1FY8E

Crystal structure of the deltaile16val17 rat anionic trypsinogen-bpti complex
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
215
Chain Sequence
DKGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN II, ANIONIC
publication title The energetic cost of induced fit catalysis: Crystal structures of trypsinogen mutants with enhanced activity and inhibitor affinity.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Hydrolase/hydrolase inhibitor
total genus 54
structure length 215
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2000-09-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy8E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fy8E02
4YESB 3QLPH 1W13U 1S0QA 3QZRA 1DWDH 2ANKH 3T25A 2TGAA 4E7RG 4GAWA 2Z9KA 1J16A 1VCPA 3GY4A 3P92A 1CHGA 1TGBA 2BLQA 4LOYH 1P03A 2AMQA 1UVTH 2BZ6H 3R0FA 3GYLB 3PO1C 2ZU5A 2XCFA 3IITA 1Y3WA 4MNYA 1IOEA 1GJ9B 4Q7ZA 1SGDE 1SGQE 1TWXB 2G00A 1GMDF 1O3BA 1YPHC 1GJAB 5TCCA 1AI8H 2H9HA 1EUFA 2DUCA 3RM2H 2CHAC 3ZZAA 1ANBA 2Y81A 9LPRA 1P9UA 4A7IB 5EODA 5C2ZA 2ZDAH 1KTTB 1AVGH 1XUHA 1NC6A 2FOCA 1SVPA 8ESTE 2P95A 1HAOH 4X2WA 1EJAA 1LCYA 1P10A 2ZGXH 3KF2A 1Y3XA 3M3SA 4OGXA 3MNXA 1NRPH 1Z71A 4D9QA 4ABGA 3F1SB 3TH2H 2PGQB 4FU9A 4FVDA 2W26A 1VCQA 1OWKA 3E6PH 2FI5E 6ESTA 1WV7H 1GI2A 1G9IE 2BY6X 4AFZA 2ZFTA 3A7YA 3D62A 1DM4B 2VIWA 4FU7A 2GV6A 1SHYA 3MOCA 1D3DB 2EEKA 1QJ7B 1SGYE 2XBXA 3VXEH 5F8XA 1DSUA 1TGCA 2CMYA 2GKVE 5FX5A 4ZXYH 3M5MA 2A5IA 4Z0KA 2FOBA 1GI8B 3PTNA 1DY8A 3ITIA 1TB6H 1B0FA 4B2CA 5L2ZH 1CU1A 2O8LA 1D6WA 2A2XH 2P8OC 4WMEA 3BTWE 1GHBF 3UR6A 3RXQA 3LGVA 3KL6A 5AF9H 1FJSA 1K1JA 2OD3B 3C27B 1G2LA 1GBFA 1BTHH 1O3NA 1GHWH 2WPKS 5DKMA 1YPGH 4AB9A 3GCNA 4YOJA 1DXPA 4J2YB 2VIQA 1WU1A 2PFEA 1DY9A 1C1VH 2ZDKA 4IMZA 4ZKNU 4KTSA 4MPWA 3ZZ5A 1TBZH 3FFGA 2G5VA 3OX7U 1E38B 2B0FA 3BG4C 3MNSA 3LIWA 1MH0A 1OKXA 3B8JA 1HCGA 4CH8B 3MTYA 1WQSA 3ODDA 1RTFB 1T8MA 2SGFE 1BHXB 1V2TT 1GHZA 3RXUA 3EA7A 5EXLA 8GCHF 3RXCA 4FXGH 2XBVA 4ISNA 3MU4A 1N8OC 2A32A 4NIWA 1W3CA 1Z8RA 4TYDA 1H9IE 1GBEA 5FAHA 3ATWA 2BDAA 2TBSA 1S81A 4KKDA 4WJG2 4DJZB 1ZTLA 1CT0E 1AMHA 3UWJH 1CVWH 3ATMA 1GJ8B 2C93B 1P8VC 3ZZ8A 2R2MB 1W7XH 2WPJS 4X1QU 1OWDA 1BT7A 2FOEA 1ETSH 1PPCE 3W95A 4NZQA 2VB0A 1A0JA 3ATLA 5DO4H 1O30A 3SJKA 2FS8A 3KN2A 4U32A 1TRMA 1HNEE 3TJUA 1INCA 7KMEH 5E0JA 1S84A 1O2MA 2FI4E 3GDSA 2IOTA 4BAOB 1GBAA 2BD7A 1Y59T 3MO3A 2BM2A 3EYDA 5JPMH 4U01A 3GISB 1WAYB 1C2MA 2BMGB 4HGCA 1O5GH 1GBKA 2FIRH 1NRNH 2CV3A 1WYKA 2FLBH 2ZFSA 2BQ6B 3ZYEA 1EPTB 1F0RA 2HOBA 1TGTA 1J14A 1TA2A 2OQUA 2CF8H 1V2QT 1ZGVA 5EPNA 4AG1A 1DFPA 1PQ5A 1Z8GA 2A7HA 2BB4A 1NT1A 1O5FH 2BLWA 2ZO3H 3HPTB 2PWXA 1UCYK 2BDYA 2EI7A 1SLUB 1A7SA 1SG8B 1W14U 4H6SB 1BRAA 4JYTA 1E36B 4WH8A 1LHDH 3ZZ9A 1BQYA 2R2WU 1PJPA 1L1GA 2VNTA 5T3HA 3SV6A 1P57B 2NU1E 3FP6E 5T6DA 5TJXA 3P8GA 3ZZ4A 3BN9A 2FDAA 1QL9A 1AUTC 4RSPA 1FY4A 3SUGA 8KME2 5AHGH 1PQ8A 2QF0A 3MU0A 1P9SA 3GICB 4KELA 2ZU2A 2VU8E 4I8HA 2Y5FA 3PO1B 2BD3A 2ZHWH 1LTOA 1EPTA 3TVJB 2B8OH 3EAJA 1AUJA 1SC8U 1WOFA 1QL8A 3FZDA 1MQ6A 2CHAB 3U8OH 1GVLA 2PKSC 2UWOA 3GY2A 1G36A 1KLIH 4NIVA 1DANH 1QB6A 3MH7A 1EZSC 1FY5A 1K1LA 1GCDA 2G8TA 4UFGH 4D8NA 1Z8JB 4HZHA 1SGNE 3ESTA 1GVZA 1P2NA 3BV9B 4MNVA 1E34B 2FLRH 5G4BA 1ACBE 3SQEE 3LDXH 1E35B 3SU2A 1QRZA 1N6YA 2O9QA 4J1YA 1CA8B 1GGDC 2ZZUH 4JYUH 5GDSH 2FMJA 2SGEE 3QTVH 4SGAE 5FX6A 4AB8A 6CHAC 4I8GA 4I8JA 1V2JT 3T2NA 3BEIB 3SQHE 3QTOH 4GPGA 1C2EA 1XUJA 2KAIA 4I31A 2EI6A 1TONA 1CGHA 1DDJA 2W7SA 2F9VA 2EC9H 7GCHF 3BTKE 4ISLA 1C9PA 3PMJA 1UMAH 2HLCA 2VIOA 1L4ZA 4TPYA 4QT8C 1TE0A 4MNXA 4NCYA 2Y80A 1KLJH 1Y5AT 1ESAA 1GDUA 2JH5D 1OP0A 1GHBG 3UNQA 1H9HE 5FPSA 1LPKB 4UD9H 1FY8E 1GCTC 1A2CH 5JB8S 1ZRKA 3DFLA 2P8OB 4UFEH 3U69H 1HAYB 3QO6A 3RC6A 1O0DH 1D3PB 1HBTH 1O3HA 2PTNA 2Q6GA 1ABIH 2K1QA 4LZ1H 1LO6A 4Y10E 1SGTA 3SZNA 1C1QA 5A0AE 1TOCB 2BOKA 4X6NA 2HPPH 2QYIA 2ZCLP 5EW2H 3VB4A 2BLOA 1WBGB 1SOZA 1B0EA 3T5FH 1UVUH 1SLXB 3QDZB 4UFFH 2OC1A 1DUEA 1FDPA 1IHTH 3SJ9A 1TMBH 3RC5A 1LMWB 5I46H 2AYWA 2GTBA 2P3TB 3K65B 3LGWA 3EQ0H 1AD8H 2ZG0H 2WV5A 2GV7A 3PLPA 3SJOA 2BY5X 1DITH 1HGTH 1FQ3A 1YPLH 3BSQA 4CHAC 1ZJDA 3A85A 1F7ZA 3CENA 4K3JA 4XFQA 1BMAA 4B74A 2BDGA 3SHCH 1CQQA 1HV7A 1GI1A 2FPZA 3F9GA 1CBWC 3KGPA 7ESTE 2V35A 2BVRH 4AFQA 3TH4H 5ETXA 4AX9H 5PTPA 1ELFA 4K1EA 1D3QB 1C1NA 3SV7A 4F4OC 3ZZDA 3A7VA 1W11U 4OS2A 1TX6A 3LC5A 2OQ5A 4CRBA 1L1NA 1XMNB 1GBMA 2I6SA 2XBWA 2FO9A 3VPKA 1ZTKA 4ABHA 3SUFA 3DD2H 4X2XA 1A1RA 4JK5A 1IQGA 3RXVA 2BY9X 1GJ7B 5LH8A 4ISIH 9ESTA 3PLBA 1BRUP 1OX1A 1P06A 1T8OA 1A0HB 3OSYA 3LGIA 3SU3A 3BTFE 1FY1A 2BD5A 1ZMJA 2GCHG 2H5DA 2BXTH 2V6NA 3RXIA 1TPSA 3A89A 5FBIA 3URCA 4E7NA 1TPOA 4PROA 4DIIH 1IQEA 3H7OA 3NXPA 1D6RA 5DGJA 4KTUA 1P04A 3BTQE 2VJ1A 2FTMA 1GJDB 4FUBA 4MG3A 1FV9A 3U1JB 8LPRA 1K1PA 4INHA 1IQFA 1GI6A 1DXWA 1UHBB 4GSOA 1BTYA 3VGCB 2ZGJA 2ZHDA 3A8CA 1BJVA 1SHHB 5ESBA 3KIDU 1WCZA 3AASA 4BXSA 2QXHA 2FXRA 2GMTC 1TAWA 1QFKH 1HRTH 5LPRA 3SI4H 2WPLS 1NZQH 1GPZA 2C3SA 3E0NB 4GUXA 4AOQA 1GJ4H 2UUJB 4AYYB 1EZXC 3E91A 1SGEE 4A5TS 1K28D 4DIHH 3MFJA 4DG4A 2ZFPH 4X6PA 3T62A 3HATH 1P3CA 2ZU4A 4VGCC 5A8ZA 