3GY4A

A comparative study on the inhibition of bovine beta-trypsin by bis-benzamidines diminazene and pentamidine by x-ray crystallography and itc
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Structural binding evidence of the trypanocidal drugs Berenil and Pentacarinate active principles to a serine protease model.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3gy4A02
4AB8A 1A5HA 2VWLA 1T32A 1Z1IA 4NCYA 2TPIZ 1WCZA 4Y8ZA 1TA2A 3DFJA 3BTFE 3GISB 4KGAA 5F6MA 1A0HB 3OX7U 4Z0KA 2FOMB 1YPLH 1YPMH 1YKTA 2XBXA 4X2WA 1OWKA 5BRRE 1DANH 2GV6A 2SGQE 3KN2A 1ZLRA 3RXFA 2J94A 2XBWA 3HKJB 2LNCA 1ACBE 5CHAB 2ZGBH 2UUYA 1KXBA 1N1LA 4JZDH 4X6PA 1PPGE 2BY6X 4ZXXH 1SMFE 4YM9A 1KLIH 1YLDA 1A7SA 1Y3VA 3TIUA 3RXOA 2XW9A 5E8EH 4VGCC 1WUNH 2R0LA 4Q2KA 1HXFH 3GCHB 3GOVB 1QBOA 2SNWA 2VU8E 1FV9A 3GDUA 4Y79A 4O3TA 3QTVH 4I7YH 1TNGA 1ABJH 4AFSA 3GY4A 7ESTE 2HOBA 5JYIA 1UTPA 2F9VA 1Y3YA 3OY6U 1W10U 2VJ1A 1CA8B 2PKSB 4Y10E 2OD3B 3V0XA 2XWAA 3GCTG 2Z9GA 1GJ6A 3NZIA 1A4WH 4B75A 1GBFA 4IBLH 3PLBA 4WXVA 5FCKA 4A7IB 2O8MA 2H2ZA 3UR6A 1AN1E 2WPJS 2A4GA 1P3CA 1SLWB 4MPWA 1HLTH 5A8ZA 1ID5H 4MNYA 3I78A 4NA8A 1BQYA 4HFPB 4DCDA 1HDTH 2ZC9H 4BAHB 3I77A 1RFNA 1O2HA 4UEHH 4X6MA 2GCHF 3E6PH 1LMWB 4MTBA 4X8VH 3B9FH 2PUQH 3M61U 3W95A 5T3HA 4FXGH 1EPTA 2ZDLA 3TLOA 2VB0A 4ABAA 3URDA 4WJG2 2P95A 3Q3KA 4MPVA 4I8LA 1GPZA 1L4ZA 5C20A 1O2ZA 3PWBA 3O8CA 3GY6A 2KAIB 4DJZB 2ZTYA 1V2UT 3BTWE 3GY5A 1XMNB 1G3CA 2AIPA 1KY9A 2TGDA 1EJAA 2VH0A 4MDSA 3UIRA 4XFQA 2CMYA 1TGNA 1DE7H 4AZ2B 1MMJN 3M3TA 1F0UA 1QB9A 4DIIH 1GI9B 1SSXA 1EJNA 4KP0A 1ZZZA 1FI8A 3P8NA 3Q76A 2XC0A 5EXMA 1C2LA 1K1NA 1EAWA 1V2TT 4BTIB 3E8LA 3O8RA 4GSOA 3SUFA 4DY7B 1TX7A 1H9HE 1S0QA 1UHBB 2V3OH 3SNDA 3UUZA 2VIQA 1C5UA 1K1OA 1LHFH 1DPOA 1Y8TA 2F83A 1HBTH 5DP3A 2PR3A 1LDTT 1CE5A 1MQ6A 1OP0A 4JK5A 1TMTH 3BTEE 1FPCH 4SGAE 1MBMA 4ZKSU 1OXGA 1LVOA 1QJ1B 2EA3A 1SGCA 3KCGH 3VXEH 2ZTZA 1YPHC 3SNEA 3UWJH 3OSYA 4X2XA 3N7OA 5B6OA 2BLQA 3BTGE 1C5WB 3SOSA 4X1SU 1S6FA 1C5LH 1S5SA 3U8TH 3D23A 1SGFG 1OWEA 2VWNA 1CT4E 1T8LA 4YO9A 5LPFA 1O3HA 1W8BH 1TALA 5H4IB 3UNQA 2FEQH 2W7SA 5HYOA 1G32B 8GCHG 3NPSA 4NIWA 1VITH 1EAUA 1EXFA 3A83A 3K6YA 2ZA5A 1LTOA 1BTYA 4I33A 3RM2H 4YOIA 1HAHH 3S69A 1DICA 2C8XB 1ARCA 1HNEE 2QYIA 4BNRA 2ZU3A 4VGCB 1A0JA 2FMJA 3SNBA 1AB9C 1UK4A 1GJCB 1C5ZB 1EOJA 3MH6A 2C3SA 3BF6H 1FIWA 1T7CA 3MNSA 2VWOA 4ABIA 5I46H 3SU5A 4CRGA 3BEFB 3SQHE 1O3MA 1GI2A 1YBWA 4IN2A 1B7XB 2SFAA 4NIXA 5DG6A 4AFQA 4B74A 1ELFA 4NIVA 1XVMA 1C5TA 2G5NA 1QB6A 1DM4B 2UUJB 3AVZA 3RMOH 2BY9X 3SV7A 1YYY1 2GCTC 2TGTA 1LPGB 4FUHA 1CGJE 1AU8A 1C2MA 4MG3A 1JBUH 1KSNA 3QLPH 1O2NA 5CMXH 9ESTA 1KYNA 4ZKRU 1KDQA 1ORFA 4LOYH 2AS9A 3BTQE 4K69A 5G4BA 4ESTE 4ISIH 3RXCA 1P8VC 2ANYA 3SU6A 1WSSH 5I25A 1TX6A 2ZGJA 2ZHFH 3U8RH 1P2NA 1P09A 1SC8U 2XRCA 2BYAX 5CE1A 1IHTH 1ETTH 2BQ7B 3TH3H 3RMNH 3QZQA 3RXEA 3T62A 4X0WU 1LHEH 4X8TH 3TNSA 3TK6A 1PQAA 3PWCA 1S84A 2PSYA 1D6WA 1EX3A 3SORA 3U9AH 3ZVBA 1MTNC 5PTPA 1QBVH 1G3EA 2D2DA 1BHXF 4K8YA 2BY8X 1HAIH 1C2HA 1SQOA 3BIUH 5EW2H 3GYLB 2NU1E 3QDZB 3V12A 2PKAB 3K65B 2G8TA 2LPRA 1DWBH 2ANWA 2ULLA 1L4DA 5HM2A 1K1JA 1BRBE 1TPPA 2FI3E 1PPZA 1GBCA 1GL1A 1KXEA 1A2CH 3A7WA 1TNLA 3KQBA 2ZHQH 1FY3A 1DX5M 3EQ0H 5C3NA 2ZI2H 3SW2B 1NU7B 2BOHB 1RIWC 4K60A 3RUOA 2QGRA 1S6HA 2A45B 2W3IA 3UR9A 2RA3A 4YLQH 3ELAH 1AVWA 2A4OA 1IOEA 1V2WT 2AIQA 1QIXB 2F9NA 1TPSA 2FYQA 1VJAU 3LGYA 2HPQH 1QR3E 2CF8H 1D4PB 4AYVB 3F9FA 1BDAA 2H5CA 3WY8A 1G2LA 5DP7A 1TMBH 1BBRH 1O2TA 2HNTF 1FMGA 4JZIA 4NGAH 3U69H 1O5AB 3F9GA 4BXSA 1ANEA 2PWXA 2H9HA 2HVXA 2RDLA 2P3FH 2GX4A 2RCEA 1XUFA 2ALPA 2O8UA 3GY3A 1EUFA 1QL7A 4HGCA 1AO5A 3ATIA 2ODYB 2ZU1A 1THRH 1BRAA 3QK1A 1XXFA 2VIPA 8ESTE 1AI8H 2AEIH 2XBVA 4DT7B 4ZHAA 2KAIA 4Y6DA 4A1TA 3A89A 4Y11E 4WH6A 2ZKSA 1ZOMA 2AGGX 5J4SA 2EI6A 2SGFE 1KIGH 5C2ZA 1QA0A 1PYTC 4UFEH 4I32A 3LPRA 1KLTA 3SJIA 4WXIA 4B1TA 1Y5AT 4CH8B 1AB9B 2IPHA 3LJOA 4ISOA 1VR1H 2FOAA 3VB5A 7LPRA 3A88A 3TH4H 4MPUA 3NCLA 2OC7A 3T28A 1EB1H 2BDIA 1TRNA 4ABGA 4H42U 2GT7A 5LH8A 2XWBI 5E2OA 1TGCA 1F0TA 1O2WA 1L1GA 1FZZA 4ZKOU 2G52A 3MFJA 4NWKA 4ZMAH 1LVMA 1UHBA 3Q77A 2NU4E 4H4FA 1AY6H 1SGRE 1CVWH 4X6OA 1OKXA 1PPHE 1UTMA 2ALVA 1O3OA 1K9OE 1RGQA 1TWXB 2BDBA 2GCTB 2ZFQH 2ZPSA 1T8MA 1TAWA 3MWIU 5HGGA 3MH4A 1ELTA 1BJUA 4O3UA 1B0FA 1P3EA 2P16A 2NU0E 5C1UA 3L6PA 2Z6BD 3AAUA 1O32A 8LPRA 8KME2 2ZHEH 3RXUA 1HAOH 1GDQA 1O37A 1RXPA 3D49H 4MLFB 4FU7A 1V2PT 3MU4A 1GCTC 4CRCA 1DSUA 1NROH 1K1MA 1FY4A 2FP7B 1O2YA 4JZFH 5DKMA 2H6MA 2GZ9A 2HLCA 3FAOA 1O3DA 2QCYA 1TB6H 2BD2A 3GY2A 3M3SA 5FHTA 5C1XA 1W0YH 2PHBA 3EA8A 4GUXA 1RS0A 1E37B 2QXGA 5JBCS 1MTNB 3NXPA 2Y80A 2V0BA 4X8UH 1ZHRA 4ASHA 3EE0B 2G5VA 1HXEH 1FNIA 1TPAE 1ZPZA 2BLOA 4KTCA 3TPIZ 4INKA 1O2RA 2VIVA 1E38B 3FP7E 4CRBA 4A5TS 3M3VA 1V2JT 1ZJDA 1O2UA 1C2GA 1FN8A 1AWFH 2XC4A 5JDUB 1C2EA 2A5IA 3MU5A 4UD9H 2G4UA 4NWLA 2J34A 3R0FA 3VPKA 1DXWA 4D8NA 1Z8RA 1AE8H 1EZSC 4K1EA 1QTFA 6LPRA 1K28D 4Q7XA 5A2MH 1RIWB 5FXLA 2VIWA 1TGBA 2A0QB 1C5YB 2JH5D 2VGCC 1UMAH 2VH6A 3M7UA 1K1IA 2OC1A 6GCHG 2FTMA 2R2MB 4ZHLU 1EAIA 2CN0H 3TNTA 