IA 2QE7D 3AVTA 2XGJA 2NOAA 2QE7A 4EJSC 1AS0A 1E2IA 1T91A 4B48A 2V8OA 1MABA 5CLLA 1T0HB 2ZI6A 4HI0E 1PUIA 4B34A 3I61A 3WNBA 5BN3A 4XWAA 1JAIA 1R2QA 3UIEA 2D62A 4AKIA 1XD2B 2V1UA 3GJ8A 4IVPA 3HR8A 1Q1EA 3WHKA 1E9EA 4NYMR 1TF2A 4IFBA 2ZQ5A 4P4UA 3EARA 3PR1A 5EJEA 1T5LA 5EE9A 4BZPA 5FBQB 1XEWY 3CRVA 1RYHA 4Q1DA 1HURA 2WWXA 2GCNA 4HAYA 4U02A 1IN8A 2QUZA 2R65A 4GOJA 1OT3A 4Q4AA 1RC8A 5BYKA 2FFBA 5EXXA 3JZAA 2ZRIA 2F55A 1G41A 3GP8A 1JR3D 4TYPA 3WMEA 1E32A 3LVRE 1E2QA 1ZU5A 2PEYA 4QNMA 2BBSA 1R7RA 2WOOA 4UNRA 3EA5A 3KJEA 1NRJB 2PLFA 1T9HA 2CL0X 3SU0A 4I1OA 4L15A 1TF7A 3LNCA 4FD2A 2PX3A 5FTKA 1PV4A 4K46A 2HT1A 5HTKA 3AB3A 4ARZB 1J8YF 1HTWA 5FL3A 5SZJA 1NKSA 3OAAD 4Q7JB 2R6CA 4V0LA 4AIIA 1CIPA 3DDCA 2IS6A 3OAAA 2P0EA 1ZD1A 4CF7A 3MMPA 1Q57A 3QIAA 4KITB 1NVXQ 5JZVA 1U81A 3VKHA 3KTAB 1IJFA 4DB2A 5FFMA 2IK8A 1XD8A 2WIAA 2RHMA 3KKMA 1KI3A 3AKCA 2PLRA 4EKDA 4EUNA 3PUWA 4JVMA 2W6ID 4U00A 4ZDKA 4DCVA 1AS3A 5H1YA 1CR0A 4JT4A 2QBYB 1Q3HA 1CR2A 3C41J 3REFA 1WMSA 3AF4A 2FZLA 4RZ2A 1KI1A 3GD7A 4G1UC 1KYIA 1KSHA 3BOSA 3U5ZB 2FSIA 2YOFA 5BN5A 3GJ5A 3B82A 4JLVA 3AVXA 3AVYA 3A36A 3Q7QA 5FPSA 2ECKA 2YV5A 4LJ4A 4V0NA 1RJ9A 5KTYA 4JIMA 4JLNA 3C5HA 5DO9A 2OM2A 3CM0A 3WYGA 1S0UA 1GP2A 3LXXA 4JLMA 2GXSA 4PAMA 2BC9A 1AQUA 3ZVLA 2J0QA 3HU3A 2ZSEA 2F9LA 1YRAA 3H1TA 3H4MA 5KNDA 1KTVA 3M1IA 4GT1A 2A30A 1CJVC 521PA 5F98A 3KZ1E 4ESVA 1I4LD 2BM0A 1R0YA 5DI3A 4F38A 3A1SA 3PITA 1Q21A 4Q18A 2OO7A 1JBKA 1T5IA 4RZUA 1XMVA 2QN6A 5CB8A 4NU0A 2DB3A 1Z6XA 2RGBA 4YMSA 1L4YA 2ZE7A 4DSNA 3CB4A 1JR6A 4QJ4A 4TZ0A 4FIDA 3GJ4A 2BM1A 1X1SA 1MH1A 2UZ3A 2B21A 4DHEA 4ZKDA 4L4UA 1E0KA 2VH5R 3C14C 4HAUA 3FVQA 2WWIA 2IC5A 4B71A 2C9CA 2FOLA 2FNAA 3IO3A 4KU4A 4E5UA 1QZXA 2JEOA 4Q1CA 3OIVA 3BAFA 2IYXA 1N6OA 1AQYA 1J8MF 1T6NA 3AQ4A 4XTRA 5H68A 1KKLA 1E2NA 4AYWA 4D2IA 4KODA 3MFYA 3EC2A 4L8GA 1ZC4A 2QPOA 3B5JA 4C2UA 2OFOA 2IYRA 4HZUA 3OESA 1KI4A 1W49A 1XEWX 3H86A 3TAUA 2QTHA 2BV3A 1E94E 1H8ED 4URVR 4TYNA 1G3UA 1IN4A 1E6CA 1L2TA 2BEJA 2F43A 1H8EA 2VSOA 2XITA 1BT7A 3ECCA 4HB3A 3R7WA 3BIFA 4XOIA 2PCLA 4QM7A 4LJ5A 2GZHA 2XB2A 2RCNA 4LYAA 1FP7A 2ZU6A 3TBKA 4IEEA 2ZJ2A 3PG5A 2QENA 3ADCA 3HDTA 5EPNA 4D6PA 3CKLA 4C0SA 3L6PA 3A4NA 3CZQA 1KZ7B 2O8FA 4ZO4A 4R7ZA 3U6BA 4Q5IA 4BLSA 4B2PA 3SV8A 4WBSA 2GESA 4R9UC 5G40A 2C5LA 3Q8XB 2ZSAA 2A5GA 4Q9JA 3ADDA 2FJUA 2PX0A 4KSCA 2IS2A 3FMPB 2FFHA 1G7RA 3B78A 5T1VA 1Z2CA 3AF0A 1II8B 2W83A 2CVFA 1OFTA 4EPWA 4PSKA 4QJ5A 4KLZA 2GVZC 1R8QA 1R10A 2XNSA 1TAGA 1TQDA 1RE0A 4Q21A 3X1ZA 1MRNA 3K09C 1F3OA 4U7DA 2WKQA 2ONJA 3GEHA 3O8BA 3EG5A 4IDNA 3QJYA 2JJ1D 3TE6A 1B23P 2H17A 3T61A 2JJ1A 4NWKA 1T0JB 3DKVA 2YNMA 1X3SA 1UJ2A 1QHHA 1GIAA 2ZAMA 4LV8B 1KI6B 1ZNWA 2OBNA 5KUTA 4MKIA 3NEYA 3LQRA 4IOJA 4CW7A 2R8RA 4GL2A 2O8EA 3P4XA 2ZRKA 3MJRA 1KSJA 3PENA 1OH6A 4TYQA 3K9HA 4I99A 4AURA 2C03A 1DAIA 3A4MA 3CPJB 3IIJA 4RFSB 4NCJA 4DRZA 1W2GA 2A78A 2GVDC 2EFCB 4LBYA 3NC0C 2GGVB 1E4VA 1SXJD 2IYZA 4UJ3A 1II0A 1IBRA 3TNFA 5KDDA 2HF9A 1NIPA 2F6RA 4YXWD 4NBSA 3I62A 4TMXA 1YZGA 3IHLA 2DFLA 1KI2A 3P8OA 2YWFA 1W36B 3EZFA 4QG7A 4EQ6B 4US1R 1G64A 1IM2A 3GEIA 1G21E 4ZI2A 1UBEA 4O0MA 3DHWC 4NKRA 5TARA 3S1AB 2KBEA 3X1WA 1C4OA 3CRMA 3DM5A 2V6JA 2BOVA 1P7CA 3RRYA 4V02A 1ZMXA 4LHXA 4MKGA 5TV2A 1W0KD 1HA3A 3RRZA 3BFXA 3PVSA 4DSUA 2XZOA 1AGRA 4F7WA 3IEVA 2DY1A 5G53C 2XTMA 3M6AA 2FPMA 1U94A 4PPGA 3N2EA 4TYWA 4URUR 1GFIA 1SKYE 2V1XA 2QRZA 2XNDD 1Z6TA 4LJYA 5DH9A 5EE0A 3WMGA 2WWYA 1S2MA 2XNDA 3PEUA 4FMBB 3U3JA 1NJFA 5HCNA 5AK0A 2DPXA 3DVLA 1QHGA 4NZYA 4US0R 1YR7A 1IN7A 4P31A 1KK2A 2P65A 2JLRA 2O8BA 4WH6A 1JB1A 1JECA 1N3BA 2WVJA 4NYIR 5EUMA 3SOPA 3KDSE 5BN4A 1OXXK 2XSZD 3PJRA 2XSZA 2PZFA 2QY9A 221PA 5CYPA 5FBWB 2OBMA 4OKSA 4LV6A 4DC9A 4MGKR 2Z0MA 5D3MA 1TU4A 4CVNA 3T1TA 3QENA 4CEIB 4QL3A 2X77A 4Q4HB 3THYA 4A1VA 3IEUA 2X2EA 4GP7A 1GUAA 5JCPA 5FPTA 1OIVA 3OE7D 4I1VA 1ZVQA 4LHZA 5JRZA 2BWJA 3OE7A 3VX4A 4YMVA 5JSZA 1NN0A 1MO5A 2FN4A 2VEDA 1XB2A 3MD0A 1SHKA 3WRYC 1KK1A 2NO6A 1OYWA 3NDPA 4GI7A 3MLEA 1HT2E 4MQBA 4TTQA 4P4TA 1KO4A 1Z3IX 1IQPA 2BDTA 4KLNA 4A1TA 1L8QA 4GBMA 4Q4JB 3VX3A 2OXRA 1TMKA 1V43A 4V03A 3EZ6A 1E3MA 2ZI3A 3A4LA 1JEDA 2ZR9A 2GVFA 5L3VA 2WWWA 3LV8A 