4B6FA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
646
structure length
645
Chain Sequence
b'ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 196
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6fA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA02
2OE2A 1EFRD 1SHKA 4JMPA 4DWJA 2A5GA 2J0SA 4Q00A 5E7IA 1VECA 3Q7PA 4B35A 2AHOA 5G40A 1Z0AA 4M1OA 3ADKA 5CM9C 3AF1A 2IL1A 4RZUA 1YQTA 4BUJA 3I8SA 4JT2A 2BKUA 2GVZC 5L3SB 2QORA 1OYWA 1Z0KA 2IYVA 4QBGB 2QP4A 1E0JA 1G19A 3P32A 3EX7C 3F8TA 1F3OA 5IDKA 1XDBA 4TLAA 2DBYA 4B2PA 2FOLA 5EE3A 1GAJA 4TYQA 5C4MA 3GLHA 2YJTD 4F4CA 2NOAA 4OQLA 3HU2A 3K09C 2VTKA 3VHLB 2YHSA 4G5SA 1XPUA 4GOXA 4TL9A 3W34A 1GSIA 4JLKA 1A4RA 3T35A 4MYCA 1RIFA 3K70C 3TJZA 4PC7A 3VNVA 2QRZA 4KCGA 4TZ6A 4LYJA 3TKLA 1DPFA 4OJKA 3AP1A 3JZAA 3B82A 5F9FA 2ZJAA 1E96A 1BIFA 2F1IA 1P5ZB 5GJWC 4UJ5A 1AA9A 1P2SA 2GA8A 1DEKA 1MT0A 1XZQA 4IKEA 2FZ4A 4JKIA 3REFA 2OAQ1 1W0KD 2KSQA 5TXGA 5LB2A 2YWEA 2P6UA 4JIMA 5B57C 1MABA 3TW4A 1NY5A 4YQFA 3KNXA 2D62A 2O8BB 1N6HA 4EUNA 3UMRA 4TQAA 4C0BA 1Q3TA 2PT5A 3THWA 4QFMA 2ZJ2A 4B6FA 4B74A 3C7KA 3TNFA 4MKFA 4FD2A 4ESHA 2HUPA 4DLSA 3TVTA 4C0HA 1NS3A 2ZSAA 1TNDA 1D9ZA 1QRAA 3QXJA 4B3CA 1KO5A 3HR8A 3IBYA 4ILEA 1TU4A 5J4HA 3B5JA 2PT7A 5FOWA 3ZQJA 2QE7D 3IEVA 2E87A 3U4QA 4CEHA 4AWXA 3WBJA 1EWRA 1II8B 2B21A 2UVQA 2ZYVX 2FH5B 1G3IA 2CCKA 1Z8FA 3QXCA 3PXGA 5E4FA 2HEIA 3BE4A 4LK2A 4NZYA 3X1YA 3A1VA 3W8NA 4Q9HA 2X8AA 4UXIA 3H86A 2PCJA 3M0EA 2AKYA 3H4MA 2KI5A 2B7CA 1RC8A 3GLIB 2IS1A 3OFNA 3ZZ0A 1U99A 1LS1A 1M1YE 1KO7A 1WP9A 2R62A 1AZSC 3I92A 1E2LA 2QENA 3AGQA 2G0NA 3GJ5A 3HP1A 2ZJYA 3FKSA 4BFYA 4TYNA 2R44A 3QF4B 1GL9B 2QU8A 4KITB 2OSBA 1G5RA 4IFBA 3G5UA 4W5HA 4L9SA 4MGYR 5LB4A 1Z3IX 3MLEA 3AF2A 3QPVA 3QXHA 5FBVB 1XU4A 3EZ9A 2QROA 1J90A 1XTKA 2IJD1 4Q4JB 5KYKA 2VYFA 4RCZA 2OHFA 2VH5R 4TYWA 3JVUA 4Y0AA 1P60A 4F38A 2ZVPX 4LC0A 4C3ZA 4NWLA 1W44A 4DRZA 1QHIA 3GFTA 3KQUA 2VSXA 1SVSA 2O52A 2ERXA 4F4IA 3M5MA 4M0LA 2WMOB 1TU3A 3B60A 5CYOA 1RGQA 2CCJA 2F3TA 1PUIA 2JJ8A 2ZR9A 2IS6A 3WMFA 1NKTA 1R5NA 1Q1EA 1SKYE 3ASYA 3P4YA 4P32A 1Y63A 2QT0A 2ZJ5A 2ONJA 4A8JC 3U3RA 1FL9A 5FPHA 1FX0A 2WZQA 2WSSD 2HCJB 1R0YA 1KK1A 4RJLA 1G20E 1OXSC 4NE2A 2XNDA 4OI1A 3PUYA 4QNMA 3K8YA 1KNXA 1HQCA 2CXXA 2ZI3A 2ZU0C 3PUZA 2ZIAA 1P2VA 5HPYB 1T6NA 4LRWA 3VNUA 1VHLA 5C1BA 3B6EA 3C5HA 1X1RA 1KAOA 4MUAA 1OFHA 4V0MA 3R7WA 2DWPA 3BB4A 3TAHA 1FUKA 2JGNA 4DVGA 1VYVA 2QPOA 3SJBA 1NIJA 2Z5FA 4LUCA 4D0NA 1JXPA 2R9VA 2OM2A 1OW3B 2XOKA 2GETA 2QM7A 3C14C 2PJZA 3O8CA 3CNLA 3RWMB 2IWRA 1D5CA 4EPTA 1HYQA 1ZYUA 2ASEA 2RB4A 3OE7A 3BFXA 5FPSA 4IOMA 4N0EA 5AWFC 2Z4SA 1UBGA 5B30A 2I1VB 1Z0DA 4HLDA 4B33A 2KB0A 3B9QA 1G3MA 4Q4AB 2Q3MA 2O8EA 3KZ1E 5UKDA 421PA 1E94E 3PV2A 1G6OA 4Z1MA 2NZ8A 4DKXA 2QP9X 2YOFA 3MGCA 4FN5A 3MAAC 4P0TA 1K8RA 4US1R 5EP3A 1T9HA 3W90A 4DJTA 4GBMA 1KJZA 3HJNA 3P8OA 2VPPA 4F91B 4AY2A 1GRRA 3A8TA 1QVAA 2D4HA 2F9LA 4HAVA 1RRPA 2J9RA 4IDOA 3THOA 4AD8A 4CVNA 2KBFA 1RJ9A 1Q12A 2GHIA 1E4YA 3WYFA 3UG7A 2H1LA 1P2TA 1ZMXA 1ELOA 3I32A 1HY3A 3I73A 2WJHA 3KXIA 5CLLA 4KSBA 2ORWA 1XMSA 2GZDA 3VR4A 4YXWD 1K5DA 1O3YA 4LV6A 5GNDA 4Z51A 1JBKA 5FTKA 1GVNB 4FMDB 1E9AA 2G83A 3B1YA 3AKYA 4GNKA 1EGAA 4JVSB 4RSGA 4EPRA 3NDPA 2OINA 2WTUA 3PEWA 4U7DA 3K0FA 4KBGA 4B3BA 4I1UA 3GP8A 2R6CA 4M9ZA 1UADA 3CNOA 1NN3A 4IDHA 1IAQA 1GDDA 2C99A 5L8VA 4C7OA 2CDNA 3NKVA 1JJ7A 3AF3A 1Z29A 3SU5A 4WH8A 2GZAA 3EARA 4G5OA 2O8MA 2EFDB 1L8QA 2BDTA 2F3RA 2XB2A 4HLUA 2ZQ5A 4A6XA 2VHTA 3M5LA 5AUOB 4EFNA 5HR5A 5EUMA 3OHMA 2X19A 5AJZA 4HDQB 1M6NA 3EAQA 3SFZA 2GK6A 4WF8A 4JBXA 3KQLA 2Z4RA 1U8ZA 3WBKA 2HXSA 4BZXA 2WVJA 1ESMA 1TADA 3LFUA 3WNCA 2ZE8A 2LKDA 4M1KA 4OK3A 3GEIA 2ZE7A 4N1AA 1F2TB 1XJ0A 1P62B 2GXUA 2CHQA 1XEXA 2A4GA 1IY0A 1EFUA 2PEYA 2HXYA 3ZIAD 1ZM2A 4KFUA 2VHCA 2XNIA 1I4LD 1W0KA 3D3QA 2HDNB 3AEZA 1U8AA 2WICA 3CZPA 4JLPA 2G9NA 3EC1A 2QAGB 2OBMA 3FHCB 2IK8A 3K0AB 2OLJA 4O2RA 4LSGA 5AJYA 4V0OA 3WHLA 3RVBA 4DEXA 3SDZA 1OHHD 2WIBA 4I4LA 4OHVA 1FQJA 4D4LA 1DY8A 2RGNA 1AZTA 1QG4A 3LW8A 4TQ9A 3A4LA 3SYNA 3RABA 2OFOA 2GJAA 3KB1A 5E7JA 1II8A 3LY5A 1P72A 2W2VA 3UKDA 2GK7A 2GEUA 1E99A 1NN5A 4O3MA 2HYDA 1ZC4A 2IYWA 4MRVA 3CLVA 4IVRA 2V1UA 5EXTA 5GJ4B 4NKRA 4Q5IA 2RGCA 5GJVC 4WZBE 2G1JA 3A1WA 3FKQA 2ECKA 2WJYA 5F98A 3N5CA 2QE7A 1Z22A 4TMKA 1ZM3A 2DFKB 3BORA 3CWZA 3GJ6A 5SZIA 5D3QA 3GLIA 2JLUA 3R8FA 1KHTA 3SU8A 2TMKA 1CJUC 1HE8B 1YZKA 2C95A 2NTYC 4OYHA 2OCYC 4KJZA 4Q9KA 1XPOA 2F9UA 2CE2X 4NWKA 1W49A 4BFTA 4C9BA 5IK2D 3OEHD 1VIAA 3SU4A 3QKTA 1EFHA 1IQPA 2CJWB 3QF4A 2GKSA 2DCUA 4WW0A 3NBZC 1ZU5A 2BJVA 1F48A 3F5FA 4KXFB 1IHUA 4LJ7A 3X1XA 3IILA 3LO5A 4LPSA 1IN7A 4FWTA 2JJ1D 1CR0A 1KKMA 4II7A 4QGAA 2EW1A 3OIWA 1AS3A 4Q4JA 5KNDA 2OO7A 1TMKA 1NVVR 3UATA 2CHVA 4MUBA 5HKKD 2QP3A 4DT1B 4XIGS 2QN6A 4NMMA 1C1YA 2G77B 4C0QC 3K9HA 1OT3A 1KDPA 2VSFA 4M9FA 3LQRA 3OAAD 3PQCA 5FI1B 2JIZD 5EE1A 1OKKA 3P20A 4KYUA 3A37A 2FDCA 1M7BA 5GVSA 1XNJA 2QTHA 4BLRA 3T1VA 4CIDA 1JAIA 2WWFA 2OT3B 3U3JA 1UKZA 1E1QD 4GI7A 4BWYA 4PR0A 2OAP1 4M9XA 4P3YA 5CB8A 3UMFA 4XVQA 5J4KA 