1BTHH 4AYYB 4RSPA 2H9TH 2F3CE 2GMTC 1VGCC 1XUGA 1LKAA 5L2ZH 5A8XA 1PJPA 4GHQA 2Q6DA 4Y0ZE 5AHGH 1DT2A 1LCYA 2HPPH 2JH6D 5F8XA 4OS5A 3SO3A 4IMZA 1VCQA 4LK4A 1GI3A 2QN5T 1GHYH 3MHWU 1RTFB 3MNXA 1Z6JH 2A2XH 1H9LB 1WAYB 4JZEH 2JKHA 5JB8S 1O3KA 1S83A 1UVPA 3A8DA 1FQ3A 4KKDA 1WTHD 1EQ9A 1PQ8A 1D3DB 5E0JA 1NY22 5EPYA 2VVUA 1UTLM 2VNTA 3RXBA 1O2GH 3EYDA 4FUIA 4A1XA 3UQVA 4CRAA 1Q31A 4U01A 1TQ7B 2PKAA 4D7FA 1FONA 4Q7ZA 1AQ7A 1JIRA 3F1SB 2ZECA 1MAXA 1TBZH 2FI5E 3P70B 4ABDA 1DVAH 3SU1A 1KXAA 4AG2A 3PB1E 3BTHE 1YCPM 1MD7A 2YNAA 3A7XA 3UOPA 4KTSA 2AH4X 4NFEA 1C9TA 2A5KA 1DSTA 2VWMA 1MBQA 3ITIA 1WU1A 3B8JA 1T8NA 1SBWA 3F9HA 5GWZA 4SGBE 1O2SA 1HGTH 1TRMA 1NRQH 2G55A 5F03A 2ZCHP 1GBIA 1LQEA 3RLWH 1F92A 5FBEA 3LIWA 1GI5A 4HTCH 1O2KA 3K2UA 4FUJA 2SGDE 1NFXA 2JH0D 1ESBA 4FVDA 2QXHA 1QA7A 3BG4C 1GCTB 4I8JA 2Z3CA 1DWEH 3M5NA 3KGPA 3OTJE 1GJ8B 2FOFA 1C2IA 1JRTA 3T26A 6CHAC 3SI4H 1BRUP 3VFEA 1O2QA 7GCHF 5EODA 1O5FH 1THPB 1H4WA 4AN7A 1C5PA 2FLBH 1A0LA 2QF0A 1YPKH 2EI8A 3F68H 1HFDA 2TRMA 4A1VA 1LPKB 4OS6A 1QQ4A 1NT1A 1AMHA 2OBOA 3UY9A 2BB4A 2PTCE 4ZKNU 1S81A 5GIBA 2BDAA 1AFQC 3GDSA 3SU0A 4AB9A 1S82A 1C5MD 3HGPA 1TYNA 3ATMA 3P95A 1EKBB 4CBNA 4TWWA 3H7TA 1GHBF 4ABJA 4J2YB 1FJSA 1P2MA 1C1NA 1DY9A 2HALA 4B71A 3GICB 2XC5A 3A8CA 1F2SE 2A31A 3PMBB 3A8AA 3KQCA 3KNXA 4K3JA 3UQOA 1XX9A 1QCPA 2VGCB 3P92A 1GCDA 2Y5GA 1A1RA 1C4Y2 1Q3XA 3PMHB 2ZWLH 3ZZ6A 4K1SA 2A7HA 4ABHA 4WVPE 3RXMA 3ZZ5A 4JYUH 2WPHS 2WV4A 1YM0A 3LOXA 2GMTB 1VGCB 2O9QA 2DUCA 2WINI 3MO6A 4B73A 3P8GA 2FODA 3RXKA 2Y82A 1SB1H 1SLXB 2B8OH 2VIDA 1UO6A 2O8WA 2VVCA 1ZJKA 5C5OA 3STIA 3MNCA 5LPEA 1DXPA 1ZTKA 1ZSKA 2CF9H 2H1UA 4LZ1H 3BG8A 4MNWA 3UOUA 2ZDKA 3S9BA 5T6DA 3RXQA 5JBTA 3SGBE 3MH7A 4CREA 3TGKE 1P9UA 2BD4A 4NFFA 1C4U2 1NS3A 1O36A 4FVBA 1WQVH 3B23B 3U1JB 1C1MA 1TOMH 1ZSLA 1NPMA 1AE5A 3MNBA 4NA9H 2AMQA 4J1YA 1GBAA 3PM3A 2TGPZ 1P04A 1Z71A 2ZU4A 2G81E 3KQDA 1JIMA 2ANMH 4OGXA 3VEQB 4AFZA 1BUIA 1GMCF 1P02A 5L2YH 3PTNA 1KXCA 1SFQB 1IQJA 5ESBA 4B76A 1J9CH 4X1PU 3RXIA 1ZMLA 3UNRA 4NA7A 1MKWH 4UFGH 2FYRA 1BRCE 1HJ9A 3C27B 3NK8A 3SNAA 2PTNA 1P0SH 4FUEA 1O3LA 2ZP0H 5F8ZA 5A09A 4BAMB 2W26A 4E7NA 1WBGB 3AAVA 3RU4E 2ZDNA 3AW1A 3CS0A 3QX5H 3RC4A 1ELEE 4Q7YA 5T6GA 3BG4B 3ZVFA 3I29A 2BXTH 1F5KU 4AFUA 4UONA 1SR5C 4JCNA 1LHGH 4AG1A 1EB2A 2Z7FE 1O3EA 6CHAB 5FPYA 3PMJA 2BVXH 1GBEA 2M5TA 2Z94A 1O3JA 4ZH8A 2VVVA 2C4FH 4IW4E 1CQQA 3LU9B 4NG9H 1B5GH 2P3UB 4JK6A 1OWJA 1P11E 4ISLA 3PROA 1MKWK 4Z6AH 1TX8A 3MMGA 3QZRA 1V2RT 5T6FA 3SUDA 1CBWC 1O3GA 1GG6C 1GHXH 2A4RA 4GLYA 1Z1JA 1YCPH 3UTUH 1YP9A 1EOLA 1H1BA 1YC0A 1AFQB 1MTVA 1HV7A 3PV4A 4ZUHA 2BM2A 2ZGHA 3BTME 2BD5A 3SI3H 1W0ZU 2F91A 2AFQB 1K22H 5FX6A 3DA9B 3RXHA 5EPNA 1DITH 4LXBH 3FANA 1F7ZA 3SV2H 4AGJA 2A1DB 4CR5A 1Z7KA 1QNJA 1PYTD 1HYLA 2ZFFH 3V13A 3RXAA 4E05H 2ZDMA 1RTLA 2PLXA 1N6YA 1SHHB 3MU8A 7GCHG 3ZZCA 1AUJA 1LHDH 3JZ1B 2GTBA 1UK3A 1YCPK 4LZ4B 2ZO3H 1YPJH 3VB6A 2B5TB 3ZZBA 3FVFB 1GJDB 3SUGA 1TNIA 1MCTA 2YOLA 1LVBA 1BCUH 1HB0B 2H5DA 2OCVB 1Q2WA 5FCRA 2P93A 1A5GH 3FFGA 4ZAEA 4BAOB 4X1NU 1GVKB 2QAAA 1XXDA 3DFLA 5HM9A 1V2LT 4K8BA 1BITA 4IC5A 1ZRKA 1BJVA 1EJMA 1J8AA 2ZHDA 4X2VA 2FS8A 3A80A 2GCHG 1C1UH 3LC3A 1O33A 1GHBG 1H8IH 1C5XB 1GBTA 1SGDE 2FPZA 2QXIA 3SV6A 2W7UA 3LGIA 2WUBA 1BTXA 3FZDA 2OBQA 1O3AA 2ESTE 1NRSH 1PPEE 3KEEA 2F9UA 1O3NA 2ZU5A 2BLWA 3RP2A 4JZ1A 2AERH 1A3EH 1SGNE 3HK3B 2ZF0H 2FDAA 2STBE 3STJA 3DUXH 1DLEA 1UTJA 4UDWH 2ZU2A 1ANCA 1SGQE 4XDEA 1HPGA 5FAHA 5EU8A 3M36A 4CBOA 1GHVH 3MI4A 4OS2A 3ATKA 3ZVEA 1O3CA 1GJBB 3JZ2B 5EQRA 3SJ9A 2FIRH 2SGAA 3LC5A 1GJ7B 4TWYA 1K21H 2EI7A 2C8YB 3MO9A 3GY8A 4Y71A 3SNCA 4X6NA 4JYTA 1UTNA 1MH0A 2FM2A 1PPBH 1AHTH 1SOZA 2ZNKH 3ZZDA 3AASA 3ZVDA 2WYGA 3U8OH 2Z9IA 1J14A 2ZG0H 3QWCH 5HXFA 1TE0A 2GZ7A 1T4VH 3FP8E 1W13U 1HJ8A 5E2PA 4Q80A 2QC2A 4THNH 5AF9H 5IYTA 1O5EH 1UCYE 1ZRBA 1T4UH 3D65E 1K1LA 1BT7A 1A61H 1FPHH 1SGEE 4O97A 1V6DA 2G4TA 5GXPA 1HJAC 4WH8A 3QTOH 4AOQA 2J2UA 1D3PB 1FN6A 5LGOA 1GMHF 2W5EA 2GDDA 2Z9JA 2OQUA 5E0GA 1O5CB 2HNTE 1QHRB 2XCFA 1C1PA 4BOHA 4IS5A 1AZ8A 1OOKB 2D26C 3ZVAA 5DK1A 3UWIA 4WF8A 3HATH 5C67A 1W3CA 5A0AE 4ZHMU 2O8TA 3GCTF 3LT3A 2K1QA 1CBWB 1GMCG 1O3IA 1GG6B 1H8DH 2BDHA 4RN6A 5EXLA 3RXGA 3S0NA 3RXSA 2P8OC 3IITA 1ZGVA 3TGJE 1O2OA 1GI6A 3LONA 4DVAU 1O2XA 2DE8A 4ISHH 1ESTA 1FDPA 3PLPA 4IC6A 4RKOB 2R3YA 1G36A 1SFIA 2OP9A 2ZPRA 1TBRH 2BDCA 5EQSA 3A82A 4WWYA 4OS7A 2ZDVH 4Y8XA 1O2IA 1C5QA 3TJOA 1NRNH 1EASA 2PGBB 2FOHA 4TY7A 3A7ZA 2OLGA 1FY8E 4CR9A 4ABBA 1UK2A 3PTBA 1UCYK 1Y3UA 4GPGA 2F9PA 2Y5HA 5DPAA 2P3TB 1P03A 3OYPA 1C2KA 1SOTA 1F0SA 5E0HA 3QO6A 3BV9B 1XKAC 2BQWB 3M35A 1ELDE 5AFZH 1PPCE 1SGPE 2WYJA 1QL9A 1NU9A 3HKIB 4AORA 2JETC 1DOJA 1CSOE 1LO6A 3ZZ3A 1E35B 3D62A 5DJ7A 1LKBA 1KXDA 2BVSH 1CU1A 1FLEE 1MTWA 3E90B 1O2PA 3GDVA 3VB3A 1QBNA 1ELAA 1Y59T 1TNKA 1AFEH 1ABIH 1SLVB 1H9IE 1ZSJA 3ZV8A 3ZZ4A 1P01A 2GD4B 5AFYH 3ODFA 3FZZA 3KIDU 1GDNA 1GMDF 4JYVH 1XUHA 3GY7A 2CXVA 4I8GA 1LQDB 1HAVB 1Y3WA 1RTKA 2ZFSA 1TNJA 1MQ5A 4NZQA 2TIOA 1CA0C 1W14U 2GV7A 1C2DA 1O35A 1V2ST 5DGJA 4ZXYH 4YTAA 1NESE 3VGCC 1UTQA 5JPMH 3Q3XA 2FOCA 