1THPB 4YT7H 3BIVH 1GBCA 1GDQA 5DPAA 3ZZ7A 3TK5A 3R3GB 1E0FD 3FVFB 5F8TA 2R0LA 2TGPZ 3E1XB 4ZROA 2XCNA 1TNLA 3CS0A 3F9FA 4Y0ZE 1CGJE 3TNSA 1A0LA 4U2WA 1AKSB 1DOJA 1O35A 2F9NA 4MPVA 5I25A 4CBNA 4LK4A 2IN2A 5DP6A 3ZV8A 1Z6JH 1QBNA 2A1DB 2AMDA 1BOQA 4Q80A 5DP7A 1PPZA 1MTNC 1SQOA 2ZGBH 4AYVB 3MWIU 1OXGA 4ABDA 1YPMH 4A1VA 2BD4A 1ELGA 1NFYA 2OINA 2UUKB 3GCOA 1O5DH 2SGAA 1YP9A 5BPEA 4CH2B 1NESE 2BYAX 1GGDB 1MKWK 3MNBA 4FUFA 1MQ5A 6CHAB 2HRVA 1GBDA 3LH3A 3Q3XA 1O3EA 3A8DA 1GHXH 1VITF 3SGBE 4WF8A 4DT7B 4R8TB 3TH3H 3O8BA 1P2JA 3PB1E 3D49H 1AFQC 4NSYA 4Q7YA 5E2OA 1QY6A 1TFXA 2OC0A 1SGFG 5CHAB 3UR9A 2ALPA 1MD8A 4GCHG 3UPEA 2PHBA 2ZHEH 4CBOA 1OWIA 1PPBH 2XWBI 2IJOB 5LGOA 3P8FA 1QRWA 2ZCKP 2GDDA 1EJNA 3K2UA 1AKSA 1C1UH 3BTME 5JBTA 3GCTG 4A92A 2SGDE 4X1PU 2UUFB 2PW8H 1NY22 2ZC9H 4BTTB 1AVXA 2RA3A 4OS7A 2Z9LA 1MCVA 3GY8A 3ZZ3A 4RKJB 2O8MA 2PUQH 1A5IA 1A61H 3PROA 2DE8A 3AW1A 1AHTH 1MKXH 1SGRE 1NU9A 3ATKA 1O2WA 3MI4A 4R0IA 3SUDA 1JXPA 3VFEA 3ZVGA 1O2GH 3EA8A 2C4FH 7LPRA 1BMNH 1H1BA 1THSH 1O2UA 1ZJKA 4O3UA 1T4UH 1ZR0A 3SU0A 5A0CA 1NN6A 4IMQA 4IN1A 3GY7A 2D2DA 4FU8A 2A2QH 2W5EA 2WUCA 3MH4A 3ZZ6A 2BZAA 5JBAS 3N7OA 1ORFA 2NU3E 1O2KA 4TPIZ 1GJBB 1NM6A 5F8ZA 4FUDA 5JBBS 4IC6A 1HAVB 3VB6A 1EXFA 1WQVH 4YLQH 1C5UA 2F9BH 2GGVB 2ODYB 3KEEA 2W3IA 3U1IB 1EX3A 1SGFA 2FODA 1V2PT 3RMOH 1YCPK 3RXJA 5JDUB 5SGAE 4BAKB 2RDLA 3RXRA 4GLYA 3SN8A 3RUOA 1TPPA 1QA7A 1SI5H 2DE9A 2GP9B 1BRCE 3DUXH 3V12A 4CR5A 1EZQA 2ODQA 4YOGA 2V3HH 3QN7A 4KTCA 4CHAB 1JMOH 3DA9B 1FUJA 1TGNA 1TGSZ 2XC0A 5CMXH 2ZKSA 1LKAA 2BX3A 1BBRH 4ESTE 3RMLH 1CBWB 5EQSA 1S6HA 2BY7X 4AGJA 1K9OE 5ABWA 3L6PA 3RU4E 1YPJH 2H5CA 3RXHA 2AH4X 3EE0B 5GXPA 1VITH 2AMPA 3RM0H 2BVSH 2HNTC 1O3LA 1B5GH 2VVCA 1AZ8A 3TJOA 1GI4A 2BDHA 4XBDA 2ZDLA 1ETTH 1MAYA 1FPHH 2PTCE 3WY8A 3L33A 1HAVA 2JETC 2VIVA 3SU4A 4YTAA 5LPEA 3UOPA 3KQCA 1LVMA 2HNTF 3UNSA 1KXCA 3H5CB 1QURH 3SU6A 6LPRA 1C2FA 1FIWA 2QXJA 3S69A 1ELVA 2B7DH 2ZQ2A 5DG6A 1P12E 1KIGH 4INLA 4IW4E 4Y7AA 3ZVEA 2YNBA 3CP7A 2QV1A 3M61U 4K69A 1ABJH 1PYTC 4MDSA 2AFQB 4BTIB 1V2MT 2VWMA 1TQ7B 3T27A 1FIZA 2I6QA 4JZ1A 1C2IA 2PUXB 3NUMA 1IQMA 1OWJA 1C5NH 2GCTC 5FXLA 4B76A 4XDEA 1FAXA 2HGTH 2BX4A 1HIAB 2F91A 5DP8A 4TWWA 4CRFA 1HUTH 4OS6A 3HGPA 1FY3A 1O36A 3HK3B 3A8AA 3TGIE 1SQAA 4DGJA 4ZHLU 1A46H 2TIOA 1LDTT 3FP7E 4XBCA 1LHFH 2P16A 4DVAU 1XKAC 1GBTA 1GI3A 1C5SA 5EOKA 1TMTH 4ZH8A 3GY3A 4AN7A 5C3NA 1RFNA 3GYMA 2JH6D 1TX7A 2THFB 3SO3A 3RMMH 2SGPE 4VGCB 2NU2E 2SNWA 1V2RT 4X8VH 1MKXK 1HJ9A 3K9XB 2AGEX 2HALA 1HAHH 1IHSH 1L4DA 1C2HA 1SR5C 3LU9B 3CS7A 4NFFA 4A1TA 2BQ7B 1YYY1 5AVDA 3A82A 1F0TA 1SGCA 2G81E 3UTUH 3OYPA 1MTUA 1V2NT 1HIAA 2STAE 4DY7B 1DX5M 2OBQA 2GCHF 2UUYA 3NWUA 5EGMA 6GCHF 2GZ8A 4Q2KA 4INKA 3Q77A 1TNKA 2A5AA 1Y5BT 4JCNA 2LNCA 4CRAA 1S5SA 1AVWA 1UVOA 1SFQB 3QX5H 3O8RA 2WUBA 1NO9H 3PWBA 1C5RA 4K8YA 1ID5H 1NFXA 2HPQH 5EQQA 1HAIH 2SFAA 4GVUA 1MTNB 3TK9A 3MNCA 3S7HB 1ESTA 3M5OA 1VITG 3RXPA 4JZFH 3A7ZA 3SV8A 1MUEB 2VGCC 1DUAA 3M5LA 1C2KA 2ZU1A 1LVBA 3SORA 3GDVA 1CSOE 1VGCC 2YOLA 1BBRK 1QNJA 1T8NA 3M7UA 3P6ZB 1UTNA 2A4RA 3PMHB 3RXLA 1OSSA 4TY6A 1AFQB 1GJ5H 1Q31A 3EA9A 1NFUA 2KAIB 3MU5A 1Z6EA 1O32A 1MZAA 1GMHG 3OY5U 1LVOA 4OS5A 5FCRA 1AWHB 5E2PA 4XE4A 3V0XA 3V7TA 4Z6AH 3O8CA 3ELAH 3KHVA 1OOKB 3LOXA 4BANB 2ZHFH 2BTCE 1O39A 5JBCS 2GZ7A 3O8DA 1XVMA 3RP2A 3A86A 2FOMB 1ZOMA 1AFEH 3KCGH 4MNWA 1SSXA 1G3CA 2WPMS 2BD2A 2A7CA 2VWOA 4B1TA 2ALVA 3RXFA 1C1RA 4Y8XA 1GG6C 3JZ1B 2XC4A 2D8WA 1DWEH 1ZMNA 2AS9A 3I77A 3KNXA 1O34A 5A09A 1UK2A 1H9LB 3RXDA 3U8RH 2QAAA 4JMYA 5E0HA 4ZKRU 1HAPH 4O97A 1O2RA 2ZIQH 5T6FA 1NS3A 1F0UA 3ENSB 2Z3CA 5K0HA 3V3MA 2Z7FE 1QCPA 4JZIA 1MU6B 1P11E 5JB9S 1O2JA 2FM2A 1O2TA 2O8WA 1ARBA 1AGJA 1ZTJA 1C1PA 1C5OH 4Q7XA 4YZUA 4TWYA 3SHAH 1PYTD 2XXLA 3SNDA 1PQAA 1DICA 1O2ZA 1G2MA 4B71A 3D65E 3P95A 3VB3A 2XC5A 4GCHF 3A7XA 1KDQB 3GY5A 3S0NA 3AAVA 1DT2A 2ULLA 5J4QA 5A2MH 1LQEA 2PR3A 1L1JA 3GCTF 1QL7A 1MD7A 1P2IA 1EP6A 1W7GH 2C8XB 1O2VA 3UUZA 5IDKA 1SGIB 1JWTA 2G51A 5C67A 2D1JA 2BDCA 1ELAA 1XXFA 1AE8H 1O3IA 4NFEA 2ILNA 2J9NA 2JETB 5T6GA 3EDXB 4NGAH 3RMNH 4DCDA 3QWCH 4MVNA 3FZZA 4D7FA 1FI8A 4IN2A 3PM3A 4NSVA 2QXIA 3M7TA 1K1IA 4BTUB 1RXPA 1SOTA 3FAOA 3S9CA 3I78A 1O3DA 1O5BB 3QUMP 2Y5HA 1RS0A 1AB9C 3RU4D 2ANYA 3ZVBA 1TLDA 5GJ4B 1C1SA 3BG4B 3BTGE 2XNIA 1RTKA 3GCHC 2QGRA 2GZ9A 5AFZH 1N1LA 2F3CE 2RG3A 1T32A 1TNJA 2PSXA 1Y5UT 4X0WU 5J4SA 4IC5A 4GHQA 1KDQA 3HK6B 2GCTB 3NPSA 4O3TA 1SGPE 1NTPA 3STJA 1CE5A 1EAWA 3P8OA 1N8OB 2TPIZ 1GBLA 4AGKA 4D76A 1ZHMA 4HTCH 2AEIH 2F9PA 2WPHS 4I32A 2A0QB 3MU8A 2FYRA 1VR1H 1W2KH 1UTMA 2FOAA 3E8LA 1JIRA 5HXFA 1IQNA 1DWBH 1C1TA 1UTLM 4X6MA 1GI5A 3E3TA 1MTWA 4AZ2B 4X1RU 1J9CH 1P2QA 3NZIA 1DE7H 1HJAC 5EXMA 2O8UA 1OS8A 1Z7KA 4TY7A 4WMDA 1TQ0B 1GJCB 1IQKA 1BBRE 1OWHA 2Z3EA 3SJ8A 4BOHA 6GCHG 3OY6U 1QB1A 1QJ1B 1ZLRA 3LT3A 1WTHD 2UWPA 3P17H 2P3UB 2HWLB 3NKKA 1C1MA 4JK6A 1ZSKA 1TMUH 1FN8A 2A7JA 3RLYH 3U9AH 2Y7XA 2ZU3A 1MMJN 3L3TA 5EXNA 1TNGA 2TGDA 3K6YA 2CGAA 4E06H 2XWAA 2JKHA 1ZHRA 5AFYH 1GWAA 2P94A 4I8LA 3M7QA 2FI3E 4RKOB 1XVOA 3TPIZ 4OGYA 1O3KA 3SW2B 3UOUA 5C20A 1L2EA 3NK8A 2ZDMA 1AE5A 1C5QA 4NA7A 