4PAQA 1JJ7A 3U6KA 4HLUA 3KQHA 5GJWC 3KF2A 2J0UA 1CRPA 1SHZA 1MO6A 1Z6GA 1G7TA 1E2FA 3AF1A 4DDUA 1YZTA 4JKIA 2O8CB 1E2EA 1TX4B 5GADl 1Z06A 5AJYA 4YONB 1AM4D 4FINA 1SQ5A 5AJZA 3RRMA 1OIWA 4TQ9A 2FPKA 3U3OA 5EXTA 1BYIA 1DG3A 2DHRA 1D9XA 4HUQB 2IBMA 3K70B 1C1YA 4L5BA 4O25A 1L7VC 3SJAA 1DAFA 2VP5A 2L0XA 3RS0A 3CIOA 3EA0A 1GSIA 5AUNB 4KVGA 5K8TA 3U1JB 2GEDA 3W6NA 3EAQA 4DT1A 4EJSB 3L43A 3SU2A 4BEJA 5K8IA 1ZC3A 3OIYA 3ZVNA 1W46A 5IDKA 1NBME 1ZIPA 3IIKA 3M4YA 4M1KA 3BB4A 3NBFA 2BKEA 3KKPA 3I4LA 1I2DA 3SZEA 2GA8A 5EUQB 4UXHA 4LC0A 1NIJA 4A6PA 4A2QA 4G01B 3GFPA 5UKDA 2NG1A 4PAOA 3BXZA 1DAMA 5FOUA 2ZAOA 3QPUA 2CK3D 3VR5A 3T1QA 1FX0B 1QHXA 2AHOA 3W9YA 3ASYA 2F1JA 2A4GA 2GBLA 3SU8A 4PR0A 1KKMA 1SKYB 1ONBA 2WMNB 2ZM5A 2GF9A 4B43A 2ERXA 4BRWA 3NVAA 1MOZA 3K0FA 1CTQA 3RS2A 1GOTA 4AD8A 2AR7A 3F0TA 2VPPA 2FG5A 2DR3A 2F3TA 4FMDB 4D80A 5C1BA 1J7KA 5HZKA 2W00A 1S9HA 5CK5A 3WNCA 2XB4A 4WZ6A 2OUKA 1ZD8A 3FHOA 3SU4A 3CX6A 4P3YA 1OLOA 2AWNA 3Q72A 3AV0B 3K53A 2HXYA 4HB4A 4OJKA 4LWZA 5L3QA 3ZS8A 3VR4A 2JLYA 4MUBA 1NLZA 3RS4A 2D7DA 1Y3AA 2OT3B 3THWB 1TEXA 1XZQA 4LCBA 5SZKB 1NMXA 4FMCB 3EZ9A 1D2NA 4D4KA 4MITA 2OV2A 4V0KA 4TTRA 3BB1A 3KXLA 1TADA 4Q48A 4FMDF 4FWIB 1EWQA 2AFIE 4QBGB 1XCMA 3TW4A 4DZZA 1JQJC 5ELXA 1RZ3A 5J4HA 4QHSA 2IF0A 3RAPR 4M1TA 4KSBA 3ICQB 4WW0A 2YZ2A 1E1QA 1UKEA 1W2HA 3FWYA 2ODNA 1DE0A 3KKOA 4MYUA 4PO9A 4DLYA 4YDHB 1M34E 2FA9A 3SJZA 4JKYA 3HPRA 3RWMB 2WJVA 4ZCLA 2A9KA 2RGAA 4HAZA 3RWOA 3CH4B 3EZ7A 4LHYA 4FMCF 4DBLC 2R6FA 2AKAB 3K0CC 1GNPA 2JJ8A 5JLJA 1ZAKA 2J3EA 3A1VA 2IX3A 3EWSA 2OCBA 2REBA 5GVRA 1WB9A 2Z4RA 3KXKA 2FH5B 1GRQA 5D3QA 1XXHE 2H1LA 2W2VA 1BS1A 3K8YA 2ZUCA 5B6LA 1JXOA 4RJLA 1W0JA 1CU1A 2QL6A 4AKGA 3FFBA 4AK9A 3GLIA 1BH2A 1VDZA 1D5CA 4PQYA 2BVNA 2MSCB 3G5UA 1Z83A 2J0SA 1DBSA 1W48A 1YZUA 3I1FA 2ZROA 4OQFA 1E1RA 2R6AA 1SKQA 3BFKA 3F3YA 1ZBDA 2XCFA 3RSLA 1VCNA 4M9SA 1PZNA 2VSXA 2ASEA 4M53A 1P2VA 3MSXA 4DJTA 1ZJ6A 2JCSA 1R0XA 2NIPA 4KYIB 3H2YA 4D26A 5C4MA 1GAJA 1PJRA 3RLFA 1CKEA 2WM9B 3PUVA 4OHWA 4WZAE 2OCAA 3U7FB 1M8PA 2KBFA 5K8UA 1E0JA 5KSZA 3B7GA 2NPFA 1ZRHA 3L0IB 4PPNA 4TMVA 4G5OA 4GP6A 1Z8FA 4W5JA 4F4CA 4RVCA 3SUDA 1R5NA 4ZDJA 1XWIA 3REGA 2A5JA 1Y63A 3OHMA 4IDOA 3G0HA 5CM8B 2VA8A 1U8ZA 3EW9A 2CLDX 2IYLD 3IUYA 1NL3A 3P4YA 2XZPA 2CCJA 4QGAA 4RD6A 1XTQA 2Q9CA 4MDEA 1P61B 4WXRA 2GXUA 2ZS8A 4M0LA 3SUGA 4PC6A 2WAYA 5JI3E 1TNDA 4PQFA 5CJ2A 4TYDA 2B92A 4Q1AA 3GLGA 1E9SA 2JJ2A 2JATA 3GLFA 2ZRBA 2AFHE 3OYPA 2C78A 3I32A 4OHZA 3FKSD 4W5WA 3WNDA 4A1XA 2ZIAA 3ZD7A 4OK5A 3FKSA 3LX5A 1G5TA 4BASA 4R71A 5B64A 1Z0DA 2WHXA 2DWQA 4C0JA 4E07A 1SVIA 1P72A 1GTVA 1UDXA 4A8JA 4MYCA 1DAKA 5BYJA 3EWAA 2N42A 1NSTA 1RW4A 2JASA 3CONA 2FPLA 2C9OA 4QXAA 1SGWA 1ZNYA 1KO5A 5IHPA 5JECA 4MDFA 4CGZA 2G6BA 2D7CA 2O0JA 2YJTD 4LX0A 4C7OB 1RRCA 4HAXA 2ZTSA 4W9MC 4NWLA 3BC1A 1GWNA 5DN6D 1OXVA 4Q03A 2H7VA 4HEJA 4AWXA 5DN6A 1ZUHA 1G18A 1G7SA 2MMGA 4KFUA 3M5MA 4MKHA 1A1RA 1XXHB 1ZM9A 3CNOA 4HAWA 4TL7A 3W3AA 4TLAA 2J45A 3UANA 5H8WA 4GZMA 4GOXA 5JS8A 2OHFA 3B1ZA 5DYGA 1U0JA 4M1WA 2A3RA 4X8MA 3AVQA 1LVGA 2JAQA 1LY1A 4BLTA 1KY2A 2OXCA 1XJCA 1D2MA 1S96A 3WBKA 4O2RA 1V5WA 5JMTA 1DEKA 4BECA 2G77B 1I4DD 1D6JA 1R8SA 2ZSBA 2VL7A 4B47A 1VIAA 2WTUA 4AKEA 3AGQA 5KNCA 5HE8A 1KDPA 2GJSA 2VSFA 3CPHA 3FHCB 1T8TA 1KO8A 4OHYA 4KCGA 4BLRA 2GZDA 2QPAA 2IYYA 1VIYA 2BJVA 3GLHA 2RB4A 3QKSB 4Q7LA 4FW9A 1RRPA 2YYZA 1ZCAA 2CDNA 2W2XA 2ZI9A 3WYFA 3R9IA 2DBYA 3W8NA 4LGMA 5EP2A 4CZ2A 2NZJA 5JI2E 3UKDA 3PEWA 3RC5A 2BMDA 2Z43A 1WRBA 3RANA 4ILEA 821PA 2ZS9A 4TSFD 3A1UA 2G3YA 2B7CA 4MRSA 2FOMB 1M1YE 2AD5A 2R2AA 4RD4A 1TQ2A 1XTSA 2C96A 1GNRA 5J47A 5EQSA 1OYYA 1U98A 2GRJA 2WJIA 1HUQA 2CJWA 3K9LA 2N46A 2CVHA 4POAA 1HH4A 1AZTA 3IO5A 2LKCA 4CEHA 2QAJA 2ZRMA 1PLKA 5A0FA 4JZKA 1P2SA 3KX2A 4LJ9A 4IOLA 1CJTC 2DWOA 1DG1G 1S1MA 2CHVA 1JXPA 4QNRA 2MSDB 5FTLA 2OZEA 5KHOC 1JPJA 1S1CA 4ZIRA 1F2TA 2ZRHA 1R4AA 4LDJA 5KDOA 1J99A 5JJIA 5FBLB 2WMOB 3Q7PA 1J90A 2F3RA 1A4RA 2QT0A 1JR3A 1KDOA 2OILA 3T5GA 3VHLB 3OIUA 2IT1A 2P67A 1DAEA 3MWLA 1OF1A 2QTFA 2ZR7A 2QM7A 3SC3A 1NN3A 1CULC 4JLDA 4PO8A 2JLSA 3PV5A 3LD9A 3UMRA 5B57C 2WICA 3RC3A 4BGDA 2OC0A 2KSQA 3B9QA 2QGNA 5LDDC 3I5YA 