4B6FA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
total genus 196
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6fA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA02
3IDQA 3BB4A 1OXXK 3CX7A 2OLKA 1EFUA 1Z83A 4A36A 2VHQA 1P9WA 2HYDA 2ZSDA 2WWIA 1XJQA 2ERYA 5CK4A 3LQQA 2R8RA 4PSAA 5E7JA 4FN5A 3VQTA 3ZH9B 4NP6A 4NCIA 3P8OA 3X1XA 1GRRA 5CK5A 3IPXA 2RB4A 3CF2A 1DVRA 4O25A 1N6LA 4DSUA 3QENA 4BEJA 3B1ZA 2CNWD 4TL8A 3SU2A 1VIAA 3B6EA 5F98A 1WXQA 1EWQA 5CYPA 2MMGA 2AD5A 3KTAA 1A82A 2QBYA 2WKRA 3KJEA 1KSHA 1QHGA 4QFMA 4DDVA 1R4AA 3THOA 1HE1C 1CF4A 1IHUA 3CM0A 3CPHA 4OI2A 2GESA 4MRNA 5JRZA 3P27A 4URZR 4B75A 2YWFA 1BMFA 1XEXA 4M1TA 3RS0A 4JSTA 1HT2E 5G3ZA 3UKDA 4BLOA 1CRPA 2G3YA 1MABA 3WMGA 2OHFA 2FGJA 2H92A 3SU0A 2XNSA 3CRW1 3CKLA 2ZI3A 2ZJZA 4QOSA 1KAGA 1V43A 1OFIA 4MYCA 4PQFA 5B6LA 2HLDD 2GGVB 2GKSA 4HI0E 4K46A 121PA 4A8JA 2GVDC 3G5UA 4HUQB 4URWR 1NJFA 1IY1A 3F8TA 2Z4RA 2HF9A 5GJ4B 2QM7A 1D2MA 2FFAA 4RCYA 1IN5A 1E69A 4Q21A 1FL9A 2GWHA 2D3WA 1T5LA 1JXMA 1KI8A 3W8NA 4ZDKA 2GNOA 1PLKA 2OBLA 3KJHA 2PMKA 2XCFA 1T8TA 1LS1A 3KFXA 2REXB 1Z0KA 3ICEA 2F7SA 1LNZA 4A1TA 3GLHA 4XH9B 4PQRA 5KPJA 4IDPA 1E1RD 4NE2A 3A6PC 3SC3A 4Z51A 1X1SA 2PLFA 4P4SB 4ILEA 5IT5A 3OTPA 4RI0A 2LKDA 3E2IA 4U00A 2QP3A 3AVWA 3BFXA 3KXKA 2LCFA 5DSZA 1YZGA 4RD3A 5DIFA 2DWPA 3E1SA 1ZRHA 3N5CA 3NBYC 1YHNA 2FWRA 2OE2A 1EGAA 2A5DA 3LXRA 2H57A 2ZYTX 3Q5EA 5IF9A 2FSHA 3FMIA 3JVUA 3CONA 4DIEA 3AB3A 5HE8A 4QHYA 3GD7A 2QN6A 3BD9A 1OIVA 3K0AA 3VU9A 5KU1A 1HEIA 1SXJA 3BBPA 5KOYA 4Q1FA 4JLKA 4C0JA 2ZJOA 4E09A 2GHIA 3ADBA 4MKIA 4GBMA 3EC2A 3B82A 2GBLA 1S0UA 5B57C 2F6RA 3DM9B 4C2UA 4P32A 2FSFA 3PVSA 1E0AA 1YR8A 4IW3B 3U7EB 6Q21A 4QG7A 4XJXA 4A82A 4OQNA 1KO5A 4AG6A 2HT1A 1BO6A 2SHKA 5BN3A 1PZNA 3A4NA 4LV8B 4GP6A 3AKCA 4HZUA 1R10A 4WH8A 2XTNA 1KZ7B 4B2PA 3IIMA 1E6CA 1Z0AA 4B74A 1Z0JA 4LPSA 3ZYCA 4OYHA 2VBCA 2PZGA 3AKDA 1Q1ZA 4IXNA 4BECA 2ORVA 4F4IA 5CLLA 1VYUA 1UAAA 3RC5A 1BH2A 3RYTC 1MT0A 1UKZA 3TBKA 4US2R 1F3OA 3OF5A 1S8FA 1YQTA 1SKYB 4I1UA 1XMVA 5C1BA 3SQWA 4A9AA 4B43A 1TQ2A 2WTUA 3U1IB 2IYXA 1A1VA 3M6AA 1I2DA 1P6XA 3K0EA 3NH6A 4WOPA 3WNBA 1FPMA 3IIJA 4W5WA 3KFVA 1SZPA 2FDCA 4BRUA 3ZLJA 1CIPA 3T1OA 3DO6A 4DEYA 3DHWC 5EPNA 1E1QD 5EE0A 1AM4D 2VEDA 1EX7A 1KGDA 4PO9A 4UQOA 2CMKA 2DR3A 3SYNA 4BE7B 3EYDA 5HCNA 1G4AE 4QHTA 1ETUA 3ZDQA 1SKQA 4RSGA 2PJRA 4KV9A 2CL0X 2ZM5A 2WWXA 2FZ4A 4D25A 1WQ1R 1YZTA 3KTAB 3Q85A 4P31A 3SN6A 2QBYB 2HT6A 3QNUA 1UADA 2PBRA 2WJGA 1XWIA 4NMMA 4GNKA 3B5JA 4U02A 2FFHA 1N1LA 1MKYA 3LBIA 4HAVA 1XEXB 1PUIA 1F2UA 5TDHA 3DOEA 2J7KA 4Q02A 4GRAA 2HJVA 1XTKA 1MABB 3ADKA 4LYAA 1JI0A 4MYUA 2VSFA 4E5UA 3KEEA 4LJAA 5DO9A 4BFWA 2FSIA 3GEIA 1ANKA 2KBFA 4MRPA 4BFXA 5DI9A 4MA4A 2ZRJA 2IWHA 4D4LA 3VFDA 3BFVA 3QOFA 4A8JB 2YINC 3PQCA 4LK2A 3FHOA 3LLMA 4EKDA 2G88A 4GMXA 1Q1BA 1T3LA 4WZBE 1OXVA 2JDIA 4BFYA 4DXAA 1LV7A 4TMVA 4A0HA 4IOKA 2BJVA 1OXSC 3TAUA 5IRCD 1CJMA 3KKPA 4YDSA 4TSFA 2FFBA 4TQUS 1W4CA 2ZSBA 5A4JA 4B32A 1PUJA 5FR2A 2WMNB 3AVYA 5CLQA 1NVVR 1MO4A 2FV8A 1SHZA 1N3BA 2FSGA 3GLHB 3ZZTA 5LBIA 1FUKA 2V54A 4AKGA 3GMTA 2ZJ5A 1ZC3A 3HP1A 4KFUA 5BQ5A 4OI0A 4E03A 3TW4A 2CDNA 2GF0A 3B85A 2RGEA 2WV9A 1FX0A 1KI4A 1VCNA 3MRSA 4EFLA 3GJ6A 3RVBA 3DOFA 1GTVA 3GJ3A 3LD9A 5AUQA 1S3GA 2OLJA 5EXXA 3KN2A 4D4MA 4JL5A 1GSIA 2QUZA 1JAHA 1JPNA 3R9WA 2CHQA 1A4RA 3AP2A 3EPKA 1CR0A 2QENA 1IJEA 2E1RA 2IWRA 3VU9B 3K0AB 1WA5A 4JJZA 2O8MA 2BWJA 3NVAA 3VR2A 1SXJB 4XSGA 4QJ5A 2XOKD 2CL7X 3T15A 4M1WA 3Q8XB 5FOSA 2J9RA 2BKUA 3FKQA 4US1R 3NXSA 3NDPA 3AP1A 3VR6A 2QMUA 3R20A 1VCMA 4DLRA 2JLZA 5L3QA 1T3SA 4ASUD 4QGHA 3ZVLA 1XMSA 4HLDA 3SUFA 4JLNA 4UNNA 1EFHA 2ASEA 4BGDA 3THXA 4JLBA 1ZCBA 1FMJA 2J41A 2P5SA 2WWWA 3ND9A 2ZIAA 4HATA 2P5TB 421PA 1N2CE 1X3SA 4HZUB 1E2DA 3K0SA 1G6OA 1SVSA 2BMDA 1K5DA 3SE0A 4A1VA 4NCJA 5CJPA 4Q03A 3SEAA 3VR5A 3BE4A 4M9XA 2ZS9A 1RRPA 5FL7D 3VHXA 3A1VA 3MJHA 3EPJA 2HXSA 4PPQA 3PV0A 1QHNA 4M9QA 1NS3A 2ZI5A 3QBVA 4UXJA 2H7VA 2EFEB 3O47A 3QVUA 4B2IA 3WYFA 1X8JA 3H09A 1RVDA 4NWKA 4HLUA 3O8CA 4PC2A 5JBQA 1N6NA 3I92A 4V0ME 2QQEA 2FEOA 3GCGA 3MG9A 5F3WB 3U6BA 3W34A 5JECA 4LSGA 4CW7A 1IOZA 3HPRA 1P60A 2BMJA 3G0HA 1Z6XA 4H1VA 1GOTA 2XTMA 3LNCA 4PHFA 1XCPA 3H2YA 3L0IB 4Q19A 1BYIA 2WPDD 4YC7A 1IQPA 5EQSA 1D2NA 1FNMA 1SVKA 2PT5A 1P2VA 4FD2A 2CLSA 4DDWA 4LCBA 4LV6A 5B2ZA 2QT0A 3WBKA 3E90B 2WMOB 1U0JA 4BEBA 5J4KA 5JHGB 1CRQA 1X1RA 4Q5IA 1N25A 3TW8B 3EIEA 3IPYA 5KHOC 2OESA 4MYTA 2JJ8A 3RRZA 4D80A 4LWZA 1XMIA 2EWWA 4XWAA 5F9FA 4DRZA 4FWTA 4V0OA 2DB3A 2XZOA 4NYJQ 4PO8A 1OT3A 2OBQA 5FH9A 2AXNA 3X2SA 2OAP1 4C2TA 1QZXA 4Q9JA 3SS8A 1CU1A 1F2UB 3HDTA 4EUNA 2IXFA 3UANA 4BLQA 1QHXA 1C4OA 4I33A 1QG2A 1UM8A 4Y0VA 3RAPR 4DCVA 3KZ1E 4BLSA 4D81A 4C7OA 1OHHD 4M9FA 1UKEA 2I1VB 1GWNA 2K5UA 4ARZA 3UMSA 2C99A 2GZHA 5GJWC 4NKRA 2DWQA 4AKIA 3K70D 4JYBA 5SZJA 4Q4JA 4JL8A 1OPXA 1GKIA 2D2EA 4UJ5A 3WBJA 3C16C 1G5RA 3U61B 1NY5A 1VTKA 4MUBA 5HZKA 2I1QA 4X8MA 4NWLA 3TUJC 3RS2A 1HQCA 4Z1MA 2LKCA 4Q9KA 4W7SA 3DZDA 3FGNA 4QM6A 3BWDD 2QV1A 2VP6A 2AN9A 2R2AA 1P9NA 4ZIRA 1D9ZA 