4B6FA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 196
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6fA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA02
1GSIA 3NG1A 2W6JA 5L3QB 2AWOA 3TBKA 2IEZA 1X6VA 2KI5A 3QSYA 3NBYC 4DCVA 4F4CA 1QF9A 1T0JB 2B7BA 3NEJA 2FMXA 3A37A 3MJRA 4QNMA 3VR1A 2JLYA 3BH0A 2NPFA 3MFYA 1ZU4A 3VX3A 3ICEA 4PQFA 3SEAA 1ZNZA 4R71A 2ZS7A 2XCFA 121PA 5G53C 4DLXA 1DPFA 3PEVA 2RGCA 4EQ6B 3RAPR 3W6NA 2JLVA 4OM9A 3V9PA 3TUJC 2QGNA 1DY8A 1XEWY 4LDJA 2FU5C 2JLXA 2NO7A 3BH7A 1RW4A 1SXJA 2CEAA 4OQXA 2QU8A 5JECA 3A1WA 3WBKA 1J7KA 2GA8A 4HZUB 1RTLA 1W7AA 2F6RA 3IIMA 4CT4B 4AC9A 4NHOA 2K1QA 3RC5A 5LB4A 3ZZTA 2GHIA 3P20A 5ELXA 2VP4A 2QA5A 1SVMA 1F48A 2JLQA 4K8OA 1XWIA 1D9ZA 2OBQA 1DXPA 3C41J 4NCJA 3KUCA 2GXSA 2XITA 5DGXA 4CEJA 4TYWA 2VF7A 2NMVA 3SV8A 1YZNA 3VR2A 4Q18A 1W2HA 4DLWA 4LSGA 3TAUA 3MRSA 2W83A 4U01A 4NMMA 1Q0UA 4A1VA 4MYTA 2IYRA 4YDHB 3U3KA 2JJ1D 1GVNB 3I3SR 4LGMA 4LPKA 3IHLA 1GAJA 2ZUBA 2J0UB 4YC7A 5EQTA 3WY9A 3QKUA 4NP6A 3IBGA 4TQAA 2GCOA 2R6DA 3UANA 1XB2A 3W8NA 1KI2A 2F1HA 2H57A 2K5UA 1KY2A 3H1TA 3UXMA 5EPYA 1KY3A 2NIPA 1KGDA 1Y3AA 2YWEA 3KKQA 1IXSB 3PVSA 4LJAA 1G4AE 3TW4A 3SU2A 1P61B 1RZ3A 2WJIA 2OBOA 4A15A 3FYHA 3U7FB 3CF2A 4MRVA 4Q1CA 5FI0B 3SE0A 3THOA 3I32A 5AJXA 2VA8A 2GXAA 2WSSA 3QQ5A 3ZS8A 5F9FA 3VKWA 4CEHB 2ZTSA 4XTCS 1TF5A 5CDFA 1GNPA 1CTQA 3ICQB 3X1YA 2J0QA 2W00A 2WJJA 3AM1A 2IK8A 3KTAA 4XWAA 2XSZA 1CP2A 5FTKA 1N5JA 2BVNA 3W34A 2FN4A 3T61A 5BN5A 2QI9C 5DO9A 2YOHA 3T15A 1NBMD 2DWOA 2XZLA 2IXEA 2EFCB 1DS6A 4OI1A 4A2PA 4D4JA 2OAP1 4E07A 5FBRB 3LBIA 3KEEA 4PC2A 5JWRA 1Q3TA 1E79D 4WAUA 1CS4C 3IEUA 4XTRA 3WYAA 221PA 2ODBA 4J0QA 1KZGB 2QAJA 4KJZA 3SJCA 1EWQA 2OV2A 1P2VA 2IA5A 4GP7A 4XIGS 4A0GA 3SU8A 4NZYA 1Q57A 4DSOA 1IN7A 4TTRA 1UEJA 2QROA 5GJCA 1Z0FA 4Q4JA 2WV9A 1A5TA 4QL3A 1Z0IA 2BMFA 1WQ1R 4FINA 2P3SA 3LQQA 2G1JA 2ZVQX 3IDQA 4ZI2A 3ZIAA 1IY0A 3ADBA 5LDDC 1E98A 3AGPA 4KSCA 3DEFA 4US0R 1PZNA 2GEUA 2DWQA 3K0CA 4QC2A 3LONA 4QBIA 3ASZA 2GXUA 1OV4A 2QQEA 1M7HA 5HKKA 2AD1A 4DCSA 1U8ZA 1U90A 5G41A 5EUMA 4DRZA 5HE8A 2GILA 3LH5A 4AKIA 1L2TA 1MABB 1T6NA 4Q00A 4P3YA 1MH1A 1E3MA 2PEZA 4EFLA 4TLAA 2ATXA 1ZW6A 4C0JA 1Z07A 5CM9C 3B78A 3CZPA 1G3UA 2D74A 1OHHA 1LVGA 1E0AA 4PAOA 3ZD7A 4AG5A 2ZRIA 3QXJA 5GJ4B 1HUQA 3QPVA 1BMFA 4PPGA 2YJTD 3CPHA 4GSYA 2GEVA 1QG2A 2NO0A 5FI1B 1I4DD 1AIPA 2VF8A 2YWGA 1KNQA 2F1RA 3CRQA 3DHWC 4KTCA 3RYTC 1VPLA 1F5NA 3AKDA 4V03A 3LFUA 3QIAA 4IOMA 5EZ6B 3Q5DA 5IRCD 5AUQA 1BS1A 1KAOA 1C9KA 3H84A 3AVWA 3LOXA 5JJIA 2A5FA 1HE8B 4HAZA 4KV9A 2ZRNA 3A1TA 4P4TA 4ZKEA 1GM5A 4LV5B 1AK2A 1Z29A 2V55B 1S4QA 2I3BA 4GNKA 4EPRA 2WOJA 3NHBA 3OIVA 1GRNA 2CK3A 2IBMA 1Z8FA 3DM5A 2XZPA 5EE9A 3QXHA 2RH5A 4BFTA 2AKAB 3WNBA 1BKDR 4FIDA 4DDUA 2O8EA 2O0HA 1GZSA 1N6HA 1FW6A 2P65A 3WHLA 4JZKA 4D81A 3K8YA 4AKGA 3DVLA 3QUSA 1I2DA 2JLWA 4E03A 4NPHA 3RS5A 3MD0A 4ZCMA 4KYUA 4A8JB 1JI0A 4OQNA 2HYIC 1J90A 1ZUIA 1XZPA 2WWFA 1G3IA 3RS3A 2OFWA 3GPLA 3SHFA 1XMVA 2DHRA 4EPWA 1QVAA 2ZRDA 1NN1A 2AK3A 2BIFA 4TWZA 5EUQB 1WXQA 4AYTA 1AGRA 2ODWA 3RS7A 4D0LB 3DOFA 1JECA 1IN8A 3BS4A 5C2JB 5KPDA 1Z3IX 1ZCBA 1Z6TA 1M6NA 3MUFA 3QENA 3LX8A 1O87A 4OK6A 4RZUA 2WHXA 2J7KA 1KI4A 4MRNA 5CLLA 3QF4B 1E79A 4K81B 1UJ2A 3AQ4A 2YV5A 2HUPA 4GZLA 3HDTA 4PX9A 4YONB 5E7IA 2P2LA 2HEIA 3TSOA 5KSPA 3P8OA 4G3XA 4M1MA 2WWXA 4BFXA 4DEYA 4BEJA 4LJ4A 5B6LA 3EWAA 3SJZA 4TQ9A 4NYJQ 4HZUA 3MSXA 2DBYA 1T0HB 2F7SA 3VR5A 1ANKA 3IIKA 3AP2A 3CONA 3AKYA 1E32A 3D31A 2D2EA 4XH9B 3PUZA 2OEPA 3EAQA 4QOSA 1KI8A 3IUYA 4B2PA 1U0JA 3K0AB 4ARZB 2D4HA 3V00A 2QUZA 3LNCA 4Q1BA 5K8TA 1G20E 1ZNWA 3QKSA 1S2MA 1CLUA 2R6AA 1N2CE 1JEEA 1N0VC 3IILA 4DLTA 4US1R 2CDNA 2ZE7A 2OC8A 2ZU0C 3W9YA 2OBLA 1HURA 3NIBA 4F4IA 4M9ZA 1TPZA 4BFYA 3M6AA 5TVKA 1ZM9A 3K9LA 1F2UB 1VCNA 1GOTA 2XX3A 3LXRA 1ZCAA 3EIEA 3J81k 3HP1A 3L0PA 4IOKA 4A6PA 2EU8A 1DADA 4BRUA 1YZQA 1G3RA 1TMKA 2GVFA 1K5DA 1SQ5A 4IDHA 2I1QA 4JLJA 4QRHA 2BBOA 1QHSA 5KHOC 1K6MA 3AVTA 3FPAA 4WOPA 3GD7A 2R6FA 4BECA 2ZJYA 4V0KA 5LB2A 3UKDA 3GLIA 5P21A 3W6PA 3ZGXA 2QT0A 3D8BA 3SU4A 2JJ8A 3KZ1E 3B1WA 1TEVA 4IVPA 2FF7A 3U6BA 3SUGA 4Y0VA 3PV0A 4HAWA 4IHQA 5TB5A 3ZVNA 3B1VA 2IUSA 1E2LA 1L8QA 3PIRA 3QY0A 2OILA 4XSGA 1E9FA 1VIYA 4I32A 3L0SA 2PZEA 3U4QB 1M8PA 2J0SA 1HH4A 5H1YA 1OW3B 2IS6A 4RKFA 5E3HA 5J4VA 4ZDJA 1E0KA 2VYFA 2Z5FA 2ZRAA 5JWHA 1CULC 3JZMA 4MA4A 4TMVA 4TN1A 4FCVA 4BLTA 3C15C 2GJ8A 2OCYC 3GEIA 3SDZA 1XD8A 2Q6TA 3K0CC 4KU4A 4I81A 5J4HA 5JLJA 3U5ZB 4UJ5A 2YOGA 2YKGA 3THXA 4TYYA 1JNYA 3P26A 5TARA 3WNCA 4TSFD 4FCWA 1P2TA 3TR5A 3BGWA 5KNDA 2WVJA 4NCHA 1F2TB 5CJ2A 5KYKA 4GP6A 1E2JA 1DOAA 1TU4A 3M5MA 4B3FX 3FMPB 3DMDA 1NVVR 2DFTA 5HZKA 4JLPA 5K8UA 3AF4A 3MLEA 3BORA 1UBEA 2XAUA 2J9RA 2ZRKA 3QVVA 4KI0A 1SXJE 4GBMA 4DJTA 5C46F 3SYJA 1FUKA 1MABA 2RHDA 5JEEA 4RY2A 3TK1A 5GVSA 1N6KA 5HPYB 1IJFA 1WF3A 1IXZA 5TY0A 5IDKA 2VIIA 2GK7A 1MV5A 4GPTA 3IGFA 2WKRA 4M2LA 3M5NA 1FMJA 3B6EA 4XWKA 1XPRA 3T1QA 4C0LA 1UKZA 1LTQA 3SV9A 1A1RA 1XXHB 2O5VA 2RGNA 3SYNA 5B30A 4MRSA 3TVDA 2XJ4A 3W5IA 5IK2D 3B60A 