4NYMQ 2AD1A 3SE0A 5L3SA 2ORIA 1M7HA 5TDHA 4HDOB 1KO7A 2O52A 1DY9A 1Q1QA 2FV8A 2RKOA 2UVQA 1GM5A 3B85A 3T1VA 4DDWA 1LB1B 1K6MA 2FE4A 1S9DA 4IOKA 1GL6A 4RD2A 3CR8A 2QTVB 3L0SA 1OB2A 3B2EA 2WZQA 2W6IA 4OI0A 2PBRA 4L9WA 3EPJA 1OKKD 4JVSB 2WJJA 1F5NA 3L8YA 4B6FA 3WRXC 5L8VA 5JJKA 1OKKA 3K1JA 2FMXA 3GJ3A 4A9AA 1OE0A 621PA 5IT5A 3ADKA 1FW6A 2IXFA 5C18A 1ZP6A 5AJXA 4LY6A 1AA9A 2GAAA 2ZI4A 5DLQC 4LZZA 4BFWA 4G3XA 2MMCA 3UATA 3PEYA 2NO7A 3U2QA 4LV5B 2ANCA 2EQBA 1VG0B 4XTCS 3AKYA 5DHAA 2OLJA 3SQXA 3ZVRA 4NL4H 2P5SA 1OXTA 2R62A 1N5KA 4QC2A 3KN2A 4JYCA 4OI2A 4GNKA 2CCKA 1CR1A 3I8XA 4JYBA 4V0MA 5F9FA 2EFGA 1F6BA 3QG1A 3PUXA 1FFHA 2B6HA 3Q5DA 4AYXA 4GZLA 1EFHA 2N1BA 1YR8A 1DPFA 4P4SB 2H92A 2HYDA 4D0NA 1XEXA 1N6PA 2B8TA 4RCYA 5J4VA 3A8TA 3OEHD 2ZPTX 5EP4A 5KYKA 2EWWA 1KMHA 3OEHA 1QG2A 1P9RA 1TQ4A 2NO0A 3HR7A 2ZSFA 1OFUX 3B1VA 2FWRA 4B75A 3LH5A 3NC1C 1RPZA 3CX8A 4OJQA 4KFSA 4AYTA 1Z07A 3ND9A 3GLFE 1GNQA 4CEJA 1W4CA 2VLIA 3I3SR 1N5LA 3C5CA 3SJBA 2VHCA 4X8OA 1J2JA 5IK2D 3QKRA 5IK2A 4HLCA 2ZS7A 2BMJA 4AKHA 3MUFA 1XTJA 3OF5A 1IN6A 1WQ1R 2CHGA 5P21A 3RRNA 5BXQC 4TMKA 3IDQA 4JLKA 3VU9B 4M9XA 2EW1A 2XXAA 3A58B 3FMOB 1TL7C 3BH7A 3KJIA 4YLGA 5EE1A 2F1IA 3OFND 4TQUS 1KMQA 3GJXC 3K9NA 3OFNA 4I31A 3MGCA 4DCUA 2HDNB 4TMWA 2XZLA 1QBKC 3LVQE 3LFUA 2A5DA 5DE3A 4PC3A 2WKRA 3U44A 4Q1EA 2AN9A 1P2UA 2P2LA 2Q9BA 4QGHA 1VG1A 5SZIA 2QEQA 1G8YA 4ZPXA 5B30A 3KQLA 5EZ6B 2C99A 2GKSA 3PEVA 3X1XA 5EE5B 3DMDA 4CIDA 4HSEA 4DCTA 3CW2A 3QF4A 2ZRLA 4B3CA 3ZZ0A 3QOFA 4TMTA 1TTTA 2REXB 5BWMA 1F60A 1QVRA 3CF6R 5FL7D 3N5CA 3HYRA 1AZSC 4TL8A 4F93B 1YVDA 1VTKA 1DAHA 3IBGA 5JWRA 1LTQA 3IBYA 2Z83A 3U4QA 1DADA 1P9NA 3KL4A 3SHFA 4A0RA 2FGJA 3GJ6A 4PSVA 5CDFA 1G20E 1M74A 1XCPA 2OAP1 4R98A 1E2PA 3Q3JB 3SFVA 4Q4LA 1M7BA 3NBYC 1P4SA 2IXEA 4NYJR 3V9PA 5LD2C 3Q9LA 1OIXA 1G3IA 1HQCA 2ZUBA 4AI6A 4I32A 1T3SA 3GMTA 4XD7D 1VCIA 1K5DA 4G5QA 2FU5C 3FYHA 5G41A 3LKWA 4OI4A 4XD7A 1G8FA 2RHDA 1WXQA 2V6IA 1Z6YA 3ASZA 5HCIA 2QZ4A 4PQRA 4JVLA 2A7QA 3KQUA 3T34A 4DVGA 2ZJAA 1VG8A 4OQNA 3SV6A 4PO1A 2W0MA 1SXJA 2LCFA 3CX7A 5EPYA 4QRHA 5DI9A 5FR1A 5J5CA 1F2UB 5J40A 1YJ5A 3DZ8A 4PC1A 4B44A 1UDWA 4YXWA 4M9FA 2V54A 1CLUA 2J59A 2IEZA 5FI1B 4DDVA 1DOAA 1NN1A 2C95A 3NEJA 5LB2A 3UWKA 2W58A 2CHQA 4BLPA 4LI0A 4KFTA 3BGWA 3SQWA 1A1VA 4WH8A 2O8DA 2ZRCA 1E2HA 3TH5A 1UKZA 3H09A 2QMEA 2WV9A 1AN0A 1T4GA 1SVMA 3QXSA 1G9XA 1FMJA 2GK6A 4QBIA 4ZDWA 3RVBA 5KDLA 4W5HA 2ZVPX 1W0KA 4B33A 3KXIA 3TSOA 4V0OA 2FEOA 4Q19A 2JA1A 3UMSA 1LNZA 4AC9A 3B13B 3UMFA 1KI7A 1BO6A 2UKDA 4WZBE 4Z51A 5ETXA 4LYHA 1ZM7A 4YDSA 2QPTA 5FR2A 1FQKA 4A36A 4L16A 4PHGA 4KVAA 1Z29A 3VHXA 3ZYCA 4XSGA 2C77A 4RD1A 1OFIA 2HEIA 2JDID 4NCNA 1UKYA 1US8A 2JDIA 1UEJA 4BZXA 2G0TA 4Q1BA 2HCBA 3VMFA 1T3LA 4NONA 3DM9B 3KFVA 1VPLA 1IXRC 1TF5A 3QXJA 5FTMA 3KJGA 3U3RA 4TQAA 2FEMA 421PA 3SBEA 2W0SA 1SVWA 1T8UA 4LK2A 3FFAA 1SVKA 2G1JA 4U01A 2WKPA 3IKJA 5CLQA 5EXSA 3ZJYA 3J81k 4MGZR 1II9A 2CL6X 2QAGC 4E09A 1OXUA 4ZKEA 4IXMA 2AKYA 2HLDD 1FP6A 3BD9A 4HLUC 2HLDA 3K0AB 3B1XA 5JEDA 3IPYA 4NYIQ 3NTUA 3M5NA 1IY2A 5GJCA 2QAGA 2WPDD 3JVVA 5TB5A 3BH0A 2OC7A 5JS7A 2WPDA 2LKDA 4V0ME 1E2GA 5DNYB 2R6DA 5HKKD 1Z63A 1XZPA 4JMPA 1ZD9A 2DYKA 4LUCA 2P59A 2EWVA 5HKKA 2ZJZA 4JVNA 4I33A 2NPIA 4XJXA 3AEZA 3PUYA 5LBIA 5EQTA 2XTZA 1YKSA 2ZYTX 1JAHA 2GJKA 4AG5A 4DUGD 1KSFX 5J4YA 5FI0B 3V4RA 1DELA 1ZINA 2GCOA 4DLZA 1YZKA 4DUGA 5K8LA 5KPDA 2DFTA 2CEAA 1P2TA 1Q12A 3LW8A 3U3KA 2D3WA 4B2LA 2NTYC 2H8KA 4ZDIA 4OL0A 2IHYA 3ZQ6A 3A37A 1E2JA 2HUPA 4EPVA 3VKWA 3UPUA 3TMKA 3H0KA 4TLEA 1MABB 3NBZC 3ZS9A 2F9MA 4ZI3A 1YZQA 1XD2A 2VTKA 2XX3A 5AJWA 2B8WA 3I8SA 2PL3A 2ZRDA 4DDTA 3A1WA 1QHIA 1Z5ZA 1F48A 1DS6A 3ZZUA 3ONWA 1N2CE 2ZJ8A 4WF8A 2GDJA 1AS2A 1ESNA 3DEFA 3IIMA 5KU1A 2FX3A 1H8HD 3GFTA 4A2PA 2IS1A 5KNBA 3BERA 3P20A 2GEVA 2GBLC 2BHRA 2IXGA 4M1OA 1E0AA 2ZRPA 5E7IA 3IGFA 2C04A 4Q4AB 3RNLA 5KOYA 2VP2A 3KQNA 4Y0VA 5FTJA 2C98A 4QOSA 2CK3A 1XPOA 1XMSA 3FE2A 4LBVA 5FUWA 5LPNA 3EPLA 1UAAA 1CEEA 1G5RA 2VP4A 3KJHA 2C8VA 3IHWA 3AVOA 4ARZA 1CRQA 1NSFA 2VHQA 1P73A 1JNYA 5JFGA 4LJ6A 2XTNA 3W8RA 1IY0A 3QPVA 2W6JD 4A0FA 3KB1A 1OB5A 3KTAA 5DGXA 1TU3A 2ANBA 1KI8A 1WE2A 2GK7A 1M2OB 2REOA 