1O3BA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3bA02
2Z6BD 1P11E 1PPBH 2ALVA 2H6MA 2G8TA 2P16A 1HNEE 1NFWA 1SGDE 2SNVA 3P17H 4X1SU 3K6YA 5FPTA 1H8DH 1SGPE 1NU9A 1CVWH 1QB1A 4PROA 1SGFA 1HFDA 4ZKRU 2J92A 2CGAA 3PO1C 1CT4E 1IQMA 2ZZUH 2J9NA 3TNTA 1ZJKA 2GTBA 1KTSB 3ZVFA 1L1NA 3KQBA 4ZXXH 7KMEH 1AY6H 4MNWA 1SMFE 1BRAA 3IG6B 4ZUHA 1GJDB 2PUXB 4BTIB 4UFGH 1ZGVA 1AFQB 3ZZ4A 3ESTA 1WAYB 2W26A 1E34B 1UJ1A 2WPHS 3RXTA 5C67A 4BNRA 2FM2A 3SUFA 1AHTH 4ABIA 2FXRA 1LVOA 3GOVB 3RU4D 1FLEE 1TIOA 3BTKE 3MO6A 1C5TA 3RXAA 1FY3A 1O2GH 3GCHB 4X8UH 4DOQA 1GI1A 2ZDVH 4YTAA 2GGVB 1CU1A 1SLUB 1TMUH 3P8OA 3SNDA 2VWOA 3IITA 4FUBA 2BD3A 1UTOA 4BAHB 5DPAA 4MDSA 4LOYH 4ABHA 5A8ZA 1OWEA 1MTSA 1BTUA 1BTXA 1F92A 1GBMA 2R2WU 1O2XA 4JYUH 1N1LA 4UONA 1TYNA 1SI5H 4ZKSU 2O9QA 1DWBH 4NWLA 1L1JA 1Q31A 1H8IH 1MBMA 1OSSA 2BHGA 2Z9IA 1GPZA 4YOJA 5IYTA 1V2TT 2QGRA 1C9TA 1UTPA 4ABBA 1ELBA 5ESTE 4A5TS 3FANA 3F9FA 3S9CA 1HUTH 3SV9A 3GY8A 2FX6A 1GJCB 2Y7XA 1NRQH 2AEIH 3RP2A 1BJUA 2G5VA 3EYDA 5F8ZA 4RSPA 3BEFB 1ELFA 4IN2A 1EOJA 1P2KA 3SZNA 1SQAA 4AYYB 2BVRH 1ZOMA 1THSH 3M7UA 1T8LA 2QXJA 1DY9A 1FIZA 2XNIA 5DP6A 2GX4A 2H9EH 1JRTA 6CHAB 1QL8A 2PGQB 5AFYH 1Z8GA 1NS3A 1GMCG 1K1IA 1O2KA 3B9FH 3HK6B 4J2YB 1DDJA 1GMCF 2P3TB 4BXWA 2OTVA 4Y7AA 1O3IA 1GG6B 2KAIA 2ZHQH 1OOKB 4I8HA 1J9CH 3PMJA 3F6UH 1EXFA 2GCTB 4XOJA 1PQ5A 3MU8A 3TK6A 2HPQH 4Z6AH 1TBZH 3ZZ7A 5LPRA 3KHVA 1FPHH 3M7TA 3BTEE 1EZXC 3SHCH 1E36B 1LVBA 1Y5UT 4WMDA 1PPEE 3M5MA 4X6MA 4FVDA 1S81A 1TRMA 2VVVA 3O8BA 3NK8A 1MTUA 1BDAA 2F9UA 2QF3A 2WYGA 2BM2A 3M5LA 1Y8TA 1P05A 2TPIZ 4D9RA 1SOTA 3MHWU 2CXVA 2GZ7A 1A5GH 1HDTH 1J8AA 1P04A 1WTHD 1XKAC 6ESTA 3D62A 2FODA 4YM9A 3FZDA 1BTYA 1EP5A 2V35A 3M61U 2B0FA 2ZGJA 3QGNB 4TPYA 1MZDA 3UOPA 1ANEA 2FZZA 2ZG0H 1YCPH 1JIRA 1G36A 4U01A 1YBWA 3LOXA 3EA7A 4DURA 5TCCA 3MNXA 5GPIB 2G4TA 2BD5A 4IC6A 4ZHLU 1GI8B 3UTUH 1AE5A 2GP9B 4IN1A 3LGVA 3TPIZ 4Q7YA 4JYTA 1GBTA 3S69A 3F9GA 4D8NA 2AERH 1CT2E 1XUGA 1XM1A 3K6ZA 1BHXF 1P9UA 3PLPA 2A5AA 1QBVH 2Z3CA 4R8TB 1GI0A 3SU3A 1PQ8A 3E16B 4O3UA 1DSTA 2XBXA 2QY0B 1UVSH 4E7RG 3A7WA 3QWCH 4ZH8A 3RXIA 3ZVDA 3EE0B 3CENA 4NIVA 1O3AA 5LPFA 1W0ZU 3TH4H 2GD4B 4BTTB 3RXMA 1AUTC 3RC4A 3UR6A 2WPLS 2ODPA 4ZHAA 1WOFA 3KNXA 1E0FD 1ELVA 1T8OA 4TPIZ 1K1MA 1DITH 5JBCS 1VGCC 2C8ZB 1BCUH 1N6YA 2WUCA 5AVDA 2OQ5A 1TOCB 2XW9A 2OINA 4O3TA 4MNVA 3RXGA 1XUFA 3BTGE 2V3HH 2PGBB 2P94A 2FOEA 4ZKNU 1NTPA 1TGCA 2FOCA 3MO3A 1BRCE 2FYQA 3A8DA 4K8BA 3KN2A 2C8YB 3C27B 4INKA 1OP2A 2QCYA 4A7IB 1SPJA 4MLFB 3UQVA 1SLWB 3V12A 2W5EA 3P92A 4D76A 1SGCA 3D49H 4XFQA 1NC6A 1TX6A 3ODFA 3PTBA 5EOKA 5FBIA 1IHSH 2D1JA 2VIPA 2R0KA 1BRUP 2OBOA 5E2PA 4ABGA 2SGDE 3CS7A 1B5GH 1F5KU 1Z8IB 1KY9A 1O33A 2HVXA 2ZI2H 5FPSA 1C2EA 2BD4A 4FU7A 3SW2B 2J4IA 3NZIA 1DSUA 2GVFA 5DP8A 1HAZB 4X2YA 1OWKA 1GL1A 1ABIH 1HAYB 4H42U 4JMYA 1GBEA 1F0SA 1GVZA 2XWAA 1FQ3A 3I29A 3B8JA 2A4RA 1SR5C 1TNKA 3AW1A 2XXLA 1GI5A 1BB0B 3HKIB 5GCHG 3L33A 5F6MA 1THPB 3BN9A 1GI9B 2PKSB 1LMWB 5GCHF 4I8KA 1HIAA 4X8VH 3GY6A 2FYRA 2XBWA 1QY6A 5TJXA 5L30H 1QHRB 1T32A 5G4BA 4RKOB 4IW4E 1FY8E 1KXBA 1YGCH 2GV6A 4A6LA 1JBUH 3BV9B 1GJ6A 3PM3A 2AIPA 3P8FA 1V2UT 3D23A 4UE7H 2QIQA 2FOMB 3T25A 2UUYA 3PROA 4FUGA 3GDSA 2BLWA 5FPYA 2F9OA 2ZCKP 1QB6A 1UCYK 3QTOH 2FI4E 3PYHA 3FP7E 3RXBA 1BUIA 1VZQH 5HM2A 1HB0B 1NROH 3RXHA 3URDA 3ATIA 3RMNH 2EI6A 1YPMH 2P3UB 1GI2A 2PKAA 2Z9LA 1YP9A 2TGAA 3AASA 2SFAA 2BY8X 2ZGHA 1A3BH 3DT0H 1BITA 4X2WA 1P10A 1FZZA 9LPRA 1DWEH 2A7CA 5EGMA 5EXLA 1H1BA 3LGIA 4GHTA 1K1LA 2WV5A 1O3KA 4DVAU 2O8MA 3PWBA 3E1XB 4H6SB 2A7JA 1WSSH 1OWIA 2GZ8A 1AZZA 3E0PB 3OYPA 2Z9JA 2XTTB 5HGGA 1A7SA 1MMJN 4U32A 1AZ8A 2BMGB 1UHBA 1W0YH 1JXPA 3Q00A 2R0LA 2ZIQH 1AE8H 4NG9H 2AFQB 1HJAB 8ESTE 5C1YA 1SHHB 3LGTA 1G2LA 3S9AA 1F0UA 2OD3B 1GJ8B 4TY6A 1V2PT 2WV4A 1E35B 4BTUB 3P70B 1MTWA 1DXPA 2BZ6H 1Z1JA 2SGQE 5ETXA 2ZC9H 2BY5X 4K1TA 4FXGH 4YO9A 1KDQA 3GYMA 3LJJA 3W94A 2ZF0H 1YPEH 4D7FA 1D9IA 3I78A 3RM2H 3QUMP 4K69A 6LPRA 2Z3EA 4YLUA 3IWMA 4AG1A 1O3BA 1ZSJA 1H4WA 1J16A 1UK3A 5EXNA 1OYTH 1MTNC 7GCHG 1O2JA 3KGPA 2P8OB 2OBQA 1K1OA 7GCHF 1Z6JH 1GJ7B 1DICA 1C2JA 1GHXH 1Y59T 3HKJB 3S0NA 1GDNA 1MKXH 1RTLA 1HCGA 3EAJA 5E0HA 2ZFFH 2ZTZA 3A87A 4NA7A 3R0FA 4XBBA 1BMMH 1D3QB 1Y3VA 1RXPA 1LDTT 3SJOA 1RS0A 1L0ZA 1OS8A 1GCTB 2VU8E 4K3JA 2ZU4A 2A5IA 4DG4A 2PTNA 4Y8YA 4ESTE 2QV1A 1C5YB 3Q77A 4B75A 2FOHA 5FX5A 3SNEA 1KXEA 1RIWC 3VEQB 2QC2A 3O8DA 4K5ZA 3RXFA 3A81A 2DE9A 1TNLA 3KQEA 2K1QA 1FXYA 1NRNH 3TLOA 1MTVA 5I46H 2J95A 3TGJE 1PYTC 2C90B 1O2UA 1NRRH 5A0BA 4B71A 1O2WA 2D8WA 1AIXH 1D6WA 1JOUB 3RXVA 3SBKA 1WV7H 1Y3XA 2Y5GA 4AZ2B 2EI8A 1IQIA 3LH3A 1C5XB 3MFJA 1GHYH 1O2HA 2OP9A 1G37A 5A8XA 2UWPA 1MCTA 1P3EA 3HGPA 3RXPA 3MNSA 2H1UA 1IQHA 2PW8H 3BTHE 1ID5H 1EATA 2OXSA 5EQQA 2HNTE 1ESBA 3VB5A 1TRNA 2CN0H 3A7TA 5LGOA 1AGJA 2BOKA 1TGSZ 4XBDA 5EPYA 3VGCC 1LQDB 3E3TA 2JH0D 2Y7ZA 1SGTA 2PSYA 3NXPA 4IMQA 1H9IE 1TGNA 2ZHEH 4WXIA 4DY7B 5K0HA 3MH6A 1AUJA 1DM4B 2FI5E 1P2OA 1QFKH 1IHTH 1SOZA 1ARBA 2W7SA 4MG3A 2CMYA 4IS5A 4H4FA 1O2YA 1GVKB 1ORFA 3VXFH 