4B6FA

Discovery of an allosteric mechanism for the regulation of hcv ns3 protein function
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
646
structure length
645
Chain Sequence
ITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVTGSVVIVGRIILSGSGS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of an Allosteric Mechanism for the Regulation of Hcv Ns3 Protein Function.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords NON-STRUCTURAL PROTEIN 4A, SERINE PROTEASE NS3
total genus 196
structure length 645
sequence length 646
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2012-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 4b6fA04
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 4b6fA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4b6fA02
5CDFE 2P6RA 4WW0A 2BWJA 1KO5A 4OHVA 3EW9A 2JJ1A 2V6IA 1J90A 1JXPA 2D3WA 2GTPA 1TF2A 2RGEA 4UJ5A 2PMKA 4D4KA 3THWA 5EE9A 1KY2A 3AGQA 1HTWA 2F4LA 1PLJA 4LI0A 4QJ3A 5AUPB 3PEWA 2GBLA 4DKXA 3UIEA 3QVUA 1OHHD 2XNSA 4KVAA 5L3VA 421PA 2IEZA 1W2GA 1Z0JA 3U3OA 3X1WA 1SULA 3GJ0A 4TL9A 2ZSDA 1W36B 5C2JB 3Q9LA 3PFIA 3QSYA 1WRBA 5G41A 4TMWA 3H0KA 4FXPA 3GEHA 1ZC3A 3DEFA 3KL4A 2X77A 3NH9A 2ZTSA 4J0QA 2ZI3A 4KITB 1DELA 2OM2A 3QENA 1Z2CA 3W9YA 1AKEA 4LUCA 5CLQA 1F2TA 4D25A 3PUYA 1EFRD 2DBYA 2PZFA 2ZRJA 4LYAA 4F4IA 4Q4AA 3EZ6A 3PUZA 1TPZA 1BS1A 3PR1A 5EP4A 1NVVQ 3A1WA 4S35A 1UBGA 4NONA 3QF7A 5JJKA 1VYTA 3M5NA 1DAEA 3UKDA 2QA5A 2YWFA 1UADA 4Q9KA 4M1WA 2I4IA 3TUZC 5EXXA 2ZRPA 1XMJA 1F60A 3AK5A 4DWJA 3F5FA 2AHOA 2OG2A 4MGZR 2HXYA 5J4YA 3CRRA 5JMTA 4IVQA 4F7WA 1US8B 2AD1A 1FZQA 1U9IA 2J0UA 1S3GA 4DLYA 4TLDA 1E99A 4WH8A 3U60B 3PQCA 1OE0A 4XTCS 1AS2A 2ZJBA 5LB4A 4AURA 1CIPA 1SHKA 4JSYA 4XOIA 4D4MA 1R10A 5AWFC 5FOSA 3M6AA 2JJ2D 1NBME 4A1FA 5BN3A 4NYJR 1M34E 3O8CA 2J9RA 1RZ3A 3B78A 1O87A 1E0SA 1G4UR 3LFUA 3AB3A 3KUDA 4BECA 1KDOA 2OCYC 1C1YA 2NPIA 2XOKD 4B34A 1I4LD 4PQRA 4B35A 4LBVA 5FOXA 1N0VC 3IO5A 3RC4A 1CBUA 5CITA 3W5JA 2W6JA 1ZMXA 2ZE6A 1OYWA 5GJCA 1WXQA 3B13B 3BB1A 3GLHA 1P60A 3CRMA 4RD3A 3TAUA 4BLSA 5IRCD 2ZJ5A 2X8AA 2JEOA 4BE7B 3DMNA 1N6KA 1N25A 3ADBA 5CLLA 2FEMA 1K5GA 3H86A 4B76A 3KXIA 2VHJA 2OFWA 4EQ6B 1KI3A 3SZEA 4AIIA 3FMPB 2ERXA 2Q6TA 4QM6A 3R9WA 2GZDA 3A1VA 3GJ7A 3LOXA 2BCJQ 1UDWA 1FL9A 1OPXA 3WNDA 1NL3A 1E0AA 3BERA 1FX0A 3AVVA 4IHQA 3T61A 4BLRA 4OQFA 4CW7A 1IONA 5B6LA 1X86B 2PMDA 5TY0A 4NCIA 2WPDA 2Q9BA 2ODNA 4B43A 2CLSA 1RRGA 2BJWA 1LS1A 4NWKA 2BBWA 4HB0A 1ZW6A 2D62A 4TYWA 1L2TA 3W5IA 5EQSA 3IO3A 5AUNB 2H57A 2ZUBA 1G21E 4E09A 4MRPA 3AUYA 1ZU5A 1KSFX 1ZRHA 4TMKA 2IW3A 4Q7JB 5JEDA 4Q9HA 2P2LA 3RLFA 1E94E 2QROA 3G82C 4MH0R 1KI4A 3T34A 2HXSA 2CNWD 4GI7A 5HZHA 1CR4A 3PG5A 4PC3A 4ZI2A 3WBJA 1E4VA 4L15A 4Z8YA 2R8RA 1N1LA 4DCSA 4GT1A 4M21A 2QE7A 1XPUA 1ETUA 1G41A 1Z6XA 3C5HA 2B21A 3DM9B 3QPUA 2RGCA 1YQTA 2KI5A 1XD8A 5CJ2A 4WH6A 1KI7A 4XWAA 2BBTA 2G77B 1Z07A 1XPRA 2BV3A 3OE7D 2FG5A 1U81A 2F1RA 4P4UA 3TSWA 3KDSE 1N6IA 1UFQA 2WJIA 3KNXA 1G6OA 4HLUC 3ZIAD 2H18A 4B3GA 2ZR7A 4TTQA 1HT1E 4R98A 3R7WA 3C5CA 2CJWA 2O8EB 2V54A 1OKKA 3CRQA 2A4RA 3RRZA 2EFCB 3QVVA 2FP7B 3WXMA 3A1TA 5L3QB 3FWYA 5BQ5A 3K70B 3VKHA 1T91A 5DO9A 4JLNA 1YJ5A 2IYTA 2RGAA 2EFHB 1S4QA 2D4HA 3LWNA 4MDEA 1GRNA 1XXHE 2R6GA 2H5EA 2JJ1D 3LW7A 1E2QA 1OXVA 4Q1AA 2A78A 4FMDB 3ZH9B 2FM2A 3IKJA 3U7HB 1TUIA 4P3YA 5SZHB 3KX2A 3QF4A 1E2NA 1KDTA 1GILA 3R8CA 2C5LA 1UEJA 4TWZA 3RWMB 3LW8A 1N5KA 5G40A 2RKOA 1NJFA 2QTVB 4C0BA 3T1TA 1DTSA 4R2IA 3SHWA 2GRJA 1ZJ6A 2G1KA 3GCGA 5AJZA 3W6NA 4CEHB 4PAQA 2FSIA 5IDKA 3CLVA 1Z47A 3CKLA 3P32A 1CJVC 2MSCB 4JLKA 2VP6A 4LYJA 5C4MA 5LD2C 4C0SA 4WXPA 5DYIA 3SU1A 4IFBA 4AKEA 4DJTA 1E2MA 3DOEA 5EPYA 2DFKB 2Q21A 3U3MA 1FP6A 2GF0A 1F2TB 4MUAA 1QHIA 4KFUA 3C7KA 4URYR 4Z1MA 4C7OA 3OEEA 5FTJA 2OBNA 1TNDA 5JSZB 4KFTA 3EA5A 3SR0A 3L0OA 1L4UA 2CCKA 2DCUA 3BB4A 1TL7C 2OILA 3QEOA 3BAFA 4WBSA 3KF2A 3EYDA 3GEEA 4PX9A 5HTKA 4ZIRB 1N5JA 4D80A 4PHGA 2DWQA 5GJ4B 1S3SA 4XVUA 5KNCA 3U4QB 4XH9B 4IDNA 3LLMA 3ND8A 5H1YA 1YR9A 4M1MA 2CHVA 4LK2A 4HLDA 2VSFA 2VHTA 3QBTA 1K6MA 5AJVB 1O3YA 3FPAA 3MD0A 1N6PA 2Z43A 5CJPA 4EJSA 5JRJA 4TYYA 4R7ZA 1VYVA 1KK1A 1G18A 2XAUA 5KTYA 1HQYE 1COWA 4UJ3A 4FN5A 2A5GA 2ZI5A 2ZJZA 4LHVA 1LV7A 1HQCA 1UBFA 1XEWY 4TT3D 4C7OB 3IIJA 2QPAA 1AZTA 2ZEJA 4X8OA 2OC0A 3P4YA 4Q1DA 1U8ZA 1E96A 2NOAA 3RS5A 3IBYA 4RCYA 1LFDB 2RCNA 4JKYA 3L6PA 5F2EA 5H4IB 1RRCA 2QV1A 2VLIA 3C4JA 4LJ9A 5HCNA 3OIWA 1KNQA 3TVTA 3HPRA 4LPKA 1P3JA 3SV7A 3CW2A 1OJLA 3NHBA 4MRVA 3K70C 2OCAA 2WAXA 3EC2A 4I99A 4LY6A 4TTRA 3LY5A 2FOMB 2GETA 1XWIA 4EJSC 1OB2A 2GXAA 2ATVA 4CEHA 4TLCA 1NIJA 3JZAA 4LJ8A 1DG3A 1GTVA 2C03A 4U5XA 1BH2A 1X8LA 5CM8B 4HLCA 4B48A 2BM0A 2YYZA 2TMKA 4A92A 3B60A 1W4BA 1LNZA 2DPXA 1JR3E 3N5CA 2VA8A 5J4LA 3UANA 1KAOA 4PHTA 1Z22A 1G3QA 2OBMA 4EQ6A 1SKYB 3RYTC 4OK5A 1H8EA 3PVSA 2OLJA 3KXKA 4RFSA 1NMXA 1TX4B 2CLCX 4AG6A 2WJGA 4NDZA 2H7VA 1UJ2A 1WDTA 2JJ2A 3IGFA 5EXTA 4URZR 3LV8A 4DLSA 1A2KC 1A82A 4DBLC 1IXRC 4PZLA 1E6CA 4P4SB 1EESA 3AVTA 3B8HA 1KKMA 2YC2C 2JDIA 3PV0A 3MWYW 5J4HA 4FWTA 1OV4A 5KSPA 4Q7LA 3L2OB 4CDGA 4PSAA 1IN5A 2CXXA 1VIYA 2IT1A 