1O3BA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3bA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o3bA02
4IW4E 3VPKA 1C5ZB 4ABGA 1O2RA 5GWZA 1BUIA 5LPRA 1V2QT 2QIQA 4Q7XA 3P70B 4ASHA 1AN1E 2PGBB 1UCYH 1LHEH 1ZLRA 5FBEA 1C2JA 5FAHA 4X2WA 1D3QB 1GJ4H 2ZU2A 1FY3A 3E0PB 1YKTA 2R9PA 3BTDE 3Q3KA 1YPHC 4GCHF 3RM0H 3T29A 3UY9A 3ZV9A 2WUBA 2ZGHA 3HKIB 1EXFA 1FY4A 3QGNB 1EASA 1ACBE 3NCLA 4CR5A 1BHXB 1C2IA 1Q3XA 1TNIA 3PTBA 4F49A 7GCHG 2TGTA 3MU1A 3CP7A 3IG6B 5J4SA 1O2ZA 3A8BA 1C9TA 3OYPA 2Y7ZA 3A7VA 2XCNA 1QTFA 1DS2E 1ANBA 5FX6A 4B73A 2WINI 5PTPA 1AZZA 1T31A 2BLVA 7GCHF 1OYTH 2VH6A 1M9UA 4ZXYH 2ALVA 4OS7A 5TCCA 3GY3A 1BTYA 2UWOA 1MTNC 3PMBB 1Z8RA 1MTSA 1D3TB 4MVNA 1PPGE 4K5ZA 2BX3A 1DFPA 1HB0B 1VCPA 1GI3A 4CRGA 2Q1JA 1XXFA 1EPTA 4TWYA 4H4FA 1FPHH 3PTNA 2GDDA 1ESBA 1ARBA 1Y3YA 3LGVA 1OWDA 1IQJA 1GBAA 1HXEH 4IMZA 4AN7A 1MTNB 3GDVA 2D2DA 1H9IE 1ELCA 1V2LT 2C3SA 4B76A 1CA0C 3URCA 3ZVFA 4A1TA 8LPRA 3TVJB 1D4PB 1QRZA 1UTPA 4B2BA 1IAUA 4MNWA 1FY5A 2KAIB 1BB0B 1HYLA 3GY8A 3P6ZB 1ELEE 1SGCA 1CHOG 1UK4A 3KQBA 1FUJA 1AFEH 1A5HA 4O3TA 2FODA 4K1TA 5JBCS 1UTJA 3GICB 4HFPB 1NPMA 1A3BH 5C2ZA 4NZLA 1ZSKA 2C8YB 2ESTE 1H9HE 4DIHH 1TB6H 5EOKA 1CHOF 4I8LA 4JZ1A 1JIMA 3M7UA 4M7GA 3TGKE 4B2AA 4SGAE 2OC0A 5T6GA 4GLYA 1V2NT 1HAZB 1TMTH 1SGFA 2ZFSA 3LOXA 4H42U 4CH8B 3OTJE 2IOTA 3RXKA 2TPIZ 1MMJN 2ZECA 3SU1A 2UUKB 1C4V2 3M35A 4ESTE 1AKSA 2WYGA 1Z6EA 1QURH 4CRFA 1WQSA 3MO3A 1TA2A 1BBRK 1WAYB 4ZKNU 3AAVA 3BG4C 2D26C 1Y3VA 1BRCE 4K1SA 4CRDA 2P3UB 2FTMA 3BTWE 4ZROA 2J4IA 3VB7A 3RXUA 3TJOA 4BTUB 1C1SA 1K9OE 1C5LH 1J15A 5DK1A 1K1IA 2AMPA 5EQQA 3IWMA 1F0UA 1DY8A 1KLIH 1BTWA 2XC0A 1SHYA 1FY1A 1UCYK 1UTOA 3R0FA 3BG4B 1MZDA 1ETTH 3H7TA 1P09A 1K2I1 2ILNA 3BIUH 3UTUH 1DITH 1AD8H 3URDA 2I6SA 2F9NA 1DE7H 1O3LA 2ULLA 1O2VA 1GBMA 