2J4IA 3TK9A 1WTGH 2Z3DA 1GBJA 3BTKE 2CJIA 5EXNA 1VJ9U 3PO1C 3W94A 2TBSA 1MCVA 2NU2E 2F9BH 4BXWA 1ZR0A 4MQAA 4NIYA 4KELA 4M7GA 2BD9A 1ANBA 4HI3A 3EGKH 2C8ZB 3RXDA 4GVUA 4AGKA 3FP6E 4D76A 1TFXA 1JMOH 2BY5X 1G37A 1GBMA 1GL0E 1ZTJA 1SHYA 1V2VT 5FBIA 1SVPA 3SQEE 1B0EA 2V3HH 3F6UH 1OX1A 8GCHF 1W12U 4YESB 2ZDAH 3LDXH 1TGSZ 2P59A 1JRSA 3RC5A 1J16A 1ZYOA 2FOGA 2FXRA 1OYQA 3P6ZB 2Y7XA 1ZPCA 1GI4A 4BTUB 1OSSA 2WV5A 2GKVE 2GGVB 5GDSH 4A92A 1PPFE 1HJAB 2C8WB 2QY0B 5DP8A 5A8YA 2J38A 4X1QU 3TH2H 1ZMJA 3ZZAA 2TGAA 3BIVH 1O3PB 1TONA 1KTSB 2WUCA 2WPKS 3KL6A 1FAXA 2EC9H 3TJNA 1G30B 1W7XH 5GPIB 3SJKA 4CRDA 4B2BA 5EW1H 1D9IA 1NM6A 1QB1A 1T31A 1ETRH 1QRXA 3MTYA 1WOFA 3T29A 2P8OB 1CHOF 5GJ4B 4K2YA 3MH5A 2F9OA 1SI5H 4O9VA 5SGAE 1ZHMA 2UWOA 1OS8A 1HUTH 1W7GH 2ZCKP 4BAQB 3M7TA 1TA6A 1GVZA 3L33A 1XUJA 5F8TA 1P2KA 3MYWA 1IQMA 1IQIA 3K6ZA 1GI1A 1THSH 2ZQ2A 3RXJA 3VXFH 1NZQH 4B2CA 1W11U 2HNTC 2O8LA 2AMDA 1C5OH 1FIZA 1GHWH 4H6SB 1WYKA 1C2FA 4FUDA 2CHAC 1P2OA 1GMHG 1IQNA 1V2OT 3UNSA 1HIAB 1DUEA 1ANDA 1TNHA 3S7KB 4GCHF 2FS9A 2JETB 4D9RA 1IQEA 1NN6A 4WY3A 1GI8B 3DD2H 2BDYA 1MKXH 1AD8H 4E06H 1EZXC 1O30A 2WPLS 2UWLA 9LPRA 1HCGA 2ANKH 3TVJB 3NKKA 4X2YA 1AKSB 3KHVA 2AGEX 1P9SA 1G3BA 3PLKA 1OWDA 1CT0E 1SGFA 5EG4A 4BAKB 3E0NB 1KXFA 4GAWA 3SBKA 1BMMH 3M5LA 1NO9H 1O39A 4FUCA 4DIHH 1O5BB 1C9PA 1DLKB 2IJOB 2OC0A 3MOCA 3O8DA 4FUFA 1CA0B 2PW8H 1FUJA 1MAYA 2BD8A 1IQLA 3ZZ8A 1O5GH 4I8KA 5L6NH 3ESTA 2FX6A 2AMPA 5IDKA 4BTTB 1TMUH 3HK6B 5EQQA 3VGCB 3ZYEA 2QXJA 1IQFA 1GJAB 3QUMP 5TJXA 1JWTA 5BPEA 2W3KA 3O8BA 3RXRA 1CGIE 1HAZB 1OP8A 1MKXK 4XBCA 3MU1A 1U6QA 2ZQ1A 3Q00A 3DT0H 1CHGA 2A2QH 1C5SA 1AWHB 1BTWA 1QURH 3PO1B 2OTVA 2PSXA 1C2JA 4FUGA 1T8OA 2H9EH 1O0DH 1UTOA 5GCHF 1SGIB 1C1QA 2ZZUH 1ZMNA 2BHGA 1QL8A 1GWAA 1GHAF 3BN9A 3A8BA 3KQEA 1VITF 3BEUA 3C1KA 1O2JA 2Y6TA 3SUEA 3ZVCA 3TGIE 2BY7X 3EDXB 2GT8A 4TY6A 1QRWA 1ELCA 5DP6A 1GMDG 1UTKA 2BTCE 4INHA 3RLYH 4E7RG 1DFPA 1WQSA 1SQTA 2FLRH 2QF3A 1P2QA 3LGWA 1FXYA 5A0CA 1J17T 3E16B 1YLCA 1EATA 3QGNB 3P8OA 4OS4A 5JBBS 1WV7H 3VB7A 3H7OA 5EGMA 3V3MA 3RXPA 3TITA 5LPRA 5FX5A 1O31A 3LGUA 1BHXB 4K1TA 3E3TA 3LGTA 2PFEA 1QY6A 1C1RA 1N8OC 2OXSA 3RM0H 2FTLE 1C4V2 1HAVA 4WMDA 1HAXB 3M37A 3A7TA 5C5NA 4B2AA 2OUAA 1MU8B 2Q6GA 4AX9H 1M9UA 3UPEA 3MO3A 1RRKA 1OYTH 1MU6B 1GI0A 1ZPBA 2ODQA 2RA0A 2WPIS 1TIOA 3P8FA 3TJVA 1AIXH 3E91A 3ZZ9A 1BMLA 2THFB 3F9EA 3HPTB 3SZNA 5DP9A 1E0FD 4WMFA 1D3QB 3ZYDA 3TJUA 2XYAA 1INCA 1S85A 2ZPQA 4Y7AA 2FO9A 4QT8C 2GVFA 1X7AC 3M5MA 3URCA 1HAGE 1BB0B 5JBAS 1L1JA 1XKBC 2FOBA 4YOGA 2R2WU 4WMEA 2XCNA 2YNBA 4MPXA 4CHAC 1HAYB 4NZLA 4YLUA 2XNIA 2STAE 2A7JA 2FI4E 1MZAA 4UFFH 1N6XA 3MU0A 1TGTA 2CHAB 2WPMS 1P06A 2HGTH 5ETXA 1QJ7B 2QIQA 4Y8YA 3OY5U 1ZTLA 4YZUA 2A32A 1IQKA 1DS2E 2V6NA 3RXTA 1EPTC 2B9LA 1E34B 2Q1JA 4DG4A 3SJ8A 1PQ5A 1SPJA 1L2EA 2D1JA 4K5ZA 3ZVGA 4U32A 2HRVA 3BSQA 2C93B 2GZ8A 1ESAA 1EAXA 2D8WA 1GGDC 1MUEB 1JOUB 1CHOG 1V2MT 2FWWA 5TCAA 4U2WA 4INLA 4Y76A 2R0KA 2ZFPH 2FZZA 1Z8JB 1DUAA 3R3GB 1DWCH 1NRRH 4FU9A 2SGEE 1UVTH 4OS1A 5HMAA 3SJOA 1D6RA 1BZXE 1DWDH 4MVNA 1O5DH 3SHAH 1C1SA 1F5LA 2R9PA 2SGPE 1O2LA 1UVUH 2R3UA 2BD7A 2ODPA 2Q6FA 2UUKB 3HGNA 1HRTH 2OINA 1IAUA 4YT7H 3A86A 3PYHA 4I31A 2BMGB 4UFDH 2ZEBA 2G51A 2CGAA 1GBLA 2GDEH 6GCHF 1QRZA 1IQHA 1KLJH 1MD8A 3BTTE 3RMLH 1RD3B 2I6QA 3EAJA 2A5AA 3Q3YA 1MZDA 4GCHG 4IGDA 3T5FH 1K2I1 3NUMA 3IWMA 2C90B 1BTUA 1O3BA 1LVYA 4HZHA 1NFYA 3U1IB 4OGYA 3BEIB 2B7DH 2J95A 3S9CA 4MNVA 2RG3A 1YGCH 4XBDA 1KTTB 1BMNH 1V2KT 1A46H 4FU8A 4U30A 4YOJA 2I6SA 1C1VH 2AGIX 5FPSA 4DURA 1P10A 1O3FA 3RU4D 1HIAA 3E0PB 1GBHA 4TYDA 3OU0A 5A0BA 1L0ZA 2BQ6B 2PGQB 1ARBA 2XBYA 1W2KH 1VZQH 7KMEH 1YF4A 1Z8GA 1K1PA 4H6TA 4X1RU 3A7YA 1OWHA 1Y5UT 3NWUA 4Y0YE 1UVSH 4NSYA 1Y5BT 1NFWA 2XTTB 3CS7A 1AKSA 2BOKA 1G3DA 1BBRE 4KTUA 4R8TB 1UJ1A 1SL3A 2V35A 1JXPA 1N8OB 3T2NA 1LHCH 1BMAA 1O38A 4ISNA 1P2JA 2A7CA 2B0FA 2FOEA 3LH1A 1BA8B 2BXUH 1NFUA 3A85A 4GHTA 1GJ5H 5L30H 1SGTA 2BX4A 3A81A 4XE4A 1ELVA 1QFKH 5GCHG 3TU7H 1E36B 3V7TA 1V3XA 1GHAG 1VITG 1IHSH 1GDUA 1FY5A 3CENA 1O2VA 3GCNA 1QGFA 2ILNA 4FUBA 3L3TA 3ODDA 3RC6A 5ESTE 1UVOA 3DHKH 3ATWA 1C5VA 1TOCB 2ZIQH 1NC6A 1EP5A 2BZAA 1S0RA 4CHAB 2DE9A 2PUXB 2UUFB 4TPYA 2PV9B 1AUTC 4MNXA 4ZROA 4D7GA 1UCYH 4F49A 3RXVA 2FESH 1EP6A 2ZCLP 4BANB 2NWNA 2ZGXH 5DO4H 1GVLA 2Y5FA 1AVGH 2ZFRH 1BBRK 4RKJB 3SV8A 2ASUB 3A84A 3PMAB 2BVRH 1EPTB 1V2NT 3SGQE 1QJ6B 2QV1A 4IMQA 2UWPA 2AYWA 4DOQA 1O34A 2Z9KA 6ESTA 4X8SH 3GCOA 1C1WH 3VB4A 1HAPH 1GI7B 1ETSH 1GGDB 1YPEH 4O03A 1P2IA 3RMMH 1DY8A 1XVOA 1F5RA 4NSVA 4JMYA 5CHAC 5EOKA 3SU4A 1L1NA 1CT2E 1SGYE 1EZQA 4ABFA 3S7HB 1C5NH 3IG6B 1GHZA 3EA9A 5TCCA 1VCWA 1XUIA 3ATLA 5ABWA 1CO7E 3RXLA 1Y3XA 3GCHC 1ZHPA 2BZ6H 4CH2B 1XUKA 1F0RA 2BDGA 2Z9LA 4D9QA 1PFXC 3UFAA 1CGHA 2HWLB 1Z6EA 3GYMA 1GBDA 1GBKA 2G00A 2PKSC 4TPIZ 1C1OA 3RDZA 1OWIA 3RU4T 1TABE 1TQ0B 1TPOA 1OPHB 2ZGCA 4XBBA 1AZZA 1G9IE 1V2QT 1GJ9B 3H5CB 1ELGA 1ELBA 1EZUC 2J9NA 1J15A 3QGJA 1SQAA 2P94A 4DGJA 5K0HA 5FPTA 1P05A 1QQUA 2BD3A 4DW2U 1MTUA 3CP7A 1BTPA 4UE7H 5C1YA 2SNVA 2Y81A 1XM1A 1A3BH 1G2MA 2OC8A 1BTZA 4R0IA 3ZV9A 1LPZB 1SG8B 1C5RA 1YPGH 1TLDA 1NRPH 2A4QA 3M5OA 2BLVA 2FX4A 1DDJA 2BX3A 3LJJA 1AVXA 3SU3A 2VINA 4Y7BA 1FAKH 1C1TA 3SV9A 2VIOA 2ZFTA 2ZHWH 1TBQH 1BIOA 2IOTA 1P12E 3BTDE 5DP4A 5K7RA 3E1XB 2IN2A 1GBBA 1P57B 2NU3E 3S9AA 5AVDA 2XXLA 3U98H 2CV3A 3SU2A 1IQGA 3K9XB 4XOJA 1YPHE 2QA9E 3LKWA 4A6LA 4XSKU 3T25A 3LGVA 2EEKA 3T27A 3A87A 1O2MA 1SLUB 3M7QA 1PQ7A 4ABEA 3P17H 1RJXB 3SN8A 1Z8IB 3KF2A 1VCPA 1ZGIA 2ZTXA 3TK5A 1MTSA 5DP5A 1BOQA 1D3TB 4IN1A 1OP2A 1A5IA 2OQ5A 1GJ4H 2Y7ZA 3SHCH 1NTPA 3ENSB 2GP9B 3EA7A 3SGAE 4CRFA 4PROA 5J4QA 3UREA 4I8HA 1AGJA 5JB9S 3ZZ7A 4YT6H 3A7VA 2J92A 3AW0A 3QN7A 1KDQB 1FY1A 1TRYA 3LH3A 4F4OC 2Z3EA 3G01A