3BS4A 4WZ6A 2P65A 4K8OA 2J7KA 4V0LA 4WZAE 4JSTA 2IYWA 2ASEA 3G0HA 2ZRFA 4DIEA 5FBQB 3OESA 4DB4A 2PZGA 2VH5R 1XRJA 1SGWA 3AF0A 3I62A 1KO1A 3OF5A 1NSFA 3DKVA 4RZ3A 3T06B 2ERYA 2O5VA 3C14C 5GJBA 2O52A 3FE2A 1WBBA 1N0WA 3BK7A 3AP1A 3L0SA 3K53A 4AC9A 3FFBA 5JJLA 1JB1A 3P4XA 5ELXA 4GPTA 5DH9A 4ASUD 3SU0A 4I81A 1RW4A 3M5MA 4PXAA 2ZREA 2XJ4A 1Z5ZA 4IXNA 3U3JA 2HCBA 3CBQA 3EG5A 4D0LB 4DEYA 3K8YA 1AK2A 3R9XA 2QQ0A 3NBZC 1SVKA 1UBEA 2OBQA 4YLGA 4A9AA 3T1QA 3QBVA 4DEXA 4HAXA 1VCOA 4ASUA 1SXJD 4QBGB 4ZCIA 5F3WB 4M53A 2QMEA 1XD2A 4EPWA 3Q5DA 2V8OA 3OYPA 5DI3B 3A4MA 1R5NA 2ONJA 3VR6A 5KDOA 5CK4A 1EWQA 2IHYA 4A1TA 1T5LA 3NBXX 2ZRHA 2FPKA 2YWHA 4MGIR 1PUIA 4GDFA 1Q1BA 3WHLA 2VP9A 3F0TA 2JIZD 4JBYA 4B3XA 1HURA 3NBFA 4URXR 3IIKA 3GPLA 2IS6A 1P7CA 1FX0B 1AQYA 2R65A 1VIAA 3FKSD 521PA 4JYBA 3FOZA 2WMOB 1QG4A 1KAGA 4LV5B 3ND9A 4DDWA 3SU5A 4QOSA 2G1JA 1E9EA 2O8FA 2WIBA 1Z3IX 4QJ4A 1VCMA 5DHFA 1P2UA 3ICQB 3H1TA 2JA1A 2JDID 2B7CA 2Z83A 1Q3TA 4JLVA 5FPHA 3KQHA 5K8TA 2HLDA 2BKUA 4HB3A 3W6PA 1E9BA 3SYLA 1MOZA 3WNBA 4BFUA 1ZP6A 2P6UA 2YJTD 3IPXA 1N5IA 2C2HA 5K8LA 1J8MF 1R0ZA 1VG0B 3I8XA 2CEAA 3VKGA 4OK3A 2XX3A 3KFXA 2G9NA 4DXAA 1XJCA 3NBYC 3GJ3A 1Z08A 3VR2A 1E2KA 3W90A 1S2MA 3B1XA 1Q0UA 2R6FA 3BFXA 3D3QA 2YOLA 5DGXA 1R4AA 4RSGA 2Z6VA 1EG7A 4MRSA 5DIFA 1G8FA 5T1VA 2FPLA 4RD0A 4F4JA 5KSOA 5BWMA 1R5OA 3H84A 4NPHA 1XMSA 1E1QA 5HR5A 4D0GA 621PA 4KCGA 1NSTA 4PZZA 2OK5A 1RYFA 3V9PA 3LO5A 3OAAD 3GJXC 3ZVRA 4B75A 3EX7C 3ZD7A 2ZUDA 2JJ8A 2XNIA 3SFVA 3CZPA 3KKNA 4NH0A 3CONA 2F9MA 5H68A 5B2ZA 2F9VA 3TSOA 1AQUA 4XSHA 2O8BA 4RKFA 2KSQA 1OFTA 2WTUA 2WZQA 4IW3B 4Z54A 5JHHB 1LVGA 2IJD1 5ESBA 3OZXA 2QSYA 4Q1EA 4TMZA 4Z8XA 2YWGA 2IYQA 3O8BA 5JS7A 2MMCA 5L3SA 2BJVA 4PPNA 5JRZA 1XTIA 3PITA 3RSOA 5HE8A 1U8AA 3T35A 3TUJC 4MKHA 4L9WA 4A0HA 2QGNA 4MYUA 3B5JA 5FR1A 2QP9X 4EPRA 4UNNA 2BMDA 4I1OA 3VU9B 2KBEA 1M6NA 4LJYA 2ZYVX 3R7WB 4CGZA 4Y0AA 2J5XA 1II8B 3VMFA 1U8YA 3GD7A 1JQLB 4P0TA 5E95A 3ZVMA 3QUSA 4BLQA 2P3SA 2FMXA 4ZV4A 1NVUQ 1YZTA 2UKDA 4HEJA 1IN8A 5IK2A 4TYNA 4GRAA 1YZQA 4P33A 1W0KD 5KYKA 4JZKA 3I5XA 3LLUA 1DADA 4BRUA 4QHTA 4QBHA 2GEUA 2IS1A 2UZ3A 4GBMA 4NBSA 3KTAA 2GILA 2GJSA 3ONWA 4MITA 3AV0B 4A0FA 2VEDA 2XZLA 1JQJC 2IJOB 1MV5A 1N6OA 2LKCA 2OFXA 5E7JA 3NEYA 5EE3A 1E98A 5DN6A 4RD6A 3CF2A 2D2EA 2DFNA 3CR8A 3U61B 3LDAA 2FFQA 1KSJA 5GVRA 3G5UA 2NIPA 2A9KA 4LPSA 1EWRA 1GKUB 3K0FB 2DY1A 5DSZA 4A8JC 4EIWA 1U0HC 4M2LA 2GCNA 1NN3A 1V5WA 3SC3A 1SZPA 1KOFA 4E22A 5HE9A 4I33A 5HPYB 3KUCA 3LQQA 4OQNA 5DNYB 2N46A 2F1HA 4PTLA 3AM1A 2XNDA 1T0HB 4QG7A 3K0AA 4A1VA 3F3YA 4C0AC 2NZ8A 3MCAA 3AKDA 1ZD9A 3K9NA 1Q21A 1G4AE 3HPQA 2OC7A 4LC1A 5FFMA 5G53C 4E07A 3MLEA 4ZKEA 1WF3A 5EP1A 4Q1CA 1RFLA 3NDPA 5EQTA 3ZS9A 3GLIB 1GITA 1OSNA 3BH0A 5FTMA 4C0KA 5TB5A 4YMTA 3O8RA 4B3BA 1OB5A 1JPNA 4LHYA 4EPVA 2HV8A 2XTNA 5D3MB 3T5DA 1S0UA 2EWVA 1KJYA 1KDRA 1BT7A 1SQ5A 3IHLA 1BMFA 1E1RD 2PCLA 4V0ME 3SEAA 1S8FA 5CB6A 1RJ9B 4AYTA 3U44B 3TJZA 1LF5A 1P62B 2W2TA 2O0KA 2YWEA 5TVKA 3AF3A 2IX3A 3TW4A 2B8WA 1T0JB 4A15A 3VKWA 1TQ4A 3E70C 2WJVA 2OCBA 2WJHA 1ZD1A 2WOJA 3UK6A 1VCIA 1RJ9A 3Q3JB 3P1JA 4W7SA 1D2EA 1F48A 4DLXA 2V7QA 4BASA 4QFMA 3BIFA 1TAGA 4MA4A 1FQKA 2BEJA 3RC8A 2H17A 4B2PA 1NMYA 1Z0KA 4Q19A 2VP4A 4DSTA 1I2DA 3LVQE 1FW6A 3B2EA 4PPGA 2GK6A 1YZNA 4IVPA 2IL1A 2ZRLA 3DL0A 2HF8A 3OIYA 3W8RA 2EWWA 3RS7A 3IILA 1H8ED 5EJEA 3U3RA 2A7QA 2O0HA 4M22A 5AJWA 3PEYA 3GLFA 2GNOA 3U5ZB 4C30A 4B6FA 3VHXA 1OW3B 2P0EA 4P4SA 1WB9A 1ZIOA 3RVBA 4HDOB 3BB3A 4NYIR 4OL0A 2I3BA 1JECA 4PC6A 1P9WA 3BC1A 3EIEA 4GNKA 2FV8A 5FUXA 2JCSA 1KJWA 1DY8A 1Z2AA 2OBLA 3IBGA 4Q4JB 2AFHE 1NIPA 2WVJA 2YOHA 1XTQA 1TF7A 2R44A 4M0LA 2R6CA 3RRNA 3RSLA 3GP8A 2HF9A 2NQ2C 3ASZA 3FHCB 2CK3A 1T8TA 1QHYA 1ZVQA 2DFTA 4JKIA 1W49A 4US2R 4EAQA 2VP5A 2D7DA 1SVIA 4DLUA 4FD2A 5BW8A 3CNOA 3Q72A 1VTKA 2YC4C 3SFZA 1M8PA 1VYUA 3MMPA 3VR5A 4TZ6A 2OC1A 3RNLA 2CL0X 2CDNA 5SZKB 5EP3A 2RGDA 5TXGA 4M1OA 3K0CA 4M9FA 2PX3A 2VIIA 3SU6A 1MR3F 4RFVA 2IYRA 2ZM5A 3RC3A 4OQXA 4C0LA 4CIDA 3K9LA 2CK3D 1KHTA 3A58B 5JI3E 2J41A 2B7BA 5HKKD 1XCPA 4FINA 1G3UA 1XX6A 2WSMA 1IAQA 2V1UA 3VU9A 3TGPA 4PHHA 2IYSA 1W0JD 1RVDA 2AWOA 4L4UA 1TEXA 4WIAA 1SHZA 3LXRA 5JZVA 5KSZA 1A1VA 4IXMA 4IOJA 1ZM3A 4CVNA 4G5QA 1AIPA 4I1UA 1ZC4A 1G16A 4JJZA 1J99A 1NY6A 2ZRKA 4ZI3A 1TF5A 4HDCA 1R0YA 1CP2A 3K9HA 5AJYA 5L3RA 4JL8A 3NIBA 4RKEA 1YHNA 721PA 4AKIA 3EZ9A 4JYCA 3DOFA 4NCJA 5L3SB 1YZUA 4N1AA 3SS8A 4W5JA 4DVGA 1E69A 2R6DA 3T1OA 5LPNA 5BYKA 2WWIA 4RD1A 4JMPA 2HDNB 3BFKA 1RIFA 2MSEB 1P6XA 3VNUA 1GDDA 3FTQA 4ZCMA 1IM2A 2I1QA 4HAZA 4TLBA 4V02A 3KQKA 2PT7A 4QBIA 1NKSA 4D0NA 5L3QA 3DVLA 2X2EA 2QM7A 4Z1MD 3A36A 3M0EA 3OHMA 2E9SA 1F2UB 4I4LA 2DB3A 2RGXA 3K0SA 2JGNA 2ZRAA 4ZDWA 2HYIC 2KJQA 2FF7A 1ESNA 1F3OA 3QJYA 4NYIQ 2IK8A 2IS2A 3MWLA 2QMHA 4ZPXA 1MH1A 3SU8A 3TR0A 1AZSC 1UDXA 4QJ5A 4UNQA 2ORWA 2R62A 1CU1A 3CPHA 3REFA 4JLDA 1G7RA 1HA3A 4DIDA 4CT5A 1VPLA 2QI9C 2WICA 2FFHA 1P5ZB 4TLEA 2AKAB 3CX7A 2QP3A 4BFSA 1UBCA 1XJQA 5C4GB 3ZVLA 4IEIA 1BMFD 1VKJA 4PSVA 3I5YA 2BMEA 3SYKA 2XB4A 5JS8A 1E2PA 1XD2B 1GWNA 3K0FA 4YMSA 4WXRA 3EARA 3L82B 2IXGA 2KE5A 1LTQA 4NHOA 4QGHA 