4MPXA 2PLXA 3RXTA 1GBIA 1NRSH 1C4V2 5GWZA 4BXWA 1O2YA 2A4OA 2XW9A 2ZCHP 2ZFFH 3T29A 3QGNB 1B7XB 2VGCB 4WXIA 4THNH 4IGDA 1E37B 4OS1A 1V2UT 3F9HA 3ZZBA 1KXBA 3RDZA 2Q1JA 2ZNKH 5DJ7A 1G37A 5LPFA 1YF4A 2C8ZB 3RXEA 3ATIA 3P8NA 3PMBB 3M3TA 4U30A 3KQBA 3BTTE 1O3JA 1LHEH 1SFIA 4CR9A 1N6XA 1Q3XA 1YPEH 1GHAG 1O3CA 3SNBA 2H9TH 1O5CB 4K1SA 1TA6A 1XUKA 3KQEA 3RU4T 4Y79A 1QQ4A 1BMLA 2O8TA 4F49A 1BDAA 1V2LT 3Q3YA 1KY9A 1Y8TA 2GDEH 1QRXA 1RTLA 4NIXA 3KQDA 2XBYA 1S83A 2G5NA 2ZDNA 2PKSB 4H4FA 4DURA 2FX6A 2OCVB 3TJNA 4AFSA 3BTHE 1TNIA 1BA8B 4ABEA 3DT0H 3VEQB 1QTFA 2V0BA 1HYLA 1OWEA 2G4UA 1W0ZU 5FCKA 1QGFA 1T8LA 4X8TH 1C5PA 1TOMH 3PLKA 5EPYA 1BTUA 1BITA 2ZDVH 2VVVA 4YM9A 2VH6A 3FANA 2BOHB 1BB0B 4Y11E 1UK4A 2P3FH 2BXUH 1SPJA 4KP0A 1QJ6B 4I7YH 4D9RA 4HFPB 1GBJA 5DP4A 2ZHQH 2P59A 4MTBA 3Q00A 4X1NU 2CJIA 3A80A 5HGGA 5DP9A 1O3OA 2G4TA 4E05H 5DK1A 1DPOA 2ZTXA 1C5MD 1P01A 2QA9E 4K8BA 3LC3A 4ZHAA 5EW1H 1PQ7A 2ZTYA 2R3UA 1EZUC 1YC0A 1MBQA 1T4VH 2HNTE 2Z3DA 2R9PA 4CRDA 3RXOA 1XUGA 2ZA5A 4CREA 2AIPA 1S6FA 3TLOA 1C5TA 1KTSB 2Q6DA 1O3FA 3GY6A 1XM1A 2CN0H 2M5TA 4D7GA 1XKBC 4NWKA 3URDA 1ELTA 1PPHE 1C4U2 1GMHF 1TYNA 2G52A 1GCTB 3M3VA 3E90B 2R0KA 1ZMLA 4WWYA 1NFWA 4Y8YA 1DLEA 5H4IB 1EKBB 1G3BA 1UTOA 4MQAA 1ELDE 1AIXH 1C2DA 3M5NA 3ZYDA 1TIOA 1DSTA 1RRKA 1HB0B 5ESTE 2C90B 4NA8A 3LPRA 1Z1JA 4UDWH 2F9UA 1SQTA 1Y3VA 3W94A 3SV9A 3EGKH 1GL1A 1O5AB 4XOJA 3LKWA 4LXBH 5A8XA 1CT2E 3LONA 2P93A 1A5GH 4Y7BA 1AB9B 2WV4A 1O38A 2GVFA 1O2NA 3B23B 2FOGA 3GCHB 3PV4A 2J34A 2Z9IA 1VJ9U 4YT6H 3LJJA 1YM0A 1NU7B 2OTVA 4WVPE 1V2OT 3F9EA 5A0BA 1P05A 1QIXB 3LJOA 5FHTA 1BZXE 2TGTA 1YLCA 1F2SE 1ZPCA 3A81A 1JOUB 2OUAA 1BRBE 2ZEBA 4X1SU 3SGQE 1AY6H 3RLWH 1BTXA 1EAIA 2PSYA 2FTLE 1UCYH 1LQDB 2VIPA 3T26A 2ZWLH 5C1YA 1ANCA 3MMGA 4WY3A 2Z6BD 2EI8A 2ESTE 2AIQA 1OYTH 1C2GA 3K6ZA 1C2LA 2BQWB 2J38A 2YNAA 3SNCA 4B73A 1P0SH 1EP5A 4A6LA 1GHVH 1PPFE 5HMAA 3RXBA 5C5NA 2VVUA 3A84A 4ABJA 1P2KA 2VWLA 1HJAB 3FP8E 4FVBA 1ZPBA 2QY0B 5F03A 1JIMA 1BMMH 3RXAA 1WUNH 1OP8A 5BRRE 2D26C 1XXDA 2FZZA 1T7CA 1WSSH 3LH1A 5A8YA 1IQJA 3MH5A 2ZI2H 1AWFH 1ZSJA 3I29A 2BHGA 1WTGH 2ZECA 4FUGA 3BF6H 3SBKA 2A4QA 3E16B 1ZHPA 2AERH 1EOJA 2GD4B 3HKIB 4BAMB 4X8UH 1X7AC 2BD8A 1HJ8A 1UVSH 4CRGA 5GCHF 1AN1E 1J17T 3TK6A 1CT4E 1SBWA 1TABE 1A3BH 3TGJE 4WMFA 4BAQB 3SNAA 1SMFE 5TCAA 2GMTB 4NIYA 1Z8IB 3LGTA 1HFDA 1P02A 1OYQA 1V6DA 4ABFA 3M37A 4AORA 2LPRA 2OBOA 4YO9A 4A1XA 1UTKA 1K1OA 4NG9H 4Y76A 4K2YA 1EB1H 5K7RA 1HDTH 1TRYA 2ANMH 3G01A 5E0GA 1CA0C 1CHOF 4O9VA 4H42U 3ZVAA 3LGUA 4ZKOU 3STIA 4CRCA 4SGBE 2H1UA 4ABIA 1FAKH 4ABAA 3SU5A 4JZEH 2FP7B 1SB1H 1YLDA 1O2PA 5HM2A 1FONA 2BVXH 2RCEA 3MO6A 4BNRA 1GBBA 1LKBA 4FUCA 3NCLA 2QC2A 2HVXA 3MHWU 1BTPA 1W12U 1Y3UA 4AG2A 1PFXC 1ZZZA 1RIWC 1LPZB 4DOQA 5L30H 1YKTA 1MAXA 4WH6A 3RXKA 4BAHB 4B2AA 1MZDA 1IQHA 1IQIA 4FUHA 2WINI 1GMCG 1GBHA 1AO5A 1YGCH 1JRTA 4NZLA 1GJ6A 1QBVH 1LHGH 1FPCH 4X2YA 3QK1A 3SGAE 3BEUA 2PV9B 3QZQA 5C1XA 3VGCC 3BTDE 3V13A 2UWLA 1O33A 4NA9H 1HLTH 3SUEA 1K2I1 1UTQA 3C1KA 5HYOA 1F5LA 2FOFA 1U6QA 4UEHH 2OXSA 4XBBA 1XUIA 2Z94A 5GIBA 3HKJB 3BEFB 5DP3A 2FESH 3SOSA 2AGGX 1XX9A 1HXFH 1H8IH 2Z9JA 5FPYA 2FYQA 1C5XB 2STBE 2VH0A 4ASHA 1GHAF 1YCPM 1V2WT 3F6UH 1RJXB 4JYVH 3MH6A 2FWWA 2WYJA 3ZVCA 1ANDA 1GMDG 2TRMA 1C5WB 2QN5T 3ZVDA 4ZXXH 2VINA 1GI0A 3UREA 2FOHA 2NU0E 3S9BA 2J2UA 1TBQH 1NRQH 3QGJA 1NRRH 3IG6B 1YBWA 2Y5GA 2ODPA 1HPGA 4LZ4B 2IPHA 5HM9A 1D3TB 2J4IA 3RXGA 1C5YB 1DS2E 4Y8ZA 4YLUA 1TRNA 1QR3E 1W10U 1NROH 1C1WH 1F0SA 3TITA 2QCYA 5CE1A 1GDNA 1MBMA 1SLWB 1FZZA 1EASA 3T28A 3TNTA 1ELEE 3GDUA 4K60A 2Y6TA 1QBOA 4ZKSU 1MTVA 1Y3YA 1JBUH 1F5RA 3PMAB 1P09A 1V3XA 1P2MA 3ZVFA 2Q6FA 1EAXA 3TJVA 4I33A 2VIDA 3TU7H 3MU1A 1D9IA 2F83A 1FMGA 3F68H 2Y7ZA 4X2VA 3MYWA 1C5ZB 1O5EH 4UFDH 1GI9B 2ZF0H 3UWIA 5CHAC 2ZFRH 3RXMA 3UY9A 2W3KA 4JZDH 1S85A 1SLVB 3TIUA 1RD3B 5DP5A 1A4WH 1D4PB 4Y0YE 2OLGA 2ZP0H 4ZMAH 2J95A 2A31A 3ZZCA 4K1TA 3PTBA 4ISOA 3BG8A 2ZFQH 5EG4A 3VB7A 2OC8A 2WYGA 3A83A 3H7TA 2CF9H 1A3EH 3PWCA 1P2OA 2NU4E 5GPIB 1KXAA 5FPTA 1RGQA 4X8SH 3U8TH 4H6TA 4AFUA 1K1MA 1ARCA 1W8BH 4B2BA 3UFAA 1O2HA 1UO6A 1AZZA 1V2KT 5C1UA 3A8BA 2EA3A 1KSNA 1G3EA 3RC4A 5GCHG 1C1OA 2FEQH 1EJMA 4IBLH 1O3PB 1UJ1A 4MLFB 2ANWA 1K1NA 2VWNA 2H6MA 2ZPSA 1DWCH 4GHTA 2H2ZA 4NWLA 1GHYH 1TBRH 1LPGB 4ISHH 1YPKH 5B6OA 8GCHG 1GVKB 2V3OH 1O2OA 3BIUH 1S0RA 3MO9A 1UTJA 2C8YB 1P3EA 1BTWA 1QA0A 1MKWH 2SNVA 1MCTA 3AAUA 1PPEE 4I8KA 1LHCH 1CHOG 2FS9A 4ZUHA 1KXFA 4UONA 1FLEE 2G55A 4ZAEA 3ODFA 2ZQ1A 4B75A 1ESBA 3UQOA 1AQ7A 1K21H 2F9OA 2GT7A 1KXEA 1BTZA 3DHKH 3OTJE 2SGQE 2BDBA 1BIOA 3SJIA 3B9FH 4WXVA 1IQLA 1EOLA 1UK3A 1EB2A 1FNIA 1CA0B 3VXFH 2B5TB 4K5ZA 3SU1A 1FN6A 1OPHB 1C5VA 3A87A 3PYHA 4Y6DA 3LGYA 1C2JA 1KLTA 1BCUH 3GOVB 2BY8X 1UCYE 1QQUA 3UNRA 1EAUA 1ETRH 2JH0D 1IAUA 1O37A 2CXVA 1EATA 2XYAA 2A45B 4HI3A 3HGNA 2PKAB 1C5LH 2ZTZA 4FUIA 1T31A 1C4Y2 1RIWB 5F6MA 3S9AA 3IWMA 1F5KU 3AVZA 1THRH 1QHRB 1KYNA 3DFJA 2ZPQA 1L0ZA 4FUJA 1PPGE 4IS5A 3Q3KA 1LVYA 4KGAA 3TGKE 5IYTA 4XSKU 1SL3A 1W0YH 2W7UA 2GX4A 3OU0A 1GI7B 1XUFA 1YCPH 2A5KA 2XRCA 3UQVA 2PGBB 1DVAH 1O3GA 1BHXF 1VGCB 1TNHA 3UIRA 1HAGE 4DW2U 