chains in the Genus database with same CATH superfamily
4AB8A 1A5HA 2VWLA 1T32A 1Z1IA 4NCYA 1COWD 2TPIZ 1WCZA 4Y8ZA 1TA2A 3DFJA 3BTFE 3GISB 4KGAA 5F6MA 1A0HB 3OX7U 4Z0KA 2FOMB 1YPLH 1YPMH 1YKTA 2XBXA 4X2WA 1OWKA 5BRRE 1DANH 2GV6A 2SGQE 3KN2A 1ZLRA 3RXFA 2L6OA 2J94A 2XBWA 3HKJB 2LNCA 1ACBE 5CHAB 2ZGBH 2UUYA 1KXBA 1N1LA 4JZDH 4X6PA 1PPGE 2BY6X 4ZXXH 1SMFE 4YM9A 1KLIH 1YLDA 1A7SA 1Y3VA 3TIUA 3RXOA 2XW9A 5E8EH 4VGCC 1WUNH 2R0LA 3DSPA 4Q2KA 1HXFH 3GCHB 3GOVB 1QBOA 2SNWA 2VU8E 1FV9A 3GDUA 4Y79A 4O3TA 3QTVH 4I7YH 1TNGA 1ABJH 4AFSA 3UAIC 3GY4A 7ESTE 2HOBA 5JYIA 1UTPA 2F9VA 1Y3YA 3OY6U 1W10U 2VJ1A 1CA8B 2PKSB 4Y10E 2OD3B 3GS9A 2XWAA 3GCTG 2Z9GA 3V0XA 2W6ID 4B6FA 1GJ6A 3NZIA 1A4WH 4B75A 1GBFA 4IBLH 3PLBA 3WWFA 4WXVA 5FCKA 2XOKD 4A7IB 2O8MA 2H2ZA 3UR6A 1AN1E 2WPJS 2A4GA 1P3CA 1SLWB 4MPWA 1HLTH 5A8ZA 1ID5H 4MNYA 3I78A 4NA8A 1BQYA 4HFPB 4DCDA 1HDTH 2ZC9H 4BAHB 3I77A 1RFNA 1O2HA 4UEHH 4X6MA 2GCHF 3E6PH 1LMWB 4MTBA 4X8VH 3B9FH 2PUQH 3M61U 3W95A 5T3HA 4FXGH 1EPTA 2ZDLA 5DSFA 3TLOA 2VB0A 4ABAA 3URDA 2GJGA 4WJG2 2P95A 3Q3KA 4MPVA 4I8LA 1GPZA 1L4ZA 5C20A 1O2ZA 3PWBA 3O8CA 3GY6A 2KAIB 4DJZB 2ZTYA 1V2UT 3BTWE 3GY5A 1XMNB 1G3CA 2AIPA 1KY9A 2TGDA 1EJAA 2VH0A 4MDSA 3UIRA 4XFQA 2CMYA 1TGNA 1DE7H 4AZ2B 1MMJN 3M3TA 1F0UA 1QB9A 4DIIH 1GI9B 1SSXA 1EJNA 4KP0A 1ZZZA 1FI8A 3P8NA 3Q76A 2XC0A 5EXMA 1C2LA 1K1NA 1EAWA 1V2TT 4BTIB 3E8LA 3O8RA 4GSOA 3SUFA 4DY7B 1TX7A 1H9HE 1S0QA 1UHBB 2V3OH 3SNDA 3UUZA 2VIQA 2V7QD 1C5UA 1K1OA 1LHFH 1DPOA 1Y8TA 2F83A 1HBTH 5DP3A 2PR3A 1LDTT 1CE5A 1MQ6A 1OP0A 4JK5A 1TMTH 3BTEE 1FPCH 4SGAE 1MBMA 4ZKSU 1OXGA 1LVOA 1QJ1B 2EA3A 1SGCA 3KCGH 3VXEH 2ZTZA 1YPHC 3SNEA 3UWJH 3OSYA 4X2XA 3N7OA 5B6OA 2BLQA 3OEED 3BTGE 1C5WB 3SOSA 4X1SU 3SZEA 1S6FA 1C5LH 1S5SA 3U8TH 3D23A 1SGFG 1OWEA 2VWNA 1CT4E 1T8LA 4YO9A 5LPFA 1O3HA 1W8BH 1TALA 5H4IB 3UNQA 2FEQH 2W7SA 2EQNA 5HIYA 5HYOA 1G32B 8GCHG 3NPSA 4NIWA 1VITH 1EAUA 1EXFA 3A83A 3CNRA 3K6YA 2ZA5A 1LTOA 1BTYA 4I33A 3RM2H 4YOIA 1HAHH 3S69A 1DICA 2C8XB 1ARCA 1HNEE 2QYIA 4BNRA 2ZU3A 4VGCB 1A0JA 2FMJA 3SNBA 1AB9C 1UK4A 1GJCB 1C5ZB 1EOJA 3MH6A 2C3SA 3BF6H 3F0OA 1FIWA 1T7CA 3MNSA 2VWOA 4ABIA 5I46H 3SU5A 4CRGA 3BEFB 3SQHE 2JDID 1O3MA 1GI2A 1YBWA 4IN2A 1B7XB 2HLDD 2SFAA 4NIXA 5DG6A 4AFQA 4B74A 1ELFA 4NIVA 1XVMA 1C5TA 2G5NA 3N7EA 1QB6A 1DM4B 2UUJB 3AVZA 3RMOH 2BY9X 3N7DA 3SV7A 1YYY1 2GCTC 2TGTA 1LPGB 4FUHA 1CGJE 1AU8A 1C2MA 4MG3A 1JBUH 1KSNA 3QLPH 1O2NA 5CMXH 9ESTA 1KYNA 4ZKRU 1KDQA 1ORFA 4LOYH 2AS9A 3BTQE 4K69A 5G4BA 4ESTE 4RT0A 4ISIH 3RXCA 1P8VC 2ANYA 3SU6A 1WSSH 5I25A 1TX6A 3PV5A 2ZGJA 2ZHFH 3U8RH 1P2NA 1P09A 1SC8U 2XRCA 2BYAX 5CE1A 1IHTH 1ETTH 2BQ7B 3TH3H 3RMNH 3QZQA 3RXEA 1S6LA 3T62A 5KEDA 4X0WU 1LHEH 4X8TH 3TNSA 3TK6A 1PQAA 3PWCA 1S84A 2PSYA 1D6WA 1EX3A 2QE7D 3SORA 3U9AH 1MTNC 3ZVBA 5PTPA 1QBVH 1G3EA 2F4LA 2D2DA 1BHXF 4K8YA 2BY8X 1HAIH 1C2HA 1SQOA 3BIUH 5EW2H 3GYLB 2NU1E 2HVYB 3QDZB 3V12A 2PKAB 3K65B 2G8TA 2LPRA 1DWBH 2ANWA 2ULLA 1L4DA 5HM2A 1K1JA 1BRBE 1TPPA 2FI3E 1PPZA 1GBCA 1GL1A 1KXEA 1A2CH 2J5UA 3A7WA 3H09A 1TNLA 3KQBA 2ZHQH 1FY3A 1DX5M 3EQ0H 5C3NA 2ZI2H 3SW2B 1NU7B 2BOHB 1RIWC 4K60A 3RUOA 2QGRA 1S6HA 2A45B 2W3IA 3UR9A 2RA3A 3PRBA 4YLQH 3ELAH 1AVWA 2A4OA 1IOEA 1V2WT 2AIQA 1QIXB 4AC9A 2F9NA 1WDIA 1TPSA 2FYQA 1VJAU 3LGYA 2HPQH 1QR3E 2CF8H 1D4PB 4AYVB 3F9FA 1BDAA 2H5CA 3WY8A 1G2LA 5DP7A 1TMBH 1BBRH 1O2TA 2HNTF 1FMGA 4JZIA 4NGAH 3U69H 1O5AB 3F9GA 4BXSA 1ANEA 2PWXA 2H9HA 4OM9A 2HVXA 2RDLA 2P3FH 2GX4A 2RCEA 1XUFA 2ALPA 2O8UA 3GY3A 1EUFA 1QL7A 4HGCA 1AO5A 3ATIA 2ODYB 2ZU1A 1THRH 1BRAA 3QK1A 1XXFA 2VIPA 8ESTE 1AI8H 2AEIH 2XBVA 4DT7B 4ZHAA 2KAIA 4Y6DA 4F55A 4A1TA 3A89A 4Y11E 4WH6A 2ZKSA 1ZOMA 3VG8A 2AGGX 5J4SA 2EI6A 2SGFE 5F53A 1KIGH 5C2ZA 1QA0A 1PYTC 4UFEH 4I32A 3LPRA 1KLTA 3SJIA 4WXIA 4B1TA 1Y5AT 4CH8B 1AB9B 2IPHA 3LJOA 4XD7D 4ISOA 1VR1H 2FOAA 3VB5A 7LPRA 3A88A 1KMHB 3TH4H 4MPUA 3NCLA 1UW7A 2OC7A 3T28A 1EB1H 2BDIA 1TRNA 4ABGA 4H42U 2GT7A 5LH8A 2XWBI 5E2OA 1TGCA 1F0TA 1O2WA 1L1GA 1FZZA 4ZKOU 2G52A 3MFJA 4NWKA 4ZMAH 1LVMA 1UHBA 3Q77A 2NU4E 4H4FA 1AY6H 1SGRE 1CVWH 4X6OA 1OKXA 1PPHE 1UTMA 2ALVA 1O3OA 1K9OE 1RGQA 1TWXB 2BDBA 2GCTB 1E1RD 2ZFQH 1T8MA 1TAWA 2ZPSA 3MWIU 3MH4A 1YLNA 5HGGA 1ELTA 4I86A 1BJUA 4O3UA 1B0FA 1P3EA 2P16A 2NU0E 5C1UA 3L6PA 2Z6BD 3AAUA 1O32A 8LPRA 8KME2 2ZHEH 3RXUA 1HAOH 1GDQA 1O37A 1RXPA 3D49H 4MLFB 2LELA 4FU7A 1V2PT 3MU4A 1GCTC 4CRCA 1DSUA 1NROH 1K1MA 1FY4A 