4CHAB 4TY7A 1GHBG 3UY9A 5CMXH 1O2SA 1UO6A 1O3OA 2C4FH 4ISNA 1GHBF 2NU3E 1ETTH 1G3BA 1A46H 4HFPB 1PPHE 3M7QA 4XE4A 3U1JB 4IMZA 5T3HA 5AHGH 3OX7U 1L2EA 3KL6A 4B2AA 2OC8A 3Q3KA 3UWJH 1A2CH 1DOJA 2Z7FE 5E0GA 2H5CA 2O8TA 2NU1E 1U6QA 1GJ9B 2FS9A 4OS6A 1XXFA 1TX7A 1O3LA 3ZZAA 3BIUH 1IQNA 3MNCA 1ELTA 2BD7A 2SGPE 2ZA5A 2XC4A 5A2MH 2G81E 1O2PA 3S7KB 1P57B 2Z3DA 4Y8XA 4TYDA 4K1EA 1FJSA 4FU9A 3KQDA 2THFB 4F49A 5T6GA 1BBRK 1C2GA 4OS7A 4AGKA 3BG8A 1SFIA 2JETC 3EDXB 5EU8A 3DHKH 3RC5A 1S82A 1C2HA 2W3KA 2A2QH 3FFGA 5DK1A 1J14A 1RD3B 2HOBA 1LTOA 2RCEA 1ZSLA 2FOGA 3TK5A 2A4GA 1HAGE 3ZVAA 3SQHE 3SU4A 3OTJE 4XBCA 3TGKE 2AMPA 1TE0A 1LCYA 1V2MT 3ATWA 1DXWA 9ESTA 1THRH 2FESH 1ZZZA 4A1VA 1W3CA 2SGAA 1CBWC 1IAUA 4IBLH 2OCVB 1FI8A 1KLJH 4Y7BA 1PQAA 1EAUA 3T29A 2VGCB 2BDHA 3FZZA 2PHBA 3TIUA 1UTQA 5C2ZA 4NIWA 2BB4A 1BJVA 3ZV8A 2PWXA 5JPMH 1PPGE 1AB9C 5DGJA 1JMOH 4GUXA 2AGEX 5TCAA 3MH5A 1B0EA 2HWLB 3QTVH 4AX9H 1O2VA 1YPHE 1HAHH 2HNTF 2SGEE 2C8XB 4K60A 3K65B 1HJ8A 2BQWB 4OS4A 2UWOA 2CHAB 8GCHG 5IDKA 1TX8A 8GCHF 1EPTC 2HPPH 2QN5T 4X8SH 1BZXE 4BAOB 3SQEE 1S85A 1IQEA 2ZDMA 1TNIA 1TAWA 1QRWA 4AFUA 3L6PA 4X1PU 2I6QA 4Q7ZA 1ZPCA 1O3CA 1F5LA 2F3CE 3DA9B 4D9QA 1CT0E 3E91A 1AWHB 2FTMA 5EQSA 1UTNA 1C4V2 3UREA 1CE5A 3PLKA 4AGJA 1SGNE 3ITIA 1QL9A 1LHGH 4X2XA 1GBHA 5ABWA 4Q2KA 5C1XA 1OX1A 3LGWA 2SNWA 1P0SH 1O3EA 1GI7B 4I31A 1C1MA 4MQAA 1P02A 4X0WU 2BLQA 2BDYA 2STBE 4MPVA 2BDAA 3ELAH 1YM0A 1OXGA 3FAOA 2BYAX 4GCHG 1K1JA 1FUJA 5DG6A 1SL3A 1DE7H 4GCHF 2XRCA 2J2UA 3RUOA 5EW2H 3KIDU 2A4OA 4AFSA 1SGRE 5FXLA 1CA0C 1UVUH 1PJPA 1A0JA 1C1WH 2Q6DA 1DWDH 2FTLE 1NPMA 4YZUA 3JZ1B 5AFZH 1GJAB 1X7AC 4VGCC 2Z9KA 4UFFH 3SI4H 1G9IE 4XDEA 4O9VA 4DW2U 2EC9H 4X8TH 4CR9A 3VB4A 1QB9A 1V2JT 3MH7A 4WF8A 2VINA 1BQYA 3A8AA 5DP5A 4JK6A 4NZLA 1D4PB 1C1OA 1XUHA 3TVJB 1DWCH 1C5SA 1GHAG 3SGAE 1MQ5A 1TPSA 1GHAF 4YLQH 2VWLA 4KELA 1C5VA 3ZV9A 4I8LA 3TJVA 2BXUH 1SC8U 2W7UA 1EKBB 2RA3A 1SSXA 1DVAH 2J38A 3E90B 4DJZB 1PYTD 1H9HE 5J4SA 1EX3A 4B2BA 4JYVH 1IQFA 4LZ4B 1JIMA 1RFNA 2BLVA 3GY2A 1LVYA 1O2QA 3PTNA 3CP7A 3QLPH 1EOLA 2EEKA 3A7XA 3M37A 1C5UA 5DP9A 3TK9A 4UDWH 4JK5A 3QDZB 4ASHA 4CRGA 2ZDNA 4DGJA 2Y5HA 1TQ7B 1TOMH 3BEIB 1O5GH 2ALPA 4ABAA 1TABE 1Y5BT 3BF6H 4ISIH 3MTYA 4U30A 1TBRH 1GL0E 1FY5A 2BY6X 3MOCA 4I7YH 1O5AB 1GHVH 2R3UA 2NU2E 1YPGH 1QNJA 4B74A 1F7ZA 2ZPSA 1RTFB 4YESB 1QTFA 1IOEA 1C5PA 1HXEH 4FUEA 1GBDA 5DJ7A 1FY1A 3RXOA 3M3SA 4UD9H 3SJ8A 1AFEH 1ELGA 2ZU5A 1UTLM 2HGTH 3GCHC 1SFQB 3A8BA 1W2KH 2QXIA 4CRCA 4WMFA 1XVOA 4AN7A 3ZYDA 1SBWA 1QL7A 2OC0A 1C1SA 1DANH 3GY4A 1GBFA 1ELDE 2B7DH 5JBBS 4F4OC 1LVMA 2A32A 1GDUA 1QURH 1C1QA 1AI8H 2BZAA 1NY22 3LPRA 4J1YA 1WTGH 4KTCA 4M7GA 5F8XA 1SG8B 3H5CB 2WYJA 3T26A 1IQJA 2LNCA 1C1PA 2F9VA 3SV6A 2GMTB 4BANB 5CHAB 1RIWB 3GDVA 5C5OA 3MO9A 3T27A 1CO7E 1C1TA 1MKWH 1HLTH 2A7HA 1RRKA 3SJKA 2LPRA 4ABJA 3U8RH 3ZZDA 3FP6E 1HV7A 5GIBA 1YPJH 5JB9S 1W8BH 1V2QT 2GDEH 3T28A 1Y3YA 4DIIH 2GCHG 5E2OA 1WU1A 4KTUA 2WPJS 4AG2A 3W95A 2BVSH 1O2LA 8LPRA 2GCHF 5JDUB 1HAIH 5FAHA 3MYWA 1LO6A 4FUFA 1TWXB 2GT8A 1N8OB 1C5RA 1CGIE 1C5QA 6CHAC 5L2YH 1K28D 2FOFA 1CHGA 4NA8A 4NIYA 4JCNA 2FDAA 1OKXA 1W13U 2QAAA 5T6FA 1AWFH 1QR3E 1K9OE 4FVBA 4X6PA 3ZZ5A 2W3IA 1ZHRA 1DX5M 4O03A 1RGQA 4MVNA 1GMHG 3S7HB 1T4UH 3UFAA 2Q6GA 4AB8A 5HM9A 1GMHF 2ODYB 2TRMA 2ZTYA 3GCOA 3UPEA 1A0HB 3H7TA 1Z8RA 1E38B 1O32A 3UIRA 2G55A 3M3TA 2VIVA 2F9NA 3RXDA 1O0DH 2OC1A 1S83A 2WPKS 1DS2E 1ESTA 1QBOA 1SQOA 1VITH 5GJ4B 1O5FH 3MU4A 3MI4A 1FNIA 1PPZA 1M9UA 1QCPA 3MH4A 1GJ4H 1C5OH 1C1UH 1S6HA 3LH1A 3PMHB 4E7NA 2QXHA 2YNBA 3SNBA 1AQ7A 3EGKH 4A1XA 1AMHA 2V0BA 1NRSH 2IPHA 1DUAA 1TNJA 1VITG 1VJ9U 4K8YA 1YCPM 5T6DA 1VITF 1UCYH 1C2IA 2XBYA 1BTWA 3BEUA 5GDSH 1S0QA 2FEQH 2BDCA 2WPMS 1ANBA 3SHAH 1MH0A 3A88A 1O38A 3A86A 2C8WB 1KSNA 2VIWA 2A4QA 3BTTE 1BMLA 1NFXA 4B2CA 3NCLA 5A0AE 1XUIA 2G4UA 3F9HA 4CRAA 3PO1B 2A5KA 4Y10E 4X1RU 2UUJB 2ZU3A 4INLA 3ZVGA 2XCFA 4Z0KA 2Y82A 2BQ6B 3ZZ3A 1RTKA 1A0LA 1A1RA 1HPGA 1MAYA 1W10U 4ISOA 5F8TA 2PR3A 2VNTA 1GCDA 2ZDAH 4Y8ZA 2Z9GA 3F1SB 3KF2A 5FBEA 3QZQA 1VCPA 1ZR0A 2ZGXH 3GCTG 3QN7A 1ZMLA 5E8EH 1GDQA 2OQUA 4HTCH 3GCTF 1NZQH 1SGYE 2GV7A 2XBVA 3SJ9A 1FAXA 3SOSA 1L4DA 1SVPA 1YLCA 1VR1H 3A7YA 3TJUA 1P8VC 1DLEA 1O2NA 1AB9B 2OUAA 2VH0A 4NSVA 3C1KA 3MU5A 4YOIA 1V2VT 4LK4A 3AAVA 3KQCA 3T2NA 1MUEB 1AU8A 1O3JA 1W11U 2D26C 3BTQE 3M36A 4X1QU 3U8TH 2ZWLH 3RDZA 3QK1A 3HATH 3CS0A 3GISB 2Q6FA 2TGDA 1MU8B 2P93A 4NWKA 3RMLH 3TU7H 1ZMNA 1Z7KA 1OWDA 3VB6A 3PV4A 3A7ZA 1Z71A 2F91A 1CGHA 1LHCH 1K22H 2BLOA 4E06H 1UTMA 1TALA 4AFQA 1TPOA 5HMAA 5ESBA 1P2JA 3LC5A 2FPZA 3SN8A 1VCWA 3ZVEA 3M5NA 1LKBA 2V3OH 4AYVB 1GBIA 2FLRH 1D3PB 1DLKB 3MMGA 1SB1H 4ZROA 3BTME 2I6SA 2ZQ1A 1YC0A 3DFJA 5EQRA 1HAVB 3UWIA 3I77A 1A3EH 3M5OA 3A8CA 3VPKA 4RKJB 5FX6A 5JYIA 1ZTJA 2B5TB 2PFEA 3LDXH 3U8OH 1CA0B 1D6RA 4Y79A 2PKSC 1FV9A 2R3YA 1ZPZA 6GCHG 3A80A 1BTPA 2P3FH 2AGGX 1O3GA 6GCHF 1C1NA 2GT7A 1Q2WA 4VGCB 1T7CA 1F2SE 1KLIH 4YOGA 5A09A 3V0XA 1ABJH 3P95A 1ANCA 3HK3B 4GPGA 4BAQB 1GBKA 4OS2A 1PQ7A 3A84A 1O34A 1GVLA 1AD8H 