1D8TA 4LV6A 2YOGA 1P2SA 3GFPA 3IQXA 1RYHA 5JLJA 2BMFA 4PZYA 2CHGA 4KYIB 1MRNA 1Z6AA 2QAGA 3B6EA 3N70A 2OSBA 3B7GA 2JLYA 3ZQ6A 4KXFB 5K8IA 1CRPA 1XB2A 4EPTA 2C04A 1HEIA 1ZD8A 3KQLA 1QG2A 1V43A 3QKRA 4LBWA 4KSCA 3SHFA 2ZQ5A 4ERNA 5GPIB 1T4GA 1UF9A 2ODEA 3B82A 4A8JB 4DDTA 4B74A 1TU4A 1Y3AA 3SI7A 3EZFA 5BN4A 5J4VA 4YXWD 1E1QD 1IY0A 4OHZA 1II8A 2JLQA 4K8BA 2KB0A 4R2HA 4OI1A 3DKPA 4TZ0A 1VHTA 2WWXA 1G3IA 3GLHE 3FHTA 2QTFA 4WVFA 5CIWA 3UATA 4UQOA 3K70D 1Z0DA 4HAWA 3THWB 4OI2A 5KUTA 2VF7A 1JR6A 1G5PA 1UKZA 2BIFA 3B1ZA 3BOSA 5J47A 4O3MA 3PUXA 5EQRA 1OIWA 4PC2A 1WCV1 4Q03A 4EDHA 3EPJA 3K0AB 4AKGA 5C18A 5JFGA 4PAOA 1NF3A 3BH7A 2JLVA 4LYFA 4JT2A 3GLHB 2ZYUX 2ZJ8A 1E3MA 3FYHA 4UXIA 4OM9A 2VSOA 3EA0A 3PJRA 4KAXA 2Z4RA 2AK3A 4PQYA 1R6BX 2FFAA 1KNXA 1S1MA 2N42A 2GF9A 2NMVA 4LHZA 1NBMA 4PANA 3U3KA 4JS0A 3BWDD 5SZJA 1E9RA 1JXMA 3NHAA 1T8UA 4IDPA 1W4RA 4RFSB 2GEDA 4IEEA 3K1JA 4B6EA 4M9XA 2CCGA 4BQSA 3CNLA 4HUQB 4JLJA 4HDQB 1H8HD 3RS0A 4YXWA 3MWJA 1YR7A 4F93B 2B92A 3SUGA 1II0A 2NZJA 3CWZA 4Q7MB 5AUOB 1NNEA 5FI0B 3MSXA 4W5WA 2GZHA 1IXZA 2D7CA 2ZANA 3A37A 1A5TA 3EPHA 2LCFA 4ZCLA 4YC7A 1SKYE 2BVNA 6Q21A 1W4CA 2AK2A 2FPMA 1VMAA 4II7A 2B6HA 4HAVA 5P21A 4TMXA 5FUWA 2OAQ1 3QY0A 1NG1A 1ZM7A 2GXQA 2QRNA 4DLWA 3CH5A 2LKDA 3WYAA 1Z83A 1KMHA 1WA5A 4NP6A 4ZDJA 4K81B 2BOVA 2RH5A 2YVUA 2ZRBA 4V03A 4ACBA 1L7VC 2C9YA 3KJGA 2IEYA 1OYYA 4LJ4A 4CF7A 1II9A 1XEFA 4GOKA 2J45A 4LV8B 4NYJQ 1BIFA 1IBRA 2WKRA 2WJYA 1SVMA 3I1FA 4FCWA 4Q1FA 3EPKA 4ZO4A 2RHMA 3AVXA 4GZMA 2EVWX 1CR1A 2AX4A 3ZYCA 1E0KA 3JVVA 1SXJB 5FBLB 4DLVA 3SUDA 1M2OB 3FKQA 4TQAA 3THXA 3TK1A 1DXPA 1KI8A 4KHZA 2J7PA 4X8LA 5FOWA 5H8WA 2WWHA 3ZZ0A 1ZCAA 2OXCA 5G3ZA 5CDFA 1PJRA 4G01B 4EPYA 2ZI7A 4A2QA 4C4PA 1RRPA 2WM9B 1J8YF 1FTNA 1XTJA 1T9HA 1C9KA 5JWHA 2F43B 5KDDA 1OFIA 5KNDA 3F8TA 3ADDA 4NTZA 1QHNA 3CX8A 4X8HA 5G3YA 3U4QA 1SXJE 4FW9A 2W83A 4JVLA 1MO5A 1Z28A 3GLGA 2QGZA 1YZLA 3C41J 1KI2A 4KSBA 3AVYA 1UPTA 5B57C 2RGNC 3QOFA 3RRMA 2J0VA 4XWKA 1CKEA 1SXJC 3UMFA 5FPKA 2LWIA 3BORA 4BLOA 1AN0A 4M1SA 1YU9A 2WWGA 4IOMA 3SYJA 4ZKDA 1XMVA 3LAWA 3AEZA 2QN6A 2Q9CA 3KTAB 4UNSA 4P32A 1Q1QA 3UXMA 4CT4B 3GJ5A 2G6BA 1P2VA 2JLSA 5EPNA 2QP4A 1FUKA 1ODFA 1U2RA 2P6NA 2QY9A 2ZJ2A 4IVRA 1XCMA 4CYMA 1QRAA 2KWIA 2Z0MA 3MWKA 5AK0A 3PENA 5HZKA 3HR7A 1IN4A 3W34A 3QG5A 2VHUA 1NVWQ 4I32A 5FOVA 2GJ8A 1KI1A 3Q5EA 2NO0A 3TMKA 2NO7A 2OHFA 2P5SA 2ZE5A 4GSYA 3S1AB 4BFWA 1ZM2A 3QPWA 5KHOC 2QSZA 3MFYA 3A1SA 4DSOA 2HT1A 2WKQA 4B32A 3CPJB 3RS4A 2GGVB 4FCVA 4JLAA 5FOUA 3UG7A 2F6RA 4LWZA 1N2CE 4URUR 3U44A 1JJVA 4G0NA 2VQSA 1XXHB 1CR2A 3LONA 1G7SA 5GADl 4XIGS 5JJIA 1ZNWA 2C95A 4P4TA 5B30A 1XNJA 4YMVA 1JI0A 1N3BA 2EFEB 3OEED 3TIFA 3BGWA 1JEDA 4TSFD 1DBSA 1Z6TA 2YZ2A 1S9HA 4RVCA 2VP2A 2ORVA 3QQ5A 4GMXA 4PO9A 2XTZA 5EUQB 1JALA 5CYPA 3AVOA 3A8TA 4BZXA 2OE2A 2VSXA 4HZIA 4TT3A 5FTNA 5KNBA 5FBWB 5E4FA 4TL8A 4B3CA 4DLTA 1B0UA 1N5LA 1DEKA 2PLFA 2QPOA 4NCHA 4EFMA 3E1SA 4O2LA 2GCOB 1CR0A 2X1VA 4X8MA 3KFVA 4NMMA 3KN2A 4DT1B 3P26A 2BCGY 3NC0C 2QPTA 1S1CA 3FDIA 4WA7A 1RGQA 1XD9A 3X1YA 2CMKA 4PSKA 4LBYA 1W1WA 2JLWA 4MRRA 3OAAA 3RWOA 3WMFA 4PC1A 5JECA 4YDHB 5KO2A 5EZ5A 2V1XA 3MRSA 2AKYA 4BEJA 4M1YA 4OJQA 5SZIA 3EIQA 2REXB 2P59A 2YOFA 3LD9A 2YHSA 4LJAA 1QVRA 121PA 3L0PA 1T5IA 3SV8A 2GA8A 3C15C 4G3XA 4E5UA 4HAYA 4Q4HB 2ZYWX 4XD7A 1E2EA 4HZUA 3QXJA 2ZXUA 3B1VA 3GJ6A 1GZSA 3QPVA 2ZVPX 3RS3A 2GVDC 3V4FA 1G9XA 4FMCB 3KJHA 4JVMA 3BXZA 4LBZA 2QM8A 1DG1G 3AKEA 1Q12A 3I73A 3SJAA 1RTLA 2D2FA 1W5SA 4LHWA 3P8NA 2XEXA 3CF0A 4EFLA 1OXTA 1RKBA 4C0QC 1RC8A 2RGBA 4G5OA 5CM9C 4ON9A 4UXHA 4FIDA 5CK5A 2UZIR 2XSZA 1NN5A 3U2QA 1WXRA 4TQ9A 5C46F 3SUEA 4XWOA 2G3YA 2V9PA 3R20A 3SUFA 5LDDC 3SJCA 1P4SA 5GJWC 1WMSA 3QF4B 3NVAA 3CX6A 1GNQA 3SYNA 2C98A 4F92B 1AS0A 1D9ZA 1NN0A 4E03A 1U0LA 2C96A 1JNYA 1DXWA 5KPJA 5J5CA 3K9GA 4Q02A 1AGRA 2OESA 1GG2A 4QKQA 2ZPTX 1TU3A 1X8KA 2NO6A 1E2HA 1KO7A 4JLBA 2AN9A 2PT5A 3FMOB 4JT4A 4N3NA 3CH4B 4QC2A 3CRW1 3V4RA 4N0EA 4Q00A 3TW8B 1NG9A 1BKDR 1U98A 2O8CB 3T5GA 2DYKA 4LDJA 3P20A 2VBCA 5EUMA 4B44A 1W36D 5B58C 2ZI4A 2VTKA 2QZ4A 3NXSA 2BKEA 1NBMD 2XGJA 4RZ2A 4MKFA 3OEHD 4QHSA 3QNUA 1Q57A 1OKKD 3D31A 4NE2A 4PPQA 2FE4A 3SDZA 4YQFA 2K5UA 2ZI9A 1ZNYA 3WMEA 3PV2A 1R0XA 2OCPA 1D9XA 3PXGA 4MYHA 2C9CA 1HYQA 3AVWA 2IWRA 1TQ2A 1ANKA 1Q1EA 2MSDB 5F9HA 3MUFA 4FWIB 2C99A 4C9BA 2OV2A 1FOEB 3AKCA 4IFEA 1R0WA 2ZVQX 2VHCA 3X1ZA 1ZYUA 2ORIA 4G5SA 2O8EA 1BOFA 1W4AA 1ZUIA 1DAHA 3PUWA 2G0NA 2QG6A 2WMNB 4H1UA 4JBXA 1ZM4A 3L8ZA 3E5HA 2Q9AA 2PCJA 4URWR 1G3MA 3KXLA 3GLIE 4V0MA 5FPSA 3SV9A 1NY5A 5JEEA 1D5CA 4M9ZA 4PFSA 4PR0A 2PJZA 3A6PC 1DAMA 2VP0A 3CO5A 5KSYA 3DZDA 1G1MA 4M8NE 4A36A 4U02A 3UPUA 3NEJA 2GHIA 2ZAMA 3SU2A 1MO6A 2YNMA 3K09A 2PH1A 2ZJYA 3WRXC 2OO7A 3LNCA 3O47A 5DN6D 4URVR 2XSZD 2IF2A 2ZRGA 3KKOA 3OIVA 1H8HA 5B64A 2L0XA 4POAA 5J40A 4LC0A 2IXEA 1R8SA 2XJ9A 3GEIA 4Q5IA 1G8YA 2OC8A 2GZAA 2XZOA 1JEEA 4ILEA 4B3FX 3GLIA 2HUPA 1EFRA 3IQWA 5F9FA 2DR3A 4C0HA 5FBRB 4DCTA 3LX5A 4AYXA 2IYZA 1TEVA 2CL7X 3QXHA 3U1JB 3FHOA 3U6KA 4BGDA 2REOA 3D7MA 4BFXA 4OHXA 1NN1A 3TKLA 4Q9IA 4RD4A 2ODWA 1M7GA 2J0SA 1CEEA 1A7JA 2OAP1 1W47A 