1DAHA 5AWFC 2R65A 1F2TA 2QE7A 1W2GA 3HJNA 2J1LA 4WXPA 1Z08A 4I1SA 2ZEJA 2WIBA 2O8EA 1T8UA 2QGNA 3GJ4A 3U7HB 4PHGA 1OKKA 5B30A 5KNDA 2FM2A 4M1KA 1GKUB 3FMOB 3O8DA 1IXZA 4IEIA 1HUQA 2GAOA 3WMEA 1FX0B 2QMOA 3H86A 4EJSC 4B71A 3ZZ0A 5UKDA 1UKVY 2OINA 2ZRNA 1Z2CA 2C5LA 3PUXA 4C0LA 2Q9AA 3O8RA 1BMFD 5IK2A 3LH5A 3I72A 2Z5FA 2O8FA 3VNVA 4UNRA 4MRSA 3FMFA 2IF0A 2IYYA 1ZM2A 2DPXA 2FN4A 4EFNA 1OB5A 1BKDR 1KO4A 2ZAOA 3L8YA 1KI6A 4MGKR 3SU1A 4UKDA 1NMYA 5CITA 2QROA 3CX8A 1L8QA 2WSMA 4QJ4A 1IONA 2IC5A 2GCPA 5GADl 2XXAB 2XNDD 1KY2A 2VHTA 4CT5A 1G3RA 5AUNB 3NEJA 2ZRBA 3KX2A 1H65A 4L5BA 1U0HC 3VKHA 1JJ7A 2XEXA 4IDNA 5K8TA 1NJGA 1ZP6A 5L3QB 4LY6A 1X8KA 3ICQB 2FZLA 2JJ1A 3LW7A 2BBWA 4LJ9A 3MD0A 3THXB 4A1FA 5E3HA 2ZRHA 2HUPA 1DARA 1KZGB 1SVWA 3OEHA 4DB2A 3PR1A 2B8TA 3OAAA 4GZMA 4PTLA 4XVRA 3QBTA 3SFVA 3AP3A 2OAQ1 4OL0A 2QQ0A 4B44A 2X1VA 1UBFA 3BERA 2HF8A 4A2QA 1KSGA 3KB2A 3AUXA 1DADA 1D5CA 1LS6A 3NIBA 2F9UA 4TLCA 5HKKD 5JLJA 2QY9A 3GJ8A 4QRHA 1EESA 3P4XA 3D8BA 4EPWA 1ZNZA 4LPKA 3CZPA 2W6ID 4JVSB 2BHRA 3KQNA 2RMKA 3L6PA 4QGGA 5JFGA 3QSYA 2OM2A 3AGPA 2Q9CA 1XTSA 1Q0UA 4KBGA 4XIGS 1Q3HA 3SV6A 2ODEA 1GP2A 1T9HA 3K9NA 3QEJA 4V0NA 3MGCA 4GZLA 4V0MA 5EUMA 1RRCA 4TLDA 1CJTC 1DELA 1O3YA 1XNJA 2P59A 1KOFA 3TK1A 1FP6A 2F1HA 2R9VA 3AKEA 3QF4A 4CGZA 2VLIA 3AVUA 3QKRA 3I1FA 1YVDA 1M6NA 2ZROA 4LJ7A 5KSZA 4HDCA 2P65A 2X2FA 5KSYA 3UPUA 1IXSB 2Q9BA 1GG2A 2QORA 3M5OA 4LOAA 2IX3A 2RGNC 621PA 3U60B 2C9OA 1G7CA 1XRJA 1YZKA 2IYQA 2HCJB 4C0HA 1G8YA 3CWQA 1RIFA 3BC1A 2NQ2C 3RSLA 2H8KA 4C3ZA 4C7OB 1EWRA 1IY2A 4ARZB 1HTWA 3I5YA 5EZ5A 4LHYA 5FL3A 3HWSA 4Q4JB 2IUSA 2ZRMA 1ZD8A 4RD6A 4DLZA 2A2ZA 3OIVA 2NZJA 1UBEA 3KF2A 1GNPA 4NYIQ 5E95A 1W0JD 2G1KA 1ESNA 3DKVA 4ZKDA 1L7VC 1M7HA 4TQAA 3W90A 3GLFE 1ONBA 3TMKA 4PX9A 4ZIRB 1L4UA 3X1WA 1F2TB 2QAGC 5KYKA 2PLRA 3ZIAD 5FOTA 1E2MA 2O8EB 1CS4C 2VP2A 2X8AA 1LFDB 2VSOA 3NTUA 4JKYA 3H84A 2QNRA 1N6OA 2CL6X 4IKEA 1G8PA 2QTVB 4GFDA 4PZYA 3N70A 2EU8A 4JIMA 4WW0A 1M7BA 1ZUNB 1K5GA 3T1QA 1NSFA 4XD7D 3EC1A 4X8OA 1NMXA 3HR8A 3KUDA 1XDBA 2YYZA 2P6RA 3UK6A 2A4QA 5CDFE 4IVQA 2O8FB 1YZQA 3CLVA 5JWHA 1ZJ6A 1T5IA 3TQCA 1E32A 1QHIA 2GXAA 2WJYA 2J87A 1KDRA 1W5TA 2VQSA 3FHTA 3TSOA 1KJYA 1JXOA 2Q21A 3Q3JB 2OK5A 1KI6B 4JVNA 3QKTA 1Z3IX 4F7WA 1G3MA 1ZCAA 4JL6A 1P7CA 4FXPA 3L0SA 2ODBA 3A1WA 5J4LA 1H8EA 3BRWD 1U9IA 4M1OA 5DI3A 2WWGA 4TL7A 4IDHA 2ANCA 3RS3A 5FOUA 2KE5A 1Y3AA 4G5OA 4ZV4A 4JSYA 5GPIB 1AGPA 1E2JA 3SJZA 4DHEA 2CHGA 1DOAA 1G41A 4Q4AA 4R8TB 3ETLA 3HU2A 3AUYA 4B3CA 4ZCMA 2J7PA 2NO1A 2NIPA 3EZFA 1Q22A 2JJ2A 2P6NA 2GVZC 5C46F 3SJBA 3TR0A 1R6BX 3C7KA 3B9QA 3LY5A 2QU8A 3MWJA 1KI7A 3EPHA 4BQSA 1XTRA 4AG5A 1ZIPA 2ZE8A 2JLWA 2YOFA 3AVVA 1XJ0A 1S9HA 2V8OA 3SU3A 4M4SA 1E3MA 2HDNB 3CIOA 1WXRA 2FA9A 4NBSA 1RE0A 3AF3A 2HYIC 2JAQA 3AM1A 4JLAA 4B48A 4C0SA 5EPYA 1NBME 4K8OA 1GZSA 2NMVA 1T0JB 1LB1B 3I61A 3QVVA 3QY0A 4OBEA 4NH0A 3NKVA 4NONA 2RGDA 4DUGA 2QA5A 1FW6A 1P9RA 4XSHA 2F9MA 3EPLA 4CZ2A 4PQYA 2QMEA 4KBFA 5GVRA 2REOA 3B9PA 1W44A 4PAQA 2V55B 4EDHA 4QGFA 1P72A 3QF4B 4D4KA 1CXZA 3PV2A 1NKTA 3QKRB 2UKDA 3MWYW 3AH8A 1S1MA 3F3YA 1NSTA 3KKMA 4ERNA 3U5ZB 3DPUA 1W48A 2GZAA 2WAXA 3SZEA 1TTTA 5GVSA 2IYRA 1W49A 3RS4A 5T1VA 4MUAA 4BLTA 5FPTA 4Q7LA 5AUPB 4TZ6A 2D62A 4RY2A 4PSVA 2IS2A 1ZD9A 2I4IA 1XPOA 3KQLA 1GNQA 1M2OB 4HLQB 2PMDA 1HQYE 3QKSA 4KSCA 5DE3A 3IBGA 3JZAA 1VG0B 5DN6A 1NIJA 2YKGA 2ZI4A 1OLOA 5EE1A 1JBKA 1ZC4A 521PA 1SGWA 4HUTA 5FI1B 1G8HA 1MRNA 1ZYUA 3LKWA 3CB4A 4XWKA 2JLXA 5KDOA 2H16A 3SNHA 3GLIE 2WBLC 1D2EA 2EYUA 2AL7A 1JR3E 4MKFA 1XTQA 2ZRKA 1XBTA 2WJIA 3L82B 1GL9B 1FQJA 2G9NA 3WYAA 2IUTA 2O8BA 4OK5A 2QSZA 4RCZA 1DO0A 2ZRPA 1QBKC 2D2FA 2DBYA 1W0KA 4C9BA 2V3CC 3A37A 3TH5A 3FE2A 1RJ9A 5JRJA 4TMKA 2PEYA 1Z2AA 5G3YA 5GJCA 3GLFA 1OV4A 2AFHE 3R9XA 1OW3B 3WXMA 3K09A 1N5JA 3S1AA 2BKEA 4M9SA 2G83A 1UDWA 1KI3A 4I32A 1VKJA 2BDTA 4Z54A 1GRNA 2C96A 4B6EA 2KB0A 2A7QA 5K8UA 3UIEA 2ZR7A 5EQRA 3KB1A 1Z6AA 5EZ6B 1P5ZB 3EZ2A 2GF9A 5H1YA 2W6JA 4EPTA 2PZEA 4RZXA 5CDFA 4BFZA 3GJ5A 1W4RA 5ELXA 3ND8A 3AK5A 4LYFA 1AZTA 1DTSA 5DI3B 1K8RA 1DAMA 5TVKA 5KDDA 4HAUA 2VIIA 3UWKA 3V9PA 1VIYA 1H8HA 3N2EA 5JI2E 1R2QA 2O8CA 2ZRAA 2D06A 4Q4AB 4BFSA 2Q3HA 2GRJA 1IN6A 1BS1A 2A9KA 2RGNA 3A4LA 2AKYA 1GNRA 1XD2A 2QE7D 4CIDA 3ZD7A 3QG1A 1UEJA 5FBVB 4DZZA 1SVOA 3QPVA 1R5NA 3I3SR 4LJ4A 1S4QA 2JATA 4PXAA 4TMZA 4DIDA 1OKKD 4OHWA 4ZCIA 2TMKA 3IILA 1XZQA 1S2MA 3AQ4A 3P4YA 1DG3A 3FB4A 2PCLA 3PJRA 3Q9LA 2G1JA 8OHMA 1NVUQ 4UNQA 2O52A 3F5FA 1J7KA 3PITA 3ZJYA 3U6KA 2XZPA 3IHWA 3QI2A 2ZQ5A 1VG9B 2NOAA 3FKSD 1EK0A 3A4MA 4M22A 5LD2C 3LWNA 4KCGA 4PPNA 2C8VA 1CR4A 1XEFA 3LVQE 1N5LA 3SUEA 4OQXA 3SI7A 3P26A 4B76A 4JMPA 2GJAA 3TR5A 4BZXA 5A5GA 4EPRA 1CKEA 2C9CA 5LB4A 4CVNA 4F38A 4US0R 4FMCF 2EVWX 1NLFA 4HAWA 4PC6A 4Q18A 1QG4A 4LBVA 3ADCA 2ZREA 1NNEA 2ZJAA 1NBMA 2XAUA 4Q7MB 4M9ZA 1UKYA 2DWOA 3Q7QA 1XEWY 3RHFA 5FOWA 2ZJYA 5FI0B 2Q3FA 5TXGA 1RPZA 3LRPA 2YZ2A 1NG9A 2JJ1D 4MYHA 2PL3A 4Y0AA 4XTRA 4MGYR 3RC6A 5M04A 3NC1C 2W2XA 2HEIA 4RFSA 3VKWA 4BLPA 1O87A 1Z29A 1VG1A 5EP4A 1TF2A 2KI5A 