4FUIA 2NU4E 4CH8B 3LGYA 1QIXB 3V3MA 2R9PA 4K1SA 3SV8A 2BDGA 4JZEH 3ATKA 3NUMA 3E0NB 2VWNA 1Y5AT 1OWHA 2ZDKA 5C20A 1P12E 2ANYA 1YYY1 1NN6A 5F03A 3GCNA 1EASA 1O2TA 1ETSH 4D7GA 1Z1IA 4NFEA 3HPTB 4MPXA 3TJNA 3RMMH 4NIXA 2D2DA 3RXSA 2CF9H 3PLBA 2ASUB 1ZPBA 2SGFE 3TNSA 8KME2 5BPEA 2XCNA 4Y0YE 1TONA 5CE1A 5DO4H 1TNGA 2OC7A 1NESE 2Y81A 5PTPA 1O30A 3P6ZB 3E8LA 1NU7B 1HAPH 1KXAA 2RG3A 3URCA 1FONA 2PUQH 5LPEA 1HJAC 1WQVH 4OGYA 4OGXA 2ILNA 2ZU1A 3BIVH 3Q3YA 1ZMJA 1WCZA 2ZKSA 1KXCA 4JZDH 1HJ9A 3R3GB 1O5DH 1UK2A 2FWWA 3LU9B 2VH6A 3G01A 1O5CB 1BBRH 1J17T 4Y6DA 1K1PA 1TFXA 1P06A 2RDLA 2VVUA 3ZZBA 5HXFA 1O2MA 2O8LA 1VGCB 3LKWA 4ZMAH 3U1IB 1MAXA 3RXUA 3RXRA 2F9BH 1CHOG 1EAXA 4O97A 1BHXB 3SU0A 2P8OC 3OY6U 4BAKB 1JWTA 1CHOF 1BTZA 3QX5H 4ZHMU 2BOHB 3B23B 1KXFA 3A89A 2FI3E 1FIWA 2YNAA 3UNQA 4HI3A 1UTKA 4ZAEA 1C1VH 3TH3H 1TA6A 2BDIA 1GCTC 1HBTH 4SGAE 3OU0A 1GGDC 4UFDH 1HAXB 3RLYH 1GJ5H 3GY7A 3LJOA 3T5FH 1MU6B 3UOUA 3UR9A 1QRZA 4TWYA 1C5LH 4UFEH 1TGTA 1TPPA 1GBBA 2ZO3H 4B73A 1DY8A 4OS5A 2ZU2A 1BMAA 2A0QB 3T62A 2EA3A 1ZHMA 1C2KA 3KEEA 2J34A 3V13A 2FO9A 3BG4C 3F9EA 1G30B 4WVPE 3AAUA 1PPCE 2H5DA 2HNTC 2AMDA 1AVGH 1QJ6B 3TH2H 1OPHB 1ELAA 1GBCA 3RU4T 2ZFQH 4FUCA 3LIWA 2ESTE 2EI7A 1F5RA 3EA9A 4KKDA 2FMJA 1CQQA 2AIQA 2C3SA 1C9PA 2A2XH 3UNSA 3SV2H 1P09A 1V3XA 2VIDA 2KAIB 5GXPA 1YF4A 3A85A 4A92A 4XSKU 1SGQE 3BSQA 5BRRE 2ZCLP 1GBAA 3GYLB 2ZTXA 1L4ZA 1GI3A 2Y5FA 3O8CA 4ZXYH 3RU4E 4LXBH 1C2MA 1ZGIA 4GSOA 1LPKB 2TGTA 1O3HA 2TGPZ 2VVCA 2ZNKH 4AORA 1YCPK 1P01A 1P03A 2FP7B 5A8YA 1C2DA 1LPGB 1DFPA 3SUEA 1O36A 2YOLA 5EW1H 1BOQA 1QBNA 1KLTA 2C93B 2P59A 3TJOA 1TLDA 2M5TA 1B0FA 2PTCE 4CHAC 4I32A 1UVTH 4JZIA 2XWBI 4DT7B 1O31A 1GBLA 4AB9A 4CRDA 3OSYA 1V2OT 1G2MA 3RLWH 2V6NA 2NWNA 2ZP0H 4BAMB 1TNHA 1OYQA 1ZHPA 2ZHDA 2FOAA 1ACBE 3N7OA 2FIRH 2UWLA 1YKTA 1QJ7B 1SGFG 3PB1E 1TB6H 1XMNB 1IQKA 2R2MB 4Y11E 2PSXA 1LPZB 1XXDA 1F0TA 1W12U 1V2RT 2A45B 2ZCHP 1BRBE 5FHTA 5DKMA 2UUFB 3GDUA 4CH2B 3ZZ6A 3STJA 2ANWA 1EUFA 1XUJA 4WH8A 4TWWA 1T31A 1S84A 1EJMA 1W14U 2O8UA 2XC5A 1T8MA 1T8NA 2ZFTA 5L6NH 4OS1A 1Y3WA 2ZEBA 3STIA 4WXVA 2BX3A 2ZHFH 1PFXC 4ABEA 1O3PB 1V2LT 1K2I1 1F0RA 4YT6H 3MWIU 2GZ9A 1WQSA 1EJNA 2B9LA 1O39A 2FLBH 2Y6TA 3RM0H 4FU8A 1Q3XA 3FVFB 4RN6A 3SUDA 1AFQC 1GI4A 1SHYA 1W7XH 4I8GA 2FS8A 1V2KT 1EZUC 2AYWA 1MQ6A 2TIOA 1AO5A 1A5IA 2DUCA 1AVWA 2AH4X 1BTHH 1A4WH 1G32B 1QGFA 1O35A 1MTNB 1ESAA 1N6XA 3WY8A 3AVZA 3LT3A 3ZYEA 1ELCA 2F9PA 1A61H 5C5NA 2P95A 1FPCH 1ZRKA 1ZJDA 5C1UA 3OY5U 1YPHC 1CA8B 1INCA 2VGCC 4Y0ZE 1UCYE 4Y71A 2ZFRH 2WPIS 3Q3XA 1O5EH 4A1TA 1O3FA 1C5ZB 4ISHH 1FDPA 4IC5A 3VFEA 1EZQA 2ZGBH 5JBTA 1MKWK 1XX9A 3LC3A 2VIOA 2AGIX 3E6PH 4BOHA 3ODDA 4NCYA 1V2WT 2HLCA 1ZLRA 2GKVE 2H2ZA 2OLGA 3HGNA 3RXEA 2BY7X 1XKBC 4X1NU 5GWZA 4KGAA 2CHAC 3RXKA 1J15A 1GHWH 3BTWE 3F68H 1O3DA 5AF9H 1K21H 2RA0A 1E37B 3BTFE 1DPOA 1DT2A 1UVPA 4AFZA 3DD2H 2VWMA 1XVMA 4Y76A 1S0RA 4HZHA 1NFUA 1FMGA 4ABDA 1D3DB 1LHDH 2ZGCA 4K2YA 4GVUA 1NT1A 1O5BB 5FCKA 1V6DA 4U2WA 1FN8A 3MNBA 1L1GA 3PMBB 4CRFA 4WJG2 1GI6A 1A5HA 1S5SA 1ZRBA 3MU1A 2HALA 1EB1H 4YT7H 4X6NA 4CREA 2CV3A 4FUHA 4Q7XA 3QZRA 4MPUA 1T4VH 1GG6C 1EB2A 3VGCB 1TMTH 4ZKOU 2ANMH 1EAWA 5E0JA 1Z6EA 3SU1A 3JZ2B 4WWYA 5K7RA 2STAE 2XC0A 2GCTC 2H9HA 1MBQA 3NWUA 4WH6A 3Q76A 1HIAB 2Q1JA 5B6OA 1EAIA 1H9LB 1WYKA 4NZQA 1OWJA 3GY5A 4I8JA 4NGAH 3PWCA 1MD8A 1P2IA 1P2NA 5HYOA 3UNRA 1HRTH 2JKHA 3M3VA 1DUEA 2ZFPH 5EXMA 4GAWA 4JZ1A 1C1RA 2TBSA 1CGJE 3A82A 4CR5A 3UUZA 2BD8A 3BTDE 5DP7A 1P2MA 4AOQA 3DUXH 1SQTA 2CJIA 1C5NH 4H6TA 3QO6A 3SO3A 2WINI 2BY9X 4SGBE 3U98H 2ZPRA 2PKAB 1Y3UA 1EJAA 1YPLH 1G3EA 2FX4A 3SU6A 1QQ4A 1EP6A 2H9TH 5I25A 1OP8A 1AKSA 1AKSB 3GY3A 3LONA 1SGIB 2G51A 5DP4A 4CBNA 2QXGA 1G3DA 4KTSA 2WUBA 3RXCA 1HXFH 3GICB 1BMNH 5DP3A 1C2LA 2ZFSA 2ZPQA 4WY3A 2PV9B 1TGBA 1SLXB 3VB7A 1IQGA 1C4U2 2QF0A 4DCDA 4GHQA 1O37A 2JETB 1LHEH 1EZSC 1OP0A 1UHBB 3UQOA 1YLDA 3TGIE 1MD7A 1V2ST 1TQ0B 1KIGH 1O3MA 4QT8C 2A1DB 3TITA 1O2IA 5C3NA 5J4QA 2BD9A 2BQ7B 3M35A 1ZTLA 1CBWB 2VB0A 1MKXK 3VB3A 1QJ1B 4JZFH 2DE8A 1BIOA 3O8RA 1HGTH 1KTTB 2BTCE 3ZZ9A 3ENSB 1KDQB 2BDBA 3H7OA 7ESTE 5L2ZH 1NFYA 5JBAS 2ULLA 1LQEA 2ZQ2A 4GLYA 1MCVA 1O3NA 3ATLA 1GHZA 4CRBA 1RJXB 1TMBH 3A7VA 3AW0A 3SI3H 4NA9H 1S6FA 1QA0A 1GBJA 2F83A 5H4IB 4FUJA 1ARCA 1GMDG 1MZAA 1UK4A 2ZDLA 1GMDF 1YPKH 3ATMA 4MNYA 4NSYA 2FOBA 3A83A 4ISLA 3FP8E 1C2FA 1FY4A 2NU0E 3K2UA 4I33A 3P8NA 4B76A 1G3CA 1C4Y2 1EPTA 1EPTB 3D65E 1ELEE 4Q80A 2IOTA 3LGUA 2HRVA 4R0IA 3QGJA 4UEHH 4THNH 3ZZ8A 1KXDA 1LKAA 4MPWA 3RMOH 2GDDA 1O2OA 3EA8A 2GMTC 1W7GH 1B7XB 3PMAB 1GGDB 1O2ZA 5CHAC 2ZHWH 2G00A 5EODA 1ANDA 1ZTKA 2Y80A 1BT7A 2QA9E 3P8GA 1FAKH 3KCGH 4B1TA 2JH6D 3BG4B 1P3CA 2A31A 1BBRE 1WBGB 2B8OH 4E05H 1TPAE 7LPRA 4MNXA 3SGQE 2UUKB 5LH8A 4FUDA 1GJBB 3U69H 3VXEH 3RXQA 1HAVA 3NKKA 1ZYOA 3SORA 1VJAU 4MTBA 1C5MD 4NFFA 1NM6A 3V7TA 1BA8B 1V2NT 1AN1E 4X6OA 3SNAA 3RC6A 3ZVCA 1N8OC 3U9AH 4CBOA 2AS9A 3SU2A 3NPSA 2ODQA 3SU5A 3SJIA 1P9SA 3S9BA 1SGEE 1JRSA 1P2QA 1LHFH 1TBQH 1AVXA 1EQ9A 2ANKH 3RXLA 3DFLA 2O8WA 2BVXH 3L3TA 1ZSKA 4IGDA 5EPNA 2IJOB 2J94A 1HAOH 4WMEA 1C5WB 1HYLA 1QA7A 2AMQA 1NRPH 1QQUA 5FCRA 1O2RA 1PPFE 1GWAA 5A0CA 2ZECA 3ZZCA 1IQLA 1WUNH 2VJ1A 4INHA 2JH5D 4X2VA 2IN2A 2VIQA 1VCQA 1QRXA 1SLVB 2PLXA 1TRYA 3EQ0H 2CF8H 5EG4A 4LZ1H 3RXJA 2BD2A 3K9XB 3SUGA 4DIHH 1ETRH 1FN6A 2G5NA 2XYAA 1XUKA 1D3TB 1NO9H 3SGBE 1K1NA 2Z94A 3SV7A 3SNCA 1Z8JB 1TA2A 1UMAH 2BXTH 2BX4A 4BXSA 5SGAE 5JB8S 1UTJA 1KYNA 3MU0A 4KP0A 1UVOA 1CSOE 4HGCA 2QYIA 4ABFA 2G52A 3ZVBA