3H2YA 4L16A 4M1TA 3IEUA 1KJZA 3ICEA 3MJRA 1G5RA 3KQNA 1N6HA 1QZXA 1HE8B 2GBLC 1J7KA 3T1VA 1KO4A 1QF9A 3KJIA 4DUGD 1T6NA 3AH8A 2QRZA 2FFBA 4Y0VA 3SQXA 1GAJA 2NO9A 1A2BA 1NI3A 4OHWA 3VAAA 5UKDA 1JAHA 2QUZA 2F43A 1CJUC 2QT1A 4YMWA 1QHGA 1UM8A 4MKIA 2IC5A 1EGAA 2WWWA 3C8UA 2PX0A 3DO6A 4QRHA 4AK9A 4BFYA 1E2LA 1DOAA 1SVLA 1QHXA 4QL3A 1ONBA 3B85A 4A2WA 2EQBA 4D4LA 4CEJA 1CJMA 1E9CA 4EJSB 5C1BA 1U90A 2XOKA 1OHHA 2O8MA 3W8NA 3TNFA 1P2TA 2FZLA 1HE1C 4BLTA 3SZRA 1PVOA 3QKTA 1YR6A 1A1RA 3NDBB 4BFTA 1BYIA 4R71A 1F2UA 4PPFA 2HCJB 1FUUA 1GKIA 1T3SA 1X8JA 4PQFA 2ONKA 2PJRA 2A5DA 1MO3A 4JL6A 3Q8XB 1ZNZA 4XVRA 4JIMA 4BUJA 1GOTA 1UKYA 1KYIA 4CRWB 1U9IC 5HCIA 1YZKA 4HUTA 3EASA 4PAMA 2IBMA 4MUBA 1Q22A 2F3TA 5EE1A 4NWLA 1OH6A 4NYMR 4LRWA 4C0JA 3IEVA 2W58A 1DY9A 1NMZA 5DE3A 4D81A 5FTLA 2VPPA 1FNNA 2A3RA 2WIAA 2GVZC 3SNHA 2C77A 3S1AA 2V4ZA 3UWOA 3LBIA 1P9RA 4IKEA 2VL7A 1XTRA 3TBKA 3SE0A 821PA 1TADA 4MYCA 2FSHA 1FMLA 4IOLA 2QAJA 3THYB 1KTVA 5GJVC 2AFIE 3SBDA 3TQFA 4ZDIA 2QQEA 1J2JA 2OINA 3CUEF 5EE5B 1E79A 1TUEA 5FH9A 3AVPA 1U99A 2FX3A 2JASA 2ODBA 2NG1A 4QBFA 4HI0E 5FUYA 2IUTA 4GOJA 4JL5A 3QXSA 3DZ8A 4NKRA 3FVQA 3CPEA 1SVOA 4BFVA 1XBTA 2AR7A 3TH5A 2GDJA 3QXXA 3VHLB 3VNVA 4EFNA 4TQUS 4GP6A 4R8TB 4TL7A 2PLRA 1ZBDA 3ADCA 1XPOA 3GJ4A 4RJLA 1C4OA 2CL6X 1JPJA 5HKKA 3MG9A 1DO0A 2BC9A 1E9AA 4O25A 5CIQA 2IYVA 4LJ6A 4XD7D 1MRSA 3VTKA 1COWD 2FNAA 2ZROA 3M5LA 3FB4A 3FMIA 4G5RA 4Q4JA 3JZMA 3THOA 1JJ7A 1NLYA 4AWXA 5JWRA 4W9MC 5EZ6B 5FR2A 1ZIPA 1D6JA 5FL7A 1EX6A 1XTKA 5LBIA 4MQBA 1Z06A 1X6VA 2P5TB 3KKPA 4DZZA 3IDQA 4FMCF 3OE7A 3TSZA 2X19A 2AXPA 5JCPA 3SN6A 1FMJA 3IIMA 4B33A 1YVDA 4AD8A 1PV4A 4R9UC 3EWSA 1LW7A 4AYWA 3DM5A 4A4DA 3OTPA 1Z0FA 2EYUA 1H65A 2Q0HA 2QE7D 3IPYA 3MJHA 4MRNA 3DHWC 3M5OA 2HEIA 2O8CA 4D2IA 3E90B 1AGPA 1E4YA 3CB4A 1Q1ZA 1D2NA 2F1IA 3Q85A 1GRQA 3AKYA 4V0KA 4OK6A 2P67A 2XTMA 2QBYA 3MAAC 3AP2A 2CVFA 1XJ0A 3TRFA 2ZU0C 4OKSA 1KIMA 4RY2A 3I3SR 4Q9LA 2A5JA 2FOLA 3HU3A 1G7CA 4IDQA 4H9GA 4KFSA 4GMDA 4MYTA 3AF1A 1Q20A 3TAHA 4UNPA 1ZUNB 3A1UA 4B2IA 1NLZA 1EK0A 3AF2A 3WNCA 4A82A 2YKGA 1EX7A 2D74A 4OI4A 1AA9A 4US0R 4US1R 4JLMA 2BDTA 2IXFA 3BH6A 3WYGA 1GVNB 2GK7A 4PO8A 1CS4C 2O8BB 1PUJA 2VF8A 2NPFA 2ZRCA 3ZGXA 2GEVA 4F91B 1IOZA 2BBOA 2XITA 3A4NA 4M9SA 2F9UA 1N6LA 3DMDA 4QXAA 3WY9A 1DAFA 2FU5C 2WPDD 2W0MA 3AVUA 3LX8A 4I1SA 4UNRA 2DFLA 2CLDX 2XCNA 4KBFA 5H70A 3E2IA 1W7AA 3I92A 1G8PA 1SVSA 3CWQA 2FWRA 3QIAA 2PZEA 2GAAA 1L4YA 5E7IA 1NLFA 4IOKA 3TUIC 5JHGB 1VDZA 1XEXA 4KLNA 1E1RA 1E2JA 1UAAA 2R2AA 3IHWA 2AXNA 2ANBA 2VRWA 4TTPA 2C78A 3AF4A 3VX3A 5F98A 1Q44A 2E1RA 4NYMQ 1XZPA 3SU3A 3I72A 4CEJB 2W6JD 5FPYA 4V0NA 3SBEA 2WV9A 1QHHB 4KTCA 4M4SA 2N1BA 3TVDA 2ZU6A 1KK2A 1UKVY 2F9LA 1PLLA 5FI1B 1OXUA 5TARA 3O8DA 1UEIA 3CNNA 1JBKA 4DDUA 3CIOA 4D26A 1NRJB 4QHYA 5DLQC 4BWYA 2GJ9A 2YINC 1WE2A 3GMTA 4BLPA 4W5HA 4LHXA 4NCNA 3I61A 1LB1B 2FSGA 5DHAA 4BZQA 2GXUA 5FTKA 4KJZA 3J81k 1FFHA 4EUNA 4A1XA 1CRQA 3JVUA 4TN1A 4IJMA 4MGKR 4C2UA 1AS3A 4YMUA 1CJTC 1YE8A 2OEPA 2JAQA 2C9OA 3HYTA 4Q18A 4YDSA 4TYQA 4A0RA 2ZS8A 5CB8A 2W0SA 1ESMA 5A4JA 5JI2E 4Q9JA 4DSUA 1PZNA 5DI3A 2A4QA 1JR3A 5BYJA 3GQBA 2QEQA 1SKQA 2A5YB 4XJXA 4DCVA 4FMBB 2GCPA 2ZE8A 1YRAA 4I1VA 1Z6YA 3BJIC 3U7EB 2CJWB 3ZZUA 5D3MA 4Q4AB 1KDPA 2F1JA 3RANA 1DS6A 3QI2A 2HYDA 3VFDA 3WBKA 3NH6A 1TMKA 3AGPA 3P27A 3LXXA 1AJEA 3W3ZB 2D06A 2GJKA 2RAPA 4ESVA 4H1VA 2F55A 3EWAA 4HLQB 4NL4H 2CCJA 2A2ZA 2G83A 4PO1A 3KZ1E 4KYUA 3PUVA 3B9PA 3SJBA 4ABYA 2OLKA 4Q66C 5JWOA 3L0IB 2OT3B 4HAUA 1FNMA 1NKTA 4KU4A 4M1KA 1LF0A 4U00A 4KLZA 1NS3A 4ESHA 1G291 1DAKA 4I31A 1XEXB 1EFUA 1GL7A 3K09C 5KPDA 2ZRMA 4IRUB 2ZJOA 2XNDD 1LS6A 3EIHA 1NP6A 5CYOA 4LGMA 4EKDA 3CR7A 4HYYA 3I4LA 1P72A 2W00A 1IN6A 1YZGA 1XTSA 3U7GA 1QHHA 2QT0A 2IS4A 1E2IA 3WMGA 1GNPA 4MKGA 4JMYA 1X1SA 3R9IA 1EFTA 4C2TA 2ZS9A 3AQ4A 1ZNXA 2JLXA 1ZAKA 3VX4A 1OF1A 2GWHA 3X2SA 1DE0A 2PEYA 1HV8A 2AD5A 3M1IA 4YONB 2BEKA 3BE4A 3ZJYA 2QL6A 4FMDF 3IUYA 3NG1A 2NTYC 3WRYC 1Z0AA 3LVRE 4A6XA 2W2XA 1IY2A 4PC7A 1KSGA 1G8GA 2BM1A 4GP7A 1X3SA 3L8YA 1KI6A 2WSSD 4LJ7A 3ZD6A 3LKWA 1DO2A 3SV6A 2W6ID 4MDFA 3EXAA 4OJKA 4XVQA 2J59A 3RAPR 1XZQA 2EFGA 2RGNA 5KU1A 1M7HA 3THYA 2NGRA 4ZIRA 1G64A 5FBVB 1J70A 2HT6A 1R8QA 4AG5A 2V3CC 3Q7PA 4GL2A 1L8QA 1MO4A 1OH5A 4DRZA 3EZ2A 4F4CA 4OQMA 1XXHA 2J7PD 4M9QA 1G20E 3H09A 2WAYA 1W3CA 2QMOA 1ZCBA 4GZLA 1NVXQ 2A4GA 2FEOA 1ZINA 3U6BA 3Q7QA 2CVHA 1G7TA 3HYRA 4Q21A 2CNWA 3PV5A 2OBOA 2JLRA 2RB4A 1Q3HA 1R2QA 3X1DA 4JVSB 4L5BA 2J46A 2Z4SA 2UVQA 1FP7A 4S2EA 4L8GA 2IWHA 1DVRA 1DARA 5A0FA 2QBYB 5IDVA 2ZR9A 3EPLA 4RI0A 4ITRC 4IDHA 4GOXA 1MABB 5D3QA 1KMQA 1KI9A 2ZYTX 2DWOA 3ZVNA 3WHKA 1OFHA 3I32A 3QKUA 1OXXK 2O8DB 4XTRA 4TYPA 4KI0A 4PHFA 3RC5A 3LA6A 4O2RA 4TL6A 4O0MA 2ZS7A 1YKSA 3HU2A 2Y8EA 1XEWX 3QE0A 1G6HA 2IYYA 1GUAA 1JR3D 1Y63A 4QGGA 1E2DA 1IXSB 1OH8A 2XXAA 2FJUA 4QM7A 5L8VA 3FKSA 1Z6GA 4BRWA 1G19A 1DPFA 4DSNA 2FGKA 1GIAA 5EXSA 1WQ1R 1M7BA 1NVVR 4NZYA 1QBKC 2J0UB 1W5TA 3CZQA 2QNRA 4F38A 4JVNA 4HUQA 1N6NA 1EFHA 4LSGA 5LD2B 1QVAA 1Z63A 4CEIB 5GVSA 5JCZA 1HUQA 2VHQA 4TMVA 3X1XA 2IUUA 1KGDA 4WAUA 4DCNA 4OHYA 1FQJA 1CULC 3UMSA 3QEJA 