4A6PA 2OILA 2XCNA 1ODFA 3LW8A 2NTYC 1HV8A 1B0UA 3RSOA 1AQYA 1FZQA 3LQRA 4WZAE 2EFDB 3IIKA 4LI0A 2ZJBA 1W2HA 2FOMB 1B23P 1X86B 3QKSB 4CEHA 2WSSA 3PEYA 2IS1A 3CF0A 4LC1A 4IEEA 1G20E 1HH4A 3K0CC 1X8LA 3U2QA 1A1RA 1KO7A 1Z6GA 3IKJA 3QXJA 2QTFA 3HU1A 5HCIA 2F1IA 4JVLA 3B13B 4V03A 1SULA 2YV5A 4Q66C 1F6BA 4D2IA 4MDFA 1TAGA 1TQ6A 4PPGA 4HSEA 4N1AA 4UNPA 2J45A 1E9AA 1N0UA 3REGA 4FI3C 5J4YA 1OH7A 5JMTA 4BUJA 4JLVA 5JS8A 3MUFA 3T12A 5B64A 2JASA 1UJ2A 2BCJQ 2AWOA 3B8HA 2O8BB 4YQFA 1W4BA 1J99A 2FMXA 3EWAA 1ELOA 4KFRA 5AR1A 4NHOA 4DCNA 5J4HA 5C2JB 3QXXA 3LV8A 3MSXA 3QG5A 4IRUB 1EXMA 1RJ9B 3GLIA 2ZVPX 1JR3A 1NI3A 2BBTA 2F3RA 1JALA 4LC0A 3GLFB 3AEZA 4D4JA 4QBHA 4B35A 3WP0A 5KNBA 5IHPA 2QEQA 3CZQA 4TMTA 2WKQA 3S1AB 1XFAA 4PAMA 1T3HA 3TUZC 1RW4A 3W5IA 4I4LA 4WVFA 1YE8A 1R5OA 4OKSA 5KDLA 4B33A 3FWYA 1Z8FA 4NYJR 1XZPA 1G5PA 2G6BA 2X19A 1KMHA 2YVUA 3W6OA 5EP1A 3LVRE 3CNLA 4I81A 2QPAA 2QRNA 1VHTA 5P21A 2ZUDA 3EXAA 2GCNA 3Q7PA 1S96A 2W83A 2ZI7A 2CK3A 1G17A 3K53A 5LDDC 4A15A 3GEHA 2YC4C 1EX6A 4DT1A 5JEEA 1G291 4WA7A 4U7DA 1E79A 5JJLA 1Z07A 2O8CB 4Q1AA 2IEYA 1YR6A 3IHLA 2AHOA 1KHTA 4LRWA 3W9YA 2W58A 4XWOA 2RGBA 2YOGA 1XD2B 2ZSFA 5EXPA 1CLUA 2ORIA 3M5LA 2VO1A 2P6UA 4NYMR 4URVR 1IN8A 2RGXA 1ZU4A 3RLFA 1X6VA 2V9PA 4Q1DA 1M1YE 1COWA 2A5JA 3EZ7A 3H4MA 2DYKA 3BOSA 4NU0A 3U3JA 5JSZA 1OXTA 4NDZA 1ZNXA 3K9GA 4JMYA 2W00A 3VR1A 4HDQB 2NPIA 4YMWA 1DEKA 1G19A 5DNYB 1OYYA 4PPFA 5AJYA 1LVGA 3BGWA 4XOIA 4B3FX 4HB3A 2O0JA 5DH9A 2V7QA 4ZO4A 2NZ8A 1NN0A 3EG5A 3CX6A 5D3QA 2RAPA 2CJWA 3FFAA 4BFUA 3CPEA 3PENA 1P62B 4B3BA 2V4ZA 5G41A 4YMUA 4FCVA 3U3KA 4IFBA 1DS6A 3G82C 5IDVA 4ESHA 5BWMA 5CB6A 3KXLA 4OI4A 1H8ED 3A1TA 1II9A 4R7ZA 4EPYA 3BH7A 1LTQA 1G6HA 1ZU5A 1E2NA 1Z22A 1OSNA 4FINA 5H70A 3FYHA 4OHYA 2ZAMA 1QHHA 3HYRA 1R8QA 4D82A 4DLUA 2IXGA 4RFSB 4ESVA 2NO6A 1E2KA 1AK2A 4G5GA 4WZ6A 3IO3A 1E9RA 2MSDB 1UBCA 3UATA 1E9FA 1IN7A 4ZDWA 1DAIA 1GM5A 1U8YA 2ZRGA 1Z47A 2NPFA 3ZVNA 1KKMA 3OIUA 4CEHB 4OHVA 3GLGE 3AVXA 1XCGB 3TVTA 3TGPA 1OB2A 4LHXA 1DY8A 1UPTA 3I4LA 4I1OA 4KTCA 4Q47A 4NTZA 3SU4A 4TZ0A 2FF7A 1KDOA 5EXTA 5HPYB 1IN4A 4QHSA 3C5HA 1E1RA 4AY2A 1Z0DA 5FUVA 4TTRA 1TMKA 1II0A 3KUCA 1RC8A 2VHCA 3RRMA 4DUGD 4NYMQ 5DISB 2Q0HA 2YNMA 4A92A 4OK3A 5KSPA 4FIDA 1WCV1 4DLTA 3JVVA 2OBNA 1JXPA 2C04A 5JCZA 3I8SA 4A1XA 1JEDA 1AS3A 1Z0FA 1GKYA 2O5VA 3PUWA 3NEYA 3GLIB 1F48A 3L0OA 4LJ8A 1I4TD 3DVLA 1J90A 1ZM7A 1QDEA 4LBZA 2IF2A 3WMFA 4M8NE 4TTPA 5CIQA 1P61B 3W3AA 3K70C 3ZVMA 2Z43A 2IL1A 4Q48A 2IYZA 3ZS9A 5E7MA 4QBGB 4AYXA 4LV5B 2WOJA 2R6GA 4URUR 1NRJB 2XJ9A 5GJBA 2XNIA 3CO5A 3NBXX 3FVQA 3SYKA 2JLRA 3TAHA 1KMHB 5AJWA 1G1MA 1R8SA 5FOXA 4ABYA 2VRWA 5J47A 4KVAA 1Z28A 5EQQA 2CVFA 2LWIA 5DN6D 2BJWA 4D0GA 1Q1EA 3A58B 3CRQA 4FWIB 1NG1A 2VH5R 4TN1A 2GXSA 4NZYA 1AIPA 2DFKB 1ZW6A 3A36A 3KKNA 1MO3A 1XF9A 4GSYA 1P4SA 4DT1B 3BS4A 3CF6R 2C03A 3NBZC 3K0FA 4PHHA 4R2HA 3T1TA 4L8GA 5J4VA 3QQ5A 2QPOA 3KKQA 3JZMA 2YOLA 1GL6A 2WJJA 4V02A 2MMCA 1SVMA 3PG5A 1CBUA 1XTJA 4NYIR 1R0ZA 3GJXC 2XJ4A 3EIQA 4NCNA 4R2IA 3NHBA 4IDOA 5CYOA 1TNDA 5JSZB 4DDUA 1JNYA 1N6HA 2R6DA 3WP1B 4HAXA 2OUKA 1AZSC 4DLXA 1QHYA 1E1QA 2GETA 3K0CA 4P4UA 5D3MA 4Q1BA 5DHAA 4BZQA 4IOMA 2F9VA 1T0HB 4G3XA 2OC1A 3CPJB 2EFHB 1IM2A 2ZYUX 1MR3F 3OE7A 4JZKA 4CEIA 4JT2A 4JBWA 3U44A 4WAUA 2JIZA 2YOHA 4TMXA 3SQXA 4KJZA 1YRAA 1ZUIA 3R7WA 5F9HA 1MH1A 2CJWB 3T5GA 2WOOA 2O0KA 4NCHA 4RZ3A 1Z5ZA 1ZNYA 1WE2A 4B3XA 2JEOA 3AKYA 4P4TA 3CH4B 1U8AA 1G64A 4DEXA 1SKYE 4O2RA 4IFEA 2FPLA 1VHLA 2ANBA 1DXPA 3T06B 1DBSA 2BIFA 5FTJA 4XTCS 3VX4A 1Y63A 5L3SA 4L9SA 1E2FA 4G0NA 1DAKA 3B1XA 4F4JA 2GEVA 1L4YA 4KITB 1SXJD 4QXAA 1EFCA 1I2MA 1H8HD 1E98A 2QSYA 4IVPA 4Q4LA 1I4LD 1QHHB 5FPYA 4CEJA 2VF8A 2MSEB 2CE7A 4URYR 1G7SA 1HURA 2FNAA 1DY9A 2ZITA 1G4UR 1NY6A 3NDBB 1M74A 2QTHA 4N3NA 1E2GA 2BM0A 2P0EA 1E2PA 3QPUA 4ON9A 1KK3A 4LJYA 1EG7A 2REBA 4DB4A 1A2BA 2QAJA 1XTIA 2RCNA 2QRZA 4M2LA 4JT4A 2R44A 4OM9A 4YMVA 3WNDA 1GUAA 1TL7C 4PZZA 3SJAA 1UBGA 5JWRA 1QHSA 4CF7A 3KKOA 1E4VA 4IJMA 3W8RA 2WZQA 1D8TA 4YDHB 3PV5A 3NC0C 5B58C 2J0QA 2W2TA 3HR7A 5HTKA 3U7FB 2IBMA 3PUZA 5L3RA 3B78A 3O8BA 3B1YA 3CWZA 1KIMA 1LW7A 3EARA 4QBFA 4YMTA 2VL7A 3CR7A 4QKQA 1QRAA 1R0YA 4FCWA 3I8XA 2DCUA 2ZETA 4PANA 1U90A 2AKAB 2AXPA 3PCRB 3UG6A 3GLGA 1Q57A 1N6PA 3GFTA 2IYSA 4ACAA 2CE2X 1J70A 2NO7A 1F60A 3TQFA 4R9UC 5FTNA 2K1QA 4FMDF 1NN5A 1FP7A 1NBMD 1ZUHA 4OJQA 2YJTD 3C15C 3KQUA 3EX7C 3AF2A 1YRBA 1WDTA 1Z6TA 4KO8A 5FOVA 3CR8A 1DO2A 2IXEA 2ZANA 3U3OA 1OIXA 4HLCA 4IVRA 1GILA 2A30A 5FBRB 5JWOA 2ZUBA 3RC3A 4DSNA 1NLZA 2GTPA 2CXXA 4DDTA 5LD2B 3TJZA 1KMQA 3M0EA 3VMFA 4LZZA 3CNOA 5BN4A 3GFPA 1MO5A 3OZXA 5H8WA 4JLPA 4ASUA 4KLNA 2R6CA 3RWOA 2P3SA 1P75A 4AWXA 1OFTA 4OHXA 3WRYC 4C0BA 5GNDA 2V6JA 1TADA 2RHMA 2PX0A 5TV2A 2ZRCA 1W36C 3VNUA 4RD2A 3M4YA 4N0DA 1Q1QA 4HAZA 1TEVA 4TMWA 1RTLA 3Q5DA 4G01B 1R7RA 4EQ6A 2WM9B 1GIAA 3K0FB 2FOLA 2UZ3A 4MDEA 5FBWB 1MO6A 2GXUA 4PC1A 1TF7A 3FFBA 2FPKA 4QNRA 3AVQA 1KDTA 2JDID 2AK2A 4WIAA 4F93B 3LX8A 2BVNA 4RD4A 2PT7A 2YWGA 2OC0A 2ATXA 4GOKA 3OYPA 4S2EA 1KTVA 4TSFD 