1QB9A 2OC7A 1KXDA 1M9UA 3Q76A 3VB5A 1O31A 4YOIA 1C9TA 4Y71A 2ZPRA 1VJAU 1ZPZA 3ZV9A 1A5HA 3SNEA 1TALA 1FXYA 2C8WB 4OS4A 2XTTB 3D23A 5EU8A 1HXEH 3P70B 1UVPA 1O3MA 2AGIX 4X6OA 2NWNA 3RXSA 1HAZB 1YPHE 1TPAE 2BDIA 2PKAA 1AU8A 4MPUA 4O03A 2ASUB 2QF3A 3A7TA 1H8DH 3M36A 2BD9A 1BJUA 3A7WA 5L6NH 1MTSA 1K22H 1TX8A 2ZGCA 1G3DA 1VZQH 5FBEA 1ELCA 2OP9A 3SV2H 3M35A 1H4WA 5L2YH 1HAXB 2Y82A 1V2ST 2FX4A 2BLVA 3E0PB 1O2XA 1G32B 1S82A 2RA0A 1MU8B 3JZ2B 4RN6A 4ABBA 5E8EH 4FUEA 3AW0A 1UHBA 1DLKB 2B9LA 2H9EH 5C5OA 1GG6B 1VCWA 2GT8A 1ZSLA 1O2QA 1ZGIA 4M7GA 1J15A 1UTPA 1ANEA 1EPTC 1ELBA 1Q2WA 3SI3H 2A4GA 4ZHMU 1BUIA 1F92A 3A88A 5JYIA 4UE7H 1Z1IA 1GMCF 1CGIE 1NPMA 1G30B 5EQRA 3U98H 3BTEE 1EQ9A 2J92A 1O2SA 1O3AA 1ZYOA 1OP2A 1O2IA 1JRSA 1ZRBA 3S7KB 2Z9GA 1CO7E 2QXGA 1V2VT 7GCHG 1J8AA 2J94A 2QIQA 2R3YA 1O2LA 1GL0E 2WPIS 2ZGHA
chains in the Genus database with same CATH superfamily
3DSGA 4YESB 3QLPH 1W13U 1S0QA 3QZRA 1DWDH 2ANKH 3T25A 1KMHB 2TGAA 4E7RG 4GAWA 2Z9KA 1J16A 1VCPA 3GY4A 3P92A 1CHGA 1TGBA 2BLQA 4LOYH 1P03A 2AMQA 1UVTH 2BZ6H 3R0FA 3GYLB 3PO1C 2ZU5A 2XCFA 3IITA 2J97A 1Y3WA 4HG6A 4MNYA 1IOEA 1GJ9B 4Q7ZA 1SGDE 1SGQE 1TWXB 2G00A 1GMDF 1O3BA 1YPHC 2KZ4A 1GJAB 5TCCA 1AI8H 2H9HA 1EUFA 2DUCA 3RM2H 2CHAC 3ZZAA 1ANBA 2Y81A 9LPRA 1P9UA 4A7IB 5EODA 5C2ZA 2ZDAH 1KTTB 4M9FA 1AVGH 1XUHA 3FN8A 1NC6A 2FOCA 1SVPA 5C0UA 8ESTE 2P95A 1HAOH 4X2WA 1EJAA 1LCYA 1P10A 2ZGXH 3KF2A 1Y3XA 1YY3A 3M3SA 4OGXA 3CNRA 3MNXA 1NRPH 1Z71A 4RT1A 4D9QA 4ABGA 3F1SB 3TH2H 2PGQB 4FU9A 4FVDA 2W26A 1VCQA 1OWKA 3E6PH 2IJD1 2FI5E 6ESTA 1WV7H 1GI2A 1G9IE 2BY6X 4AFZA 2ZFTA 3A7YA 3D62A 1DM4B 3OE7D 2VIWA 4FU7A 2GV6A 1SHYA 3MOCA 1D3DB 2EEKA 1NBMD 3GS9A 1QJ7B 1SGYE 2XBXA 3VXEH 5F8XA 1DSUA 1TGCA 2CMYA 2GKVE 5FX5A 4ZXYH 4TSFD 3M5MA 2A5IA 4Z0KA 2FOBA 1GI8B 3PTNA 2K8IA 1DY8A 3ITIA 1TB6H 1B0FA 4B2CA 5L2ZH 2YMSC 1CU1A 2O8LA 1D6WA 2A2XH 2P8OC 4WMEA 3BTWE 1GHBF 3UR6A 3RXQA 3LGVA 3KL6A 5AF9H 1FJSA 1K1JA 2OD3B 1BMFD 3C27B 1G2LA 1GBFA 1BTHH 1O3NA 1GHWH 2WPKS 5DKMA 1YPGH 4AB9A 3GCNA 4YOJA 1DXPA 4J2YB 2VIQA 1WU1A 2PFEA 1DY9A 1C1VH 3EE7A 2ZDKA 4IMZA 1SQRA 4ZKNU 4KTSA 4MPWA 3ZZ5A 1TBZH 3FFGA 2G5VA 3OX7U 1E38B 2B0FA 3BG4C 3MNSA 3LIWA 1MH0A 1OKXA 3B8JA 1HCGA 4CH8B 3MTYA 1WQSA 3ODDA 1RTFB 1T8MA 2SGFE 1BHXB 1V2TT 1GHZA 3RXUA 3EA7A 5EXLA 8GCHF 3RXCA 4FXGH 2XBVA 4ISNA 3MU4A 1N8OC 2A32A 4NIWA 1W3CA 1Z8RA 4TYDA 1H9IE 1GBEA 5FAHA 3ATWA 2BDAA 2TBSA 1S81A 4KKDA 4WJG2 4DJZB 3N7DA 1ZTLA 1CT0E 1AMHA 3UWJH 1CVWH 3ATMA 1GJ8B 2C93B 1P8VC 3ZZ8A 5GNDA 2R2MB 1W7XH 2WPJS 4X1QU 1OWDA 3F0OA 1BT7A 2FOEA 1ETSH 1PPCE 3W95A 4NZQA 2VB0A 1A0JA 2WZQA 3ATLA 5DO4H 1O30A 3SJKA 2FS8A 3KN2A 4U32A 1TRMA 1HNEE 3TJUA 1INCA 2F43B 7KMEH 3DSPA 1S84A 5E0JA 5EJ1A 1O2MA 3UAIC 2FI4E 3GDSA 2IOTA 4BAOB 1GBAA 2BD7A 1Y59T 3MO3A 2BM2A 3EYDA 5JPMH 4U01A 3GISB 4B6FA 1WAYB 1C2MA 5KGOA 2BMGB 4HGCA 1O5GH 1GBKA 2FIRH 1NRNH 2CV3A 3PRBA 1WYKA 2FLBH 2ZFSA 2BQ6B 3ZYEA 1EPTB 1F0RA 5IK2D 2HOBA 1TGTA 1J14A 1TA2A 2OQUA 2CF8H 1V2QT 1ZGVA 5EPNA 4AG1A 2EQNA 1DFPA 1PQ5A 1Z8GA 2A7HA 2BB4A 1NT1A 1O5FH 2BLWA 2ZO3H 3HPTB 2PWXA 4RT0A 1UCYK 2BDYA 2EI7A 1SLUB 1A7SA 1SG8B 1W14U 4H6SB 1BRAA 4JYTA 1E36B 4WH8A 1LHDH 3ZZ9A 1BQYA 2R2WU 3F2HA 1E1QD 1PJPA 1L1GA 2VNTA 5T3HA 3SV6A 1P57B 2QF5A 2NU1E 3FP6E 5T6DA 5TJXA 3P8GA 3ZZ4A 3BN9A 2FDAA 1QL9A 1AUTC 4RSPA 1FY4A 3SUGA 8KME2 5AHGH 1PQ8A 2QF0A 1VKYA 3MU0A 1P9SA 3GICB 4KELA 2KCAA 2VU8E 2ZU2A 4I8HA 2Y5FA 3PO1B 2BD3A 2ZHWH 1LTOA 1EPTA 3TVJB 2B8OH 3EAJA 1AUJA 1SC8U 4XD7D 1WOFA 1QL8A 5EIYA 3FZDA 5KEDA 1MQ6A 2CHAB 3U8OH 1GVLA 2PKSC 2UWOA 3GY2A 1G36A 1KLIH 4NIVA 1DANH 1QB6A 3MH7A 1EZSC 1FY5A 1K1LA 1GCDA 2G8TA 4UFGH 4D8NA 1Z8JB 4HZHA 1EFRD 1SGNE 3ESTA 1GVZA 1P2NA 3BV9B 4MNVA 1E34B 2FLRH 5G4BA 2W6ID 1ACBE 5EJLA 3SQEE 3LDXH 1E35B 2LELA 3SU2A 1QRZA 1N6YA 2O9QA 4J1YA 1CA8B 1GGDC 2ZZUH 4JYUH 5GDSH 2FMJA 2SGEE 3QTVH 4SGAE 5FX6A 4AB8A 6CHAC 4I8GA 4I8JA 1V2JT 3T2NA 3BEIB 3SQHE 3QTOH 4GPGA 1C2EA 2CK3D 1XUJA 2KAIA 4I31A 2EI6A 1TONA 1E1RD 1CGHA 1DDJA 2W7SA 2F9VA 2EC9H 7GCHF 3BTKE 4ISLA 1C9PA 3PMJA 1UMAH 2HLCA 2VIOA 1L4ZA 4TPYA 4QT8C 1TE0A 4MNXA 4NCYA 2Y80A 1KLJH 1Y5AT 1ESAA 1GDUA 2JH5D 1OP0A 1GHBG 3UNQA 1H9HE 5FPSA 1LPKB 4UD9H 1FY8E 1GCTC 1A2CH 5JB8S 1ZRKA 4I86A 3DFLA 2YMSB 2P8OB 4UFEH 3U69H 1HAYB 3QO6A 3RC6A 1O0DH 1D3PB 1HBTH 1O3HA 2PTNA 2Q6GA 1ABIH 2K1QA 4LZ1H 1LO6A 4Y10E 1SGTA 3SZNA 1C1QA 5A0AE 1TOCB 2BOKA 4X6NA 2HPPH 2QYIA 2ZCLP 5EW2H 3VB4A 2BLOA 1WBGB 1SOZA 1B0EA 3T5FH 1UVUH 1SLXB 3QDZB 4UFFH 2OC1A 1DUEA 1FDPA 1IHTH 3SJ9A 1TMBH 3RC5A 1LMWB 5I46H 2AYWA 2GTBA 2P3TB 3K65B 3LGWA 3EQ0H 1AD8H 2ZG0H 2WV5A 2GV7A 3PLPA 3SJOA 2BY5X 1DITH 1HGTH 1FQ3A 4YXWD 1YPLH 3BSQA 4CHAC 1ZJDA 3A85A 1F7ZA 3CENA 4K3JA 4XFQA 1BMAA 4B74A 2BDGA 3SHCH 1CQQA 1HV7A 5HIZA 1GI1A 2FPZA 3F9GA 1CBWC 3KGPA 7ESTE 2V35A 2BVRH 4AFQA 3TH4H 5ETXA 4AX9H 5PTPA 1ELFA 4K1EA 1D3QB 1C1NA 3SV7A 4F4OC 3ZZDA 3A7VA 1W11U 4OS2A 1TX6A 3LC5A 2OQ5A 4CRBA 1L1NA 1XMNB 1GBMA 2I6SA 2XBWA 2FO9A 3VPKA 1ZTKA 4ABHA 3SUFA 2WSSD 3DD2H 4X2XA 1A1RA 4JK5A 1IQGA 3RXVA 2BY9X 1GJ7B 5LH8A 4ISIH 9ESTA 3PLBA 1BRUP 1OX1A 1P06A 1T8OA 1A0HB 3OSYA 3LGIA 4P02A 3SU3A 