4AY2A 4KODA 3FGNA 1RRFA 1GNRA 1K5DA 5ETXA 1G8HA 1K8RA 2H8KA 1SVWA 3OFND 5EP2A 3AVQA 3KKQA 3QKSB 1E0JA 5JSZA 1GRRA 3V00A 1IJFA 1KO8A 3TLXA 2GCOA 2BMJA 1W0JA 1Z0IA 2OFOA 2WKPA 3B1WA 3NKVA 4A8JA 2JLUA 2EYQA 3VR1A 2W6IA 1SXJA 2Z5FA 4RZXA 1X1RA 4OBEA 2Q3HA 4UXJA 4ARZB 1ZU4A 2I1VB 2RMKA 3VR3A 5EQQA 3OEHA 2YV5A 2RHDA 4MGYR 4HSEA 4DLZA 3OFNA 4FCTA 4JLPA 4BEBA 4TMTA 1F5NA 1AKYA 2HJGA 4RCZA 1E9FA 4DC9A 1S9DA 2ZSAA 4KVGA 2JIZA 2DWPA 4Q1BA 2J1LA 4G5GA 1TTTA 2ZSFA 1MKYA 2HLDD 4EPXA 3FFAA 2ZSBA 4B73A 4D6PA 2ZIAA 5FUVA 2BBSA 2QU8A 3UMRA 3RC6A 4HATA 2OUKA 3QXCA 2Q3MA 4XSGA 1OIVA 1GFIA 2WOOA 1AM4D 4BZPA 3K0CC 3QG1A 1R7RA 3PEUA 8OHMA 1E2GA 2W2VA 2V55B 1GP2A 2QAGB 2DHRA 4JLOA 4N0DA 4DB2A 4JJKA 2E87A 4KO8A 2GVFA 2GESA 1GL9B 3SU4A 3B9QA 2J87A 4OYHA 2ZITA 1CTQA 3GFTA 2O0JA 1I4TD 3GLFE 3ZQJA 4B47A 1JXOA 3LBHA 3TQCA 3K0EA 5ANRB 1W44A 5FOTA 4JBWA 2IYUA 3SOPA 1WP9A 2IF0A 4D4JA 3RS2A 1PLKA 4U01A 5KOYA 5AUQA 5EXPA 4P31A 5BXQC 5AR1A 3ECCA 1DAIA 2CHQA 4HB4A 1EXMA 4LJ5A 5LB2A 3ZDQA 1CLUA 4TLAA 1KKLA 2FH5B 4TSFA 1EFCA 4DUGA 1W2HA 4Q4HA 3GLFB 1KZ7B 3WYFA 4KBGA 2IA5A 1KK3A 3A4LA 3U7FB 1OH7A 2MMGA 1VCNA 5BN5A 3REGA 2JLZA 1OXSC 1FTSA 1XP8A 3WP0A 1BYUA 1US8A 3BRWD 1P9NA 3BD9A 3KKMA 1S96A 2C8VA 1GL6A 2V7QD 1XU4A 1I4DD 2H16A 4NU0A 1R5BA 3PEVA 2ZRDA 1ZUHA 5EE0A 1IQPA 5FL3A 2A5FA 3WP1B 5A5GA 2WWFA 3C16C 221PA 1MABA 4DDVA 3M4YA 1RE0A 4BFZA 4CZ2A 1VECA 1KMHB 3TR5A 1GKYA 3HDTA 2XZPA 4ACAA 4C3ZA 4DT1A 4AI6A 1T3HA 1KSHA 2XB2A 2PEZA 3UG6A 4WOPA 3B1YA 2ZR0A 3EAQA 3THXB 1XDBA 1P73A 2G88A 3BFVA 3LH5A 1QDEA 1E9SA 2R9VA 5GNDA 1XCGB 2ZE7A 1P75A 1HT2E 3RRYA 3TE6A 4HLUA 4LYHA 2BHRA 2Q3FA 2QTHA 2EFDB 2ZRIA 5TMPA 4A2PA 3ETLA 5E3HA 2XCFA 1N0UA 1A4RA 3GJ8A 1FPMA 2IHBA 2KBFA 3PIRA 4Q4LA 3VR4A 1E32A 4V0OA 1NJGA 3DDCA 4A0GA 4Q47A 1P61B 1CF4A 1M74A 5TDHA 5K8UA 1CJKC 3ZIAA 4L9SA 2QAGC 2QMUA 1GM5A 2GAOA 4BPBA 2CE7A 2ZRNA 3SQWA 1BO6A 3EZ7A 4WZBE 4Z51A 4CEIA 1ELOA 2IYLD 2V6JA 3KJEA 1XF9A 3LBNA 4KV9A 4G1UC 2F3RA 5IT5A 3GLGE 2J0QA 3KQUA 2OZEA 3FMFA 1F6BA 5FL7D 4NCKA 4QNMA 2XXAB 3CF6R 4LCBA 3KB1A 1W48A 3HU1A 4LX0A 2WWYA 3NWJA 3L43A 2AWNA 4QNRA 1I2MA 3OIUA 1VG9B 3AP3A 2WBLC 4OI0A 3HR8A 1LY1A 3RABA 1XFAA 3DPUA 1VG1A 2CBZA 1DAGA 3D6TB 4K46A 5AJXA 3D8BA 1VHLA 4OQLA 1ZM9A 2SHKA 2X2FA 4Q7KA 2O8DA 3T15A 3P8OA 5IF9A 2ZUCA 1U94A 1W0KA 4RZUA 5DYGA 1G5TA 3BBPA 1Z29A 2CE2X 4B3DA 2O8FB 1IHUA 3R8FA 2AL7A 3ZS8A 4UKDA 1OIXA 5TV2A 2FA9A 1JAIA 1T3LA 2F7SA 1D2MA 1GSIA 2FSFA 4LOAA 4DHEA 1W36C 2GXSA 2EU8A 1N6RA 2FN4A 2H1LA 1QHSA 4TYDA 1IJEA 4GFDA 3CRVA 3MGCA 2K1QA 4FI3C 1OT3A 2QORA 3GLGB 1OFUX 1CXZA 5DISB 2B8TA 5KDLA 1RPZA 1M1YE 2GJAA 3KB2A 3LRPA 2VO1A 1E9DA 3AUXA 3GFOA 3RHFA 3UWKA 1MT0A 5FPTA 3ZZTA 4IDOA 3LQRA 1KI6B 1WBDA 3I8SA 4WF8A 1HY3A 2ZSEA 4Q48A 1VG8A 3PCRB 2REBA 2HJVA 3QKRB 4B71A 5IHPA 1B23P 4ARZA 2FGJA 3HJNA 4KFRA 5DI9A 1YR8A 4DCUA 2RGGA 4ZDKA 1E79D 2FZ4A 5M04A 3ZLJA 1KK0A 2R6AA 2ANCA 3NC1C 5E7MA 2EW1A 2ATXA 2G0TA 2PBRA 2ZETA 3ADKA 4RD2A 2WJJA 3W6OA 1G3RA 5IK2D 2IYXA 2J3EA 3U1IB 2QENA 1OLOA 3CM0A 3HP1A 4D82A 2VYFA 2ZI6A 3QKSA 4HB2A 1KY3A 1U0JA 2FDCA 1E2FA 3T12A 1XMIA 4AKHA 3VQTA 2IUSA 2ZAOA 4QGAA 3EC1A 4Q01A 2WSSA 4QGFA 2JATA 2WHXA 1YRBA 1Z8FA 4B2LA 2NO1A 3SJZA 4HZUB 5JBQA 3N2IA 2H92A 2GKSA 2ZJAA 3ASYA 3W3AA 1UKEA 2ECKA 1G17A 2PL3A 1IN7A 1IY1A 1TQ6A 3H4MA 5J4KA 1HH4A 3NTUA 1KZGB 1TQDA 3RDPA 2A30A 4DLRA 3N2EA 2OXRA 4U7DA 4LZZA 4A6PA 3KEEA 3HWSA 1W46A
chains in the Genus database with same CATH superfamily
3WK4A 2P6RA 3DZJA 1LVHA 4JC5A 2H4HA 2PD4A 4JUDX 3W9UA 5C2JB 2ZB4A 3SMQA 4D4KA 4PZEA 2JVKA 3MIIA 1GQFA 3AGQA 1HTWA 2PMWB 3P2KA 4NA8A 1U0TA 1LPPA 1U4SA 2VAVA 4DKXA 3PEWA 3FLEA 4ZKRU 2BEVA 3GNSA 1SC6A 2XNSA 1CUBA 2F8LA 1DB3A 2HF7A 4KVAA 4EK9A 421PA 3G5MA 2O3SA 3HV0A 1PK7A 2JH6D 4AJ9A 3RAFC 1ECJA 4CBVA 2P3TB 3GJ0A 4HS9A 3K8ZA 4WN9A 1TRYA 1NOIA 3EGXA 3VZBA 4YUWA 2UUKB 1RWOA 3ABSB 3VO2A 3RUCA 3GFFA 4N49A 2QVBA 3OVMA 3UHOA 3OSUA 1A95A 2RHJA 2AHRA 2VQDA 2XQIA 2ZHFH 3VDMA 5B1YA 3VFEA 3AFNA 1ZC3A 1YFZA 2X77A 1HCGA 5IC6A 2ZI3A 3HHEA 4KITB 3AG6A 1D6SA 1DELA 2OM2A 2Q8NA 3ACBA 3BQ9A 4PWZA 3VGJA 4YK7A 3W9YA 5SYAA 5IT4A 3DCJA 4IDFA 4WKPA 2ZRJA 4X1YB 3F2HA 4IYRA 1DQSA 3O0TA 3EZ6A 3WGGA 3KE8A 3F9RA 1BS1A 2Q2VA 3NV7A 3PR1A 4M7OA 5KYNA 4B3SB 1JFLA 1UBGA 4BCCA 1J2TA 1QIKA 1VYTA 3GARA 3MT8A 2K8IA 2X4DA 1B0AA 1QCZA 1JF8A 1PZFA 1UADA 3I2HA 3G5TA 2Y2VA 4PSCA 3PUIA 1F12A 1FMGA 2YNAA 1RQLA 5EXXA 1PJ2A 2FTMA 2ZRPA 1QCYA 4F06A 5LQUA 1RZRD 1E7SA 3IUMA 1GGVA 3FRIA 4E5SA 1Y59T 3C8HA 3M7QA 1EHYA 1V6AA 3ZVFA 3CRRA 4IVQA 3D6HA 4TS4A 3ZHSA 2J0UA 4HCJA 2O2DA 4CTOA 4F7WA 4DZZA 2VH1A 2CXUA 2ZJBA 1AWFH 6GCHF 4U8GA 5FD8A 4QOFA 1J25A 6CHYA 1CHGA 2BFPA 5ICCA 2DLNA 1MCZA 1PE0A 5AWFC 5FOSA 3M6AA 2WTUA 3NBUA 4I2NA 1V35A 4A1FA 5BN3A 1M34E 3EE0B 4UC0A 5AKHA 3T9BA 4U2BA 1KXCA 1FS5A 2ECQA 2AYZA 5GZ6A 3I5UA 1Q7CA 1XXDA 3AB3A 1OILA 1JDNA 3KUDA 2ZPUA 1KDOA 3ROKA 2EXXA 1V11B 1C1YA 4IFTA 2GD0A 4JJFA 4GVLA 4A23A 5I8WA 5AFYH 5GDSH 1I7SB 2UV8A 3ZWDA 1Y5IA 1QQAA 1U6KA 3D0OA 5FOXA 3IO5A 1FJSA 1CBUA 2OP0A 3IQDB 4NSYA 2QJFA 1DUVG 1SBYA 4B2YA 3EZNA 1A7SA 4HFMA 1ZMXA 1IUOA 3CVOA 5F76A 5GONA 3H1FA 