chains in the Genus database with same CATH superfamily
2Z6BD 1P11E 1PPBH 4B6EA 2ALVA 2H6MA 2G8TA 2P16A 1HNEE 1NFWA 1SGDE 2SNVA 3P17H 4X1SU 3K6YA 5FPTA 1H8DH 1SGPE 1NU9A 1CVWH 1QB1A 4PROA 1SGFA 1HFDA 4ZKRU 2J92A 2CGAA 3PO1C 1CT4E 5C17A 1IQMA 2ZZUH 2J9NA 3TNTA 1ZJKA 2GTBA 1KTSB 3ZVFA 1L1NA 3KQBA 4ZXXH 7KMEH 1AY6H 4MNWA 2LP6A 1E79D 1SMFE 1BRAA 3IG6B 4ZUHA 1GJDB 2PUXB 4BTIB 4UFGH 1ZGVA 1AFQB 3ZZ4A 3ESTA 2GJGA 1WAYB 2W26A 1E34B 1UJ1A 2WPHS 3RXTA 5C67A 4BNRA 2FM2A 3SUFA 1AHTH 4ABIA 2FXRA 1LVOA 3GOVB 3RU4D 1FLEE 1TIOA 3BTKE 3MO6A 1C5TA 3RXAA 1FY3A 1O2GH 3GCHB 4X8UH 4DOQA 1GI1A 2ZDVH 4YTAA 2GGVB 1CU1A 1SLUB 1TMUH 3P8OA 3SNDA 2VWOA 3IITA 4FUBA 2BD3A 1UTOA 4BAHB 5DPAA 4MDSA 4LOYH 4ABHA 5A8ZA 1OWEA 1MTSA 1BTUA 1BTXA 1F92A 1GBMA 2R2WU 1O2XA 4JYUH 1N1LA 4UONA 1TYNA 1SI5H 2KCOA 4ZKSU 4DT4A 2O9QA 1DWBH 4NWLA 1L1JA 2JJ1D 1Q31A 1H8IH 1MBMA 1OSSA 2BHGA 2Z9IA 1GPZA 4YOJA 5IYTA 1V2TT 2QGRA 1C9TA 1UTPA 4ABBA 1ELBA 5ESTE 3W1EA 4A5TS 3FANA 3F9FA 3S9CA 1HUTH 3SV9A 3GY8A 2FX6A 1GJCB 4F48B 2Y7XA 1NRQH 2AEIH 3RP2A 1BJUA 2G5VA 3EYDA 5F8ZA 4RSPA 3BEFB 1ELFA 4IN2A 1EOJA 1P2KA 3SZNA 1SQAA 4AYYB 2BVRH 1ZOMA 1THSH 3M7UA 1T8LA 2QXJA 1DY9A 1FIZA 2XNIA 5DP6A 2GX4A 2H9EH 1JRTA 6CHAB 1QL8A 2PGQB 5AFYH 1Z8GA 1NS3A 1GMCG 1K1IA 1O2KA 3B9FH 3HK6B 4J2YB 1DDJA 1GMCF 2P3TB 4BXWA 1FX0B 3WW7A 2OTVA 4Y7AA 1O3IA 1GG6B 2KAIA 2ZHQH 1OOKB 4I8HA 1J9CH 3PMJA 3F6UH 3KYFA 1EXFA 2GCTB 4XOJA 1PQ5A 3MU8A 3N99A 3TK6A 2HPQH 4Z6AH 1TBZH 3ZZ7A 3FO8D 5LPRA 3KHVA 1FPHH 3M7TA 3BTEE 1EZXC 3SHCH 1E36B 1LVBA 1Y5UT 4WMDA 4I86A 1PPEE 3M5MA 4X6MA 4FVDA 1S81A 1TRMA 2VVVA 3O8BA 2XNDD 3NK8A 1MTUA 1BDAA 2F9UA 2QF3A 2WYGA 2BM2A 3M5LA 1Y8TA 1P05A 2TPIZ 4D9RA 1SOTA 3MHWU 2CXVA 2GZ7A 1A5GH 1HDTH 1J8AA 3SYJA 1P04A 1WTHD 1XKAC 6ESTA 3D62A 2FODA 4YM9A 3FZDA 1BTYA 1EP5A 2V35A 3M61U 2B0FA 2ZGJA 3QGNB 4TPYA 1MZDA 3UOPA 1ANEA 2FZZA 2ZG0H 1YCPH 1JIRA 1G36A 3F3BA 4U01A 1YBWA 3LOXA 3EA7A 4DURA 5TCCA 3MNXA 2KCYA 5GPIB 2G4TA 2BD5A 4IC6A 5DSFA 4ZHLU 1GI8B 3UTUH 1AE5A 2GP9B 4IN1A 3LGVA 3TPIZ 4Q7YA 4JYTA 2RFKC 1GBTA 3S69A 3F9GA 4D8NA 2AERH 1CT2E 1XUGA 1XM1A 3K6ZA 1BHXF 1P9UA 3PLPA 2A5AA 1QBVH 2Z3CA 4R8TB 1GI0A 3SU3A 1PQ8A 3E16B 4O3UA 1DSTA 2XBXA 2QY0B 1UVSH 2EY4C 4E7RG 3A7WA 3QWCH 4ZH8A 3RXIA 3ZVDA 3EE0B 3CENA 4NIVA 1S6LA 1O3AA 5LPFA 2RDEA 1W0ZU 3TH4H 2GD4B 4BTTB 3RXMA 1AUTC 3RC4A 3UR6A 2WPLS 2ODPA 4ZHAA 1WOFA 3KNXA 1E0FD 1ELVA 1MABB 4ACAA 1T8OA 4TPIZ 1K1MA 1DITH 2M2AA 5JBCS 1VGCC 2C8ZB 1BCUH 1N6YA 2WUCA 5AVDA 2OQ5A 5HIYA 1TOCB 2XW9A 2OINA 4O3TA 4MNVA 3RXGA 1XUFA 3BTGE 2V3HH 2PGBB 2P94A 2FOEA 4ZKNU 1NTPA 1TGCA 2FOCA 3MO3A 1BRCE 2FYQA 3A8DA 4K8BA 3KN2A 2C8YB 3C27B 4XRNA 4INKA 1OP2A 2QCYA 4A7IB 1NBMD 1SPJA 4MLFB 3UQVA 1SLWB 3V12A 2W5EA 3P92A 4D76A 1SGCA 3D49H 4XFQA 1NC6A 1TX6A 3ODFA 3PTBA 4M9FA 5EOKA 5FBIA 1IHSH 2D1JA 2VIPA 2R0KA 1BRUP 2OBOA 5E2PA 4ABGA 2SGDE 3CS7A 1B5GH 1F5KU 1Z8IB 1KY9A 1O33A 2HVXA 2ZI2H 5FPSA 1C2EA 2BD4A 4FU7A 3SW2B 2J4IA 3NZIA 1DSUA 2GVFA 5DP8A 1HAZB 2YMSC 4X2YA 1OWKA 1GL1A 1ABIH 1HAYB 4H42U 4JMYA 1GBEA 1F0SA 1GVZA 2XWAA 1FQ3A 3I29A 3B8JA 2A4RA 1SR5C 1TNKA 3AW1A 2XXLA 1GI5A 1BB0B 3HKIB 5GCHG 3L33A 5F6MA 1THPB 3BN9A 1GI9B 2PKSB 1LMWB 5GCHF 4I8KA 1HIAA 4X8VH 3GY6A 2FYRA 2XBWA 1QY6A 5TJXA 5L30H 1QHRB 1T32A 5G4BA 4RKOB 4IW4E 5C94A 1FY8E 1KXBA 1YGCH 2GV6A 4A6LA 1JBUH 3BV9B 1GJ6A 3PM3A 2AIPA 3P8FA 1V2UT 3D23A 4UE7H 2QIQA 2FOMB 3T25A 2UUYA 3PROA 4FUGA 3GDSA 2BLWA 5FPYA 2F9OA 2ZCKP 1QB6A 1UCYK 3QTOH 2FI4E 3PYHA 3FP7E 3RXBA 1BUIA 1VZQH 5HM2A 1HB0B 1NROH 3RXHA 3URDA 3ATIA 3RMNH 2EI6A 1YPMH 2P3UB 1GI2A 2PKAA 2Z9LA 1YP9A 2TGAA 3AASA 2SFAA 2BY8X 1WDIA 2ZGHA 1A3BH 3DT0H 1BITA 4X2WA 1P10A 1FZZA 3U28C 9LPRA 2KCPA 1DWEH 2A7CA 5EGMA 5EXLA 1H1BA 3LGIA 4GHTA 1K1LA 2WV5A 1O3KA 4DVAU 2O8MA 3PWBA 3E1XB 4H6SB 2A7JA 1WSSH 1OWIA 2GZ8A 1AZZA 3E0PB 3OYPA 2Z9JA 2XTTB 5HGGA 1A7SA 1MMJN 4U32A 1AZ8A 2BMGB 1WXRA 1UHBA 1W0YH 1JXPA 3Q00A 2R0LA 2ZIQH 1AE8H 4NG9H 2AFQB 1HJAB 1OHHD 8ESTE 5C1YA 1SHHB 3LGTA 1G2LA 3S9AA 1F0UA 2OD3B 1GJ8B 4TY6A 1V2PT 2WV4A 1E35B 4BTUB 3P70B 1MTWA 1DXPA 2BZ6H 1Z1JA 2SGQE 5ETXA 2ZC9H 2BY5X 4K1TA 4FXGH 4YO9A 1KDQA 3GYMA 3LJJA 3W94A 2ZF0H 1YPEH 4D7FA 1D9IA 3I78A 3RM2H 3QUMP 4K69A 6LPRA 2Z3EA 4YLUA 3IWMA 4AG1A 1O3BA 1ZSJA 1H4WA 1J16A 1UK3A 5EXNA 1OYTH 1MTNC 7GCHG 1O2JA 3KGPA 2P8OB 2OBQA 1K1OA 7GCHF 3OTPA 1Z6JH 3VG8A 1GJ7B 1DICA 3OFND 1C2JA 1GHXH 1Y59T 3HKJB 3S0NA 5HIZA 1GDNA 1MKXH 1RTLA 1HCGA 1YLNA 3EAJA 5E0HA 2ZFFH 3N7DA 2ZTZA 3A87A 4NA7A 3R0FA 4XBBA 1BMMH 1D3QB 1Y3VA 1RXPA 1LDTT 3FKSD 3SJOA 1RS0A 1L0ZA 1OS8A 1GCTB 2VU8E 4K3JA 2ZU4A 2A5IA 