1FNNA 2BBOA 2V54A 3L0SA 4YMUA 5GJBA 1R7RA 2A5DA 2AD5A 2CCGA 2V6IA 4WXPA 2YC4C 5FOVA 3TUZC 3AF4A 5B2ZA 3FTQA 3BBPA 2L0XA 1L2TA 1XD2B 2I4IA 2ZTSA 3KL4A 4A1VA 4RFSB 3IIMA 3BD9A 4OL0A 4DB4A 1A1RA 1BH2A 2PZGA 4KV9A 2EQBA 4HSEA 2ZYTX 4NPHA 1WQ1R 4DSOA 3SHWA 2GNOA 2C78A 2IEYA 8OHMA 1LW7A 3U7EB 3GJ4A 5FPKA 3QENA 2PLFA 3L0PA 1D2MA 1W4BA 3EIQA 3FMFA 2CL6X 1W47A 4NP6A 4EFLA 3RC8A 4PAMA 4TYYA 3SZRA 4GMXA 4OQXA 4JBWA 5KNBA 1Z06A 2CL0X 3LAWA 1KZ7B 1AJEA 4B3XA 1G4UR 4Q7KA 2JLRA 4F93B 4MKGA 4A8JB 5KDOA 3B1ZA 4A92A 1D8TA 1IBRA 1VYTA 1R10A 3A4NA 3SEAA 3QXXA 1ZP6A 2F1RA 2C9CA 2JCSA 1R5OA 1Z47A 2DYKA 4KLZA 4TMTA 3R8CA 5K8UA 2GWHA 5KDDA 1R0WA 4X8OA 4PC3A 1SXJD 3KKPA 2CLDX 3KX2A 4AG5A 3SQWA 3WYGA 1CXZA 2OXRA 1KI8A 2R65A 1X3SA 4L8GA 4TN1A 4MGKR 2FF7A 3WNBA 2VBCA 2XX3A 4QRHA 3P26A 4D4MA 2QTVB 2DB3A 3SJAA 3U7FB 2C98A 4B71A 1G4AE 3DM5A 1F5NA 1SXJB 2B8TA 4KAXA 1FTNA 4JVLA 3CRQA 4JLJA 4OQFA 4CEIA 2GTPA 2ONKA 3KN2A 2FU5C 4X8LA 2IUTA 2VL7A 2FN4A 4M1TA 4EAQA 4AKHA 4LC1A 1KJWA 2GDJA 1OIVA 2RGBA 4AKEA 2PJRA 3NBYC 5F2EA 2J45A 1OIWA 3KKNA 2GVDC 3SV9A 2F4LA 1YU9A 4JVNA 4X8MA 5G41A 4GT1A 4U5XA 3CONA 4H1VA 4TYPA 3THWB 5KSPA 5FTMA 3AVUA 2XSZA 2VA8A 2C2HA 1FTSA 1NVWQ 2IA5A 1PLKA 1ZCAA 2RGEA 3AVPA 4Q9LA 5ESBA 2CNWA 1X1SA 3NTUA 3AK5A 4OM9A 1SVIA 3KQNA 2WOJA 3Q72A 4FINA 5FR1A 2GXAA 5TARA 4BASA 1MO3A 4DLWA 3U4QB 1TF5A 4CEHB 3M6AA 5TVKA 4D0LB 1EK0A 3QKUA 1MR3F 2AK3A 4MRSA 3A58B 4G3XA 1ZD8A 2Z6VA 2YV5A 3HDTA 3NBXX 2W00A 4MKHA 4CZ2A 3EPHA 4ZKDA 4FMCB 4HATA 3ZGXA 3W6OA 2YZ2A 4NCIA 6Q21A 2K5UA 4ASUD 2ZAOA 4W5WA 1OXTA 3QE0A 3ETLA 3SUGA 3K09A 4WBSA 4YONB 1GKIA 2QAGA 3K0AA 4LHWA 3D31A 3F3YA 3VQTA 4YDSA 3NWJA 1XXHE 1W4AA 1GNPA 3WY9A 3E70C 2RGDA 2WWWA 4I99A 4AIIA 1DG3A 1J7KA 3JZMA 5FUWA 4Q21A 3I62A 4ZI3A 2W6ID 3MJHA 1QF9A 1E9EA 1P61B 2GBLC 5CITA 4DBLC 3K9GA 4YMWA 5F3WB 4Q9IA 3UPUA 2OCAA 1T3HA 1KSGA 3CPHA 2P2LA 1UJ2A 4EDHA 1JEDA 1E2KA 1T3LA 2MSCB 4EQ6B 2H16A 2WKPA 3TMKA 2WPDA 3KFVA 4FMDF 1E9CA 4F92B 3IPXA 2Q3FA 3LXXA 3ZLJA 1V5WA 2CJWA 5KDLA 3WP1B 3C4JA 2YVUA 2J1LA 1ANKA 3WXMA 5DI3B 3EASA 1NBME 3ZYCA 1CRPA 2GJKA 1DE0A 1TUEA 3AH8A 1U90A 1ZUNB 3EWAA 4G5GA 3E1SA 1A7JA 1XFAA 4IEEA 2W0MA 2X1VA 3OEHA 4NYJR 3ZS8A 4DUGA 1OJLA 1VG1A 3LBHA 4RFVA 1XTQA 2OBOA 2OFXA 121PA 4FW9A 4IDPA 5JFGA 1UDXA 5KTYA 3GJ8A 3GLFE 2JJ1A 1S9HA 3LRPA 2BBTA 1DAMA 1TQ6A 2AD1A 4HZUA 2VP4A 1M2OB 2V55B 2ZSBA 4IHQA 4P4SB 1TQDA 5GJCA 4RZXA 2VF7A 4ITRC 4UXHA 1FUUA 2JLSA 3T1OA 5HKKA 2HYIC 3OE7D 2ZRAA 1RRGA 2C5LA 4MA4A 3CRMA 1KI7A 3JVVA 5LD2C 1BKDR 2NGRA 1JAHA 1E6CA 3OAAA 3ZQ6A 1G41A 2F9MA 1XPRA 4PPGA 2JIZA 1ZNZA 3CNNA 4LBWA 4PSVA 2G1KA 1Z6YA 3TUIC 2EYUA 1GNRA 3GJXC 3EZ2A 4LJ5A 4BLTA 1IN8A 5D3MA 3RNLA 1G7SA 1L7VC 4TTQA 5JWRA 5TY0A 1W0JD 1HA3A 3KDSE 3DL0A 3CR7A 1WXRA 4RFSA 2ZRJA 4LBZA 1GRNA 2HJVA 4NCNA 4LJ4A 5BN5A 4D2IA 2QA5A 2HLDA 2NPIA 3QKRB 2NMVA 4JJKA 2EWVA 4QL3A 4XWOA 3UWKA 1NRJB 4ZI2A 1JQJC 5FH9A 2KJQA 3HR7A 3FMIA 2JLQA 2RKOA 1AK2A 3I3SR 1Z6TA 3HYRA 1Z63A 4LI0A 2BBWA 1RJ9B 4YLGA 3BOSA 4PTLA 1YHNA 4NYMR 4RD6A 3CM0A 5DI3A 4CGZA 4JL6A 4PHTA 1J99A 4L9WA 3G0HA 3CF6R 4A8JA 3IO3A 4JS0A 1AQUA 1TF2A 4C4PA 1N3BA 3D6TB 4CYMA 1U0LA 4MYUA 1FMLA 1N2CE 4S35A 4EPWA 1IJEA 1QHSA 2V9PA 4Q9JA 1XJCA 1AIPA 4Q19A 1CULC 1YR6A 3K0FB 1G3UA 3UK6A 4PAOA 3BC1A 1I2MA 1F2UA 2IYRA 2B7BA 2FFHA 4HB2A 2K1QA 3W6NA 5KPDA 3QEOA 1FMJA 5DISB 3SV8A 4C7OB 1TL7C 5SZKB 1XZPA 2DFLA 3PVSA 4ZDJA 1SXJA 3EPLA 1J70A 3LVQE 4WOPA 2ODWA 1G8GA 3SR0A 3TH5A 3LX5A 4MDFA 2Z83A 1BYUA 1P73A 5JCZA 5BQ5A 1E2PA 1ZUIA 3NDBB 2QQEA 5CYPA 3RS4A 3GD7A 3K53A 4U01A 1NMZA 2GGVB 4WH6A 1CLUA 3NHBA 2ERYA 2CK3A 4M1YA 1UEIA 5CJPA 4XJXA 1XEXB 4LHXA 5FBWB 3SYLA 1XB2A 3QQ5A 4C0KA 3R9XA 1JR6A 2H17A 2IXFA 1S3GA 1SKQA 4U02A 2BKEA 3LW7A 5EQQA 4DLYA 3HU3A 1KK0A 1CU1A 4F4JA 1EX6A 4NL4H 3X1ZA 4OHWA 2WOOA 3AP2A 2BMJA 4I31A 4JKYA 4NTZA 3MWJA 4IJMA 2A5JA 3FOZA 1P75A 2X2FA 1P9RA 1MRNA 2GF0A 4IOJA 2H5EA 4IEIA 1E0AA 2FGKA 221PA 4TL8A 3CW2A 4Q4HA 2EVWX 3G82C 5JS8A 1J8YF 2AWNA 4PX9A 3U5ZB 1XXHA 3Q85A 3AVXA 2O5VA 3RSLA 1DS6A 4DCUA 1SVMA 2WHXA 4QKQA 1W48A 4CEJA 1IOZA 3R20A 1U9IC 4QJ3A 5GADl 1HURA 4G5QA 4TLDA 1AGRA 1DELA 2YWHA 4TZ0A 4JLNA 2ATXA 1NJGA 4QJ5A 1LVGA 3GFPA 1AQYA 5DE3A 4ESVA 1N1LA 4YC7A 2HV8A 3BFVA 1IN6A 2VF8A 1W4CA 5CM8B 3N2IA 3RS7A 3U61B 2XNSA 4URWR 3GJ7A 3TGPA 1Q57A 4ASUA 3X2SA 3SU2A 2YWGA 4GP6A 5JRZA 5LDDC 1NI3A 2RHMA 4HYYA 1QHGA 1UKVY 3H0KA 1M7GA 1RYFA 1OPXA 4Q18A 1OKKD 4OQNA 4Q01A 1SKYB 4DLUA 1FP6A 1NBMA 4GMDA 4PFSA 4A4DA 2QGZA 4HAXA 1W36D 3EW9A 2FV8A 4V0KA 1JXOA 1E9SA 4D80A 2IS4A 1KJYA 4POAA 3H84A 2W6IA 1T0HB 4EQ6A 1DO0A 1GWNA 1UM8A 1X6VA 2ORVA 3DEFA 4LJ6A 1GKYA 4M1SA 4V0LA 4HEJA 3ECCA 3GLFA 4OK6A 2J46A 3CPEA 3NVAA 3FDIA 4TLCA 1W36B 1NP6A 1CEEA 3ICQB 2PLRA 3CX7A 5KNCA 4D6PA 2O0KA 3GQBA 3DVLA 1ODFA 2KE5A 2H7VA 3DZDA 2PBRA 3Q8XB 2YNMA 2YOHA 3IO5A 4GSYA 4RCYA 5TMPA 1IM2A 1H65A 3QIAA 1UPTA 2N42A 2AN9A 1ZUHA 1G6HA 4IXNA 2BCGY 1WF3A 4LJ8A 4OHZA 1QG2A 5G3ZA 5JCPA 4Q1DA 4AYTA 5KSOA 1ESNA 4TYDA 5P21A 3W9YA 1KZGB 2P6NA 1KI1A 3ASZA 4MRPA 3VR2A 2QZ4A 4ERNA 4P4SA 1WMSA 4XWAA 