3BTFE 1FY1A 2BD5A 1ZMJA 2GCHG 2H5DA 2BXTH 2V6NA 3RXIA 1TPSA 3A89A 5FBIA 3URCA 4E7NA 1TPOA 4PROA 4DIIH 1IQEA 3H7OA 3NXPA 1D6RA 5DGJA 2WV9A 4KTUA 1P04A 3BTQE 2VJ1A 2FTMA 1UW7A 1GJDB 4FUBA 4MG3A 1FV9A 3U1JB 3OFND 8LPRA 1K1PA 4INHA 1IQFA 1GI6A 1DXWA 2KCYA 3FOAA 1UHBB 4GSOA 1BTYA 3VGCB 2ZGJA 2ZHDA 3A8CA 1BJVA 1SHHB 2JJ2D 5HIYA 5ESBA 3KIDU 1WCZA 3AASA 4BXSA 2QXHA 2FXRA 2GMTC 1TAWA 1QFKH 1HRTH 5LPRA 3SI4H 2WPLS 1NZQH 1GPZA 2C3SA 3E0NB 4GUXA 4AOQA 1GJ4H 2KX4A 2UUJB 4AYYB 1EZXC 3E91A 1SGEE 4A5TS 1K28D 4DIHH 3MFJA 2HVYB 4DG4A 2ZFPH 4X6PA 3T62A 3HATH 1P3CA 2ZU4A 2W6JD 2GJGA 4VGCC 5A8ZA 1THPB 4YT7H 3BIVH 1GBCA 1GDQA 5DPAA 3ZZ7A 2JDID 3TK5A 3R3GB 1E0FD 3FVFB 5F8TA 2R0LA 2TGPZ 3E1XB 4ZROA 2XCNA 1TNLA 3CS0A 3F9FA 4Y0ZE 1CGJE 3TNSA 1A0LA 4U2WA 1AKSB 1DOJA 1O35A 2F9NA 4MPVA 5I25A 4CBNA 4LK4A 2IN2A 5DP6A 3ZV8A 1Z6JH 1QBNA 2A1DB 2AMDA 1BOQA 4Q80A 5DP7A 1PPZA 1MTNC 1SQOA 2ZGBH 4AYVB 3MWIU 1OXGA 4ABDA 1YPMH 2QE7D 4A1VA 2BD4A 1ELGA 1NFYA 2OINA 2UUKB 3GCOA 1O5DH 2SGAA 1YP9A 5BPEA 4CH2B 1NESE 2BYAX 1GGDB 1MKWK 3MNBA 4FUFA 1MQ5A 6CHAB 2HRVA 1GBDA 3LH3A 3Q3XA 1O3EA 3A8DA 1GHXH 1VITF 3SGBE 4WF8A 4DT7B 4R8TB 3TH3H 3O8BA 3PRDA 1P2JA 3PB1E 3D49H 1AFQC 4NSYA 4Q7YA 5E2OA 5T1VA 1QY6A 1TFXA 2OC0A 1SGFG 5CHAB 3UR9A 2ALPA 1MD8A 4GCHG 3UPEA 2PHBA 2ZHEH 4CBOA 1OWIA 1PPBH 2XWBI 2IJOB 5LGOA 3P8FA 1QRWA 2ZCKP 2GDDA 1EJNA 3K2UA 1AKSA 1C1UH 3BTME 5JBTA 3GCTG 4A92A 2SGDE 4X1PU 2UUFB 2PW8H 1NY22 2ZC9H 4BTTB 1AVXA 2RA3A 4OS7A 2Z9LA 3F3BA 1MCVA 3GY8A 3ZZ3A 4RKJB 2O8MA 2PUQH 1A5IA 1A61H 3PROA 2DE8A 3AW1A 3F2GA 1AHTH 1MKXH 1SGRE 1NU9A 2AHME 1O2WA 3ATKA 3MI4A 4R0IA 1JXPA 3SUDA 3VFEA 1O2GH 3EA8A 2C4FH 7LPRA 1BMNH 1H1BA 1THSH 1O2UA 1ZJKA 4O3UA 1T4UH 1ZR0A 3SU0A 5A0CA 1NN6A 4IMQA 4IN1A 3GY7A 2D2DA 4FU8A 2A2QH 2M2AA 2W5EA 2WUCA 3MH4A 3ZZ6A 2BZAA 5JBAS 3N7OA 1ORFA 2NU3E 1O2KA 4TPIZ 1GJBB 1NM6A 5F8ZA 4FUDA 5JBBS 4IC6A 1HAVB 3VB6A 1EXFA 1WQVH 4YLQH 1C5UA 2F9BH 2GGVB 2ODYB 3KEEA 2W3IA 3U1IB 1EX3A 1SGFA 2FODA 1V2PT 3RMOH 1YCPK 3RXJA 5JDUB 5SGAE 4BAKB 2RDLA 3RXRA 4GLYA 3SN8A 3RUOA 1TPPA 1QA7A 1SI5H 2DE9A 2GP9B 1BRCE 1QZ8A 3DUXH 3V12A 4CR5A 1EZQA 2ODQA 4YOGA 2V3HH 3QN7A 4KTCA 4CHAB 4Z1MD 1JMOH 3DA9B 1FUJA 1TGNA 1TGSZ 2XC0A 5CMXH 2ZKSA 1LKAA 2BX3A 1BBRH 4ESTE 3RMLH 1CBWB 5EQSA 1S6HA 2BY7X 4AGJA 1K9OE 5ABWA 3L6PA 3RU4E 1YPJH 2H5CA 3RXHA 2AH4X 3EE0B 1WXRA 5GXPA 1VITH 2AMPA 3RM0H 2BVSH 2HNTC 1O3LA 1B5GH 2VVCA 1AZ8A 3ZIAD 3TJOA 1GI4A 2BDHA 4XBDA 2ZDLA 1ETTH 1MAYA 1FPHH 2PTCE 3WY8A 3L33A 1HAVA 2JETC 2VIVA 3SU4A 4YTAA 5LPEA 3UOPA 3KQCA 1LVMA 2HNTF 3UNSA 1KXCA 3H5CB 1QURH 3SU6A 6LPRA 1C2FA 1FIWA 2QXJA 3S69A 1ELVA 2B7DH 2ZQ2A 5DG6A 1P12E 1KIGH 4INLA 4IW4E 4Y7AA 3ZVEA 2YNBA 3CP7A 2QV1A 3M61U 4K69A 1ABJH 1PYTC 4MDSA 2AFQB 4BTIB 1V2MT 2VWMA 1TQ7B 3T27A 1FIZA 2I6QA 2QF4A 4JZ1A 1C2IA 2PUXB 3NUMA 1IQMA 1OWJA 1C5NH 2GCTC 5FXLA 4B76A 4XDEA 1FAXA 2HGTH 2BX4A 1HIAB 2F91A 5DP8A 4TWWA 4CRFA 1HUTH 4OS6A 3HGPA 1FY3A 1O36A 3HK3B 3A8AA 3TGIE 1SQAA 5DSFA 4DGJA 4ZHLU 1A46H 5DN6D 2TIOA 1LDTT 3FP7E 4XBCA 1LHFH 2P16A 4DVAU 1XKAC 1GBTA 1GI3A 1C5SA 1W0JD 5EOKA 1TMTH 4ZH8A 3GY3A 4AN7A 5C3NA 1RFNA 3GYMA 2JH6D 1TX7A 2THFB 3FO8D 3SO3A 3RMMH 2SGPE 4VGCB 2NU2E 2SNWA 1V2RT 4X8VH 1MKXK 1HJ9A 3K9XB 2AGEX 2HALA 1HAHH 1IHSH 1L4DA 1C2HA 1SR5C 3LU9B 3CS7A 4NFFA 4A1TA 2BQ7B 1YYY1 5AVDA 3A82A 1F0TA 1SGCA 2G81E 3UTUH 3OYPA 1MTUA 1V2NT 1HIAA 2STAE 4DY7B 1DX5M 2GCHF 2OBQA 2UUYA 3NWUA 3PV2A 5EGMA 2GZ8A 6GCHF 4Q2KA 4INKA 3WW7A 3Q77A 1TNKA 2A5AA 1Y5BT 4JCNA 2LNCA 4CRAA 1S5SA 1AVWA 1UVOA 1SFQB 3QX5H 3O8RA 2WUBA 1NO9H 3PWBA 1C5RA 4K8YA 1ID5H 1NFXA 2HPQH 5EQQA 1HAIH 2SFAA 4GVUA 1MTNB 3TK9A 3MNCA 3S7HB 1ESTA 3M5OA 1VITG 3RXPA 4JZFH 3A7ZA 3SV8A 4FOUC 1MUEB 2VGCC 1DUAA 3M5LA 1C2KA 2ZU1A 5C17A 1LVBA 3SORA 3GDVA 1CSOE 1VGCC 2YOLA 1BBRK 1QNJA 1T8NA 3M7UA 3P6ZB 1UTNA 2F4LA 2A4RA 3PMHB 3RXLA 1OSSA 4TY6A 1AFQB 1GJ5H 1Q31A 3EA9A 1NFUA 2KAIB 3MU5A 1Z6EA 1O32A 1MZAA 1GMHG 3OY5U 1LVOA 1MABB 4OS5A 5FCRA 1AWHB 5E2PA 4XE4A 3V0XA 3V7TA 4Z6AH 3O8CA 3ELAH 3KHVA 1OOKB 3LOXA 3OEED 4BANB 2ZHFH 2BTCE 1O39A 5JBCS 2GZ7A 3O8DA 1XVMA 3RP2A 3A86A 2FOMB 1ZOMA 1AFEH 3KCGH 3OEHD 4MNWA 1SSXA 1G3CA 2WPMS 2BD2A 2A7CA 2VWOA 4B1TA 2ALVA 3RXFA 1WDIA 1C1RA 5C94A 4Y8XA 1GG6C 3JZ1B 2XC4A 2D8WA 2YMSD 4ACAA 1DWEH 1ZMNA 2AS9A 3I77A 3KNXA 1YLNA 1O34A 5A09A 1UK2A 1H9LB 3RXDA 3U8RH 2QAAA 4JMYA 5E0HA 4ZKRU 1HAPH 4O97A 1O2RA 2ZIQH 5T6FA 1NS3A 1F0UA 3ENSB 2Z3CA 5K0HA 3V3MA 2Z7FE 1QCPA 4JZIA 1MU6B 3PV5A 1P11E 5JB9S 1O2JA 2FM2A 1O2TA 2O8WA 1ARBA 1AGJA 1ZTJA 1C1PA 1C5OH 4Q7XA 4YZUA 4F48B 4TWYA 3SHAH 1PYTD 2XXLA 3SNDA 1PQAA 1DICA 1O2ZA 1G2MA 4B71A 3D65E 3P95A 3VB3A 2XC5A 4GCHF 3A7XA 1KDQB 2L74A 3GY5A 3KYGA 3AAVA 3S0NA 1DT2A 2ULLA 5J4QA 5A2MH 1LQEA 2PR3A 1L1JA 3GCTF 1QL7A 1MD7A 1P2IA 1EP6A 1W7GH 2C8XB 1O2VA 3UUZA 5IDKA 1SGIB 1JWTA 5CDFE 2G51A 5C67A 2D1JA 2BDCA 1ELAA 1XXFA 1AE8H 2KFWA 1O3IA 4NFEA 2ILNA 2J9NA 2JETB 5T6GA 3EDXB 4NGAH 3RMNH 4DCDA 3QWCH 4MVNA 3FZZA 4D7FA 1FI8A 4IN2A 3PM3A 4NSVA 2QXIA 3M7TA 1K1IA 4BTUB 1RXPA 1SOTA 3FAOA 3S9CA 3I78A 1O3DA 1O5BB 3QUMP 2Y5HA 1RS0A 3N99A 2V3MA 1AB9C 3RU4D 2ANYA 3ZVBA 1TLDA 5GJ4B 