4B6FA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 196
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6fA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA02
1E98A 4RKFA 2C78A 4UQOA 4Q18A 1NVXQ 2W6JD 3K8YA 1SHZA 3CBQA 2CK3A 2ZVQX 5JBQA 1NJGA 4M9XA 2ZITA 4PSAA 4V0NA 3SZRA 2AXNA 1UAAA 2ZS7A 1RJ9B 2XTMA 4P0TA 2ZRJA 1ZC4A 5A5GA 1G5RA 3GJXC 3EYDA 2QMEA 4GI7A 2IK8A 1Z06A 4BFSA 1OXXK 3RC8A 1WF3A 5EXPA 2WMNB 4WOPA 3VR3A 1E79D 5FUXA 3KQNA 3A37A 8OHMA 1RVDA 4MKHA 4LYAA 2PX0A 3KTAA 4B3FX 2QPOA 3KDSE 2MSCB 4RD2A 1SULA 2QM8A 2W0MA 1E2HA 3L0SA 3U4QA 1XU4A 3B2EA 5CLQA 3WP1B 2REXB 1A5TA 4PO9A 4TYNA 3EZ9A 2QRZA 3GLHA 3F3YA 2A5GA 4LSGA 2J7KA 2FF7A 3OFNA 4DC9A 5DNYB 4BPBA 1DARA 1IN4A 1CRQA 1PVOA 1Q1BA 3BE4A 1UKEA 5T1VA 2WIAA 1ZUIA 3LX5A 3OAAA 4AKEA 1VECA 4C0AC 1O87A 1Z0IA 4ERNA 3K0SA 1HQCA 1IONA 1Q12A 3IHLA 1MV5A 5JECA 3LW8A 2BVNA 2LWIA 2V9PA 4XWAA 3OIYA 4EUNA 3IKJA 3B85A 3KN2A 2IW3A 2D7CA 1AZTA 1GTVA 5EP3A 1Z47A 4KLZA 1JXMA 4P4TA 3FPAA 3VHXA 1DY9A 1N0VC 1VCIA 3HP1A 3EA5A 3KKNA 3GLGA 1YZTA 1OH7A 2XAUA 2FMXA 5AJZA 2WBLC 2ANBA 1CR0A 3TSWA 5BN4A 4B43A 3SYJA 4YXWA 2ZU0C 3EAQA 5KPJA 1TQ2A 4B6FA 4WH6A 2ZVPX 1KI2A 4ILEA 3IPYA 5FI0B 3UK6A 1Z8FA 3C7KA 2ZSAA 5AJXA 4BLQA 3MJHA 4PAQA 4G5GA 2VLIA 3G82C 5TB5A 4OQLA 3RRZA 3SNHA 2D74A 1CJMA 1OFIA 2JLUA 1M34E 1KI3A 3QIAA 2GZAA 4GT1A 2QMOA 5IDKA 2ZSBA 3W5JA 4BZQA 1ZU5A 2Y8EA 3AH8A 4KLNA 3RLFA 1E96A 1W49A 4LX0A 2RGNA 3QBTA 4UJ3A 1RYHA 4LY6A 1SVIA 3QBVA 4LHXA 2FEMA 1CTQA 2WJHA 4D26A 1AKEA 3KQKA 1MRSA 2A5YB 3KZ1E 3K0AB 5G40A 1DXWA 2PZGA 2F9UA 4KXFB 1J90A 2GGVB 4JVNA 1XMJA 1G6OA 4TMTA 1Q44A 2OC1A 2NG1A 5J4KA 3A4LA 4KBGA 3AQ4A 5TVKA 3IBGA 1DAHA 4H1VA 2CCGA 3DM5A 5HR5A 1XEWY 3MWLA 3L8YA 2VPPA 3RYTC 4U00A 1X1SA 2BJVA 2FEOA 2FV8A 1SXJE 3SHFA 2G1JA 2QT0A 3QKSB 4G1UC 4NYMQ 4Q9KA 3J81k 2DY1A 3ZZTA 3TKLA 2ZU6A 4KI0A 1YZUA 4IHQA 1NL3A 3TE6A 1IM2A 2WJYA 4UNNA 4A2QA 2YJTD 4Q4JB 1WCV1 4BFYA 2E9SA 2GTPA 3SQWA 3R7WA 5JWOA 3AF3A 3P1JA 1YZNA 2OXRA 3AKEA 4A4DA 3Q8XB 4M1OA 3CLVA 3PV2A 2BBWA 1C1YA 2DCUA 2MMCA 3AVWA 2QAGA 3W3ZB 1G18A 1W36D 3SUEA 4RZ3A 5B6LA 1UKZA 3I3SR 3F0TA 3DEFA 4H1UA 4KFSA 5FTMA 1D2NA 2F9MA 1F2TB 5AJYA 1V43A 1VIYA 2QE7D 4BLPA 1D5CA 1G21E 1K8RA 3SE0A 2DWQA 1KY2A 5FTLA 2GXUA 2BWJA 2QMHA 1KI1A 3VU9A 5GVSA 2DHRA 3DZ8A 5F9HA 4TL7A 2IYQA 3SI7A 1QZXA 1DAFA 5KTYA 3REGA 5CYPA 4KVAA 5LPNA 421PA 3ADBA 3A6PC 1Z0JA 2IWHA 2WAYA 2RCNA 1K5DA 2IHYA 4PR0A 4KV9A 2E87A 4FINA 1KO1A 1AM4D 2FSFA 1EWRA 1Q0UA 3B82A 1E2MA 1N2CE 3A4NA 4DCTA 4CGZA 5HPYB 4DZZA 3GEEA 2EFCB 4JBYA 1P9WA 2XNSA 3ND8A 4R2IA 3KKMA 3VKGA 1M6NA 1VTKA 2XTZA 5DYIA 2XITA 3NC1C 1QHNA 1MO4A 1HTWA 4TMXA 1HH4A 2GRJA 2AHOA 3DHWC 5FBQB 1KJYA 2HEIA 2AKAB 1AK2A 1AS3A 2H18A 3LBHA 2WMOB 4NBSA 3S1AB 2GK7A 2KJQA 3C14C 4Q01A 4ZIRB 4L5BA 4B75A 1T5LA 1UBCA 4HB3A 3ZIAA 1EFUA 1ZCAA 5FL7D 2QBYA 1KNXA 2QQ0A 2VEDA 4QFMA 1WXRA 2OBOA 5TY0A 1N25A 1S3GA 1P3JA 4F93B 1G3UA 4GL2A 1KYIA 2PT5A 4A2PA 2EVWX 3OEED 2OCPA 3R7WB 3AVPA 4EJSC 3MG9A 2IUTA 3WNBA 3LO5A 5E4FA 3NG1A 5TMPA 4D25A 1W4BA 3Q5DA 3WBKA 3QG5A 5EPYA 3IIJA 5EUMA 3I61A 5BYJA 1SXJD 5JLJA 3FWYA 2OG2A 1AQUA 1GVNB 1XXHA 1EWQA 2L0XA 1L8QA 2MSEB 2Q9AA 1BT7A 4F4CA 3HWSA 3B78A 1AS0A 5DIFA 2VYFA 4DXAA 4NONA 3EC1A 3U3JA 2FOLA 3O47A 4NKRA 1Z28A 2ZI5A 4GPTA 3SJBA 2C03A 5SZKB 4B2IA 1OYYA 2WWIA 5AUQA 5C4MA 3KQUA 3D6TB 3WRXC 2WWWA 3X1XA 4WVFA 1P60A 3SJZA 4HLCA 2VRWA 4MYHA 2GF0A 4IOMA 4C7OB 3RWOA 4IEIA 2RGAA 5K8IA 4Q1EA 1QHGA 1L4UA 3JVVA 2AXPA 4C7OA 1E9FA 3C41J 621PA 2AWNA 2QTHA 4DUGA 3RHFA 3W34A 5CDFE 2NOAA 2GVDC 3GJ8A 4DIDA 2JA1A 2WKPA 4WF8A 2PMDA 4K8OA 1A7JA 3T35A 1X6VA 1GP2A 3A36A 2WWFA 3ZVRA 1G20E 4QHTA 1MO5A 4E09A 2B7CA 5AUNB 2OAQ1 1XCMA 4QJ5A 3PVSA 1NSTA 4KJZA 1Q22A 2G0TA 3P32A 1E4YA 4GZMA 3V4RA 4JBWA 1WDTA 4EAQA 1TEVA 1WMSA 2G6BA 2DFKB 3GFPA 4GNKA 1ZD9A 2ZEJA 1ONBA 3B1VA 2VO1A 1Q57A 1T0HB 1ETUA 1DVRA 3OESA 1IN8A 3VR5A 4IKEA 5IF9A 4EQ6A 3L0IB 4GMXA 4AYWA 4FIDA 2ZI9A 1XTJA 1T3HA 2GILA 2NZ8A 1KJWA 1YZKA 2QT1A 1ZU4A 1OH6A 2GAOA 4B74A 2VHUA 3DZDA 3PUYA 1VCMA 2FH5B 1PV4A 521PA 2IXFA 2PCLA 2ZR7A 3H0KA 4L9SA 2F9VA 1COWA 2QA5A 5D3QA 4MKFA 4LHYA 1LFDB 3W9YA 1GIAA 4W9MC 3K70C 1IY2A 4QKQA 4YMTA 2EFEB 1TF2A 5IK2D 3LD9A 1TTTA 1ZM9A 4LV8B 1UEIA 2W00A 4C30A 2GAAA 1CR2A 1Z07A 1XXHE 1A2BA 5JHGB 5KNDA 4P4SA 5IHPA 4TTRA 4ZKDA 2QBYB 3U3MA 3AKCA 3IUYA 2ZR9A 2QP9X 1FQKA 1IXZA 2MSDB 1YR9A 1E2FA 4ZIRA 2PEZA 3CRQA 4HAUA 3TMKA 1KI7A 5DHFA 4GOKA 4NYJR 1XBTA 5GJWC 3EC2A 3THWB 4KCGA 1G8PA 1TQ6A 1G8FA 4JYBA 1ESMA 1N1LA 1KI9A 1E99A 1Z6AA 4Q7KA 1JAHA 3I62A 4D4JA 4FCTA 3WBJA 3U7FB 1N6RA 1VYVA 4MH0R 4OK5A 1RGQA 4P31A 5FL3A 4AURA 2F4LA 3IPXA 2W2XA 4FN5A 4OHVA 3NDBB 2VHJA 1COWD 1ANKA 3THYA 2H57A 2A78A 5C46F 1HY3A 3LAWA 4C4PA 4XVQA 4EFLA 1Q1EA 3QY0A 4EIWA 3U1IB 1Q3HA 2R6DA 3CX7A 3GEIA 1MRNA 4G5OA 4HAVA 4LUCA 3LLMA 5HTKA 5GADl 1G64A 1OE0A 4II7A 2QP3A 4QJ3A 5LD2C 1GKIA 5KSYA 4V0OA 3X2SA 3QPWA 3BWDD 2KWIA 1YZLA 1G16A 1M1YE 2RH5A 3KXKA 4PO1A 4CEIB 1L2TA 3K09A 2FNAA 4ASUA 1WP9A 4I33A 1S1MA 3K0CA 3L43A 3OEEA 4I31A 1Z6YA 3HU3A 