3LBIA 4PZYA 5GVSA 2HT6A 2QNRA 2XJ9A 3U7GA 4Z54A 1MRSA 3LW7A 3C16C 3P32A 4NCKA 3PXGA 4N3NA 2MSEB 2QBYA 1DARA 3BWDD 3DO6A 4NTZA 3R8FA 3TGPA 5EQRA 1KAOA 3QQ5A 1UF9A 5CDFE 1EFRD 1S4QA 4BPBA 3AGPA 4PZZA 3SUEA 4TLDA 1LFDB 1XTKA 5FUYA 4EPRA 2F9UA 2YC2C 4PHFA 3C4JA 3QKUA 4HATA 3LQQA 2GZAA 1RJ9B 1N5JA 3NWJA 4A1FA 4EFNA 4C4PA 1G3MA 4XWOA 1T3HA 2ZYVX 3O8RA 5BQ5A 4JLPA 4HAVA 3LXRA 3F8TA 1IN5A 2G1KA 2CE7A 3W90A 4E22A 1A82A 1E69A 4BWYA 4NDZA 2AK3A 2FSFA 3CH5A 1IOZA 1SXJE 2X2FA 3T06B 3TQCA 1ANKA 5JHHB 1UKVY 3I92A 1H65A 1Q44A 5DI3B 2NQ2C 4XVRA 2AXNA 3DOFA 1UADA 1E9AA 4IOMA 4BFXA 1U8AA 4LBWA 2IYQA 4G5SA 2C9YA 3K0SA 3QVVA 2RGNA 1LF0A 2PMKA 2HYIC 2QG6A 2FF7A 4XH9B 3AKEA 2OBLA 1DY8A 3AP1A 3IPXA 4CEJB 3ICEA 121PA 1N6KA 2GF0A 3CNNA 4UXIA 2Q0HA 1NP6A 2UZIR 4DLSA 3I5XA 1Z0JA 1YZNA 2ODBA 4OI1A 2WWFA 2IS4A 2R9VA 2D4HA 1MO4A 1U9IA 2HJGA 4OHVA 4Q9HA 5B58C 4PTLA 2VYFA 4DSTA 1NVVR 2RGXA 3TQFA 1TPZA 1NN5A 4IDQA 4BRUA 1SVSA 3EASA 4HZUB 1C9KA 1BYUA 2PJRA 1NLYA 5KSPA 2F43B 1PLJA 4LBZA 4B2IA 5FUVA 2D2FA 1FUUA 3R7WB 2Q6TA 3SU6A 2VHTA 2R6GA 4MRRA 3ND8A 5TY0A 3HYTA 1RRFA 3R9WA 3EZ2A 1YQTA 3HP1A 3U3MA 2BKUA 4UXJA 2VHJA 4GSYA 1QRAA 4DIEA 1JI0A 2Q21A 1WF3A 1ZW6A 1E2LA 3LLMA 4JS0A 2O8FB 2ZRGA 3AP2A 2B7BA 1OH5A 3LA6A 1KHTA 3W34A 1KDTA 2XOKD 2F7SA 1E0SA 3GJ0A 2ONKA 4URZR 1II8A 4MRPA 1EK0A 1IJEA 1KY3A 1DO0A 3KUDA 4RD3A 4KBGA 1KNXA 1CJKC 1SULA 1NKTA 2ZYWX 3DZDA 4F91B 4M1MA 2ZRNA 2ZU0C 1WA5A 2QT1A 2ZR0A 4B3GA 3LDAA 4NCIA 3BK7A 4H9GA 5E7MA 3DOEA 4DB4A 4ZV4A 4ZCIA 4AG6A 3LRPA 4MKFA 2J41A 4GFDA 1KI6A 1HY3A 5EXPA 2QQ0A 4IW3B 1QHHB 5GJVC 2EVWX 4LHWA 1DO2A 2G88A 1E79D 3QBVA 4BFVA 1E79A 4O3MA 3E90B 1Z0IA 1J70A 1XEFA 2CXXA 2RGCA 1AJEA 1XX6A 3OZXA 2O8EB 1LS1A 5LD2B 3FTQA 4RFSA 4A15A 2JIZD 3X1DA 2OE2A 4MA4A 1NI3A 2JIZA 4A8JC 4Y0AA 3AH8A 4C3ZA 4EIWA 4ZCMA 3M5OA 4Z8XA 2PH1A 1W36D 2X1VA 4IDPA 3L82B 1YRBA 4A82A 4MYHA 3CZPA 1W4BA 2GXQA 4XIGS 4EQ6A 4YQFA 2VHUA 4PFSA 3SJCA 3S1AA 3WP1B 5TVKA 4EPYA 3RYTC 1CS4C 2YOGA 3CR7A 3CWQA 3KEEA 1MKYA 1XCGB 3EC1A 4BLQA 4C0AC 2O8DB 3D7MA 2RH5A 5J4LA 3O8DA 1KI9A 4TLCA 3EYDA 5ESBA 1UPTA 3LOXA 4CT4B 4DSOA 3NG1A 3TVTA 4UNPA 4PHHA 1HT1E 4RKFA 5EZ5A 5AWFC 4QHYA 4HDCA 5FOWA 2ORWA 3TR0A 1HYQA 3QNUA 4RCZA 2OAQ1 2EFDB 4A4DA 2C2HA 2QMOA 1FNNA 5A4JA 4LC1A 2IYUA 3LX8A 4DCNA 5DSZA 3GCGA 4C9BA 4RZXA 3VQTA 1NY5A 3FGNA 2J1LA 4DLVA 1KNQA 5CIQA 2NZ8A 1FZQA 2O8BB 2J7PD 4C2TA 1N6LA 3SNHA 2V4ZA 3R8CA 1EFTA 2G9NA 1BKDR 5H4IB 1DVRA 4HLDA 2D74A 4RSGA 3SBDA 5CJPA 4CEIA 1LW7A 4Q4HA 2OFWA 5D3MB 2Q3MA 3BBPA 4BE7B 1Q3TA 2R44A 4JL6A 1S3SA 3THYB 5E3HA 5E7JA 2AK2A 3QVUA 5BW8A 1PVOA 3Q5EA 4R2IA 3SR0A 1KGDA 5JSZB 3BRWD 2QP3A 1VCOA 1G4UR 4NHOA 4QGFA 1OJLA 5EQQA 2CL7X 5JEEA 1DXPA 2CNWD 4DIDA 1CP2A 3C15C 2CNWA 3V00A 3H84A 4OK3A 4TMZA 4PC2A 4TLBA 4X8LA 1DTSA 2QAGB 2QI9C 4I81A 4LJ7A 2E87A 4TSFA 3NIBA 2AX4A 2NO9A 3FKQA 4LRWA 2WAXA 2QRNA 2OLKA 4K8OA 3IILA 4FXPA 5FPYA 2ZRAA 4Q00A 5FPHA 3RS3A 2J0UB 3SHWA 3SS8A 2O8CA 2QROA 3CRRA 4OQMA 1JQLB 4KAXA 4MYTA 4NCHA 4IEIA 4S2EA 2IYWA 4TL6A 2IEYA 1VECA 1ZM3A 3LBNA 3KUCA 4QFMA 3TVDA 5AR1A 4U5XA 5HE9A 3A1TA 4P0TA 4MRVA 1GVNB 3CRQA 1DXWA 4M2LA 3B8HA 3K70D 1RKBA 4RY2A 1RIFA 5DYIA 1GITA 4HUQA 1IXZA 1G16A 2ZYUX 4DCSA 4KBFA 4QM6A 3U60B 4D4LA 4GDFA 4MH0R 2P6RA 2KJQA 3HU2A 4A92A 1A5TA 1G6HA 4NMMA 1PLLA 3BE4A 4IFEA 3T5DA 3P8NA 1UBCA 4FCVA 3ZZTA 3RABA 4KV9A 1GZSA 2G0NA 2QA5A 4G5RA 4EJSA 2TMKA 1BOFA 1EX7A 1R5OA 2HF8A 3E70C 2AWOA 4JT2A 1LS6A 4PC7A 3AP3A 4JLOA 1N25A 4DT1B 1UM8A 1ODFA 4IHQA 1JEEA 2RGGA 4PPFA 1AGPA 2O8MA 4URXR 4KYUA 4NE2A 2FZ4A 4Q66C 2H16A 5HR5A 3VTKA 5TMPA 3RC8A 3R20A 1FX0A 1TEVA 3GLIE 1Z0FA 3FDIA 4HYYA 4N0EA 1OPXA 3U7HB 3RS7A 2J0VA 2VBCA 3SYLA 3VR3A 2E1RA 4BQSA 4TYYA 1FPMA 5CITA 4KO8A 4OK6A 1QG4A 4PSAA 4EDHA 4IDHA 1ETUA 2DFNA 3IQWA 4ERNA
chains in the Genus database with same CATH superfamily