3UATA 2ASEA 1DAKA 3CB4A 3K09A 4DT1A 1E2EA 4A82A 5FTLA 4ACBA 1U0HC 1W4RA 2F9UA 1OKKD 1CJVC 4UJ3A 2JATA 2QM7A 4PO1A 3GJXC 1OH5A 3FE2A 1J99A 1W4CA 5FBQB 3QJYA 4M0LA 5FTNA 1W36D 5EQQA 4ZDWA 4IOJA 2OCBA 1DAFA 3OIWA 3KL4A 2VSOA 4DHEA 1ZC3A 1YJ5A 1TQ6A 2OZEA 2ZQ5A 3N2IA 4L8GA 1G7TA 3ZQ6A 3NTUA 2GAAA 1EFHA 5AUOB 4TLEA 3LDAA 4KBGA 3FFBA 2C77A 1H8HA 2VL7A 3ND8A 1XMIA 4FMDF 4XD7D 4XOIA 4Q5IA 1CR4A 4DKXA 5LPNA 1Q21A 1U8YA 1F6BA 1JR3D 3KJIA 3MG9A 1FMLA 4FCTA 1E9CA 1CJMA 1X1SA 4ZDIA 4GRAA 1FL9A 3KKPA 4Q02A 4XVUA 1NRJB 1CJTC 2CLSA 5CDFE 3VFDA 2BKUA 3V4RA 3RRYA 4A8JA 2REXB 2QENA 2ZI5A 3QXSA 2JLUA 2OC7A 2IS1A 4DCUA 5FPSA 2IUTA 4X8LA 5DSZA 1NN5A 3PEWA 1CJKC 4JSTA 4BE7B 1VECA 1OE0A 2IHBA 2X2EA 2KE5A 4BLSA 4TYDA 2PMKA 4HUQA 1T3HA 2OT3B 4I31A 4Q9HA 5CK4A 1DE0A 1XFAA 1FNNA 3IQXA 3T5DA 1WXRA 1JXOA 1KYIA 1T3SA 4A0FA 5KUTA 4DSUA 1COWD 1P6XA 2QSYA 2Q3HA 2QL6A 1RPZA 3T12A 2PJRA 3AVVA 2PMDA 2PLRA 4IW3B 4Q19A 4IXNA 1W0KA 1FPMA 3DDCA 4P33A 4NCKA 1QHHA 2FFQA 1R4AA 3B1XA 2F3TA 3GLGE 2N46A 3RSLA 5D3MB 4II7A 4N1AA 4NTZA 5JWOA 4JYBA 3THWB 1OT3A 5DISB 1OB5A 3AEZA 4D0NA 1KI3A 4ESHA 4ZCLA 2ZYWX 3KN2A 1IJEA 4TSFA 4Q7MB 4AYWA 3EYDA 1G8GA 4DB2A 4F38A 1VKJA 2WPDA 1N6RA 6Q21A 3CR8A 3GJ0A 4PC3A 5HCIA 4A1FA 2IJOB 2DR3A 5IDVA 5CB8A 1EX6A 2C95A 2L0XA 4TT3D 3K0AA 3I62A 5HE9A 2GVDC 4Z1MD 4GOJA 4FXPA 4M1TA 4RKEA 4M21A 4Q03A 3SN6A 1CF4A 3UG7A 2W6JD 4JL6A 4HDCA 1D2NA 3EC2A 2VRWA 3NH6A 1NLYA 1Z2CA 1R0XA 2G88A 4AWXA 2Z0MA 2ZSBA 1Z28A 1DELA 3E5HA 4QJ3A 4C0BA 1GFIA 1QG4A 3QBTA 2O8MA 1GNRA 4LYAA 4Q1AA 3FMIA 4QHYA 3ZZ0A 4G5SA 5KSOA 3FHTA 3SYLA 2FFHA 3U44B 3IIJA 3TSWA 3ZJYA 4G5RA 3RANA 1YHNA 4Q48A 3A1VA 1M7GA 3Q7QA 4JLVA 5BWMA 4M1OA 2IT1A 3X1WA 2Q9BA 4TMXA 1UKVY 1P75A 1OKKA 2ZR9A 2W2VA 1YZKA 2GGVB 4HLCA 2ZE6A 2YOLA 1U9IC 4UXJA 1PUIA 1I4LD 1R5OA 2VTKA 2ZYTX 2ZRMA 1PV4A 4W9MC 1KK3A 3B85A 1XJ0A 2Q9AA 3IPXA 3CH4B 4P4SA 2ATVA 3VHXA 4ERNA 1DAHA 4MITA 3SUDA 1YZGA 2I1VB 1R5BA 1D9XA 1T4GA 4EFMA 1J8MF 4IKEA 3GLFA 1WCV1 1XTRA 2YOFA 4PSAA 1MO4A 4B3CA 2ORIA 1G7CA 3BE4A 3IO3A 2B7CA 4HUTA 1E9AA 4TZ6A 2J87A 5L3SA 3VKHA 1UM8A 5EZ5A 5H4IB 4Q7KA 1NP6A 3QXXA 3CLVA 4PZZA 2H7VA 3WRYC 4MQBA 4JLAA 2DFLA 3A1UA 3SR0A 3U4QA 1JR3A 2ZRLA 1KK2A 1ZC4A 2WMNB 4TL6A 4EIWA 2QMUA 3R9WA 2UZ3A 1HY3A 1OIXA 5DN6A 4QHTA 4XJXA 5H70A 4PANA 1WBDA 1OPXA 4AKHA 4YQFA 5CM8B 2R65A 4M9FA 4LYJA 4EJSB 2BM1A 5CK5A 5DYGA 4G5OA 4AKEA 5JFGA 3AVQA 2G77B 1OB2A 3VMFA 2C8VA 1NBME 2IHYA 3AF1A 1NY6A 4BEBA 4ZDKA 1JEDA 2FA9A 2WAXA 2ZROA 4AI6A 1TF7A 2REBA 3A4LA 3TQCA 2XXAB 4TZ0A 3CRW1 2WSSD 1ZUNB 1F2TA 4FMBB 1JR6A 1PLKA 2V1XA 2B21A 3TNFA 1WB9A 1Z63A 3PENA 3O8BA 2WWHA 4PTLA 2R2AA 4LHXA 1YZLA 2XSZD 1VCOA 1E96A 1R0ZA 3EARA 5FOVA 4Q7LA 5DH9A 1ZM2A 4IEEA 3SUFA 2GZAA 2ZSEA 2A5GA 4OJKA 4JMPA 2RGNC 1E2GA 3B82A 3SU1A 3QF7A 1MR3F 2WJVA 5FOWA 1JPNA 4KBFA 1Z06A 2J0VA 1FP6A 4ASUA 5AWFC 2A2ZA 1DAMA 3W3ZB 3SU3A 5EJEA 4URUR 1AGPA 3C16C 5SZHB 4C30A 2CMKA 2Z83A 1ODFA 3SJAA 1VMAA 4HSEA 1HV8A 3KQKA 1XXHA 3VQTA 1AN0A 2KWIA 4OI4A 1S8FA 3DMNA 1KTVA 2ZREA 3OZXA 4F91B 3AH8A 2ZITA 2KJQA 4LI0A 4GOXA 2P5SA 1XX6A 1BIFA 2YHSA 3VNUA 3ZIAD 1IY1A 4LHVA 4URYR 4NU0A 5DHFA 2F55A 4P4UA 4JLMA 2ZSAA 1S3GA 5IF9A 4OYHA 4PQYA 1Z0JA 2IYQA 1WE2A 4JL5A 5HKKD 1Q1QA 4JT4A 4UNQA 2F3RA 5E7JA 4AG6A 4PPQA 5JSZB 4IDPA 1P2SA 1IAQA 1JQJC 1U2RA 1AS3A 1VIAA 3FDIA 3LLMA 4NKRA 3Q9LA 1Z6GA 4KVGA 4A8JC 5F3WB 4CVNA 2CJWB 3EASA 2ZU6A 1NN3A 3LVQE 1TX4B 3FKSA 3WXMA 1TUEA 2A5JA 2FEMA 4Z51A 1AS2A 3TMKA 2IX3A 3GQBA 5KNCA 4F4JA 3BAFA 2CHQA 1DTSA 1SHKA 1OHHD 4R2IA 1XP8A 4DWJA 3GLIE 3N2EA 5JJKA 3UIEA 5JHHB 1E2FA 1BMFD 1US8A 2QQ0A 2WKQA 1OXTA 4NYMR 2BDTA 2BMEA 1X86B 2VHTA 4K46A 4KCGA 1W5TA 3B13B 4QBFA 1PVOA 4UXHA 421PA 2H18A 2PT5A 4A6XA 1TQDA 4RJLA 1DEKA 2YZ2A 5TDHA 2ZJ8A 1ZMXA 1F3OA 1G291 3KKOA 4ABYA 1XDBA 1D8TA 1P7CA 4FD2A 4LC0A 3U1JB 4MKGA 4UXIA 1GRQA 1G7RA 1XEXB 1AZSC 3AP1A 4V0OA 1M7BA 3AF0A 3OFNA 5FR2A 3U61B 2IF2A 1I4TD 3ZVRA 1XZQA 1RC8A 4H1VA 1CIPA 2RGDA 5BYKA 2CK3D 4V0NA 1LB1B 4Z54A 4FMDB 3CM0A 2V7QA 3MWYW 1A7JA 1G21E 2GXQA 2XZOA 1XMSA 1TUIA 3U60B 4EPYA 2BEJA 1CXZA 1DBSA 4N3NA 1L7VC 4QNRA 2G9NA 3TH5A 2BEKA 2GAOA 2KB0A 3BERA 4I1SA 2P6UA 3CF0A 4JKIA 4DUGA 2Z4SA 3CW2A 1KDOA 4BFUA 1Z83A 4D6PA 4B44A 1KO5A 3LVRE 1K8RA 3C14C 2PT7A 1KO7A 3Q85A 1LF0A 2FSFA 4OHWA 4RD4A 3TW8B 3HR7A 4LHZA 1KI1A 1KDPA 1KSGA 4PC1A 4WIAA 3FMOB 2HCBA 3E1SA 3JVVA 1EWRA 3BWDD 3RDPA 1N5KA 5K8IA 1OSNA 3OE7A 1OLOA 1Z0DA 4QGAA 5E4FA 2R62A 4NH0A 4QGHA 1GG2A 4LBVA 5DYIA 4JBXA 5JI3E 4XVRA 1KI7A 4FMCF 2IUUA 1IHUA 1VYUA 1JJVA 3U44A 1E9BA 3QVUA 2DPXA 3T1OA 4E22A 4HAVA 3ADDA 4C9BA 3R8CA 3EPKA 5C18A 4OK5A 1Z47A 3F8TA 2RGAA 2QNRA 4M9QA 3I5XA 4LC1A 1LY1A 3SJBA 2ZRCA 4CIDA 2FSGA 1IQPA 1D5CA 5FUYA 4JMYA 1JAIA 1H8EA 4PHGA 3KF2A 1W0JA 2EWWA 3PQCA 4NCIA 3SQWA 4LYFA 1UBCA 2WJGA 3A4NA 3LXXA 2VLIA 4IDNA 4WXRA 4B47A 4E09A 3A4MA 4C7OA 5HCNA 1FQJA 3UPUA 3WRXC 1E9DA 1S3SA 1XCMA 2X8AA 3EPHA 5CIQA 2QAGB 1IM2A 3GJ5A 3VX4A 3EZ6A 5DI3B 1T8UA 5AJVB 4C0SA 5KO2A 3A8TA 8OHMA 1R5NA 2GJAA 1M2OB 1RJ9B 2EFGA 1OYYA 3I92A 2IYVA 3AB3A 4RD6A 