1C1SA 3BG4B 3BTGE 2XNIA 1RTKA 3GCHC 2QGRA 2GZ9A 5AFZH 1N1LA 2F3CE 2RG3A 1T32A 1TNJA 2PSXA 1Y5UT 4X0WU 5J4SA 4IC5A 4GHQA 4RI0A 1KDQA 3HK6B 2GCTB 3NPSA 4O3TA 2XOKD 1SGPE 1NTPA 3STJA 1CE5A 1EAWA 3P8OA 1N8OB 4ASUD 2TPIZ 3UB0A 1GBLA 4AGKA 4D76A 4F55A 1ZHMA 4HTCH 2AEIH 2F9PA 2WPHS 4I32A 2A0QB 3MU8A 2FYRA 1VR1H 1W2KH 1UTMA 2FOAA 3E8LA 1JIRA 5HXFA 1IQNA 2L6OA 1DWBH 1C1TA 1UTLM 4X6MA 1GI5A 3E3TA 1MTWA 4AZ2B 4X1RU 1J9CH 1P2QA 3NZIA 1DE7H 1HJAC 5EXMA 2O8UA 1OS8A 1Z7KA 4TY7A 4WMDA 1TQ0B 1GJCB 1IQKA 1BBRE 1OWHA 2Z3EA 3SJ8A 4BOHA 6GCHG 3OY6U 1QB1A 1QJ1B 1ZLRA 3LT3A 1WTHD 2UWPA 3P17H 2P3UB 2HWLB 3NKKA 1C1MA 4JK6A 1ZSKA 1TMUH 1FN8A 2A7JA 3RLYH 5CHBA 3U9AH 2Y7XA 2ZU3A 1MMJN 3L3TA 5EXNA 1TNGA 2TGDA 3K6YA 2RFKC 2CGAA 4E06H 2XWAA 4P00A 2JKHA 1ZHRA 5C0TA 5AFYH 1GWAA 2P94A 4I8LA 3M7QA 2FI3E 4RKOB 1XVOA 3TPIZ 4OGYA 1O3KA 3SW2B 3UOUA 5C20A 1L2EA 3NK8A 2ZDMA 1AE5A 1C5QA 4NA7A 4MPXA 2PLXA 3RXTA 1GBIA 1NRSH 1C4V2 5GWZA 4BXWA 1O2YA 2A4OA 2XW9A 2ZCHP 2ZFFH 3T29A 3QGNB 1B7XB 2VGCB 4WXIA 4THNH 4IGDA 1E37B 4OS1A 1V2UT 3F9HA 3ZZBA 1KXBA 3RDZA 2Q1JA 2ZNKH 5DJ7A 1G37A 5LPFA 1YF4A 2C8ZB 3RXEA 3ATIA 3P8NA 3PMBB 3M3TA 4U30A 3KQBA 3BTTE 1O3JA 1LHEH 1SFIA 4CR9A 1N6XA 1Q3XA 1YPEH 1GHAG 1O3CA 3SNBA 2H9TH 1O5CB 1H8ED 1SKYE 4K1SA 1TA6A 1XUKA 3KQEA 3RU4T 4Y79A 1QQ4A 1BMLA 2O8TA 4F49A 1BDAA 1V2LT 3Q3YA 1KY9A 1Y8TA 2GDEH 1QRXA 1RTLA 4NIXA 2WHXA 3KQDA 5B6LA 2XBYA 1S83A 2G5NA 2ZDNA 2PKSB 4H4FA 4DURA 2FX6A 2OCVB 3TJNA 4AFSA 3BTHE 1TNIA 1BA8B 4ABEA 3DT0H 3VEQB 1QTFA 2V0BA 1HYLA 1OWEA 2G4UA 1W0ZU 5FCKA 1QGFA 1T8LA 4X8TH 1C5PA 1TOMH 3PLKA 5EPYA 1BTUA 1BITA 2ZDVH 2VVVA 4YM9A 2VH6A 3FANA 3KYFA 2BOHB 1BB0B 4Y11E 1UK4A 2P3FH 2BXUH 1SPJA 4KP0A 1QJ6B 4I7YH 4D9RA 4HFPB 1GBJA 5DP4A 2ZHQH 2P59A 4MTBA 3Q00A 4X1NU 2CJIA 3A80A 5HGGA 5DP9A 1O3OA 2G4TA 4E05H 5DK1A 1DPOA 2ZTXA 1C5MD 1P01A 2QA9E 4K8BA 3LC3A 4ZHAA 5EW1H 1PQ7A 2ZTYA 2R3UA 1EZUC 1YC0A 1MBQA 1T4VH 2HNTE 2Z3DA 2R9PA 4CRDA 3RXOA 1XUGA 2ZA5A 1COWD 4CREA 2AIPA 1S6FA 3TLOA 1C5TA 1KTSB 2Q6DA 1O3FA 3GY6A 1XM1A 2CN0H 2M5TA 4D7GA 1XKBC 4NWKA 3URDA 1ELTA 1PPHE 1C4U2 1GMHF 1TYNA 2G52A 1GCTB 3M3VA 3E90B 2R0KA 1ZMLA 4WWYA 1NFWA 4Y8YA 1DLEA 5H4IB 1EKBB 1G3BA 1UTOA 4MQAA 5F53A 1ELDE 1AIXH 1C2DA 3M5NA 3ZYDA 1TIOA 3NRLA 1DSTA 1RRKA 1HB0B 5ESTE 2C90B 4NA8A 3LPRA 1Z1JA 4UDWH 2F9UA 1SQTA 1Y3VA 3W94A 3SV9A 3EGKH 1GL1A 1O5AB 4XOJA 3LKWA 4LXBH 5A8XA 1CT2E 3LONA 2P93A 1A5GH 1K0HA 4Y7BA 1AB9B 2WV4A 1O38A 2GVFA 1O2NA 3B23B 2FOGA 2K0QA 3GCHB 3PV4A 2J34A 2Z9IA 1VJ9U 4YT6H 3WWBA 3LJJA 1YM0A 1NU7B 2OTVA 4WVPE 1V2OT 3F9EA 5A0BA 1P05A 1QIXB 3LJOA 5FHTA 1BZXE 2TGTA 1YLCA 1F2SE 1ZPCA 3A81A 1JOUB 2OUAA 1BRBE 2ZEBA 4X1SU 3SGQE 1AY6H 3RLWH 1BTXA 1EAIA 2PSYA 2FTLE 2VBCA 1UCYH 1LQDB 2VIPA 2OK5A 3T26A 2ZWLH 5C1YA 1ANCA 3MMGA 4WY3A 2Z6BD 2EI8A 2ESTE 2AIQA 1OYTH 1C2GA 3K6ZA 1C2LA 2BQWB 2HLDD 3DCLA 2J38A 2YNAA 3SNCA 4B73A 1P0SH 1EP5A 4A6LA 1GHVH 1PPFE 5HMAA 3RXBA 5C5NA 2VVUA 3WWFA 3A84A 4ABJA 1P2KA 2VWLA 1HJAB 3FP8E 4FVBA 1ZPBA 2QY0B 5F03A 1JIMA 1BMMH 3RXAA 1WUNH 1OP8A 5BRRE 2D26C 1XXDA 2FZZA 2WPDD 1T7CA 1WSSH 3LH1A 5A8YA 4B6EA 1IQJA 3MH5A 2ZI2H 1AWFH 1ZSJA 3I29A 2BHGA 1WTGH 2ZECA 4FUGA 3BF6H 3SBKA 2A4QA 3E16B 1ZHPA 2AERH 1EOJA 2GD4B 3HKIB 4ACBA 4BAMB 4X8UH 1X7AC 4Q63A 2BD8A 1HJ8A 3N7EA 3AK5A 1UVSH 4CRGA 5GCHF 1AN1E 1J17T 3TK6A 1CT4E 1SBWA 1TABE 1A3BH 3TGJE 4WMFA 4BAQB 2KR7A 3SNAA 1SMFE 5TCAA 2GMTB 4NIYA 1Z8IB 3LGTA 1HFDA 1P02A 1OYQA 1V6DA 4ABFA 5HKKD 3M37A 4AORA 2LPRA 2OBOA 4YO9A 4A1XA 1UTKA 1K1OA 4NG9H 4Y76A 4K2YA 1EB1H 5K7RA 1HDTH 1TRYA 2ANMH 3G01A 5E0GA 1CA0C 1CHOF 4O9VA 4H42U 3ZVAA 3LGUA 4ZKOU 3STIA 4CRCA 4SGBE 2H1UA 4ABIA 1FAKH 4ABAA 3SU5A 4JZEH 2FP7B 1SB1H 2EY4C 1YLDA 1O2PA 5HM2A 1FONA 2BVXH 2RCEA 3MO6A 4BNRA 1GBBA 1LKBA 4FUCA 3NCLA 2QC2A 2HVXA 3MHWU 1BTPA 1W12U 1Y3UA 4AG2A 1PFXC 1ZZZA 4ZCNA 1RIWC 3H09A 1LPZB 3OAAD 4DOQA 5L30H 1YKTA 1MAXA 4WH6A 3RXKA 4BAHB 4B2AA 1MZDA 1IQHA 2KCOA 1IQIA 4FUHA 2WINI 1GMCG 4Q4LA 1GBHA 1S6LA 1AO5A 1YGCH 2KM0A 1JRTA 4NZLA 1GJ6A 1QBVH 1LHGH 1FPCH 4X2YA 3QK1A 3SGAE 3BEUA 2PV9B 2V7QD 3QZQA 3VGCC 5C1XA 3BTDE 3V13A 2UWLA 1O33A 4NA9H 1HLTH 3SUEA 1K2I1 1UTQA 3C1KA 5HYOA 1F5LA 2FOFA 1U6QA 4UEHH 4TT3D 2OXSA 2JIZD 4XBBA 1XUIA 2Z94A 5GIBA 3VG8A 3HKJB 3BEFB 5DP3A 2FESH 3SOSA 3KQ5A 2AGGX 1XX9A 1HXFH 1H8IH 2Z9JA 5FPYA 2FYQA 4AC9A 1C5XB 2STBE 2VH0A 4ASHA 4XRNA 1GHAF 1YCPM 1V2WT 3F6UH 5FL7D 1RJXB 4JYVH 3MH6A 2FWWA 2WYJA 3W1EA 1ANDA 1GMDG 3ZVCA 2TRMA 1OHHD 1C5WB 2QN5T 3ZVDA 4ZXXH 2VINA 1GI0A 3UREA 2FOHA 2NU0E 3S9BA 2J2UA 1TBQH 1NRQH 3QGJA 1NRRH 3IG6B 1YBWA 2Y5GA 2ODPA 3F0PA 1HPGA 4LZ4B 2IPHA 5HM9A 1D3TB 3MQKC 2J4IA 3RXGA 1YWUA 1C5YB 1DS2E 4Y8ZA 4YLUA 1TRNA 1QR3E 1W10U 1NROH 1C1WH 1F0SA 3TITA 2QCYA 5CE1A 1GDNA 1MBMA 1SLWB 1FZZA 1EASA 3T28A 3TNTA 1ELEE 3GDUA 4K60A 2Y6TA 1QBOA 4ZKSU 1MTVA 1Y3YA 1JBUH 1F5RA 3PMAB 1P09A 1V3XA 3U28C 1P2MA 3ZVFA 2Q6FA 1EAXA 3TJVA 4I33A 2VIDA 3TU7H 5KECA 3MU1A 1D9IA 2F83A 1FMGA 3F68H 2Y7ZA 4X2VA 3MYWA 1C5ZB 1O5EH 4UFDH 1GI9B 2ZF0H 3UWIA 5CHAC 2ZFRH 3RXMA 3UY9A 2W3KA 2RDEA 4JZDH 1S85A 1SLVB 3TIUA 1RD3B 5DP5A 1A4WH 1D4PB 4Y0YE 2OLGA 2ZP0H 4ZMAH 2J95A 3FKSD 