3ZLBA 1KJZA 4NMXB 3FFTA 1XZNA 2JGLA 3JQCA 3WZMA 5IBPA 1AQLA 4BTVA 2NQTA 2POCA 1OLSA 1W5FA 3MFQA 3RC2A 1U0BB 4GRAA 4TROA 3ZX5A 3L6OO 3OU6A 1S01A 5FPPA 2QNBA 2FN9A 4N65A 2Q27A 4L22A 2Q6KA 1CBUA 2H54A 1DO8A 1GL9B 4GHWA 2VZ9A 2COUA 2HDWA 2LDBA 4MI3A 2WJGA 3JQGA 3LIWA 1ESTA 2ZJBA 4JP8A 5JRDS 2VTBA 1UKBA 4G0UA 1V7PC 2Q3HA 5KTRA 3IDAA 1OH8A 1CQPA 3H6HA 2LZ0A 1T6ZA 3WAKA 5IC4A 5FBRB 3AVPA 1S8AA 2I67A 3SV2H 3CPSA 2ORVA 4DM4A 1U7PA 1AE8H 3QX8A 4W1RA 3W5HA 3ATWA 4MEBA 1N1LA 5JAMA 3UXMA 1O3BA 3OFJA 3H5NA 1GLVA 1RXIA 1NMZA 2B98A 4C4TA 2FOGA 1FDOA 4FU0A 5C4IA 2FMKA 4UFDH 5SZHB 1YR9A 4NYJQ 3ZHTA 3O2JA 3V7WA 3UA4A 3GLGB 1J20A 2R1ZA 3GDSA 6Q21A 4QECA 1X8KA 2Q4DA 3GLKA 5C8YF 3ZGVA 2J07A 1BFDA 3F6BX 2AEIH 3CLRD 1JZTA 7GPBA 2Q50A 1W75A 1WP4A 4O4JF 1SK8A 1VE7A 5EU8A 1PR1A 1ZH4A 5AUQA 1QVZA 1K4MA 5AIAA 4JCCA 3ATKA 4A7PA 1RC0A 4URYR 1DEXA 1N0VC 2YH2A 4BMZA 2ZUDA 2QRGA 1JA0A 2XCSB 4CFSA 1U2GC 5CA0A 3I2KA 5IJZA 5C7LO 1P0FA 5EP1A 4D8VA 4ISIH 3HJNA 4WZAA 4X3CA 1B43A 2MU1A 1ANEA 4ZYZA 4GCHG 3AHCA 3D2LA 4YT2A 5AM5A 5IDQA 1RBZA 2BFAA 4MKXA 3BG5A 1AZZA 4XW2A 2K1QA 2OFXA 3AWDA 1UJ4A 3WB0A 4X54A 4WY8A 1MNQA 3L0PA 1TCUA 1TGBA 1A2QA 3LDFA 2XAUA 5A4AA 2ERCA 3R5KA 2GCEA 2DPLA 1ECFA 3IMFA 2IUEA 4B4KA 5ALWA 1V6AA 2WLTA 3TUZC 1HZZA 1EP5A 1TM1E 4NLLA 4EBFA 4BVGA 1VHJA 4ZV7A 1U7XA 1SOUA 2Q3JA 2I8AA 3SLKA 4NBRA 2XEXA 4C0BA 3F9CA 5EJ8A 2O9JA 2HC9A 3GYBA 4J0IA 4DR5B 3KQKA 4NXNB 2QZPA 3R9XA 3F2HA 1HDCA 1FDWA 2C5BA 2BCGY 5JAZA 3P92A 1R8JA 2VJCA 3W9UA 3IQGX 4JR1A 1CPYA 3O2NA 3RC1A 4UU8A 4C08A 3WDSA 1TGSZ 3C45A 4E31A 4KMOA 3GRRA 1G1MA 4RS3A 3E9MA 1JMOH 4GUAA 1EK1A 2NM0A 2P77A 1V2WT 5AKYA 3DD1A 5KVCA 3A28A 2WIBA 4L0DA 4JYPA 5KPJA 2QHXA 2CUTA 5AVKA 1G4AE 1IAVA 4LJ8A 3LUJA 1FLAA 4FUGA 1E9CA 1XDGA 3VOTA 2BHGA 3JYOA 4JBIA 4CQJA 3GVXA 4PZDA 1NRPH 1G8GA 4MTLA 3I9MA 2AGVA 2BR3A 1JJIA 5FWAA 1G8HA 1QJ4A 2I3GA 1YRLA 1E1RD 4RETA 4R31A 3EA8A 3DE3X 4BVKA 1NW7A 1N6RA 3W8FA 2EWMA 2LTAA 2D1TA 3WWCA 1HOTA 3GNTA 2C20A 4QG3A 4CLRA 4ECAA 1SHUX 1C1DB 1YR6A 2QYOA 4X3OA 3N5KA 1GJ5H 2W26A 3KPUA 4GZ3A 1QIJA 4P80A 2YFHA 2PT5A 1QHSA 1TK3A 3E3LA 1SXJB 5F7XA 3TKYA 3ZXUB 1WCV1 5JXIA 3ZKAA 1E3DA 4MMYB 2GILA 5DNEA 3UKOA 2XA2A 3MWKA 5H70A 5J5VA 1TRNA 2QP4A 3T12A 1JFVA 1GMHF 1NXOA 2WYHA 4MVJE 4TSRA 4EECA 3LPAA 1E36B 4YMUA 3UK0A 4FFMA 5CM9C 1U0FA 2DC1A 4P33A 4XVUA 3RK4A 2QR5A 3MNCA 5TF0A 1RU3A 5EZYA 2H1IA 3H7IA 5B1DA 5HUQA 5KTNA 3FOZA 5MN6A 4KHZA 4KWCA 1B1CA 2P9GA 1GHAG 4YACA 1YE5A 3C3MA 5IKEA 3DSRA 4YCCA 1MJGM 2YXLA 2E7ZA 4HMQA 2QVLA 4I8XA 4G86A 5HG0A 3PF9A 4OREX 4DL9A 4HPWA 1K0UA 4IV0A 3JCZA 4AQDA 5GWZA 3WXMA 1IZ7A 2R7AA 1CV2A 1U90A 1RXYA 3O3CA 4ZI7A 1OA1A 1VHWA 3J81A 1E2IA 1J09A 1ZVJA 3DYIA 1WB6A 3WNBA 3I6IA 4AKIA 1WWKA 1MB0A 2UUKB 3QFCA 1HURA 4Z9XA 2FR8A 3JZAA 2ANKH 3LC1O 4R8MA 5HJ7A 1DDIA 3DCIA 1JHPA 5HOEA 4D8TA 1T0BA 4MVJI 1IQ0A 3LNCA 3GGOA 2IS6A 3FWKA 2R1VB 2BQ7B 1GJ7B 4IIJB 3I53A 2G81E 1SBYA 4RZ2A 2RONA 4L8VA 4BO8A 4BO0A 1SQRA 4FS8A 1LLCA 2FSIA 2VINA 1FTGA 1PGNA 4TPKA 4B6PA 3U81A 6ESTA 5IKPA 1XAGA 1YRAA 1EZ4A 1VL6A 4ZMRA 5DI3A 3A1SA 2VK8A 5H4GA 1ZH8A 1T5IA 3T41A 2BD9A 4II2A 1ZPZA 3FXAA 1L5FA 2RHTA 3RBAA 2Y1WA 4OS7A 2IC5A 4NE7A 2ID4A 2IYXA 4IC5A 5H68A 1F5KU 4XTRA 1KKLA 4G0WA 4KODA 4HDNB 3B5JA 4H1HA 4XQGA 3BN9A 5LPFA 3MH5A 1KP2A 4DBVO 4URVR 1G3UA 2F43A 4O4IF 1H8EA 1GPH1 3VC1A 2XIJA 3EEOA 2IUFA 1RJXB 1O97C 2J3MA 4K9SA 4D6PA 4J1NA 1ZHOA 4HVCA 5ES4B 2Z9JA 4Q5IA 3WIUA 5J2UF 3OJ0A 4WBSA 3Q8XB 3ADDA 2LRHA 1G8AA 5T1VA 2QXIA 5L95A 2A92A 1O96B 2SGEE 2W83A 3LQ4A 1JYEA 4OJNA 3LOUA 4YUWA 1DWPA 3CVVA 4FJ1A 1V8PA 3HADA 4S0ZA 3B6ZA 4CQLB 1XRNA 4D9CA 3TM5A 5JY6A 4RWEA 2WEKA 3GN1A 3LC5A 4TYQA 4I99A 1IZ8A 4CM9D 2UVPA 1A27A 1YZGA 1UIRA 3E2PA 3I9V1 2OQ2A 3FB1A 3V1YA 2GKVE 4V02A 3OQOA 4WWHA 4XA8A 3D1JA 1NURA 2Q4RA 4F7WA 1SLUB 5G53C 4GXTA 4TYWA 1LBHA 2XNDD 1Y6RA 4JR2A 1B0FA 1YS9A 3HL0A 1R1DA 2XSZD 2VPTA 5EW1H 3RUEA 5E1BA 3QUMP 2IEAA 2EL7A 5KMGB 1V16B 2VYND 3L9WA 1H9IE 3UGJA 5I4KA 4QL3A 4YO9A 1U1IA 5FPTA 2YX1A 1S84A 5KQSA 1R0RE 3PFCA 1KS2A 4NFYA 3UZUA 1NATA 3MLEA 1SGEE 2HIHA 4TUYF 1SXPA 2WE8A 1CQJA 3F8SA 1GPAA 1JEDA 2GVFA 3I77A 3ILHA 4ATNA 4UTOA 4WCVA 2HPPH 1MO6A 2BFPA 4MHSA 3H7TA 1C7QA 1SQ5A 3RRMA 2O2ZA 1CY6A 5KU7A 4E46A 1OVMA 3W6NA 4B3JA 1NBME 3M4YA 3MRXA 1I2DA 4CMEC 3LT1A 1NIJA 3UMYA 3ZKWB 2CN0H 5ITWA 5UKDA 1VZ3A 3VR5D 3BXZA 3HJCA 3W9SA 2GBLA 1UZMA 2AQIA 5DHRA 3RS2A 4YO8A 4RANA 4FQ8A 4LFAB 1IUOA 2GZ3A 3UTUH 1GXSA 4B8WA 3RS4A 3JPYA 4B79A 4RZHA 3BSFA 2AEJA 1Z2EA 3ZW8A 1BWRA 1TADA 