2OG2A 3N2IA 4Q9HA 1M7GA 4LYHA 2ZPTX 3OEEA 2ZU6A 1MOZA 1U94A 3EIHA 4I1VA 4KODA 3IBYA 4TYYA 2ZSAA 1N0VC 2IUUA 5JJIA 2JLSA 3RNLA 3V4RA 1W7AA 1E96A 1JR3D 2WPDA 3LBNA 2OBMA 4PZLA 2XSZA 221PA 2F4LA 1YR9A 2GCOA 4MH0R 1GAJA 2ZJ2A 5D3MB 4DBLC 2QP9X 3SJCA 4BFTA 3NHAA 2J0UA 3MJRA 4KFSA 4JYCA 4CEIB 2GK6A 2G0TA 2B92A 2QZ4A 3RWMB 1QF9A 1JQJC 3U44B 3VKGA 5C18A 1VCOA 1OF1A 1GRQA 3IGFA 3R7WB 3X1ZA 1VPLA 2GJSA 4NL4H 4QC2A 2IYWA 3LDAA 2ZS8A 1P2TA 3UMRA 3PFIA 3REFA 1YR7A 2VPPA 3QUSA 3GEEA 4OJKA 5EE5B 1V5WA 4O2LA 1KY3A 2OCAA 3BFKA 5DLQC 4R71A 2D74A 5SZIA 1PVOA 5L3SB 4JLOA 4S35A 3TRFA 1CR2A 3EZ6A 2CK3D 3QIAA 2BC9A 2F43A 5FBQB 4DVGA 4ZI2A 2A4GA 3BORA 4KYIB 1E79D 2ZJ8A 4GP7A 1OHHA 1T91A 4CEJB 2GAAA 2F55A 2GEUA 1U0LA 4KYUA 1G9XA 5F2EA 2BMEA 3GPLA 3LONA 1JQLB 2J46A 1XEWX 2C98A 721PA 5HE9A 1E2IA 2DFNA 4EJSA 2E87A 5CIWA 4IDQA 5SZKB 4DCTA 1G7TA 2VHJA 3A1UA 3PXGA 1Q3TA 2EFGA 1VYTA 2GA8A 3M1IA 4JLJA 4MGIR 3CW2A 4A4DA 2RKOA 1FMLA 2GXQA 1COWD 4HDOB 2YC2C 2YWEA 1VCIA 2IK8A 2IJOB 4N0EA 3K8YA 4QM7A 3THWA 2WJVA 3SBDA 5G40A 2Q3MA 3ZVRA 2I3BA 2P2LA 1PLLA 1G5TA 2V7QD 1E9EA 3D6TB 3CRMA 3MMPA 3FOZA 5KO2A 1J8MF 3B1VA 1J8YF 2OXCA 5DYGA 1G3UA 1P3JA 4Q9LA 3UG7A 5L3VA 3U7GA 3ZD6A 4TYWA 1VYVA 2GILA 3GLGB 3KQKA 2OBOA 2CLDX 5EP2A 1E94E 3LA6A 1U8ZA 5JS7A 1KNQA 1SVLA 2XZLA 4A0GA 1PJRA 2OT3B 4HB4A 1W47A 1GFIA 2ZSEA 3EW9A 3RANA 2V1UA 1NP6A 2F9LA 2BM1A 3MLEA 3ONWA 1D6JA 3U1JB 5FUXA 3VTKA 2ZUCA 4LHWA 2QI9C 1YKSA 3NH9A 4U5XA 1KSJA 2OFWA 3BK7A 3H0KA 2ZXUA 5FPSA 1ZAKA 3CNNA 1FTSA 2QPTA 2FG5A 1J2JA 4UXIA 5KTYA 3WHLA 2FX3A 2PH1A 2XNDA 4BZPA 1Z0IA 2BEKA 2C2HA 4HLUC 4QBIA 1G8GA 3U3MA 2NO0A 2WVJA 2IYVA 4YXWA 1EFTA 3AF4A 4KHZA 3F0TA 5FFMA 4DLSA 1G8FA 2FJUA 3TNFA 4KI0A 1OXUA 5KPDA 1P73A 1XB2A 3B2EA 5AK0A 4AIIA 1XX6A 4JLDA 3PEWA 2VSXA 3AV0B 3V4FA 1NVWQ 2ONJA 2FEMA 3TSZA 4C4PA 4TT3A 3SU6A 4EQ6B 2N46A 4LGMA 5JJKA 3X1DA 4ZDIA 1G21E 3ZS8A 1I4DD 2ZYVX 4MQBA 4OQMA 1RGQA 1CTQA 1D9XA 1YJ5A 5HKKA 3SU8A 4M21A 5EXSA 4Z1MD 1RFLA 1TEXA 4I99A 1TX4B 5FUYA 3PEVA 4ZDJA 2WHXA 4Q4HA 4GDFA 4UJ3A 5A0FA 4BRWA 1ZD1A 4WXRA 4RZ2A 2W6IA 2KJQA 5EJEA 4TYDA 1N5IA 3RS7A 1DE0A 1ZM3A 2ZRLA 4L15A 1TPZA 4B3DA 2B7CA 2AFIE 1XMJA 1RYHA 2ZI6A 2GCOB 2ATVA 1E99A 2VP0A 4NCKA 2ZE5A 1AGRA 2J0UB 4Q1EA 3VX3A 1YZLA 1P2SA 5BYJA 5CB8A 3ADDA 3T35A 1XD9A 2CHVA 3BJIC 5KSOA 4Q9IA 3VAAA 4RD0A 2IS4A 3GFOA 2QGZA 2CCGA 3GJ0A 5IK2D 4CRWB 3IEUA 1W5SA 1CP2A 1ZVQA 2J59A 1AJEA 2ZE7A 4XVQA 1MV5A 1RYFA 1NLYA 4JBXA 1FTNA 2WJHA 1TUIA 2QAGA 2IHYA 3CRRA 1UFQA 1XCMA 2J0SA 2F43B 1CJUC 3L2OB 1FFHA 2FFQA 2C9YA 3SZRA 4TTQA 2IEZA 4KXFB 5FUWA 4ACBA 2NGRA 3DEFA 4LYJA 1G18A 2XGJA 2KSQA 2Z83A 3UMFA 4QJ3A 4HYYA 3K70B 1W4AA 3OFNA 4EJSB 1OIWA 2GK7A 5EE9A 821PA 3HYTA 4W5HA 1WP9A 4C0AC 3QKUA 3OEHD 4KU4A 3D3QA 4Z8YA 1ZIOA 2A5YB 2VTKA 3OAAD 4CDGA 5FTLA 1W0JA 5BW8A 3GP8A 2KBEA 2IS6A 3SFZA 2W0SA 4QL3A 3MFYA 1N6RA 3THWB 1S3SA 2A5FA 4D6PA 4GT1A 3LBHA 3ZIAA 3RC4A 3OE7D 1PLJA 2JIZD 3SHWA 3DZ8A 1WF3A 2VA8A 3U4QA 3K1JA 3R9IA 3VR4A 1GITA 1XXHE 4II7A 5C4MA 4RKEA 3PUVA 4G1UC 2W0MA 2C77A 1E2HA 4DLVA 1TQDA 3T1VA 4XD7A 1LY1A 5ANRB 2F3TA 2IW3A 1A5TA 3SR0A 1F5NA 1W3CA 2ZRIA 2ZU0C 4IXMA 3C5CA 3FDIA 4EIWA 1YZUA 2PZFA 3KNXA 3KJIA 1E4YA 3CBQA 1US8A 2IYTA 2JLYA 4BFVA 4RFVA 4PC7A 2Z4SA 2OCPA 2ONKA 1OFUX 3D7MA 4LJ5A 1E9SA 2BEJA 4B34A 1KJWA 2FH5B 2HV8A 4PHTA 2JLQA 2V6IA 3DM5A 3LLUA 2ECKA 3LX5A 4FMDB 4RVCA 1WMSA 3QE0A 2GDJA 4UXHA 1JAIA 4AURA 2IT1A 4HEJA 1MRSA 2OFOA 3B60A 2OO7A 3QJYA 2HXYA 4A2PA 1AN0A 4RD1A 5AJXA 1KDPA 1XJCA 3IQXA 4AYWA 4YONB 4DWJA 1KNXA 1KI9A 2OCYC 4KVGA 4L9WA 1AS0A 2Z6VA 5E7IA 5C4GB 5ETXA 1DAGA 2ZR9A 1BT7A 4MGZR 5JEDA 1HE8B 1KO1A 3X1YA 2DHRA 2D4HA 1NF3A 1FUUA 3E5HA 3TIFA 1FNNA 2BOVA 4HZIA 3KL4A 1DG1G 4IHQA 4ZI3A 2Q6TA 3AVOA 3FMPB 3TLXA 2KWIA 2P67A 2WWHA 4Q4HB 3SDZA 4LHZA 3H1TA 2AR7A 3I5XA 2ODWA 4J0QA 1U81A 2A3RA 3T34A 3L8ZA 3I62A 1KJZA 4IOJA 4Q01A 2IJD1 2BCGY 1EFRA 2IYLD 3SBEA 4I31A 2ZVQX 3ZGXA 4ZCLA 3AVTA 4G5SA 2QL6A 1ESMA 3RS5A 1OE0A 2WIAA 4F4CA 1ZMXA 2CVHA 1TUEA 5ESBA 3DMNA 2VP4A 4AC9A 4EPXA 2QMHA 1BYUA 4DLYA 2XXAA 1E0SA 4JBYA 4AYTA 3GQBA 4TLBA 2GJ8A 2IYUA 5FPHA 3P8NA 2CNWA 2ODNA 3RDPA 4E22A 4Q7KA 3ASZA 4X8LA 4LUCA 2RHDA 2OXRA 3W6NA 3KQHA 1HYQA 2OCBA 1UF9A 2OSBA 4IOLA 1E0JA 3CH5A 5JHHB 1OYWA 1VDZA 4AD8A 5K8IA 1NN3A 1C9KA 2QAGB 4MRRA 2X77A 4TYQA 2YHSA 3RC8A 2WAYA 4AK9A 3OHMA 4DCUA 1LF5A 4P3YA 4D0NA 5GJVC 3SYLA 5HZHA 3NWJA 1IJFA 2FU5C 2GZDA 2OFXA 3D31A 4OI1A 5CM9C 4DSTA 2PJZA 4GL2A 1WBBA 2NO9A 3SUGA 4LJ6A 1T6NA 4OQLA 4FCTA 1PV4A 3C8UA 2HLDA 2C78A 1KK1A 3C4JA 4JS0A 3OEED 2J7PD 2OV2A 3W3ZB 4DSOA 4TYNA 2JJ2D 4R98A 4HAYA 3EA5A 1U98A 5CJ2A 2IA5A 1NVVQ 4GMDA 3T61A 2VF7A 4D0LB 1AQUA 1E2EA 1QVRA 5J5CA 1TU3A 2XSZD 3QXHA 3SV9A 4Q7JB 1YU9A 3BB1A 1W36B 4B3GA 2JA1A 2XX3A 3MCAA 3P20A 1M8PA 4UNSA 5AUOB 2QM8A 5SZHB 1NKSA 4WF8A 4DLWA 4K8BA 1UEIA 1RZ3A 3U4QB 3KDSE 1FQKA 2R62A 3QXCA 1U9IC 1N0WA 4ZPXA 3R8FA 3LO5A 5DGXA 2RGCA 1ZM4A 1VG8A 3GJ7A 1XD8A 3A8TA 2N42A 4QNMA 3ZQJA 4B73A 1C1YA 4AKHA 3WY9A 4K81B 5EQTA 4HB0A 2FP7B 4V0KA 4POAA 2DY1A 4RZUA 4ITRC 4TYPA 