3QG1A 2GVZC 2YWHA 1S9HA 2ZANA 3D7MA 2ZI6A 4KFTA 4NYIR 521PA 2QBYA 3K70B 2ZUCA 3I1FA 2D62A 3CPJB 4M4SA 2GJSA 1DAEA 5T1VA 1HTWA 1Q44A 1UFQA 1A1VA 4OI0A 2FGJA 2W0MA 4PSVA 4EJSA 1CBUA 5JS7A 4UNRA 1RYHA 2ODNA 4A4DA 5KTYA 1A4RA 1NLFA 1GDDA 2HXYA 4GDFA 1E2DA 1CRQA 3FHOA 3RWMB 2A5DA 2ZS9A 2VO1A 3F5FA 2XXAA 1NMZA 3NH9A 1G64A 5FBVB 4IOLA 1EX7A 2BC9A 1E69A 2TMKA 2EW1A 2V4ZA 2BCGY 5FOUA 2YINC 4JL8A 3SS8A 4DIEA 2ZAOA 1CEEA 5AJWA 1NG1A 1XCGB 4BFVA 4PHFA 3T34A 1W2GA 2IYTA 2JASA 3GLHE 3QNUA 2OCPA 4LWZA 3LV8A 1Q1ZA 1ZNXA 3DL0A 2HF8A 1E4YA 3K9NA 3NDBB 3W6OA 1G8YA 2C9CA 4MH0R 4KVAA 2P5TB 4D80A 2YC2C 1IN5A 1ZM3A 2G6BA 1W49A 1DO2A 1T91A 4UKDA 3TQFA 1Z22A 5IHPA 2XOKA 2ZRPA 3B9PA 2HDNB 4BFSA 5BYJA 1AKEA 2G0NA 4RD0A 3DOEA 2ZYVX 5FPTA 2RCNA 3EIHA 4IVRA 1W1WA 3EC1A 2VP9A 4OL0A 5L3QA 4ZIRB 5CYOA 3RC6A 4O2LA 5FBWB 1DG1G 3Q7PA 4LCBA 2OAQ1 1GKIA 4Q9LA 1D6JA 1RKBA 4G1UC 3MWJA 4JIMA 3WMFA 1FX0B 4EQ6A 4B2LA 5GADl 1KJYA 1R0YA 4D4LA 2ZE8A 1BO6A 1SGWA 1XNJA 3BH6A 3JZAA 1N0UA 1LW7A 1ONBA 3OIUA 1KI6B 2N42A 3DM9B 4D26A 4HB4A 2XNDD 2FNAA 1KNXA 2IL1A 2P67A 3I73A 3KNXA 3UMFA 3GLFE 1EG7A 2WSMA 2CLDX 4PHHA 3R9IA 1NIPA 1NVVQ 1KK0A 4JVLA 1RRPA 2OINA 2C96A 1NSTA 4QM6A 2UVQA 1KDRA 3A36A 4URWR 3HYTA 1JR3E 2P0EA 3O47A 1W4BA 3LX5A 3BIFA 4BWYA 5G40A 1E2MA 4LJYA 4ZO4A 3E2IA 3EX7C 2QG6A 1B0UA 2J0UA 3FOZA 4JYCA 3QEJA 2AHOA 2Q3MA 5AUPB 4B33A 1VYVA 4EPTA 2CL6X 3RHFA 2FP7B 1KJWA 1LS6A 3KQNA 2DCUA 4M9SA 4Q4LA 3M1IA 2OK5A 4QFMA 3LO5A 5BQ5A 4AK9A 3HJNA 3MWKA 1H8HD 2KSQA 4HEJA 2PEYA 2R9VA 2ZE5A 4I99A 2C04A 1AKYA 1NY5A 5GJWC 2FDCA 3SV6A 1HEIA 2LKDA 4O25A 1KI9A 1PLLA 4DLUA 2B6HA 2H5EA 2V8OA 4PPNA 1L4YA 1NVUQ 1TF2A 4IJMA 2EWVA 2ZSFA 4JVSB 4CEHA 2J41A 1GL6A 1T5IA 1UADA 4JS0A 4Q66C 1QHXA 1P62B 2A3RA 1VHTA 2OBMA 2O0JA 5FFMA 2DY1A 4WBSA 5F2EA 1U9IA 3QKRB 3FVQA 1CU1A 4HLQB 2YNMA 2BBSA 5FOSA 3EXAA 1DARA 4GMXA 4PC7A 2JJ2A 2Z4RA 3P4XA 4LOAA 2XB2A 2V9PA 1HQYE 4RD1A 5CIWA 4A0HA 3VKGA 1W36B 3KFXA 1KDTA 4QGFA 3WMEA 1JXMA 4WF8A 2H8KA 3KQUA 1NVXQ 3TRFA 2GNOA 2J7PA 3KJHA 1W0KD 3CUEF 1V5WA 2V54A 3OEED 1IN6A 4QXAA 5FH9A 4UNSA 4CGZA 5EXPA 2WWWA 4HLUC 3VU9B 4JLDA 2ZI7A 3PCRB 2ZETA 4JJKA 4NL4H 3NKVA 4RVCA 721PA 1MO6A 5EPNA 4WA7A 3UG6A 1LF5A 5DI9A 1DXWA 4W5JA 1OFHA 2VPPA 2BBTA 2WPDD 2VBCA 4PQRA 2RGEA 3TE6A 4URXR 4B74A 2PBRA 4BASA 2AK2A 2JAQA 3NEYA 1Z5ZA 2ZRFA 4M9XA 3M5OA 4GI7A 4GZMA 3GJ4A 3VHLB 3EWSA 2QAGA 2V6JA 1Z0AA 3FHCB 1E9EA 1QBKC 3KQLA 2J59A 4NYJR 4N0EA 4EJSC 2ZRHA 1Q20A 2FOLA 3NDPA 1G9XA 1TADA 3AF3A 3CWQA 2IS2A 4M1YA 1RE0A 4G5GA 3ZD6A 2CLCX 2XNDA 4FMCB 5D3QA 1E2IA 5LD2B 2J45A 4PAMA 4S35A 3QE0A 2WIAA 4DBLC 3QOFA 2G1KA 4WH6A 4Q01A 1X8LA 3P4YA 1P9NA 2AKYA 4AD8A 1I2MA 1OXSC 4QBGB 1YR9A 2WTUA 1LNZA 1NJGA 4B3GA 4R2HA 4B6FA 1YKSA 1KSFX 4HB0A 3ECCA 3HPQA 3AUXA 4I1OA 1P2UA 1RGQA 2O8DB 4HDQB 1WA5A 1Z08A 5J40A 1QRAA 4RCZA 3OEHA 5G3ZA 4C3ZA 5EP4A 3PEYA 4BZPA 3CBQA 2QY9A 3DKPA 4JBWA 3PJRA 4MDEA 2D7DA 2PJZA 4DEXA 1IONA 1HT2E 2J1LA 3R7WB 5M04A 3AVXA 2ORVA 2R6CA 3B8HA 2EYQA 2QMHA 2GBLA 3CPEA 1C4OA 1CR0A 2JCSA 2OE2A 2CCJA 1B23P 1Y63A 2F1IA 4ZCIA 3ND9A 2F43B 2YWFA 2ODEA 1UKYA 2XGJA 3KJGA 1KKLA 4P32A 1VTKA 3ADCA 2O8BB 4Q9KA 4B3DA 3BFXA 3CKLA 2O8CB 4R98A 2BBWA 2IC5A 5DN6D 3DKVA 2VHUA 3GCGA 3T5GA 1GITA 2VP6A 5DLQC 1GNQA 2RGXA 1GL9B 1OXUA 2GETA 3WBJA 5EE5B 2FX3A 2CVFA 3PV5A 3DZ8A 5CJPA 1WP9A 2GEDA 1SXJB 1S9DA 2ZI3A 1NVWQ 3FTQA 2WKPA 3UWKA 3X1ZA 2FJUA 1KJZA 2W6ID 3VR3A 3U3OA 4DLVA 1FOEB 3F0TA 3ETLA 2C9OA 3NBZC 3X2SA 2E1RA 5AR1A 4PSKA 3B1ZA 1OIVA 1VG9B 3SV7A 1YR7A 3GJ7A 4CF7A 1P3JA 5JCZA 1O3YA 2BWJA 1GL7A 3SI7A 2VP5A 2ZPTX 1IBRA 3QF4A 1W3CA 4G01B 4Q47A 1GRRA 4D4KA 2OSBA 3OEEA 3GEEA 3QI2A 3SYKA 3U7HB 4CEJB 3PG5A 5LBIA 1KZ7B 2LCFA 1E2PA 1U98A 4OQFA 2O8FB 3AVOA 5G3YA 3K53A 3SNHA 5JHGB 2FGKA 2B8WA 4ASUD 1KI6A 2D3WA 2Z6VA 4C0KA 4Q1FA 4DC9A 3GFTA 3F3YA 5JRJA 3NBXX 4U02A 1JB1A 3ZLJA 3CNLA 1XMJA 2OC0A 1KK1A 2OXRA 1AJEA 4YMTA 1IN4A 2SHKA 4BPBA 4NE2A 1TEXA 4GMDA 4ARZA 3KJEA 1ETUA 1HYQA 2ZAMA 3D3QA 4TL8A 2HT6A 1P9RA 1KMHB 2Q0HA 3B2EA 4B43A 2C9YA 1TAGA 2JLRA 2QE7A 4LV6A 4EFNA 4XVQA 3SHWA 3TR0A 5J4KA 1R7RA 1IXRC 1JQLB 5DE3A 3LW8A 3TGPA 5FOTA 2ERXA 1E1RD 2Z43A 5CYPA 1ZM4A 2VP2A 4KFSA 1NN0A 4XWOA 1NJFA 5AUNB 3KQHA 4YMUA 3UMSA 2UZIR 2IYWA 3K0SA 2IWRA 3AVPA 3OAAD 1F2UA 3KB2A 4CYMA 4GOKA 4O0MA 2F9VA 1GP2A 2C03A 4MKIA 4POAA 5KDOA 3H4MA 1NS3A 4D25A 4B73A 4KAXA 4DB4A 3L6PA 1OFIA 2NTYC 3FKSD 2QV1A 5A5GA 1J8YF 1DO0A 2FZLA 3A1SA 5A0FA 4JBYA 1XTSA 4ACAA 2AFHE 2GWHA 1EXMA 4LYHA 4QJ4A 4JVNA 2EYUA 4B3XA 4PAQA 4HAXA 1F60A 4PO8A 2BJVA 2V6IA 3WYGA 3GJ6A 1P4SA 5GVRA 3L2OB 3KX2A 3BFKA 1KO8A 3WP1B 1DVRA 2NO6A 3QKRA 2ZI4A 3QG5A 4CEIB 2D06A 3FMFA 3GLGB 3RRNA 4LJ8A 3IBYA 2UKDA 4HZIA 1YZUA 1JBKA 3OFND 4DXAA 1G18A 3I4LA 3NC0C 4DSTA 2JEOA 2JIZA 4D4MA 3R8FA 4A1TA 3L0IB 2MSDB 3OIYA 4ON9A 3BOSA 2BJWA 4DDWA 1KSHA 2V7QD 3M0EA 1EGAA 1OH7A 3ZVLA 1SKYB 4F93B 3FFAA 1XU4A 1KKMA 1SVKA 2D2FA 2IYLD 3VU9A 4MKHA 5J4LA 3QXCA 5FR1A 5KDDA 1ZJ6A 3L8YA 2HJGA 4JLKA 2QTHA 2ERYA 2GKSA 1OIWA 2QAGC 2WOOA 2W6IA 4I1VA 1ZUHA 3X1DA 2NPIA 5FUWA 1E2NA 