4WZAE 4NCHA 1S8FA 1YRAA 3RS4A 4CEJA 1XMSA 5FUWA 3GFTA 5SZIA 3O8RA 4M1TA 5FTJA 3PV5A 2FFQA 2QPAA 2JLSA 4N1AA 3SJAA 2ZIAA 1GZSA 3T1VA 5DI3A 1DADA 4R2HA 1KK3A 3FKSA 4IVPA 1AGPA 2G9NA 4TSFA 2F7SA 1M7GA 1JQLB 2BMEA 1KKMA 2IBMA 3BIFA 4PC7A 2IYRA 4GFDA 3QEOA 4A0GA 2A4RA 3P8OA 3SU2A 1E1RD 3FB4A 3GJ4A 1RJ9A 5EQTA 4ASUD 3LBIA 3PCRB 4IDHA 4OKSA 1CR4A 4DCVA 3QKRA 3BFKA 1I4DD 2BCGY 1S96A 4RD4A 2ZJ5A 3ZYCA 4BLSA 1EG7A 4MKGA 2OFWA 1XTIA 2CE2X 4A6XA 5FPSA 4Q21A 3CNLA 2ZROA 4TL9A 1JAIA 2O8BB 3TW4A 4PPQA 4CZ2A 4ACAA 1G9XA 2LKCA 4HB4A 4QNMA 1GSIA 2EFGA 5FUYA 2JJ2A 5G3YA 2J7PD 1T3SA 2GJAA 5EJEA 3GCGA 3FMOB 4OHXA 1Z63A 1U0LA 3ZZ0A 1SVLA 2GJKA 3FE2A 3QEJA 3QE0A 1NBMD 4DLRA 3LNCA 1XTSA 2QY9A 1RW4A 1UADA 4RZ2A 3SYNA 1DAGA 5JEDA 1XPOA 1U98A 1US8A 2BKEA 1UKYA 4GOJA 2JLXA 3HU2A 5SZJA 3AF1A 1U9IA 1AJEA 5LBIA 5TDHA 2VSFA 2BBTA 4ZPXA 1DTSA 1ZUNB 1M7BA 3RANA 4B6EA 4DWJA 1W7AA 5F9FA 1Z6XA 4JKIA 2HYIC 5JEEA 3UMRA 3VFDA 2VP9A 1FL9A 2WWHA 5AR1A 3TBKA 4IW3B 3A1UA 1YQTA 5EE5B 3HR8A 3IDQA 2ZE8A 3AK5A 3RC5A 2GNOA 1AKYA 4LJ7A 4LHWA 1U0JA 2OLKA 2CLDX 3AF4A 5EQQA 3F8TA 4ZCLA 1P4SA 3AGQA 2BMJA 3A8TA 4G5QA 1D2MA 4JT2A 5J4YA 1N3BA 2EW1A 3B9PA 3I1FA 3NBXX 2CL0X 4BZXA 4Z54A 1ZM2A 4V0ME 1E2KA 1HQYE 2ZSFA 4TMZA 3CX8A 4D4KA 4JLKA 1KK1A 2F55A 3BFXA 4PC6A 2MMGA 1HUQA 1EFRD 1SHKA 2JDIA 2QENA 1S0UA 4CYMA 4NL4H 2BDTA 2IYXA 1LV7A 3D8BA 4DDWA 3R9WA 1QVRA 3M0EA 2ZETA 3U6KA 3BB4A 4XJXA 3BK7A 4CIDA 3HR7A 5DI3B 1II9A 3EASA 4WXPA 3AUXA 2EQBA 1G19A 5TXGA 2FDCA 4QM6A 2YZ2A 1ESNA 4DUGD 4KYIB 3QG1A 3WYAA 4Q5IA 3TRFA 2ORIA 2W6IA 1KSFX 2QMUA 2RGGA 4A8JB 3NC0C 4IDQA 1ZIOA 3SDZA 4U7DA 1UFQA 2FGJA 4M9SA 2R9VA 1ZNZA 5L3VA 2F1IA 1W4AA 1E4VA 2H16A 3JZMA 3LQRA 3MCAA 3ADCA 1OB2A 2JLWA 2XNDD 1FNNA 3NH6A 4M8NE 3AKYA 1DOAA 4IOKA 4K8BA 1FFHA 5FBRB 3CNNA 4ZV4A 4MRVA 1TADA 1XD9A 3EWSA 2JIZD 2K1QA 5BXQC 2ATVA 2PX3A 3NVAA 2XXAA 1P7CA 1IN7A 3U3OA 3KXLA 4A15A 1SVKA 2LKDA 5EXTA 4ZCMA 2C5LA 4HAZA 3QOFA 1NN3A 1TUIA 2ZUBA 5FOXA 4HSEA 2O5VA 1E9RA 4OYHA 5E7MA 3FHOA 1A4RA 2OLJA 4BFZA 4D4LA 1G7TA 1XD2A 2BJWA 3LLUA 2R44A 1IY1A 1FPMA 2OBLA 3OFND 2O8MA 4QNRA 4YMVA 2V3CC 2ZJ8A 3SU1A 3VR2A 2UKDA 3EWAA 1H8HA 2OCYC 1Z6GA 1T3LA 2A5JA 4IDNA 2W0SA 1P2TA 1QHSA 4CF7A 4Q9IA 4QBHA 4LBVA 2IHBA 3OIVA 5IT5A 2XSZD 1KNQA 2JCSA 3VNVA 1W0KA 4B3DA 1DY8A 4G01B 1QF9A 2WJVA 5FOVA 3DOEA 3QF7A 4RD6A 3NBZC 4LJ4A 5SZHB 5AUPB 4GP6A 3CRRA 2ZM5A 1JPJA 3BXZA 4PZLA 3R8FA 1RRFA 3HYRA 2X8AA 5DO9A 2OSBA 4Z1MD 3KL4A 3H2YA 4P4SB 3R8CA 5C1BA 2IYYA 1K5GA 3TW8B 4JLDA 4QBGB 2VF7A 3QI2A 3GJ7A 1OFHA 4AG5A 4PC2A 1EFTA 4XSGA 1X8KA 4HDCA 2A4GA 4KTCA 3EA0A 4PANA 1R4AA 4EPWA 3PEVA 2FFAA 3IILA 4NCNA 4V03A 3K9LA 5EE1A 2ZS8A 1TMKA 1QG2A 1TF5A 4DLVA 4EPXA 1S4QA 1G3IA 2ZREA 5CJ2A 2HCJB 1XCPA 2ZSDA 1H8HD 3RS2A 4NCJA 4NCKA 4LZZA 4D0LB 2J0QA 1EX6A 3NKVA 1TPZA 4B2LA 4EQ6B 1OF1A 2OUKA 1HE1C 4FMCB 4LOAA 3P26A 2BHRA 4I99A 3P4XA 3W6PA 1JR3E 2NPIA 1KTVA 5EP4A 2QZ4A 2O8CA 2GDJA 4D81A 5IDVA 4S2EA 4NWLA 1EFCA 3EW9A 1JQJC 3EZ7A 3KJEA 3EXAA 4URYR 1IXSB 4WBSA 3UMSA 2D2FA 4HZUA 2H17A 3K1JA 1H8ED 4BFXA 3W5IA 4M9FA 1XEFA 2YINC 2Q6TA 4LYHA 1VCOA 1Z0FA 4HB0A 4X8LA 3O8CA 4FCVA 5BYKA 2OFOA 3LDAA 5CITA 2N1BA 5BQ5A 1J70A 1RZ3A 2CJWB 2F1JA 3GLIA 1XD2B 2ZYUX 4BFWA 4TQAA 4M4SA 4C0HA 1E1RA 5FOUA 3U44B 3X1ZA 1DPFA 5FPYA 5AJVB 4FMDF 2ZXUA 4BECA 1E0JA 2Q3HA 4OHWA 2D62A 4BFUA 4EKDA 1H8EA 1RTLA 1VG1A 1E69A 2CBZA 2VHQA 1G3RA 2ZRHA 3KFXA 3BS4A 1NIPA 2HT6A 4KBFA 1W44A 3LXRA 3VQTA 1Z22A 4L9WA 2VP2A 2V6JA 2GXSA 3REFA 1EFRA 3K70B 4JLNA 5J47A 2ODWA 5BWMA 4A9AA 4DT1A 2J46A 3LW7A 2WVJA 1ZBDA 2ZRBA 1R5OA 3HPRA 3MUFA 1SKQA 2ODBA 4B48A 2CK3D 1TNDA 4IVRA 1ELOA 1SZPA 4BWYA 3QKRB 3W8NA 1G7CA 3RC3A 5HKKA 2X2EA 3GLIE 1OFTA 1OJLA 2EU8A 2ZUDA 3GJ6A 4EDHA 4CVNA 1G4UR 4TZ0A 3K9HA 4BRWA 1I4LD 2I3BA 3ZZUA 1OKKD 1EK0A 4LC1A 2ZJ2A 3EPJA 2I1QA 4OK3A 4H9GA 1X3SA 3KQHA 2BC9A 4G5RA 3MWJA 4A1FA 2HJGA 2IS2A 2ZI4A 4LYJA 1OIVA 2Q3MA 4MRSA 2IYUA 4JBXA 1OH8A 1QVAA 2KI5A 5JI2E 1VKJA 5KU1A 4TWZA 1XB2A 4ITRC 2B8TA 1FNMA 3KX2A 3OEHA 2XOKA 3WYGA 1E9AA 4DB4A 1YKSA 3UIEA 1YR8A 1ZRHA 3KJGA 4P32A 2Q3FA 3NDPA 4Z8YA 3I73A 3B13B 1W1WA 1RRGA 1LF5A 2WKQA 3AVOA 2Q21A 2Z5FA 1XEXA 1EESA 2XCFA 2P0EA 4JL5A 4DLTA 4YDHB 4KO8A 4A36A 3W6NA 4MDFA 3GFOA 1BH2A 3L0OA 5L3SA 1R6BX 4U5XA 2OC0A 3P27A 1YE8A 3TSZA 4BLTA 3I8SA 2NZJA 4JLMA 1C4OA 4NZYA 5FL7A 2RGXA 2ERYA 1ZAKA 4M1SA 1MO3A 2AD1A 1YJ5A 1W47A 1MH1A 2PZFA 1JR3D 2HXSA 4B71A 2A30A 4DLXA 3B8HA 2V54A 2QAGC 3WMGA 3H84A 3U3RA 2FFBA 2OT3B 1NIJA 5TV2A 2C2HA 4ON9A 3RVBA 3SS8A 4ARZB 2XSZA 5GPIB 1TL7C 3BORA 3THWA 1MO6A 4AKHA 3TSOA 5FUVA 5CB6A 1AQYA 3U5ZB 2BIFA 4LHZA 2XTNA 4QGAA 1O3YA 1R5NA 5JSZB 3OTPA 3IIMA 5UKDA 2CE7A 4TQ9A 5JCZA 2H7VA 1DO0A 3BFVA 1DAMA 1RRPA 2WKRA 3CF2A 1CIPA 3CNOA 1KI6A 3N2EA 1CBUA 3NBYC 4LJ8A 4M1KA 1IY0A 4PC1A 1E3MA 4UXIA 2CMKA 2YWEA 3LY5A 1VYTA 3LRPA 2ZRAA 2AR7A 2QSYA 4Q4JA 4TQUS 2ZPTX 1ZW6A 4ZDWA 4XIGS 3SEAA 1EFHA 1FX0A 2NPFA 1T0JB 1BKDR 3CPEA 2VSOA 4ZI3A 3GP8A 2GEUA 3CR8A 1PUJA 1AGRA 3OIWA 2RGBA 3G0HA 1U90A 3RS3A 1XX6A 3DPUA 4PTLA 3PJRA 2J45A 3M1IA 1FTNA 