1OYWA 3F5QA 2EIHA 3PJGA 4KO2S 5CB0A 4WXIA 4AF8A 2V97A 3B13B 1DCMA 3SZNA 3T99A 1BVYF 3OZEA 3RIMA 3RR2A 1ZD2P 2DY0A 1TTQB 2HLNA 4BO7A 2DULA 2BISA 2GYYA 5AVVA 3FOFC 3Q6MA 4KR6A 2QHXA 3ZTYA 4E33A 1GI0A 5FRDA 2JEOA 1GHBG 2PV9B 1N6KA 2AEMA 3MF4A 2IOQA 1C5NH 2FEMA 3WWCA 4G0VA 1NVEA 4P0QB 7MDHA 3UK1A 3ZBPA 4X6UA 3RYFB 3FSGA 1OPRA 3A1DA 3TRJA 3ZNPA 1VE6A 2VZ0A 2VHJA 5EJMA 1XTZA 4JDUA 1KPHA 4P35A 2OA0A 5FJJA 1KI3A 1M0WA 3SZEA 2PU5A 5FKJA 4U32A 4BNMA 1X7WB 2VG8A 4C29A 3CN7A 3KPVA 1IWPB 1QORA 2GD2A 2O19A 3JZFA 2HRZA 2X5NA 1A96A 4Y2HA 5J59A 3WNDA 1NRIA 1NL3A 5LQSA 5A0AE 1FX0A 3AVVA 2EFJA 1S2OA 1QBVH 3ITNA 5AKZA 1GMCF 1WD5A 1E3WA 1I3OA 1PL8A 2Q5JA 4CW7A 1AKRA 4OHMA 1MJFA 1DV2A 1X86B 2JIMA 2WFAA 1XQYA 3L7MA 4NCIA 1EPTA 1NASA 1QBGA 5ILQA 3W4KA 3UR9A 2G5PA 2ODNA 3TD6A 2JJMA 4B43A 1UTKA 4AFUA 1RRGA 4JA0A 4DIHH 1P3CA 1BGXT 4HXEB 4PV7A 3TBFA 5CXQA 1SL3A 1GFZA 1TMYA 1CGJE 1A8QA 4U39A 4TYWA 1DZ3A 1LJLA 3BWMA 1XZEA 3IO3A 4FQ7A 4HVCA 3VZCA 4ABEA 5IM4A 4L9AA 1AUJA 4JT9A 2ZUBA 3G79A 1DIBA 3L6BA 3T4PA 3UF0A 1YDFA 4B7ZA 4O5OA 1NM6A 3AUYA 3U4DA 1N33B 1ZRHA 3GCOA 5IYZB 1WAYB 5HIZA 3T34A 1V1RB 2H8GA 2ZIUB 3DLHA 1KMMA 1VJTA 1UTLM 5EFZA 4CQNA 2R86A 1V2RT 3WBJA 3GOQA 2H2WA 4Z8YA 1B3BA 3U31A 3UGQA 3WQRA 3WWDA 4C1NA 5JH7B 4EKIA 1IL0A 3MU4A 3C1OA 4M21A 1V2UT 4M8SA 3GUVA 1XPUA 4L51A 2WIFA 1J09A 3O31A 4BX3A 4F48B 1PFUA 3KQWA 2RBGA 2RGCA 3RM3A 3N0XA 5D5QA 3JALA 3DDOA 5CYGA 3EGKH 4PZCA 4R51A 5AW4A 3N3BC 3PNYA 4H3SA 2QZZA 2F9PA 4XBDA 2QXUA 5DYNA 1T2DA 2H1RA 2YJGA 2G77B 5KGOA 2IKQA 3CF4A 2BV3A 4ZYYA 3E2PA 4IIXA 4BNKA 4TXNA 5MF6A 3H13A 1N6IA 1QURH 3KNXA 2MSWA 4MR7B 3ZIAD 3I2GA 3ANMA 1ORWA 4NQZA 1SXPA 1AZ8A 3M89A 4KJXA 5L30H 4TTQA 1BHQ1 5IDQA 4QT8C 5DULA 1V1MA 1BTYA 1OKKA 3BM5A 4J16C 2VNHA 3QOYA 4UEQA 2AC4A 2FP7B 3QVVA 4FDAA 3RRZA 2I78A 3G6WA 1T91A 1TBZH 3RAEC 1C2KA 2IE8A 3PE4A 3ZWCA 4MZDA 4ISLA 5J4SA 2RHRA 4UHBA 5M29A 2R6GA 1PPCE 1QB9A 2E5FA 1OC2A 2H5EA 3M82A 5L2YH 4KIFA 4RKWA 5TEVA 4CKZA 4Q1AA 1QNJA 2A78A 2ZHWH 2FM2A 3KOXA 5KKAA 1FUEA 1TUIA 4GHTA 3U7HB 2B30A 3Q11A 2H0RA 4DOMA 3R8CA 4MV5A 1OP0A 1UEJA 2IGTA 3KE9A 3FBGA 5A0TA 4NHEA 2HIAA 3LW8A 1VM6A 5L7WA 3BX1A 3OQNA 1R4MB 2PL5A 3T1TA 1Z62A 1DTSA 4BWFB 1E35B 1Y1TA 1ZJ6A 4X1NU 2PM8A 1Y3HA 2HA2A 4HHEA 3VVMA 1DC7A 2FSIA 5IDKA 3ISTA 1Z47A 3P2OA 4ZGWA 2R8BA 3BRSA 3CKLA 3H5OA 2X5XA 2MSCB 2WP0A 1YOVB 1EQ2A 1JEQA 5C4MA 1BE0A 4L6AA 5LZ9A 1C5QA 1JMYA 2DR0A 1P33A 2WU1A 2QMYA 3C24A 1TE2A 4KQ2A 1P12E 5DYIA 3SU1A 3ZVGA 1I9GA 1V3UA 2YASA 1Q7GA 3CJRA 3G9QA 4IMJB 2PUFA 1Z5VA 5EQDA 4AKEA 1I1OA 1E2MA 1UR5A 3A28A 3WR5A 3U3MA 1OYOA 1B6TA 1R0RE 3GCHC 1EUFA 1XAGA 3JQBC 4TV9B 3U37A 5GOZA 1D3AA 3UPTA 1HNXB 1V4NA 2DWCA 1W4ZA 4RSMA 4EG7A 4C7OA 1H2EA 3CLHA 4EI2A 4NBTA 1QZZA 2ZFSA 1AFQC 5FTJA 3W9BA 1P9UA 1LRLA 4N9QA 2XCLA 3SJ8A 2WUVA 2GBIA 3NDRA 4FDLA 3S44A 4AJHA 3LDGA 4CXMA 3MAGA 1PSZA 1L4UA 3L0OA 4KL8S 1ZG3A 2P62A 1TL7C 3QEOA 2IW1A 5JBTA 1RIWC 3TQRA 5BNTA 5LR6A 1N34B 4W1SA 1HI9A 1SGTA 5ER6A 1PEDA 1O31A 1V7QA 1DFPA 2J3KA 3C8DA 3GEEA 5IXYA 4JJGA 4HH4A 2Q5IA 4L28A 5KINB 2DWQA 5GJ4B 1S3SA 3JWEA 1U9YA 5E4YA 3FCEA 3TTTA 1CSEE 5BSEA 1RJXB 3RC1A 2C8LA 1JHAA 1VSUA 5HMAA 3K1YA 4QPCA 4XH9B 3ND8A 4ISCA 3R5KA 4M1MA 1I0ZA 1IHSH 3J7TA 1EE2A 2JJYA 2CHUA 4C3VA 1GT6A 3QBTA 1T36B 5F3RA 1XG5A 1YZFA 4LN1A 1EUCB 1Z37A 3E05A 1O3YA 2H2DA 1DIGA 2WPMS 3MJEA 4OHBA 1LKZA 3KEGA 4MAMA 3F0PA 5CJPA 4Y0YE 4BN5A 4EJSA 5CB4A 5JRJA 4R7ZA 1VYVA 3CISA 5SY6A 1KK1A 1MQ9A 3OU6A 1EZUC 1KYYA 5KTYA 1WHTA 3NPSA 4XB2A 5DBIA 5BSUA 2PRJA 2ZI5A 3HCEA 4G8CA 4I50B 1XNRB 4EABA 3VB6A 1XEWY 2C7RA 1J9ZA 3U4AA 3ZCSA 2BHSA 2HVYB 1J7JA 5KWEA 4X8OA 4MWZA 1Y7IA 1ZX1A 4ISNA 1U8ZA 3HJGA 2NOAA 3GCDA 3LSTA 3N8DA 3R0VA 3WNQA 2RCNA 1ZOOA 3I83A 4JKYA 3T3PB 2WM2A 2OK7A 2R7KA 3PFWO 4BO9A 5H4IB 2C9MA 4FK8A 4KYTA 2QV1A 3G0DA 1RRCA 1ULTA 2CLIB 3OPYA 1J2EA 2R8PA 3HPRA 2YS7A 1SKMA 3FPHA 1ONPA 2QD2A 3SV7A 4LPKA 3NHBA 5E2AA 3TQTA 3ZV4A 3ZLUA 4MUGA 3V8BA 1WSAA 1L8LA 1CZNA 3EC2A 3B23B 2O8NA 1PHRA 3M6WA 4LY6A 1BJRE 1V45E 5C7OO 1OB2A 2I4RA 4JFAA 4Y6OA 4MDEA 1LBIA 3JZAA 3PC6A 3VNQA 1O9HA 7REQB 2PMCA 3UR6A 2DQKA 2VBFA 2PQ2A 3DAPA 4P82A 4INOA 5EKUA 3AFHA 3SIPA 3CZCA 4P54A 4B48A 1FDOA 1ZPZA 4OS5A 2GLUA 2YYZA 3DLCA 2P2DA 3ZWVA 1G3CA 3B60A 1F8UA 4YOJA 1LNZA 1NLUA 1JR3E 2G80A 3N5CA 4WN9B 5CVVA 3WLIA 4GBJA 2IN2A 5F1PA 4FN4A 2FRDA 4EA7A 1SFRA 1ZESA 1M1NB 1DP4A 3BSQA 1L7BA 1KFKB 2GLXA 3QLPH 1VB5A 2PMBA 4P38A 4EG0A 3TLGB 1ZHPA 2XUDA 3KV1A 2W6QA 2OBMA 4HNQA 4QQ8A 3PFBA 1ZTLA 4IHJF 4JR1A 5TNXA 1KJ8A 3RIHA 5ENZA 9ATCA 4JI3B 1SKUA 5HRUA 3A86A 1LTOA 4KNYA 3BTKE 4NZQA 1TX4B 2IUFA 2CLCX 2QX9A 4FFVA 4HQ6A 4AG6A 1DRJA 1WB4A 3I34X 2JEZA 4KKXB 4NDZA 4E7PA 1UODA 2JJ2A 1JRTA 4I3FA 4JCOA 1YCDA 3VPDA 1NUQA 1EX9A 2YV3A 3HGMA 4DLSA 4LSWA 1A2KC 3CBGA 4I1IA 4DQXA 2EP7A 5EMHA 3GOHA 3LUAA 1V41E 1IXRC 3IUBA 3ELBA 1YZYA 4P4SB 3LYHA 3QFTA 4W8OA 4BPRA 2AOUA 3HYCA 1KKMA 2Y6VA 4O6VA 2JDIA 1GZ3A 3N5KA 1C1UH 2PPVA 4X44A 5A9RA 5BUZA 5J4HA 5JNLA 2E4VA 2VUIB 3KJXA 4Q7LA 4U0KA 4V3BA 1EA5A 2VR1A 5KSPA 5BWOA 1SI5H 5KTNA 2NUAB 2VRCD 2PWXA 3QYPA 4LNAA 1M5UA 1E1NA 1GQOA 4J9UE 1GMDG 1Z34A 1P45A 2P65A 2QZJA 