3B1YA 4DUGD 5K8LA 3BC1A 3EW9A 4Q4HB 2CNWA 5DHAA 5FUXA 5KSYA 2G83A 3SBDA 2C78A 4FWTA 5JS8A 3A6PC 5GNDA 2H1LA 5EE3A 5BXQC 5FL7D 3K70C 4I33A 2GF9A 1KHTA 1N0WA 1N5IA 1OH8A 1GUAA 1AZTA 2EFDB 1GKYA 3JVUA 3OE7D 1JXPA 2YYZA 1MRSA 1QDEA 1XTJA 3GFOA 4A0RA 2NG1A 2GTPA 2FWRA 1SVIA 2ANCA 3GMTA 3M4YA 2GZHA 3VAAA 4CRWB 4U00A 4GL2A 5FPKA 2QM8A 3EA0A 1S96A 4FI3C 2ZEJA 3RS4A 4Q1DA 1S0UA 1Z6YA 2G3YA 2GF0A 2LKCA 3L0OA 4TLCA 4RD2A 1UDXA 4F7WA 2WWGA 1J70A 2FZ4A 1W4AA 1ZU5A 1N6PA 3NC1C 3T1VA 1II8B 1FZQA 1E2HA 4K8BA 4BFZA 4TTPA 3QPWA 1QHGA 2O8DA 4MGIR 2QEQA 4KITB 1H8ED 4G5QA 2GBLC 1W0JD 1QHIA 4OQMA 4EKDA 1G41A 2QRNA 2O0KA 2FG5A 3I72A 2GESA 4UNPA 5FBLB 1E1RA 3U6KA 5E95A 4URVR 4QHSA 4LHYA 1TNDA 4A92A 4LZZA 4M1SA 5EXTA 1CKEA 1JPJA 1A2BA 2CCKA 4KSBA 3CF6R 3EZFA 3SU5A 3OAAA 4V0MA 3B9QA 2YC4C 2FEOA 1TU3A 2PX3A 2PCLA 2FH5B 1R0WA 2H16A 4XSHA 1E99A 4IFEA 5H68A 3AGQA 3R9XA 5AJYA 1R10A 1V43A 2F43A 2WIBA 4LHWA 4BQSA 3C7KA 3U3JA 1KAGA 4L9SA 2O8BA 1UBGA 4MRRA 1C1YA 2PH1A 3WP0A 2O8CA 2WJYA 5FTMA 4LBWA 2CE7A 2CHVA 2FPMA 2ZSDA 2NGRA 3BXZA 1J2JA 1YE8A 3BB1A 4L15A 3P32A 1K5GA 3P8NA 4NBSA 3BJIC 4LJ9A 1U8AA 4Z1MA 2LWIA 2AFIE 3K1JA 4L5BA 1R8QA 2HYDA 4WXPA 4TMTA 2A7QA 3C5CA 3EG5A 3Q8XB 1Q22A 3LAWA 2BMJA 4M53A 5EQSA 1N5LA 2GRJA 2RGGA 2C99A 4NDZA 1ZYUA 1H65A 1N6IA 1YVDA 4EDHA 4TTQA 2AWNA 1WBBA 4C0QC 5ETXA 2GJKA 4NYIQ 2HLDD 1S1CA 5AJZA 4H1UA 4DVGA 4AY2A 3Q3JB 2CXXA 3LWNA 3RS2A 5EP2A 3OESA 2ZUDA 1MO5A 4KYIB 1XCPA 4EAQA 5KU1A 3VNVA 5ESBA 1FFHA 1FP7A 1RVDA 4LJ5A 1W44A 5D3MA 5TV2A 3IEVA 3QKSB 2O8FA 1N6OA 3QKTA 2AR7A 3THWA 2HV8A 1YRBA 4OBEA 2GCNA 1G19A 3EPLA 4RZXA 4M1KA 3NHAA 3WYFA 1XBTA 2A4QA 1CRPA 1X1RA 3CZQA 1AQYA 2C2HA 2KBEA 5SZKB 1FTSA 1A2KC 1NI3A 1UF9A 5JEDA 4DCTA 1KMQA 3I8SA 1VG8A 2QN6A 2WWIA 5C4GB 2XOKD 5AK0A 4M8NE 1NMYA 5J5CA 4KO8A 4U7DA 5FL7A 1G8FA 1KMHA 3REFA 4DDTA 1R2QA 5KNBA 2QMOA 4W5HA 1AA9A 4WZBE 4F92B 2A4GA 1A82A 4OK3A 1SVOA 3HR8A 1FQKA 3NWJA 4JKYA 4OHXA 5B64A 5SZIA 3LD9A 2X2FA 1XJCA 1VYTA 3GLIB 1SVLA 2DB3A 4MGKR 2PLFA 4A2WA 2FFAA 3CX6A 2ZJBA 5L8VA 4PC6A 3ZH9B 3TLXA 2IJD1 1CJUC 2PZGA 2RKOA 4BZXA 5KSZA 3S1AB 3IHWA 4IRUB 4JT2A 4X8OA 1ZD9A 2ECKA 1N1LA 2QP9X 4HLUA 1UAAA 2JDIA 4CZ2A 2HJVA 1XTIA 1X3SA 2Q3FA 1G16A 4KLNA 5DIFA 2ZM5A 5J47A 3V4FA 3QEOA 5C1BA 1Z2AA 1RIFA 2CBZA 2QSZA 3X1XA 1W36C 5JCPA 4UQOA 4LJ7A 5FUVA 2AL7A 1RYFA 3ADKA 2QZ4A 4CEIA 3GLGA 1D2EA 4LPSA 2R44A 2AXNA 3THXB 4ZI3A 2OM2A 5CITA 4MRPA 1RRCA 3AK5A 4Q9IA 5HTKA 1TTTA 2BCJQ 1MO3A 3CRVA 5EE0A 4YMVA 2A78A 5B2ZA 5EP1A 2P6RA 2ZR7A 2QPOA 1U94A 4L4UA 2GJ9A 2VSXA 3ZQJA 4AURA 1LFDB 3KFVA 3KXIA 1EK0A 3RC4A 2QT1A 4PO9A 5EXSA 1G8PA 4NWLA 1E9SA 5HZHA 3ONWA 3O8CA 1XTKA 1VHLA 4EPXA 2JLZA 2GK6A 2Q9CA 3THYB 3G0HA 3L8ZA 3FWYA 4TYPA 4BRWA 4BUJA 4FW9A 3I8XA 3T1TA 4Q4HA 3U7EB 4R9UC 1R6BX 4B32A 3H09A 5H8WA 1BYUA 1E1QD 3CNOA 2HLDA 3A58B 4C4PA 1QZXA 1ZIPA 2ZRJA 3GFPA 5LD2C 2BMDA 4RFVA 4HATA 1ZNYA 2H17A 1ZM7A 3AUYA 4OJQA 2W0SA 4JSYA 4DT1B 2ZJ2A 2Q21A 3CIOA 3AP3A 4PR0A 2JGNA 3UWOA 4CT5A 4V02A 2XTNA 3RLFA 1P73A 2JJ2D 4QJ5A 1E9RA 4B3BA 5KPJA 2P59A 3RC3A 4NONA 3SZEA 1NKTA 2WWYA 2JJ1A 3CWZA 3QPUA 4QBHA 1JALA 2DFKB 2QPAA 1WDTA 3BFVA 3TUIC 4TLDA 4BLOA 1GIAA 1XF9A 4C0AC 3PR1A 1AQUA 2J7PD 4PHTA 4O2RA 1YU9A 4M1WA 2XNIA 5EQRA 1N6NA 4P31A 4OHZA 4MDFA 3AVYA 1G4UR 2NZ8A 4RCYA 3IO5A 1W5SA 5FL3A 4ITRC 1II8A 3RC8A 1E6CA 1II0A 2A5YB 4DLSA 3AV0B 1N6LA 3LLUA 4OHVA 3ZVMA 4WVFA 2JLSA 4ESVA 5F9HA 4HAUA 3TIFA 2X77A 2F1JA 1ELOA 4YMSA 5KOYA 1G5TA 2HT1A 4RFSB 3G82C 3L43A 5JZVA 4MYHA 3SOPA 5JJLA 2XCNA 2VQSA 1U99A 3CX7A 1KOFA 3SQXA 1NKSA 4D2IA 2NO9A 2QP3A 4KFRA 4KODA 2BM0A 2VHQA 4BLPA 4L9WA 4S2EA 1SZPA 5JSZA 2IS4A 2QTVB 1II9A 2IXGA 1DAGA 1ZVQA 4OI2A 2FOMB 2FV8A 1DG3A 4IDQA 3KUDA 4HUQB 4A9AA 4IDOA 2CJWA 1ESNA 5EXXA 4A1XA 4C2TA 2B8TA 1W47A 1XEWX 4DCNA 1NBMA 3MWLA 3PUYA 1IY2A 2W2TA 3K70D 1SXJC 3H86A 1U81A 2RMKA 4TMKA 2VP0A 3I5YA 4LV8B 3PUVA 2FSHA 2GCPA 3CH5A 3U2QA 1SULA 3ZS9A 1VCIA 1D2MA 1VCMA 1QHHB 4D82A 1CR1A 1GILA 1U0LA 2HF9A 4LJ6A 4BLRA 2R6GA 1UKEA 2IEYA 4Y0AA 3N5CA 2QGZA 3OEHD 4IFBA 1G5RA 1FNMA 1R8SA 3GLHB 1XEXA 1P5ZB 4R7ZA 1E0JA 4JLBA 2REOA 3BD9A 1Z6XA 3BRWD 2NZJA 3PEUA 3HU3A 2XNSA 4QGGA 3NVAA 2CE2X 3B7GA 3KDSE 5KDLA 3KXKA 1G8HA 5L3RA 5GJVC 1E4VA 621PA 4YMWA 1OJLA 1UEIA 1ESMA 4Q9JA 3SZRA 3SFZA 2WM9B 3P27A 3RVBA 2A30A 2FSIA 2IYUA 5JMTA 2IYYA 2RB4A 4TL7A 3HU1A 1E94E 5E7MA 4KLZA 4MGYR 4A2QA 2PL3A 3H2YA 3HPRA 821PA 1HT1E 2C5LA 3LQRA 2W58A 1E1QA 1KSJA 1GTVA 2ZR0A 4BLQA 4EUNA 3FKQA 2AN9A 3CRMA 3HU2A 4HYYA 2OFOA 3K0EA 2IYSA 4Q4AB 3PUWA 3ZDQA 1YRAA 4RZ2A 1W48A 2WMOB 4Z8YA 1Z0KA 4H9GA 1QHNA 4Q7JB 1OYWA 1Q1BA 1LS1A 3GJ3A 1G1MA 3AKEA 3PITA 5EP3A 5TMPA 3M5LA 4HB3A 3AF2A 3RNLA 2OFXA 4WH8A 2KBFA 1XXHE 4P4SB 1XD2B 3TUZC 2ZJOA 1MRNA 3GLFB 1E0SA 2C98A 1XPUA 4MYUA 4ILEA 2N1BA 3TKLA 1SKQA 5L3SB 4DZZA 3K0FB 3T06B 2OC1A 3G5UA 3S1AA 3DZDA 1VG1A 5L3VA 1QHYA 4BFWA 3ASYA 4KXFB 3IPYA 4DSNA 3B5JA 1SVSA 4LBZA 4CW7A 3KB1A 1MT0A 5UKDA 4PPFA 4TYNA 4NCNA 4V0ME 4A36A 1EFRD 2QPTA 2WAYA 4LUCA 4UNNA 2NO1A 3O8RA 2D7CA 2J5XA 2QORA 4TLBA 2XTZA 2AXPA 