2RGNC 5FPHA 5H1YA 2F43B 3TJZA 1XMIA 3NEYA 4O2RA 4D2IA 2J3EA 3SHWA 4IVQA 2EYUA 4P33A 5CK5A 1KDTA 4RCZA 1YRBA 2CNWD 2F1RA 5GVRA 3QVUA 1HA3A 4ZKEA 2A4QA 3K0AA 3FHCB 4A1VA 2X2FA 1WBDA 4JZKA 1MR3F 3B7GA 3PUVA 1CS4C 1RFLA 1U81A 5E7JA 4B44A 1RYFA 1BMFD 4DSOA 1LNZA 4DLZA 2YKGA 1SVWA 4GZLA 5D3MA 3MWYW 2XCNA 4Q7MB 3GLHE 1KO5A 2OAP1 2J41A 1VYUA 1I2DA 5AUOB 1ZD8A 2QP4A 4A0RA 3U7HB 3ADDA 5CB8A 4US2R 3T1OA 1W0KD 2AN9A 1NY6A 5H8WA 1XF9A 3DKVA 2ZAMA 2GCPA 1E2LA 1S2MA 3R9IA 1ZM4A 4CEIA 1E2GA 2AKYA 3P8NA 2JDID 4C0SA 2V1UA 5F98A 4N0DA 1LTQA 3PUZA 4LJAA 4WZBE 3NWJA 1FTSA 3AEZA 4B47A 4PHTA 4NYMR 2OM2A 4WW0A 4JVSB 1FMLA 1NN5A 1NI3A 2QPTA 3LKWA 3IQWA 1P2UA 1T8UA 2IC5A 2UVQA 4URXR 4HAXA 4FWIB 3BH0A 2CNWA 1K6MA 4QHYA 4WIAA 1XJQA 3PXGA 4URVR 1CLUA 1G41A 2XEXA 4I32A 3HYTA 1M2OB 3CRW1 4HZIA 4LC0A 1XTQA 1XJCA 2OE2A 3DDCA 3NBFA 2ZQ5A 1GITA 4NDZA 2XB2A 5J4HA 3Q7PA 4QGGA 4M1MA 5HKKD 2GJ8A 3KKPA 3SFVA 1SKYB 1PZNA 3CZQA 4MRPA 1TAGA 2IEYA 3FKSD 3DKPA 4Q48A 3RDPA 4KSCA 4RSGA 2ZTSA 4W5HA 3T06B 4FMCF 4W5WA 3HDTA 1QHYA 4Z8XA 1IJFA 4CEJB 4A82A 1QG4A 3SU8A 2ERXA 3X1DA 2NIPA 3PITA 4B3CA 1GKYA 4ABYA 2WPDA 3PFIA 1LVGA 2BMDA 2XZOA 1JXPA 3SUDA 2JLYA 3VAAA 2ORVA 3N5CA 5B58C 2HLDA 4O25A 5GJVC 1HURA 3S1AA 3U61B 4V02A 4MUBA 1NSFA 4LK2A 2F3RA 4HAYA 1JALA 3U7EB 3CZPA 2ZE5A 4RY2A 1KSGA 5KDOA 1CF4A 1KAOA 1GILA 1Z08A 4HB2A 5CLLA 4AYTA 1RC8A 3QPUA 3EG5A 3QXXA 3LA6A 3L2OB 2B6HA 3TUJC 5JJIA 3BERA 4V0LA 3QUSA 4AD8A 1E9DA 5KDLA 3GLIB 1F3OA 1E9BA 1RE0A 4RD0A 3K0FB 5E7IA 1XTKA 1HYQA 2JLRA 2IF0A 3B5JA 4JT4A 1N0WA 3I8XA 1UKVY 4RZXA 1NVVQ 4I1OA 1KMHA 2IF2A 4FXPA 1TUEA 3TQCA 2XZPA 3T5DA 1VHTA 3M5MA 1PUIA 3AF2A 4LPKA 1OV4A 4DCNA 2NQ2C 2FZ4A 5JHHB 2GK6A 2ZRMA 2OESA 5H4IB 3DL0A 1BMFA 4NYJQ 4UJ5A 1XPUA 3WMFA 1HT1E 2ZJBA 4NH0A 1G5TA 3MAAC 4TYPA 1WRBA 2BMFA 1W48A 3FTQA 3I72A 3GLFB 3D31A 4JL6A 2FPKA 5J5CA 2JGNA 2W83A 1BOFA 5CIWA 4DIEA 4OQFA 1NG1A 1KSHA 4LHVA 4YLGA 3IIKA 2QTVB 1M7HA 2Z4SA 2ZI7A 1A82A 3T61A 4AIIA 3CONA 1TQDA 2ODEA 1KDOA 2NO9A 4HEJA 3CRMA 3B6EA 1P73A 3FMIA 1Z3IX 3EIEA 2XJ9A 2QAGB 3WRYC 3AP3A 5F2EA 1R0YA 3BAFA 3NTUA 1TEXA 3T5GA 4CDGA 3KFVA 4DRZA 1E94E 2K5UA 2IJOB 3ASZA 4QRHA 3QXCA 2RGEA 4DSUA 3SU3A 3T1TA 3M5OA 2OILA 2V55B 4RFSB 2RMKA 3B1ZA 1E2DA 4JS0A 3QKUA 1D2EA 1KAGA 4XH9B 2LCFA 2V4ZA 1T4GA 1N6NA 3CO5A 2ZAOA 2D7DA 2OCAA 1MKYA 2AL7A 2ZJOA 4NE2A 4TYWA 3OIUA 1ZMXA 4EFNA 2GCOB 1AS2A 3ZLJA 3KB2A 5E95A 1CJTC 3SU0A 3VX4A 4Y0VA 2P67A 2HT1A 4ESVA 3CF0A 3K70D 1GOTA 3OE7D 1E9SA 1GDDA 1T6NA 4LBZA 4E5UA 5KDDA 3Q5EA 4RKEA 3FDIA 1WE2A 1E1QD 2IYVA 2C04A 2YWFA 3RSLA 1J8YF 4A2WA 5KUTA 2WWYA 1G3QA 3SN6A 2P5SA 2B21A 5K8TA 1X1RA 4PHGA 4PZYA 5FR1A 4OQXA 1SGWA 1OXVA 4OM9A 2C9YA 2HLDD 3IQXA 1Q20A 1DG1G 1OSNA 2QI9C 2BEKA 2VQSA 1MABA 4D80A 4NTZA 1DELA 2FSGA 4TN1A 4DT1B 2FN4A 3ZH9B 5ETXA 2HCBA 3A4MA 2UZIR 2R6GA 3H1TA 4AWXA 4Q7LA 2VHCA 5L3RA 2A2ZA 4PC3A 3AGPA 3DMNA 4XOIA 4HUQA 1Z83A 4L4UA 5TARA 3E70C 3ZJYA 2V7QD 3I32A 3M6AA 5JI3E 1D8TA 4JLJA 3PUXA 1P2SA 2VBCA 3SU4A 3KUDA 1NNEA 5BN3A 4BEBA 3BOSA 3TAUA 2ECKA 1NN1A 3RS7A 2IJD1 4HI0E 4JSYA 1F5NA 2YC2C 1N6IA 3QKTA 1KK2A 4JJZA 4MITA 1J99A 2J59A 1AA9A 2FOMB 2AX4A 2QRNA 3K0FA 1SVSA 5CJPA 4KITB 3K0EA 3TK1A 3KXIA 4FMDB 3AV0B 3BRWD 4B35A 5B2ZA 1NP6A 2ZJYA 3ONWA 4LBWA 2JLZA 3KJHA 1NVWQ 4KFRA 3UWOA 1XCGB 2VH5R 2YOFA 1NG9A 5KOYA 2XNDA 3MWKA 3GJ5A 3VX3A 3U4QB 2A5DA 2DR3A 2IUUA 2QGZA 3LH5A 2PJRA 2BBOA 3SOPA 1UPTA 2ZRPA 4L16A 1X86B 4J0QA 3VKHA 1B0UA 3NEJA 2PH1A 3EARA 121PA 2GJ9A 2WOOA 3V4FA 2Z83A 4YMUA 3IO5A 1FX0B 2QORA 3IBYA 2GXQA 4DCUA 4K46A 4Q9HA 2OC8A 5FOTA 3QKSA 3PEUA 2IEZA 4YMWA 1L7VC 1E2IA 2BKUA 2QROA 4NYIQ 4E03A 3DVLA 1BS1A 1A1RA 1GL9B 2OXCA 2UZ3A 3UG7A 1G17A 5AJWA 3IEVA 1S3SA 3LFUA 2IWRA 3CR7A 4HLDA 4NMMA 4FMBB 1CRPA 3H86A 4BRUA 2PZEA 4TLEA 4C2TA 2D06A 5G3ZA 5DH9A 2IS1A 4TLAA 4DDVA 1VMAA 1U0HC 1NLYA 4Q02A 2GKSA 2ZYWX 4D6PA 3JVUA 1I2MA 1QRAA 2O8DB 1ODFA 4M2LA 4HLUA 4O0MA 3QF4B 1X8JA 2CCJA 1MABB 1ZNYA 1II8A 1RIFA 1U94A 4OI4A 5GJ4B 4Q03A 1CXZA 4TYYA 2OZEA 1TU3A 4Q4LA 4QGFA 4W7SA 5EUQB 1R2QA 3CW2A 4EPTA 4KU4A 2B92A 1UM8A 2EFHB 2O8DA 1N5KA 1MT0A 3QF4A 2ZS9A 5CIQA 1QHXA 2YOLA 3FFBA 1GWNA 3KF2A 1FOEB 3CM0A 1U9IC 1W2HA 2WIBA 4HDOB 4US1R 3A1WA 4XD7D 3UPUA 1OH5A 1XDBA 1HEIA 4KFUA 4RFVA 3THOA 4DVGA 2P2LA 2KB0A 3SU6A 2QEQA 1QBKC 5KSOA 2IYZA 1LW7A 2GXAA 2ONKA 5BW8A 1WA5A 1IN5A 2EWWA 1QHHA 3AP2A 1R0ZA 3QNUA 3CH4B 3RRMA 5H68A 5GJBA 4IOLA 2C99A 3V9PA 1E2JA 1G3MA 2FWRA 4YC7A 1GRRA 3ZS9A 4M0LA 3EX7C 4OHZA 2EFDB 5JRZA 4E07A 4P3YA 5EQRA 2ZSEA 4A8JA 1J2JA 5HZKA 4F91B 4NWKA 3P4YA 1KO8A 5JS8A 1YR6A 2C9CA 3NIBA 2QQEA 3SUGA 2C98A 1UEJA 4KVGA 4JMYA 2GCNA 3DOFA 1J8MF 2P65A 5G53C 4GP7A 4BQSA 1PLJA 1BYIA 4CEHA 3CWZA 2ZE7A 4IFBA 3AM1A 3PEWA 4G0NA 5DSZA 4B73A 5KYKA 4GMDA 4U02A 1E9CA 5GJCA 2PLFA 3RNLA 4B3XA 4O2LA 4FD2A 1N6KA 2D4HA 4MUAA 3CIOA 1E0KA 4TYQA 2PEYA 5JSZA 2IA5A 1CJUC 3ZD6A 5JZVA 3K0CC 4MRNA 3CPHA 1OXSC 2CHGA 3SUFA 3WHLA 2RB4A 3TLXA 3WYFA 1VPLA 5DI9A 3BC1A 4ZCIA 2GVFA 1KO4A 3ICQB 3TUIC 1KMHB 2J87A 3THYB 1R8SA 2OBQA 2YYZA 3SBDA 1I4TD 3IO3A 3T12A 