1HY3A 1US8B 5AJZA 4AI6A 2ZS7A 2UZIR 4JLMA 4RKFA 5DHFA 5KNCA 1XXHA 2RH5A 3FTQA 4FW9A 1A7JA 1GDDA 1A2KC 4A6XA 4H1UA 4KFTA 2H5EA 1G3QA 2OC8A 2JGNA 1S1CA 3IO5A 1GL7A 3ZZUA 5LPNA 1YZNA 2AK3A 3PUYA 3AVPA 1JECA 4ZKEA 4MRVA 3UXMA 2A4RA 4LHVA 1KI1A 2CEAA 3W6PA 4CYMA 4WBSA 4M0LA 3VHLB 4URXR 1FOEB 2H1LA 5EUQB 3KJGA 1KO8A 3I73A 2H18A 4EFMA 4L16A 1RRFA 3IQWA 4M1YA 2ZRFA 4LBWA 5TARA 5TMPA 1KK2A 4DKXA 2QT1A 2PEZA 5BYKA 5DYIA 1Q12A 4BLRA 1S9DA 4YMSA 1Z06A 1Q44A 4FMBB 2B21A 2DFTA 4MITA 1HT1E 4O3MA 3QXSA 2XTZA 4G5QA 2ZE6A 5HR5A 3OIWA 4PR0A 2BMFA 4B47A 3HU3A 4W5JA 3WYGA 3J81k 4P0TA 1HA3A 3QPWA 3TKLA 1CEEA 1II8A 1AA9A 2X2EA 1JJVA 2J5XA 5H68A 1LF0A 2J3EA 1NIPA 1ZNWA 3FKSA 2N1BA 4Q00A 1P2UA 1E9BA 3NBFA 1ZM9A 3K9HA 3DL0A 2D7CA 4PC3A 3WRXC 2Z0MA 3DDCA 4TL9A 5FPKA 1W0KD 1CJVC 3IEVA 3TSWA 1G3IA 1TU4A 2YWHA 3OIYA 4A0FA 3ZQ6A 1WB9A 2A78A 4TLAA 2GVFA 2R6AA 4MKHA 1R0XA 1Q20A 1TF5A 3DMDA 1JR6A 4YXWD 2HCBA 1NMZA 2FGKA 4LX0A 3C14C 3THYA 3QF7A 4LDJA 2JCSA 4A8JC 2ZRDA 2GEDA 5EE3A 5G53C 2EYQA 5FBLB 1JPJA 1KSFX 2C95A 1NN1A 1UDXA 3U3RA 3K9LA 4P33A 3TE6A 2CLCX 5TY0A 2O8DA 3EA0A 2E9SA 2L0XA 1OFHA 4TT3D 4TQ9A 4M1MA 1M34E 1N5KA 4OK6A 2W6JD 2VHUA 3BXZA 2ZR0A 3P32A 3V00A 3E70C 2VP5A 5LB2A 2ZI9A 1VMAA 3MAAC 1R0WA 2EW1A 2WWFA 1IXRC 4Z8XA 2BV3A 3SU5A 4M1SA 1VECA 3LAWA 5J40A 3MWLA 1N6KA 4BPBA 2A5GA 3K09C 5BXQC 4FMCB 1T4GA 1BOFA 1DXWA 1QVAA 5L8VA 3TVDA 2QP4A 3AF1A 2BBSA 2VYFA 2WICA 4O0MA 3EAQA 3WNCA 4A2WA 5JZVA 4W9MC 2JLUA 2PX3A 4GOJA 1W46A 4HB2A 3RABA 5FTMA 2AD1A 2JLVA 4LBYA 2UVQA 3NG1A 4KLZA 1SQ5A 4GOXA 4A0RA 3HPQA 2G77B 1E9CA 4X8HA 2ZYWX 4PO1A 3Q72A 4E07A 3AGQA 3EASA 4TL6A 4M53A 1DPFA 2HJGA 1SXJC 2AX4A 1AKEA 2F1RA 5FR1A 4TWZA 4AKEA 4F92B 3EZ9A 2IHBA 3BH0A 2D7DA 1E9DA 1RRGA 1CULC 1KKLA 2O0HA 2GBLC 2OZEA 1CR1A 4EPVA 1L2TA 4F91B 1IAQA 1KI2A 1XU4A 4OQFA 1XXHB 1Z6YA 2W2VA 4GI7A 3ECCA 3I32A 3W5JA 4DC9A 2J0VA 4H9GA 2FE4A 3VR3A 4NPHA 5KUTA 2VP9A 3LXXA 1KAOA 4XVUA 4L4UA 1E2LA 1KYIA 5IDKA 3OFND 1R5BA 4DCSA 4EAQA 4V0LA 3C41J 3IUYA 2XOKA 1AKYA 4GPTA 2RGGA 3AF0A 4HUQA 1XPUA 1WBDA 5JI3E 4WH6A 5K8LA 3FPAA 1G7RA 2G0NA 2H17A 1BIFA 3BAFA 3GLHE 1W36D 3DKPA 3SOPA 1N6IA 1U99A 3OESA 3B1WA 3P1JA 2WSSD 2XB4A 2F1JA 2NG1A 5TB5A 4OHZA 3RRYA 2AWNA 1XP8A 1NL3A 3CRVA 3LFUA 4PSKA 3M5MA 1U2RA 3L43A 1JEEA 1Q21A 2CBZA 2MSCB 1OH6A 5BN5A 3EWSA 1AS2A 4PAOA 1W1WA 5JCPA 3RRNA 1II8B 5FL7A 2FPMA 5FTKA 4D26A 1XPRA 3CUEF 2ERXA 4U01A 4P4SA 3QEOA 5AJVB 4QGAA 1SVIA 5H4IB 2ZTSA 4G5RA 1ZINA 3BB3A 4PFSA 1IY0A 4BWYA 1WRBA 3M5NA 1SXJE 2OEPA 2EQBA 1RKBA 4CT4B 2XB2A 1OJLA 3SHFA 4B6FA 2CCKA 3FHCB 1ZBDA 2PCJA 2Y8EA 2XITA 3B7GA 4B2LA 1DAEA 3PIRA 3LOXA 4KAXA 2GJKA 3SYJA 3L0PA 2B7BA 1E0KA 5E4FA 2BBOA 3THYB 2WKPA 1TQ4A 3MWKA 2QG6A 3ASYA 2WWYA 1Z63A 3TUIC 3UWOA 4TLEA 2ORWA 3KXIA 4MKGA 4RJLA 1G16A 4Q1CA 1IBRA 2DFLA 4JVMA 3WHKA 2O8DB 1CJKC 5EP3A 3T5DA 1OH8A 1SHKA 1DAFA 3R8CA 3SV8A 3A1SA 4YLGA 3SV7A 1NVXQ 4BASA 1JB1A 3PEUA 2CCJA 2RGAA 1E2QA 3BH6A 2B8WA 2EWVA 3BIFA 3SUDA 1K6MA 4C30A 2OC7A 4KSBA 1GVNB 2V1XA 4JKIA 2GJ9A 2R6FA 2EFCB 2B6HA 4C0QC 4JJKA 4C0KA 1OH5A 4DJTA 1EFRD 1KK0A 5CM8B
chains in the Genus database with same CATH superfamily
1ACJA 1C5TA 2B4QA 3MNSA 1KEPA 4PN3A 3E3TA 3ZH9B 2OBBA 3RTEA 3GJTA 1BZXE 3IDZA 1ZZEA 1C1QA 4M9UA 1T2CA 2QBYA 3QHAA 2HIMA 3G5TA 1IHUA 3CPHA 4JI5B 3E2PA 3TLCA 4A23A 1BMFA 4JMLA 1GMDG 4UZEA 2V5UA 2PQ0A 1TTQB 4FHCA 1I5EA 1RI2A 3KTOA 121PA 1RP7A 1Q16A 2HF9A 2OCDA 4BO6A 1D2MA 1NUUA 4WV3A 4CF5A 1PLKA 2OBLA 4BE4A 1VCPA 5AKZA 5CA0B 1XVLA 4J8PA 4E70A 5B55A 1M33A 2Z2IA 3E2IA 3EVCA 4HQKA 2OE2A 3GT0A 3VJKA 3SZLA 3FCEA 1CUEA 3OFKA 3SICE 4F2HA 4RHYA 5KOYA 2ZJOA 3EC7A 3O82A 1EA7A 1CSEE 2F6RA 2BHNA 3CWCA 2X1LA 4E21A 2GJGA 3W4IA 1M66A 2XTNA 4RNDB 1KZ7B 2GCGA 1UBKS 2P3QA 2QN1A 2IRWA 2VK8A 2XWQA 5F33A 1UKZA 1XMVA 5AK6A 1UIRA 1JV2B 1B8PA 3U4MA 3KFVA 1WSSH 3BTDE 1C80A 3CUKA 2ORYA 3DHWC 1EP3B 3MJFA 2CMKA 2G9UA 1UOEA 4FYXA 4QQ8A 3ZG6A 2Z9GA 2VXCA 3NJ4A 3VTZA 2WIJA 3BZWA 3QNUA 3QE9Y 1GBJA 1JPVA 1I10A 2STAE 3DAOA 1T4BA 2XBWA 1LVUA 1NKVA 2HSDA 5JDCA 1X42A 5HJ7A 4BFWA 1RQPA 3GVCA 2PXHA 1N2GA 3O7WA 2IP4A 4A8JB 3FHOA 3SF8B 1JWAB 2DWUA 2G88A 3HFRA 2I9PA 3TSYA 5MGNA 1J21A 2FV8A 2Q4RA 1SGEE 4ZOBA 1BTUA 4QELA 2CT8A 3EOZA 3GMTA 1V1MB 3TW4A 1J8QA 1ZK1A 2W7UA 3BHIA 3RT1A 1M6VB 5ECYA 1A4RA 3EIWA 3JAWB 4J4BA 3OQVA 2QENA 3VR2A 3K8QA 4AN1A 1I5RA 4ZHMU 4M1WA 2J9RA 5DLYA 3KV1A 5H83A 2V0NA 3SUFA 5LLTA 1AE5A 1LDEA 1FMJA 3FPFA 3QVSA 3RNOA 3Q7EA 3PROA 4HQFA 2QW8A 1U7HA 1UZNA 2BHGA 3IELA 3OO1A 4EHBA 1O2UA 4ZOAA 1FLNA 2QY0B 1QHNA 5CHAB 1X8JA 3IAHA 1J97A 2PSDA 2EX4A 1PJ8A 1HFDA 2WWVD 1AA6A 1XCPA 2F2TA 4R1TA 4LXXA 1UQUA 3M9XA 2V7TA 3QBDA 2ACWA 4RTSA 4HH4A 1HAHH 5JHGB 1X1RA 5FPPA 4V0OA 2DB3A 4DXDA 5TMEA 2AXNA 2FUG6 4EH1A 1C5SA 5H4HA 4Q9JA 4RTKA 3D6FA 2PRKA 4ZAYA 2GPAA 5K4HA 3ROPA 2BUBA 4PHCA 5GJWC 1YMUA 3EVBA 1GKIA 2XMZA 5K0LA 5HZKA 4D9GA 1X7WB 1IQJA 3PFBA 4BMSA 4QU0A 3DZDA 1TAWA 1CP3A 1F2TA 4UHHA 5BSTA 4IG4A 2JLBA 4TPIZ 4NULA 3FVVA 4Z2YA 4PYKA 3AINA 4DA6A 4HNHA 2QMOA 3ELYA 1BMFD 3UAGA 1QU2A 2G09A 4X92A 