3S40A 3M34A 4FQ7A 4QHSA 3N6VA 2HDHA 4X2VA 4EHLA 5ALJA 3SJZA 2PS9A 3WLRA 1LLDA 3F9RA 3PC8A 3RADC 5K0NA 1O3IA 2CLFB 1QCYA 3KXKA 1J14A 5CVJA 3UJCA 1RQ2A 1Q7CA 3ZCPA 3WB1A 4OOFA 5IT4A 3JD3A 5KINB 3EAFA 3G5UA 4CHAC 2CD7A 2RHCA 1DBSA 1CG6A 3NCHA 1V2MT 2FPPA 3RXTA 1V2ST 3Q9UA 1V2TT 5EG4A 1JDBC 4LRYA 2NNLD 3RHSA 1MMJN 2JCSA 4B83A 1PJRA 4I7YH 4AMUA 2GX4A 1NW5A 1KEKA 1PN3A 1JU3A 5AKHA 4FQ5A 3O4IA 2H1UA 3HQ4O 3R5SA 4WXRA 1ENZA 5GZ3A 5DTQA 1L5OA 4C6SA 2WUDA 3GLFA 3DXYA 3I32A 3NPMA 1DDOA 4MYRA 1RM5A 1UWCA 2O2YA 5CA1A 5LMNB 1N6XA 2G6BA 5IJ0A 1YDMA 1J2UA 4C7OB 3LQ1A 4Q03A 4YAIA 1JWTA 1ZUHA 1MX9A 1F38A 3HUDA 5AHXA 2J45A 2ET6A 4GZMA 2OHFA 3IKLA 5CVDA 4YEDA 4AJLA 4X8MA 2B61A 4D4IA 2P7HA 3AL2A 4GI2A 1B7GO 3PGMA 5DM1A 4EVQA 4PRYA 3T9DA 1NV9A 4Q1VA 2AFRA 1T8TA 1Z4NA 5JSQA 3ZTWA 5IARA 3EQ7A 4F9TA 2P9BA 3MQFA 3Q3YA 3GJYA 1WXWA 4QFCA 1KVTA 3RC5A 1UXKA 2E4AA 3A1UA 2G3YA 2B7CA 2QUHA 1TQ2A 4NENB 3BWBA 3K9CA 3VSCA 4FTWA 3M3TA 4IO1A 1OYYA 1HUQA 3H11B 2EIXA 4UBMA 1PFVA 4QOGA 1FXYA 1JEQA 4OHOA 1GCGA 4FJ2A 5C9ZA 2FW1A 1FDPA 4CG3A 1DG1G 4YRJA 2D8AA 2A9PA 4F5WA 4UU1A 1GQSA 3EHDA 3TIVA 3N53A 2BUCA 1V3QE 1Z5OA 2PKXA 1Z4LA 5B57C 3ED1A 1N5RA 4DT7B 4YRBA 4NYMQ 3PFBA 2ORIA 4F12A 4AMBA 3V1KA 3ENNA 2P8OC 1GYPA 4DCPA 5JDIC 3T3IA 1C1WH 3WRXC 4NE9A 2FMXA 2O4CA 3EYWA 4YI5A 2W8BA 3SQXA 3ZVRA 2JGDA 2JJMA 4UASA 1E6LA 5JU6A 4NMWA 2Y1XA 3D64A 3BIWA 1EFHA 3C8MA 4RCYA 2B8TA 3GFBA 3BTOA 2G67A 2NO0A 2V3OH 4RSMA 5BSGA 3L7KA 3SVZA 2GM9A 4BEWA 3U9LA 1VCWA 1GPWB 4X8OA 1J2JA 3ZHRA 2F91A 1VSTA 4BP3A 3RRNA 5LLDA 3OHSX 4UMDA 2ZYDA 1WULS 2Q5IA 4Q9DA 2Y66A 2DJ5A 1UCFA 4B7AA 4TQUS 1RKUA 4IWYA 1VIDA 4QGHA 1OP0A 5BSVA 3HKCB 3ZV8A 2W6ZA 3ELDA 1F60A 1QVRA 3V1MA 3LC7O 2OXEA 5G2OA 3CX3A 4D46A 1DADA 2FGJA 1CGIE 2PUXB 1G20E 5AFYH 3NBYC 3LF1A 1E3EA 3KZNA 2YDYA 4XFKA 2J08A 1ULSA 2Z2XA 3O92A 4TWRA 1C4XA 5EEHA 3T34A 2VNIA 3DP7A 1ZPCA 5EPYA 1V0JA 1CT0E 2PXAA 3SJKA 1IQUA 3LWBA 4WN9B 3NEJA 3G2HA 1VQ1A 5BV2P 1SVMA 3QXSA 1MRZA 5CLGA 3KETA 2QYIA 2JA1A 4AC9A 1DLIA 2D1JA 4M83A 1SG8B 6LPRA 4O4LA 1TRHA 4LYHA 2VNKA 2X9VA 2AA3A 4RS4A 2XMQA 1EDDA 1WUJS 3HRIA 2G0TA 2R00C 3MTYA 3RKSA 2WA2A 4L8FA 4MP6A 3GRCA 5HIIA 1GPKA 4FU8A 3IKJA 1ODTC 3BD9A 4HLUC 3BULA 1TNLA 3JATA 3RXEA 2X86A 3KOMA 5HGXA 1SKBA 4LUCA 3S7TA 1OZHA 3M2TA 5A7FA 1YKSA 3ME5A 4HH4A 2H08A 4LHSA 1ADCA 1ISHA 2ZGCA 3A1DA 3LCUA 3JQ9A 2B8WA 1P2MA 5A05A 4PHCA 4L75A 1SELA 1HXHA 2E5WA 2BTQA 2P62A 2C29D 1G5FA 4N5NA 4WCFA 4JN6B 4WESB 4UNIA 2B4RO 3C4QA 1S85A 1WTCA 5T4BA 3I6MA 3L1JA 5NULA 1GPYA 3B5IA 4UHCA 2DQ4A 1KI8A 1XLWA 2XJ9A 1BRCE 4D9IA 4TWJA 2HWKA 4NCKA 1X80B 3G2KA 3UMGA 3BWDD 2C4VA 3R8FA 3ZYZA 3QBJA 3NRBA 4TWIA 3HJFA 1LFDB 2QRLA 4R84A 3OCVA 5AXAA 3ETDA 1ORWA 3OX7U 6REQB 1H23A 3SN8A 3DYBA 2OV3A 1A82A 1OX5A 5JHHB 5B58T 3IMGA 4IOMA 4LBWA 3K0SA 1N4AA 2IQ5A 3E15A 3VV3A 1TD9A 3F46A 3UK1A 4NFFA 1P1HA 4RLFA 2FPGA 4CRBA 1Z0JA 1XRSB 1U9IA 2PS0A 1CRWG 1FS5A 2O1XA 1A5IA 5C5CA 2R8YA 3LRTA 3WICA 3EZLA 5F52A 5TY0A 1DZ3A 3HP1A 3EQ6A 1QQ6A 2O8FB 3PTBA 2OQRA 4E51A 1E0SA 2IE8A 1HT3A 3MO3A 2QX7A 5EHZA 1XTBA 4CRDA 2PLAA 5ECWA 4OH1A 1EAWA 2ZU0C 3LH3A 1V2HE 2BFMA 4EA7A 4EDFA 2HA0A 3SGBE 3BL8A 1I51A 1VR1H 1ZZEA 3JQRA 4BCCA 3NHLA 2W2OA 3QBVA 4R1OA 4C4OA 1NI3A 2JIZA 4X1YA 1UMDB 2NVUB 3EZXA 2WD7B 2C2ZA 4EQ6A 2XVYA 1PWHA 3ENQA 1WB5A 5DTJA 1XCGB 1OGYA 2RH5A 4CV0A 1OWEA 1RNLA 3MH7A 3M1LA 3UPDA 3UK7A 1AZWA 1WVGA 3GCGA 2J1LA 4XE4A 2IIBA 5BRNA 3SNHA 5BN4B 2Q5EA 4EI2A 1E2UA 5I7AA 1PZXA 1C0LA 5D3MB 3KK0A 1T1GA 5THQA 4GKVA 5E3HA 4B5KA 3IUQA 1D2RA 2JGKA 1OLUB 3T9BA 1O3NA 4GLOA 4WRRA 3D7RA 2BFFB 4X8LA 2Y77A 3EG9A 2CUZA 5JOQA 4LZAA 4TSFA 1BWSA 2VJMA 3IILA 3O74A 5IJWA 4KGZA 1HLDA 2JB9A 4O63O 4Z4QA 3WFIA 1DXWA 1PJSA 3B8HA 2WKSA 3E8SA 1G16A 1U0NA 3MZ0A 4BGUA 1T1IA 1W2KH 1F0PA 1GG5A 3HCDA 3H2GA 5JXHA 1F9AA 4X66B 1H4QA 2XPCA 3R23A 2P79A 3VH3A 4Y1FA 1C5KA 5ELMA 2AH4X 2FX5A 4RHTA 4PSAA 1OJ7A 1W59A 3DZJA 5A6SA 1Z4IA 3JRXA 1KK3A 3N2LA 2XXLA 2EJBA 2BIFA 2NO1A 3QU7A 2BY4A 1WPGA 4MUAA 1XZJA 1ZRMA 1PNQA 2BJWA 4C0KA 4G5FA 1PJPA 3CCBA 2STAE 2HU5A 1ZZGA 1BCUH 3D0OA 3R2JA 3OT4A 3LJOA 3IP1A 4DJAA 2A9RA 2HRDA 1AE1A 1U7OA 2ZE6A 1ELOA 5EIEA 2A5LA 4ML3A 3DBHA 3E3OA 1ZSKA 