2FP7B 1O2YA 4JZFH 5DKMA 5C17A 2H6MA 2GZ9A 2HLCA 3FAOA 1O3DA 2QCYA 1TB6H 2BD2A 3GY2A 3M3SA 5FHTA 5C1XA 1W0YH 2PHBA 3EA8A 4GUXA 1RS0A 1E37B 2QXGA 5JBCS 1MTNB 3NXPA 2Y80A 2V0BA 4X8UH 2JIZD 1ZHRA 4ASHA 3EE0B 2G5VA 1HXEH 1FNIA 1TPAE 1ZPZA 2BLOA 4KTCA 3TPIZ 4INKA 1O2RA 2VIVA 1E38B 3FP7E 4CRBA 4A5TS 3M3VA 1V2JT 1ZJDA 1O2UA 1C2GA 1FN8A 1AWFH 2XC4A 5JDUB 1C2EA 2A5IA 3MU5A 4UD9H 2G4UA 4NWLA 2J34A 3R0FA 3VPKA 1DXWA 4D8NA 1Z8RA 1AE8H 1EZSC 4K1EA 1QTFA 6LPRA 1K28D 4Q7XA 5A2MH 1RIWB 5FXLA 2VIWA 1TGBA 2A0QB 1C5YB 2JH5D 2VGCC 1UMAH 2VH6A 3M7UA 1E1QD 1K1IA 2OC1A 6GCHG 2FTMA 2R2MB 4ZHLU 2KX4A 1EAIA 2CN0H 3TNTA 1BTHH 4AYYB 4RSPA 2H9TH 2F3CE 2GMTC 1VGCC 1XUGA 1LKAA 5L2ZH 5A8XA 1PJPA 4GHQA 2Q6DA 4Y0ZE 5AHGH 1DT2A 1LCYA 2HPPH 2JH6D 5F8XA 4OS5A 3SO3A 4IMZA 1VCQA 4LK4A 2WPDD 1GI3A 3OE7D 2QN5T 1GHYH 3MHWU 5C94A 1RTFB 3MNXA 1Z6JH 2A2XH 1H9LB 1WAYB 4JZEH 2JKHA 5JB8S 1O3KA 1S83A 1UVPA 3A8DA 1FQ3A 4KKDA 4RT1A 1WTHD 1EQ9A 1PQ8A 1D3DB 5E0JA 1NY22 5EPYA 2VVUA 1UTLM 2VNTA 3RXBA 1O2GH 3EYDA 4FUIA 4A1XA 3UQVA 4CRAA 1Q31A 4U01A 1TQ7B 2PKAA 4D7FA 1FONA 4Q7ZA 1AQ7A 1JIRA 3F1SB 2ZECA 1MAXA 1TBZH 2FI5E 3P70B 4ABDA 1DVAH 3SU1A 1KXAA 4AG2A 2W6JD 3PB1E 3BTHE 1YCPM 1MD7A 2YNAA 3A7XA 3UOPA 4KTSA 2AH4X 4NFEA 1C9TA 2A5KA 3OTPA 1DSTA 2VWMA 4RI0A 1MBQA 3ITIA 1WU1A 3B8JA 1T8NA 1SBWA 3F9HA 5GWZA 4SGBE 1O2SA 1HGTH 1TRMA 3F0PA 1NRQH 2G55A 5F03A 2ZCHP 1GBIA 1LQEA 3RLWH 1F92A 5FBEA 3LIWA 1GI5A 3KYFA 4HTCH 1O2KA 3K2UA 4FUJA 2SGDE 1NFXA 2JH0D 1ESBA 4FVDA 2QXHA 1QA7A 3BG4C 1GCTB 4I8JA 2Z3CA 1DWEH 3M5NA 3KGPA 3OTJE 1GJ8B 2FOFA 1C2IA 1JRTA 3T26A 6CHAC 3SI4H 1BRUP 3VFEA 1O2QA 7GCHF 5EODA 1O5FH 1THPB 1H4WA 4AN7A 1C5PA 5GNDA 2FLBH 1A0LA 2QF0A 1YPKH 2EI8A 3F68H 1HFDA 2TRMA 4A1VA 1LPKB 4OS6A 1QQ4A 5IK2D 1NT1A 1AMHA 2OBOA 3UY9A 2BB4A 2PTCE 4ZKNU 1S81A 5GIBA 2BDAA 1AFQC 3GDSA 3SU0A 4AB9A 1S82A 1C5MD 2WV9A 3HGPA 2WSSD 1TYNA 3ATMA 3P95A 1EKBB 4CBNA 4TWWA 3H7TA 2L74A 1GHBF 4ABJA 2EY4C 4J2YB 1FJSA 1P2MA 1C1NA 1SKYE 1DY9A 2HALA 4B71A 3DSGA 3GICB 2XC5A 3A8CA 1F2SE 2A31A 3PMBB 3A8AA 3KQCA 3KNXA 4K3JA 3UQOA 1XX9A 1BMFD 1QCPA 2VGCB 3P92A 5EJLA 1GCDA 2Y5GA 1A1RA 1C4Y2 1Q3XA 3PMHB 5HIZA 2ZWLH 3ZZ6A 4K1SA 2KZ4A 2A7HA 4ABHA 4WVPE 3RXMA 3ZZ5A 4JYUH 2WPHS 2WV4A 1YM0A 3LOXA 3DCLA 2GMTB 1VGCB 2O9QA 2DUCA 2WINI 3MO6A 4B73A 3P8GA 2FODA 3RXKA 2Y82A 1SB1H 1SLXB 2B8OH 2VIDA 1UO6A 2O8WA 2VVCA 1VKYA 1ZJKA 5C5OA 3STIA 5DN6D 3MNCA 5LPEA 1DXPA 1ZTKA 1ZSKA 2CF9H 2H1UA 4LZ1H 3BG8A 4MNWA 3UOUA 2ZDKA 3S9BA 5T6DA 3RXQA 5JBTA 3SGBE 3MH7A 4CREA 3TGKE 1P9UA 2BD4A 4NFFA 1C4U2 1NS3A 1O36A 4FVBA 1WQVH 3B23B 3U1JB 1C1MA 1TOMH 1ZSLA 1NPMA 1AE5A 3MNBA 4NA9H 2AMQA 3F2FA 4J1YA 1GBAA 3PM3A 2TGPZ 1P04A 1Z71A 2ZU4A 2G81E 3KQDA 1JIMA 2ANMH 4OGXA 3WWBA 3VEQB 4AFZA 1BUIA 1GMCF 1P02A 5L2YH 3PTNA 1KXCA 1SFQB 1IQJA 5ESBA 4B76A 1J9CH 4X1PU 3RXIA 1ZMLA 3UNRA 4NA7A 1MKWH 4UFGH 2FYRA 1BRCE 1HJ9A 3C27B 3NK8A 3SNAA 2PTNA 1P0SH 4FUEA 2IJD1 1O3LA 2ZP0H 5F8ZA 5A09A 4BAMB 2W26A 4E7NA 1WBGB 3AAVA 3RU4E 2ZDNA 3AW1A 3CS0A 4XRNA 3QX5H 3RC4A 1ELEE 4Q7YA 4FOUC 5T6GA 3BG4B 3ZVFA 3I29A 2BXTH 1F5KU 4AFUA 4UONA 1SR5C 1YWUA 4JCNA 1LHGH 4AG1A 1EB2A 2Z7FE 1O3EA 6CHAB 5FPYA 3PMJA 2BVXH 1GBEA 2M5TA 2Z94A 1O3JA 4ZH8A 2VVVA 2C4FH 4IW4E 1CQQA 3LU9B 4NG9H 1K0HA 1B5GH 2P3UB 4JK6A 1OWJA 1P11E 4ASUD 4ISLA 3PROA 1MKWK 4Z6AH 1TX8A 3MMGA 3QZRA 1V2RT 5T6FA 3SUDA 1CBWC 1O3GA 1GG6C 1GHXH 2A4RA 4GLYA 1Z1JA 1YCPH 3UTUH 1YP9A 1EOLA 1H1BA 1YC0A 1AFQB 1MTVA 1HV7A 3PV4A 4YXWD 4ZUHA 2BM2A 2ZGHA 3BTME 2BD5A 3SI3H 1W0ZU 4F48B 2F91A 5C0TA 2AFQB 1K22H 5FX6A 3DA9B 3RXHA 3FO8D 5EPNA 1DITH 4LXBH 3FANA 1F7ZA 3SV2H 4AGJA 2A1DB 4CR5A 1Z7KA 2K8IA 1QNJA 1PYTD 1HYLA 2ZFFH 3V13A 3RXAA 4E05H 2ZDMA 1RTLA 2PLXA 1QZ8A 1N6YA 1SHHB 3MU8A 7GCHG 3ZZCA 1AUJA 1LHDH 3JZ1B 2GTBA 1UK3A 1YCPK 2V3MA 4LZ4B 2ZO3H 1YPJH 3VB6A 4M9FA 2B5TB 3ZZBA 3FVFB 1GJDB 3SUGA 1TNIA 1MCTA 2YOLA 1LVBA 1BCUH 1HB0B 2H5DA 2OCVB 1Q2WA 5FCRA 2P93A 1A5GH 3FFGA 4ZAEA 4BAOB 4X1NU 1GVKB 2QAAA 1XXDA 3DFLA 5HM9A 1V2LT 4K8BA 1BITA 4IC5A 1ZRKA 1BJVA 2J98B 1EJMA 1J8AA 2ZHDA 4X2VA 2FS8A 3A80A 2GCHG 1C1UH 2AHME 3LC3A 1O33A 1GHBG 1H8IH 1C5XB 1GBTA 1SGDE 2FPZA 2QXIA 3SV6A 2W7UA 3LGIA 2WUBA 1BTXA 3FZDA 2OBQA 1O3AA 2ESTE 1NRSH 1PPEE 3KEEA 2F9UA 1O3NA 3OFND 2ZU5A 2BLWA 3RP2A 4JZ1A 2AERH 1A3EH 1SGNE 3HK3B 2ZF0H 2FDAA 2STBE 3STJA 3DUXH 1DLEA 1UTJA 4UDWH 2ZU2A 1ANCA 1SGQE 4XDEA 1HPGA 5FAHA 5EU8A 3M36A 4CBOA 1GHVH 3MI4A 4OS2A 3ATKA 1H8ED 1O3CA 3ZVEA 1GJBB 3JZ2B 5EQRA 3SJ9A 2FIRH 2SGAA 3LC5A 1GJ7B 4TWYA 1K21H 2EI7A 2C8YB 3MO9A 3GY8A 4Y71A 3SNCA 4X6NA 4JYTA 1UTNA 1MH0A 2FM2A 1PPBH 1AHTH 1SOZA 2ZNKH 3ZZDA 5CDFE 3AASA 3ZVDA 2WYGA 3U8OH 2Z9IA 1J14A 2ZG0H 3QWCH 5HXFA 1TE0A 2GZ7A 1T4VH 3FP8E 1W13U 1HJ8A 5E2PA 4Q80A 2QC2A 4THNH 5AF9H 2RFKC 5IYTA 1O5EH 1UCYE 1ZRBA 1T4UH 3D65E 1K1LA 1BT7A 1A61H 1FPHH 1SGEE 4O97A 1V6DA 2G4TA 5GXPA 1HJAC 4WH8A 3QTOH 4AOQA 3WW7A 2J2UA 1D3PB 2KFWA 1FN6A 5LGOA 1GMHF 2W5EA 2GDDA 2Z9JA 2OQUA 5E0GA 1O5CB 2HNTE 1QHRB 2XCFA 1C1PA 4BOHA 2IPQX 4IS5A 1AZ8A 1OOKB 2D26C 3ZVAA 5DK1A 3UWIA 1MABB 4WF8A 3FKSD 3HATH 5C67A 1W3CA 5A0AE 4ZHMU 2O8TA 