3UWMA 1HZZA 2V6GA 3GYBA 3IHTA 5GADl 4E2ZA 2VUHB 1LNQA 4B5LA 5EGMA 3GB9A 2OGTA 3ICQB 3THXB 2XMRA 3BWVA 4E5KA 4A10A 3H05A 1I4EB 4B44A 4JI7B 4O8CA 3ABOB 1YO6A 4IUBS 3TOZA 4M7WA 3NATA 4JEIA 1FLEE 4TLCA 3MH7A 4JHXA 4R2XA 3F3SA 5GZ6A 4RDCA 3DXXA 3HV2A 1X74A 4KPEC 3QSYA 2EDCA 1NA5A 2JGIA 2P59A 2FPPA 3TK1A 3SR3A 1O34A 2QORA 4LOAA 3U60B 2FWJA 2ZQZA 4K69A 1RIFA 1Z4JA 5IVDA 1YA4A 3MWDB 3QLUA 4AJOA 2PR7A 3BF8A 1EJ0A 4IEFB 2ZRMA 1ZD8A 3WBFA 4AX8A 3KF2A 5H9WA 1KDVA 3S9CA 1L7VC 3JWIA 2BQWB 3W90A 3EHEA 3ZVDA 1RABA 4ZIRB 1A3EH 2BISA 2Z98A 3ZZDA 4JKYA 2QNRA 2WYJA 3JTMA 2QTVB 4UBJA 4JIMA 1KQPA 1P81A 4CDRA 1HLFA 1WZUA 5H7XA 1KYZA 3PZBA 5DRYA 4Y9DA 3UAYA 1FLVA 3ER8A 3Q3JB 4M1ZA 4BU1A 4ARBA 4MWSA 5IBPA 1QXSA 4M1OA 4RETA 2GERA 5FWXB 4J43A 3PX3A 1EAXA 2Q8NA 3EZFA 1Q22A 5LXTB 2AZXA 4KTSA 1APBA 1CUIA 3N3AC 1NONA 1XTRA 2YOFA 2DQ4A 4F4OC 5EFZA 2RGDA 1AKSA 3VR2D 4DZTA 4CMIB 4EDHA 2NAPA 4TY7A 3N7EA 1UCYK 1UANA 2FR0A 1ETTH 1N2BA 5ALXA 1EFPB 2D7JA 1VJ1A 4HLQB 1ACLA 1ZC4A 3ZWMA 2HTEA 2FEWB 2W11A 2E18A 1U2GA 3UH1A 4HDSB 1DC4A 3IEPA 2ZHFH 2ALVA 3CUSA 2WUFA 3A1NA 1JDVA 1XTQA 3L82B 5DTIA 1JDJA 1V2VT 2A0XA 3FAZA 5BMVB 1ICIA 1S2NA 5JRJA 1WVMA 1VJGA 3S1AA 3RAEC 4B4OA 2Q1WA 6AT1A 3MTYA 3ND8A 1K8RA 5CX4A 3V9PA 1T8YA 4MEBA 2ZDHA 4CM8B 3PGMA 3VSDA 1IN6A 1BS1A 2A9KA 5KTPA 3A4LA 1IK4A 1GNRA 4MVJH 3K9QO 4JBHA 5HGGA 4U30A 4DIDA 1YH3A 3DDWA 2G1JA 1VSTA 3QI2A 5H3CA 3KOUA 1VCQA 3D59A 5HF8A 3LWNA 4AJKA 1TMGE 1CKEA 1PR9A 3UVEA 3RMMH 3FF1A 3ADCA 3FVFB 2ZJAA 4UMVA 4FUJA 3B1FA 4C6TA 2EP8A 5JQGF 3AV3A 4BNGA 3VKWA 1MG5A 3OA2A 4E5DA 4IF6A 2HV9A 2ZBVA 3KB8A 3OF3A 2GCTB 1W2HA 1X86B 2GTIA 2OQIA 2AG8A 2QJWA 3FLEA 3IKJA 1PQ7A 3JQBA 2FW0A 3H5TA 1FY3A 3S7ZA 4Y6QA 1E9AA 1Z5GA 2ZGVA 1PPEE 1NBAA 4EW1A 2DBVO 1X7ZB 1NW7A 2QLJA 5F23A 2NYUA 2NVUA 4DCNA 5J4HA 3VDQA 3FIUA 3T99A 3MSXA 1HDOA 5CX1A 3QJ5A 1GG6C 4L22A 3FUTA 1G3BA 5AFYH 4QBHA 5E1OA 4K2YA 2C3UA 2GYWA 3EVGA 1K7SN 3AFOA 3F1SB 2ZI2H 1XZPA 1CC1S 4AUKA 2HH9A 2AEEA 2QRNA 5P21A 2VAMA 1J9CH 1NWHA 3GEHA 1A4UA 1EX6A 4S04A 1FYDA 1XT6A 2YZNA 4PGGA 2Q7DA 1RTTA 3NGXA 3T7SA 3DLCA 3LC7O 4LJSA 3WFIA 4Z5XA 3WGUA 1X6VA 1J0BA 2CLFB 3H4MA 4NDZA 1FVHA 5PGMA 5U4XA 2RAPA 1E6EA 4BFUA 3JZDA 4JWTA 3I45A 2FR8C 1CGIE 1V8DA 1ZU5A 1YZHA 3F6BX 1R8QA 4GOLD 3RVJA 3K94A 4TKUA 4ZDWA 3PPVA 4P34A 3ZVNA 4CEHB 3VDRA 1AQ6A 3WMXA 4NTZA 1SFIA 1IBKB 3Q2IA 2YNAA 4JB8A 2VHCA 3ITKA 5IH7A 3WK7A 4ZT6A 4FIDA 5T3UA 4IV5A 5EMNA 1SA0A 3O9MA 3PNBA 3T4PA 4KB5A 4H4CA 4LBZA 2ZDMA 2XV1A 3CZ9A 4N0QA 2YS7A 4Q48A 4QBGB 1DIAA 2GSWA 3EPPA 4URUR 4DMKA 5PNTA 5AQEA 2X0IA 3GICB 1R4NB 3ZQKA 1R8SA 2LWIA 3A58B 1ZESA 2YY5A 4ZXPA 3A8DA 1QBOA 4X2YA 3LUDA 4QGSA 3QV1A 4NC9A 4V02A 3I77A 2GFIA 2PXCA 1F8YA 1BHXF 3NETA 1QGDA 5I5GA 4FS8A 4HAXA 2OUKA 1ETHA 5LA6B 4IOMA 3UPTA 1H42A 2Y3IA 4JT2A 1UPCA 4RHUA 2CJWB 1HC7A 2ZBUA 2C4UA 3BWXA 2VTBB 4O2RA 1FTQA 1JJFA 3JYQA 2BIFA 4L9SA 1DAKA 5JANA 5CBPB 2UWLA 1SXJD 2L69A 3RK0A 1XZEA 2BGJA 4QUBA 1LUAA 4CRGA 3OQ6A 3K1AB 4C1NA 1M74A 3VR5H 1F0RA 4CIWA 4C22A 3SJAA 3N39C 3F2FA 2ZJ0A 2WPKS 3NHRA 3PV5A 4ZYTA 3AHDA 3GJZA 5ESTE 1ICEA 4G85A 3U4CA 4LS3A 2HHHB 3R5FA 5IMBA 3MQFA 3OLXA 3GFTA 1NR5A 4K40A 4AJLA 3OX1A 5LC1A 1HDIA 3WWBA 1NLZA 5DB4A 4DDTA 5LD2B 2FEKA 3DBRA 5CCEA 1O97D 4YRZA 3U37A 3MGAA 3L1JA 2IJGX 1GPUA 2CV1A 1FU7A 5A2GA 2GJ4A 2KCOA 4F56A 3TK9A 4YWJA 3OZBA 3OSYA 2JCYA 2XNJA 1DV1A 3N2IA 2BKVA 1GADO 3T7CA 4CMJA 2X2OA 3QK7A 4LOJA 4NCAA 2Q5IA 2F4LA 4CN9A 3MJRA 4JYCA 4I1RA 2B92A 4JEMA 3I30X 1FVXA 1Y7TA 3DCJA 1P0IA 1QGYA 3RTBA 3ZPXA 4B7CA 1KY9A 3TRFA 3RHTA 5FAKA 4Q63A 4I4TB 3U7QA 4BQQA 3KQPA 1QYXA 1V0JA 2G4UA 4I9UA 4CEJB 2H1CA 5KYXB 4RJJA 3W04A 1G9XA 2WSIA 3X3HA 1JQLB 1F4PA 1UMCB 4GLYA 4MGIR 4YJHB 1FJ2A 1THZA 2HPVA 1FY5A 4BNJA 3VSBA 4YT8A 2WB4A 1ORFA 1G5TA 3N1UA 1EUDB 3JTEA 3DAFA 1LD3A 1EZUC 4G24A 5L30H 1L6RA 2YFKA 4A0GA 4CUKA 5G0WA 2QKYA 3TW6A 3DT6A 2F9LA 1K4MA 2WRZA 3RFXA 4KNYA 2Y71A 3CLRD 4RMJA 1YF3A 4H16A 1JHAA 1F3LA 5B37A 1X7GA 4AUEA 5J5VA 1G8FA 1KQGA 1OXUA 2H3HA 1P73A 3PEWA 2BZGA 2GEBA 4JQZA 4HDRA 3SU6A 3LY7A 1DTEA 1PJ4A 3UR9A 1DQYA 4HVAA 3SU8A 4YRQA 1KZ6A 1CA0C 2JGDB 3FLMA 1RAGA 2AN5A 3RS7A 1Z45A 2BY6X 1TPZA 3BIUH 2TRSB 1Y9AA 1UDCA 1Q95A 4G8DA 4ZQIA 1LBTA 1IUOA 1S7GA 5FI5A 2VDVE 4RMIA 1A8SA 2IEZA 3DEFA 1G18A 3UMFA 3E3NA 3AEUB 1IAUA 1PNTA 3RT7A 3LUPA 1WP9A 1J25A 3UK1A 1FAXA 1WV7H 4Q3OA 4Z8YA 4CDGA 1IEQA 4BZWA 2KBEA 3T7RA 2VIVA 4GT1A 2GS9A 3WX0A 3S6JA 1NFWA 1JHPA 4ICIA 2VU8E 3SO3A 3K1JA 2BP7A 2C54A 3UMCA 2X9LA 4JWKA 3QWBA 3BSWA 2VBIA 2JLYA 2QUKA 1SLUB 3HB0A 2FQ1A 4IHAA 1KJWA 3U3XA 4RSMA 1JI3A 4RVSA 3KEFA 3QLEA 4TKVA 4HGOA 2GDJA 3IBCA 1FPHH 3T29A 4B3SB 2H9HA 4L9WA 3NHJA 4RDIA 3UNSA 1EJBA 2OD3B 3CKKA 3U1BA 3MJVA 2B25A 5JEDA 3N87A 3RCBA 4I8XA 1OGIA 4OXRA 1KAEA 2AR0A 4ZI3A 1N32B 1M2FA 3T34A 2ZGBH 4XYLA 4DXHA 1FN6A 3CHYA 4I31A 3ZGXA 2VBFA 1EZ1A 2X9GA 4G5SA 4P2GA 3H11B 1DEXA 1BWPA 1YD7A 1Y8AA 4H60A 3SQLA 3SNAA 4UM9B 5AM0A 2HF2A 1VMEA 2YL2A 5BP7A 4U8HA 2YJNA 1XTVA 2Y1EA 1F7VA 1FS4A 4PVCA 3CH5A 3KT0A 4MDYA 4AD8A 3I2IA 1NN3A 4LSMA 4U39A 3RC8A 3TM4A 