1P72A 2QE7D 5J4YA 5DI3A 2GDJA 5F98A 4B75A 4MUAA 3SC3A 4YLGA 4QKQA 4X8MA 4YXWD 2CCGA 1EESA 1T8TA 1RJ9A 2OLKA 2OLJA 3TJZA 4TMWA 1SVWA 4B34A 1OXXK 3UK6A 1WRBA 2CVHA 1KO1A 1OF1A 1OFUX 3K9GA 5DNYB 1BT7A 1N3BA 5GPIB 1M1YE 3Q72A 3OYPA 1JAHA 3UMRA 2F9LA 2GZDA 1CR2A 2QP4A 3PXGA 1N25A 1G3QA 1XJQA 3PV2A 5BW8A 1MKYA 2IXFA 4W5WA 3THYA 4BGDA 4O3MA 4EPVA 4AYXA 5FOXA 3W8RA 1XRJA 2ZYUX 2VHJA 3LY5A 3K9HA 4PXAA 2OHFA 3EA5A 4OQLA 4P0TA 4JJZA 4M22A 4B76A 1Q3HA 2QTFA 2VEDA 4WZAE 3SUEA 3SBEA 3AKCA 3P1JA 4L16A 2OESA 2BHRA 1M34E 4V0LA 4B71A 1NMXA 2CL0X 3T35A 3MJHA 2ZJAA 1DAIA 2BV3A 2G0TA 3CNNA 1UBFA 1OXVA 3GP8A 4PZLA 3HWSA 1W46A 1T9HA 4DIDA 2EFHB 3I61A 4G0NA 2JIZD 2WZQA 3W90A 1TQ2A 4MUBA 4JVMA 1BOFA 1BH2A 4R8TB 3LBHA 2J3EA 1HQCA 2ZRGA 3VTKA 3IKJA 2OCAA 2WICA 4RD3A 3DPUA 3H0KA 4OKSA 2CHGA 3OTPA 2JA1A 3OHMA 4ZV4A 4US2R 2BKEA 4ZIRA 5B57C 1LV7A 4DLYA 3CX8A 5TXGA 3WHKA 2PCJA 4KHZA 4X8HA 4RFSA 4I4LA 4B6EA 3MAAC 2RHMA 1FUUA 4DDVA 2CNWD 2A9KA 1M74A 3KXLA 1ZD8A 2F9MA 1EFTA 4E5UA 3EPJA 4C2UA 2FFBA 1ZINA 1US8B 3Q5EA 4TYQA 1FX0A 3MCAA 1UPTA 2FPLA 3PUXA 3LKWA 3U7GA 5BN4A 2ZS8A 4DLRA 4LRWA 2MMGA 3LW7A 3NBFA 1G7SA 1NL3A 4LY6A 4U5XA 1G5PA 2MSCB 1NF3A 4LX0A 3E90B 3GEHA 2V1UA 4B48A 2QMEA 2AD5A 3SFVA 5FPYA 2ORWA 1X8KA 4GFDA 1ZRHA 2GCOB 3HYRA 4QM7A 4GT1A 2RGBA 5IT5A 3D6TB 3O8DA 1EFRA 4TL9A 1JJ7A 2J46A 1NSFA 1RFLA 2BOVA 1PLJA 2I4IA 1XPOA 4PFSA 4Q21A 5FTJA 3VR6A 2ZJZA 1AM4D 4HLDA 2RAPA 1P60A 1TQ4A 4YXWA 3U3MA 4HB2A 3GLHA 2FPKA 3WNDA 2A4RA 1HE1C 2MMCA 4ZPXA 4ZKDA 1Z6AA 4BZQA 2CL7X 2EVWX 2H92A 3GJ8A 3MMPA 4MGZR 2IYZA 1SKYE 3KTAB 3WMGA 4LBYA 2WBLC 3SU6A 2EFEB 1NNEA 3ZZUA 1BYIA 3U3RA 3DO6A 2Y8EA 3NXSA 1QVRA 3C4JA 3TAHA 2EQBA 3L82B 2OO7A 3R20A 2B92A 2ZJ5A 3FB4A 1Q12A 1XD9A 4FN5A 2PZFA 3REGA 5FPHA 1T5LA 1X8JA 3RABA 1WMSA 1YQTA 5JBQA 1S1MA 2IYXA 1NIJA 2X1VA 4Q1EA 5IK2A 2DWPA 1SXJD 4RI0A 1FTNA 2R8RA 1YZTA 2OXCA 1E2KA 4Q4AA 1ZIOA 4Q4JB 2QRZA 2E9SA 1PUJA 3EIQA 2WJHA 4D0GA 1YR6A 1EFCA 2O52A 3TVTA 1G6OA 2VHCA 3BBPA 5SZJA 5A4JA 4RSGA 3QBVA 2XTMA 4RZ3A 1KO4A 3LBNA 4MYCA 3MGCA 1UDWA 1XD2A 2DFNA 1AS0A 4OHYA 3CO5A 4C7OB 4C0HA 2FM2A 1SHZA 2IW3A 1ZAKA 2DYKA 1GWNA 3N70A 4FWIB 4I1UA 4NYMQ 2ONKA 4WZ6A 3RRMA 3FGNA 3RS0A 5HR5A 4QG7A 3K0FA 5B58C 4WW0A 2OUKA 2IF0A 3RRZA 1HA3A 4XD7A 2AX4A 3CRRA 5ANRB 2NOAA 2HCJB 1OFTA 2VH5R 4TQUS 4AIIA 5JI2E 3BB3A 2QBYB 3EZ9A 1OH6A 1KIMA 1EFUA 2X19A 5BN3A 3C8UA 1NG9A 4LK2A 3AVUA 4IVQA 2OG2A 4TMZA 5JRZA 3RWOA 1T3LA 3SU0A 2XB4A 2HXSA 2ZRBA 2VSFA 2YVUA 4PZYA 1RRGA 4URZR 1L4UA 3BK7A 4IXMA 1VG0B 5EE1A 3LA6A 3PFIA 1VDZA 3ZYCA 1P9WA 1XEFA 5GJBA 3W3AA 1DY9A 1ZD1A 3LRPA 2W2XA 4N0DA 2ZXUA 5CLQA 3C5HA 2ZVPX 2ZIAA 3U1IB 3E70C 1COWA 2ZI9A 3KKMA 2MSEB 4B35A 3RSOA 3EZ7A 4NWKA 4B2IA 4KFUA 4W7SA 2V3CC 1Q1EA 3EZ2A 2IWHA 2F4LA 1MOZA 5CB6A 1XTQA 1IOZA 1TL7C 2ANBA 2FE4A 4HDOB 4MKFA 3IQWA 4JLNA 4DLZA 3VR4A 3OF5A 2OBNA 1PJRA 2O8EB 2ONJA 1YR8A 1E2QA 3K09C 4YDSA 4HI0E 1G6HA 1RRFA 4CDGA 4IEIA 2E87A 2NQ2C 4JLOA 2XEXA 2JDID 5C4MA 3R7WA 1GKUB 3BB4A 3KKNA 1ZBDA 1NLZA 4Z8XA 1G17A 1ZP6A 3W5JA 4HAYA 3TSZA 2P6NA 3CR7A 2XJ9A 4TT3A 1G3MA 2PX0A
chains in the Genus database with same CATH superfamily
2PWAA 1AVWA 1AUJA 3NBYC 4A0QA 3K9WA 2XR1A 1JU3A 1KARA 4EUKA 2JZOA 2R84A 3BH0A 3KKLA 2R1TB 1YCHA 2IYAA 1WDMA 1JXQA 5TQ0A 1NRNH 3R3JA 3OVMA 2RHWA 3DGFC 4NMWA 4Z4QA 4CR9A 1P9SA 3RC5A 3HDQA 2GHIA 3CX3A 2QE6A 2ZYGA 2OBQA 2VG8A 5FWDA 3DSRA 3MNFA 2Q46A 3VPGA 1TE0A 2C9MA 4DBVO 1KEKA 2W83A 3HBAA 4C76A 2XQIA 5DMHA 4L3OA 1GAJA 4Q7XA 2KS6A 3WY9A 4G1CA 3V1YA 1FXYA 2R4UA 2DXIA 1IQNA 2F1HA 3KR1A 1CJBA 3QNMA 1Y3AA 3C98A 1IXSB 3HKBB 3SU2A 4CT0A 4E15A 3RTAA 2YZNA 2VA8A 2WSSA 3QELB 2BQWB 2BDUA 1JRTA 3WFZA 1IQGA 2HJSA 3FWNA 1SQAA 1CP2A 1JLSA 1PR3A 1AO3A 1T35A 2BDHA 4L4YA 4X85A 2QR2A 4MICA 4F3YA 3GLQA 4XTRA 1S2NA 3NBKA 4KJZA 5K3DA 3PMBB 5D86A 4GP7A 3BTSA 3AILA 4WOJA 2INGX 1I33A 4Q4JA 4WNAA 5LDDC 3DEFA 2GEUA 2ZJ1A 4IP0A 1MOQA 1CNMA 3LOQA 2VQDA 5KWJA 2IW1A 4X3CA 2QB5A 2BTCE 1ESBA 3LP6A 3TI7A 3T7DA 5GJ4B 4PPGA 2B20A 1QG2A 3G2OA 4D7FA 4IOMA 1MH0A 5EZ6B 1YR3A 1E38B 1MD8A 4B17A 3WQHA 3SZ3A 1KH2A 1UCYK 3K31A 3HA5A 2X5XA 3WNBA 1ESAA 3UXHA 1XLWA 3MWGA 4JGIA 3WI7A 3DVLA 4OMFG 1MB9A 5JO0A 1VKRA 1JI0A 2HYIC 2PKSC 1U2DA 1UMDB 3EZLA 5G1OA 3MTGA 2QW8A 4LZJA 3EDQA 1Z6TA 2GF2A 1TFXA 3CF4A 3ANNA 3ZHSA 4CTJA 1M6EX 4PX9A 4AMYA 2RA0A 4RS4A 2WWXA 2E7ZA 4E06H 5EAIA 1W7GH 3PCTA 3I8OA 3IIKA 4IQ0A 2ZT6A 4XH9B 4IO0A 5DNWA 1SUIA 4V38A 3PD1A 4YI3A 3HGMA 1TBZH 3A89A 2OLEA 5K8TA 2ILVA 1FIWA 3RXGA 1JA0A 2R85A 2B2NA 3FX2A 1GPUA 1ZVMA 3W78A 2PJUA 2WNSA 1VCNA 5L6NH 4MV9A 4GPZA 2HW8A 3O9MA 4RJJA 5LQJA 5A9SB 1T2DA 2B1RA 1SKAA 3V6MA 2Q6FA 1CRZA 3UKDA 1CUCA 1T8LA 3SBKA 4DMKA 1N5DA 1ZH0A 1LH0A 3I5UA 3U6BA 3QHAA 5I3CA 2E6KA 4UHEA 1J2TA 4WBNB 2VTEA 1HH4A 1EX1A 3V4ZA 3MM4A 1YCPK 4Y6DA 2VYFA 3JZMA 1Z7EA 3K0CC 2X8JB 3P9IA 1ZRMA 3THXA 5BWCA 4P93A 4K5QA 2POCA 4FFPA 3EH1A 3L46A 5F1KA 1MVOA 2JD0A 2K0QA 4Y6RA 3EGEA 1U65A 2WYIA 4J1QA 3NOOA 3MWDA 1FUKA 1R9MA 5JEEA 1R8XA 2Y3IA 1D2RA 1J8VA 3FJYA 5TY0A 1T7CA 3M5NA 3T1QA 1D1PA 2ZT7A 