5SICE 4KFCA 1PZGA 1U2QA 2A58A 4GOKA 2P16A 3KWFA 3MTDA 5LP6F 3T28A 4EB3A 1A9XB 3WYAA 4COOA 3ETEA 5BP7A 4RV9A 4RO0A 4RV5A 2A7XA 2FMFA 1P02A 3U1IB 4IMIB 4F21A 1N2HA 4F6LA 3DWIA 4EA9A 2WJPA 2XB8A 3OMLA 4E2YA 1W44A 1C9DB 2P95A 3EQ8A 3F7MA 3BQNB 4HFPB 3CRZA 4MW2A 3IVRA 2M5TA 4DM3A 4GEKA 1W5SA 5J5AA 3WJ1A 1E3SA 1H2YA 1P12E 3UB4A 4NNJA 2FIRH 4E5YA 1ULHA 3N2NA 1JKXA 3O3MB 2YWEA 1FLDA 4IRMA 1ACJA 4Y67A 2BY7X 4Q3LA 1ZNXA 4K81B 1UFQA 3UOGA 2OP9A 4H6TA 1XA0A 2QQEA 2AUNA 3L8MA 4KN6A 4U39A 2F9PA 1XP8A 4ND8A 3UWSA 3AVWA 1NQVA 4K86A 1F5SA 1AMHA 4MUFA 2OINA 3I72A 3ZU6A 1BCRB 2WHYA 4Z9FA 2NYUA 3G8DA 1DC8A 2O8NA 4MW4A 2QIPA 1G2LA 1IQLA 3L05A 2I3BA 5AQEA 5I9MA 4F8JA 4FDLA 3MWDA 3INRA 5H02A 4B76A 4E33A 3KTFA 3WOHA 3V4FA 1UTPA 4ZKNU 2GM5A 1XZLA 2WUWE 3CURA 1TRMA 2FODA 3UG7A 2LUOA 4E6EA 1VIMA 3CS3A 4KWEA 4RTPA 3WRWA 4EPTA 4YMWA 3O9VA 4Q9AA 3D3JA 2BMFA 2CSUA 3A10A 2D4AA 4A6XA 5EHGA 5DJ7A 1DMRA 2FVXA 4QDZA 3TSZA 5F1PA 2G83A 4YWJA 4PVCA 2H2DA 1FZZA 1XJ0A 3P97A 1PFQA 3HB4X 2WIFA 4BMDA 1EFUA 1NBEA 4G9EA 5EWLA 2QI9F 1DTWA 4H1WA 1S6HA 1A5GH 4LVOA 4JSTA 3DMNA 4XLTA 3UHPA 2PCJA 3OEED 2Y8EA 1I4OA 4D9JA 1S3IA 4AM8A 2VATA 5KNBH 1BGWA 1JN0A 2Z09A 3ZQJA 2YMSC 1C9EA 4J1TA 2NWQA 4Q7QA 1Y8RB 3UXHA 2E5LB 3RXKA 4KACA 3SF8B 1TYBE 1BN7A 2Q9UA 1YU9A 5KC8A 1FVXA 3QO6A 4B17A 3I5AA 1Q22A 3DNMA 1AI8H 1B41A 2EQAA 3IH5A 1ML3A 1PL7A 1TTQB 1K21H 1PJQA 3DGEC 1GDDA 3LYAA 3BQMB 4ZXPA 2R2MB 1J24A 5E6RA 3CF2A 4KWHA 4MTBA 2YOLA 3LQKA 2NT3A 2OSBA 3LS2A 4M0KA 1QNJA 1KQ3A 4Q1FA 2QN1A 3LO5A 1K7FB 2R4QA 1IQIA 1L4FA 5NLLA 3O4VA 3CF0A 4JI0B 1H5NA 2H1VA 5H9WA 4QSHA 3LC0A 1W2WB 4BJ6A 1D3PB 3T4PA 3EULA 2XF8A 3I9KA 1PQYA 2YNBA 1KEUA 1ZY2A 3FYUC 1EDEA 4JK3A 1ZMOA 1VGCB 5EXNA 4FDMA 3BQ9A 5C4GB 4PSUA 2TIOA 3KPVA 2OC8A 1EBFA 4B35A 1O2GH 3HXOA 3L18A 3AKDA 5B1IA 3REQB 4R83A 3F2GA 1TTHA 1WX1A 2ZJOA 3TK6A 2EGHA 4CG0A 2ZPRA 4LZNA 5JNVA 3KG2A 4D9HA 1A8SA 1SAYA 2P6NA 1EWKA 1RLIA 3Q87B 1OS8A 1M2VB 2NNWB 1XUOA 2PGJA 4M8NE 2F1KA 1DKOA 2Y99A 4MGEA 3SU3A 4YMTA 4JLAA 1CT4E 3QBDA 2ZE8A 1QA7A 3NHFA 4P5DA 3KB2A 2MSWA 1FIZA 1N6HA 3M5DA 5BR4A 1KIMA 1Z28A 4Q47A 4ILKA 4R2HA 4MW7A 4CLDA 2E0IA 4PG8A 2OGUA 4MS4B 3N8IA 3GY6A 2GCOB 3T15A 3DPUA 2B4QA 2XGJA 1KJJA 4EJSC 4LZJA 1T91A 4WLOA 1KBOA 1IUNA 3DZIA 4XJSA 3I34X 2JH5D 3A7YA 2BRUA 4O3FA 4NAUA 1UQRA 2OK7A 4Z6AH 5BSRA 3L7MA 1L3BA 5J59A 2Z2JA 2GPWA 2I91A 2QUAA 4X6UA 3IQZA 1CF9A 3ORSA 3WKAA 5JCJD 1CX9B 1SUSA 3LIIA 4K46A 2H8GA 1WXEA 2GJ4A 4BO4A 3EGKH 2IPAB 1XZDA 1ZD1A 1Q57A 1NM6A 3VH1A 1A7AA 3NK8A 3AFNA 4J9VA 4N49A 1KQGA 9LDBA 1ZSLA 1CR2A 1YMQA 1KI1A 4J07A 4K5ZA 2BFBA 3I5MA 5DWDA 2X2OA 1K9OE 3B82A 3GJ5A 3A36A 3BSSA 3HFSA 3P94A 1MJ5A 1WHSB 4AJJA 1NFFA 3NBKA 3CM0A 1YTLA 1JHDA 3MNBA 5LPEA 1YVEI 3P4UA 2ZT7A 1I4LD 3QLTA 3NDIA 1LVBA 3VKFA 1H5UA 1GRVA 2FW9A 5EPEA 3K6RA 3Q3IA 3QWBA 1ITZA 1M76A 1JXAA 1XZCA 3CNEA 5EJ2A 5G1NA 4BAMB 1WCIB 3ZN2A 4HVAA 4MNVA 4L8GA 4MYDA 2QPOA 5EGMA 4CFZA 4C2UA 2IYRA 4HZUA 3OKCA 1EK2A 5L2YH 3BTKE 4J2OA 3NXKA 1WZIA 3R7WA 4F9GA 3A0UA 1MB9A 3LL7A 1VSBA 3PG5A 3B6KA 3OY5U 3EXEA 3M5WA 5JQWA 3EOAI 3S27A 4RQBA 1GU1A 1GI9B 3RJTA 4P7JA 3PJFA 4LNAA 4MP8A 1TAGA 1ELEE 3O1HB 1O5GH 3QJYA 5CM2Z 1MQSA 3TRDA 3L77A 1C1TA 3P2JA 4H7EA 1UC9A 4NCJA 3RB8A 3CLUC 1T1EA 3VZSA 4CM9A 1VPEA 4MQMA 1UBEA 4TMYA 1T4DA 3QHPA 1SBZA 4CRCA 1NR5A 4O59O 3R8XA 2HRRA 1TAHA 4M8SA 4P3PA 2Z56A 1GFIA 2C7QA 1LHFH 2HRQA 1BRBE 1O3GA 2PKAB 2XNDA 2H2IA 4W6QA 5LQAA 4IVNA 3UAGA 1J33A 1DDGA 4BKRA 5U4QA 4NYIR 1X9GA 1KQPA 3WYNA 5E0JA 2XSZA 1MU8B 4O5AA 3JQFC 1EFPA 1GHVH 4A1VA 2XAAA 1U7DA 2EKDA 2OORC 1P74A 3PM3A 3MYWA 4B4OA 4CU2A 2FEWB 2ZWVA 1D03A 3DONA 3KQTA 3E4DA 2XYHA 3DDNA 1R6TA 5IBQA 1ZJWA 5LKRA 5AJZA 3I2HA 2GF2A 3PC4A 4RTRA 4KXMA 4R2WA 1D9XA 4MWOA 4PAWA 5LNK1 4X6PA 3H4IA 1GV0A 2ISCA 1N3YA 4UVDA 1KZ6A 2IZ0A 1JQ3A 4QA9A 4ENWA 3KKPA 3HGTA 1Z3CA 2VJBA 1B2LA 1P05A 5BXYA 4G01B 4K7JA 3UR6A 5FOUA 3VR5A 1QUEA 2E4VA 4A8HA 2A4GA 1KOGA 2JJYA 3UA3A 4PBTA 3MINA 5BSWA 2NSYA 3TE7A 5JNLA 4AD8A 3DBLB 4B5LA 5C1BA 1M0SA 1T6YA 4AJ1A 5EJ9A 2QXTA 4L07A 3PO1B 4XLLA 4RY9A 5JY1A 3A1EA 4MUBA 3Q9NA 3SDSA 3CLKA 3UB2A 4YALA 4U3JB 1GQFA 2X6QA 3QKIA 2CFTA 1TA9A 1KLIH 1MAXA 2PQMA 3CC8A 