1TRYA 3RXEA 1GBTA 1Y8TA 1J17T 3P92A 1BZXE 2A31A 1PJPA 5E2OA 3LKWA 2WYJA 1BTHH 3ZZ8A 3EA7A 2ZDAH 1TONA 1G32B 5E0HA 3BTME 1QQUA 2RG3A 1E36B 1G3BA 1GI4A 3P8GA 2EI8A 1EAIA 2AS9A 4O9VA 3BTTE 1QBOA 1TX8A 3GCHC 1ZMJA 1A7SA 3F68H 1O33A 1L0ZA 2G52A 1CO7E 1V2TT 2PUXB 1O3IA 1AVXA 1T8NA 1UVTH 4DY7B 1L2EA 2GD4B 4AB8A 2Y82A 3UNRA 1DX5M 3O8CA 3A7ZA 4Y76A 3RXJA 1GBLA 1MAXA 1RJXB 3B23B 2STBE 2Y80A 3GCHB 5FX5A 1UVUH 4DG4A 1TNKA 3GDSA 4AYVB 1A5GH 1KYNA 1TQ0B 3BTQE 3QLPH 2BYAX 1O5FH 1P2OA 3A86A 4NSYA 1DLKB 1SGRE 4DGJA 1FMGA 2FI4E 3MH6A 1GJ5H 1V2KT 4ZKOU 1TQ7B 1YLCA 3M7QA 2P8OC 2PW8H 2ZDLA 1XXDA 3D23A 5DP4A 5JYIA 3SV6A 1RGQA 2ANYA 2ZF0H 2WPHS 3F9HA 3GYMA 5ESTE 1LHGH 3SOSA 1F7ZA 2PUQH 4FUIA 1HFDA 2G00A 4X2YA 3RMLH 4O3UA 2FOBA 2V3HH 1DWEH 2UWPA 3EE0B 3U69H 1VITH 1UVSH 4D76A 4RN6A 1QB9A 1O37A 1OWKA 4INKA 1QRWA 3V0XA 2EI7A 2ZFTA 1RTLA 1OOKB 1IQHA 1O2KA 1V2RT 1CGJE 3M5OA 1IQNA 3T25A 2ZFRH 1F0TA 2F9UA 2BZ6H 1AIXH 4ISLA 4ZAEA 3RMMH 1GDQA 1O3OA 2ZA5A 1OWHA 3PM3A 3TNSA 1QNJA 1XUHA 4Y8ZA 1W11U 2VGCC 2VB0A 1BMAA 2BQ7B 4CRCA 2H2ZA 4I8HA 5EXLA 5FHTA 2OINA 1HAVA 3ZZ9A 3DFLA 4RSPA 2OBOA 2WPLS 3FZDA 4Y7BA 1DSTA 5T3HA 2BOHB 1W7GH 1ZGVA 1T4VH 1LQEA 4F4OC 2GZ7A 1TNJA 1KDQB 2J34A 3EDXB 3LH1A 1J8AA 1YPGH 5ABWA 5DO4H 1B7XB 2O8UA 4AZ2B 4A7IB 1G2MA 1W12U 3BG8A 3UR6A 1UVPA 3FAOA 3SQEE 4JZDH 1GJ7B 1P57B 3VB4A 2CXVA 5T6FA 3RXTA 4U01A 2V35A 3TITA 2VWLA 3K6ZA 4INHA 2FOFA 3BN9A 2QCYA 1ZGIA 4NG9H 4MPUA 1ZJDA 1NM6A 4UFEH 2CMYA 2EI6A 1P12E 1Y3UA 1TA6A 1EZQA 1OP0A 2OXSA 6GCHG 5F8ZA 2SGEE 1O3PB 3NKKA 1C4Y2 1S0RA 2PGQB 4UONA 1NRSH 1O2YA 1EAUA 1RTKA 2ZO3H 1O3CA 1ZR0A 5DGJA 3SZNA 2D8WA 1YPLH 1K1NA 1MAYA 4FU8A 1FXYA 3GISB 2J92A 2IPHA 1W3CA 1PQ8A 4Y8XA 3KQCA 1QJ7B 1YCPH 4X1QU 4Z6AH 4BOHA 3C27B 2BDIA 3JZ2B 1ANDA 1YLDA 4ABJA 1UTLM 1EB2A 1NESE 1TGBA 3SU4A 