4DG4A 2PTNA 4Y8YA 4ESTE 2QV1A 1C5YB 3Q77A 4B75A 2FOHA 5FX5A 2WSSD 3SNEA 1KXEA 1RIWC 3VEQB 2QC2A 3O8DA 4K5ZA 3RXFA 3A81A 2DE9A 1TNLA 3KQEA 2K1QA 1FXYA 1NRNH 3TLOA 1MTVA 5I46H 2J95A 3TGJE 1PYTC 2C90B 1O2UA 4RT0A 1NRRH 5A0BA 3GS9A 4B71A 1O2WA 2D8WA 1AIXH 1D6WA 1JOUB 3RXVA 3SBKA 1WV7H 1Y3XA 2Y5GA 4AZ2B 2EI8A 1IQIA 3LH3A 1C5XB 3MFJA 1GHYH 1O2HA 1UW7A 1G37A 2OP9A 5A8XA 2UWPA 1MCTA 1P3EA 3HGPA 3RXPA 3MNSA 2H1UA 1IQHA 2PW8H 3BTHE 1ID5H 1EATA 2OXSA 5EQQA 2HNTE 1ESBA 3VB5A 1TRNA 2CN0H 3A7TA 5LGOA 1AGJA 2BOKA 1TGSZ 4XBDA 5EPYA 2JDID 3VGCC 1LQDB 3E3TA 2JH0D 2Y7ZA 1SGTA 2PSYA 3NXPA 4IMQA 1H9IE 1TGNA 2ZHEH 4WXIA 4DY7B 5K0HA 3MH6A 1AUJA 1DM4B 2FI5E 1P2OA 1QFKH 1IHTH 1SOZA 1ARBA 2W7SA 4MG3A 2CMYA 4IS5A 4H4FA 1O2YA 1GVKB 1ORFA 3VXFH 2IJD1 4CHAB 4TY7A 1GHBG 3UY9A 5CMXH 1O2SA 1UO6A 1O3OA 2C4FH 4ISNA 1GHBF 1H8ED 2NU3E 1ETTH 1G3BA 1A46H 4HFPB 1PPHE 3M7QA 4XE4A 3U1JB 4IMZA 5T3HA 5AHGH 3OX7U 1L2EA 4TT3D 3KL6A 4B2AA 2OC8A 3Q3KA 3UWJH 1A2CH 1DOJA 2Z7FE 2J5UA 5E0GA 2H5CA 2O8TA 2W6ID 2NU1E 5C0UA 1U6QA 1GJ9B 2FS9A 4OS6A 1XXFA 1TX7A 1O3LA 3ZZAA 3BIUH 1IQNA 3MNCA 1ELTA 2BD7A 2SGPE 2ZA5A 2XC4A 5A2MH 2G81E 1O2PA 3S7KB 1P57B 2Z3DA 4Y8XA 4TYDA 4K1EA 4FOUC 1FJSA 4FU9A 3SZEA 3FOAA 3KQDA 2THFB 4F49A 5T6GA 1BBRK 1C2GA 2YMSD 4OS7A 4AGKA 3BG8A 1SFIA 2JETC 3EDXB 5EU8A 3DHKH 3RC5A 1S82A 1C2HA 2W3KA 2A2QH 3FFGA 5DK1A 1J14A 1RD3B 2HOBA 1LTOA 2RCEA 1ZSLA 2FOGA 3TK5A 2A4GA 1HAGE 3ZVAA 3SQHE 3SU4A 3OTJE 4XBCA 4ZCNA 3TGKE 2AMPA 1TE0A 1LCYA 1V2MT 3ATWA 1DXWA 1VKYA 9ESTA 1THRH 2FESH 1ZZZA 4AC9A 1BMFD 1W3CA 4A1VA 2SGAA 1CBWC 1IAUA 4IBLH 2OCVB 1FI8A 1KLJH 4Y7BA 1PQAA 2W6JD 1EAUA 3T29A 2VGCB 2BDHA 3FZZA 2PHBA 3TIUA 1UTQA 5C2ZA 1E1RD 4NIWA 2BB4A 1BJVA 3ZV8A 2PWXA 5JPMH 1PPGE 1AB9C 5DGJA 1JMOH 4GUXA 2AGEX 5TCAA 3MH5A 1B0EA 2HWLB 3QTVH 4AX9H 1O2VA 1YPHE 1HAHH 2HNTF 2SGEE 2C8XB 4K60A 3K65B 1HJ8A 2BQWB 4OS4A 2UWOA 2CHAB 8GCHG 4B6FA 5IDKA 1TX8A 8GCHF 1EPTC 2KX4A 2HPPH 2QN5T 4X8SH 1BZXE 4BAOB 3SQEE 1S85A 1IQEA 2ZDMA 1TNIA 1TAWA 5GNDA 1QRWA 4AFUA 3L6PA 4X1PU 2I6QA 4Q7ZA 1ZPCA 1O3CA 1F5LA 2F3CE 3DA9B 4D9QA 1CT0E 3E91A 1AWHB 2FTMA 5EQSA 3FN8A 1UTNA 1C4V2 3UREA 1CE5A 3PLKA 4AGJA 1SGNE 3ITIA 1QL9A 3DSOA 1LHGH 4X2XA 1GBHA 5ABWA 4Q2KA 5C1XA 1OX1A 3LGWA 2SNWA 1P0SH 1O3EA 1GI7B 4I31A 1C1MA 4MQAA 1P02A 4X0WU 2BLQA 2BDYA 2STBE 4MPVA 2BDAA 3ELAH 1YM0A 1OXGA 3FAOA 2BYAX 4GCHG 1K1JA 1FUJA 5DG6A 1SL3A 1DE7H 2F4LA 2LELA 4GCHF 2XRCA 2J2UA 3RUOA 5EW2H 3KIDU 2A4OA 4AFSA 3H09A 1SGRE 5FXLA 1CA0C 1UVUH 1PJPA 1A0JA 1C1WH 2Q6DA 1DWDH 2FTLE 4FETA 1NPMA 4YZUA 3JZ1B 5AFZH 1GJAB 1X7AC 4VGCC 2Z9KA 4UFFH 3SI4H 1G9IE 4XDEA 4O9VA 4DW2U 2EC9H 3F0PA 4X8TH 4CR9A 3VB4A 1QB9A 1V2JT 3MH7A 4WF8A 2VINA 1BQYA 3A8AA 5DP5A 4JK6A 4ACBA 4NZLA 1D4PB 1C1OA 1XUHA 3TVJB 1DWCH 2F43B 1C5SA 4F55A 1GHAG 3SGAE 1MQ5A 1TPSA 1GHAF 4YLQH 2VWLA 3EE7A 4KELA 1C5VA 3ZV9A 4I8LA 3TJVA 2BXUH 1SC8U 2W7UA 1EKBB 2RA3A 1SSXA 1DVAH 5CDFE 2J38A 3E90B 4DJZB 1PYTD 1H9HE 5J4SA 1EX3A 4B2BA 4JYVH 1IQFA 4LZ4B 1JIMA 1RFNA 2BLVA 3GY2A 1LVYA 1O2QA 3PTNA 3CP7A 3QLPH 1EOLA 1H8HD 2EEKA 3A7XA 3M37A 1C5UA 5DP9A 3TK9A 4UDWH 5EIYA 3KQ5A 4JK5A 3QDZB 4ASHA 4CRGA 2ZDNA 4DGJA 2Y5HA 1TQ7B 1TOMH 3BEIB 1O5GH 2ALPA 4ABAA 1TABE 1Y5BT 3BF6H 4ISIH 3MTYA 4U30A 1TBRH 1GL0E 1FY5A 2BY6X 3MOCA 4I7YH 3DSPA 1O5AB 1GHVH 2R3UA 2NU2E 1YPGH 4Q4LA 1QNJA 4B74A 1F7ZA 2ZPSA 1RTFB 4YESB 5FL7D 1QTFA 1IOEA 1C5PA 1HXEH 4FUEA 5HKKD 1GBDA 5DJ7A 1FY1A 3RXOA 3M3SA 4UD9H 3SJ8A 1AFEH 1ELGA 2ZU5A 1UTLM 2HGTH 3GCHC 1SFQB 3A8BA 1W2KH 2QXIA 4CRCA 4WMFA 1XVOA 4AN7A 3ZYDA 1SBWA 1QL7A 2OC0A 1C1SA 1DANH 3GY4A 1GBFA 1ELDE 2B7DH 5JBBS 4F4OC 1LVMA 2A32A 1GDUA 1QURH 1C1QA 1AI8H 2BZAA 1NY22 3LPRA 4J1YA 1WTGH 4KTCA 4M7GA 5F8XA 1SG8B 3H5CB 2WYJA 3T26A 1IQJA 2LNCA 2KCAA 1W0JD 1C1PA 2F9VA 3SV6A 2KZ4A 2GMTB 4BANB 5CHAB 1RIWB 3GDVA 5C5OA 3MO9A 3T27A 1CO7E 1C1TA 1MKWH 1HLTH 2A7HA 1RRKA 2AHME 3SJKA 2LPRA 4ABJA 3U8RH 3ZZDA 3FP6E 1HV7A 5GIBA 1YPJH 5JB9S 1W8BH 1V2QT 2GDEH 3T28A 1YY3A 1Y3YA 3N7EA 4DIIH 2GCHG 5E2OA 1WU1A 4KTUA 2WPJS 4AG2A 3W95A 2BVSH 1O2LA 8LPRA 2GCHF 5JDUB 1HAIH 5FAHA 3MYWA 1LO6A 4FUFA 1TWXB 2GT8A 1N8OB 1C5RA 1CGIE 1C5QA 6CHAC 5L2YH 1K28D 2FOFA 1CHGA 4NA8A 4NIYA 5C0TA 4JCNA 2FDAA 1OKXA 1W13U 2QAAA 5T6FA 1AWFH 1QR3E 1K9OE 4FVBA 4X6PA 3ZZ5A 2W3IA 1ZHRA 1DX5M 4O03A 1RGQA 4MVNA 1GMHG 3S7HB 1T4UH 3UFAA 2Q6GA 4AB8A 5HM9A 1GMHF 2ODYB 2TRMA 2ZTYA 3GCOA 3UPEA 1A0HB 3H7TA 1Z8RA 1E38B 1O32A 3UIRA 2G55A 3M3TA 2VIVA 2F9NA 3RXDA 1O0DH 2OC1A 1S83A 2WPKS 1DS2E 1ESTA 1QBOA 1SQOA 1VITH 5GJ4B 1O5FH 3MU4A 3MI4A 1FNIA 1PPZA 1M9UA 1QCPA 5B6LA 1SKYE 2WZQA 3MH4A 1GJ4H 2HLDD 1C5OH 1C1UH 1S6HA 3LH1A 3PMHB 4E7NA 2QXHA 2K0QA 2YNBA 3SNBA 1AQ7A 3EGKH 4A1XA 3WWBA 1AMHA 2V0BA 1NRSH 2IPHA 1DUAA 1TNJA 1VITG 1VJ9U 4K8YA 1YCPM 5T6DA 1VITF 1UCYH 1C2IA 2XBYA 1BTWA 3BEUA 5GDSH 1QZ8A 1S0QA 2FEQH 2BDCA 2WPMS 1ANBA 5EJ1A 3SHAH 1MH0A 3A88A 1O38A 3A86A 2C8WB 1KSNA 2VIWA 2A4QA 3BTTE 1BMLA 1NFXA 4B2CA 3NCLA 5A0AE 1E1QD 1XUIA 2G4UA 3F9HA 4CRAA 3PO1B 2A5KA 4Y10E 4X1RU 2UUJB 2ZU3A 4INLA 3ZVGA 2XCFA 4Z0KA 2Y82A 