2A31A 3ZZCA 4K1TA 3PTBA 4ISOA 3BG8A 2ZFQH 5EG4A 3VB7A 2OC8A 2WYGA 3A83A 3H7TA 2CF9H 1A3EH 3PWCA 1P2OA 2NU4E 5GPIB 1KXAA 5FPTA 1RGQA 4X8SH 3U8TH 4H6TA 4AFUA 1K1MA 1NBME 1ARCA 1W8BH 4B2BA 3UFAA 1O2HA 1UO6A 1AZZA 1V2KT 5C1UA 3A8BA 2EA3A 1KSNA 1G3EA 3RC4A 5GCHG 1C1OA 2FEQH 1EJMA 4IBLH 1O3PB 1UJ1A 4MLFB 2ANWA 1K1NA 2VWNA 2H6MA 2ZPSA 1DWCH 4GHTA 2H2ZA 4NWLA 1GHYH 1TBRH 1LPGB 4ISHH 1YPKH 5B6OA 8GCHG 1GVKB 2V3OH 1O2OA 3BIUH 3DSOA 1S0RA 2KCPA 3MO9A 1UTJA 2C8YB 1P3EA 1BTWA 1QA0A 1MKWH 2SNVA 1MCTA 3AAUA 1PPEE 4I8KA 1LHCH 1CHOG 2FS9A 4ZUHA 1KXFA 4UONA 1FLEE 2G55A 4ZAEA 3ODFA 2ZQ1A 4B75A 1ESBA 3UQOA 1AQ7A 1K21H 2F9OA 2GT7A 1KXEA 1BTZA 3DHKH 3OTJE 2SGQE 2BDBA 1BIOA 3SJIA 3B9FH 4WXVA 1IQLA 1EOLA 1UK3A 1EB2A 1FNIA 1CA0B 3OTPA 3VXFH 2B5TB 4K5ZA 3SU1A 1FN6A 1OPHB 1C5VA 1E79D 3A87A 3PYHA 4Y6DA 3LGYA 1C2JA 1KLTA 1BCUH 3GOVB 2BY8X 1UCYE 1QQUA 3UNRA 1EAUA 1ETRH 2JH0D 1IAUA 3F2FA 1O37A 2CXVA 2IPQX 1EATA 2XYAA 2A45B 4HI3A 3HGNA 2PKAB 1C5LH 1H8HD 2ZTZA 4FUIA 1T31A 1C4Y2 1RIWB 3ZVGA 5F6MA 3S9AA 3IWMA 1F5KU 3AVZA 1THRH 1W0KD 1QHRB 1KYNA 3DFJA 2ZPQA 1L0ZA 4FUJA 1PPGE 2PP6A 4IS5A 3Q3KA 1LVYA 4KGAA 3TGKE 5IYTA 4XSKU 1SL3A 1W0YH 2W7UA 2GX4A 3OU0A 1GI7B 1XUFA 5EJZA 2LP6A 1YCPH 2A5KA 2XRCA 3UQVA 2PGBB 1DVAH 1O3GA 1BHXF 1VGCB 1TNHA 3UIRA 1HAGE 4DW2U 1QB9A 2OC7A 1KXDA 1M9UA 3Q76A 3VB5A 1O31A 4YOIA 1C9TA 4Y71A 2ZPRA 1VJAU 1ZPZA 3ZV9A 1A5HA 3SNEA 1TALA 1FXYA 2JJ1D 2C8WB 4OS4A 2XTTB 3D23A 5EU8A 1HXEH 3P70B 1UVPA 1O3MA 2AGIX 4X6OA 4OM9A 2NWNA 3RXSA 1HAZB 1YPHE 2XNDD 3SZEA 1TPAE 2BDIA 2PKAA 1AU8A 4MPUA 4O03A 2ASUB 2QF3A 3A7TA 1H8DH 3M36A 2BD9A 1BJUA 3A7WA 5L6NH 1MTSA 1K22H 1TX8A 2ZGCA 1G3DA 1VZQH 5FBEA 1ELCA 2OP9A 3SV2H 3M35A 1H4WA 5L2YH 1HAXB 2Y82A 1V2ST 2FX4A 2BLVA 2J98B 3E0PB 1O2XA 1G32B 1S82A 2RA0A 1MU8B 3JZ2B 4RN6A 4ABBA 5E8EH 4FUEA 3AW0A 1UHBA 1DLKB 2B9LA 2H9EH 2J5UA 5C5OA 1GG6B 1VCWA 2GT8A 1ZSLA 1O2QA 1ZGIA 4M7GA 1J15A 1UTPA 1ANEA 1EPTC 1ELBA 1Q2WA 3SI3H 2A4GA 4ZHMU 1BUIA 1F92A 3A88A 5JYIA 4UE7H 1Z1IA 1GMCF 1FX0B 1CGIE 1NPMA 1G30B 5EQRA 4DT4A 3U98H 3BTEE 4FETA 1EQ9A 2J92A 1O2SA 1O3AA 1ZYOA 3SYJA 1OP2A 1O2IA 1JRSA 1ZRBA 3S7KB 2Z9GA 1CO7E 2QXGA 1V2VT 7GCHG 1J8AA 2J94A 2QIQA 2R3YA 1O2LA 1GL0E 2WPIS 2ZGHA 2J98A
chains in the Genus database with same CATH topology
4YESB 3QLPH 1W13U 1S0QA 3QZRA 1DWDH 2ANKH 3T25A 2TGAA 4E7RG 4GAWA 2Z9KA 1J16A 1VCPA 3GY4A 3P92A 1CHGA 1TGBA 2BLQA 4LOYH 1P03A 2AMQA 1UVTH 2BZ6H 3R0FA 3GYLB 3PO1C 2ZU5A 2XCFA 3IITA 1Y3WA 4MNYA 1IOEA 1GJ9B 4Q7ZA 1SGDE 1SGQE 1TWXB 2G00A 1GMDF 1O3BA 1YPHC 1GJAB 5TCCA 1AI8H 2H9HA 1EUFA 2DUCA 3RM2H 2CHAC 3ZZAA 1ANBA 2Y81A 9LPRA 1P9UA 4A7IB 5EODA 5C2ZA 2ZDAH 1KTTB 1AVGH 1XUHA 1NC6A 2FOCA 1SVPA 8ESTE 2P95A 1HAOH 4X2WA 1EJAA 1LCYA 1P10A 2ZGXH 3KF2A 1Y3XA 3M3SA 4OGXA 3MNXA 1NRPH 1Z71A 4D9QA 4ABGA 3F1SB 3TH2H 2PGQB 4FU9A 4FVDA 2W26A 1VCQA 1OWKA 3E6PH 2FI5E 6ESTA 1WV7H 1GI2A 1G9IE 2BY6X 4AFZA 2ZFTA 3A7YA 3D62A 1DM4B 2VIWA 4FU7A 2GV6A 1SHYA 3MOCA 1D3DB 2EEKA 1QJ7B 1SGYE 2XBXA 3VXEH 5F8XA 1DSUA 1TGCA 2CMYA 2GKVE 5FX5A 4ZXYH 3M5MA 2A5IA 4Z0KA 2FOBA 1GI8B 3PTNA 1DY8A 3ITIA 1TB6H 1B0FA 4B2CA 5L2ZH 1CU1A 2O8LA 1D6WA 2A2XH 2P8OC 4WMEA 3BTWE 1GHBF 3UR6A 3RXQA 3LGVA 3KL6A 5AF9H 1FJSA 1K1JA 2OD3B 3C27B 1G2LA 1GBFA 1BTHH 1O3NA 1GHWH 2WPKS 5DKMA 1YPGH 4AB9A 3GCNA 4YOJA 1DXPA 4J2YB 2VIQA 1WU1A 2PFEA 1DY9A 1C1VH 2ZDKA 4IMZA 4ZKNU 4KTSA 4MPWA 3ZZ5A 1TBZH 3FFGA 2G5VA 3OX7U 1E38B 2B0FA 3BG4C 3MNSA 3LIWA 1MH0A 1OKXA 3B8JA 1HCGA 4CH8B 3MTYA 1WQSA 3ODDA 1RTFB 1T8MA 2SGFE 1BHXB 1V2TT 1GHZA 3RXUA 3EA7A 5EXLA 8GCHF 3RXCA 4FXGH 2XBVA 4ISNA 3MU4A 1N8OC 2A32A 4NIWA 1W3CA 1Z8RA 4TYDA 1H9IE 1GBEA 5FAHA 3ATWA 2BDAA 2TBSA 1S81A 4KKDA 4WJG2 4DJZB 1ZTLA 1CT0E 1AMHA 3UWJH 1CVWH 3ATMA 1GJ8B 2C93B 1P8VC 3ZZ8A 2R2MB 1W7XH 2WPJS 4X1QU 1OWDA 1BT7A 2FOEA 1ETSH 1PPCE 3W95A 4NZQA 2VB0A 1A0JA 3ATLA 5DO4H 1O30A 3SJKA 2FS8A 3KN2A 4U32A 1TRMA 1HNEE 3TJUA 1INCA 7KMEH 5E0JA 1S84A 1O2MA 2FI4E 3GDSA 2IOTA 4BAOB 1GBAA 2BD7A 1Y59T 3MO3A 2BM2A 3EYDA 5JPMH 4U01A 3GISB 1WAYB 1C2MA 2BMGB 4HGCA 1O5GH 1GBKA 2FIRH 1NRNH 2CV3A 1WYKA 2FLBH 2ZFSA 2BQ6B 3ZYEA 1EPTB 1F0RA 2HOBA 1TGTA 1J14A 1TA2A 2OQUA 2CF8H 1V2QT 1ZGVA 5EPNA 4AG1A 1DFPA 1PQ5A 1Z8GA 2A7HA 2BB4A 1NT1A 1O5FH 2BLWA 2ZO3H 3HPTB 2PWXA 1UCYK 2BDYA 2EI7A 1SLUB 1A7SA 1SG8B 1W14U 4H6SB 1BRAA 4JYTA 1E36B 4WH8A 1LHDH 3ZZ9A 1BQYA 2R2WU 1PJPA 1L1GA 2VNTA 5T3HA 3SV6A 1P57B 2NU1E 3FP6E 5T6DA 5TJXA 3P8GA 3ZZ4A 3BN9A 2FDAA 1QL9A 1AUTC 4RSPA 1FY4A 3SUGA 8KME2 5AHGH 1PQ8A 2QF0A 3MU0A 1P9SA 3GICB 4KELA 2ZU2A 2VU8E 4I8HA 2Y5FA 3PO1B 2BD3A 2ZHWH 1LTOA 1EPTA 3TVJB 2B8OH 3EAJA 1AUJA 1SC8U 1WOFA 1QL8A 3FZDA 1MQ6A 2CHAB 3U8OH 1GVLA 2PKSC 2UWOA 3GY2A 1G36A 1KLIH 4NIVA 1DANH 1QB6A 3MH7A 1EZSC 1FY5A 1K1LA 1GCDA 2G8TA 4UFGH 4D8NA 1Z8JB 4HZHA 1SGNE 3ESTA 1GVZA 1P2NA 3BV9B 4MNVA 1E34B 2FLRH 5G4BA 1ACBE 3SQEE 3LDXH 1E35B 3SU2A 1QRZA 1N6YA 2O9QA 4J1YA 1CA8B 1GGDC 2ZZUH 4JYUH 5GDSH 2FMJA 2SGEE 3QTVH 4SGAE 5FX6A 4AB8A 6CHAC 4I8GA 4I8JA 1V2JT 3T2NA 3BEIB 3SQHE 3QTOH 4GPGA 1C2EA 1XUJA 2KAIA 4I31A 2EI6A 1TONA 1CGHA 1DDJA 2W7SA 2F9VA 2EC9H 7GCHF 3BTKE 4ISLA 1C9PA 3PMJA 1UMAH 