4TLBA 4D82A 2VP0A 3WNCA 1OXTA 2AK2A 4OBEA 2GJSA 3ZVMA 1GRQA 3VU9B 4EPVA 4DDTA 3VNUA 4LJ5A 2CLCX 6Q21A 2W2TA 1SQ5A 4I4LA 2G77B 5B30A 1PLKA 3PIRA 1U99A 4G3XA 1R10A 3GEHA 2F9LA 3ECCA 4BASA 1N6LA 2O8BA 3LONA 4PHFA 3GLFE 2IXEA 5EXXA 1W4CA 3AVTA 4LDJA 2XXAB 3TNFA 3B1WA 3KQLA 1UJ2A 2JEOA 2R62A 1CEEA 5FBWB 2FG5A 3B1YA 1Z29A 3L82B 1NF3A 4KFTA 4NCIA 2Q9BA 4PSVA 4CEHB 4A1TA 1ZM7A 4IRUB 4DLWA 4LGMA 2I4IA 3VR6A 4XSHA 5D3MB 4Q00A 2QM7A 2J7PA 3C5CA 4TYDA 2VA8A 4OL0A 1KDPA 2XB4A 1U8YA 4C0BA 2O8EB 3FFAA 4AKGA 4OJKA 3KJIA 2W6JA 3U7GA 1R0XA 4JIMA 3EIHA 5HE8A 1N5IA 4JL8A 1JR6A 4LJ6A 4R8TB 3T15A 1FMJA 5CYOA 3U1JB 3LOXA 1JI0A 2I1VB 1N5LA 4PSKA 2GCOA 1PLLA 1P75A 1J7KA 1OPXA 3OYPA 3FYHA 2YOGA 4GDFA 2HV8A 4FCWA 1U8ZA 4BFVA 4CT4B 2Q9CA 1R5BA 3UANA 4PQYA 1NMXA 1E2EA 3MD0A 1AN0A 2ZANA 3U2QA 4RFSA 1LS1A 1IBRA 2P3SA 2QL6A 4KHZA 2REBA 4DLUA 4C2UA 2HYDA 2ZR0A 5LB2A 2O8FA 1N6HA 5EP2A 4N3NA 4N0EA 2GZDA 5CM8B 2O0KA 2Z4RA 2B8WA 2V7QA 3BH7A 1B23P 1S1CA 1ZNWA 1XD8A 5L8VA 1WBBA 3ZQJA 4JMPA 2NO6A 4Q47A 4BEJA 1Z0KA 3AUYA 1KGDA 3DMDA 4OI0A 4IXMA 3HU1A 4PHHA 4Y0AA 1N6OA 4I1UA 4KAXA 3PEYA 2ZJAA 2FJUA 2RKOA 1GL7A 3K53A 2OHFA 4PPFA 5C2JB 3LWNA 4QBIA 5K8UA 1SVMA 4K81B 4POAA 3L6PA 2WSSA 1P61B 3SU5A 5FR2A 3GLFA 4D0GA 2JJ8A 3BH6A 4Q1CA 4OK6A 1T9HA 1CU1A 2OFXA 2BEJA 1T5IA 3MFYA 3UATA 1YZGA 4NP6A 3WY9A 3SR0A 4C9BA 3N2IA 3A1TA 3RABA 3BB1A 5EP1A 2FP7B 1FP6A 2BM1A 1OKKA 2DFNA 3ZQ6A 3OE7A 2QGNA 4RI0A 3FGNA 4C0JA 2ZRGA 5DN6D 2DWOA 1FW6A 2XGJA 2HF9A 4DBLC 1CKEA 2X19A 4AKIA 3I92A 4CW7A 1US8B 2DFTA 4QG7A 1KZGB 1QDEA 2ZJZA 1MOZA 4JLBA 1RRCA 1ZP6A 1NY5A 1SXJC 1A2KC 3OEHD 4MA4A 4TT3D 1ZCBA 1NLFA 3H4MA 3UKDA 4B34A 4D0NA 4XWOA 4WA7A 3C16C 4RVCA 2JJ2D 1F6BA 2ZI3A 3TQFA 3BB3A 4IXNA 1YVDA 1GUAA 4MYUA 2IXGA 2KE5A 1P72A 2J0UB 4ACBA 3CB4A 4MGYR 4YMSA 2YWHA 4FI3C 5LD2B 1XWIA 4C3ZA 4B3BA 3KUCA 2W2VA 4M9QA 1W5SA 1N0UA 4O3MA 3WXMA 2QV1A 2WJJA 1UDXA 5KPDA 1E0SA 4M9ZA 2OV2A 4R71A 5KHOC 4DB2A 1CJKC 4EJSB 3B9QA 4B3GA 3L0PA 4TT3A 2F1HA 1NLZA 4DDUA 4XWKA 4F92B 4URWR 4UNQA 1XPRA 2ZRFA 4BE7B 3VMFA 1JR3A 1X8LA 2A3RA 4P4UA 4NPHA 2C96A 2WICA 5IRCD 1IXRC 1D9XA 4JLPA 4URZR 3G5UA 2AWOA 2O52A 4X8HA 3E90B 1GNPA 5JWRA 2J5XA 1W5TA 1WXQA 2DBYA 2WAXA 2DPXA 5F3WB 4HATA 2FE4A 3LX8A 4HLQB 4V0KA 4QBFA 4FW9A 4RZUA 3ADKA 4DCSA 5L3SB 3H09A 3BBPA 1KZ7B 2BM0A 3SV9A 5JWHA 1P62B 1G1MA 1II8B 3GLGE 1UBGA 1R7RA 2BCJQ 1D9ZA 2CL6X 3RS5A 3TGPA 2AFIE 3VTKA 5DE3A 3I5XA 5EZ5A 2O8FB 5FPKA 2IYWA 1YHNA 4DEXA 1BYUA 5JJKA 3WMEA 3QJYA 1NBME 3BD9A 1OHHD 3M5LA 1NJFA 2Z43A 1JECA 3SV8A 3TR5A 2ZRIA 2IUSA 3NHAA 4URUR 5EXSA 3UXMA 4MYTA 1R8QA 3PUWA 3CUEF 3A1VA 1GNQA 1S9HA 2FPMA 1KK0A 3SYLA 1JEDA 3EPLA 3PR1A 3R9XA 2WSSD 1VHLA 4EPYA 2WTUA 1Q21A 4Q66C 3CX6A 2V1XA 2G83A 4YONB 1XP8A 1OHHA 1EGAA 4Q9JA 2VL7A 2Z6VA 2VSXA 2G0NA 4CRWB 1IN6A 3X1WA 1OIXA 1ZC3A 5EE9A 2IS4A 4UNSA 4R9UC 4Q1DA 2GA8A 3QVVA 2ANCA 1V5WA 4LRWA 5L3QA 2NMVA 1ZM3A 4KYUA 1XMVA 4S35A 4DHEA 3CF6R 2F43A 2Q0HA 1PJRA 3U60B 2CEAA 2X1VA 2HDNB 3OZXA 1GG2A 4I1SA 2PJZA 2R8RA 3THXB 1RPZA 4HYYA 4JJKA 2ZRCA 1YR7A 4IEEA 4GSYA 2RGCA 2P59A 1UBFA 3D7MA 4DSNA 1XEWX 2CCKA 3FKQA 3ND9A 1NKSA 1OLOA 5FBVB 2FSIA 1KY3A 3KEEA 1F60A 2FGKA 4X8OA 1G5PA 4V0MA 1U8AA 2CHVA 2VIIA 3Q3JB 4NHOA 3OF5A 2F6RA 2ZRLA 5J40A 1BO6A 1F2UB 1FQJA 2RGDA 2YHSA 3D3QA 3GJ0A 3LVRE 5CM9C 5G41A 2ZUCA 4LYFA 1FUKA 2QN6A 4UNRA 1G291 4GRAA 3KNXA 2R6CA 4HZUB 1XZPA 1VG8A 4PO8A 2RHMA 5EE0A 3AVYA 4ZI2A 3E5HA 1A1VA 3I4LA 1Z2AA 1Z0DA 2QU8A 4TLCA 3UG6A 3EPHA 3NH9A 4Q4HB 4DJTA 1ZIPA 2WJIA 1DAIA 2O8CB 2V8OA 2IS6A 5JMTA 4AI6A 2GESA 2A7QA 1NVVR 3QENA 3RS0A 2BBSA 3F5FA 1Y3AA 2PLRA 2HXYA 4MGZR 1XRJA 4F7WA 4KSBA 1KO7A 2GF9A 4OJQA 5KSPA 2OBNA 4QL3A 1JBKA 4LCBA 4HUTA 1E2NA 1ZVQA 1TQ4A 2JIZA 3EIQA 1NMZA 1OT3A 1TX4B 3QQ5A 1KKLA 4I1VA 1VDZA 1NN0A 4HUQB 3ZS8A 4ESHA 3THXA 5JFGA 5ANRB 4OQMA 2OC7A 5IK2A 2HUPA 4C0LA 4BUJA 2DYKA 4BGDA 2WV9A 4WZ6A 3W8RA 1VG0B 4TTPA 3CH5A 1E2QA 4A1XA 2GEDA 3RRYA 3FVQA 3AB3A 2PMKA 2P6RA 2G1KA 4AYXA 3RWMB 5E3HA 1SXJB 1YU9A 2OCBA 4RJLA 4ZDKA 4A92A 3VHLB 4LWZA 4EPRA 4GBMA 3EZ6A 1LF0A 5FTNA 2FA9A 4PPGA 2PBRA 3W3AA 4R7ZA 221PA 3MJRA 2D3WA 2OO7A 4Q1AA 5KNCA 3QPVA 4PFSA 2VP5A 4QXAA 1R0WA 2JATA 1UF9A 1W3CA 2FX3A 1M74A 4LV5B 1SXJA 5GNDA 2XOKD 2GEVA 5DLQC 3RSOA 3AVUA 2IL1A 3L8ZA 5HCIA 4QJ4A 4B32A 5JJLA 3LV8A 1E79A 4WH8A 4MYCA 3FOZA 2ATXA 4RD3A 4QC2A 5AWFC 3RRNA 1S9DA 3AVXA 2YC4C 4FWTA 2ZE6A 2GETA 5H70A 4R98A 3EZFA 2IT1A 2IYLD 2WSMA 3NXSA 4JYCA 3K9GA 2R6AA 1N5JA 1H65A 3UWKA 1Q1QA 3RAPR 5DHAA 5AK0A 5KO2A 1NKTA 3PENA 2QTFA 2W58A 3T34A 1T91A 4AG6A 4A6PA 3OAAD 4PPNA 2EWVA 1CR1A 2VTKA 1NS3A 1CJVC 3A1SA 5EE3A 2FPLA 5DN6A 3A58B 1KHTA 5JCPA 1JJVA 2PCJA 3OHMA 4AK9A 1KI4A 1W0JD 3SV7A 5KSZA 1GAJA 2ONJA 2XX3A 1FZQA 4TMVA 3Q7QA 2F3TA 4XD7A 5DGXA 1DEKA 2J0VA 2ZRNA 4Q19A 2WOJA 3QXJA 4IFEA 1G8HA 1OB5A 2J0SA 1IJEA 1E0AA 1GRNA 4XTRA 4M21A 2JAQA 1AIPA 1N6PA 5B57C 1OIWA 2JASA 2JLQA 1GFIA 4JVMA 1E1QA 1WB9A 4TTQA 5C18A 3MMPA 1HE8B 5ELXA 4YDSA 4ZDJA 3GMTA 1Q1ZA 4UXJA 5FI1B 2ASEA 4LV6A 4MKIA 5HCNA 1SKYE 3HJNA 2H5EA 4QOSA 3W90A 1CULC 