4V0LA 4WZAE 4DCGA 5C52B 4L7VA 4GI2A 1X9GA 4HMQA 4OJTA 4UONA 2J3JA 1PSWA 1R66A 3A7ZA 2C4FH 1O2OA 3I52A 3OT1A 3R0FA 4NIVA 4CR8A 3B6IA 3MBIA 3NJ8A 4R41A 4BQFA 4XRGA 4Z7NB 5CFMA 2GBGA 1L5YA 5HKBA 4DB4A 3QLJA 3JAWA 4RS3A 3TR6A 4P80A 5EZQA 4U9HS 1SGWA 3IXQA 4M87A 1KO1A 3OF5A 1NSFA 5E1MA 1KE2A 1UZNA 5LPRA 2VOJA 2WSLA 1ELFA 3T06B 4D74A 1V6CA 2J5QA 3LF1A 1PR9A 2EC5A 4PYMA 3L93A 4WXHA 3FFXA 3AP1A 4CNQA 3L0SA 3TSAA 1VGCB 1IPEA 2IE0A 5AVTA 1R6AA 4DRYA 1W13U 2TIOA 1GL0E 2PTGA 4Z49A 4ASUD 1I5OA 3C6MA 4RTLA 4I81A 3T3NA 1RW4A 3M5MA 1DCFA 4PXAA 3BVPA 3W2IA 1NOJA 1PU2A 1CFJA 2ZREA 1Z5ZA 3EG5A 3E8SA 3H9UA 4EG8A 5JDCC 2R0QC 1ZK1A 2RAVA 5C1OA 3GRFA 3M6UA 3AKZA 3HO1A 2IHTA 1HZJA 2HEGA 4DLPA 1A71A 2HSEA 4ER5A 2PKWA 2CVQA 3HYLA 4BTVA 1V1RA 4UAGA 4B7AA 4JYTA 1BWSA 3QK1A 4YLGA 3ELWA 1C81A 4RY0A 5A5FA 4BNGA 1MENA 4EHKA 2IOTA 5AHGH 2V65A 4FGSA 3VB3A 2IP2A 4QYXA 3UJPA 5BPHA 1PR0A 2YHAA 3AY3A 3D49H 1P4HA 3DP7A 2RA3A 4G5XA 1T5SA 5JMPA 5TPWA 2QMEA 5IAAA 1T0BA 3BRQA 2WD7B 3GZNB 1GYRA 2V8OA 4EPWA 3B8JA 4MW6A 4QPZA 3NEPX 4B87A 4ZMAH 2FLVA 1F8GA 5CK4A 1MDFA 3RYFA 1SNYA 3HK6B 2R1VB 1T5LA 5HNKA 3NQ41 1PUIA 1Y3YA 4M6WB 3E3AA 2F3UA 2R11A 3G2LA 3WHLA 2PMFA 2VP9A 3MA0A 2JIZD 1UMDB 2FWJA 2HBRA 1CZHA 2JFYA 1NRPH 3NBFA 4Z0TA 4B3XA 4BLUA 1FX0B 3GPLA 1O0SA 1VIAA 1FV9A 3G7UA 3RASA 3Q8KA 1C2FA 3FDFA 1TNJA 2IPXA 4DDWA 2VB0A 3SU5A 2G1JA 1E9EA 1Z3IX 1N57A 1SN7A 2H6EA 2Z30A 3HEMA 3KT8A 5AM0A 4JU9A 4HYQA 5DLYA 3RV3A 2FSVC 5K6TA 3EUEA 4KQWA 5FPHA 1T7CA 2EJBA 3NV9A 5K8TA 3NO4A 2BKUA 2QW1A 1SRRA 3AY0A 4GUAA 3A9SA 1AO5A 5B1IA 1K5HA 3U1VA 3WNBA 2VT7A 2CDAA 4BKUA 2C2HA 2KPOA 1NBWB 4M8KA 1VG0B 3JQPA 1NDQA 2I80A 4TMYA 5SYMA 2CEAA 4UE2A 5KKNB 4XAQA 2IUEA 3KFXA 3E18A 4DIOA 2J3MA 3NBYC 1O2JA 2QRVA 3VPGA 2ZBDA 1Q0RA 1Z08A 4G0ZA 1N2IA 1P0QA 4R8SA 2R6FA 3W90A 4GOMD 1IBKB 3WIOA 3WTBA 5IJZA 1NJ8A 2DXIA 2GERA 1AV7A 3R5HA 1EVQA 3NGMA 2X8JB 1TYAE 2GTBA 1EG7A 4TWRA 3MTQA 5T1VA 5DIFA 3ZHYA 4D4IA 4LWOA 4EEXA 5BWMA 5KSOA 3H84A 1Q17A 2KYRA 2WIJA 3OZIA 4RHTA 1NM5A 3QEMB 2FQ1A 3TMAA 2QDXA 1NSTA 1WXHA 2GR9A 4PLZA 1XVOA 1NR7A 3AIKA 4R54A 5DNUA 1KZYC 3BIUH 4B75A 3HFJA 4JAVC 3ROTA 1JYSA 1YTUA 3ZD7A 1QRDA 1BCUH 2JJ8A 3AONB 3CU5A 3LPAA 4E2FA 2L17A 5H68A 5B2ZA 1BN7A 2F9VA 1KZ1A 3F3BA 1E5QA 1ZL2A 2HGSA 2PT9A 4R5MA 2AT1A 4EY4A 2X9GA 2KSQA 4JYMA 1OFTA 3ZD8A 2J98A 2BI4A 1OVGA 2Y1GA 3GEBA 1T5HX 3HCCA 5EXDA 3RS8A 4XQ9A 2ZHQH 1PTJC 2GEKA 4D45A 5IM5A 4B3MB 1CUDA 2IJD1 1MJNA 4RMGA 6GCHG 2OYSA 1QY6A 5ESBA 1S2LA 1WPXA 2NVUA 2QSYA 3AV3A 3N28A 2RG1A 3R7NA 2YWGA 3QJ5A 2IYQA 3QIVA 1UC8A 1XPRA 5JS7A 5E38A 3DD2H 1IG0A 2XODA 2NT4A 2C2KA 2HHLA 1CRWG 3ZNOA 5JRZA 3PITA 1U8AA 1X0VA 1XKAC 2VDUE 1TO2E 3OCZA 4YJKA 1YCGA 4MYUA 2QV0A 4PIPA 1U0GA 4P4GA 1QVWA 2R7AA 2C5GA 4NU8X 3IUSA 4EPRA 3EMDA 3SNBA 5GV8A 3ZHTA 2J9GA 2B2NA 3L40A 1O03A 4IBOA 1M6NA 1Q6YA 2ZYVX 4LJYA 3VU9B 4CGZA 1UHBA 4Y0AA 1C4XA 3IUPA 3S2ZA 5JROA 1Q77A 4A73A 4GWGA 3T94A 5DG6A 5KCZA 3ZVMA 1E2BA 3X43A 4ZFNA 5ALWA 1NO9H 3KIPA 1F0KA 3A9TA 4X61A 5FX6A 2BH2A 2UKDA 4HEJA 3AB8A 4HVTA 1IN8A 3S2IA 4AOQA 3C85A 1ORFA 4BEVA 4TYNA 3KU4A 3QX3A 1SM4A 2BGNA 3UUFA 5LKAA 5KYKA 4JZKA 2TS1A 3CINA 2DSNA 3TOXA 3TZHA 2BVRH 1DADA 2I4LA 4BIMA 4R5HA 4CI9A 1GTSA 5CNKA 1EKBB 4KRFA 2I54A 2OBBA 1BD4A 2GEUA 2WV5A 4GBMA 3JATA 3KTAA 2GJSA 2HC9A 3ONWA 1UFKA 2VEDA 3QKIA 1GA4A 1V8BA 1GCDA 3FDJA 4JHXA 4LRYA 3ZBTA 1GEEA 1QG6A 5E7JA 4C20A 3IE2A 4C14A 3NEYA 5KJFA 3WWBA 4TRRA 4YCLA 1XA0A 1XO1A 1P5HA 4EW1A 4ENSA 1XUKA 1O8CA 3EYAA 2D2EA 2P4SA 4HQLA 2UWLA 2FR1A 3LDAA 2GM4A 4XGNA 1Z4OA 1C9DB 3E22A 4LPSA 2A9KA 2ZGJA 1UPUA 3SQLA 5JD3A 4TTAA 5JO9A 4A8JC 1TUBB 3AEQB 4MYDA 5KAPA 1CQIA 4XDGA 1U0HC 1V5WA 3EGOA 1RAIA 3QH4A 1KOFA 5I9TA 4THNH 1JA1A 1T3TA 4I33A 3K96A 3IUNA 4Y2GA 4E22A 3LQQA 3SZMA 4BTEA 5CLIA 3JPYA 1SB8A 1R6TA 4XPIA 4XI9A 1DTWB 1T0HB 3DEKA 4QG7A 4ZC1A 3K0AA 4X65B 3F3YA 3OCUA 4ZYZA 5EN4A 2A9RA 1MC4A 1E3WB 1ZD9A 4D7GA 2B9VA 1Q21A 2O05A 3G9UA 3L05A 3NM5A 1G4AE 3HN7A 2AI3A 3ZYDA 5AHXA 5F9MA 4CE6A 3RXTA 1YMQA 4DXAA 1B16A 4MDSA 4KK4A 4NOJA 5IM4F 5JFTA 2Z2ZA 5EQTA 1IOWA 4DCMA 4YOGA 3K6YA 4C0KA 3KS9A 2IEBA 4INJA 3K1AB 1E89A 3KBOA 3BEIB 4YOIA 3D4LA 4NE7A 5MGBA 1OB5A 1NTOA 3WO0A 2GP9B 1QOPB 4IUYA 4ER0A 1AHPA 2R2WU 2FXIA 1TCVA 3K4QA 1KDRA 1SQ5A 3SIXA 1ZNQO 4HF7A 5ARBA 3GH3A 4KQIA 2HWXA 4AB8A 1FZZA 1S8FA 1UT8A 2B78A 1UMCB 2GH1A 3TJZA 4LDAA 1DBRA 3MU8A 4HGZA 1P62B 2W2TA 4ZOLF 2YWEA 3VHQA 4AP5A 4RTQA 2NWNA 1SQFA 1ENYA 4L57A 3ZCTA 5FAKA 2PA3A 1KYXA 1X94A 1GJ6A 1G55A 4HY3A 1DWDH 3PLKA 4RIEA 2Q5OA 1JOUB 4XFQA 4YRIA 4LOJA 2BD0A 4HZHA 1X19A 2XI4A 5A4DA 3GYLB 4X63A 5JCJD 5ER9A 2OCBA 2A5KA 1AUXA 2QM0A 4NFEA 1JLHA 2D2IA 5JH7F 3RXLA 3HDQA 4HG2A 1RJ9A 3IV7A 3I2YX 4LHVA 3ZDBA 4W7SA 3NW9A 3ZTTA 2OUIA 2PZBA 1SMFE 1PCXA 2V7QA 3K1ZA 1KLIH 1QAQA 5FA5A 4BASA 2X22A 4DNQA 2VC2B 4NPAA 3GP3A 1HAHH 4X84A 1SPJA 1D7OA 1QH0A 3WFIA 4B2PA 5LU9A 4PGGA 4TKVB 2VP4A 1C3LA 3HUEA 3D8SA 3M2TA 3LHFA 5FNZA 4CL8A 1QH1A 3GBPA 4NA9H 1FU8A 2G4VA 2A45B 3OLZA 4FEGA 1ZMRA 4WK2B 4ZQCB 3CUTA 1Q2UA 4BXWA 4H27A 5DXJA 5EJIA 1ONNA 4AT1A 2YMQA 3L3TA 2ZRLA 4HP8A 1PJZA 3PMJA 1XFDA 2EWWA 1RLMA 2Z3VA 3CS3A 