3AVVA 2WJVA 2ZI4A 2PL3A 1MKYA 4LV5B 2RGXA 3ONWA 1P9WA 4I1SA 3TE6A 3R9IA 1PLJA 4AURA 1DAIA 4K46A 1IXSB 5BW8A 2OK5A 5KSZA 2ZXUA 4R8TB 1G9XA 3IQWA 1PJRA 2VQSA 3KKMA 3T12A 4IFEA 4IDQA 1Z08A 4PC1A 1W5SA 5SZHB 5JEEA 3I8XA 3RLFA 2GJSA 3THYB 2BC9A 4E07A 4ARZA 1OH5A 4AK9A 1XX6A 1XJQA 5B58C 4B43A 2P67A 4GPTA 4DDTA 1GITA 1NSFA 1R5BA 1ETUA 4RD4A 1NN1A 4B75A 3FE2A 4MRNA 3EC2A 4QHTA 4NCJA 4WZ6A 3QKRA 2OEPA 2CL7X 3TUJC 3RC5A 1E1RA 3D8BA 3AB3A 1DVRA 2MMCA 1AKEA 1W0JA 1TEXA 1MOZA 1PUJA 5KU1A 1UAAA 1ZM4A 2WWXA 2V7QA 2RGAA 1N6OA 3S1AA 1YZLA 2R6FA 1IONA 2WWGA 3P27A 4IVPA 1GILA 2CVFA 3SNHA 4QOSA 4UJ3A 5JJKA 3CH5A 2V1XA 4CEIB 2LWIA 2DHRA 2XSZD 4LJYA 1OYYA 3FFBA 3B7GA 1JPNA 4PZZA 2CNWD 1DXPA 2J3EA 4DEYA 4HUTA 4WIAA 3U7HB 1YZGA 1FNMA 4M21A 1DO2A 1GFIA 5KHOC 3PR1A 3TLXA 3BWDD 4EJSC 3HU1A 4XVRA 621PA 2P0EA 3U44A 5H70A 3AP3A 1GIAA 2HT1A 2H18A 3UG6A 3VKWA 2ZRLA 2VP0A 2JLWA 1Z0JA 4MH0R 3RYTC 3OIVA 2BWJA 3ZVRA 2FE4A 2VP5A 4UXJA 2DPXA 4FWIB 5ANRB 2REBA 4A1XA 4B2LA 4NHOA 4QNRA 1G7TA 3MMPA 1CBUA 1KDTA 4M9SA 1OFIA 4A2PA 4DLZA 4EPVA 5KPJA 3L0IB 2RHDA 2HF9A 3OESA 3RS5A 1KGDA 1KI9A 5EJEA 1NN0A 1TQ4A 3PEUA 4A2WA 4ZV4A 4EPXA 2BHRA 1WRBA 1ZVQA 1T91A 4MYHA 3UIEA 3WP0A 2GCPA 2NO9A 2ZJZA 3WRYC 5IDVA 4QBFA 4XVUA 3K70D 2C9YA 1COWD 3CZQA 3H2YA 4RD3A 5KUTA 2CHGA 3SBDA 3UXMA 1ZAKA 1YRAA 4XWKA 1QHYA 2ZJ8A 4L16A 3V9PA 2F43A 1SVOA 4PHGA 2D06A 3H1TA 2VP9A 2XAUA 3K70B 2ZRCA 1FP7A 2NPFA 2ZU6A 3GCGA 2WMNB 2BM0A 2ZI9A 2BEKA 3KJHA 2PZEA 4I1OA 1GG2A 1DAKA 1AGPA 3Q7QA 2QSZA 4CT5A 3ND9A 3T1TA 4YDHB 5FTNA 1M74A 4DLXA 4Q1FA 5JWOA 4WA7A 1OH8A 2IEZA 3SUDA 2ZS7A 2WPDD 4JL8A 3THXB 2ZRBA 1Q3HA 4LX0A 1RFLA 5FL3A 3BJIC 4UKDA 1YZTA 3L6PA 4XTRA 3T06B 3CRVA 2XCFA 1G8FA 3BH0A 1E2EA 4HB0A 1T4GA 2YWFA 1Q21A 1Y3AA 4BFWA 3TRFA 2PEZA 2X77A 1G17A 3LBNA 4DB2A 2V6JA 2NQ2C 2R6AA 3CRRA 2GEDA 5FBQB 5J47A 4LWZA 1NLFA 4LHZA 3LBIA 4M22A 4LYAA 4Q7JB 2A3RA 4XTCS 1WDTA 3QG5A 4DUGD 4QGHA 4D81A 2HF8A 2WIAA 3AQ4A 2CVHA 3A6PC 2XZOA 2IX3A 1S9DA 1I4DD 4B47A 1Z2CA 2GEVA 3RRMA 4AC9A 4A2QA 3WMGA 1NVXQ 1LS6A 4O0MA 5FUXA 3I61A 1G5PA 3U7GA 1GL6A 3KUDA 2G6BA 2BMEA 2IYSA 1JALA 2BOVA 3C15C 3T61A 1QVRA 3RRZA 5FPTA 4FIDA 3U1IB 3KF2A 2IYZA 2P5SA 2J0UB 3PIRA 4HUQA 1Q44A 5CLQA 2JAQA 2VHJA 4B3GA 5EUQB 2JLYA 3RS3A 3SN6A 3TBKA 2C8VA 1YZQA 4HZUB 5IRCD 3CX6A 1IXRC 4D4JA 1ZM9A 1XTRA 2BBSA 2F6RA 5HE8A 1KK3A 2FFAA 4URVR 2V4ZA 4JZKA 3SJZA 3B1WA 3NH9A 2F55A 1KI3A 3X1DA 4GOJA 1PZNA 5C4GB 3PV0A 4C0AC 1SVKA 1QHHB 1UF9A 2D7CA 2GAAA 4I33A 4NYIR 4UNNA 3SU1A 2HT6A 3L82B 4US0R 4QGFA 4G01B 4Q7MB 4KHZA 4DSUA 5FOTA 1X8JA 5FFMA 2HLDD 1OXVA 2EFCB 5KO2A 1UBCA 5EE5B 4Z54A 5D3MB 5H1YA 1Z0FA 3I5XA 4M1WA 2ZRKA 1CJKC 2PCLA 2ZSFA 3VR3A 2OESA 3OZXA 3ZVNA 4KODA 2ZE5A 3OIYA 1U2RA 2ZUDA 2IXGA 5JI3E 1G8HA 1NIPA 4P31A 1W2GA 5L3QB 4BLPA 1TX4B 3KQHA 4KBFA 3RSOA 1LV7A 4QM6A 4R98A 3QKSB 5EXSA 1GUAA 3UANA 2QNRA 3U60B 2QMHA 4NDZA 4GZLA 1E69A 2O8FB 1MO5A 2J0QA 3T15A 2QT1A 1CR4A 5EZ5A 2QUZA 1WB9A 1TUIA 1E2JA 3AUYA 2KBEA 2BMFA 1LFDB 4JLBA 2W6JA 2WV9A 4PSKA 2JEOA 4JYCA 3THYA 1JI0A 4Q1EA 5DYGA 1UBEA 4IRUB 2GXSA 2VO1A 4N0DA 4BZQA 4JLAA 3WMEA 4BRUA 4BECA 2W0SA 1MRSA 1KI4A 2NIPA 3I72A 3CX8A 2XGJA 1F2UB 1VPLA 2YKGA 1RW4A 1NL3A 4DCTA 4TMWA 1JR3E 1XF9A 3TQFA 3FHTA 4E09A 2XJ4A 2EFHB 1KOFA 3GJ3A 1JPJA 3VR5A 2GJ9A 5AR1A 3QI2A 1SQ5A 4ZDKA 2WJGA 4ZCIA 1CP2A 1S3SA 1M34E 2A5FA 2CK3D 4IOKA 4FCVA 3SI7A 2NO0A 3LNCA 3OIUA 4XSGA 3W5IA 1E9FA 1U94A 5J4VA 1YR9A 3J81k 1HUQA 1VTKA 4LY6A 3SYKA 4A6PA 1K6MA 1VMAA 5JHGB 1H8EA 4I1VA 2IYYA 4PQYA 4C2TA 4B76A 1S1MA 4D25A 2A9KA 2H57A 5EP1A 4PZYA 3REGA 3T5DA 1ZIPA 4E5UA 5JHHB 3B8HA 3VU9B 3SQXA 5K8IA 3BB3A 1S8FA 2VP6A 5GPIB 3QOFA 4KO8A 2KWIA 3ZDQA 2IUSA 4DLVA 4B73A 1N6RA 5KSYA 2C9OA 4URZR 4URUR 2QMEA 1CJMA 2ZRMA 5FL7A 5EZ6B 1N0WA 1XEWX 1PVOA 4K81B 1DXWA 3SOPA 4R71A 4AKIA 1YZUA 3W3ZB 4Z8YA 3DMDA 3SV7A 4QBIA 2FMXA 3GLGE 4Q4HB 2FG5A 1E79D 3K0EA 3IKJA 2WWYA 2QV1A 1OFUX 1Z5ZA 4NYMQ 1XXHB 4AKGA 1NY6A 1S2MA 2RAPA 3EA5A 5JBQA 2FEMA 5CK5A 3W8RA 4DZZA 3DM9B 4TT3A 3Q5DA 4ZPXA 2A7QA 4MQBA 4CEJB 4PO1A 4BEJA 4UQOA 3VFDA 1JEEA 3GFOA 2R6DA 2FOMB 3V00A 2WKRA 4TWZA 3CRW1 1G291 1LTQA 3NC1C 1R2QA 2ANBA 2R2AA 3BK7A 3PUVA 2EWWA 2ZSEA 3VTKA 2J59A 4EJSB 3BRWD 1NBMD 5EQSA 3IQXA 3MWLA 2XZLA 1CKEA 3WNDA 1G1MA 1KMHA 1COWA 2QL6A 2ZROA 1OXUA 2A2ZA 1NLZA 4P33A 4JVMA 5BYKA 4BPBA 3THXA 4ZIRA 3FMPB 2ZPTX 3NEJA 2E1RA 5C2JB 1CJVC 1NNEA 3M5OA 3EIHA 5HCIA 3WYAA 2O0HA 1NSTA 2EU8A 3SHFA 4QHSA 1ZM7A 1SULA 4EPYA 5FUVA 3TSWA 5EXPA 4FI3C 2PH1A 4LJAA 4BRWA 2N46A 1XP8A 3L2OB 2HJGA 4O25A 2ZUCA 5JSZA 2A4QA 3RAPR 1KO4A 3GLFB 2FWRA 2CLSA 2IWHA 3LKWA 3Q9LA 4NBSA 5JECA 2IF0A 3PUXA 1KIMA 3D7MA 3HPRA 4G0NA 2DWOA 2QTFA 3EG5A 3RC4A 4KFRA 4P4UA 2J7PA 2UZIR 4TLBA 3AKDA 4TMZA 3PFIA 1HTWA 1VG9B 3DMNA 4HAZA 4HLQB 4DC9A 2ZI6A 2B8WA 2CEAA 3KKOA 2F1HA 2OXCA 2J0UA 1YZNA 2D74A 2F7SA 2O8DB 4PANA 721PA 3DKPA 5G3YA 3MWYW 1OB2A 4NCKA 4FCWA 4PO9A 1IY2A 1UEJA 1XTSA 2W2TA 3IGFA 1OH6A 1QDEA 1UKYA 4BFZA 4A9AA 1D2NA 4E03A 1VCIA 2W58A 4LJ9A 4AYWA 1G64A 1U9IA 5BYJA 1G8PA 2OC7A 3B85A 3UMSA 2AKAB 4C0SA 5FOUA 