3C4JA 3BGWA 1XNJA 3K09C 4E22A 3BJIC 3SC3A 3CRVA 4OHYA 1LS6A 1KJZA 3SYKA 4UNPA 5K8LA 4M53A 3RC4A 4TL6A 4B76A 1TF7A 2H1LA 1KOFA 4LBYA 4TMWA 5KNBA 2J0UA 2KBEA 1C9KA 5HZHA 2DWPA 2WWXA 1ZNXA 3C8UA 4KODA 5A4JA 1GM5A 1ZUHA 2P5TB 4AY2A 2OEPA 4RCYA 2KBFA 1IHUA 3UMFA 3C5HA 4CT5A 3TR0A 1VIAA 3B1XA 3U44A 1TU4A 3U6BA 1M8PA 4XVRA 1NRJB 2HF8A 4IDPA 1W46A 3AKDA 5EQSA 3SBEA 3SZEA 1DAKA 1NVUQ 3AF0A 1XFAA 4DEYA 5FTKA 1JJ7A 1Y63A 2D2EA 2QNRA 3PG5A 4WAUA 1E32A 1ZINA 1II0A 1BIFA 4Q9LA 2FM2A 1KDRA 4QHSA 5FBLB 4HLUC 2QSZA 2ORWA 2XNIA 1EXMA 5DYGA 3LVQE 1FUUA 5JS7A 1GNRA 2AK3A 3PQCA 2NTYC 2V6IA 4B33A 2CDNA 1DS6A 3AVVA 3MLEA 1Z0AA 4BZPA 1GL6A 1KMQA 3VKWA 3GPLA 1HT2E 4Q1BA 2IYTA 3M5NA 2H92A 3PV0A 2R65A 4LI0A 4QM7A 5FPTA 2IYSA 1VG9B 4MQBA 1U2RA 3LXXA 4OQNA 5P21A 4B2PA 3TUZC 5EZ6B 3LQQA 5CK4A 821PA 1RKBA 2HJVA 1DAEA 4WXRA 3O8DA 1KSJA 2WZQA 2J9RA 4JLAA 1DXPA 2N42A 5C4GB 1UBEA 2WPDD 4X8MA 4A0FA 3CPJB 4MGKR 2ZRDA 1JB1A 2KSQA 4M1WA 4C0KA 4YXWD 1LB1B 2SHKA 1E9EA 5L3QB 4HAWA 1G7SA 5FOSA 5M04A 1XXHB 2GBLC 2ZYVX 4TMKA 4PZZA 5DISB 2BOVA 2OK5A 3ASYA 5JRJA 2O8EA 3GLGB 2QAJA 3DM9B 4U01A 1KIMA 2VP4A 2VP6A 3E1SA 4L15A 5CDFA 4D4MA 3DO6A 4Z1MA 3Q85A 4AC9A 1VCNA 2EYQA 3SFZA 3ICEA 1XZQA 4XVUA 4G5SA 2XZLA 3W6OA 1IOZA 1CP2A 3B60A 1OXUA 2GVZC 4IDOA 2O0JA 4Q1FA 4TSFD 2CL7X 4L8GA 3SQXA 2O0HA 3HPQA 4JVLA 5FH9A 2JLVA 2TMKA 4PAMA 2AD5A 2YNMA 4F4IA 1OFUX 4DKXA 3TVDA 3ETLA 3JZAA 1FP7A 1E2PA 2DFLA 1ZYUA 2CVHA 4DSTA 2NGRA 3GD7A 3KB1A 4JLOA 3N70A 2WJGA 1G8GA 3IEUA 1G8YA 2G3YA 2R2AA 4US0R 3ZIAD 1UDWA 2PT7A 1QHIA 1AZSC 3SJCA 4M22A 4PXAA 5A0FA 3KTAB 2CLSA 2GBLA 1EX7A 3K9NA 3ZGXA 1ZD1A 1SVOA 3KKOA 3LBNA 1W36B 2J1LA 2DB3A 1D6JA 2Z0MA 4OI1A 4TZ6A 1JNYA 4A8JC 4ZDIA 2QG6A 3AP1A 5J4VA 4RD1A 2ZRKA 1KI6B 3SV6A 2NO1A 3WP0A 4Z51A 1Z5ZA 3QXSA 4OI2A 2QE7A 2P6UA 4Q4HA 3FHTA 1F48A 3KKQA 1Z6TA 4LPSA 3QSYA 3C15C 3VR1A 3ZDQA 1F2TA 1P9RA 4ARZA 4I81A 4DLSA 5FFMA 1DE0A 4PQFA 5LB4A 1NBMA 2GZHA 4JSTA 1F2UA 3O8BA 2FU5C 4JKYA 4QGHA 4LJYA 1P5ZB 4EJSA 1G7RA 1NMYA 4IOJA 3MGCA 4NU0A 1XTRA 1P6XA 2YOHA 1W4RA 1JEEA 2RAPA 3TIFA 3VR4A 4F4JA 5LDDC 721PA 5HE9A 2C95A 3EZ2A 3WNDA 4IJMA 4YQFA 3RC6A 2YV5A 2XJ4A 2RHDA 4BLOA 1DG3A 3QXHA 2WHXA 4NYIR 2E1RA 3TH5A 1ZJ6A 3MSXA 5BN5A 1XJ0A 3IGFA 3TVTA 3ZVLA 5B64A 2A9KA 5ESBA 2IX3A 3NHBA 5EPNA 3M4YA 2YVUA 1XEXB 2BV3A 2OBMA 2QUZA 3FMFA 4UKDA 3GJ3A 1T8TA 1DBSA 3P20A 5FOWA 4F38A 1LY1A 4DLYA 1OW3B 1YZQA 4ZO4A 1E6CA 2JJ1A 2AFHE 2VHTA 1QHHB 1L4YA 3T1QA 1IQPA 3I5YA 2R6FA 2CHQA 4Q7JB 3FMPB 1W36C 4W5JA 4EFMA 3GQBA 4M1YA 3CKLA 4PX9A 2P6NA 4TLDA 3WHKA 4BFTA 1Z2CA 2PL3A 3V00A 3GLHB 2YWGA 4HDQB 1W2GA 4PAOA 4MRRA 3U3KA 1KI8A 1DO2A 2FZLA 1G4AE 1W0JA 3IHWA 3X1YA 2G88A 4UXHA 1HV8A 2GHIA 3Q72A 4BLRA 3E2IA 1JPNA 2C8VA 2WWGA 3R20A 4MGIR 2H8KA 1G6HA 2C9OA 2FFHA 2NO7A 2FSHA 2ZYTX 3AVQA 3CWQA 3MRSA 4LJ9A 4Q4AA 2X77A 2OINA 4JLVA 4XTCS 2CJWA 2C77A 1JXOA 2GWHA 2CXXA 2ODNA 1GKUB 3Q9LA 3ZD7A 5J4LA 2ZI6A 4Q4AB 1IAQA 4TL8A 1P2VA 3ZVNA 3TAHA 1OYWA 3EPKA 2VF8A 2JJ1D 2CVFA 2A5FA 2NO0A 2WM9B 2REOA 4C0QC 1Q3TA 4MDEA 2W6ID 4PQRA 2B7BA 1WQ1R 1P9NA 4A0HA 4GOXA 2N46A
chains in the Genus database with same CATH superfamily
1WAMA 4UFDH 2H0AA 4RKFA 4DL9A 1E63A 5C8DA 4UQOA 3RYIA 4LF8B 5YASA 4CKBA 2X8WA 2PH3A 4H0NA 3RTAA 1KYYA 5EU8A 1TECE 2W6JD 2ATIA 1SHZA 2BR4A 1XP5A 3CBQA 3G5AA 1OGIA 2KX4A 4UEKA 4FGSA 5TMEA 1KDYA 4JI8B 1E3IA 1RXSA 1E38B 1G8AA 2AC4A 1BDMA 4RDCA 4V0NA 4O4HF 4OXKA 2ZS7A 3DYBA 1RJ9B 2XTMA 2EZTA 3BD7A 1HDXA 1N8NA 4L8FA 4XSVA 4DBVO 4Z6KA 1VSTA 5A5GA 2FQQA 2YN4A 1ZTLA 2Y5FA 4H4FA 1I6MA 5CPFA 2QMEA 4LE1A 1TW3A 1SGRE 2IK8A 3Q3KA 4BFSA 3BWMA 3DV2A 1EDBA 4Q4CA 5JD3A 5JNTA 3H16A 1G2QA 4WOPA 3V97A 3UTDA 3F9CA 5FUXA 3A37A 1Y8QB 2NN3C 3CH6A 3EZYA 4LYAA 4MKHA 3Q4GA 4RF2A 5I7RA 2EG5A 4HMQA 2OXSA 3S6JA 1R4NB 2Z3ZA 3AV3A 4Y2YA 4WK2B 1MQ9A 1A5TA 4TKZA 3DF7A 5B1HA 1EMDA 5BV2P 4TYNA 3F3YA 3ZNNA 3KPJA 2ON6A 2WD8A 3W05A 1ZA2A 3OFNA 3S7TA 3VKUA 4CN9A 4EZIA 1DARA 1IN4A 1CRQA 4IXDA 4UUAA 4GKJB 1PVOA 3LZ6A 5FI5A 3W04A 2HSJA 2WIAA 3PSHA 1QP8A 1TUBB 3O8LA 4QPCA 4R69A 3WB1A 4X8VH 1KH1A 1O87A 4ZVOA 2VDVE 1IONA 4EJ0A 4QREA 2P1ZA 1M8GA 5IVKA 5JECA 2YMSC 3LW8A 2V9PA 5ICMA 4F3TA 4EJ2A 1C5MD 1SCUA 4X85A 1VZQH 1O58A 1HRKA 3IKJA 4YHBA 3C4VA 4EGSA 2C2WA 3KN2A 2Z95A 3DXZA 8LDHA 3FUWA 3KSMA 5DM2A 3ETDA 2J3HA 3B38A 2BZGA 4ZA2A 5EP3A 2Z2JA 4KLZA 5KVQA 1ZOIA 1BOQA 2ENUA 4I8IA 4MVJE 1BHO1 4ALMA 4DFDA 1QH0A 1X2EA 3BWCA 5AO9A 3TJVA 3LO8A 3QEMB 2XWPA 3HP1A 3KKNA 3SICE 3K15A 2A57A 1GPMA 4MQ5A 1SIOA 5AJZA 2Z9IA 1XU9A 5EMLA 1L5GB 3ZN2A 3SYJA 2BSQA 1E61A 4MVJI 2ZDQA 1C2KA 4MI1A 2A3NA 4IQGA 5TT0A 2XNKA 4R8RA 4B6FA 2GM9A 1DPOA 5ALXA 1EEXB 4ILEA 4KYTA 3IPYA 3E0XA 1T4CB 4NA8A 4NBUA 1H2HA 3B2NA 3PIDA 2IYAA 1QDUA 2O7QA 3FPJA 5JSYA 1GTL1 3C7KA 4KAFA 2V9ZA 3I04M 4TM7A 5E6RB 3U49A 3QV1A 1NF8A 5AJXA 4KPFC 2JPDA 2VLIA 3G82C 2V3VA 1S84A 2HDWA 1JKMA 3AHFA 3ON5A 4FYHA 2HA0A 2Y0EA 1KI3A 3IEKA 3QIAA 4RPHA 4TKMA 1ZZEA 1C2DA 1C5ZB 1XLWA 3DZKA 2QMOA 3HFJA 4EJMA 1TE0A 4NA7A 2QUJA 3RSFA 3UMBA 2AF3C 3WX0A 2XQKA 2A5AA 1GPKA 3EISA 4NQZA 