1W0KD 2BQ6B 3ZZ3A 1RTKA 4P00A 1A0LA 1A1RA 1HPGA 1MAYA 1W10U 4ISOA 5F8TA 2PR3A 2VNTA 1GCDA 2ZDAH 4Y8ZA 2Z9GA 3F1SB 3KF2A 5FBEA 3QZQA 1VCPA 1ZR0A 2ZGXH 3GCTG 3QN7A 1ZMLA 5E8EH 1GDQA 2OQUA 4HTCH 3GCTF 2QF4A 1NZQH 1SGYE 3ZIAD 2GV7A 2XBVA 3SJ9A 1FAXA 3SOSA 1L4DA 1SVPA 1YLCA 1VR1H 3A7YA 3TJUA 1P8VC 3OAAD 1DLEA 1O2NA 1AB9B 2OUAA 2VH0A 4NSVA 3C1KA 3MU5A 4YOIA 1V2VT 4LK4A 3AAVA 3KQCA 3T2NA 1MUEB 2XOKD 1COWD 1AU8A 1O3JA 1W11U 2D26C 3BTQE 3M36A 4X1QU 3U8TH 2ZWLH 3RDZA 3QK1A 5CHBA 3HATH 3CS0A 3GISB 5KGOA 2Q6FA 2TGDA 1MU8B 2P93A 4NWKA 3RMLH 3TU7H 1ZMNA 1Z7KA 1OWDA 3VB6A 3PV4A 3A7ZA 3MQKC 1Z71A 2F91A 1CGHA 4RT1A 1LHCH 1K22H 2BLOA 4E06H 1UTMA 1TALA 4AFQA 1TPOA 2L74A 5HMAA 5ESBA 1P2JA 3LC5A 2FPZA 3SN8A 1VCWA 3OEED 3ZVEA 3M5NA 1LKBA 2V3OH 4AYVB 3F0OA 1GBIA 2FLRH 1D3PB 3PV5A 1DLKB 3MMGA 1SB1H 4ZROA 3BTME 2I6SA 2ZQ1A 1YC0A 3DFJA 5EQRA 1HAVB 3UWIA 3I77A 1A3EH 3M5OA 3A8CA 3VPKA 4RKJB 5FX6A 5JYIA 3AK5A 1ZTJA 4YXWD 2B5TB 2PFEA 3LDXH 3U8OH 1CA0B 1D6RA 4Y79A 2PKSC 1FV9A 2R3YA 1ZPZA 6GCHG 3A80A 1BTPA 2P3FH 2AGGX 1O3GA 6GCHF 1C1NA 2GT7A 1Q2WA 4VGCB 1T7CA 1F2SE 1KLIH 4YOGA 5A09A 3V0XA 1ABJH 3P95A 3KYGA 1ANCA 3HK3B 4GPGA 4BAQB 1GBKA 4OS2A 1PQ7A 3A84A 1O34A 1GVLA 1AD8H 4FUIA 2NU4E 4CH8B 3LGYA 1QIXB 3V3MA 2R9PA 4K1SA 3SV8A 2BDGA 4JZEH 3ATKA 3NUMA 3E0NB 2VWNA 1Y5AT 1OWHA 2ZDKA 5C20A 1P12E 2ANYA 1YYY1 1NN6A 5F03A 3GCNA 1EASA 1K0HA 1O2TA 1ETSH 4D7GA 1Z1IA 4NFEA 3HPTB 4MPXA 3TJNA 3RMMH 4NIXA 2D2DA 3RXSA 2CF9H 3PLBA 2ASUB 1ZPBA 2SGFE 3TNSA 8KME2 5BPEA 2XCNA 4Y0YE 1TONA 5CE1A 5DO4H 1TNGA 2OC7A 1NESE 2Y81A 5PTPA 1O30A 3P6ZB 3E8LA 1NU7B 1HAPH 2JJ2D 1KXAA 2RG3A 3URCA 1FONA 2PUQH 5LPEA 1HJAC 1WQVH 4OGYA 4OGXA 2ILNA 2ZU1A 3BIVH 3Q3YA 1ZMJA 1WCZA 2ZKSA 1KXCA 4JZDH 1HJ9A 3R3GB 1O5DH 1UK2A 2FWWA 3LU9B 2VH6A 3G01A 1O5CB 1BBRH 1J17T 4Y6DA 1K1PA 3UB0A 1TFXA 1P06A 2RDLA 2VVUA 3ZZBA 4ASUD 5IK2D 5HXFA 1O2MA 2O8LA 1VGCB 3LKWA 5KECA 4ZMAH 3U1IB 1MAXA 3RXUA 3RXRA 2F9BH 1CHOG 1EAXA 4O97A 1BHXB 3SU0A 2P8OC 3OY6U 4BAKB 1JWTA 1CHOF 1BTZA 3QX5H 4ZHMU 2BOHB 3B23B 1KXFA 3A89A 2FI3E 3PRBA 2OK5A 1FIWA 2YNAA 3UNQA 4HI3A 1UTKA 2QE7D 4ZAEA 1C1VH 3TH3H 5DN6D 1TA6A 2BDIA 1GCTC 1HBTH 4SGAE 3OU0A 1GGDC 4UFDH 1HAXB 3RLYH 1GJ5H 3GY7A 3LJOA 3T5FH 1MU6B 3UOUA 3UR9A 1QRZA 4TWYA 1C5LH 3CNRA 4UFEH 1TGTA 1TPPA 1GBBA 2ZO3H 4B73A 1DY8A 4OS5A 2ZU2A 1BMAA 2A0QB 3T62A 2EA3A 1ZHMA 3OEHD 1C2KA 2V7QD 3KEEA 2J34A 3V13A 2FO9A 3BG4C 3F9EA 2YMSB 1G30B 4WVPE 3AAUA 1PPCE 2H5DA 2HNTC 2AMDA 1AVGH 1QJ6B 3TH2H 2KR7A 1OPHB 1ELAA 1GBCA 2HVYB 3RU4T 2ZFQH 4FUCA 5EJLA 3LIWA 2ESTE 2EI7A 1F5RA 3EA9A 4KKDA 2FMJA 1CQQA 2AIQA 2J97A 2C3SA 1C9PA 2A2XH 3UNSA 3SV2H 1P09A 1V3XA 2VIDA 2KAIB 5GXPA 1YF4A 3A85A 4A92A 4XSKU 1SGQE 3BSQA 5BRRE 2ZCLP 1GBAA 3GYLB 5T1VA 2ZTXA 1L4ZA 1GI3A 2Y5FA 3O8CA 4ZXYH 3RU4E 4LXBH 1C2MA 1ZGIA 4GSOA 1LPKB 2TGTA 2K8IA 1O3HA 2TGPZ 2VVCA 2ZNKH 2V3MA 4AORA 1YCPK 1P01A 1P03A 2FP7B 5A8YA 1C2DA 1LPGB 1DFPA 3SUEA 1O36A 2YOLA 5EW1H 1BOQA 1QBNA 1KLTA 2C93B 2P59A 3TJOA 1TLDA 2M5TA 1B0FA 2PTCE 4CHAC 4I32A 1UVTH 4JZIA 2XWBI 4DT7B 1O31A 1GBLA 4AB9A 4CRDA 3OSYA 1V2OT 1G2MA 3RLWH 2V6NA 2NWNA 2ZP0H 4BAMB 1TNHA 1OYQA 1ZHPA 2ZHDA 2FOAA 1ACBE 3N7OA 2FIRH 2UWLA 1YKTA 1QJ7B 1SGFG 3PB1E 1TB6H 1XMNB 1IQKA 2R2MB 4Y11E 2PSXA 1LPZB 1XXDA 1F0TA 1W12U 1V2RT 2A45B 4HG6A 2ZCHP 1BRBE 5FHTA 5DKMA 2UUFB 3GDUA 4CH2B 3ZZ6A 3STJA 2ANWA 1EUFA 1XUJA 4WH8A 4TWWA 1T31A 1S84A 1EJMA 1W14U 2O8UA 2XC5A 1T8MA 1T8NA 2ZFTA 5L6NH 4OS1A 1Y3WA 2ZEBA 3STIA 4WXVA 2BX3A 2ZHFH 1PFXC 4TSFD 1O3PB 4ABEA 1V2LT 1K2I1 1F0RA 4YT6H 3MWIU 4Z1MD 2GZ9A 1WQSA 1EJNA 2B9LA 1O39A 2FLBH 2Y6TA 3RM0H 4FU8A 1Q3XA 3FVFB 4RN6A 3SUDA 1AFQC 1GI4A 1SHYA 1W7XH 4I8GA 3F2HA 2FS8A 1V2KT 1EZUC 2AYWA 1MQ6A 2TIOA 1AO5A 1A5IA 2DUCA 1AVWA 2AH4X 1BTHH 1A4WH 1G32B 1QGFA 1O35A 1MTNB 4XD7D 1ESAA 1N6XA 4OM9A 3WY8A 3AVZA 3LT3A 3ZYEA 1ELCA 2F9PA 2WHXA 1A61H 5C5NA 2P95A 1FPCH 1ZRKA 1ZJDA 5C1UA 3OY5U 1YPHC 1CA8B 2EQNA 1INCA 2VGCC 4Y0ZE 1UCYE 4Y71A 2ZFRH 2WPIS 3Q3XA 5EJZA 1YWUA 3F2GA 1O5EH 4A1TA 1O3FA 1C5ZB 4ISHH 1FDPA 4IC5A 3VFEA 1EZQA 2ZGBH 5JBTA 1MKWK 1XX9A 3LC3A 2VIOA 2AGIX 3E6PH 4BOHA 3ODDA 4NCYA 1V2WT 2HLCA 1ZLRA 2GKVE 2H2ZA 2OLGA 3HGNA 3RXEA 2BY7X 1XKBC 4X1NU 5GWZA 4KGAA 2CHAC 3RXKA 1J15A 1GHWH 3BTWE 3F68H 1O3DA 3NRLA 5AF9H 1K21H 2RA0A 1E37B 3BTFE 1DPOA 1DT2A 1UVPA 4AFZA 3DD2H 2VWMA 1XVMA 4Y76A 1S0RA 4HZHA 1NFUA 1FMGA 4ABDA 1D3DB 1LHDH 2ZGCA 4K2YA 4GVUA 1NT1A 1O5BB 5FCKA 1V6DA 4U2WA 1FN8A 3MNBA 3DCLA 1L1GA 3PMBB 4P02A 2CK3D 4CRFA 4WJG2 1EFRD 1GI6A 1A5HA 1S5SA 1ZRBA 3MU1A 2HALA 2PP6A 1EB1H 4YT7H 4X6NA 4CREA 2CV3A 4FUHA 4Q7XA 3QZRA 4MPUA 1T4VH 2J98A 1GG6C 2J98B 1EB2A 3VGCB 1TMTH 4ZKOU 2ANMH 1EAWA 5E0JA 1Z6EA 3SU1A 3JZ2B 4WWYA 5K7RA 2STAE 2XC0A 1KMHB 2GCTC 2H9HA 1MBQA 3NWUA 4WH6A 3Q76A 1HIAB 2Q1JA 5B6OA 1EAIA 1H9LB 1WYKA 4NZQA 1OWJA 3GY5A 4I8JA 4NGAH 3PWCA 1MD8A 1P2IA 1P2NA 3UAIC 5HYOA 3UNRA 1HRTH 2JKHA 3M3VA 1DUEA 2ZFPH 5EXMA 4GAWA 4JZ1A 1C1RA 2TBSA 1CGJE 3A82A 4CR5A 3UUZA 2BD8A 3BTDE 5DP7A 1P2MA 2KM0A 4AOQA 3DUXH 1SQTA 2CJIA 1C5NH 4H6TA 3QO6A 3SO3A 