2WAYA 4AK9A 4DCUA 1KTTB 1B8NA 2PJZA 1J1ZA 5IT0A 3TIUA 4FCTA 1EJ2A 2EEPA 2JJ2D 3I37X 2W98A 1MTVA 4TTJA 4D0LB 3I2JA 1HLDA 4ZT4A 2HQSA 1QVVA 2QM8A 4J07A 4QDZA 4O8ZA 4ZCTA 3V97A 2N42A 1YSCA 3U9TA 4ZYWA 3W4KA 4K03A 2DHQA 3E6AA 3ZEAA 1CHOF 4C14A 2OR3A 5F35A 4WBSA 1YR2A 1RRFA 3H5NA 3KLBA 2PKAB 2Z04A 3LCJA 2VN8A 1Z06A 5TF4A 2YVKA 4O3MA 4K60A 5EXNA 2NU2E 2C8LA 2BMFA 1PWHA 1Q91A 4IXTA 1ECCA 3QPWA 4JZDH 1SGYE 2IV3A 3O0DA 1O3MA 2Q6KA 4TL9A 5DP2A 3ROTA 4ROTA 2HCBA 3JZ2B 1U2GC 3MJSA 1FMTA 4MB6A 2NNLD 4KKDA 2FWAA 3BZUA 4RGYA 4MIEA 4M7PA 1KSFX 1O3IA 4P33A 4D9BA 1ELDE 2P8OB 4FR2A 4GPD1 3P32A 4F85A 3OQJA 1GA4A 1NW5A 1MJ5A 3PUJA 1GGMA 2XXBA 2CUTA 2JKHA 4R9VA 3K65B 1A5GH 1J39A 3VC2A 1Q7GA 4HN2A 2N75A 1ABJH 1QYRA 1J07A 2FMIA 3IP8A 1BCRA 1WCIB 5H4GA 3TTWA 3HPQA 4ZEWA 2X4DA 1SXJC 2X4LA 2WT4A 1KKLA 4QWMA 4WFQA 3O3MB 1OQAA 4X8TH 1ZTLA 4DC9A 1Z16A 3HM9A 1XRQA 2B78A 3VOBA 1ZTJA 2OGUA 4K9KA 1NQTA 5SGAE 1EE9A 1ZH6A 4OSOA 4HUQA 3B3JA 1LJLA 5DP6A 3D6HA 4MW9A 5D8DA 2ESTE 4PRKA 2LBPA 1XP8A 3PNQA 4ZAEA 1NL3A 1U2RA 4AT1A 4J0DA 1AS2A 2Q99A 2FX2A 3EQ9A 5AM1A 5JCPA 1O0DH 5FNVB 4QULA 1B0ZA 4B4VA 1R9GA 1SK9A 5LM3A 4ZMAH 1XROA 1WRBA 3M5NA 1JQEA 1O97C 1RKBA 3WV5A 4ZV9A 3DBOB 2I1WA 3L0PA 3BTTE 2OCXA 5E4FA 2ISQA 3ASYA 3IR7A 3KL6A 1Z63A 2QT9A 4MVJP 1CJKC 3M1LA 4OS4A 1RWNA 6ADHA 1PFGA 4H7JA 4XLZA 1FSSA 3RLIA 4BASA 3QWCH 2QD4A 2V1XA 3N2KA 1M34A 4G0QA 5JYCA 1YYY1 4ABIA 1V45E 2DJIA 2MYPA 3FI0A 1Z83A 3RK4A 4WWHA 1P2QA 2ZSDA 2WWIA 2R8RA 5E7JA 4KAAA 3IPXA 1HDZA 2ZG6A 3TCKA 3SU2A 4BLWA 4RACA 4HTFA 4OLFA 3RYFA 4DSAA 2AIRA 1EWQA 3CURA 3EEYA 3MBOA 1K2WA 4N65A 1I2ZA 5LQUA 3P9KA 3T9EA 4URZR 2YWFA 3L7JA 5LMCA 3HA2A 1MABA 4EOGA 2Q49A 2X9VA 4PQFA 5THXA 3EXG1 3P94A 1RYZA 4HNSA 3KJHA 1IK6A 4CG1A 4P98A 5BSUA 3WYCA 5KPJA 4IDPA 3BN3A 3CLRC 4NE2A 4LOHA 2VZ9A 4U00A 4BIIA 1SCUB 3AHFA 4UDXX 1VLMA 2I03A 3HO1A 4N3AA 3LXRA 4NU6A 1GPMA 2DUCA 1UTPA 2EGHA 4C78A 3VU9A 3BD9A 4HVLA 1P4RA 1HEIA 4MQEA 1DQNA 1DKOA 3RIHA 4CM9A 4Y76A 5BN3A 1YQWA 3KOWA 1YDWA 5DP7A 3JALB 1Z0JA 4B74A 1KP2A 4YX9A 1BRAA 1SKYB 2CEKA 3NIGB 3TJMA 1I2DA 4JH0A 3RXQA 2X23A 3PGA1 5LQCA 3MC1A 2O3SA 1AX9A 1WPXA 2FYTA 3NHWA 4BE7B 5HCNA 1H66A 4TPKA 2QBYB 1ZO8A 1BMMH 3ZWBA 5FBIA 1GZ5A 1UJCA 2UVDA 4IO1A 4ETIA 4IGAA 2V0GA 3F71A 4E5UA 3H9QA 4AWBA 2FSIA 1K22H 2P78A 1ELGA 1G30B 4U9HS 1GSHA 5FQOA 1TA9A 4DT7B 5JNTA 4P35A 2VT7A 3TTTA 4WQMA 3C27B 4DM7A 4CQJA 4BN0A 1SHZA 3R7DA 2Q45A 2OYCA 3P9QA 4OV6B 2PKSC 5CBKA 5T8KC 3DOFA 1H0SA 3LD9A 1IG3A 3L4BA 5DHSA 1CEYA 2BMGB 2BWJA 2V03A 5DM2A 3NXSA 3KOZA 2PRYA 3I1YA 1YB7A 3MBIA 1FXSA 2OV6A 4EG4A 4ESOA 2JETC 2ZSJA 2ZU1A 2PX6A 4HATA 5A06A 5G0VA 3SE0A 5AM5A 4A1VA 4NCJA 3DMPA 4GHQA 1MENA 1TONA 2TRMA 5B7NA 4WK2B 4XB1A 4XEUA 2R84A 4LSGA 1GOTA 2W2OA 3QMVA 2VDMB 1LKBA 1AO5A 1BYIA 5CFNA 3R3JA 1D2NA 3P0EA 4R1OA 1KRWA 3E90B 1CRQA 4LYGA 2C31A 3R5JA 4YT7H 3ENSB 2C4KA 5BSKA 3X2SA 5HGXA 5GIBA 1Q1GA 1C4OA 2VWLA 4H08A 4Q4CA 3WVNA 1OHHD 4L50A 1JKJA 1W29A 1GNVA 5B1DA 3K70D 1D2AA 4Q4JA 4Z9YA 3WBJA 1JHZA 1VTKA 4X8MA 3TOVA 4NOMA 1YF4A 2XWAA 2QUAA 1F14A 4UFNA 1PQPA 1T8UA 2ETXA 1Q6ZA 1GKUB 1G60A 4M86A 2QE6A 3REOA 3IAEA 3OKPA 1W93A 2ZHDA 1GTRA 4MKZA 2DPXA 2FN4A 3TECE 5GZ3A 3KAPA 4UKDA 4QJ4A 3G79A 2LD4A 2HLCA 3W9BA 4ZZ2A 1H4QA 3OTJE 1XDGA 2I2CA 3JQDA 4WTOA 4HYQA 4M0CA 3FWNA 4RWEA 3HVJA 1WY7A 3AP3A 3R7BA 1JZTA 5DKMA 1F5LA 4AFUA 5KVAA 1RC1A 2F9UA 2NZ2A 1P3CA 3PHLA 3BWBA 2GBFA 3C3AA 1ADGA 4E06H 2FOBA 4IP0A 5B3LA 1UMBA 2XQVA 4MX8A 4R3WA 2G8LA 3ZNOA 3QVJA 5DHRA 3OLZA 2J67A 3AEQA 4KQFA 4LDRA 4R51A 4FYHA 2FI3E 1KVRA 1KDYA 4ECAA 4L3VA 2X2FA 5K03A 4KLCA 4CM9D 3M49A 3H1BA 1QE3A 1T32A 1G7CA 2IYQA 1JQAA 4R5MA 3G9QA 1G8KA 2BDCA 1P5RA 4BCDA 1GI4A 5EIFA 4DY4A 3A32A 2HVYB 5IP5A 2J33A 1W0JD 1F2TB 1M2VA 3NTUA 3GH1A 4OO3A 1D2HA 3MIIA 4X8OA 1C4U2 4ZRNA 3UK6A 4EHFA 2XUOA 4YJFA 3TRJA 2BYAX 3OA0A 4ZEVA 2FWPA 1TZCA 4AFNA 3UJHA 2ODYB 1F2DA 2J97A 4L2IA 5MFZA 1RC0A 2B5VA 4G5OA 4ZV4A 3V33A 2N0SA 5I9NA 3HU2A 4ZCMA 4E51A 2R5NA 3UHJA 3VUEA 1R6BX 1V2ST 1XJWA 2F59A 1VJTA 4ZWNA 2WPIS 1A5IA 1QG0A 3BIVH 3Q9SA 4YAGA 3NHFA 5K1ZA 1YK0A 1XZHA 1SQAA 4ND8A 4C43A 3EIXA 1F5SA 4P36A 1NASA 5C8XA 4D9IA 4PQYA 2IEAA 1W44A 1Y9JA 1XQXA 1SUIA 4DPKA 2FPPB 4DJDC 2YTZA 2CD7A 2QJOA 4HWRA 4KQJA 2Q8PA 4PRYA 1FFAA 5AVKA 2G71A 4BLTA 5D5PA 1ZVVA 2PMDA 3HLKA 3S5UA 3P9ZA 1XDSA 4F48B 1SGWA 1G8HA 2GGSA 3CB4A 1DIOB 2YY7A 5JXGA 2C82A 1O9BA 2G4LA 1T25A 3FXAA 4RHTA 4JK6A 2V3CC 2CLMB 5GIOE 3BG8A 3HBFA 5G3YA 5GGXA 5GJCA 3URCA 4YCSA 2ZCUA 1FW8A 3PNLA 2C96A 4P84A 3WOVA 2A0UA 1YPEH 3ONDA 5I9MA 2IEIA 1LDBA 5H9VA 4ZVSA 5JW6A 1AZTA 5T6DA 2VIIA 3N2EA 5JI2E 1R2QA 3QW2A 1KGSA 1KEKA 2F8MA 3QG1A 5FORA 2Z3DA 3AFHA 1DX4A 1FUYB 2GT1A 3SS9X 3MS7A 2JH8A 2ULLA 1CF9A 2PCLA 3T3EA 1KYQA 3F5FA 3HJCA 1TZJA 2XVZA 2GD4B 4M22A 5JALA 3TRHA 6YASA 4LY9A 5HM8A 1QB1A 4AO6A 2C4VA 1AKSB 3DV0A 3UHPA 3UPEA 5FWYA 5FOWA 2YQZA 3AL2A 2PL3A 4EY3A 1EGQA 4CDMA 3MCUA 4F1KA 2XWPA 4A6PA 2C97A 2OK7A 2NTYC 5TMDA 2QLNA 4K9MA 4INKA 1RPJA 2WAOA 2XOEA 3VRHA 1E8DA 1CQZA 3CF0A 2DSTA 5GQSA 4GLBA 2GNAA 3GGOA 5TJXA 