2Q7OE 2NUBA 5JB9S 1FB5A 4TTJA 4ACBA 3B3AA 1CJVC 3DE3X 1J56A 3C4QA 2VSOA 2G4UA 2HI0A 1S02A 4C88A 3EEOA 1LTHR 4EF6A 1H8HA 3QUTA 1AQ7A 2ZBUA 1EP6A 2XVMA 2CLSA 2X5NA 3DO8A 5HEKA 4BE7B 4LXXA 1YCGA 1A69A 1R0BA 2PJRA 5B1EA 3BD7A 5H80A 5TEWA 1SFQB 1IOVA 1W0KA 4LZNA 1X9HA 4WY8A 2OL4A 4BNZA 1M2VB 1SI5H 1T5BA 1J00A 4KWHA 1J25A 2G67A 4DB2A 4DIHH 3SSOA 3I9LA 3RYFA 5BRRE 3K0AA 1L5QA 4M21A 5GIBA 1RT9A 1WCIB 3EC2A 3H1GA 5LYJA 1GFIA 4K1SA 4QHYA 4Q1AA 3JYOA 1WMFA 2QTLA 3ZVDA 4KXWA 3RUAA 3F8WA 1YHNA 5KQPA 2IT1A 4EO9A 1YZKA 1Z4LA 1JFFB 4HNAA 2I1LA 2JBAB 3RFCA 4ZYLA 2ATVA 5EIHA 5F5XA 2BYAX 2NV2B 2XCRB 3BFJA 3LWDA 4FYYA 1DX9A 3VR2D 3ZDFA 3K71B 5AFYH 2Q49A 3U9TA 2HOQA 3K1YA 5YASA 1SO8A 2DFLA 4HFNA 2O7NA 1WF6A 2VOJA 1EBBA 4LNAA 2UZ3A 3WRXA 5ALEA 1OPXA 4JLSA 5KVCA 2O8TA 4HJXA 5FWXA 1QQ7A 3QFFA 3EZXA 3F9CA 1NY6A 2WAXA 5TX7A 4B4VA 2B1QA 1H4VB 4D4IA 5JVDF 3O8BA 3SZLA 1YZLA 1I30A 3EARA 5JROA 1JIKA 4JMPA 2CMDA 2WJVA 5HZGA 1CO7E 4XSKU 4BVEA 4WI1A 3UWMA 5C0TA 2QD5A 5DK1A 4YESB 5A9RA 3FWPA 4OI4A 4KQ1A 1QORA 3R7BA 5EXMA 2FWIA 5JISA 4PAWA 2HWXA 3BD8A 5JH7B 4WY5A 5CU7A 4PPQA 5JSZB 2P4UA 3I64A 1IL0A 1Z6GA 2O2ZA 1A5AB 4E5VA 2E4AA 4YJHA 1DOHA 2XCLA 1SQTA 2HM7A 1E2FA 3C6QA 1UANA 4A6XA 2BJHA 4JQCA 2IEAA 4ISNA 4H4EA 1KAEA 3E0PB 1QQ6A 4QDOA 3EJWA 3CNBA 3RASA 2HMSA 3QM1A 3TLZA 2V58A 3HK2A 2I7XA 1MPTA 2GAOA 2V7TA 1KMCA 1EDZA 4ZA2A 1ZKDA 4JKIA 3RSGA 2Z4SA 3T7AA 4RLHA 2W6MA 3P2YA 1C9DB 3ZQUA 1RYYA 1N9GB 1BMMH 5FXLA 3CA8A 3V32A 4WADA 5H0IA 3STWA 3WYEA 1RKQA 1DWDH 4KWCA 2B36A 3RUDA 1Z12A 4Y2XA 1BMQA 6AT1A 1OBCA 5JQGA 4CIDA 1D5CA 2QRHA 3PQCA 3G3EA 2VLIA 1BS2A 4E09A 1VJGA 3EWIA 5DTQA 5EG5A 1E62A 3S4YA 4C0SA 3IP1A 2GJAA 2Q0SA 4BKRA 4MKRA 2J5BA 3NI2A 3PNMA 3LYUA 4WA8A 1GEGA 1BFUA 4P3XA 4CHAB 1QTNA 1QCZA 2ODNA 2BD7A 1ABFA 3VZDA 13PKA 1N5OX 3G6WA 4G5XA 3FHOA 4M38A 1EK1A 4MPUA 2VO1A 5A6VA 5GTDA 2HPHA 4FLMA 3EFOB 1X3LA 3KT6A 1JSXA 2C4TA 4KFCA 1DOJA 2C7PA 1NBOA 3F7NA 5E2PA 4QPJC 3U5TA 2JASA 3QNUA 1O08A 2CJIA 3CVUA 1ZNXA 1DI0A 3DL0A 5FA8A 3IAM1 1CCWA 2AZMA 4PLZA 2ON6A 2YC2C 1KH3A 2TMYA 4YCSA 1ZRNA 4BO3A 3NS7A 3C3BA 1UMBA 1GPNA 3KD2A 1T25A 3EVTA 1R8YA 3EC1A 1XLTC 2DQSA 3R44A 2EW8A 5B6IA 3STVA 4CI9A 2NWQA 1KAHA 1WMDA 4TPYA 4CMBA 1W30A 2H4YA 4CMGA 2B0JA 4QLBA 3ET4A 3JZAA 1MXHA 5LLDA 3H11B 3ZDRA 2FQXA 4HB4A 2XNDD 3K94A 5FQNA 3KNXA 1EPTA 2B0FA 3JTMA 1VL5A 3TJMA 3HRIA 4OREX 5JCOC 1BWRA 1V9LA 1V6CA 4HGZA 1JR3E 4C3OB 2A2QH 3LX5A 4J9VA 5FO1A 3E2IA 3OT4A 1AT1A 1M5RA 3D65E 4Q63A 4MCHA 1KJWA 1LS6A 4MQFB 4QFMA 3HJNA 3MWKA 5E6SA 4OHRA 3JD2A 4ZCRA 1KI9A 5BMVB 4XYGA 3M6WA 2H5EA 4E7PA 1M0SA 4RNDB 1SC3A 4JUCA 1OTYA 4JS0A 5HWSA 2O0JA 2A57A 4GRIA 1Q0SA 4O1MA 1ZYOA 3PPXA 1AZWA 1A9ZA 1QO0A 3FM9A 3H5AA 1GHWH 4AY4A 1VCPA 1EFKA 4FT4A 1TA0A 4ABJA 4AJOA 5HDBB 5IJ9A 3RO7A 2J6BA 1RADA 4AMGA 2A7HA 4BB6A 2J9NA 4WA7A 1Y6GA 1HDRA 1W14U 3T3IA 3RWBA 1C5PA 3IUNA 2ZRHA 1M2OA 3KL6A 1SRQA 1K7XB 1ZH4A 1NU9A 4DBLC 3F0OA 4U2WA 3H0CA 3OCXA 5DCUA 1I2MA 2VUSA 1ZOPA 3I04M 2ENWA 4N39A 1OR8A 4JBWA 2D7DA 4OG2A 5JU6A 2J1LA 4QPZA 3DPSA 4GPEA 1UOEA 4CI0B 2D54A 2OE2A 3NUZA 1Y63A 3RTDA 5AVWA 1JQ3A 2BEUA 1MF7A 1KKLA 5HFAA 4HNSA 4IIVA 3OQNA 2VHUA 4DR3B 2BE7A 4PG7A 1CX9B 4KV7A 3P8FA 3GROA 1LW6E 2ZI3A 2H9YA 2W6ID 2C9OA 5B36A 1VG9B 4ZQFA 1HETA 4RK5A 1P2DA 4JHXA 4X2XA 1M2HA 4WMDA 3U7HB 5G3YA 3K53A 3SNHA 2PXHA 2B8WA 4DV3B 4V39A 4C0KA 2HMVA 1JB1A 2HDHA 3W8EA 3IBTA 5A0BA 3NAMA 5D2CA 1NRPH 1XOIA 2Q5HA 4ARZA 1KBQA 1RBQA 1CZLA 5CB4B 3UJ7A 2QRMA 4XVQA 2QVLA 1J8QA 5FLKA 3T0GA 4YMLA 3GOVB 3W4KA 1T9AA 2Y5FA 2ZDQA 3UMSA 5IDXA 2GHQA 2YXEA 1NUAA 4HH4A 3TFQA 2PX8A 3L6PA 4REMA 4QDTA 1Q1AA 3OM0A 3PRYA 3AKZA 3HE3A 3WK9A 2P27A 4YRSA 1CY1A 2IPNA 2Q9UA 1JT9A 3KQOA 1P4SA 3WYGA 4H7DA 1FONA 2XYAA 3FMFA 1ANEA 3MLAA 2H2GA 4FVTA 1P5RA 2GYUA 1GI0A 1SGFA 3RHSA 4A1TA 1M2WA 3BEIB 2WB4A 2IBSA 2CMGA 4K05A 3M0EA 3SICE 4GX5A 4BGIA 3A6LA 2XBWA 1YPHC 2OC9A 3EE7A 4AN0A 1WMEA 2WU0A 2OBBA 5FUWA 1PPGE 2HU7A 3CMCO 5JSFA 1T36B 3IUMA 5BXQC 1AZTA 3ZV8A 5SICE 4XB6B 4YV1A 3HB5X 3M4YA 3HVKA 2ZC9H 5DBGA 2O0LA 3NHKA 3DZGA 2Z4TA 1DKQA 4MX8A 3JR7A 3CT6A 4XJTA 3P9RA 2O5EA 3E7PA 5CIYA 4LMAA 1G98A 1TCUA 1KRHA 2QD2A 5K8JB 2JHAA 1HXFH 3FF1A 1TU3A 4LVNA 2KM1A 3AUUA 3T5FH 3KQMA 4UD2A 1W1UA 5KTSA 2O8BA 4WV3A 3MO9A 4RHCA 5JNVA 1O2QA 1UFKA 1FFBA 4GD3Q 1VSQA 3C6KA 1QYRA 1IK6A 2JCGA 4Q7YA 1QR2A 2AEMA 2MR5A 1LVYA 5G0UA 1UPAA 2GR9A 5DLPA 2ADFA 5CXQA 3EG5A 4NMLA 4CIAA 5JCXA 1U2GA 1BFKA 4NDZA 4TTQA 5GMOA 1EVYA 2HLDD 1O2RA 1S1CA 1AXGA 2B5OA 4AY2A 5KU1A 3MWEB 4M3NA 5T67A 1GQQA 1XDWA 1V8FA 1TJNA 1Z62A 5DKMA 4Q3DA 2QN6A 2XW9A 5CCEA 5FL7A 2L17A 2WYWA 2ZB2A 1RPTA 3OOYA 2YXLA 3SKVA 4JA0A 4KX5A 1T5TA 2PWBA 4AFZA 4FKZA 3GDSA 1NYTA 1K6XA 2A5KA 2Z6UA 1DRWA 1V2QT 4ENPA 4XZ3A 2UUFB 2HALA 1SB9A 1ESTA 4ZVSA 3ND7A 5JCPA 3GOHA 4UQLA 4OATA 4MRPA 1RRCA 5CGQB 1Y1PA 1QXSA 1KOLA 4YMVA 5B2ZA 4NV1A 2GJ9A 3VVCA 1U8TA 1BBRK 2ZQYA 1G8PA 4NWLA 5KYUB 4UHBA 4DRXB 4YFYA 1AMUA 2PUAA 4Q4HA 1VLMA 3U31A 1BYUA 4D8WA 3RIYA 2H48A 4DNXA 2PX6A 4CLRA 4IAOA 1RLTA 1P73A 2P59A 1XF9A 4FX2A 3PR1A 3FSJX 3BHMA 