2WINI 2BY9X 4SGBE 3U98H 2ZPRA 2PKAB 1Y3UA 1EJAA 1YPLH 1G3EA 2FX4A 3SU6A 1QQ4A 1EP6A 2H9TH 5F53A 5I25A 1OP8A 1AKSA 1AKSB 3GY3A 3LONA 1SGIB 2G51A 5DP4A 4CBNA 2QXGA 1G3DA 1NBME 4KTSA 4RI0A 2WUBA 3RXCA 1HXFH 3GICB 1BMNH 5DP3A 1C2LA 2ZFSA 2ZPQA 4WY3A 2PV9B 1TGBA 1SLXB 3VB7A 1IQGA 1C4U2 2QF0A 4DCDA 4GHQA 1O37A 2JETB 1LHEH 2VBCA 1EZSC 1OP0A 1UHBB 3UQOA 1YLDA 3TGIE 1MD7A 1V2ST 1TQ0B 1KIGH 1O3MA 4QT8C 2A1DB 3TITA 1O2IA 5C3NA 5J4QA 2BD9A 2BQ7B 3M35A 1ZTLA 1CBWB 2VB0A 1MKXK 3VB3A 1QJ1B 4JZFH 2DE8A 1BIOA 3O8RA 1HGTH 1KTTB 2BTCE 3ZZ9A 3ENSB 1KDQB 2BDBA 3H7OA 7ESTE 1SQRA 5L2ZH 1NFYA 5JBAS 2ULLA 1LQEA 2ZQ2A 4GLYA 1MCVA 3PV2A 1O3NA 3ATLA 1GHZA 4CRBA 1RJXB 1TMBH 3A7VA 3AW0A 3SI3H 4NA9H 1S6FA 1QA0A 1GBJA 2F83A 5H4IB 4FUJA 1ARCA 1GMDG 3DSGA 1MZAA 1UK4A 2ZDLA 1GMDF 1YPKH 3ATMA 3WWFA 4MNYA 4NSYA 2FOBA 3A83A 4ISLA 3FP8E 4Q63A 1C2FA 1FY4A 2L6OA 2NU0E 3K2UA 4I33A 3P8NA 4B76A 1G3CA 1C4Y2 1EPTA 1EPTB 3D65E 1ELEE 4Q80A 2IOTA 3LGUA 2HRVA 4R0IA 3QGJA 4UEHH 4THNH 3ZZ8A 1KXDA 1LKAA 4MPWA 3RMOH 2GDDA 1O2OA 3EA8A 2GMTC 1W7GH 1B7XB 3PMAB 1GGDB 1O2ZA 3PRDA 5CHAC 2ZHWH 2G00A 5EODA 1ANDA 1ZTKA 2Y80A 1BT7A 2QA9E 3P8GA 1FAKH 3KCGH 4B1TA 2JH6D 3BG4B 1P3CA 2A31A 1BBRE 1WBGB 2B8OH 4E05H 1TPAE 7LPRA 4MNXA 3SGQE 2WV9A 2UUKB 5LH8A 4FUDA 1GJBB 3U69H 3VXEH 3RXQA 1HAVA 3NKKA 1ZYOA 3SORA 1VJAU 4MTBA 1C5MD 4NFFA 1NM6A 3V7TA 1BA8B 1V2NT 1AN1E 4X6OA 3SNAA 3RC6A 3ZVCA 1N8OC 3U9AH 4CBOA 2AS9A 3SU2A 3NPSA 2ODQA 3SU5A 3SJIA 1P9SA 3S9BA 1SGEE 1JRSA 1P2QA 2QF5A 1LHFH 1TBQH 1AVXA 1EQ9A 2ANKH 3RXLA 3DFLA 2WPDD 2O8WA 2BVXH 3L3TA 1ZSKA 4IGDA 5EPNA 2IJOB 2J94A 1HAOH 4WMEA 1C5WB 1HYLA 1QA7A 2AMQA 1NRPH 1QQUA 5FCRA 1O2RA 1PPFE 1GWAA 5A0CA 2ZECA 3ZZCA 1IQLA 1WUNH 2VJ1A 2KFWA 4INHA 2JH5D 4X2VA 2IN2A 2VIQA 1VCQA 1QRXA 3OE7D 1SLVB 2PLXA 1TRYA 2IPQX 3EQ0H 2CF8H 5EG4A 4LZ1H 3RXJA 2BD2A 3K9XB 3SUGA 4DIHH 1ETRH 1FN6A 2G5NA 2XYAA 1XUKA 1D3TB 1NO9H 3SGBE 1K1NA 2Z94A 3SV7A 3SNCA 1Z8JB 1TA2A 1UMAH 2BXTH 2BX4A 4BXSA 5SGAE 5JB8S 1UTJA 1KYNA 3MU0A 4KP0A 1UVOA 3F2FA 5KEDA 2JIZD 1CSOE 4HGCA 2QYIA 4ABFA 2G52A 3ZVBA
chains in the Genus database with same CATH topology
2Z6BD 1P11E 1PPBH 2ALVA 2H6MA 2G8TA 2P16A 1HNEE 1NFWA 1SGDE 2SNVA 3P17H 4X1SU 3K6YA 5FPTA 1H8DH 1SGPE 1NU9A 1CVWH 1QB1A 4PROA 1SGFA 1HFDA 4ZKRU 2J92A 2CGAA 3PO1C 1CT4E 1IQMA 2ZZUH 2J9NA 3TNTA 1ZJKA 2GTBA 1KTSB 3ZVFA 1L1NA 3KQBA 4ZXXH 7KMEH 1AY6H 4MNWA 1SMFE 1BRAA 3IG6B 4ZUHA 1GJDB 2PUXB 4BTIB 4UFGH 1ZGVA 1AFQB 3ZZ4A 3ESTA 1WAYB 2W26A 1E34B 1UJ1A 2WPHS 3RXTA 5C67A 4BNRA 2FM2A 3SUFA 1AHTH 4ABIA 2FXRA 1LVOA 3GOVB 3RU4D 1FLEE 1TIOA 3BTKE 3MO6A 1C5TA 3RXAA 1FY3A 1O2GH 3GCHB 4X8UH 4DOQA 1GI1A 2ZDVH 4YTAA 2GGVB 1CU1A 1SLUB 1TMUH 3P8OA 3SNDA 2VWOA 3IITA 4FUBA 2BD3A 1UTOA 4BAHB 5DPAA 4MDSA 4LOYH 4ABHA 5A8ZA 1OWEA 1MTSA 1BTUA 1BTXA 1F92A 1GBMA 2R2WU 1O2XA 4JYUH 1N1LA 4UONA 1TYNA 1SI5H 4ZKSU 2O9QA 1DWBH 4NWLA 1L1JA 1Q31A 1H8IH 1MBMA 1OSSA 2BHGA 2Z9IA 1GPZA 4YOJA 5IYTA 1V2TT 2QGRA 1C9TA 1UTPA 4ABBA 1ELBA 5ESTE 4A5TS 3FANA 3F9FA 3S9CA 1HUTH 3SV9A 3GY8A 2FX6A 1GJCB 2Y7XA 1NRQH 2AEIH 3RP2A 1BJUA 2G5VA 3EYDA 5F8ZA 4RSPA 3BEFB 1ELFA 4IN2A 1EOJA 1P2KA 3SZNA 1SQAA 4AYYB 2BVRH 1ZOMA 1THSH 3M7UA 1T8LA 2QXJA 1DY9A 1FIZA 2XNIA 5DP6A 2GX4A 2H9EH 1JRTA 6CHAB 1QL8A 2PGQB 5AFYH 1Z8GA 1NS3A 1GMCG 1K1IA 1O2KA 3B9FH 3HK6B 4J2YB 1DDJA 1GMCF 2P3TB 4BXWA 2OTVA 4Y7AA 1O3IA 1GG6B 2KAIA 2ZHQH 1OOKB 4I8HA 1J9CH 3PMJA 3F6UH 1EXFA 2GCTB 4XOJA 1PQ5A 3MU8A 3TK6A 2HPQH 4Z6AH 1TBZH 3ZZ7A 5LPRA 3KHVA 1FPHH 3M7TA 3BTEE 1EZXC 3SHCH 1E36B 1LVBA 1Y5UT 4WMDA 1PPEE 3M5MA 4X6MA 4FVDA 1S81A 1TRMA 2VVVA 3O8BA 3NK8A 1MTUA 1BDAA 2F9UA 2QF3A 2WYGA 2BM2A 3M5LA 1Y8TA 1P05A 2TPIZ 4D9RA 1SOTA 3MHWU 2CXVA 2GZ7A 1A5GH 1HDTH 1J8AA 1P04A 1WTHD 1XKAC 6ESTA 3D62A 2FODA 4YM9A 3FZDA 1BTYA 1EP5A 2V35A 3M61U 2B0FA 2ZGJA 3QGNB 4TPYA 1MZDA 3UOPA 1ANEA 2FZZA 2ZG0H 1YCPH 1JIRA 1G36A 4U01A 1YBWA 3LOXA 3EA7A 4DURA 5TCCA 3MNXA 5GPIB 2G4TA 2BD5A 4IC6A 4ZHLU 1GI8B 3UTUH 1AE5A 2GP9B 4IN1A 3LGVA 3TPIZ 4Q7YA 4JYTA 1GBTA 3S69A 3F9GA 4D8NA 2AERH 1CT2E 1XUGA 1XM1A 3K6ZA 1BHXF 1P9UA 3PLPA 2A5AA 1QBVH 2Z3CA 4R8TB 1GI0A 3SU3A 1PQ8A 3E16B 4O3UA 1DSTA 2XBXA 2QY0B 1UVSH 4E7RG 3A7WA 3QWCH 4ZH8A 3RXIA 3ZVDA 3EE0B 3CENA 4NIVA 1O3AA 5LPFA 1W0ZU 3TH4H 2GD4B 4BTTB 3RXMA 1AUTC 3RC4A 3UR6A 2WPLS 2ODPA 4ZHAA 1WOFA 3KNXA 1E0FD 1ELVA 1T8OA 4TPIZ 1K1MA 1DITH 5JBCS 1VGCC 2C8ZB 1BCUH 1N6YA 2WUCA 5AVDA 2OQ5A 1TOCB 2XW9A 2OINA 4O3TA 4MNVA 3RXGA 1XUFA 3BTGE 2V3HH 2PGBB 2P94A 2FOEA 4ZKNU 1NTPA 1TGCA 2FOCA 3MO3A 1BRCE 2FYQA 3A8DA 4K8BA 3KN2A 2C8YB 3C27B 4INKA 1OP2A 2QCYA 4A7IB 1SPJA 4MLFB 3UQVA 1SLWB 3V12A 2W5EA 3P92A 4D76A 1SGCA 3D49H 4XFQA 1NC6A 1TX6A 3ODFA 3PTBA 5EOKA 5FBIA 1IHSH 2D1JA 2VIPA 2R0KA 1BRUP 2OBOA 5E2PA 4ABGA 2SGDE 3CS7A 1B5GH 1F5KU 1Z8IB 1KY9A 1O33A 2HVXA 2ZI2H 5FPSA 1C2EA 2BD4A 4FU7A 3SW2B 2J4IA 3NZIA 1DSUA 2GVFA 5DP8A 1HAZB 4X2YA 1OWKA 1GL1A 1ABIH 1HAYB 4H42U 4JMYA 1GBEA 1F0SA 1GVZA 2XWAA 1FQ3A 3I29A 3B8JA 2A4RA 1SR5C 1TNKA 3AW1A 2XXLA 1GI5A 1BB0B 3HKIB 5GCHG 3L33A 5F6MA 1THPB 3BN9A 