2YMMA 5JH7B 5WRFA 3ICCA 4MS4A 1VHDA 1YPEH 3GW8A 3LPCA 4I9GA 1QR2A 2RGNA 3FR8A 4IO1A 1RYHA 1YI0A 1ARCA 4MX8A 3GCTG 1DSUA 3QBVA 3D2LA 1CTQA 1TNKA 1J21A 1Y42X 2KS6A 4S3MA 4U7TB 3KQKA 4MUEA 3SZGA 4EQZA 1N9KA 1ZPDA 3DEIA 4RANA 3JQQA 2FKNA 3KVYA 5GWZA 3RXGA 4HPJB 1LZLA 2ZYHA 2PZGA 4F3RA 1QF7A 4AO6A 3GFQA 4JVNA 4JMLA 5U4XA 1QLJA 1XMJA 5IC6A 4GWLA 4ZTUB 2NG1A 3OQ6A 4JX8A 4TXNA 5J4KA 4HY3A 4YPOA 4KBGA 2Y0PA 3IBGA 1H05A 2CCGA 1CEQA 3DM5A 1XEWY 1AB6A 2E5FA 3ILYA 4NK4A 2IDKA 1JZSA 4GECA 4AFSA 1TPAE 2VPPA 1NOKA 1QGAA 4B82A 2V0BA 3DL7A 1X1SA 2PR7A 3D0OA 3EDYA 1O2XA 1DKLA 1JVNA 1KC1A 1RQLA 1FYEA 2G1JA 2QT0A 2V0NA 1YCPM 3ESXA 4FKZA 3PMJA 4C87A 3J81k 4KI0A 5EXMA 3HYNA 3L05A 1TNIA 3S7ZA 2XCRB 4RSPA 3TE6A 1IM2A 4RHCA 1HPLA 2JIOA 2VUSA 4A2QA 4BCBA 1TRHA 4K03A 1I32A 1JKJA 3QVSA 1PFKA 4RQAA 5EXNA 1QQTA 1PHRA 2E9SA 3KG2A 1N9GA 2DHDA 1R88A 2JI8A 4KIGA 1CQQA 1DLJA 2R68A 1TAWA 1LHFH 3GPCA 2H2HA 4FHEA 5DSXA 2STBE 3E8XA 3H9QA 4WZAB 2QRLA 3CLVA 1DU4A 3PV2A 1K2I1 2VH6A 1C1YA 1KAMA 2BBWA 2WVAA 4R1TA 1GJ6A 4YASA 4D99A 3DV0B 5HOEA 4BVKA 3MXTA 1BMNH 3SZNA 1G18A 1O6GA 1VB5A 2P79A 4NWIA 4CQMA 5HM9A 1UKZA 4RS4A 1FU8A 4HRAA 1V2TT 1U1IA 3A6JA 3DEFA 2Q3CA 4NEQA 3UK7A 2D59A 1I7SB 4IMQA 1D5CA 1G21E 1Q5PA 2ZYRA 3P0FA 4HT3B 2NZYA 1W2KH 1R4NA 2QYIA 3RM0H 1E5QA 3EVCA 4G9GA 5JAQA 5FTLA 4F3NA 1V26A 2GERA 5L7YA 3FDXA 5JALA 2QMHA 3BHJA 3PXEA 1WZEA 1KI1A 1UANA 1O3BA 1KXJA 2DHRA 2HSEA 5INTA 1ZUNA 2GMTC 3P19A 1TJ4A 5HM8A 5F9HA 1U0NA 1CETA 3PT9A 4R0VA 5KTYA 1VMIA 3PUJA 3FKJA 3REGA 4MW0A 3ABIA 421PA 3PIIA 4AJHA 1F5LA 1K5DA 2P1DA 4JU8A 4JHXA 2CMFA 3ONNA 2E87A 3EDMA 3PQ3A 1UJ5A 1OMOA 4IW4E 1EWRA 4ML3A 4ARSA 2P9BA 2VBFA 3B82A 3HABA 3IQIX 4K6KA 5HPYB 1TX7A 4MG3A 3CVVA 1P9WA 2XNSA 5IF3A 4LRQA 3KKMA 3VKGA 1H0SA 2XTZA 5DYIA 3PKIA 3TLMA 2AYYA 1MO4A 4N8SA 3RVPA 3BG8A 4E2ZA 2NVBA 1OWIA 1HH4A 2CNOA 2H4YA 4PG6A 5H7XA 5CYFA 4OKNA 1V2QT 4U39A 3ZX4A 1A7AA 1ESDA 4C4ZA 3FDZB 5FHTA 1KJYA 5JXJA 2AKAB 1AK2A 1AS3A 1ECGA 3KK0A 2WMOB 3IEPA 4FEGA 5K3DA 3RAFC 1DBPA 4DCOA 4ZIRB 4V0SA 2RHGB 4LC9A 1DX4A 1RS0A 1T5LA 2BTEA 4C4XA 2G76A 1YLCA 1SI5H 5FL7D 3MBOA 2VEDA 1WXRA 2V0CA 5TY0A 5LLDA 5EHZA 1L5RA 2Z9DA 2F8TA 1YZ3A 5JTUA 3H8JA 4U1RA 3J80A 2B36A 4FHZA 1EJAA 3QP9A 3OWHA 4UTRA 2HAEA 2PUHA 1P4AA 3BMCB 3Q3IA 1GPNA 4FOPA 3D23A 3EZXA 4PG7A 4CL8A 1YJBA 4EJSC 2DETA 3LO5A 5E4FA 5ALVA 5TMPA 2YN0A 3Q5DA 4KVFA 4R6XA 4Z9AA 1RXWA 2Q5LA 3IIJA 3MJDA 5ESRA 5EUMA 5FLKA 3QX9A 1PFUA 1WUIS 1SXJD 3AG6A 4OPMA 4C5CA 4FFBA 5AVYA 3KQMA 1LC0A 3PRKE 5ES4B 4XM2A 1ORRA 1Z7WA 4DVAU 4G4GA 1LRKA 3BTKE 3OQHA 4UU1A 2W2PA 3TTUA 1BWQA 1SK9A 1V37A 3JQBA 3ROZA 4QUBA 5DO4H 4OX9Y 3PUHA 3D6MA 3KM0A 3PGJA 4MLPA 4QUHA 4R81A 2Q5OA 1FYFA 4YQYA 1AS0A 1O08A 2PUWA 2ZBPA 1GEGA 3D4LA 2PRZA 5A4DA 2VYFA 2EQ5A 1ILEA 1L8XA 1NVTA 1OREA 1WULS 3QEKA 1WD5A 3RVQA 1YL6A 5K6RA 1W1IA 1SVNA 4M3NA 4MCHA 1M1YA 3A8BA 3SJBA 2W7TA 2CSUA 3WBFA 2C1ZA 1G1AA 4IIFA 3D6TB 3WRXC 3BEOA 3E0NB 4Y67A 5JNSA 5EUCA 3HWRA 4X60A 4QT8C 3GY4A 4E7PA 3BXPA 4WVFA 5FT9A 1WXWA 3JZFA 4WCVA 4HLCA 5AHOA 1JR4A 5CG2A 4AUEA 3WTBA 1SK8A 3A1CA 2J9ZB 1F7UA 3KXDA 4GI1A 5COAA 4X6PA 1MAYA 1VBKA 5IXYA 2BXUH 3E53A 3EN0A 4G41A 4OGKA 5CAEA 1W8IA 4P4GA 4MS4B 1J14A 2BR3A 3E23A 4DA8A 5JY1A 1QUFA 4E33A 4ENUA 3PFGA 4BV3A 2YMLA 3A6HA 2VINA 3M6LA 2CV3A 3QPAA 4BNZA 3K9XB 4XUCA 4CBVA 4DUGA 621PA 1TPPA 5KREA 4OJYA 6LPRA 2YS6A 1GI3A 1MOPA 4WF8A 2PMDA 4PYRA 1ISPA 1ANEA 1A7JA 5IJ0A 2JAWA 2H4FA 4QQRA 4UUQA 3D1JA 3G0GA 4EB8A 2PZ8A 2FHPA 3WGTA 1YKGA 1LWNA 3V7WA 2VOJA 2GT7A 1QG0A 1YRWA 1ZFNA 2DE0X 2ZC9H 1C1DA 3FZQA 5AUNB 1XCMA 3JU3A 3VB6A 2OQ5A 2GN6A 3PVSA 3A31A 1GT6A 2AVNA 4KJZA 3P32A 1SFQB 1RZVA 4Z0NA 4PWYA 3MFJA 4GZMA 3TOVA 3WJ7A 3V4RA 1S02A 3W4IA 4DJZB 3R3UA 3GPIA 3CEAA 4GMGA 3DAFA 3CX3A 1U6JA 3ESAA 3DUXH 3L8DA 1T36B 2FMKA 3S2YA 2X1MA 3SLKA 3ONDA 1ONBA 1OVGA 2VO1A 1IMOA 3NS7A 3GIDA 1JLMA 7KMEH 2XMBA 4DT7B 2VIDA 1R37A 3OU7A 4GMXA 1MH9A 4H1TA 4AYWA 4D82A 4DLAA 4E5VA 1XYVA 1G63A 3YASA 1GTSA 2GILA 5CX1A 2JAXA 2QJFA 2H06A 1EXVA 1QK3A 4PLHA 2NVUA 1RWOA 1ZU4A 3GN2A 5J23A 1B2RA 2O0LA 4B74A 3SNBA 3ZVDA 4GVPA 2RBEA 3DXXA 4JP1A 4J2OA 2VJBA 3DBOB 5CA1F 4L9SA 2FZWA 2F9VA 5D3QA 2DHQA 3OFVA 4MKFA 3GDSA 1LFDB 5JD6A 3G85A 3G2OA 1IY2A 5IK2D 3F7NA 1TF2A 3IV6A 2O3RA 4HQ0A 4MV3A 1QFMA 4W63A 1ZM9A 4C89A 1TTTA 4FB5A 3BE6A 4LV8B 2COEA 1W0ZU 3EAFA 3PZBA 5LL6P 4V2UA 4YRLA 3ORYA 2DT5A 2GAAA 1PJPA 1CR2A 1XXHE 1A2BA 2ESTE 1ZKMA 2G6TA 4JZ1A 4ZKDA 1GR0A 4JZEH 3GU3A 4BX2A 1MAVA 1EAUA 3AKCA 2QBYB 1K7SN 4AMUA 3GVXA 1LX7A 2CF8H 3VYVA 1FQKA 2AB0A 1VGQA 1Y89A 2MSDB 4IH1A 4RPJA 3NIFB 1DNPA 2PEZA 2Z9CA 4OOEA 1TBZH 1BE8A 3ICPA 3RVLA 3D02A 3ZZAA 4CR9A 2HFKA 3A7TA 1QE0A 2NZWA 2YXLA 4X2YA 3EXIB 4JD5A 1QVZA 4G5FA 4JENA 5FFFA 3VHRA 4CFYA 4F6RB 5FBEA 2CN1A 4KCGA 3NAMA 5A5VA 4XD2A 3R5SA 1XLTA 1PPCE 1UCYK 2B1RA 2NXJA 2R3YA 4LXQA 2BLWA 2A1IA 2LNDA 1WKCA 2OFFA 2ORED 2WPMS 1VL2A 3WBJA 1V1MA 3A1EA 4QX6A 2YBEA 5FL3A 4FN5A 3U26A 1GZDA 3OX7U 1NVMB 2W2XA 4PX2A 4D5GA 1COWD 2VHXA 1E1CA 2GMWA 5C46F 1SOAA 1B0FA 4C4PA 1X0VA 2Q2OA 4OY3A 4KBYA 