1L5OA 1Q2XA 2A7QA 4E30A 1VZ2A 3JQAB 1Y1PA 3CGGA 5I8PA 1H0SA 3GLFA 4KXNA 4MOWA 4RSRA 1JIRA 4B6FA 1I7QB 2ARKA 1OW3B 4P4SA 1WB9A 3NUGA 3JZ1B 3IP5A 3RVBA 5L9AA 2I3BA 4D99A 1P4RA 4X64B 3EIEA 3ICWA 3O1LA 4ZHQF 1J5EB 4QPJC 1TUBA 5E4JA 4I8DA 4O4HF 1KJWA 1YRHA 4DARA 3W5BA 3PX2A 4Z9BA 4A7PA 4MR8B 5LPFA 1CG6A 1D1TA 1TF7A 3OA2A 4M0LA 3RRNA 2PH3A 4DABA 3RSLA 2HF9A 1FXYA 1X14A 1TYDE 2AN1A 3AINA 2PS0A 5EINA 2CK3A 2YUIA 1NFWA 4TSRA 1A5ZA 1W49A 2X14A 4FE3A 4WCDA 2VP5A 3DLTA 3ABRB 4DLUA 4IGAA 1ZZEA 1J1IA 1W6UA 4K6CA 5LA6B 2C4VA 4K60A 3EIOA 2OC1A 1JWBB 1OV6A 2E3JA 2YXPX 3FPEA 4TMFA 3ZZDA 1IN1A 2GSWA 1Z15A 3R3HA 1K08A 1ZI6A 3CEJA 3IV6A 3WDMA 1XL0A 2NT3A 1N2EA 2VIIA 3SU6A 1MR3F 2ZM5A 3E7FA 4U2DA 4HN9A 2ZFTA 3RC3A 5HFAA 3WLAA 4CIDA 1BMNH 4ZVPA 1KHTA 4ILKA 2WUEA 1KAHA 3D7LA 4EF6A 2SGFE 5FEMA 3NGLA 3JR7A 3TSYA 5DNAA 3NRJA 1HNWB 3R5FA 1G3UA 3QX8A 4IMIB 5AVSA 4C4AA 1B2LA 4J2YB 1TM4E 3WRYA 2V1UA 5LXTA 1OWMA 2D0OB 4D8YA 3PFFA 3TGPA 2GFIA 4H7HA 1SVNA 1FLNA 4FMPA 1R37A 4TKMA 1RVDA 4AO8A 2AWOA 2FHSA 1TEXA 4JWKA 2ZIXA 1PK8A 5BSRA 1EVJA 2JH5D 2D5CA 5JZVA 2BDHA 2NWQA 1A1VA 1JDVA 2YXNA 4CVNA 4G5QA 1OWDA 4I1UA 4CTJA 3DWFA 3R3VA 3IURA 2ZRKA 1NY6A 4DCJA 2FETA 3B6MA 2XWBI 5FHTA 1R0YA 2WNSA 3AOEA 3K9HA 4LRTB 3WISA 1A0LA 1KQGA 1O3MA 3NIBA 4JK6A 3O3MB 1YHNA 4RKEA 1BJVA 1C0LA 3EZ9A 3DOFA 1I1HA 1L6RA 1NATA 2QRUA 4B3IA 1GPKA 5L3SB 3D2BA 4N1AA 2PKAA 3SS8A 1DDIA 5PGMA 1S2GA 1SQAA 3LHKA 4PWYA 3I2KA 1OX1A 4JMPA 3LVFO 4F84A 3BFKA 4GQIA 4MV6A 2AXEA 3IBCA 4JBIA 1U1GA 1UL1X 4V02A 1E64A 2GLTA 2V7GA 1DPOA 1NKSA 3BTWE 1V8PA 2HPZA 3DW3X 3K5IA 3PHGA 1U4NA 5TEWA 4I1PA 4P34A 1EINA 1EP5A 1WM1A 1SCBA 4OXXA 2X2EA 3THRA 1FIUA 4F8YA 3HLTA 2BTCE 3A36A 3M0EA 3S8MA 4NCAA 2V4MA 3HSKA 3IR6A 2BGKA 5AM2A 3LUPA 2PTHA 4L0QA 1F3OA 5JARA 4FWBA 3VO9A 4OGFA 4QJBA 1B00A 3GCZA 5JPMH 5CA0F 1CF9A 3JQ7A 1UDXA 2ZCHP 1QV6A 2YQ4A 3FFTA 3HXMA 2M6SA 1QGFA 4B4UA 2WUGA 1U8EA 2F8MA 4CBOA 2AZ4A 1N92A 4CT5A 2GZRA 2HJHA 2WICA 4JQSA 3FF1A 4TLEA 3MJDA 1M34A 1M2VB 2WJ4A 2O9QA 4WLUA 4EJ2A 3ZVLA 5EEGA 1VCHA 4IEIA 5KJ1A 3PGXA 3TSCA 4EM6A 4CM1A 1U2PA 4FEYA 2XB4A 5BVGA 3K0FA 4GYKA 1R6UA 3RYIA 2Y81A 4WXRA 4ICIA 1TVMA 2PH5A 4OKNA 4PG7A 2F9OA 1UPFA 3RRJA 1LTQA 3PYMA 1CUYA 3T3GA 4B9EA 5AKEA 3O9ZA 4UE6A 3F9IA 4KQGA 2NACA 3PQ2A 2JFFA 3DLPX 5KCMA 3G8BA 4Z9XA 5KYGA 4KXUA 3IQXA 3R2JA 2OQ2A 3DV0A 3X44A 2BMFA 4MAFA 5K01A 2CHGA 1SXHA 5IXJA 2HA0A 1Q0ZA 4PYRA 4GSOA 2W37A 1C2EA 2FDAA 3B6EA 4PYJA 1BIOA 3UAIC 4Y2QA 2CSXA 5B1DA 4K1XA 1GJ4H 3HABA 4KXFB 3ZQ6A 1L7AA 3IALA 1CRPA 2OB1A 3DBLA 3EXEB 4BEWA 4RDXA 3AUTA 4CIVA 3L02A 1WSWA 1V43A 2DHCA 3OI7A 4BNHA 4DDTA 4EI7A 3V7UA 3LLSA 4A8JB 1CEYA 1HKHA 4AFQA 1RI1A 4N5IX 4OHPA 3SI7A 1Q31A 2BZ1A 3P9ZA 4YXWD 3IVGA 2H29A 4UTOA 1E1CA 5FNVA 3GXBA 3N75A 3H3JA 1HMPA 1NESE 1OD6A 3PLRA 4ZEXA 4ALIA 4BMDA 2DAPA 4RNCA 4J0FA 1R0LA 3D4OA 2NU3E 1VHTA 1WXWA 1FDRA 3FHTA 1LJUA 2QTFA 4WVFA 3WGOA 5BQOA 3BN9A 2EF1A 4J1TC 5CDTA 5JUWA 4CCYB 1CEEA 5D51S 1KFEB 3ECSA 4KQFA 4GVUA 1GNSA 1QYWA 1WMDA 2BIFA 2XNKA 3L7NA 4Y9DA 1BW9A 5HOEA 3LF2A 2HDWA 4HGQA 2O8VA 2QCYA 3K0AB 2QL9A 3AM5A 2OD3B 4UE3S 5JFGA 4PAOA 1F0SA 1U5CA 2CKMA 5KECA 3GNTA 3IT0A 2IIPA 3MBOA 3R6LA 2ZJ8A 4JT2A 4MV9A 3SMVA 2Y1CA 4OM9A 1SEPA 4XYBA 4Q39A 3A7XA 1AKTA 2ZFFH 2EBWA 1YR1A 2ISSD 2VCYA 2Z4RA 3C3WA 3M34A 3OJCA 4G1VA 1NGSA 4I7EA 4MI9A 1XMNB 4REMA 5DM0A 5EG4A 2N42A 1S3IA 2JKYA 3RRBA 5BT9A 1U63A 3FOAA 2AX3A 4LHZA 1UFRA 4MQ5A 3ZVKA 3CZAA 3GAMA 5DSXA 1Z12A 3G0GA 4JS0A 4RJKA 2QRQA 4LW8A 1ZHRA 2V8BA 4JQCA 1O3HA 2WPLS 4NQRA 1SEVA 2V35A 3LX4A 4RFSB 2QZ9A 3RLYH 4RSHA 5ES3A 4JYZA 3GNQA 1M5TA 3KQEA 1MB2A 2E4WA 3L0DA 1CZKA 1I0LA 1DQZA 3G0OA 2I2BA 4LQLA 2X2OA 3AI1A 4FKZA 4HUQB 5DM60 4HDQB 4EY6A 2OCKA 2HD4A 2CNOA 3GDOA 4QD3A 4EH1A 3MWJA 1MUUA 2WHPA 2B92A 1M66A 5A6VA 1II0A 3CWZA 2ZR8A 3IP1A 3L7BA 3Q1KA 4O4LB 1X15A 4Q3DA 1GGNA 4WLFA 1OLXB 4W5WA 1GGJA 3FAZA 2I0FA 4UOEA 4YUYA 3EPHA 2LCFA 1GBCA 5JAHA 2VJBA 4ZCLA 4CF3A 2R5WA 3F5MA 3C6QA 2GT8A 5FBEA 2AK2A 2FPMA 1LEHA 1YS7A 3EQ7A 1V7CA 4GKBA 2B6HA 4N3BA 5ICMA 2H9HA 4OG2A 1IQEA 5GQSA 4BDSA 5I7OA 2ZB8A 3ESZA 3FCCA 1QGAA 4JX9A 3E4CA 3FRJA 1IQKA 1ZM7A 2GXQA 4GF5A 1S5PA 2REQB 4DLWA 4XEUA 2XWJI 1JQDA 3BJMA 2LKDA 3CH5A 3T5CA 2ID8A 4YCMA 4QUEA 3BYZA 4UDYX 3WK7A 1KMHA 2WYIA 3K2UA 3N6VA 4OCZA 4PNZA 4NP6A 4K81B 3W95A 1V4VA 1LD3A 2WPHS 2IYPA 1ID5H 2YVUA 1X1TA 3OWHA 3QNMA 2KAIA 2C7VA 2QLNA 4ACBA 1RAFA 3G2IA 1NF9A 4X1YA 2HRDA 4RQTA 1K1NA 2QRKA 3V13A 3BCHA 2CUTA 1A46H 1II9A 3L8FA 2XYVA 2DUWA 3F8WA 5JBCS 2WJYA 2AEEA 1CJBA 2R00A 2WKRA 3EC7A 4FE7A 2F9NA 3P0HA 4IZ6A 3EPKA 3K7EA 2RHMA 1SBZA 2DPGA 2Z2YA 4F8EA 3AVXA 3CCCA 1ZISA 3H5AA 5DGIA 2PKEA 5I7AA 1SXJB 4Y7CA 1DIAA 2R96A 1SELA 2PANA 3B1FA 3FKQA 2NUTA 1DXPA 4KHZA 4X8LA 3RQIA 4UAJA 5LZ8A 2WWHA 4FILA 5ARCA 1ZCAA 4QLBA 3MH7A 1Z8DA 3HFGA 3T5MA 1EG2A 1DSSG 2WM9B 1DQPA 1FTNA 1XN4A 2IU3A 1C9KA 3AR2A 4UQPA 1OFIA 5KNDA 3F8TA 3R1IA 2X0IA 3U4QA 1CQJA 2EF0A 2ZYHA 5ALDA 5CP8A 2Q6GA 2D1RA 3RMLH 2W83A 4JVLA 3I6BA 5JW6A 2D0DA 2PKXA 2QGZA 2ZAYA 1HAZB 3C41J 3MT9A 4JJ7A 1GBBA 5F5NA 4KSBA 5C80A 1GHTA 1UPTA 5B57C 4DUZB 3ZGNA 2P16A 1B8OA 2OM6A 2PSXA 2F2TA 3DT6A