1TMYA 3FPBA 3M8KA 1F6BA 2GAJA 5E9AA 1MJNA 5F5XA 3UV3A 1H4VB 5ENDA 4ZQHA 4C4SA 5CDHA 3TI7A 1U6JA 4HXGA 2LP4Y 4NHOA 1O5AB 4QXMA 2ZPSA 4YYZA 2H51A 1DWQA 2H8GA 5K0EA 1SUEA 4D44A 1XDZA 3IAM6 3S1AB 4QOIA 5FO1A 4AL4A 3A89A 3CNLA 1H1DA 1MNAA 5LDDC 5J2TF 3H8WA 3Q3CA 4MV7A 4WA7A 4KL8S 3LSTA 2EGUA 1KHTA 3IMEA 5BV0A 1GJ6A 5F9MA 1Z8DA 1A4WH 1ULHA 1JSXA 2WQ7A 1P09A 5DNYB 1DWBH 3ZNPA 2V7QA 3I4CA 1H9CA 1J0EA 1GBCA 4DL9A 1QP4A 2QQFA 3VTAA 4L0MA 2ZWOA 1I6WA 4P02A 3STTA 1Z22A 4C6TB 3E4DA 3L93A 3K2EA 4D8TA 4D82A 3Q87B 4ESVA 2P68A 2VNIA 4OJNA 1U8YA 3PE3A 3PJDA 1DY8A 5HZGA 2II6A 5DISB 3KZVA 2NVUB 5CTJA 2C8YB 3FTNA 3I8SA 5HIAA 5CX1B 1RYYA 4ERXA 2FPWA 1ZM7A 1E9VA 3D49H 5DT9A 3K70C 3LGTA 5BSRA 5AIBA 3BEIB 1ZH8A 1ZPBA 3FVQA 2J9XB 4KVAA 1Q1EA 2A9QA 2J3HA 2XZTA 2ZTHA 4PSUA 3ZZBA 4GSYA 1P4SA 1GZ7A 1H85A 3R1IA 2MR6A 2ZG0H 3D6JA 3TRKA 3H7TA 1EQ2A 2GBIA 4YLUA 4IFIA 2MMCA 4XD2A 3FANA 3FAOA 4K1TA 4HBZA 1QLHA 2P6MA 3LF1A 1TNDA 1YDFA 3AONB 4Q37A 4O2AF 3RVMA 4TT8A 4UPVA 1PPFE 2FPZA 4DLXA 5D3MA 4EPTA 1GI5A 2XQGA 4CTJA 1MR3F 3LFTA 2JB9A 2YOHA 1KU0A 1EIZA 3OF2A 1LMWB 3AK4A 4HQ6A 3UV7A 1U8AA 1G64A 2QWXA 5KTTA 2YBDA 4MWEA 2FEAA 1UIMA 3JWHA 4D96A 1DC8A 3NM4A 2I6GA 4QXAA 4ZEMA 1PSDA 2CE7A 3MU1A 3O31A 1LHGH 5CVEA 3E61A 4ON9A 2DUWA 4W1PA 4G23A 4Y30A 4BE9A 2PAAA 4TKUB 2DKOA 3SW2B 1B0EA 1W2KH 3ZHYA 2R44A 1TL7C 4XYEA 3KOYA 1EZZA 1BVRA 2J0QA 4MUXA 3Q4GA 5E3JA 4Y7AA 2Q27A 3A7ZA 3GYGA 3L6RA 1QRAA 2NN3C 2AW3A 7ADHA 2IUYA 3RSGA 3INRA 1L8OA 1SA0B 2PQ2A 3KQUA 5AW9A 1YRBA 3V8BA 3UGTA 1Z6TA 3UTUH 1GJ4H 2GEFA 2ZANA 5D00A 4U0JA 5GXPA 2NQTA 4H77A 4J1TC 3OQOA 3OWOA 5AI0A 1NFFA 1KMQA 4IIXA 3LK6A 3GFPA 1CUHA 2XRZA 4WESA 2N9UA 2PBFA 3HGQA 2I34A 1PQUA 2FR8A 3CZMA 2NWNA 4EYEA 1DBRA 2YJ5A 2B4TO 3NFYA 2J38A 4G01B 1V4NA 4EEZA 3P0IA 1DGQA 3LX8A 3FYDA 3PUKA 4S2EA 4O03A 1D07A 1SCUA 2D0OB 2HX1A 3E8MA 5KNDH 3GFRA 5FUMA 4ER7A 4DG4A 5BSMA 2OBMA 4PZLA 3KHSA 1T6BY 4MH0R 1WQ4A 4DBLC 1NV8A 3R0QA 1FRZA 3SJCA 2C8XB 1L3IA 1QF9A 1VCOA 2VAVA 2VQEB 5DWVA 2P4SA 2DF8A 1VPLA 2B9LA 1YR7A 3KPJA 4PPYA 2RCEA 5DM70 4DIFA 2PKSB 2H06A 5HM9A 1U0LA 5F2EA 1SNYA 1JRSA 2J46A 1XEWX 3EQ7A 5DYTA 1DPGA 5FUBA 4YXFA 2HDOA 3L4BC 4EKIA 1YPKH 3UPDA 1YB4A 1SO8A 1NU9A 1P1JA 1V7CA 2HPAA 4CI0B 2Y0DA 2V7QD 3CQ9A 1T8LA 3ZD6A 3U7GA 4YUAA 2ZT5A 1Z6PA 3MRVA 4KIJA 2O8VA 1ZR0A 2RH9B 1P0SH 3P97A 4X6XA 4I9HA 4XGRA 1R8YA 4HC4A 2QUHA 1ZHRA 1TYDE 2PH7A 1Z0IA 2C2HA 4QBIA 1ZONA 1E64A 3DBRB 3F0TA 2XBYA 4DN6A 1Y37A 2IEGA 3WKCA 2GR9A 2B7LA 4MWTA 2FEMA 5HKAA 4MJ3A 4LGMA 1PS9A 1H9BA 3ZS8A 4WD3A 4Y2TA 4ZJUA 4Z1MD 4CODB 3PEVA 1Q5PA 3MWEA 1C5NH 2JFOA 1VIDA 3IA2A 3EGIA 5KVCA 4F46A 5CDUA 4AJPA 3ONNA 2X0JA 4HWTA 4CNBA 3V6MA 2Z3ZA 3T35A 2OCIA 5EIWA 2V6MA 1SGTA 3WLKX 1Z5WA 10MHA 2A1IA 1IY9A 1G42A 2HNTF 3QVLA 1FTNA 5E4TA 2ZUEA 3A31A 3U7QB 2J0SA 3A4YA 4E1AA 5DEIA 1RPTA 3A4VA 4LZ4B 4F84A 2WUBA 4LJRA 1TJ3A 5CB4A 3AY0A 4TYMA 2WB2A 1H0HA 3OAAD 4K1SA 4HWSA 2IVZA 4E5PA 4D6PA 1S7CA 4DJFC 2FI1A 1AC5A 3UY9A 1GTJ1 5KWSA 2FOEA 4E88A 4I4IA 1YU6A 2Y1OA 4P58A 3FZZA 4Z4FA 2NADA 3FN8A 4IXMA 1TA0A 4Q9DA 4QUDA 4R05A 4EIWA 2V7BA 1OFUX 5C0TA 1RJFA 5KQLA 3LGSA 3I83A 1XZBA 1YBAA 2HXYA 4YTEA 2EKLA 3PXDA 2MYUA 4GU5A 3U4DA 1AS0A 5IDYA 4TS3A 4HDRB 2PSEA 3EVTA 2X7HA 1VBFA 4M8SA 4GVXA 3ANSA 4EA8A 3TGWA 1XYYA 1ZGBA 1U81A 2AGEX 1G21A 2V7WA 2ZVQX 4NDAA 5L4LA 1C5RA 5NULA 3BHNA 2CVHA 1TUEA 5H3LA 1JG3A 1NF2A 2PNFA 1ORHA 2CB9A 5AVZA 3IB6A 4CQMD 5KREA 1UF9A 1IUKA 2R8PA 1JWBB 4G41A 4Q1VA 4OYYA 1NQWA 4AM8A 3GEDA 1O3HA 4FOTA 5E6SA 1F0NA 4R3UC 2STBE 2FUNB 3IBSA 3ESTA 5CM9C 2BONA 3L6UA 3ZHTA 2HFJA 2CHAC 4FFLA 2BXTH 4Z53A 2J7PD 4TYNA 4HAYA 4WLEA 3TQTA 2VF7A 3MTAA 1WB6A 3E82A 2M32A 3WRWA 5D1NA 2BP7B 1AKTA 4RMNA 2QXUA 1SQSA 1Y3IA 1YI1A 4XWWA 2Q3JA 4W1SA 5BSGA 2B34A 4FU7A 3LDGA 4RZUA 1CUCA 4AI6A 2X3YA 1YM0A 1GMHG 1L4EA 1HX7A 3DBVO 2JRCA 2PWZA 2JGNA 3PUYA 3F5SA 4TKVB 4URXR 4TVBA 1SC3A 5C8YF 2EI8A 3ER6A 1TOAA 5CA0F 2QA9E 1GI2A 4AMVA 3OZTA 1LSUA 2NV6A 2RIRA 3OTQA 4Y71A 2JCXA 3CJRA 1FFGA 1P1RA 3ABRB 2BSAA 2XC0A 2FYRA 1ZFNA 1DIBA 4LOIA 1IVNA 1ZM9A 3WRXC 3SIRA 2NW6A 3IEVA 3PNPA 1Q20A 1JR6A 2HWYA 3VDXA 4P7FA 3GDOA 4C4TA 2ZDAH 2NUPA 1OI2A 5CAEA 3PDJA 2JIDA 2ZTYA 3SZMA 3AR6A 3Q41A 3QELA 2WWFA 3IQHX 3K1ZA 4DA0A 1VGQA 3TVDA 2QP4A 2BGTA 4BBAA 1GG8A 3DGEC 1KXCA 5EG4A 3N8NA 2IBSA 1BHJA 1L2EA 2WUWE 3ENWA 5JAHA 2V7XA 4EHDA 3W78A 2ZECA 4E07A 3K9XB 3N2YA 4TS1A 1E9DA 1EDBA 1GDQA 4ZAVA 4ZHAA 4RJTA 2H08A 5TE9A 1D2GA 4WLFA 1AFQB 1XU4A 4XB2A 2J0VA 3C98A 2B8EA 5KUTA 4IUDS 4Y2SA 2G63A 3SI4H 4DCSA 1DDIA 4UUMA 1CERA 1ECFA 2NU6A 2AJTA 3FPAA 1XZKA 3AHIA 1QQ4A 2BTCE 1TOMH 2Y1KA 1P1CA 4F2WA 2PV0A 2Q0QA 3BCUA 3M82A 3L43A 3RHSA 1W9MA 1JEEA 1ECGA 2CBZA 3O4GA 3U13A 1DHRA 4PAOA 5FOQA 4FJ0A 1BSVA 3AM5A 4PYIA 3FPHA 2WV4A 2UUAB 4BAOB 3PX7A 4YLYA 1OJLA 1SHHB 4XFQA 1Q2WA 1QO9A 2KCAA 3K8ZA 4CR9A 4KAXA 3RXGA 3SYJA 2FN7A 2AQIA 1E7RA 3D3KA 4IDFA 1QCYA 3MTQA 1HKHA 2H7XA 4PBSA 1ML4A 4GD3Q 4DV4B 4KQ6A 4PBTA 4EZIA 3OIFA 1PX2A 2IEDA 5T4HA 2H5JA 1HMPA 3RYHA 3C3XA 1NYTA 1Z71A 5CT9A 3STVA 3KQVA 1M8FA 4JX9A 1IYZA 2IPHA 3D8