1GI9B 2PKSB 1LMWB 5GCHF 4I8KA 1HIAA 4X8VH 3GY6A 2FYRA 2XBWA 1QY6A 5TJXA 5L30H 1QHRB 1T32A 5G4BA 4RKOB 4IW4E 1FY8E 1KXBA 1YGCH 2GV6A 4A6LA 1JBUH 3BV9B 1GJ6A 3PM3A 2AIPA 3P8FA 1V2UT 3D23A 4UE7H 2QIQA 2FOMB 3T25A 2UUYA 3PROA 4FUGA 3GDSA 2BLWA 5FPYA 2F9OA 2ZCKP 1QB6A 1UCYK 3QTOH 2FI4E 3PYHA 3FP7E 3RXBA 1BUIA 1VZQH 5HM2A 1HB0B 1NROH 3RXHA 3URDA 3ATIA 3RMNH 2EI6A 1YPMH 2P3UB 1GI2A 2PKAA 2Z9LA 1YP9A 2TGAA 3AASA 2SFAA 2BY8X 2ZGHA 1A3BH 3DT0H 1BITA 4X2WA 1P10A 1FZZA 9LPRA 1DWEH 2A7CA 5EGMA 5EXLA 1H1BA 3LGIA 4GHTA 1K1LA 2WV5A 1O3KA 4DVAU 2O8MA 3PWBA 3E1XB 4H6SB 2A7JA 1WSSH 1OWIA 2GZ8A 1AZZA 3E0PB 3OYPA 2Z9JA 2XTTB 5HGGA 1A7SA 1MMJN 4U32A 1AZ8A 2BMGB 1UHBA 1W0YH 1JXPA 3Q00A 2R0LA 2ZIQH 1AE8H 4NG9H 2AFQB 1HJAB 8ESTE 5C1YA 1SHHB 3LGTA 1G2LA 3S9AA 1F0UA 2OD3B 1GJ8B 4TY6A 1V2PT 2WV4A 1E35B 4BTUB 3P70B 1MTWA 1DXPA 2BZ6H 1Z1JA 2SGQE 5ETXA 2ZC9H 2BY5X 4K1TA 4FXGH 4YO9A 1KDQA 3GYMA 3LJJA 3W94A 2ZF0H 1YPEH 4D7FA 1D9IA 3I78A 3RM2H 3QUMP 4K69A 6LPRA 2Z3EA 4YLUA 3IWMA 4AG1A 1O3BA 1ZSJA 1H4WA 1J16A 1UK3A 5EXNA 1OYTH 1MTNC 7GCHG 1O2JA 3KGPA 2P8OB 2OBQA 1K1OA 7GCHF 1Z6JH 1GJ7B 1DICA 1C2JA 1GHXH 1Y59T 3HKJB 3S0NA 1GDNA 1MKXH 1RTLA 1HCGA 3EAJA 5E0HA 2ZFFH 2ZTZA 3A87A 4NA7A 3R0FA 4XBBA 1BMMH 1D3QB 1Y3VA 1RXPA 1LDTT 3SJOA 1RS0A 1L0ZA 1OS8A 1GCTB 2VU8E 4K3JA 2ZU4A 2A5IA 4DG4A 2PTNA 4Y8YA 4ESTE 2QV1A 1C5YB 3Q77A 4B75A 2FOHA 5FX5A 3SNEA 1KXEA 1RIWC 3VEQB 2QC2A 3O8DA 4K5ZA 3RXFA 3A81A 2DE9A 1TNLA 3KQEA 2K1QA 1FXYA 1NRNH 3TLOA 1MTVA 5I46H 2J95A 3TGJE 1PYTC 2C90B 1O2UA 1NRRH 5A0BA 4B71A 1O2WA 2D8WA 1AIXH 1D6WA 1JOUB 3RXVA 3SBKA 1WV7H 1Y3XA 2Y5GA 4AZ2B 2EI8A 1IQIA 3LH3A 1C5XB 3MFJA 1GHYH 1O2HA 2OP9A 1G37A 5A8XA 2UWPA 1MCTA 1P3EA 3HGPA 3RXPA 3MNSA 2H1UA 1IQHA 2PW8H 3BTHE 1ID5H 1EATA 2OXSA 5EQQA 2HNTE 1ESBA 3VB5A 1TRNA 2CN0H 3A7TA 5LGOA 1AGJA 2BOKA 1TGSZ 4XBDA 5EPYA 3VGCC 1LQDB 3E3TA 2JH0D 2Y7ZA 1SGTA 2PSYA 3NXPA 4IMQA 1H9IE 1TGNA 2ZHEH 4WXIA 4DY7B 5K0HA 3MH6A 1AUJA 1DM4B 2FI5E 1P2OA 1QFKH 1IHTH 1SOZA 1ARBA 2W7SA 4MG3A 2CMYA 4IS5A 4H4FA 1O2YA 1GVKB 1ORFA 3VXFH 4CHAB 4TY7A 1GHBG 3UY9A 5CMXH 1O2SA 1UO6A 1O3OA 2C4FH 4ISNA 1GHBF 2NU3E 1ETTH 1G3BA 1A46H 4HFPB 1PPHE 3M7QA 4XE4A 3U1JB 4IMZA 5T3HA 5AHGH 3OX7U 1L2EA 3KL6A 4B2AA 2OC8A 3Q3KA 3UWJH 1A2CH 1DOJA 2Z7FE 5E0GA 2H5CA 2O8TA 2NU1E 1U6QA 1GJ9B 2FS9A 4OS6A 1XXFA 1TX7A 1O3LA 3ZZAA 3BIUH 1IQNA 3MNCA 1ELTA 2BD7A 2SGPE 2ZA5A 2XC4A 5A2MH 2G81E 1O2PA 3S7KB 1P57B 2Z3DA 4Y8XA 4TYDA 4K1EA 1FJSA 4FU9A 3KQDA 2THFB 4F49A 5T6GA 1BBRK 1C2GA 4OS7A 4AGKA 3BG8A 1SFIA 2JETC 3EDXB 5EU8A 3DHKH 3RC5A 1S82A 1C2HA 2W3KA 2A2QH 3FFGA 5DK1A 1J14A 1RD3B 2HOBA 1LTOA 2RCEA 1ZSLA 2FOGA 3TK5A 2A4GA 1HAGE 3ZVAA 3SQHE 3SU4A 3OTJE 4XBCA 3TGKE 2AMPA 1TE0A 1LCYA 1V2MT 3ATWA 1DXWA 9ESTA 1THRH 2FESH 1ZZZA 4A1VA 1W3CA 2SGAA 1CBWC 1IAUA 4IBLH 2OCVB 1FI8A 1KLJH 4Y7BA 1PQAA 1EAUA 3T29A 2VGCB 2BDHA 3FZZA 2PHBA 3TIUA 1UTQA 5C2ZA 4NIWA 2BB4A 1BJVA 3ZV8A 2PWXA 5JPMH 1PPGE 1AB9C 5DGJA 1JMOH 4GUXA 2AGEX 5TCAA 3MH5A 1B0EA 2HWLB 3QTVH 4AX9H 1O2VA 1YPHE 1HAHH 2HNTF 2SGEE 2C8XB 4K60A 3K65B 1HJ8A 2BQWB 4OS4A 2UWOA 2CHAB 8GCHG 5IDKA 1TX8A 8GCHF 1EPTC 2HPPH 2QN5T 4X8SH 1BZXE 4BAOB 3SQEE 1S85A 1IQEA 2ZDMA 1TNIA 1TAWA 1QRWA 4AFUA 3L6PA 4X1PU 2I6QA 4Q7ZA 1ZPCA 1O3CA 1F5LA 2F3CE 3DA9B 4D9QA 1CT0E 3E91A 1AWHB 2FTMA 5EQSA 1UTNA 1C4V2 3UREA 1CE5A 3PLKA 4AGJA 1SGNE 3ITIA 1QL9A 1LHGH 4X2XA 1GBHA 5ABWA 4Q2KA 5C1XA 1OX1A 3LGWA 2SNWA 1P0SH 1O3EA 1GI7B 4I31A 1C1MA 4MQAA 1P02A 4X0WU 2BLQA 2BDYA 2STBE 4MPVA 2BDAA 3ELAH 1YM0A 1OXGA 3FAOA 2BYAX 4GCHG 1K1JA 1FUJA 5DG6A 1SL3A 1DE7H 4GCHF 2XRCA 2J2UA 3RUOA 5EW2H 3KIDU 2A4OA 4AFSA 1SGRE 5FXLA 1CA0C 1UVUH 1PJPA 1A0JA 1C1WH 2Q6DA 1DWDH 2FTLE 1NPMA 4YZUA 3JZ1B 5AFZH 1GJAB 1X7AC 4VGCC 2Z9KA 4UFFH 3SI4H 1G9IE 4XDEA 4O9VA 4DW2U 2EC9H 4X8TH 4CR9A 3VB4A 1QB9A 1V2JT 3MH7A 4WF8A 2VINA 1BQYA 3A8AA 5DP5A 4JK6A 4NZLA 1D4PB 1C1OA 1XUHA 3TVJB 1DWCH 1C5SA 1GHAG 3SGAE 1MQ5A 1TPSA 1GHAF 4YLQH 2VWLA 4KELA 1C5VA 3ZV9A 4I8LA 3TJVA 2BXUH 1SC8U 2W7UA 1EKBB 2RA3A 1SSXA 1DVAH 2J38A 3E90B 4DJZB 1PYTD 1H9HE 5J4SA 1EX3A 4B2BA 4JYVH 1IQFA 4LZ4B 1JIMA 1RFNA 2BLVA 3GY2A 1LVYA 1O2QA 3PTNA 3CP7A 3QLPH 1EOLA 2EEKA 3A7XA 3M37A 1C5UA 5DP9A 3TK9A 4UDWH 4JK5A 3QDZB 4ASHA 4CRGA 2ZDNA 4DGJA 2Y5HA 1TQ7B 1TOMH 3BEIB 1O5GH 2ALPA 4ABAA 1TABE 1Y5BT 3BF6H 4ISIH 3MTYA 4U30A 1TBRH 1GL0E 1FY5A 2BY6X 3MOCA 4I7YH 1O5AB 1GHVH 2R3UA 2NU2E 1YPGH 1QNJA 4B74A 1F7ZA 2ZPSA 1RTFB 4YESB 1QTFA 1IOEA 1C5PA 1HXEH 4FUEA 1GBDA 5DJ7A 1FY1A 3RXOA 3M3SA 4UD9H 3SJ8A 1AFEH 1ELGA 2ZU5A 1UTLM 2HGTH 3GCHC 1SFQB 3A8BA 1W2KH 2QXIA 4CRCA 4WMFA 1XVOA 4AN7A 3ZYDA 1SBWA 1QL7A 2OC0A 1C1SA 1DANH 3GY4A 1GBFA 1ELDE 2B7DH 5JBBS 4F4OC 1LVMA 2A32A 1GDUA 1QURH 1C1QA 1AI8H 2BZAA 1NY22 3LPRA 4J1YA 1WTGH 4KTCA 4M7GA 5F8XA 1SG8B 3H5CB 2WYJA 3T26A 1IQJA 2LNCA 1C1PA 2F9VA 3SV6A 2GMTB 4BANB 5CHAB 1RIWB 3GDVA 5C5OA 3MO9A 3T27A 1CO7E 1C1TA 1MKWH 1HLTH 2A7HA 1RRKA 3SJKA 2LPRA 4ABJA 3U8RH 3ZZDA 3FP6E 1HV7A 5GIBA 1YPJH 5JB9S 1W8BH 1V2QT 2GDEH 3T28A 1Y3YA 4DIIH 2GCHG 5E2OA 1WU1A 4KTUA 2WPJS