2WAXA 3RRYA 5DYIA 4Q1AA 4A0HA 1Q1ZA 2ZRFA 3SFVA 2BIFA 4BE7B 1MO6A 1QHHA 1E98A 1U8YA 2Q9BA 4JT4A 1RTLA 4L15A 4B2IA 4A82A 1GZSA 1N6PA 3SE0A 4EIWA 4PPNA 1JQLB 1N5IA 3I1FA 2BV3A 4YMTA 2ZAMA 2D3WA 3BERA 3E5HA 3A1UA 4BLOA 3SU6A 1E1RD 1RYHA 1T8TA 2WWIA 4V02A 2A78A 3ZJYA 4QXAA 4ARZB 3A1TA 1RZ3A 4ZDIA 2JJ2A 2V7QD 3QPWA 1JJVA 4DSTA 5IF9A 5L3QA 1JB1A 4JLOA 3B1VA 1YE8A 4D82A 3BAFA 2GRJA 4GP7A 2LKCA 1WCV1 5AJVB 1OH7A 2Q21A 3QKSA 2QRNA 5EXXA 5HZKA 4PQFA 3QVUA 3B1XA 4LHVA 3VAAA 2VSOA 2O8FA 1XRJA 1X8LA 3PV5A 4JBYA 3AGPA 3S1AB 4JSYA 4N3NA 1E2FA 3W6PA 1UDWA 4B32A 5J40A 1II0A 1V43A 1JR3A 5B6LA 1E2HA 2OV2A 3KXLA 5CDFE 1TTTA 1G5TA 4C0JA 5JEDA 1Z2AA 4B3DA 1UKEA 2IW3A 1WA5A 4DLTA 1TF7A 5DN6D 2O0JA 1FFHA 2GXQA 5JJIA 2G0TA 1ZD1A 4IXMA 5DLQC 2AFHE 4P4TA 2BVNA 1A2BA 1XD9A 1PV4A 4LBVA 1EX7A 1CRQA 1Z07A 1W4RA 3HYTA 3KUCA 3PUWA 4XD7A 5DHFA 1PLLA 1N25A 4LV8B 3RANA 3NHAA 4DSNA 3AVYA 1E0KA 2ZI5A 1N5JA 4Q47A 4GOKA 3U44B 4DDUA 3EZ7A 2G88A 1CR1A 4RI0A 2PX3A 1WE2A 4V0NA 3B78A 3W5JA 4DDVA 1E9BA 2WSMA 2UZ3A 5DGXA 1OSNA 4WAUA 5FBRB 2C77A 2FSIA 5JZVA 2J0VA 2Q6TA 3SBEA 2QPAA 2O8CB 3O8RA 4KSCA 1DARA 1YKSA 2QAGC 3BGWA 5J4YA 2J41A 2BM1A 1RRCA 4WVFA 2ZRPA 5SZJA 5JRJA 4LZZA 5DI9A 1KMQA 1NG9A 1B23P 2BMDA 2NO6A 2RH5A 4KU4A 3GLGA 4OI0A 1TEVA 5DH9A 2AL7A 4Q66C 3U2QA 3VU9A 3BIFA 5EE9A 2SHKA 4NCHA 3FFAA 2CBZA 2F1JA 3NIBA 4MGIR 2Q3HA 4HAYA 1M7HA 3BH7A 5EPNA 3DKVA 5CIQA 4GZMA 5HE9A 1KY3A 3QXSA 2F43B 2BJWA 4RZ3A 1VKJA 2FFBA 2XTZA 4G1UC 3LOXA 4KFTA 3IBGA 5FPYA 1KI6A 4PC6A 3IDQA 3T1QA 1GL7A 2FEOA 1ZNWA 1CS4C 4Q48A 1GNQA 4B34A 4TSFA 3OEED 3LQQA 1VYUA 5AUNB 2EFEB 5E7MA 1NJFA 1XCPA 4HB4A 1DBSA 3FB4A 5BN4A 3E2IA 2PMDA 4PPFA 3LVRE 1E32A 3SJCA 1T3SA 1E79A 3KJEA 4IDNA 4CT4B 4ZCLA 3MRSA 2ZM5A 1CJTC 2OBLA 1LF5A 2CLCX 4PPQA 5GVRA 1R8SA 1S0UA 2GILA 4EJSA 4HDCA 2PZFA 3ZVLA 3X1WA 1KSFX 1W5TA 1I4TD 2FPLA 3DDCA 4BGDA 1JECA 1BYIA 2H92A 1B0UA 2A30A 1XMVA 2PMKA 2QPTA 1KNQA 1OF1A 4OKSA 1SGWA 3F0TA 5HCNA 4LBYA 3LWNA 3FMOB 1RKBA 5C46F 4OJQA 2JA1A 2P65A 3K0CC 2FNAA 5H4IB 2IF2A 4HAUA 4HUQB 1Z83A 1II9A 4RY2A 2FA9A 4CF7A 1P4SA 1AN0A 5FTLA 5DNYB 1MO4A 1G8YA 4PHHA 5TB5A 1E9RA 1E0SA 4YMSA 1D6JA 1R4AA 4RZ2A 2IXEA 2R6GA 1ZCBA 1OFTA 1ZD9A 4RVCA 1P9NA 1CTQA 2GCOB 2VIIA 1S1CA 1OV4A 3GLIE 2V8OA 1NMXA 1CF4A 4IW3B 2FJUA 1OXXK 1U98A 5G53C 2IJOB 2W2XA 1XD8A 2OFWA 3IHLA 1KO8A 3L8ZA 4R9UC 2JLZA 2ZR0A 4R2IA 4BZPA 4PO8A 3U6KA 2EYQA 2QBYA 2O8DA 1W2HA 1QBKC 2WWHA 4GDFA 3OTPA 3FHOA 3GJ0A 2NO1A 3M5NA 3QVVA 3N70A 3QUSA 4UNSA 3FVQA 2J87A 4AYXA 3PEYA 1UFQA 2ODEA 1T5LA 4RD0A 4RKEA 5JMTA 3ADBA 4DCSA 1R0XA 4M2LA 1LNZA 4W5JA 5BWMA 1XMJA 1AM4D 1ZBDA 2FSGA 4LDJA 2MSEB 4DHEA 2XJ9A 2W6JD 3K1JA 4FMCF 3H09A 4ZKEA 3LONA 3TR5A 4DCVA 1D9XA 3ZVMA 1DAFA 2ZREA 4URXR 3BFKA 1E2IA 1G3QA 4I32A 1US8B 1Z6GA 4CRWB 2GVFA 1Q1QA 3FGNA 2YOGA 4LGMA 1WBDA 1LB1B 3KJIA 3B13B 4IVQA 1RPZA 3E90B 1ZIOA 1OLOA 4A15A 1SXJC 3V4FA 5CDFA 1NVVQ 1SHZA 1BMFD 3U1JB 1P6XA 4JJZA 4G5RA 1XCMA 3QG1A 3AUXA 1KSJA 3AVQA 1Z28A 1KO1A 2C96A 2QEQA 3MJRA 2FPKA 2QMUA 2ZR7A 1R6BX 3TR0A 3C16C 1ZW6A 1MV5A 5EPYA 2EFGA 3CBQA 1U0JA 3NEYA 2DR3A 4ZO4A 4JYBA 1EFCA 1F60A 1H8ED 4TTPA 5LD2B 5T1VA 3CUEF 3DPUA 1H8HA 3MSXA 5FOSA 3KQKA 1HT1E 4NYIQ 3TW8B 5BXQC 2LCFA 4HZIA 3KB2A 2MMGA 1IXZA 2FSFA 1D2EA 2FPMA 1FZQA 2WJJA 5FL7D 3RHFA 3SV6A 1ONBA 4M8NE 1FOEB 4LYFA 1TAGA 2H8KA 5DN6A 1G7RA 2IYTA 4O2LA 1GRQA 3LV8A 3CH4B 2ZE6A 3CPJB 2AK2A 2ZETA 2ZRDA 1F6BA 5L3SA 1U81A 3UWOA 1DOAA 1GTVA 1EFRA 4A0GA 4BEBA 1QZXA 3AM1A 4KI0A 2OC0A 4TT3D 1E2MA 1KTVA 5FR2A 3QY0A 5LBIA 1ZRHA 2JLVA 2O8CA 2XCNA 3K9NA 3A4MA 5CK4A 1GM5A 5KOYA 1AS2A 3AF0A 1GKUB 1GP2A 1W3CA 3L0OA 1MH1A 1KKLA 2IC5A 3OYPA 4AG6A 2A5YB 1ZINA 2AWOA 4MKIA 3VKHA 3SYJA 3AV0B 3SUEA 1G18A 5M04A 4GFDA 1NMYA 1EFTA 1VG0B 1YR8A 5JJLA 4QBHA 1X8KA 2QG6A 2YC2C 1OB5A 5HZHA 4ON9A 1O87A 3KTAB 1IN5A 3ZZUA 2AFIE 4H1UA 3TK1A 3NG1A 3VMFA 1Q20A 3IUYA 4XH9B 3RDPA 3TIFA 4FCTA 1X86B 1KMHB 2O8BA 2B92A 2OCBA 4WZAE 3GEHA 3MG9A 2WJIA 3GEEA 1DY9A 1YR7A 2IUUA 4GL2A 4PHFA 3ADCA 3CO5A 1XTJA 3U3KA 521PA 1S4QA 4KVGA 4ZIRB 2ZVQX 5IT5A 2AXPA 4TMXA 1DADA 1U0HC 2Q9AA 1NVUQ 3P1JA 2JASA 2JLXA 1T5IA 3TVDA 4BQSA 3LLUA 4X8HA 5C18A 5EQRA 3MWKA 2YINC 3CKLA 1HQYE 3EZFA 2QAJA 2RGGA 3AVWA 4NONA 2V3CC 2J7PD 4HLCA 3OEEA 1XMIA 2WKQA 3L43A 5JSZB 4A0FA 4CW7A 4W7SA 1NF3A 3ZD6A 2ORIA 5J4LA 3ZS9A 1Q0UA 1Q22A 1Z6XA 2C03A 2ZRGA 1BOFA 4K8BA 1OIXA 1KDRA 2REXB 3QPUA 3K0SA 2CMKA 2DFNA 1XWIA 4LHYA 4NU0A 2VHUA 4A1FA 1S96A 2D2FA 2XZPA 2A4RA 3EXAA 4Q02A 3I5YA 1YVDA 3FYHA 1TPZA 2OILA 3MD0A 2JDID 1N0VC 3CF2A 4OK5A 1NKSA 3EYDA 1G21E 2GCOA 4MDEA 1NLYA 5CB6A 4C2UA 4KTCA 2REOA 2Q9CA 3MCAA 4HAWA 4BFUA 3CB4A 1UBFA 5CJ2A 4KYIB 2W83A 2ZRNA 5F9HA 1A5TA 2JJ2D 1Q1BA 3U3MA 3VHXA 3M1IA 1ZC3A 1R8QA 3EZ6A 3O47A 3MFYA 1P2UA 2NZJA 2QSYA 5FI0B 3KJGA 3ADDA 3RC3A 1EXMA 2VRWA 3TSOA 2G3YA 5AK0A 2IS2A 3KXKA 2ODNA 3Q5EA 5AJWA 5E3HA 4TLEA 2GBLA 3K9LA 2P6RA 2XTNA 1A1VA 3HPQA 2XEXA 2Z43A 3LXRA 2FSHA 1P7CA 4MYTA 4ACAA 3QNUA 3U6BA 1ZU4A 4ABYA 2OBQA 2WAYA 3Q3JB 4Z8XA 3EPJA 5EP4A 2ZYWX 4PSAA 1VCMA 2YOLA 1JR3D 4EKDA 1VIYA 1OE0A 