1E1QA 4J0GA 3FWYA 1SXQA 3RU4T 1PZMA 1RAHA 2Q2WA 1E7WA 3RWMB 1O5OA 4HRVA 5I9LA 2XMRA 3CH4B 1NQXA 2VRCD 2Y6VA 4BVLA 1VBNA 1HPGA 3IITA 2HBYA 1IVSA 3DZBA 4Q7ZA 3PWZA 4L5IA 4YJ3F 1XVOA 1QB7A 1B6SA 3V4LA 2ASVA 3EGXA 2JGJA 3GVHA 4N5HX 4YJ2F 5AKXA 1NHGA 1ZJ6A 1UJ5A 1C2YA 1FY8E 4MI9A 4J0EA 4F5ZA 1L3IA 2OCAA 2R60A 3G5TA 2FWMX 4AY3A 4N6NA 5K4GA 3GVCA 1UTKA 5LZ2A 1NUQA 1NL3A 2XZPA 2CCJA 3OKAA 4G24A 4I4TF 3SEFA 4K9RA 2DR0A 3OA0A 3HY6A 3FHJA 4MPTA 5HFJA 3V32A 4HQKA 4DIOA 3SSOA 2WU3A 2Q5LA 3LHDA 5B64A 5JH7B 2B5WA 4ZCTA 5K99A 4C01A 5BN1A 3KBOA 1UXIA 2FPLA 4LGCA 4OGYA 4YRGA 4CCSA 2VA9A 5CVCA 3WIEA 1FP4B 3J7AC 4AFNA 3CMCO 5B12A 2E89A 1NQWA 1X74A 1BKSB 4XAQA 4TL7A 1A1RA 3OF3A 4AORA 4WOKA 4M1WA 1B73A 2HRVA 2JAQA 4BGIA 2J48A 3HCPA 1S82A 3AR8A 5FNVA 3TH4H 4O2RA 1I6KA 4GKJB 1I4DD 3ANNA 1P09A 3B7PA 3MCUA 2WTUA 3ZR4B 5AH0A 4G8DA 4AJEA 4OHYA 3QVSA 1K6IA 2M1ZA 3AERB 5EODA 3B36A 3X1KA 2BMDA 5H5JA 1HAVB 2SBTA 4TSFD 1SGDE 3MM4A 1RAGA 1XDWA 1C7ZA 4POAA 3UK2A 3EODA 4O2BB 2A4KA 3GGCA 4AX9H 4GXNA 3RVMA 5FBEA 3OLXA 4GX0A 1BBRE 3MWEB 5FBLB 4ZYXA 4RTQA 1A4RA 3UMBA 4WA8A 1BRMA 1HYLA 1B93A 3TYXA 3NAGA 4PWYA 1RI5A 1T9GS 4JJFA 3I5YA 2VG8A 4PGHA 2J5RA 4HDOB 1DY9A 2UVQA 3OQIB 1U2TA 5A04A 2C4TA 2Q29A 4J0KA 4NSYA 3HCWA 2VJOA 1AA9A 3L1UA 2NO7A 5EJMA 3HKIB 1OXTA 5IYZA 3HSYA 1YJBA 4IGEA 2ZPUA 1RACA 2HOBA 2YS7A 5DYWA 1KMHA 2ZKSA 4HXGA 4FGWA 4JBGA 3L8DA 3T38A 2A5IA 1LI4A 4ER7A 1RPZA 4BGEA 2VLIA 3AM5A 3A7EA 2OBYA 5ICEA 3QYFA 2CHGA 2ZB3A 4AB8A 3E9NA 2X0NA 5IT0A 1SA0A 3A58B 3BL6A 5A9RA 2ZWOA 1DJNA 3TJRA 4G81A 4JQOA 4LF6B 1YK0A 1QFXA 2HDNB 3P9QA 1REQB 4AUMA 2RARA 4WXHA 4H3KB 5SZIA 1CIJA 1Z8RA 1HLFA 1SIWA 2VIDA 2C99A 3ICWA 1G2QA 5A9SA 3QF4A 4U7GA 4HLNA 4YRMA 1KETA 5E9AA 3Q7IA 2BEWB 4OFXA 5TJXA 2B8EA 3AI3A 3RUPA 3DTNA 1VRWA 3CWCA 4GECA 4NFEA 1P4SA 3UJBA 4QVKA 3SZOA 1H6BA 4RF3A 5LPRA 4LISA 1GZ5A 2RHDA 2V6IA 2CVQA 4G1FA 4IXTA 4DVGA 4NQRA 3SV6A 2LCFA 3EGWA 3WFJA 3O03A 3CLRC 1GJRA 3KR2A 5LB2A 2BR4A 2J9FA 1YGCH 5ENVA 3SQWA 4R5HA 3HKBB 5CIYA 2H9YA 4DSNA 4ZDWA 3F2IA 5AHRA 1N5OX 2RKBA 2PQ2A 3MJ4A 3QOYA 3ZHOA 1YA6A 3F49S 1BFUA 2QPTA 4A36A 3ESTA 4N3GA 2ZWIA 2YJ4A 2G00A 1ZXLA 3CKYA 1QU3A 1MAUA 1EVKA 4DJFC 5ISMA 3K4PA 2PWXA 1VLHA 1T5TA 4KTSA 2FHSA 3NTUA 2GAIA 3TZKA 2OC7A 1XYGA 3HCOA 4G25A 4AO8A 4TZTA 5HKKD 2SFAA 4TMFA 2OZPA 2Y81A 1UBJS 2NPIA 4QQKA 3K8QA 2ANMH 1DELA 1QDUA 1B8UA 5ADHA 2X41A 1E2JA 1BTPA 3FTEA 1AFQC 2MYUA 3GYGA 4QX6A 4HK4A 1J23A 3LPNA 1MU0A 5IVKA 3MMGA 1O31A 2B25A 1AFEH 2VDQB 3EH1A 5ITZB 1XKLA 5KNBA 3LCJA 2PH7A 2AC4A 3EIXA 1T3ZA 5CH8A 3Q8KA 4PAGA 2VP2A 5FTJA 2FXRA 3GP3A 4LDPA 3N28A 3IELA 4PLZA 1CEEA 2R9PA 4FUHA 1G60A 3FI9A 2YVLA 2PSYA 4LZPA 1TU3A 2UUBB 3KYDA 3C7TA 1GZ3A 4Z54A 2VPXA 2I8CA 2I4LA 5KVQA 3QQ5A 1VMDA 2J5KA 4BPBA 4FVTA 2Y1GA 4EY8A 2TSYB 1GI8B 3HYSA 1SCIA 2GX6A 4EFNA 2GHTA 2FLRH 2WJWA 4GZ6A 2HGSA 2QL9A 4LVUA 1DPGA 5C31A 1AD2A 3CH5A 5GINE 3TWOA 2JANA 5DGCA 1GI2A 1TQHA 3O90A 1HK7A 2XQFA 1ZMRA 3ETJA 3HY4A 2CWDA 1VIVA 2EQNA 4CEJB 121PA 1BW9B 1V25A 5FQOA 4IUBS 1UAYA 1P9OA 2DLNA 3F7NA 2GDEH 2ZNKH 1PK7A 2VYFA 4DSTA 3A88A 3TQFA 1NQTA 4FHZA 1P0MA 3L0CA 1ABEA 2OSVA 5KSPA 1JIVA 1TB4A 1EUCA 3OCZA 3OECA 2TRMA 2PRZA 5IKMA 5IUKC 1JI0A 3RO7A 3RC7A 5B36A 4MR7A 3R5TA 4IDEA 4ZN6A 3ZCQA 1K6EA 4WNCA 3VB6A 1MJNA 3PWBA 2XV1A 2I9KA 3FO8D 2CZQA 5J43A 3OOEA 2G5TA 4BV2A 3B52X 2JFOA 4NEHB 1EB2A 2AR0A 4JMLA 1H6AA 4AG6A 2IHTA 3ROMA 4LW8A 1D0SA 3HXQA 3JD1A 5EXPA 2C9MA 5EQFA 4YLQH 4WQMA 2OE2A 3F71A 2UDPA 4Y0AA 2IP2A 1SB9A 2PH1A 5ALZA 2ZSUA 2E6UX 3RQSA 4UMFA 1XDSA 1U28A 4KPYA 4KO4S 1JMYA 1ZAYA 4F6CA 2EY4C 5EG5A 5A7GA 4CT4B 2PLWA 1HJAB 4O3UA 1V5FA 4LRUA 2VN8A 4L4XA 1Z15A 2V3MA 2Z5LA 4FBGA 3QVMA 4YPVA 4O02B 2Q5CA 1GZ7A 1QYWA 3H9CA 5H4IB 4EENA 2P9JA 1Q3TA 3BSYA 2FPWA 1GY8A 1W8BH 5JSZB 1M2NA 2IFTA 3BDIA 1NW9B 1AXEA 1GBIA 3DSPA 2FW6A 4ZJUA 1LQTA 4QOFA 4BNZA 1AZ8A 1M2KA 2HN9A 3DLBA 1M9NA 5JDCA 1ZM3A 2DU8A 3H97A 5HRCA 1GVNB 1RIFA 2X5NA 4HRYA 4IRXA 4OX9B 2GR9A 1IOEA 3QWIA 4ZEOA 1N25A 3N2GA 1T5HX 4MQUA 1DAPA 2RGGA 3P5SA 4JNCA 4X1SU 5EIBD 2G08A 4OK6A 1L5KA 1PRYA 5IN5A 3KV3O 3SN6A 3QE2A 1U3VA 3VOBA 1VDMA 3EQ2A 1XXLA 5G02A 4N3BA 3GHYA 3OSUA 3T3NA 4X61A 5ARCA 1VCMA<