1DRJA 4XVQA 4N18A 3ZGZA 4DCPA 2VDJA 4I8XA 3QY0A 2E0IA 3P6ZB 5KCMA 5T7BA 1DP4A 1Q3HA 1XTZA 1V47A 5HTKA 2ZT7A 1G64A 2P3FH 1OE0A 1VITG 3EGVA 2RA0A 4CF4A 1H4TA 1GKIA 3LCJA 1GRCA 2DWUA 2HLHA 4V0OA 2R3UA 2VAPA 2P77A 1C2HA 2X0EA 1R00A 3BWDD 1HYGA 1R3DA 1F8XA 1CVWH 1U5BA 2JK1A 1G16A 1M1YE 2KWIA 2QYSA 3COYA 3KXKA 1QYIA 3R2JA 4HD8A 3K09A 4JT8A 1ZH4A 4LRTB 1I7NA 3G49A 4UZFA 2CUZA 1X7HA 1WP9A 1CR6A 3IUNA 2G81E 3EQ8A 1S1MA 1C1SA 1ZUD1 2JKYA 3IJ5A 3OEEA 5E6UB 2VJ1A 1QBOA 4AG3A 4F12A 1KMNA 1H2BA 2ULLA 3HU3A 5HQ3A 2FWNA 3Q0IA 1KQPA 3QEAZ 3O8RA 1MGPA 4KIUA 4M1TA 3SE7A 1TJ5A 2JH6D 5BSGA 1FDPA 3RXSA 5DI3A 5KJ6A 3DSRA 2V8BA 3LDHA 3TEMA 3DTTA 4IVPA 5IUNC 5CNIA 5BQ5A 2PA0A 1N2BA 4IHJF 4OA8A 1V3TA 1UBOS 2F7SA 4KXMA 1JHZA 2IYRA 4GFDA 4RPIA 1VE9A 5U1PA 3P8OA 5BVHB 4IVNA 5AOAA 2XBXA 1DIGA 5EQTA 5EHXA 1QWOA 3JQFA 3D9QX 1V5FA 1CR4A 3SK0A 1X80B 2GF2A 4PLZA 3I04A 3QKRA 3WR5A 4EB3A 4EM6A 3BFKA 1QF6A 1A96A 2WWRA 4L95C 2ZJ5A 3SFZA 1C81A 1U2DC 4MKGA 4RH1A 1UMAH 1XTIA 2RARA 2Z2IA 4FFDA 3CNLA 2ZROA 1C1DB 4AYYB 3EGXB 3G6WA 3HJRA 4FR5A 4J7CA 3WZMA 4YUXA 1JAIA 1P74A 3ERCA 1FSFA 5GIBA 1JDNA 4CZ2A 1J0EA 1IMJA 4ACAA 2QRHA 3ISTA 2BZAA 2WJPA 3SQMA 5BRAA 1GAQA 1GSIA 1O30A 5FUYA 5KWSA 1RIIA 4ZYTA 2VYNA 3JYLA 3PE6A 4JJ6A 5EJEA 1QVWA 1Z63A 2W2NA 3GDGA 1AE8H 4EELA 1V8BA 2PKAA 4X1KB 1SVLA 4DLRA 1W9HA 1MKXH 4OXYA 1U2TA 4GBED 4Y1RB 4EVRA 3AL3A 5JBTA 3FPHA 1NRPH 4XFDA 2BGMA 1RW4A 3HKDA 2QXGA 1NFYA 1DAGA 1CDDA 2B4AA 3URMA 5JEDA 4GPIB 3PRJA 2D13A 2WAOA 3I5UA 1MIHA 3O93A 4QPNA 1AHIA 1SZDA 3HU2A 1U9IA 2F48A 5LBIA 5TDHA 3WMXA 4C7KA 2PE5A 3UFBA 1U4SA 1XG5A 1T0PA 4MWCA 2R1VB 3HCFA 1OAAA 1UP6A 1VBFA 1C3JA 4KWEA 4CUJA 4B6EA 3NTVA 4DWJA 1XX9A 4WT7A 5GGXA 3NWOA 4S04A 1VGCB 1JFLA 4QIHA 3A1UA 1TAQA 1KIFA 4OHUA 1X1TA 1TI7A 2ZE8A 3F7OA 3HP4A 2GNOA 2EGUA 5BSRA 1ZJ5A 2ZW9A 2C7PA 1QO0A 1DHTA 3NPAA 1C0PA 3KKZA 3SVTA 1K1NA 4LW8A 4ZUHA 3LA8A 3UM9A 1R0RE 4EYGA 1WSWA 1FJSA 1P4SA 3FN8A 3FYUC 3MJCA 1Z6PA 4G26A 1AZWA 1Y48E 1DOHA 4MWOA 5KJCA 2J3MA 4GO1A 2OV4A 2HGSA 2EGHA 4HEA1 4JT2A 3DLAA 1FLEE 3P2OA 1N3BA 4J29A 1JLLA 5ERXA 5HXAA 3T4XA 1VCPA 4UNIA 4AN1A 4BZXA 1YZYA 1P9SA 1JXQA 1HQYE 3VZDA 3CMCO 3LBYA 2QJWA 2F55A 2AFIA 3GRKA 3PFHA 2DE8A 5DTJA 1GGKA 5AI8A 2C9MA 2QRQA 3BFXA 5DM1A 3GWZA 5CLJA 1POWA 5ALWA 1Q0TA 3D8HA 3OO0A 2OCXA 1G37A 2W2QA 2JDIA 3RHSA 1OPRA 2R8OA 3GUZA 4I0WB 2JC3A 1V5IA 4N12A 2NP7A 1SUPA 3RJZA 4FI3F 4NL4H 4L0DA 2BDTA 2IYXA 3BXGA 4EDFA 4PTYA 4FUTA 3IHKA 3P0IA 4DMMA 4ENPA 4KG7A 5AVSA 3M0EA 3U6KA 1OI4A 1YR3A 3D4PA 3BK7A 3OZIA 1JWBB 3TQOA 1P80A 1LHDH 2B1GA 1II9A 2QTWB 4WXPA 3QJGA 4YCDA 2EQBA 1BBRH 3HZZA 1H2YA 1SXIA 2IPLA 5TXGA 1I9CA 1BD4A 1WCYA 1ESNA 2YYSA 5CP8A 2ASUB 1KDZA 5BR7A 2UUYA 1TGNA 2RK4A 2XAAA 5A6SB 2WZDA 3GCXA 1HGXA 1SG8B 3I09A 3NI2A 4VGCB 3E7DA 4GUAA 4MDYA 5F7JA 3VYTB 5B7GA 3I39X 5JZBA 2QMUA 3VH3A 2RGGA 3M36A 3LL4A 5LH8A 2OTCA 1C8BA 2SGPE 3BL8A 2BTQB 2IPNA 4AP6A 3FFTA 1J9ZA 3HM2A 4R6WA 3KEOA 2FGJA 2POQX 3UHPA 2SKCA 4R2XA 3HCDA 4J07A 2AH4X 4CM9A 3OLWA 2B0CA 2F1IA 3DHYA 1MVNA 3CS7A 2WR8A 4RQTA 3QUMP 1FNNA 1N2XA 2R7MA 4O2BF 2W70A 4IOKA 3AYZB 2JFVA 1DBVO 3V8RA 3KAKA 2L74A 1XZCA 1NVAA 2FF5A 3NVMB 2LPMA 1TADA 4FYKA 2ZFTA 4TS9A 2Z2YA 4EY4A 3IUBA 4RIGA 3EWSA 2JIZD 4YV1A 1Q6ZA 1NW7A 1MN6A 1DIRA 3OLZA 4IFIA 2PX3A 3MSCA 3BV9B 3NVAA 5DP3A 2O3QA 3Q0TA 2XXAA 2P3OA 2G67A 5I4BA 3H97A 3RT1A 1XMNB 3ROMA 1GJ7B 3WB9A 3KXLA 2HPVA 1FVHA 2R87A 3AR3A 1UBLS 2LKDA 2XE8A 3GLTA 2XMSA 5EXTA 3RFXA 2C5LA 4CM1A 4NEGA 2ZUBA 4Q3EA 5FOXA 4V1CA 4A23A 4II3A 1DWEH 2XUHA 1MX9A 3HB7A 3TOZA 1IVSA 2E3JA 4R8MA 3JASA 4BFZA 4D4HA 1PWXA 4D4LA 1XD2A 2BJWA 1ECBA 1TB4A 2DKOA 1IY1A 1FPMA 2OBLA 4O59O 4EUHA 5F03A 2IP4A 2Q7XA 4YR7A 5JXGA 4X94A 5J63A 3A05A 2PKWA 4D42A 1PWYE 1GUDA 1RXPA 1DOJA 2G4VA 1E5TA 2NNWB 2Z98A 4G0MA 4R1LA 4YJ2F 1YXMA 1PDVA 3G68A 3QOYA 3H3JA 2O1XA 3IUPA 3NAQA 1JOUB 1TGSZ 1U9YA 4FDMA 3WLNA 2Q45A 2P8JA 1BITA 4G86A 5GXPA 1DKPA 2BVRH 1ZGHA 4HTAA 4OGLA 2IHBA 3DSPA 2O7RA 2XSZD 1KNQA 3BXEA 2HIMA 2I29A 4G0YA 4LX8A 2A5LA 4RMGA 2AEJA 1T4CA 4G01B 1QF9A 2D26C 5I8ZA 3EXFA 4V2IA 1MD8A 2CWDA 3TTVA 2JRCA 3EMBA 1RRKA 4LHEA 3QF7A 1I3NA 4FM9A 2A0XA 3CRRA 3BXZA 5HXFA 1UMBB 2EJBA 5DO9A 1ZS9A 3PTBA 3RVMA 3KL4A 2IGTA 1SFRA 2UZ1B 4MUNA 4P4SB 4PLYA 3THRA 3ZE2B 3NYWA 3R8CA 1T2NA 4XIJA 3D43A 1JEQB 4JLDA 2VF7A 3QI2A 3W9SA 2HCFA 2I55A 2FPPB 3GJ7A 3ITKA 1K1PA 3O7WA 5DYWA 5H0IA 2ZRQA 4D9MA 3EXEA 5FWNA 2M6LA 4OAPA 1K5HA 1FLAA 4KTCA 1HAXB 3Q3XA 1WW2A 6GCHF 3OZVA 1U5AA 3PEVA 3MYYA 1H3FA 4OSOA 4WLUA 5LLSA 5K0FA 2BFCB 1Y5IA 1TF5A 3IVAA 3D6AA 3QYJA 2UYGA 3D49H 1G3IA 2ZREA 4G85A 2F67A 4RJJA 4DLVA 1NI4B 5DNVA 1B4DA 3GLUA 1NOIA 4LCEA 4KR6A 4MKZA 1MBQA 2TGPZ 2X7JA 3EUFA 3GRPA 4D0LB 1B26A 1ORIA 2C07A 4QLBA 3SYMA 1S6FA 1NRSH 1KH3A 2WSBA 4B6PA 4YP9A 1RWNA 1UK3A 2J3DA 4C1BA 1D0SA 1RACA 2Y1DA 4LN1A 4PF1A 5JQGF 5A2GA 1N4AA 1KTVA 1T2AA 4KRFA 2QZ4A 3E22A 3NFYA 1IOVA 4IIJA 1GTRA 1AD8H 4P86A 2AOTB 2GDJA 3AR2A 4LSWA 4R05A 1PNOA 2BD7A 4EEXA 1EFCA 4URYR 3KJEA 4B09A 4D81A 2C2ZA 1VSBA 4WECA 1HG0A 3F74A 4WCDA 4YOJA 2C2XA 3NWUA 