3GCTF 3LT3A 2K1QA 3MQKC 1CBWB 1GMCG 1O3IA 1GG6B 1H8DH 2BDHA 4RN6A 5EXLA 3RXGA 3S0NA 3RXSA 2P8OC 3IITA 1ZGVA 4Q63A 3TGJE 1O2OA 1GI6A 3LONA 4DVAU 1O2XA 2DE8A 1FX0B 4ISHH 1ESTA 1FDPA 3PLPA 4IC6A 4RKOB 2R3YA 1G36A 1SFIA 2OP9A 2OK5A 2ZPRA 1TBRH 2BDCA 5EQSA 3A82A 4WWYA 4OS7A 2ZDVH 4Y8XA 1O2IA 1C5QA 3TJOA 1NRNH 1EASA 2PGBB 2FOHA 4TY7A 3A7ZA 2OLGA 1FY8E 4CR9A 4ABBA 1UK2A 3PTBA 1UCYK 1Y3UA 4GPGA 2F9PA 2Y5HA 5DPAA 2P3TB 1P03A 3OYPA 1C2KA 1SOTA 1F0SA 5E0HA 3QO6A 3BV9B 3EE7A 1XKAC 2BQWB 3M35A 1ELDE 5AFZH 1PPCE 1SGPE 2WYJA 1QL9A 1NU9A 3HKIB 4AORA 2JETC 1DOJA 1CSOE 1LO6A 3ZZ3A 1E35B 3D62A 5DJ7A 1LKBA 1NBME 1KXDA 2BVSH 1CU1A 3PV2A 1FLEE 1MTWA 3E90B 1O2PA 3GDVA 3VB3A 1QBNA 1ELAA 1Y59T 1TNKA 1AFEH 1ABIH 1SLVB 1H9IE 1ZSJA 3ZV8A 3ZZ4A 1P01A 2GD4B 5AFYH 3ODFA 3FZZA 3KIDU 1GDNA 1GMDF 4JYVH 1XUHA 3GY7A 2CXVA 4I8GA 1LQDB 1HAVB 1Y3WA 1RTKA 2ZFSA 1TNJA 1MQ5A 4NZQA 2TIOA 1CA0C 1W14U 2GV7A 1C2DA 2PP6A 1O35A 1V2ST 5DGJA 4ZXYH 4YTAA 1NESE 3F3BA 3VGCC 1UTQA 5JPMH 3PRDA 2FOCA 3Q3XA 2J4IA 3TK9A 1WTGH 2Z3DA 1GBJA 3BTKE 2CJIA 5EXNA 2CK3D 1VJ9U 5EJZA 3PO1C 3W94A 2TBSA 1MCVA 2NU2E 2F9BH 4BXWA 2M2AA 1ZR0A 4MQAA 4NIYA 4KELA 4M7GA 2BD9A 1ANBA 4HI3A 3EGKH 2C8ZB 3RXDA 4GVUA 4AGKA 3FP6E 4D76A 1TFXA 1JMOH 2BY5X 1G37A 1GBMA 1GL0E 1ZTJA 1SHYA 1V2VT 5FBIA 1SVPA 3SQEE 1B0EA 2V3HH 3F6UH 1OX1A 8GCHF 1YY3A 1W12U 4YESB 2ZDAH 4Z1MD 3LDXH 1TGSZ 2P59A 1JRSA 3DSOA 3RC5A 1J16A 1ZYOA 2FOGA 2FXRA 1OYQA 3P6ZB 2Y7XA 1ZPCA 1GI4A 4BTUB 1OSSA 2WV5A 2GKVE 2GGVB 5GDSH 4A92A 1PPFE 1HJAB 2C8WB 3FOAA 2QY0B 5DP8A 5A8YA 2J38A 4X1QU 3TH2H 1ZMJA 3ZZAA 2TGAA 3BIVH 3U28C 1O3PB 1TONA 1KTSB 2WUCA 2J98A 2WPKS 3KL6A 1FAXA 2EC9H 3TJNA 1G30B 1W7XH 5GPIB 3SJKA 4CRDA 4B2BA 5EW1H 1D9IA 1NM6A 4HG6A 1QB1A 1T31A 1ETRH 1QRXA 3MTYA 1WOFA 3T29A 2P8OB 1CHOF 1OHHD 5GJ4B 4K2YA 3MH5A 2F9OA 1SI5H 4O9VA 5SGAE 1ZHMA 2UWOA 1OS8A 1HUTH 1W7GH 2ZCKP 4BAQB 5C0UA 3M7TA 1TA6A 1GVZA 2YMSC 3L33A 1XUJA 5F8TA 1P2KA 3MYWA 1IQMA 1IQIA 3K6ZA 2WZQA 1GI1A 1THSH 2ZQ2A 3RXJA 3VXFH 1NZQH 4B2CA 2QF5A 1W11U 2HNTC 2O8LA 2AMDA 1C5OH 5EJ1A 1FIZA 1GHWH 4H6SB 1WYKA 1C2FA 5CHBA 4FUDA 2CHAC 1P2OA 1GMHG 1IQNA 1V2OT 3UNSA 1HIAB 1DUEA 1ANDA 1TNHA 3S7KB 4GCHF 2FS9A 2JETB 4D9RA 1IQEA 1NN6A 4WY3A 1GI8B 3DD2H 2BDYA 1MKXH 1AD8H 4E06H 1EZXC 1O30A 2WPLS 2UWLA 9LPRA 1HCGA 2ANKH 3TVJB 3NKKA 4X2YA 1AKSB 3KHVA 2AGEX 1P9SA 1G3BA 3PLKA 1OWDA 1SQRA 1CT0E 1SGFA 5EG4A 4BAKB 3E0NB 1KXFA 4GAWA 3SBKA 1BMMH 3M5LA 1NO9H 1O39A 4FUCA 4DIHH 1O5BB 1C9PA 2VBCA 1DLKB 2IJOB 2OC0A 3MOCA 3O8DA 4FUFA 1CA0B 2PW8H 1FUJA 1MAYA 5KECA 2BD8A 1IQLA 3ZZ8A 1O5GH 4I8KA 2F43B 5KGOA 5L6NH 3ESTA 2FX6A 2AMPA 3NRLA 5IDKA 4BTTB 1TMUH 3HK6B 5EQQA 3VGCB 3ZYEA 2QXJA 1IQFA 1GJAB 3QUMP 5TJXA 1JWTA 5BPEA 2W3KA 3O8BA 1WXRA 3RXRA 1CGIE 1HAZB 1OP8A 1MKXK 4XBCA 3MU1A 1U6QA 2ZQ1A 3Q00A 3DT0H 1CHGA 2A2QH 1C5SA 1AWHB 1BTWA 1QURH 3PO1B 2OTVA 2PSXA 1C2JA 4FUGA 1T8OA 2H9EH 1O0DH 4TSFD 1UTOA 5GCHF 1SGIB 1C1QA 4DT4A 2ZZUH 1ZMNA 2BHGA 1QL8A 1GWAA 1GHAF 3BN9A 3A8BA 3KQEA 1VITF 3BEUA 3C1KA 1O2JA 2Y6TA 3SUEA 3ZVCA 3TGIE 2BY7X 3EDXB 2GT8A 4TY6A 1QRWA 1ELCA 5DP6A 1GMDG 1UTKA 2BTCE 4INHA 3RLYH 4E7RG 1DFPA 1WQSA 1SQTA 2FLRH 2QF3A 1P2QA 3LGWA 1FXYA 5A0CA 1J17T 3E16B 1YLCA 1EATA 3QGNB 3P8OA 4OS4A 5JBBS 1WV7H 3VB7A 3H7OA 5EGMA 3V3MA 3RXPA 3TITA 5LPRA 5FX5A 1O31A 3KQ5A 3LGUA 1BHXB 4K1TA 3E3TA 3LGTA 2PFEA 1QY6A 1C1RA 1N8OC 3F2HA 2OXSA 3RM0H 2FTLE 1C4V2 1HAVA 4WMDA 1HAXB 3M37A 3A7TA 5C5NA 4B2AA 2OUAA 1MU8B 2Q6GA 4AX9H 1M9UA 3UPEA 3MO3A 1RRKA 1OYTH 1MU6B 1GI0A 1ZPBA 2ODQA 2RA0A 2WPIS 1TIOA 3P8FA 3TJVA 1AIXH 3E91A 3ZZ9A 1BMLA 2THFB 3F9EA 3HPTB 3SZNA 5DP9A 1E0FD 4WMFA 1D3QB 3ZYDA 3TJUA 2XYAA 1INCA 1S85A 2ZPQA 4Y7AA 2FO9A 4QT8C 2YMSB 2GVFA 1X7AC 3M5MA 3URCA 1HAGE 1BB0B 5JBAS 1L1JA 1XKBC 2FOBA 4YOGA 2R2WU 4WMEA 2XCNA 4ACAA 3FN8A 2YNBA 4MPXA 4CHAC 1HAYB 4NZLA 4YLUA 2XNIA 2STAE 2A7JA 2FI4E 1MZAA 4UFFH 1N6XA 3MU0A 1TGTA 2CHAB 2WPMS 3KYGA 1P06A 2HGTH 5ETXA 1QJ7B 2QIQA 4Y8YA 3OY5U 1ZTLA 4YZUA 2A32A 1IQKA 1DS2E 2V6NA 3RXTA 1EPTC 2B9LA 1E34B 2Q1JA 4DG4A 4ACBA 3SJ8A 1PQ5A 1SPJA 1L2EA 2D1JA 4K5ZA 1H8HD 3ZVGA 4U32A 2HRVA 2KR7A 3BSQA 2C93B 2GZ8A 1ESAA 3AK5A 1EAXA 2D8WA 1GGDC 1MUEB 1JOUB 1CHOG 1V2MT 2FWWA 5TCAA 4U2WA 4INLA 4Y76A 2R0KA 2ZFPH 2FZZA 2J97A 1Z8JB 1DUAA 3R3GB 1DWCH 1NRRH 4FU9A 2SGEE 1UVTH 4OS1A 2LP6A 5HMAA 3SJOA 1D6RA 1BZXE 1DWDH 4MVNA 1O5DH 3SHAH 1C1SA 1F5LA 2R9PA 2SGPE 1O2LA 1UVUH 2R3UA 2BD7A 2ODPA 2Q6FA 2UUKB 3HGNA 1HRTH 2OINA 1IAUA 4YT7H 3A86A 3PYHA 4I31A 2BMGB 4UFDH 2ZEBA 2G51A 2CGAA 1GBLA 2GDEH 6GCHF 1QRZA 1IQHA 1KLJH 1MD8A 5HKKD 3BTTE 3RMLH 1RD3B 3ZIAD 2I6QA 3EAJA 2A5AA 3Q3YA 1MZDA 4GCHG 4IGDA 3T5FH 1K2I1 3NUMA 3IWMA 2C90B 1BTUA 1O3BA 1LVYA 4HZHA 1NFYA 3U1IB 4OGYA 3BEIB 2B7DH 2J95A 3S9CA 4MNVA 2RG3A 1YGCH 4XBDA 1KTTB 1BMNH 1V2KT 1A46H 4FU8A 4U30A 4YOJA 2I6SA 1C1VH 2AGIX 5FPSA 4DURA 1P10A 1O3FA 5T1VA 3RU4D 1HIAA 3E0PB 1GBHA 4TYDA 3OU0A 5A0BA 1L0ZA 2BQ6B 2PGQB 1ARBA 2XBYA 1W2KH 2WHXA 1VZQH 7KMEH 1YF4A 1Z8GA 1K1PA 4H6TA 4X1RU 3A7YA 1OWHA 1Y5UT 3NWUA 4Y0YE 3UB0A 1UVSH 4NSYA 1Y5BT 1NFWA 2XTTB 3CS7A 3N99A 1AKSA 2BOKA 1W0KD 