4BXSA 4PVDA 4MDFA 4R8VA 1TMTH 1W5SA 4DFDA 3PUHA 2A5YB 1GHYH 1Z37A 1N6LA 3LLUA 3L0DA 2LV8A 3F49S 4OYYA 3TIFA 5KOYA 3ITDA 1H9BA 4OP1A 2VQSA 1RU3A 1LSUA 1NVFA 3SJ9A 5CCXA 1SUSA 3NX4A 4QVIA 2FOMB 4IDQA 2YICA 3T5TA 4A1XA 5E2BA 3W5VA 2AOXA 5ERXA 5EU8A 2DPHA 2RC6A 1U81A 1N9ZA 2YHBA 1SQFA 3HSSA 4NFYA 4ZV7A 3U2QA 2FI3E 1Z34A 1Y3FE 2VZLA 1NFXA 2H6EA 2R6GA 1PJZA 1LPKB 4R7ZA 2QN9A 2REOA 4AF8A 1Z6XA 2JJMA 2FUEA 1L7XA 2CE2X 1G8HA 4F2HA 4DV5B 3NRBA 3IXQA 1TO6A 4EKEA 2RB4A 4NABA 3IOYA 4JI4B 1SIBE 2A9JA 2LIPA 4CLEA 2TMDA 3OOWA 4Q4AB 4EARA 2WMOB 1OYWA 4GP9A 3ED5A 4PW0A 4WBXC 4WH8A 2QW0X 1GI2A 3MB5A 1R5JA 4DQVA 2W5UA 4IUCS 3ELWA 4CMEA 2RA3A 5AW0A 4NRDA 3H8SA 1VG1A 2OZLB 4WUVA 1MT0A 1U02A 4CQMD 4DTCA 4G86A 4WCDA 1EWVA 1FDTA 2D7CA 4R3WA 4ZV9A 1WAYB 3D6FA 3TXYA 1WRBA 2GTBA 1XVIA 2WYHA 3O92A 3TCXB 1IQFA 3HXPA 5HIYA 5I9LA 3BWEA 1KU6A 4G0OA 3THYA 1X1BA 2P5UA 1YB5A 4I8LA 4P0TA 2VEDA 3P2EA 3B36A 4CKWA 2H7CA 2C3OA 4F2GA 1T1SA 2C8WB 4DIDA 4YV0A 3UOAB 3ROXA 5IDYA 1YVPA 5ERYA 1E6LA 4K9OA 3IAEA 4DLYA 3C3JA 4HO1X 3WHKA 3S2FA 1EFTA 5TPWA 5DZSA 1O4VA 1RXEA 1F1JA 3LW7A 3H2BA 1LK7A 4Q3AA 3ZG6A 5BUQA 4YQEA 3SFVA 1Y7IA 1WTGH 1X8KA 4LWPA 1FY5A 4WVPE 3F1LA 1YB7A 3O8DA 3LGAA 3N7UA 1KJJA 4PFSA 1YULA 1VSVA 4EOGA 5HOEA 1OSSA 2H0AA 3WNDA 2A4RA 1YF4A 2EVWX 2HGZA 2H92A 3KTAB 3SU6A 2ISQA 4YRFA 3M6UA 4DBLE 1Q12A 2SCUB 5DP3A 1JEAA 4PY2A 3WW7A 3FTDA 4JWTA 2X1VA 1IQIA 4K86A 2DWPA 4OGKA 2R8RA 1YZTA 1ZIOA 3QX9A 3LZDA 3FFXA 4RSGA 2FLVA 1ZAKA 5DHSA 4I1UA 2BKXA 5KS2A 1JA1A 3RSFA 5EJ7A 3KU1A 4CIYA 1AGJA 4R8RA 1G20A 4O02B 3PXCX 1B6SA 2J3MA 3HHPA 3DHNA 4OHBA 4GSKA 4MWSA 4RT0A 1C1VH 4KLRA 3SU0A 2X4DA 1QG0A 3PFIA 2ODYB 1IVYA 1XEFA 3AIKA 1WUKS 2AMJA 2POQX 3SIWA 1UJ6A 2ZI9A 1INCA 5AW6A 3HATH 5KTPA 1IOZA 4J91A 5EHZA 3S68A 4JLNA 2C8XB 4M9UA 1PJRA 3K09C 5AESA 4CDGA 4JLOA 4QULA 3GC6A 2C0QA 5KOHB 1ZP6A 4C6HA 4B3MB 3KYCA 1J16A 2BLOA 1EJMA 2X42A 4GLJA 1BRBE 3IHTA 1QF9A 3NEJA 4LZOA 4XE4A 4S1OA 4EA7A 4X1KB 1E64A 2XCFA 4P2BA 4CF3A 4CIWA 3ZBPA 1L7EA 2G07A 4JJIA 3E91A 4YMHA 4OQXA 1VQ1A 3K2IA 3RAJA 3SEFA 2FPIB 1P1CA 4TM7A 4U6QA 2C9BA 2BRUC 3LBYA 1EOLA 2XITA 3GBSA 1HLFA 3EIUA 2ARKA 2UZ0A 2JHCA 2JLBA 5F78A 2JJ1D 1GVNB 2J0UB 1O9HA 4YC7A 2J2UA 3IBGA 1YPHE 2R6DA 1THTA 2PRZA 4Y8VA 4ZOAA 1JHMA 4H16A 4FHZA 4QARA 2Q8QA 1O8CA 1ZUWA 3VZBA 3FYHA 1PG2A 4HDMA 2PUDA 5AJXA 1JHZA 4BO9A 3MCWA 1U0OC 1W88A 4P02A 5A3RA 3AI2A 3VR6H 2HQOA 2XSZA 2WYVA 3FY4A 1O3DA 3WDKA 1HOXA 4E21A 2DWOA 1UH5A 1Q2WA 3E3NA 4R31A 3QN7A 2XXLA 3BXFA 4U5QA 5LNK1 3HCPA 1P2VA 3IAS1 4EM6A 2A1UA 4EG8A 4U2CA 2BMFA 4NG9H 4FINA 4BAMB 3PT5A 1SCDA 1TM4E 4X7RA 2H7YA 4HWKA 4AUKA 1U8ZA 4YNBA 5KQGA 3BXEA 3HBMA 1E3MA 3MMSA 1Y6FA 4E5NA 3FNGA 3AR7A 2RBEA 3VDXA 2YJTD 2BFFB 1T6ZA 3IE1A 4D4HA 4YRBA 4ND2A 3RU9A 5L7WA 5AUQA 3AVWA 1DJNA 4LV5B 1AK2A 1JLLA 1A3BH 4Y7CA 3TU7H 1IHYA 2IBMA 3D3KA 3W3AH 1DITH 1XPJA 1M8JA 2IOHA 3E3AA 4D9MA 4BCCA 2SGAA 2OQRA 3MBKA 4LOHA 2JJYA 4EPWA 4LZLA 1E5LA 3E8XA 1KYYA 2GRAA 4DHWA 1KI4A 3ME5A 3AL0C 3VYRB 3DAFA 2HUPA 3HDTA 7MHTA 5EHXA 3P8OA 1QV9A 1D3PB 5B6LA 4YT8A 3I6MA 4J0HA 4AUMA 2QZ9A 1XQWA 2DBYA 1MG5A 4QQ8A 2M32A 4CU5A 3EAQA 1LHDH 3TLBA 3DE0X 1ZI6A 2W3KA 2ZSKA 2AR0A 4PZ9A 4C20A 2CDNA 3H8WA 4UVIA 1V8OA 3MVEA 2M5TA 5IKMA 4M9ZA 3PI7A 3LXRA 5HMAA 4QO7A 1KEEB 4EY3A 1BG6A 2AR9A 1RWOA 2I1QA 2A58A 4MUMA 1J49A 3FPAA 1QGUB 3OY2A 1YCPM 4Y2PA 3I4CA 3TGJE 3ZVNA 1AI8H 3OLXA 1KXAA 2DUJA 4Q12A 1PJ8A 5C94A 4RKFA 2KQUA 1E0KA 1CULC 5F8XA 2R68A 2I2XB 1ZTLA 4FWBA 3U5ZB 2YOGA 5DP5A 3OZBA 4QUKA 5CJ2A 4B3FX 4RTSA 4M49A 1QGYA 1SEPA 1UBEA 3AETA 5DMXA 3ONDA 4N5DA 3IKVA 1BZXE 2PR7A 4NBTA 3KZVA 4XWKA 5AW2A 2WSIA 4XPIB 5GDSH 4ZARA 3OIDA 1DEHA 1T1RA 5AIAA 3Q3CA 5TC4A 1K86A 4MWCA 4TN5A 5IKXA 3CZRA 1TQ6A 1H66A 3TK6A 5T41A 3NTUA 3BJZA 4FMDF 1M1UA 4Q5IA 4F2DA 4KO4S 4MLZA 3WB2A 2J6HA 2FOHA 2IH2A 2XE4A 2OC7A 4IMIB 2CN1A 3FROA 2CB9A 2P9BA 4ER3A 1GU7A 5EUBA 3Q8KA 1SR5C 4MS1A 2A9QA 1ZZGA 4Q9HA 2Y1GA 3KEOA 2GYWA 3C39A 1UZMA 2Z6AA 1XSEA 1RPZA 1N4AA 2MT9A 4Q19A 4Q16A 1IAUA 3BXGA 4NCKA 3B1XA 2AQHA 4YECA 5K3CA 4NTZA 5JDUB 4MUKA 5IC5A 3KNZA 4TSFA 4Q7MB 5LZ8A 1G36A 3RXDA 1LDYA 5HCIA 4F5EA 5HUHA 1M5TA 4C4YA 4TMYA 2EBUA 3VR5H 3HO8A 4XI9A 3VDMA 3OD1A 3N53A 1IM8A 5C0UA 1M1ZA 4G5RA 2AEJA 4I5IA 3USES 4URHA 1M7GA 4TLMB 5BNZA 4OJNA 3OQ1A 2I03A 4UBOA 2ANMH 3Q2KA 4W9MC 2Q9AA 3ITNA 3WAGA 3GLFA 1J8MF 4IKEA 1NXOA 1MO4A 1E9AA 1DUAA 5JXGA 3UAWA 3FN4A 1NP6A 4PZZA 3C5WP 4TYMA 2B1GA 1WSWA 4EHIA 5L51A 1GCTC 4IJUA 4EBBA 3MTDA 3ZKAA 2EZ4A 3M3SA 1DXHA 3LCRA 2R8YA 2ZROA 1BRCE 2XWQA 1ZJJA 2R96A 2HNTF 1Z63A 1F6WA 2FN8A 1EUDB 5FOVA 1E18A 4B6SA 1WM1A 1MTWA 2IOQA 1FP6A 1KYTA 4Z3KA 4DMCA 3I6ZA 1Q0ZA 1VMAA 3A3KA 1HV8A 4P0QB 3LTEA 3MRVA 3EMBA 4MR9A 4X6OA 4TRRA 3JPYA 5EKUA 3WYNA 3PE3A 1JQ5A 3SR3A 3IOBA 2N1MA 3UB4A 4LHVA 4SGBE 1ZCJA 4DE5A 5E3JA 1S3GA 3MA0A 3ORHA 5HKKD 4DARA 1LWNA 5IN5A 2DWUA 4KVGA 1P57B 3ZH2A 1AKSA 3EDMA 4EUSA 2IX3A 2LIVA 1OHHD 1P1RA 4IJ6A 1PGOA 5JHHB 1M1XB 4K46A 3OTWA 1W5TA 3U4CA 2BY7X 1K2VN 1HUTH 4N40A 3UJBA 3VO9A 4UXIA 1XEXB 1EUCB 1G7RA 4ZHQB 2E5FA 4K9QA 