2HLCA 2VIOA 1L4ZA 4TPYA 4QT8C 1TE0A 4MNXA 4NCYA 2Y80A 1KLJH 1Y5AT 1ESAA 1GDUA 2JH5D 1OP0A 1GHBG 3UNQA 1H9HE 5FPSA 1LPKB 4UD9H 1FY8E 1GCTC 1A2CH 5JB8S 1ZRKA 3DFLA 2P8OB 4UFEH 3U69H 1HAYB 3QO6A 3RC6A 1O0DH 1D3PB 1HBTH 1O3HA 2PTNA 2Q6GA 1ABIH 2K1QA 4LZ1H 1LO6A 4Y10E 1SGTA 3SZNA 1C1QA 5A0AE 1TOCB 2BOKA 4X6NA 2HPPH 2QYIA 2ZCLP 5EW2H 3VB4A 2BLOA 1WBGB 1SOZA 1B0EA 3T5FH 1UVUH 1SLXB 3QDZB 4UFFH 2OC1A 1DUEA 1FDPA 1IHTH 3SJ9A 1TMBH 3RC5A 1LMWB 5I46H 2AYWA 2GTBA 2P3TB 3K65B 3LGWA 3EQ0H 1AD8H 2ZG0H 2WV5A 2GV7A 3PLPA 3SJOA 2BY5X 1DITH 1HGTH 1FQ3A 1YPLH 3BSQA 4CHAC 1ZJDA 3A85A 1F7ZA 3CENA 4K3JA 4XFQA 1BMAA 4B74A 2BDGA 3SHCH 1CQQA 1HV7A 1GI1A 2FPZA 3F9GA 1CBWC 3KGPA 7ESTE 2V35A 2BVRH 4AFQA 3TH4H 5ETXA 4AX9H 5PTPA 1ELFA 4K1EA 1D3QB 1C1NA 3SV7A 4F4OC 3ZZDA 3A7VA 1W11U 4OS2A 1TX6A 3LC5A 2OQ5A 4CRBA 1L1NA 1XMNB 1GBMA 2I6SA 2XBWA 2FO9A 3VPKA 1ZTKA 4ABHA 3SUFA 3DD2H 4X2XA 1A1RA 4JK5A 1IQGA 3RXVA 2BY9X 1GJ7B 5LH8A 4ISIH 9ESTA 3PLBA 1BRUP 1OX1A 1P06A 1T8OA 1A0HB 3OSYA 3LGIA 3SU3A 3BTFE 1FY1A 2BD5A 1ZMJA 2GCHG 2H5DA 2BXTH 2V6NA 3RXIA 1TPSA 3A89A 5FBIA 3URCA 4E7NA 1TPOA 4PROA 4DIIH 1IQEA 3H7OA 3NXPA 1D6RA 5DGJA 4KTUA 1P04A 3BTQE 2VJ1A 2FTMA 1GJDB 4FUBA 4MG3A 1FV9A 3U1JB 8LPRA 1K1PA 4INHA 1IQFA 1GI6A 1DXWA 1UHBB 4GSOA 1BTYA 3VGCB 2ZGJA 2ZHDA 3A8CA 1BJVA 1SHHB 5ESBA 3KIDU 1WCZA 3AASA 4BXSA 2QXHA 2FXRA 2GMTC 1TAWA 1QFKH 1HRTH 5LPRA 3SI4H 2WPLS 1NZQH 1GPZA 2C3SA 3E0NB 4GUXA 4AOQA 1GJ4H 2UUJB 4AYYB 1EZXC 3E91A 1SGEE 4A5TS 1K28D 4DIHH 3MFJA 4DG4A 2ZFPH 4X6PA 3T62A 3HATH 1P3CA 2ZU4A 4VGCC 5A8ZA 1THPB 4YT7H 3BIVH 1GBCA 1GDQA 5DPAA 3ZZ7A 3TK5A 3R3GB 1E0FD 3FVFB 5F8TA 2R0LA 2TGPZ 3E1XB 4ZROA 2XCNA 1TNLA 3CS0A 3F9FA 4Y0ZE 1CGJE 3TNSA 1A0LA 4U2WA 1AKSB 1DOJA 1O35A 2F9NA 4MPVA 5I25A 4CBNA 4LK4A 2IN2A 5DP6A 3ZV8A 1Z6JH 1QBNA 2A1DB 2AMDA 1BOQA 4Q80A 5DP7A 1PPZA 1MTNC 1SQOA 2ZGBH 4AYVB 3MWIU 1OXGA 4ABDA 1YPMH 4A1VA 2BD4A 1ELGA 1NFYA 2OINA 2UUKB 3GCOA 1O5DH 2SGAA 1YP9A 5BPEA 4CH2B 1NESE 2BYAX 1GGDB 1MKWK 3MNBA 4FUFA 1MQ5A 6CHAB 2HRVA 1GBDA 3LH3A 3Q3XA 1O3EA 3A8DA 1GHXH 1VITF 3SGBE 4WF8A 4DT7B 4R8TB 3TH3H 3O8BA 1P2JA 3PB1E 3D49H 1AFQC 4NSYA 4Q7YA 5E2OA 1QY6A 1TFXA 2OC0A 1SGFG 5CHAB 3UR9A 2ALPA 1MD8A 4GCHG 3UPEA 2PHBA 2ZHEH 4CBOA 1OWIA 1PPBH 2XWBI 2IJOB 5LGOA 3P8FA 1QRWA 2ZCKP 2GDDA 1EJNA 3K2UA 1AKSA 1C1UH 3BTME 5JBTA 3GCTG 4A92A 2SGDE 4X1PU 2UUFB 2PW8H 1NY22 2ZC9H 4BTTB 1AVXA 2RA3A 4OS7A 2Z9LA 1MCVA 3GY8A 3ZZ3A 4RKJB 2O8MA 2PUQH 1A5IA 1A61H 3PROA 2DE8A 3AW1A 1AHTH 1MKXH 1SGRE 1NU9A 3ATKA 1O2WA 3MI4A 4R0IA 3SUDA 1JXPA 3VFEA 3ZVGA 1O2GH 3EA8A 2C4FH 7LPRA 1BMNH 1H1BA 1THSH 1O2UA 1ZJKA 4O3UA 1T4UH 1ZR0A 3SU0A 5A0CA 1NN6A 4IMQA 4IN1A 3GY7A 2D2DA 4FU8A 2A2QH 2W5EA 2WUCA 3MH4A 3ZZ6A 2BZAA 5JBAS 3N7OA 1ORFA 2NU3E 1O2KA 4TPIZ 1GJBB 1NM6A 5F8ZA 4FUDA 5JBBS 4IC6A 1HAVB 3VB6A 1EXFA 1WQVH 4YLQH 1C5UA 2F9BH 2GGVB 2ODYB 3KEEA 2W3IA 3U1IB 1EX3A 1SGFA 2FODA 1V2PT 3RMOH 1YCPK 3RXJA 5JDUB 5SGAE 4BAKB 2RDLA 3RXRA 4GLYA 3SN8A 3RUOA 1TPPA 1QA7A 1SI5H 2DE9A 2GP9B 1BRCE 3DUXH 3V12A 4CR5A 1EZQA 2ODQA 4YOGA 2V3HH 3QN7A 4KTCA 4CHAB 1JMOH 3DA9B 1FUJA 1TGNA 1TGSZ 2XC0A 5CMXH 2ZKSA 1LKAA 2BX3A 1BBRH 4ESTE 3RMLH 1CBWB 5EQSA 1S6HA 2BY7X 4AGJA 1K9OE 5ABWA 3L6PA 3RU4E 1YPJH 2H5CA 3RXHA 2AH4X 3EE0B 5GXPA 1VITH 2AMPA 3RM0H 2BVSH 2HNTC 1O3LA 1B5GH 2VVCA 1AZ8A 3TJOA 1GI4A 2BDHA 4XBDA 2ZDLA 1ETTH 1MAYA 1FPHH 2PTCE 3WY8A 3L33A 1HAVA 2JETC 2VIVA 3SU4A 4YTAA 5LPEA 3UOPA 3KQCA 1LVMA 2HNTF 3UNSA 1KXCA 3H5CB 1QURH 3SU6A 6LPRA 1C2FA 1FIWA 2QXJA 3S69A 1ELVA 2B7DH 2ZQ2A 5DG6A 1P12E 1KIGH 4INLA 4IW4E 4Y7AA 3ZVEA 2YNBA 3CP7A 2QV1A 3M61U 4K69A 1ABJH 1PYTC 4MDSA 2AFQB 4BTIB 1V2MT 2VWMA 1TQ7B 3T27A 1FIZA 2I6QA 4JZ1A 1C2IA 2PUXB 3NUMA 1IQMA 1OWJA 1C5NH 2GCTC 5FXLA 4B76A 4XDEA 1FAXA 2HGTH 2BX4A 1HIAB 2F91A 5DP8A 4TWWA 4CRFA 1HUTH 4OS6A 3HGPA 1FY3A 1O36A 3HK3B 3A8AA 3TGIE 1SQAA 4DGJA 4ZHLU 1A46H 2TIOA 1LDTT 3FP7E 4XBCA 1LHFH 2P16A 4DVAU 1XKAC 1GBTA 1GI3A 1C5SA 5EOKA 1TMTH 4ZH8A 3GY3A 4AN7A 5C3NA 1RFNA 3GYMA 2JH6D 1TX7A 2THFB 3SO3A 3RMMH 2SGPE 4VGCB 2NU2E 2SNWA 1V2RT 4X8VH 1MKXK 1HJ9A 3K9XB 2AGEX 2HALA 1HAHH 1IHSH 1L4DA 1C2HA 1SR5C 3LU9B 3CS7A 4NFFA 4A1TA 2BQ7B 1YYY1 5AVDA 3A82A 1F0TA 1SGCA 2G81E 3UTUH 3OYPA 1MTUA 1V2NT 1HIAA 2STAE 4DY7B 1DX5M 2OBQA 2GCHF 2UUYA 3NWUA 5EGMA 6GCHF 2GZ8A 4Q2KA 4INKA 3Q77A 1TNKA 2A5AA 1Y5BT 4JCNA 2LNCA 4CRAA 1S5SA 1AVWA 1UVOA 1SFQB 3QX5H 3O8RA 2WUBA 1NO9H 3PWBA 1C5RA 4K8YA 1ID5H 1NFXA 2HPQH 5EQQA 1HAIH 2SFAA 4GVUA 1MTNB 3TK9A 3MNCA 3S7HB 1ESTA 3M5OA 1VITG 3RXPA 4JZFH 3A7ZA 3SV8A 1MUEB 2VGCC 1DUAA 3M5LA 1C2KA 2ZU1A 1LVBA 3SORA 3GDVA 1CSOE 1VGCC 2YOLA 1BBRK 1QNJA 1T8NA 3M7UA 3P6ZB 1UTNA 2A4RA 3PMHB 3RXLA 1OSSA 4TY6A 1AFQB 1GJ5H 1Q31A 3EA9A 1NFUA 2KAIB 3MU5A 1Z6EA 1O32A 1MZAA 1GMHG 3OY5U 1LVOA 4OS5A 5FCRA 1AWHB 5E2PA 4XE4A 3V0XA 3V7TA 4Z6AH 3O8CA 3ELAH 3KHVA 1OOKB 3LOXA 4BANB 2ZHFH 2BTCE 1O39A 5JBCS 2GZ7A 3O8DA 1XVMA 3RP2A 3A86A 2FOMB 1ZOMA 1AFEH 3KCGH 4MNWA 1SSXA 1G3CA 2WPMS 2BD2A 2A7CA 2VWOA 4B1TA 2ALVA 3RXFA 1C1RA 4Y8XA 1GG6C 3JZ1B 2XC4A 2D8WA 1DWEH 1ZMNA 2AS9A 3I77A 3KNXA 1O34A 5A09A 1UK2A 1H9LB 3RXDA 3U8RH 2QAAA 4JMYA