4V03A 2OZEA 4Q03A 1G16A 2ANCA 3N2EA 3NC0C 2F9VA 2IYUA 3LD9A 3PITA 4M4SA 4U00A 2YYZA 4DIDA 2XXAB 1KYIA 4TL6A 1BT7A 5JS7A 3O8BA 2Z0MA 1KAGA 3WRXC 1US8A 5A5GA 3LLMA 4PAQA 1SZPA 2BEJA 1N6KA 1A82A 1DAGA 4TL7A 4H9GA 3VR1A 4XD7D 4BLQA 2WSSA 2J5XA 3PG5A 1J8MF 5AUQA 2ZEJA 2GAOA 4NYJQ 1R0ZA 4D4KA 4US2R 4HLUC 1HEIA 1VDZA 2J7KA 5A4JA 4QM7A 3NBFA 1XCGB 5IHPA 3GPLA 2P3SA 4HB3A 1TQ2A 4FXPA 1EWQA 1HH4A 3PCRB 3AKCA 2PX0A 4JL5A 4MGZR 4DXAA 1ZJ6A 1RE0A 2ZS9A 3DOFA 4MITA 1BMFA 3EA0A 2R8RA 1E2GA 1KY2A 4L5BA 3IIJA 5LPNA 4Q4LA 1L4YA 3AVOA 4OI4A 1T8UA 2ZJOA 1N0UA 4Q4AA 3EIEA 3QBTA 3C41J 1CR2A 2IBMA 5L3VA 2DWQA 3FPAA 1N6LA 5EP2A 2QI9C 3GLHB 3TAUA 4FMBB 4I81A 1DAHA 2I3BA 3VX4A 1E2DA 1N5LA 5EE0A 2QMOA 2B6HA 4M1MA 1FQKA 5CIWA 4ZDWA 3M4YA 1E2QA 2RGNC 3AKEA 1WBBA 3GLGB 3B2EA 4RD1A 4BFXA 4JLMA 2BCJQ 2FX3A 3T5GA 4A1TA 4J0QA 4M53A 4JLVA 1KK2A 2AX4A 2CE7A 1G7CA 2IHYA 3EWSA 3LDAA 3RRNA 1FPMA 5K8LA 3IPYA 1W7AA 1G3RA 4PXAA 5JWHA 4JMYA 3GLHE 4TSFD 2GCNA 2UKDA 4A36A 1C9KA 3VR6A 4TTRA 1EG7A 3CIOA 1W46A 4LYHA 4QGGA 4EFMA 2FM2A 1MABB 4OQMA 4R2HA 1KI6B 3IHWA 4XOIA 5H8WA 1YJ5A 4E22A 3NXSA 1SXJE 4RKFA 1DAEA 1WXQA 5BN3A 3ZD7A 4PZLA 5TV2A 1QHNA 4YXWA 4ACBA 4QG7A 4JSTA 4K8OA 4W9MC 4DIEA 5A0FA 2QY9A 4TMVA 4DLRA 4KVAA 2MSDB 1LF0A 2WM9B 4S2EA 3C5CA 2HCBA 4Q7LA 1ZNXA 2GF9A 1DTSA 2Q0HA 3BB1A 3QJYA 5K8TA 3KTAA 4BFVA 2ATVA 2NO7A 4OI2A 3RS2A 1I2DA 2N1BA 2JATA 1XEFA 3DHWC 5DIFA 4BFSA 3OFND 3BXZA 1RVDA 3CF0A 3V4RA 4PQRA 5FOXA 4DDWA 1F2TA 3BH6A 3IIKA 4URYR 1J2JA 5H68A 4KFSA 4QJ4A 2OBNA 3FKSD 3TQCA 2OG2A 5FUYA 1W36C 2ZANA 4GRAA 4DCNA 3TSZA 4Q1CA 3DO6A 5AJXA 4BLSA 2XTMA 1XEWY 1Z6AA 2ODBA 3NH6A 1M8PA 3BS4A 3SU3A 2OLKA 2Y8EA 3DZ8A 3U3OA 4MRRA 1SVLA 4F7WA 3LX8A 3ZIAA 4A0RA 5ELXA 1XTIA 5J5CA 4TQUS 4R7ZA 2ZJBA 2ZSDA 1NG1A 2XB4A 3SUFA 1KDOA 1BO6A 3ND8A 3PEVA 4OBEA 1A2KC 5FTJA 2C04A 4B44A 1C4OA 2D7DA 2QM8A 4D26A 1E3MA 1OHHA 2DY1A 2XITA 2ZYUX 1HV8A 1CIPA 4B3FX 3KEEA 2ZRHA 4UNPA 3ZH9B 1BS1A 4PC2A 2RMKA 3CR8A 4LOAA 4ZCMA 1AKYA 1RRFA 2VP2A 1T0JB 1W1WA 4JLDA 3SZEA 3B9PA 5ETXA 5DO9A 2QBYB 5EQTA 2ZRIA 1DG1G 1E2NA 5L3RA 3LA6A 1XBTA 3LH5A 4OHXA 4Q1BA 4OHYA 4UNRA 3AVTA 4B6EA 1VG8A 1N6IA 2VHQA 2ZI7A 4L4UA 1IY1A 2XNDD 3QBVA 2VEDA 1YRBA 3R9WA 4KLNA 821PA 3QF7A 3A1SA 3CWQA 3RS0A 1FX0B 3I4LA 3IEUA 3QSYA 2X2EA 2QGNA 2OC8A 4LPKA 5IK2A 4C30A 2AXNA 3KFXA 4QC2A 1N6NA 3ZZTA 4DT1A 4WXRA 2P5TB 3GMTA 1P3JA 1QHXA 5TDHA 1FW6A 2WBLC 2JDIA 1N5KA 4CDGA 2FP7B 2XOKD 3KKQA 4XSHA 5JI2E 4Y0VA 1VCOA 4NH0A 2ZS8A 1HT2E 3SS8A 2VLIA 2OUKA 5HTKA 4RD2A 2IYQA 3QEJA 4LCBA 2I1QA 3R7WB 3PENA 3EPKA 2FZLA 2QQ0A 3RC6A 3MUFA 2GZHA 1KSHA 3SU0A 2IHBA 1AS0A 2RCNA 3K0CA 3C8UA 3PJRA 5AUPB 4D0GA 3WHKA 2D2EA 1KI2A 2ZUBA 1L4UA 2IYLD 2E9SA 2NG1A 4AI6A 4C0LA 1K5GA 1VCNA 2FGJA 1Z0IA 4M9QA 1H8HD 2IYXA 3ICEA 4HI0E 1GOTA 3W3AA 3SC3A 4Z1MD 2XXAA 4QHYA 2FFQA 2OCPA 4HDOB 3VKGA 1JXMA 1VHTA 3HWSA 3O8DA 2OC1A 4V0ME 2AR7A 3DOEA 4UNQA 5E95A 1SVWA 3A36A 3VX3A 1E1QA 5B64A 3T34A 1E9DA 2P59A 1JNYA 1XD2A 1ZNYA 2GESA 5DHAA 2ZITA 4IOLA 2DFTA 3OF5A 2O8EB 3P8NA 1IN4A 3FWYA 3L8YA 1EESA 5DSZA 5FBLB 4YMVA 1LY1A 4B48A 3RWOA 2GJ8A 5JLJA 3P4XA 1HE1C 2IT1A 1IJFA 1E4VA
chains in the Genus database with same CATH superfamily
4AJ2A 4CV2A 2ZVDA 2J0SA 3UMCA 4XM1A 4RZUA 4ZMRA 4JEUA 4I9FA 4GYKA 2DBYA 2H59A 5K1ZA 4IQGA 3B3FA 5C4MA 4R9SA 3NUMA 2PKAB 4JLKA 1U9JA 1O2ZA 4R8MA 3B82A 3FTNA 4KKXB 5IJ9B 4BX9A 3H8SA 1P5ZB 1IHOA 1GY8A 3M83A 4ZV9A 5I7AA 5KVCA 1PPGE 1A95A 4IIVA 2CXNA 3TZ6A 3IBSA 2O1SA 1DKRA 4HKTA 4QFMA 4P36A 4DLSA 4C0HA 3IBYA 3V4PB 3B5JA 3QUTA 4LSZA 2B61A 3UBMA 3WBJA 3H5OA 1G3IA 2OV6A 4OP1A 2PANA 4BS9A 4FLMA 1T35A 4LDNA 3FP6E 2VDWA 1Z8RA 3RM3A 3K6ZA 16PKA 1PZXA 3PTNA 2BR4A 1LS1A 1X39A 5AW9A 3L7BA 3FKSA 1THMA 4YECA 5AQ1A 2C4MA 1XU4A 1AHHA 1WMAA 4Z9XA 2ZVPX 4LC0A 4CU5A 2ADOA 3C3AA 4FUBA 3L0YA 1GL1A 4QYIB 3ASYA 1MX3A 2ZJ5A 2OO5A 5IUJC 5JBNA 2ZBPA 3ECAA 1H69A 3BCSA 2O1EA 2FAXA 1OXSC 4EUKA 2R8PA 2JHAA 1I2CA 5F53A 2PVCA 1VHLA 4IDCA 5C1BA 3R7WA 3I01M 3WQBA 4HO1X 5M34A 4NU6A 5KTTA 4JP2A 3RGWS 4G2TA 4TPYA 4FUJA 3OE7A 3BUSA 3PE4A 3BFXA 1GG5A 3PWZA 1TAHA 2GA9A 1O5AB 2D0IA 4F3KA 4FFNA 1JN0A 1G3MA 4Q4AB 421PA 4OA8A 3KLOA 5FO1A 1LVUA 2NZ8A 5IBQA 5HGGA 4IHKA 2VDVE 4GBMA 3V4SA 2VPPA 2IYPA 1P2TA 1DIOB 5AQEA 3KXIA 2G5CA 2E21A 1HFKA 5EQFA 4UBIA 2OINA 4B3BA 1V2QT 2R6CA 3NKVA 1JJ7A 1T0IA 4YH1A 1DFIA 1U2GC 3I5AA 4Y9RA 3NHPA 4C3OB 3LC7O 4HRXA 2VHTA 4PLWA 1WD7A 5HR5A 4GL4A 4QXMA 4WF8A 3KQLA 2Z4RA 1GPNA 1BTPA 4HQNA 1ZM2A 1Q7BA 1J2TA 2HDOA 1GPH1 5DYTA 3DEJA 4OHVA 2YIMA 3RJTA 4ARSA 4MG3A 2Q5CA 1FDSA 4U6NA 2NXEA 4AWAA 3BMXA 4AN4A 1M1YA 2W2VA 2I6QA 1TYDE 2OP9A 3SSMA 2V1UA 1OBFO 1IG3A 3N5CA 4Q9NA 1ND6A 3SZMA 4B81A 1QB6A 4BFTA 4UHDA 3KJNA 1I5RA 4WW0A 3LO5A 3GFQA 2JVKA 2YY5A 3EGXB 2VKQA 2DUCA 1TMKA 3RXDA 1CY6A 3RYCA 1NJ2A 3PU6A 1QHRB 5L40A 3P20A 4TXLA 2JFBA 1TVKB 5I45A 5EOKA 2HBYA 1NVAA 2WWFA 2OT3B 1PT7A 1WUIS 4GI7A 4M9XA 2BBOA 2OBYA 3ONVA 2I4IA 1TIOA 3FM9A 1BFKA 2G81E 5D6NA 2GUGA 5IVPA 3H83A 4HVTA 3GNLA 2L42A 2O06A 4MVJG 4UZFA 1KZ7B 1AJEA 3GJZA 4EUEA 2H85A 4RVGA 4MUJA 5E6UA 