3T0IA 4ME6A 2KFWA 3JQAA 3AY0A 2H31A 4OHFA 2O8WA 1ZGGA 4O4LB 4IIUA 4WJLA 1ZLRA 4WN9A 2HSJA 5IXJA 2FSFA 3T26A 2YIVX 4PC1A 1UT6A 3P45A 3N1UA 4XM0A 4DZRA 1OLOA 1TRHA 1P29A 2O7QA 1F8XA 2BTQA 3GA7A 4C9BA 2ZDVH 4H6WA 3V8VA 3OD5A 4X3PA 5C2ZA 2FSGA 4CF4A 3RUHA 2VT7A 1I3NA 4D9KA 5REQA 2D4AA 4YVFA 3ILHA 4J03A 2GN6A 5HM6A 2I22A 4UHDA 3PWCA 1E9DA 3K2QA 4YJ2F 2H4ZA 2JFZA 4U0KA 3VPHA 3HRHA 4A03A 1TQ8A 1XZAA 3V48A 2B3DA 4B9EA 2X8WA 1GT91 4PSVA 9ATCA 1K4YA 5E0OA 3QYJA 3BMOB 3C6BA 4NDAA 3RFVA 3JD0A 3EOZA 2IIBA 3MEQA 3TWOA 2Z1DA 1V2OT 2XXAA 1C9PA 3MTQA 4AZTA 1LUAA 3I12A 5FOUA 1H9CA 1EHIA 3GFGA 2XQVA 3WGNA 4AJLA 4PHFA 1W2GA 4JXKA 2QKYA 3K9NA 4QTUB 1PGNA 4MH0R 5GCHF 4UKDA 2X3YA 4NBNA 3UNQA 3AW8A 1VMDA 3DD5A 1AKEA 3R3SA 4MV7A 4HTFB 5JD4A 3OEYA 4KR0A 3M7TA 1OWMA 1D6JA 4I8JA 4G1UC 3MWJA 1UC5B 1Z17A 1HT0A 1KJYA 1BO6A 5IZ4A 1N0UA 5KYXB 2OXSA 5ALPA 1O6GA 4KACA 4D26A 4H1HA 5A3JA 2Y4NA 4J7AA 1PZEA 3WYBA 3PWKA 3EVZA 3HY4A 1LXCA 5DYTA 4NZPA 1OTXA 5EWJA 4N9WA 3R2JA 1N3IA 1ZJZA 1X87A 1UM9A 1E2MA 3D8UA 2NAPA 2QDXA 5AI4A 3A1DA 3Q3IA 3B9BA 4EPTA 3RHFA 4Q4LA 4M9SA 4Z7JA 1GJ4H 1UTMA 4JU8A 3LO5A 1DSSG 1UCFA 3GK3A 3PNBA 5GJWC 1HEIA 2DGDA 1Y0BA 3V1TC 4ZVPA 3WOVA 3ABRB 4W5RA 1BITA 2NAFA 1VHTA 5IM5A 2OTCA 5FFMA 2GCTB 3F0PA 2OHOA 3LECA 2I6XA 3QUMP 2GN4A 2XB2A 2V9PA 1IE3A 1NU6A 5EESA 4QGFA 3ZLTA 1IPHA 3OEED 1IN6A 2XCOA 2W9XA 2YN4A 5HQ3A 5DI9A 2NYVA 1QL8A 1TFRA 5JD3A 1F4LA 4ND3A 2UWOA 4BASA 5AQEA 1NQXA 1C9YA 3WLKX 3FYUC 1E8DA 4ARVA 1V6AA 3PRJA 3THSA 4PU0A 3PRHA 2O3TA 4MVJA 1GUZA 3IURA 4AIRA 4K9KA 5JNRA 1BQ4A 4C3ZA 4Q37A 1W8IA 5AKXA 4EYSA 2A0WA 3L5OA 1IONA 5LA6F 2RAVA 2IE8A 4L72A 2GBLA 3CPEA 1C4OA 3OJLA 1T8NA 2F1IA 2QG9A 2XGJA 4ZYVA 5IG2A 2IV7A 3D0QA 1ZHPA 3SPXA 5DLQC 5CT9A 4TVSA 1XMQB 3NALA 4BXWA 4DLVA 3M4NA 3KFLA 3H2ZA 1I5EA 3F0TA 1OIVA 4R2JA 5DM4A 1W4ZA 3QI2A 2ODPA 1TCCA 5KQSA 3OE5A 3W79A 4ASUD 4TPIZ 2D3WA 3PA8A 4DC9A 3GI1A 1U4OA 4C43A 3ZLJA 1ZS9A 4L6CA 2XLBA 4BPBA 1O7JA 3UJAA 4B43A 1HRTH 4L8YA 1HM5A 3NATA 5K0CA 3CJRA 2VR1A 3RU4T 3T7EA 4L3WA 4NK5A 4TKMA 4BRZA 4FDUA 3IKMB 2IXDA 4WN3A 1W0CA 2I87A 1NTRA 5KDOA 3CLUD 5HUJA 3P9ZA 5JJ5A 1W9HA 3A1SA 2CNBA 2FR0A 3SHCH 4AS1A 4PO8A 4RZIA 1C2HA 3L2OB 4FKBA 4LNUB 4EYKA 2VRCA 1C7JA 5B55A 1YD7A 4KG7A 2YASA 3IBYA 7GCHG 4EENA 1JBKA 4B4WA 3L0IB 3ZI7A 5JANA 1QC5A 2JG3A 5LH8A 6GCHF 5CPBA 1CE8B 1U7WA 1KQOA 3ZZ1A 3G2QA 3SBOA 3QXCA 1R37A 1WDIA 1NULA 2ADMA 1QQAA 5HJ2A 4MOWA 5KSYA 3IJEB 3A6PC 3T3EA 2G5TA 2V74B 3P71T 4CNBA 1JKXA 2ONCA 4MVWA 4BV8A 4UHJA 1R64A 1OBHA 4U00A 3FCUB 2FW9A 2ZEJA 3JR3A 2LKCA 2Z94A 4GHWA 1TRNA 1YNOA 1PZHA 2EDAA 4EKDA 4YRDA 5AXBA 1G41A 1SCAA 1WY5A 1F2DA 4YACA 1LHCH 3QK7A 5F1PA 5C5OA 4LHWA 2OCDA 4ENRA 4NZMA 4PX5A 1C1DB 5FTMA 1XZJA 3RK1A 3KHUA 1Y3WA 5F77A 3GUYA 1M1YA 3RJ9A 1Y1SA 1R8QA 3AHFA 3GZNB 1MQ8B 3GEDA 4B6PA 2I6UA 1DRUA 4D9FA 4ZYWA 4UPDA 1KMMA 3PPIA 4DVGA 1HOTA 1Y42X 2FW1A 1T0PA 3CEMA 2C07A 4PFQA 4F8EA 3NWOA 2XOKD 2FAXA 5AK0A 4KO8A 4U7DA 1AX9A 1GQ2A 3LWBA 1KMHA 5DLEA 1V8PA 3OMWA 4GHTA 3E9RA 5LMCA 2ZPAA 1PCXA 5AKLA 3HR8A 3NTLA 1WSSH 2PSEA 4KIFA 4ZKOU 2IYOA 3GYLB 5K8CA 3EGWA 2IJD1 4FGUA 2P9EA 4UUNA 1NUTA 1AVTA 3WVNA 1WOYA 2C2GA 4A6DA 3ODPA 3PA6A 5HM2A 1XTUA 1OWDA 2AZXA 4MQ5A 4CEIA 3MF4A 1DBPA 1TMBH 1RXUA 4IH1A 1Y8ZA 4TKUB 1P77A 1AQNA 5EE0A 5BQXA 2Z58A 3ZQJA 1RZRD 2IV2X 2Y68A 3V13A 2RK6A 4UCXA 4BNTA 3TBFA 1OYTH 2H2DA 3L8ZA 3BEFB 3Q5GA 4X6UA 3A58B 4ZVLA 2DTXA 5F1YA 5KTRA 1NW8A 1AD8H 4DT1B 1FPCH 2XTNA 4P7BA 2BGNA 4MA5A 1RJWA 4BLOA 2HQSA 3GT7A 1EIZA 1G4UR 2FPOA 1FDUA 5FL3A 3EYWA 5HRUA 1ZXBA 3Q6MA 4JT8A 1ELOA 4S1TA 2XCNA 2R0KA 2XCQA 1TT7A 4EMTA 5GWXA 1U3DA 2G80A 1OBOA 3KALA 4I9NA 1KRXA 1K1JA 5EKXA 3C3WA 4OQDA 4CNQA 3QGNB 4C2TA 3DFMA 1XEWX 5LSAA 3PUYA 1J06A 2VPWA 2KW5A 1OGJA 4Z53A 3HBNA 1XZMA 2QSJA 1VCIA 5LZ9A 5AXDA 1QHHB 3BIVH 3B6KA 1ZSYA 3OCUA 2AOTB 1FNMA 2BGRA 2Q2OA 4BTTB 1ZJKA 1YPKH 5K3SA 2PX5A 3KDSE 4AZWA 1SBCA 3ES9A 3O2SB 1UEIA 4Q1VA 1O1YA 1OAAA 4HFMA 2ZZKA 1O54A 4B0OA 1XQVA 1NX9A 5DNEA 2YBEA 3M89A 4UAGA 4KZPA 4GF5A 1TALA 1Z0KA 2DKNA 5KC9A 3O3NB 3QTLA 1SQ0A 4Y30A 4OP2A 4AJIA 1E0SA 3FDZB 4AROA 4KPYA 3IXMA 3IPYA 5CHAC 5L2ZH 5J5AA 5BN3B 1L1FA 2ZI2H 3PDWA 4UNNA 4WNYA 1HDTH 1P72A 5JNUA 1XKBC 3GHYA 2G08A 3Q9NA 1T8TA 3R0VA 3TX6A 3PL5A 1LGYA 2C57A 3U4DA 1I80A 3ATWA 3PV2A 1ULAA 4F2PA 1NW3A 4CM8A 1MVNA 4PRZA 2OHFA 3QJGA 3NHPA 3IS3A 4HWRA 3PVCA 4N4AA 4Y98A 2ZUTA 2CL0X 3KHVA 4EELA 4PZLA 4Y79A 3HWSA 3DTVB 1TQ2A 1I7SB 4ZMSA 4N41A 4CLDA 4ML3A 3V46A 5IAOA 4KW7A 2GN2A 4AS3A 1TMOA 2R00C 4U9UA 4B6EA 3WZMA 1YBMA 3I01M 1US8B 5D5QA 1LJ8A 1WTAA 2HBRA 4POOA 4KO2S 2RHGB 3QLTA 1NJ5A 3AEKB 3GMIA 4EGFA 3MT0A 1ZRHA 1DFPA 4HRXA 3PJEA 1O94A 5EJ5A 2IRWA 1A9OA 4IWXA 1TIKA 1Y8RB 5T4FA 2X4LA 3GY4A 4HB2A 3H4VA 4KXNA 5DBFA 1HE1C 2MMCA 1IIBA 4ZKDA 4YT4A 2G5PA 1Z7YA 1SKYE 1N75A 1YL5A 4ZOBA 3TAHA 4F84A 3L82B 1Z4KA 5GIPE 2B92A 3DD2H 1K5PA 4OP3A 1QNJA 1D3DB 1E0DA 3ESZA 2GZMA 3RVDA 3FPCA 5JBQA 4J9UE 1BEZA 1PFVA 2A2XH 3BDVA 5C17A 1YZFA 2XAAA 4FVBA 2VPIA 4C0HA 3B9FH 2VJKA 4PLGA 4NBLA 1GG9A 3TMAA 2XUQA 4I4NA 3RP2A 1SXGA<