1G3DA 1BBRE 4KTUA 4R8TB 1UJ1A 1SL3A 2V35A 1JXPA 1N8OB 3T2NA 4TT3D 5B6LA 1LHCH 1BMAA 1O38A 4ISNA 1P2JA 2A7CA 2B0FA 2FOEA 3LH1A 1BA8B 2BXUH 1NFUA 3A85A 4P00A 4GHTA 1GJ5H 2JJ1D 1W0JD 5L30H 1SGTA 2BX4A 3A81A 4XE4A 1ELVA 1QFKH 5GCHG 3TU7H 1E36B 3V7TA 4P02A 1V3XA 1GHAG 1VITG 1IHSH 1GDUA 1FY5A 3CENA 1O2VA 3GCNA 1QGFA 2ILNA 4FUBA 3L3TA 3ODDA 3RC6A 5ESTE 1UVOA 2KM0A 3ATWA 3DHKH 1C5VA 1TOCB 2ZIQH 1NC6A 1EP5A 2BZAA 1S0RA 2QF4A 4CHAB 2DE9A 2K0QA 2PUXB 2UUFB 4TPYA 2PV9B 1AUTC 4MNXA 4ZROA 4D7GA 1UCYH 4F49A 3RXVA 2FESH 1EP6A 2ZCLP 4BANB 2NWNA 2ZGXH 5DO4H 1GVLA 2Y5FA 1AVGH 2ZFRH 1BBRK 4RKJB 3SV8A 2ASUB 3W1EA 3A84A 5FL7D 3PMAB 2BVRH 1EPTB 1V2NT 3SGQE 1QJ6B 2QV1A 4IMQA 2UWPA 2AYWA 4DOQA 1O34A 2Z9KA 6ESTA 4X8SH 3GCOA 2KCOA 1C1WH 3VB4A 1HAPH 1GI7B 1ETSH 1GGDB 1YPEH 5EIYA 4O03A 1P2IA 3RMMH 1DY8A 1XVOA 1F5RA 4NSVA 4JMYA 5CHAC 5EOKA 3SU4A 1L1NA 1EFRD 1CT2E 1SGYE 1EZQA 4ABFA 3S7HB 1C5NH 3IG6B 1GHZA 3EA9A 5TCCA 4FETA 1VCWA 2RDEA 1XUIA 3ATLA 5ABWA 1CO7E 3RXLA 1Y3XA 3GCHC 1ZHPA 2BZ6H 4CH2B 1XUKA 1F0RA 2BDGA 2Z9LA 4D9QA 1PFXC 3UFAA 1CGHA 2HWLB 4Q4LA 2JJ2D 1Z6EA 3GYMA 1GBDA 1GBKA 2G00A 2PKSC 4TPIZ 1C1OA 3RDZA 1OWIA 3RU4T 1TABE 1TQ0B 1TPOA 1OPHB 2ZGCA 4XBBA 1AZZA 1G9IE 2KCYA 1V2QT 1GJ9B 3H5CB 1ELGA 1ELBA 1EZUC 2J9NA 1J15A 3QGJA 1SQAA 2P94A 4DGJA 5K0HA 3OAAD 5FPTA 1P05A 1QQUA 2BD3A 4DW2U 1MTUA 3CP7A 1BTPA 4UE7H 5C1YA 4ZCNA 2SNVA 2Y81A 1XM1A 1A3BH 1G2MA 2OC8A 2YMSD 1BTZA 4R0IA 3ZV9A 1LPZB 1SG8B 1C5RA 1YPGH 1TLDA 1NRPH 2A4QA 3OEHD 3M5OA 2BLVA 2FX4A 1DDJA 2BX3A 3LJJA 1AVXA 3SU3A 2VINA 2KCAA 4Y7BA 1FAKH 1C1TA 3SV9A 2VIOA 2ZFTA 2ZHWH 1TBQH 1BIOA 2IOTA 1P12E 3BTDE 4B6EA 5DP4A 5K7RA 3E1XB 2IN2A 1GBBA 1P57B 2NU3E 3S9AA 5AVDA 2XXLA 3U98H 2CV3A 3SU2A 1IQGA 3K9XB 4XOJA 1YPHE 2QA9E 3LKWA 2XNDD 4A6LA 4XSKU 3T25A 3LGVA 2EEKA 3T27A 3A87A 1O2MA 1SLUB 3M7QA 1PQ7A 4ABEA 3P17H 1RJXB 3SN8A 3F2GA 1Z8IB 3KF2A 1VCPA 1ZGIA 2ZTXA 3TK5A 1MTSA 5DP5A 1BOQA 1D3TB 4IN1A 1OP2A 1A5IA 2OQ5A 1GJ4H 2Y7ZA 3SHCH 1NTPA 3ENSB 2GP9B 3EA7A 3SGAE 4CRFA 4PROA 3SYJA 5J4QA 3UREA 4I8HA 1AGJA 5JB9S 3ZZ7A 4YT6H 2KCPA 3A7VA 2J92A 1NBMD 1E79D 3AW0A 3QN7A 1KDQB 1FY1A 1TRYA 3LH3A 4F4OC 2Z3EA 3G01A
chains in the Genus database with same CATH topology
4AB8A 1A5HA 2VWLA 1T32A 1Z1IA 4NCYA 2TPIZ 1WCZA 4Y8ZA 1TA2A 3DFJA 3BTFE 3GISB 4KGAA 5F6MA 1A0HB 3OX7U 4Z0KA 2FOMB 1YPLH 1YPMH 1YKTA 2XBXA 4X2WA 1OWKA 5BRRE 1DANH 2GV6A 2SGQE 3KN2A 1ZLRA 3RXFA 2J94A 2XBWA 3HKJB 2LNCA 1ACBE 5CHAB 2ZGBH 2UUYA 1KXBA 1N1LA 4JZDH 4X6PA 1PPGE 2BY6X 4ZXXH 1SMFE 4YM9A 1KLIH 1YLDA 1A7SA 1Y3VA 3TIUA 3RXOA 2XW9A 5E8EH 4VGCC 1WUNH 2R0LA 4Q2KA 1HXFH 3GCHB 3GOVB 1QBOA 2SNWA 2VU8E 1FV9A 3GDUA 4Y79A 4O3TA 3QTVH 4I7YH 1TNGA 1ABJH 4AFSA 3GY4A 7ESTE 2HOBA 5JYIA 1UTPA 2F9VA 1Y3YA 3OY6U 1W10U 2VJ1A 1CA8B 2PKSB 4Y10E 2OD3B 3V0XA 2XWAA 3GCTG 2Z9GA 1GJ6A 3NZIA 1A4WH 4B75A 1GBFA 4IBLH 3PLBA 4WXVA 5FCKA 4A7IB 2O8MA 2H2ZA 3UR6A 1AN1E 2WPJS 2A4GA 1P3CA 1SLWB 4MPWA 1HLTH 5A8ZA 1ID5H 4MNYA 3I78A 4NA8A 1BQYA 4HFPB 4DCDA 1HDTH 2ZC9H 4BAHB 3I77A 1RFNA 1O2HA 4UEHH 4X6MA 2GCHF 3E6PH 1LMWB 4MTBA 4X8VH 3B9FH 2PUQH 3M61U 3W95A 5T3HA 4FXGH 1EPTA 2ZDLA 3TLOA 2VB0A 4ABAA 3URDA 4WJG2 2P95A 3Q3KA 4MPVA 4I8LA 1GPZA 1L4ZA 5C20A 1O2ZA 3PWBA 3O8CA 3GY6A 2KAIB 4DJZB 2ZTYA 1V2UT 3BTWE 3GY5A 1XMNB 1G3CA 2AIPA 1KY9A 2TGDA 1EJAA 2VH0A 4MDSA 3UIRA 4XFQA 2CMYA 1TGNA 1DE7H 4AZ2B 1MMJN 3M3TA 1F0UA 1QB9A 4DIIH 1GI9B 1SSXA 1EJNA 4KP0A 1ZZZA 1FI8A 3P8NA 3Q76A 2XC0A 5EXMA 1C2LA 1K1NA 1EAWA 1V2TT 4BTIB 3E8LA 3O8RA 4GSOA 3SUFA 4DY7B 1TX7A 1H9HE 1S0QA 1UHBB 2V3OH 3SNDA 3UUZA 2VIQA 1C5UA 1K1OA 1LHFH 1DPOA 1Y8TA 2F83A 1HBTH 5DP3A 2PR3A 1LDTT 1CE5A 1MQ6A 1OP0A 4JK5A 1TMTH 3BTEE 1FPCH 4SGAE 1MBMA 4ZKSU 1OXGA 1LVOA 1QJ1B 2EA3A 1SGCA 3KCGH 3VXEH 2ZTZA 1YPHC 3SNEA 3UWJH 3OSYA 4X2XA 3N7OA 5B6OA 2BLQA 3BTGE 1C5WB 3SOSA 4X1SU 1S6FA 1C5LH 1S5SA 3U8TH 3D23A 1SGFG 1OWEA 2VWNA 1CT4E 1T8LA 4YO9A 5LPFA 1O3HA 1W8BH 1TALA 5H4IB 3UNQA 2FEQH 2W7SA 5HYOA 1G32B 8GCHG 3NPSA 4NIWA 1VITH 1EAUA 1EXFA 3A83A 3K6YA 2ZA5A 1LTOA 1BTYA 4I33A 3RM2H 4YOIA 1HAHH 3S69A 1DICA 2C8XB 1ARCA 1HNEE 2QYIA 4BNRA 2ZU3A 4VGCB 1A0JA 2FMJA 3SNBA 1AB9C 1UK4A 1GJCB 1C5ZB 1EOJA 3MH6A 2C3SA 3BF6H 1FIWA 1T7CA 3MNSA 2VWOA 4ABIA 5I46H 3SU5A 4CRGA 3BEFB 3SQHE 1O3MA 1GI2A 1YBWA 4IN2A 1B7XB 2SFAA 4NIXA 5DG6A 4AFQA 4B74A 1ELFA 4NIVA 1XVMA 1C5TA 2G5NA 1QB6A 1DM4B 2UUJB 3AVZA 3RMOH 2BY9X 3SV7A 1YYY1 2GCTC 2TGTA 1LPGB 4FUHA 1CGJE 1AU8A 1C2MA 4MG3A 1JBUH 1KSNA 3QLPH 1O2NA 5CMXH 9ESTA 1KYNA 4ZKRU 1KDQA 1ORFA 4LOYH 2AS9A 3BTQE 4K69A 5G4BA 4ESTE 4ISIH 3RXCA 1P8VC 2ANYA 3SU6A 1WSSH 5I25A 1TX6A 2ZGJA 2ZHFH 3U8RH 1P2NA 1P09A 1SC8U 2XRCA 2BYAX 5CE1A 1IHTH 1ETTH 2BQ7B 3TH3H 3RMNH 3QZQA 3RXEA 3T62A 4X0WU 1LHEH 4X8TH 3TNSA 3TK6A 1PQAA 3PWCA 1S84A 2PSYA 1D6WA 1EX3A 3SORA 3U9AH 3ZVBA 1MTNC 5PTPA 1QBVH 1G3EA 2D2DA 1BHXF 4K8YA 2BY8X 1HAIH 1C2HA 1SQOA 3BIUH 5EW2H 3GYLB 2NU1E 3QDZB 3V12A 2PKAB 3K65B 2G8TA 2LPRA 1DWBH 2ANWA 2ULLA 1L4DA 5HM2A 1K1JA 1BRBE 1TPPA 2FI3E 1PPZA 1GBCA 1GL1A 1KXEA 1A2CH 3A7WA 1TNLA 3KQBA 2ZHQH 1FY3A 1DX5M 3EQ0H 5C3NA 2ZI2H 3SW2B 