2JCSA 5KDDA 4X8OA 4BP3A 5L7TA 4AG5A 2OXRA 2R65A 2FF7A 2EQNA 3U7FB 2C4FH 4XB6B 4OMCA 4Q0MA 3EVTA 4OQFA 3VYWA 1T9BA 4N65A 3CMCO 3KKNA 1P9OA 2CUTA 2EP8A 2I65A 4H1VA 3R9XB 5GIPE 2BY7X 3AVUA 1GADO 1LSOA 4GMHA 4YY3B 1STOA 5TARA 4QG3A 1FVFA 2NYVA 3EPHA 4SGBE 2QD1A 1EUQA 4E2WA 2QAGA 3VZPA 2ZAIA 1YPEH 4EB0A 4MQFA 5JCXA 1J7KA 4LC9A 5H02A 1C9EA 3LP8A 2Q1TA 2OCAA 1JLLB 3BTSA 3DW3X 3AR3A 3PHHA 1DAOA 3GUZA 1ODCA 1IMJA 2GCTC 1JF8A 1UDAA 2H5JA 1V5WA 3C4JA 3R7DA 3ILHA 4IEEA 1JZQA 5A4IS 4MPJA 5TQ0A 4DUGA 1YRWA 4JC5A 1YH3A 4TQGA 3HFJA 3MO6A 4HZUA 2YASA 4HDKB 2I6XA 2WHPA 1AU9A 1OZ0A 4HNUA 4G8DA 3UVEA 1EEXB 4AS1A 2B69A 3TCNA 4B6JA 4NV1A 2HLDA 4N8SA 4R9RA 2Z8ZA 1T9GR 4YJ3A 3HUDA 3ODFA 1EATA 1A5HA 4ZCQA 2NMVA 4KI7A 4I8GA 4H59A 4PE5B 1JQJC 2G5NA 3L6EA 1TPOA 2QUBA 1O39A 1KZ9A 2AZMA 5U4QA 1KJ8A 5C67A 1SGPE 3EVGA 1SQOA 1AIPA 2AS9A 2BFDB 3RTDA 1HYHA 1KFJB 3W6NA 3HEMA 1E6UA 4C22A 5IASA 4OS5A 1IJKA 3LVQE 4LSWA 3SJIA 2ODWA 3SR0A 1IM8A 4DEVA 4YVFA 1Y5IA 3D6JA 3DWFA 4UD9H 5CEJA 4AMZA 3DP7A 4FHEA 1G38A 1FTWA 3MUOA 3FZYA 4KUEA 4U01A 4YRZA 1Y98A 1RQLA 3Q4GA 1EJAA 4U02A 3TVJB 3LW7A 3X1JA 3UUFA 1T3ZA 2QNBA 4RTRA 3A7VA 2P2DA 4X92A 4IEIA 3W8EA 1CFJA 2EVWX 1NRXA 1J09A 5KOJA 1QY6A 1H2HA 4JXKA 1N1EA 3GJYA 1N4AA 3E4DA 4Q2KA 3N7UA 4N0QA 2BD7A 1JH9A 1IPFA 4YC7A 4MKRA 1QH9A 2CLEB 3PGXA 1WMBA 3RS7A 3C3CA 2UV8A 1EYZA 3TGPA 3PTAA 1WYKA 3SU2A 4TXMA 1V0JA 3VVBA 4Q18A 1G8SA 1WU8A 2ZSHA 2FV8A 2BP7B 2E82A 4I8LA 4D9GA 4F60A 5JQGB 2GFIA 3IPAA 3IJEB 1O2XA 4MW9A 4OK6A 1W36B 1CEEA 1QQ6A 1WHTB 2W43A 5ERGB 3IAUA 5JIBA 2YOHA 1C9NA 1P1IA 2VNTA 1ETHA 2O3TA 4M0DA 5C7IO 4KQEA 3D49H 5G3ZA 2Y1GA 4AYTA 4TVSA 5HM2A 4OHKA 4J4HA 4M9CA 3UH0A 3BV9B 1IEXA 2P1RA 1DEHA 4XD2A 4XDGA 1A69A 1BJRE 3KKMA 5DTMA 2PTCE 5SZHB 2BC9A 4QUDA 1ZGJA 1U28C 3EXHA 3LH3A 2OWEA 5DBIA 4B75A 5FX2A 5BV0A 4R40A 2MMCA 1FW8A 4OM8A 2YDYA 4IVPA 1GILA 4G24A 4Q82A 3S8YA 4HJRA 3B7GA 3R0JA 2WK1A 2PRKA 4M21A 2XODA 2OQRA 1D1PA 3UUWA 4FHCA 5A0CA 4GX1A 4IUDS 2ZRLA 4U30A 2FX6A 2REBA 5ICSA 1CBUA 3M2TA 1DOHA 2NO9A 2V7XA 3K70D 4S1NA 5K0BA 5KTMA 3CZQA 1BKSB 2HRVA 2E89A 3V9PA 4HN9A 4L08A 4LOYH 3AEXA 3GCGA 1B26A 3E0NB 3K6SA 3ZZBA 2QSZA 4DV5B 3THXB 3GGGA 3HKEA 4MPWA 4WUTA 2VJYA 1BDMA 5LLSA 2C3MA 4HGRA 4Q7JB 2D1FA 2ZU2A 3QE9Y 4PZDA 2BLOA 4KAAA 2I7XA 4VGCC 4B47A 4A2QA 2HMYB 1ZH4A 1G5PA 2QM0A 4YLUA 3C15C 2YV3A 3JQFA 4HUQA 2TYSB 4RYDA 3GV0A 1DC5A 4D4JA 3A9SA 1J6UA 4MUMA 5EHQA 2C8JA 2F55A 1W8DA 2D7CA 2Z8YM 2GAAA 3U3DA 4KW7A 2HRBA 1UPAA 1MQ6A 1WG8A 1MAHA 5A06A 1QS0A 2YDXA 4HH0A 4XGKA 3VB6A 1XL0A 5H1YA 2DQKA 5LBUA 4M1WA 1OAKA 3S2UA 2QSJA 2ZE5A 4QEDA 5JI3E 4BLPA 5BN5B 3LH1A 4KBFA 2PUEA 5AVVA 1XIVA 2BZ6H 3M4JA 2SICE 3UAWA 2O8FB 2R5WA 1UBLS 5BQFA 5EZ5A 2X3FA 4FKBA 4JLBA 2Q49A 2N47A 5CMLA 4RSRA 4HYQA 2NW6A 1ZD3A 1WZEA 3FIJA 4TMWA 1PJ4A 1JR3E 4F4OC 4YNBA 5JQGF 2A7CA 1F8XA 2CK3D 3HUEA 1ZHPA 3I09A 4IGEA 3T5PA 2IP2A 3W5IA 3LL4A 1OC4A 3D59A 3FCYA 1EQ2A 1Q31A 3U3XA 3PR2B 1VMAA 4QTUB 4TUYF 3C3PA 4PQYA 2Q4BA 5FYQA 1V25A 4OYYA 3TITA 5KSYA 2GZ1A 4IF4A 1TYNA 1VHWA 3SOPA 3PFNA 2IU3A 5ABPA 4J6FA 4QBIA 4ALJA 3D3NA 2AGGX 3PCTA 3HU5A 4Q4HB 3KE8A 5IDXA 3G1WA 5JBQA 3DMFA 5F5LA 3W8RA 4YHBA 3QELB 3KEQA 5KWIA 1T2FA 3UWMA 1C9MA 3C8HA 3SFTA 4MV4A 1CQPA 4KP7A 3NM5A 4QT4A 1UBJS 2PUDA 2J95A 5EQSA 2BX4A 4Y9TA 5BR7A 1F4VA 1ZN9A 3CZCA 4FHGA 5ALXA 1P1KA 1QFYA 2LW7A 5ILOA 3FMPB 2FR8C 5AI4A 2QF4A 1Y4UA 4E11A 1L1NA 2J9FB 4MDHA 2GCHF 3EEOA 3IMFA 3TNJA 5F6MA 1Q1AA 4RK5A 3QLPH 1P2JA 1DRWA 3M4ZA 4HLQB 3BXOA 3N86A 3PRKE 5MN6A 1TAWA 1N1GA 4PANA 1X74A 4F49A 1YYY1 3IUNA 4FZRA 4JBLA 3VGJA 3TPCA 4O2BF 4AYWA 5KOIA 5AM1A 1ZXXA 2I1WA 3P9ZA 4JI8B 1NWCA 1ST3A 3HSKA 4OQYA 1NAIA 3H5VA 3SE0A 4TS3A 3I1FA 1SQGA 2BMVA 5K3AA 5CFRA 3ZJYA 3EXG2 5IKXA 4KGVA 1XI2A 4X20A 4D82A 2UXCB 4HQ0A 4LHVA 4NJEB 2R3YA 1F1BA 1UDWA 3DGFC 4QUJA 3D8UA 2R25B 1Z2AA 4NSNA 1QWOA 5C5OA 3DCJA 1ZOIA 3IEKA 3A11A 1Z07A 3RS9A 3BEOA 2Q6DA 2BFPA 1EA5A 4I4NA 4WH0A 5TMDA 1Y1KE 3V0XA 3D54D 4ZZ0A 3ZWOA 2J0VA 3SBEA 1PL7A 2O8CB 2I4MA 4RC9A 3CZAA 3ECSA 1VPVA 1YQGA 5IN4A 4JZFH 1TEVA 4OHRA 2IOHA 2H0QA 2GB4A 2V7EA 1XLTA 3RYFB 3EQ0H 2V7VA 3IBGA 2CHFA 5JQWA 2C7BA 3ZZ6A 1WOMA 3AL2A 1BTUA 1YNSA 3E2MA 4CH8B 2V98A 4L4ZA 1RWVA 3AW1A 3G89A 5AKKA 1K6JA 2CFIA 3KAJA 4NS4A 3P0RA 4WNIA 1ZLYA 4E5MA 4AY6A 4G0OA 4EFDA 2PS9A 1EX1A 4KXNA 3B36A 5EJGA 3VPXA 5F1OA 1NYQA 3LDFA 1II9A 3P9NA 1XMQB 5CU7A 5TB5A 3UT5A 4OXRA 1E1YA 3ZI7A 4AL4A 2Z9DA 1LH0A 1O0CA 1S1CA 1WEHA 1KDZA 2W2XA 3RLYH 1MENA 1UMDB 1BZYA 3REOA 2RD2A 1C30B 4CLHA 2AGIX 1HV7A 1V2VT 3UC9A 2FI4E 1R0LA 1ZICA 5BWMA 5AW5A 2WKWA 4HFJA 3P9KA 4F5EA 2BTQA 1QQ7A 4U7TB 3DC2A 1VBKA 4E7RG 3P70B 4YPVA 1UFVA 2AW3A 5DCYA 1G3QA 3MU1A 3K71B 2YOGA 4BAZA 1NP3A 3B13B 3WB1A 1SXJC 5DGJA 3OFKA 3I53A 4E1VA 4ZD6A 4X1OA 4CLXA 3PNYA 4DWOA 5DX1A 5JAMA 5D5PA 2NP6A 5TMEA 4X8VH 1HG0A 1P0QA 3TBHA 3FTDA 4RY9A 3M8KA 2PUGA 1GG8A 1HT1E 4AB8A 3I23A 1D1SA 4F6CA 2AA3A 4HMQA 4RABA 3F9RA 4NMWA 2L6OA 2BGMA 5LSAA 2RKWA 1SGRE 3INYA 3N99A 3DDSA 4A0GA 3AM1A 5HX7A 3N76A 4R31A 3K9NA 1J33A 4AXBA 1B00A 2QLMA 3VNBA 3AF0A 1OU4A 3SEQA 