3K1JA 5AOCA 4E3WA 1CWUA 1GBEA 1O35A 4IDEA 1SUWA 2YINC 2E4XA 1VCOA 5KTKA 2FLBH 1VRCA 3SF0A 1DITH 3C6XA 3M8KA 3R5FA 5BYKA 2G4LA 3R6GA 1I6KA 4BVHA 1E6WA 2EJUA 1GBJA 3OZWA 3F9EA 1O3JA 1NJ6A 2F1JA 5AKEA 4PYOA 1KSNA 4TQAA 4M4SA 1EM8B 1E1RA 1GZ7A 1KU6A 1N2EA 3IT0A 4GXNA 2IITA 4LKRA 1DPFA 3ICEA 3BTHE 2PMWB 4IHAA 2QLTA 1RHJA 1QQBA 3PVCA 1TCCA 1Y1LA 4G37A 4XGNA 1E0JA 2Q3HA 1XLTC 4H7EA 5A04A 1H8EA 2PSEA 1ZRBA 1JG3A 1VG1A 4WHMA 1G3RA 4COKA 2GV7A 3B3AA 3BS4A 1F1JA 2FWIA 3DAGA 2HT6A 4KBFA 3NONA 5LC1A 1JE1A 3GP3A 4C20A 1HK7A 4L9WA 2VP2A 2O8UA 2CB9A 3N8GA 4R2MA 2V6JA 3TD2A 2GXSA 3K70B 1AI8H 1ECFA 2X0RA 3NWEA 4XJSA 1NXXA 5K3BA 3RK1A 2VQFB 4HH4A 4CM6A 2ZSHA 2Q9UA 1AN1E 3LFTA 2J46A 1SQRA 2O4CA 3A1DA 1ISGA 3LW7A 1DKRA 2WVJA 3JQGA 3SQLA 4JOSA 4DN6A 3QVMA 4PZEA 5HJ5A 1HOXA 4HEQA 4M76B 2CK3D 1UMCB 1Z75A 1RDFA 4G23A 1GGDC 4XEUA 4BMDA 5TGZA 5HWSA 6ESTA 2ZOSA 1LRLA 3W8NA 2QGFA 1G7CA 1B1CA 2C9BA 4L85A 3DHKH 3C3CA 4YESB 1OFTA 2Z30A 4V0QA 5LMCA 1EP5A 4RIHA 5HYVA 4EDHA 2EEPA 3WK5A 2IDZA 1RTKA 2QVBA 4BAZA 2CHAB 4OGWA 4DY6A 2OHJA 1TGVA 5KQLA 4BRWA 3EA4A 3HS3A 3UNXA 1Y6QA 2FS8A 2QD2A 1EK0A 3ESYA 2ZJ2A 3STUA 4EFKA 4P4NA 4JFAA 1TFRA 5K6TA 4H9GA 3V8EA 3KQHA 1Z45A 1HM5A 4Z5XA 5KINB 5LA6F 4A1FA 2GDDA 2HJGA 5BYAA 1Z38A 1XK6A 2IYUA 4OSPA 3RFTA 5LZ5A 1QTNA 1K7XB 3A28A 3RSGA 2KI5A 3W95A 1VKJA 2NU6B 3VGCC 2C8JA 1WKVA 1K6IA 4QTZA 5KWEA 3BF7A 3KX2A 2XOKA 1HAHH 1OVMA 1E9AA 1Q7RA 2VVVA 1CF2O 2XMQA 4F49A 3IKVA 4GMHA 4L9AA 1ZRKA 2W4IA 3TEJA 3NDPA 3VH1A 4RTLA 5IFKA 2QR3A 4PLPA 3AZQA 1W1WA 3GB9A 1U0EA 4O4LF 4GDMA 4C6TA 4UMFA 3TJOA 4IJ6A 3PGMA 1WCIB 4CL3A 1EUFA 1XEXA 3HCAA 2AG1A 1E37B 2NO5A 2XCFA 1Q1NA 3KSZO 1FP2A 5DM60 3RXEA 4DLTA 4YDHB 4KO8A 1L7PA 3LYLA 4MDFA 4CTNA 3GGOA 1J17T 1F17A 4Y7CA 4Z99A 2LD4A 3PT5A 4FU9A 1RJFA 3G2IA 1Q77A 5AVKA 4UEQA 1YBHA 1E35B 4JLMA 1HTBA 2RGXA 3OZBA 2ERYA 3I9MA 2BXTH 3U9SA 3CRNA 1HORA 2AD1A 3T7AA 1K7CA 1JR3D 3MINB 4B71A 2A30A 4EBFA 5IJZA 1CDZA 4UUPA 2QAGC 3UCEA 1K8ZB 4QQFA 5CT5A 3UC5A 3WKDA 4EY5A 1I4OA 2OT3B 1ORHA 3MJ4A 1NIJA 2M6RA 5ECYA 2XTTB 1WHTB 5AFYH 4ON9A 4PSDA 3ZWYA 5JH7A 2O2ZA 5GPIB 1TL7C 2ECOA 4I1RA 4ZVNA 1JA0A 2IXTA 1NR1A 3JAMA 1YRQA 2O5CA 2HSWA 1Q14A 2J9FB 1N8OB 5IZCC 1SGIB 1S89A 4LHZA 2I80A 2V03A 3EQ7A 1J8QA 3L3TA 4QGAA 1YA6A 3IIMA 2Z04A 1FDTA 2C57A 4S0ZA 1UTNA 1AO0A 1KC3A 4G8CA 1XN4A 4QYXA 2IOTA 1DRWA 1DAMA 3D5QA 3OOWA 5K2OA 2YKGA 1G30B 3ZYEA 1KI6A 2YV1A 3E22B 3IVGA 4IIJB 3DNMA 1V6AA 4MCIA 1HDCA 5D51S 4QOHA 1L5OA 2BH9A 4QRIA 3VXEH 5TJXA 3LY5A 4NJOA 1X77A 4F0JA 4DYHA 3TRJA 1C5YB 2AR7A 1NWCA 3MTBA 4MVJF 4MIEA 4Q4JA 4TQUS 3U48A 3ANSA 2R8XA 2V6MA 3AY0A 4RPGA 3RXCA 3FNGA 4EATA 1FJ2A 3BVPA 4H4EA 3WYFA 2AQHA 1KTSB 1NI4A 1OA1A 4GOLD 3GP8A 1AGRA 3OIWA 3IAM1 4AZ3B 4E2WA 2JFNA 2SGFE 4BE4A 1VE6A 2KHZA 2RGBA 3WQRA 1Y3HA 2EP8A 3RS3A 4G0PA 2EF1A 4GQBA 3NHRA 1XL0A 4PTLA 1QGOA 2XRMA 4JI4B 2FYRA 1FTNA 3EWNA 4PZ9A 4G8BA 3CG4A 2ZULA 4O2RA 2VRCD 1GU0A 2J3EA 2JGKA 1OXGA 3GMDA 1EVIA 5FPPA 3M37A 5G1NA 3OZAA 2OK8A 4IVQA 2WQ7A 1HA3A 4GM0A 4ZN6A 1JHUA 5IW8A 3Q3YA 4XQ9A 3G7NA 4P8RA 1QC5A 4Z49A 1UZNA 2PUCA 2YWBA 3PUVA 1K21H 1CS4C 3R24A 2QDKA 3H2HA 3KNZA 3MU4A 1Z4LA 1KBOA 2Q27A 4DV3B 1OWKA 1XKAC 1P18A 2G8NA 4DSOA 2A9PA 3REQB 1QIEA 3MWYW 3IE0A 5LYJB 2LELA 3M4ZA 1ZCFA 2J41A 3W9YA 1I2DA 4E5MA 1C5QA 1Q0SA 1L4MA 1I1QB 3MMSA 4ZGGA 3KB6A 2OHIA 4US2R 1EVQA 4EHJA 5K6AC 1QGZA 1XF9A 1XDZA 2Q62A 2CVPA 3C85A 2BMVA 2GCPA 1TMTH 4P36A 2GZ7A 1A04A 3R0QA 1VE3A 2UUFB 4RPKA 3DC7A 1E2GA 5FPQA 3PGLA 3KWLA 3F4KA 3BDIA 3H5RA 4N0DA 1LTQA 5EHGA 1L4KA 1OU0A 3N6RA 1O97C 2QN3A 3EDOA 3SHTA 4L4XA 4NYMR 4WW0A 5AKLA 2CJYA 1FS5A 1YQDA 3IQWA 4ZV7A 5B58T 3LKWA 1J6UA 1HJ9A 2IP2A 4IIVA 1R9NA 1T8UA 2IC5A 2ZIEA 4QT0A 4CMAA 4URXR 3WGIA 2ZTXA 4GI3A 1UZAA 3SZMA 4FWIB 4R9RA 1THRH 1C1XB 4K9SA 3ETEA 4RE6A 3DBHB 5CHYA 1U3VA 2HN9A 1F0UA 2PNFA 3GJQA 1KZ4A 1XJQA 4WIAA 4URVR 2PR2A 1IUOA 3HYTA 3BDAA 2VF5X 3KHVA 1F1BA 1WUYA 1XZLA 4DILA 2Q6FA 1XTQA 2OE2A 1BXRB 1A1SA 1TO1E 4FDAA 4F4OC 1GITA 4NDZA 4B7XA 3GDHA 1O39A 4M1MA 2VVUA 2WUWE 1GU1A 2GJ8A 1WBGB 2QY0B 3UAVA 1XDUA 1ZBQA 3CZQA 1NXQA 4J1SA 1TAGA 4WTOA 2A0WA 1K7YA 1RABA 3RDPA 3IT3A 2X40A 5BMVA 3IKLA 2IY7A 4CH8B 4FYVA 4KSCA 4RSGA 4YP6A 1ISJA 2AG0A 1GBTA 3JR3A 4MMXB 4W5WA 1WVMA 5DGDA 5F9MA 3W79A 3CXUA 3WSWA 1W0YH 2FI5E 4NSVA 1HUTH 2FWAA 4H3SA 4F84A 2OXTA 4K26A 2GK3A 2D5CA 3EFOA 1TRKA 3VMMA 3HSYA 2WPDA 3RTDA 4CMBA 5LP6C 4EW6A 4HNSA 3OLCX 1GLGA 4I6EA 4LHSA 4XIIA 1R9GA 4GIBA 5KYVA 5IFLA 2XZOA 1FW6A 2ORVA 2NAFA 1U1DA 2NVOA 3AIOA 4BMNA 2VS1A 2CFRA 4F71A 5GONB 3W5CA 2Y6TA 1HURA 4LXUA 4F3CA 4EA9A 1GPUA 1YS2X 2O8WA 1NSFA 1GBDA 2Y4OA 3OTWA 4XGKA 1PD1A 3S5JA 5BSKA 2ZE5A 1Y8QA 1Y5NA 3L6DA 4ZVMA 5KDOA 1JLRA 1L7RA 3CVOA 1KAOA 1MJFA 4AZ3A 5EWLA 1OGYA 2XQFA 1Z08A 4WN9A 3IDAA 5CLLA 4DIBA 4ZKSU 3QPUA 3FTNA 1N5OX 3L2OB 2B6HA 4L3OA 3WA7A 3L7OA 4V24A 2WV7A 3B51X 3PNVA 4CCYB 3K7EA 4I8LA 3FCXA 1EFDN 1SH7A 3QUSA 4J8PA 4ZEOA 1YSCA 1E9BA 2J97A 2EJTA 2HCRA 2WWTA 4GLJA 1OWPA 1XTKA 2J98B 4JP3A 1GPYA 1JTVA 1U3WA 4KUGA 5KMGA 1UBHS 2F8LA 3CTMA 3FI9A 2VRCA