1NU7B 2BOHB 1RIWC 4K60A 3RUOA 2QGRA 1S6HA 2A45B 2W3IA 3UR9A 2RA3A 4YLQH 3ELAH 1AVWA 2A4OA 1IOEA 1V2WT 2AIQA 1QIXB 2F9NA 1TPSA 2FYQA 1VJAU 3LGYA 2HPQH 1QR3E 2CF8H 1D4PB 4AYVB 3F9FA 1BDAA 2H5CA 3WY8A 1G2LA 5DP7A 1TMBH 1BBRH 1O2TA 2HNTF 1FMGA 4JZIA 4NGAH 3U69H 1O5AB 3F9GA 4BXSA 1ANEA 2PWXA 2H9HA 2HVXA 2RDLA 2P3FH 2GX4A 2RCEA 1XUFA 2ALPA 2O8UA 3GY3A 1EUFA 1QL7A 4HGCA 1AO5A 3ATIA 2ODYB 2ZU1A 1THRH 1BRAA 3QK1A 1XXFA 2VIPA 8ESTE 1AI8H 2AEIH 2XBVA 4DT7B 4ZHAA 2KAIA 4Y6DA 4A1TA 3A89A 4Y11E 4WH6A 2ZKSA 1ZOMA 2AGGX 5J4SA 2EI6A 2SGFE 1KIGH 5C2ZA 1QA0A 1PYTC 4UFEH 4I32A 3LPRA 1KLTA 3SJIA 4WXIA 4B1TA 1Y5AT 4CH8B 1AB9B 2IPHA 3LJOA 4ISOA 1VR1H 2FOAA 3VB5A 7LPRA 3A88A 3TH4H 4MPUA 3NCLA 2OC7A 3T28A 1EB1H 2BDIA 1TRNA 4ABGA 4H42U 2GT7A 5LH8A 2XWBI 5E2OA 1TGCA 1F0TA 1O2WA 1L1GA 1FZZA 4ZKOU 2G52A 3MFJA 4NWKA 4ZMAH 1LVMA 1UHBA 3Q77A 2NU4E 4H4FA 1AY6H 1SGRE 1CVWH 4X6OA 1OKXA 1PPHE 1UTMA 2ALVA 1O3OA 1K9OE 1RGQA 1TWXB 2BDBA 2GCTB 2ZFQH 2ZPSA 1T8MA 1TAWA 3MWIU 5HGGA 3MH4A 1ELTA 1BJUA 4O3UA 1B0FA 1P3EA 2P16A 2NU0E 5C1UA 3L6PA 2Z6BD 3AAUA 1O32A 8LPRA 8KME2 2ZHEH 3RXUA 1HAOH 1GDQA 1O37A 1RXPA 3D49H 4MLFB 4FU7A 1V2PT 3MU4A 1GCTC 4CRCA 1DSUA 1NROH 1K1MA 1FY4A 2FP7B 1O2YA 4JZFH 5DKMA 2H6MA 2GZ9A 2HLCA 3FAOA 1O3DA 2QCYA 1TB6H 2BD2A 3GY2A 3M3SA 5FHTA 5C1XA 1W0YH 2PHBA 3EA8A 4GUXA 1RS0A 1E37B 2QXGA 5JBCS 1MTNB 3NXPA 2Y80A 2V0BA 4X8UH 1ZHRA 4ASHA 3EE0B 2G5VA 1HXEH 1FNIA 1TPAE 1ZPZA 2BLOA 4KTCA 3TPIZ 4INKA 1O2RA 2VIVA 1E38B 3FP7E 4CRBA 4A5TS 3M3VA 1V2JT 1ZJDA 1O2UA 1C2GA 1FN8A 1AWFH 2XC4A 5JDUB 1C2EA 2A5IA 3MU5A 4UD9H 2G4UA 4NWLA 2J34A 3R0FA 3VPKA 1DXWA 4D8NA 1Z8RA 1AE8H 1EZSC 4K1EA 1QTFA 6LPRA 1K28D 4Q7XA 5A2MH 1RIWB 5FXLA 2VIWA 1TGBA 2A0QB 1C5YB 2JH5D 2VGCC 1UMAH 2VH6A 3M7UA 1K1IA 2OC1A 6GCHG 2FTMA 2R2MB 4ZHLU 1EAIA 2CN0H 3TNTA 1BTHH 4AYYB 4RSPA 2H9TH 2F3CE 2GMTC 1VGCC 1XUGA 1LKAA 5L2ZH 5A8XA 1PJPA 4GHQA 2Q6DA 4Y0ZE 5AHGH 1DT2A 1LCYA 2HPPH 2JH6D 5F8XA 4OS5A 3SO3A 4IMZA 1VCQA 4LK4A 1GI3A 2QN5T 1GHYH 3MHWU 1RTFB 3MNXA 1Z6JH 2A2XH 1H9LB 1WAYB 4JZEH 2JKHA 5JB8S 1O3KA 1S83A 1UVPA 3A8DA 1FQ3A 4KKDA 1WTHD 1EQ9A 1PQ8A 1D3DB 5E0JA 1NY22 5EPYA 2VVUA 1UTLM 2VNTA 3RXBA 1O2GH 3EYDA 4FUIA 4A1XA 3UQVA 4CRAA 1Q31A 4U01A 1TQ7B 2PKAA 4D7FA 1FONA 4Q7ZA 1AQ7A 1JIRA 3F1SB 2ZECA 1MAXA 1TBZH 2FI5E 3P70B 4ABDA 1DVAH 3SU1A 1KXAA 4AG2A 3PB1E 3BTHE 1YCPM 1MD7A 2YNAA 3A7XA 3UOPA 4KTSA 2AH4X 4NFEA 1C9TA 2A5KA 1DSTA 2VWMA 1MBQA 3ITIA 1WU1A 3B8JA 1T8NA 1SBWA 3F9HA 5GWZA 4SGBE 1O2SA 1HGTH 1TRMA 1NRQH 2G55A 5F03A 2ZCHP 1GBIA 1LQEA 3RLWH 1F92A 5FBEA 3LIWA 1GI5A 4HTCH 1O2KA 3K2UA 4FUJA 2SGDE 1NFXA 2JH0D 1ESBA 4FVDA 2QXHA 1QA7A 3BG4C 1GCTB 4I8JA 2Z3CA 1DWEH 3M5NA 3KGPA 3OTJE 1GJ8B 2FOFA 1C2IA 1JRTA 3T26A 6CHAC 3SI4H 1BRUP 3VFEA 1O2QA 7GCHF 5EODA 1O5FH 1THPB 1H4WA 4AN7A 1C5PA 2FLBH 1A0LA 2QF0A 1YPKH 2EI8A 3F68H 1HFDA 2TRMA 4A1VA 1LPKB 4OS6A 1QQ4A 1NT1A 1AMHA 2OBOA 3UY9A 2BB4A 2PTCE 4ZKNU 1S81A 5GIBA 2BDAA 1AFQC 3GDSA 3SU0A 4AB9A 1S82A 1C5MD 3HGPA 1TYNA 3ATMA 3P95A 1EKBB 4CBNA 4TWWA 3H7TA 1GHBF 4ABJA 4J2YB 1FJSA 1P2MA 1C1NA 1DY9A 2HALA 4B71A 3GICB 2XC5A 3A8CA 1F2SE 2A31A 3PMBB 3A8AA 3KQCA 3KNXA 4K3JA 3UQOA 1XX9A 1QCPA 2VGCB 3P92A 1GCDA 2Y5GA 1A1RA 1C4Y2 1Q3XA 3PMHB 2ZWLH 3ZZ6A 4K1SA 2A7HA 4ABHA 4WVPE 3RXMA 3ZZ5A 4JYUH 2WPHS 2WV4A 1YM0A 3LOXA 2GMTB 1VGCB 2O9QA 2DUCA 2WINI 3MO6A 4B73A 3P8GA 2FODA 3RXKA 2Y82A 1SB1H 1SLXB 2B8OH 2VIDA 1UO6A 2O8WA 2VVCA 1ZJKA 5C5OA 3STIA 3MNCA 5LPEA 1DXPA 1ZTKA 1ZSKA 2CF9H 2H1UA 4LZ1H 3BG8A 4MNWA 3UOUA 2ZDKA 3S9BA 5T6DA 3RXQA 5JBTA 3SGBE 3MH7A 4CREA 3TGKE 1P9UA 2BD4A 4NFFA 1C4U2 1NS3A 1O36A 4FVBA 1WQVH 3B23B 3U1JB 1C1MA 1TOMH 1ZSLA 1NPMA 1AE5A 3MNBA 4NA9H 2AMQA 4J1YA 1GBAA 3PM3A 2TGPZ 1P04A 1Z71A 2ZU4A 2G81E 3KQDA 1JIMA 2ANMH 4OGXA 3VEQB 4AFZA 1BUIA 1GMCF 1P02A 5L2YH 3PTNA 1KXCA 1SFQB 1IQJA 5ESBA 4B76A 1J9CH 4X1PU 3RXIA 1ZMLA 3UNRA 4NA7A 1MKWH 4UFGH 2FYRA 1BRCE 1HJ9A 3C27B 3NK8A 3SNAA 2PTNA 1P0SH 4FUEA 1O3LA 2ZP0H 5F8ZA 5A09A 4BAMB 2W26A 4E7NA 1WBGB 3AAVA 3RU4E 2ZDNA 3AW1A 3CS0A 3QX5H 3RC4A 1ELEE 4Q7YA 5T6GA 3BG4B 3ZVFA 3I29A 2BXTH 1F5KU 4AFUA 4UONA 1SR5C 4JCNA 1LHGH 4AG1A 1EB2A 2Z7FE 1O3EA 6CHAB 5FPYA 3PMJA 2BVXH 1GBEA 2M5TA 2Z94A 1O3JA 4ZH8A 2VVVA 2C4FH 4IW4E 1CQQA 3LU9B 4NG9H 1B5GH 2P3UB 4JK6A 1OWJA 1P11E 4ISLA 3PROA 1MKWK 4Z6AH 1TX8A 3MMGA 3QZRA 1V2RT 5T6FA 3SUDA 1CBWC 1O3GA 1GG6C 1GHXH 2A4RA 4GLYA 1Z1JA 1YCPH 3UTUH 1YP9A 1EOLA 1H1BA 1YC0A 1AFQB 1MTVA 1HV7A 3PV4A 4ZUHA 2BM2A 2ZGHA 3BTME 2BD5A 3SI3H 1W0ZU 2F91A 2AFQB 1K22H 5FX6A 3DA9B 3RXHA 5EPNA 1DITH 4LXBH 3FANA 1F7ZA 3SV2H 4AGJA 2A1DB 4CR5A 1Z7KA 1QNJA 1PYTD 1HYLA 2ZFFH 3V13A 3RXAA 4E05H 2ZDMA 1RTLA 2PLXA 1N6YA 1SHHB 3MU8A 7GCHG 3ZZCA 1AUJA 1LHDH 3JZ1B 2GTBA 1UK3A 1YCPK 4LZ4B 2ZO3H 1YPJH 3VB6A 2B5TB 3ZZBA 3FVFB 1GJDB 3SUGA 1TNIA 1MCTA 2YOLA 1LVBA 1BCUH 1HB0B 2H5DA 2OCVB 1Q2WA 5FCRA 2P93A 1A5GH 3FFGA 4ZAEA 4BAOB 4X1NU 1GVKB 2QAAA 1XXDA 3DFLA 5HM9A 1V2LT 4K8BA 1BITA 4IC5A 1ZRKA 1BJVA 1EJMA 1J8AA 2ZHDA 4X2VA 2FS8A 3A80A 2GCHG 1C1UH 3LC3A 1O33A 1GHBG 1H8IH 1C5XB 1GBTA 1SGDE 2FPZA 2QXIA 3SV6A 2W7UA 3LGIA 2WUBA