4CM4B 1ISRA 2J3JA 5ALSA 1KDVA 3SUEA 3KTAB 5AKIA 1UUFA 3PMHB 4LOKA 1D0IA 1GNSA 1ATIA 4RA9A 3GEHA 1TLTA 2YZKA 3X1MA 3CO5A 3A8BA 1C0EA 3D4BA 4O8CA 4TMXA 1S3FA 3O82A 4K6KA 2JLXA 2P35A 3Q9NA 2YINC 4NONA 1Y1RA 3IG6B 4FOSA 4DF3A 4A0FA 2E37A 4WNAB 3ON5A 3FZNA 1ZMNA 3V3KA 2AQKA 5IDYA 3JU3A 4RU1A 4XAQA 1EP2B 1GI5A 3ZWYA 2VBFA 1RHMA 3FYHA 4K6HA 4TXNA 2PL1A 1N0VC 3CF2A 4M54A 1DPGA 1WXDA 1A76A 2REOA 3MCAA 1UBFA 4P83A 4MUNA 1YQDA 2DJ5A 3MFYA 4PAGA 5AK0A 2IS2A 3TZBA 3Q5EA 2ZTXA 3GJRA 1OI4A 3I6YA 8KME2 4E14A 4F1WA 2YXNA 2D0PB 4P2GA 2W2PA 3RR2A 4D8TA 2RCYA 1Y42X 3PD1A 1RHJA 3PG5A 1OZHA 1CDDA 1YMUA 3E3OA 4P6VF 4HLUC 1CGJE 3KS9A 3M6FA 1AWFH 2MSKA 3AHEA 1JDBC 1QIFA 2CMGA 5LPNA 4XJVA 4M7RA 3G8CA 3RIEA 1SGYE 4J0KA 3ZWDA 3AKEA 5E7QA 4MV8A 3B2EA 1YB7A 3AFOA 1GARA 3SS9X 4TXHA 3D1JA 1RHRA 2MSLA 2IEBA 2GM5A 4R2HA 2RH4A 4Q93A 4E22A 4RKFA 4A8HA 3MYRA 2Q41A 5TV2A 4OAQA 1KJNA 2D2XA 4FZJA 3BRCA 3M3VA 2P2YA 2REQA 2BQWB 2ID4A 1GMCG 2BW0A 1GHXH 1VLZA 5C1YA 3PV4A 2DUNA 1N4DA 1D0SA 4ESTE 1RVDA 1KMCA 1M2FA 4S1VA 4GM0A 4HGOA 1UJCA 2QB5A 1Q7EA 4QJ4A 2OBNA 3FKSD 2PV0A 3R7NA 3DO6A 4CM6A 4MP6A 4M7PA 5ENZA 4MRRA 4TQUS 3PC2A 4OBEA 3E3MA 1EZQA 5CD9A 1QKIA 1L5FA 4N7BA 3EFOB 1RMTA 4KN5A 1B6RA 4KFCA 1L5VA 4D9IA 1NFYA 1GGMA 3EXFA 1SB1H 3AONB 1SQSA 1YF3A 5DPMA 1DEAA 3QF7A 2QGNA 4DM7A 2BAGA 3CH7A 2M6KA 4JXZA 3V7TA 4LS3A 2JDIA 3EY4A 4NH4A 4XSHA 5AICA 4NH0A 5EODA 2VKTA 5HTKA 4LCBA 3RC6A 3LVFO 1DOZA 4GI2A 4ZCTA 2B2CA 3SU0A 5H3LA 5GMOA 2R79A 3AW0A 5AUPB 1ZK2A 2XCOA 1KI2A 2GO1A 5I9BA 4WKGA 3G2IA 3WKAA 1TW3A 5JYIA 5FUBA 4Q7ZA 3VX3A 5LP6A 4RGYA 5B64A 3KZCA 4HOYA 3KJXA 3NCTA 1T9GS 2Z2JA 3RWOA 2GJ8A 4NCAA 4YZUA 4WJG2 4ARIA 1SHKA 5EEHA 1MGPA 1VECA 3H5IA 4TS1A 4BTUB 3I8SA 2G07A 3K9CA 3WGZA 3V48A 4CCWA 1BRTA 1FMCA 1XDBA 1N2EA 5AK3A 3V4LA 4FFPA 1RIFA 3U4IA 4UBMA 1SPJA 1DPFA 4MRMA 4TY6A 2FXIA 3G2JA 2V03A 5F9FA 2VDRB 2FFJA 3T0IA 1P2SA 1JIQA 3REFA 3IE1A 3DBRA 2KSQA 3GGCA 3TW4A 3NGXA 1ZITA 2HLCA 4ZPJA 2EDCA 3DZKA 3AFMA 4DCDA 4KAJA 4IICA 4R2WA 1VE5A 3OX2A 3WMWA 4CF5A 2Y77A 2CY0A 5CG1A 4ILEA 3ZQJA 3HH8A 4WY5A 4Y6GB 3AG6A 2ZBDA 2F8SA 1KBOA 1L8LA 1W4ZA 2O2HA 3X1YA 1ZI6A 4Q9HA 4KDCA 2ZKIA 5H5JA 3BMQB 4WFQA 4KMSA 3AGQA 4XCQA 3A86A 3L0CA 4TYNA 1C1XA 2VDKB 1CQJB 2OSBA 4W8OA 1J90A 3JD3A 2FQWA 4RS3A 5CDTA 4EMBA 3V7YA 3ANTA 4HTAA 5BSGA 1SVSA 2R7LA 4F4IA 3GNSA 4MI3A 4PINA 3N0TA 5H59A 1NKTA 3AR4A 1GDTA 1FN8A 1S4MA 5KC8A 1VLQA 3O1IC 1KXBA 3PUYA 1WS6A 2PQ2A 4LYEA 1EJ6A 3RXSA 5IFKA 2Y4NA 5D1HA 1XCLA 4YP1A 1T36B 1HYQA 4BJ5A 2ASEA 3AM4A 4JSRA 2G71A 2HPPH 1X7ZA 4LI3X 1O2YA 3H99A 4TWIA 2XUIA 4GP9A 4X6UA 3A8TA 4RJTA 4B46A 1RRPA 1TNJA 1NW9B 1O3KA 4NESA 3BTKE 1JQKA 1O4WA 1I6LA 3C5WP 4FMDB 4ADSG 3PEWA 2AJLI 3RK1A 3BJRA 1Z2PX 1NN3A 1XWFA 3HZZA 3MTQA 4CL8A 5B7QA 5L8VA 2PTHA 1V2UT 4K8YA 3SU5A 3PP8A 1D2CA 3EARA 4G5OA 3V1MA 2OYRA 3GJSA 3BGOS 3IKVA 1GRCA 3AERB 1ELFA 3FSGA 5IZCA 3GCZA 4MQAA 3HXLA 4OB8A 1XEXA 2J4FA 4KC0A 5A0VA 3AM5A 1J1IA 3KSZO 2O14A 4Z6KA 5CDHA 5E0OA 3HCNA 4S1PA 3D3EA 1FQJA 5E7JA 3CKYA 2C2YA 1A9ZA 3IYLW 1XTBA 3IUMA 2JLUA 2POCA 4IIYA 1JGTA 2CE2X 3VH2A 2BDHA 3ELAH 4LJ7A 4JXXA 3BIVH 2Z6UA 3K1ZA 3R3YA 5DLDA 1EP3B 2QRGA 4B8YA 1AO3A 3SQDA 3LQRA 4RV4A 5FI1B 4F3CA 4O33A 3W3AD 5FHTA 1E5TA 4DC1A 2ODAA 1P33A 4BUCA 2JBHA 3U3JA 1NZDA 2XYRA 2O7QA 4KH0A 4BMCA 1PUXA 1EBFA 2D4AA 2YC4C 5FOVA 3WTBA 1NF2A 3E0XA 1XD2B 2WWRA 1A1RA 2ZYTX 3EVDA 1Y3CE 2D2VA 3ROKA 2IEYA 8OHMA 1Z5GA 1W4BA 1N2SA 1ECGA 3TGKE 4TYYA 2G06A 3HZHA 2OP0A 1G4UR 3L06A 2CNKA 4UCWA 1GHBF 1VHDA 1R10A 1QFKH 2AJBA 3SEAA 3QFSA 3WXBA 4I8XA 3SE7A 3G7SA 4DCJA 5EGSA 4YEDA 1Z18A 1AXEA 3NAMA 1V1MA 5E3JA 3R77A 1QTRA 2WPMS 3DPIA 2A7JA 4GKJB 1HPLA 1L5HB 5HYVA 1W10U 4CJXA 2FU5C 5C0TA 2JCXA 1QYRA 4JVNA 3TSYA 1G2QA 4M9RA 2C2HA 1PR1A 4C5AA 4G8CA 1JDNA 4BO3A 3UEOA 4OM9A 4TWRA 1MO3A 2XZTA 3M6AA 5DGDA 1T1RA 2QX9A 1DWQA 2P0YA 3Q5GA 3CTPA 4EENA 2OQVA 2PRZA 3T52A 3IUJA 4YONB 3VQTA 1JU9A 4PG8A 3C3DA 2I3DA 4IP0A 1DG3A 3C7TA 3A3OA 5FUWA 4RPJA 1MUUA 2UZAA 4MNYA 5F3WB 3HB1A 3SV2H 3EQ7A 2BM2A 3FYUC 3A2LA 1Y5NA 4EDHA 1LKZA 4ENVA 5A3SA 4FMDF 5DFAA 4F92B 4R2JA 5AVZA 1O2MA 4UHHA 3O5AA 1FDVA 4IEFB 3KU4A 5KDLA 2IX9A 1TUEA 3AH8A 2WF8A 2IEGA 5DP6A 5CCXA 2W0MA 5KAPA 2FN8A 4J76A 2XYGA 4GQIA 3ETGA 1S02A 1K97A 1UOPA 2B1QA 2UWLA 2XRMA 2ZSBA 3AR6A 2ALVA 1RBYA 2AXQA 4NIYA 1ISPA 1Y59T 1G41A 3G1TA 4IFTA 2OENG 4WK0B 1ZW1A 3CNNA 5CA0A 3EA4A 3FN8A 4S24A 1T4UH 1WXRA 4RFSA 1GRNA 4R6WA 2VDPB 4D2IA 1BMAA 3QKRB 1PYDA 1RTKA 2Y66A 3VR4D 3PCXA 3MT8A 3QGNB 1YHNA 4PHTA 1QORA 1TK2A 4MTLA 1MN6A 1LHCH 1N3BA 5JNTA 3DNMA 4MYUA 1QHSA 5ALEA 2PUHA 1G3UA 1I2MA 2QTRA 2B7BA 1KYWA 4C7OB 4TKZA 4LOLA 4ZDJA 5JYCA 1IN1A 1TNIA 2I62A 2VDMB 3U8OH 4MLFB 4I5FA 1J49A 1ZUIA 5GY7A 4D0SA 5CFPA 2CK3A 1CE8A 1S3GA 5A5VA 3FPJA 1BS9A 3IQZA 1WY5A 4NL4H 2XT6A 5H83A 3LECA 2BMJA 1K63A 3DQPA 2VZLA 1QGAA 4TL8A 2FOAA 1WAMA 1LPSA 4PWYA 3OU2A 1D04A 4ODIA 3DLBA 1NJGA 4ESVA 3T4EA 1NTOA 4MWBA 2HV8A 3RRBA 2BDBA 1N2ZA 3CJRA 5LDDC 3PVCA 5JBBS 4E70A 3HCBA 4FGSA 1P39A 4OPMA 5DXFA 1JXOA 3PDIB 1KJYA 2X5XA 3IJPA 4IDAA 2Q3LA 4M0UA 5FA6A 2VWHA 1R6VA 2PLRA 1FXWF 4D6PA 2O0KA 2H7VA 3KAKA 2PXCA 4Y0YE 4I19A 1IM2A 3I2FA 3LUPA 2XKBA 2H4JA 4EF6A 5JCPA 1KZGB 3QPCA 1W581 2B7LA 3K5IA 1NQOA 1YFJA 1WMSA 4WESB 4H15A 5DGIA 4MCHA 1KY5A 3S2YA 4JJEA 1V8FA 1QP4A 4IDQA 4J4BA 1LDEA 4IZHA 3V1KA 4DTIA 2AYYA 1KEUA 3DCNA 1BVUA 1AKEA 1G5IA 3NTQA 3FYDA 2J8ZA 5KMGB 3ENWA 2I66A 4LECA 1HLFA 3EZNA 1ZGVA 1SXPA 2NAPA 4MS1B 2FPZA 4BV9A 1WL8A 1NBAA 2ULLA 4QPPA 4GR9A 2Q6VA 4GGOA 1XA0A 2O8WA 1CZUA 4FGUA 1A5BB 1Z0JA 2NU6A 3OLCX 4UXJA 1CG6A 4A2PA 1C9DB 1RIIA 3OESA 3M3TA 2HMWA 1RWQA 1XRLA 3H2YA 1GXSB 1H85A 4DV4B 2FWIA 3L5KA 2EI6A 3H1TA 3DTTA 1Z3CA 5IC4A 4XW2A 2ZI9A 3O4RA 4I1OA 4R05A 3Q7QA 4G23A 4YYEA 4LF7B 3SUDA 4OIMA 3QBJA 2ZG6A 3VAZA 2XCFA 3GLVA 2YWFA 2QUAA 1ID5H 2R6AA 2FDXA 1BHO1 4EGAA 3SKVA 1YRYE 2HF8A 1SKMA 2QXIA 1I3MA 4JK3A 3FAOA 1O33A 4O0MA 2C84A 3G13A 2V0BA 3RRZA 1PQ5A 1QIJA 1Q44A 2J07A 2VJNA 5B1YA 3SZUA 1FPQA 2YFQA 1ZM9A 4ND1A 4QU0A 1U0NA 1V2OT 1CZHA 3CUTA 1UOQA 2CDRA 1CJCA 2HT6A 4G2NA 5FOTA 5ESWA 2A1UA 1WCXA 4NBVA 3NJ4A 4GOLD 1OTHA 4YOIA 2DSNA 4RYLA 3OE5A 3NYQA 1ZG3A 1J21A 2IXGA 4OSPA 1NRNH 3VG8A 1YV9A 4W1PA 5T6MA 2AKEA 3TTWA 2C2GA 2ZYSA 4X2VA 3V1LA 1ORHA 2GYVA 1QXSA 3A6GA 2HB6A 1EDDA 1T4CA 2QUZA 1E2JA 1GA6A 1V6CA 2GQ0A 4N0DA 4AJEA 3D6NB 4BRUA 1JLSA 4P2BA 1NV8A 4RKJB 4HFMA 1GBLA 4CH2B 3JQAB 2B5OA 4B3IA 3OEWA 1DT3A 1L5YA 3C85A 1JPJA 3TG8A 1G3EA 3I6BA 3USCS 2ACWA 2ZBFA 3FGOA 1R37A 2BTEA 5A9RA 3TW8A 1SHYA 1ONNA 2VGCB 3OIFA 3GOQA 4NEQA 4A6PA 1JSXA 4H7EA 4I1VA 3GP3A 3LHFA 3TZHA 1ZIPA 3VU9B 2B94A 2ZOSA 2VP6A 3HPTB 3ZX4A 1N6RA 2QMEA 4JI5B 4J0HA 5DKMA 4LZAA 3F73A 3F98A 3GLGE 1OFUX 2SKDA 4LDAA 3B12A 1JSCA 1GHYH 3WO1A 2A7QA 2ZTHA 4QYWA 4LRUA 4ZI7B 4GPEA 4GWKA 4R41A 2HSWA 3KSMA 2R2AA 2B30A 1NBMD 2ONYA 3STJA 3A6EA 2BY9X 1POXA 5BYKA 1EM8A 1DXHA 3EIHA 1WCYA 2Y05A 4R0NA 4PPYA 3UAGA 3RTEA 3TSWA 5EXPA 1AQJA 4CKYA 3C8MA 5KC9A 2BFEB 1UDRA 1VG9B 3RTGA 4HBGA 4HFRA 2B8WA 2FESH 2GLUA 2H7CA 1XF1A 1UBTS 4FIZA 4G4GA 4FCWA 1IY2A 5LQMA 4FLFA 4IJUA 1SRRA 4R1QA 2ZUWA 4XZ3A 5FBKA 1QTQA 3GY6A 1UZUA 3WY8A 1CIVA 2ZRFA 1PJAA 2IDKA 5ECGC 2ZLBA 4FU8A 3WFIA 1VLHA 1O2NA 2GDDA 5HF6A 4KTTE 4L74A 1BQ3A 5EKXA 3R9KA 4ZQFA 3L33A 2HRCA 1YE8A 1UVTH 3MMXA 5TEVA 1FNSA 1EFVB 4N3NA 2R1TA 2XQJA 5DLQC 4WXHA 2I34A 2J34A 3HL4A 4FYIA 4MNTA 5JPIA 2FB9A 3TE7A 4XYLA 1E0KA 4ZAZA 5KAMA 4DDUA 3VO9A 1Q83A 1MH0A 3O8QA 2RFKC 5LGOA 3A6LA 2NT4A 4BGIA 3QXGA 4DG5A 5ALNA 1XVVA 4OI0A 2HJWA 4ID9A 4OTZA 1DTWB 3EDRA 4O29A 1WZCA 4BVGA 3UJ3X 1NQ5A 3P7MA 4OUDA 3DKVA 3L1KA 3TMYA 3HCCA 4KFTA 2UYHA 4F46A 3RYHB 1HZJA 3DBVO 1ZFNA 4KXWA 2P93A 2YV2A 5A7FA 1MV8A 1RHKA 5JXHA 4Z2AA 3DV9A 3QVXA 4K1LA 3ZC3A 2RARA 3KJEA 2IOTA 2GSDA 4AN1A 2AEEA 4P3NA 4PPQA 2R60A 3FPCA 5B4TA 1PZMA 2OQUA 1W5TA 2OHVA 1B0UA 4BQNA 2JAUA 5K7SA 1BE6A 2FEAA 1PL6A 4UEOA 2JA1A 4U0KA 4A03A 1L5LA 5H4IB 4ZKRU 2FA9A 3PT5A 4BV2A 5DNYB 3W04A 2VUTA 5TE9A 4O4JA 2WFMA 3T28A 1RR6A 3MWDA 2V0GA 4H3KB 1FV9A 1NATA 5C17A 3ZDBA 3AAUA 2Q5EA 3IHLA 4GCHF 2QG9A 3WGJA 2XA9A 3JWHA 3U6KA 1V2GA 1Z6ZA 2OV8A 3M5NA 1UTOA 3W5VA 1T5LA 1J5PA 4RD0A 3D3WA 3GCWA 4HS4A 1JEYA 2VPTA 2XJ9A 3HYLA 2YFYA 2GCTB 3TR5A 4DCVA 4F8JA 4ZI7F 4QSMA 2FF5A 1FMTA 3WQQA 2YN2A 3HZOA 1J8FA 2Q5QA 4O6VA 4GBED 1XCMA 4GX0A 1RXIA 3WIBA 2BQ7B 3TR0A 5D87A 3F6EX 3B7PA 3E15A 1EFCA 4TTPA 1H4QA 3MSXA 3NI2A 3N2GA 5BXQC 3BG5A 1BXGA 2Z2YA 1IIBA 5FPQA 3ESAA 1F0YA 3PGLA 3LXUX 4GM1A 1LEHA 4H08A 4H7JA 4HH4A 2AK2A 3GDUA 2ZETA 3ZGYA 3NAQA 4PLHA 4PCLA 3E0QA 4QT8C 3A2MA 4MPTA 1PQ4A 3LQ4A 3WE7A 1Y1SA 3A3YA 3BMCB 5EJFA 5BN3B 5ADWA 4W1QA 4RZSA 3GYMA 2PGDA 1ZINA 2NU4E 2XI4A 3Q10A 1V9SA 4BFLA 1IN5A 4YRNA 2BY6X 1H2XA 1X86B 2ISSD 2WNIA 1KMHB 1W96A 2W37A 2CVZA 5ARBA 5F2OA 3AXTA 1YPKH 4Z4GA 3MWKA 1C0KA 4MO2A 4LW8A 3L43A 2CJFA 1RT9A 2QZZA 4FYYA 4LXQA 1BDBA 5KKCA 4FU9A 4X1YB 2JH9A 2ECPA 1GZUA 3IUEA 2IPLA 1WQVH 3TMAA 1XWIA 1JVBA 4O4HB 4AP5A 3EXAA 2P3LA 1YVDA 3UTCA 3SICE 2CKMA 1JW9B 2JDID 4DV0B 3T7RA 2WU0A 3RVLA 2PFSA 4BU0A 2QA9E 4KYIB 1TQ8A 2JJ2D 3F74A 4HX9A 1Z12A 1G2LA 3F5QA 4EO7A 3H3FA 3STYA 2OBQA 2XUZA 3OJCA 4P58A 1DUAA 1WSDA 3TO5A 3AG5A 2F9VA 3MOCA 3V97A 3F4BA 2IIPA 2BEJA 3IMEA 4OLFA 3IT2A 3RLWH 4M99A 3BQ9A 3F97A 4NYJQ 4LA4A 1XXFA 4RTKA 1HEIA 2J9GA 1XCGB 2EKPA 1IUNA 2PX4A 5JXGA 4JL5A 3MTEA 2J5UA 4RGQA 3QI7A 2ZDHA 2EQAA 4MIYA 2GBCA 5AHXA 4Q4LA 4HI3A 2LGJA 1UKAA 2CFCA 4CCYB 3AB8A 2OG1A 1CUZA 1D6SA 2C94A 2OECA 3D5QA 5ALFA 3GLGB 1K21H 2BR5A 4JLMA 2OGTA 4R69A 2WQ7A 3Q3IA 1OA1A 2DBQA 4ALNA 2BI7A 3QKIA 4XOIA 1SXJE 2WLSA 5HBRA 1RP1A 4ND2A 4OAPA 5HCUA 3DEKA 1LF0A 4WJLA 2A4MA 1ZNXA 3DZHA 3QJYA 4ZOLA 2Z5VA 3JV7A 4KO4S 4LWOA 4L28A 1KFCB 4PRLA 3ZZ9A 1DQYA 1LPGB 4KQKA 2XXJA 4DCNA 2AUNA 1C3EA 3DZ8A 4UAUA 1R0RE 1CVIA 2C0QA 4G84A 4R7ZA 2GEKA 1ZSKA 5JADA 2F9NA 3RBVA 2HPHA 1JQBA 3WB9A 5FPPA 5KHAA 3L40A 4B3FX 4WZZA 3KEEA 3CR8A 1RRFA 1WB4A 2GCGA 3T99A 1FSSA 9GPBA 4Q1BA 3WL3A 3RSGA 4HL6A 3IEUA 1KPGA 3GROA 4XQ9A 1N6NA 2HIAA 3LPDA 5BW4A 3I9JA 5BURA 1IQFA 7GPBA 4IDGA 1HT2E 4VGCB 3S4YA 1GGJA 2F9OA 2FIRH 1KSHA 3CUVA 3PDUA 3LYAA 5FNVB 4E3WA 3WHKA 2E48A 4N8DA 4BNMA 3GG9A 3W3AA 3TYX