4K3JA 3O8BA 1S85A 3MWIU 3UUZA 1OPHB 5HXFA 1BMMH 1HAXB 3M61U 1MTWA 3QTVH 1GJDB 3ATIA 4ZKRU 1MBQA 5A8XA 4BNRA 2B8OH 5HM2A 1MKXH 2ZC9H 1A3EH 3G01A 3HPTB 2VIVA 3SV8A 1SBWA 1UTNA 4X1NU 4O03A 4GUXA 2CHAC 2F3CE 4K8BA 4X8VH 4NIVA 4YO9A 1JWTA 2XXLA 1V2ST 3SBKA 2SGQE 1CBWB 4TY6A 3A87A 5EXNA 4MNYA 3KCGH 2H6MA 3AW1A 1PFXC 4YESB 1FIWA 3QZRA 4YM9A 2BX4A 3SUFA 3RXGA 3E91A 1GBIA 4FUDA 3HK6B 2A4OA 1AUJA 4YLUA 1DWCH 3ATWA 4ZMAH 3RU4D 2EEKA 2ZCHP 5GXPA 4I32A 1TOMH 4DW2U 2ZCKP 2C4FH 1CT2E 3A80A 4WMEA 1C5YB 3PLBA 2BDHA 3BTEE 1GI1A 5C5OA 2Y5FA 4MNVA 1SSXA 3FZZA 1VJ9U 3F9EA 1A2CH 4UD9H 3MU0A 3P8OA 1CVWH 3ATLA 1V2JT 3MI4A 1VCWA 4D9RA 5EG4A 1TGSZ 3MNXA 5DG6A 3VXFH 5EW1H 1T32A 1FY8E 1NRPH 5F8XA 2BLWA 1C1WH 3SO3A 4LZ4B 2G4UA 3MOCA 1ELDE 1GGDC 2WPKS 3K2UA 2A5KA 2BZAA 3LGWA 4BAKB 3RXSA 5C20A 3PV4A 3EYDA 1BTPA 1UJ1A 4YTAA 1EKBB 5DP3A 2QAAA 1TE0A 1GG6C 3PMHB 3T27A 1KXFA 5JBBS 1Y3WA 1P9SA 4K69A 1GGDB 3S0NA 1SGDE 1ZRKA 1TOCB 2BY8X 1DDJA 2ANKH 1FI8A 2FX6A 5LGOA 3LC3A 1O2JA 5EGMA 5L2YH 1O2HA 5JPMH 3U9AH 1NZQH 1BRUP 2GV6A 4RKJB 5ESBA 2A0QB 2K1QA 1RTFB 2AGGX 1QIXB 2BVXH 1BA8B 1XUIA 2VIQA 1OXGA 4AGKA 2ZTXA 1DPOA 2VIPA 3SGAE 1LVMA 4MPVA 2O8WA 4UDWH 4NSVA 3W95A 3ATMA 1F0RA 4WVPE 1C1QA 1V2PT 1L4ZA 1YCPK 1WTHD 3B8JA 1ESAA 2FOMB 1XUJA 2VIDA 1EB1H 3T62A 5FPTA 3UFAA 1HAGE 3M3TA 3O8DA 4NIYA 1Q2WA 1ABIH 2FLRH 3SW2B 1NRRH 1SB1H 3DT0H 1AHTH 1SQAA 3O8RA 3A8AA 1MKXK 2BMGB 1E34B 3NWUA 1EX3A 1F2SE 1TFXA 1XX9A 2CV3A 3BF6H 1Q31A 2OTVA 5C3NA 3S7KB 2BDCA 1W8BH 2QYIA 3F9FA 3SU5A 2QC2A 1GJ9B 3NPSA 1LMWB 3MH4A 1L1GA 1Y5BT 2GMTC 1NN6A 2HPPH 3RU4T 1TX6A 2FEQH 4OS6A 1SGQE 4FUHA 4GCHG 3KQDA 4B74A 1AU8A 1W7XH 1PQ7A 1P8VC 4CBOA 1O2TA 1D3PB 1GJCB 4OS5A 1VGCB 2GMTB 2FOGA 1ZHPA 1AKSB 2STAE 1PYTC 1TALA 5EODA 1FV9A 3L33A 2HNTC 5A8ZA 4Y71A 3K6YA 4XE4A 4KELA 3P17H 4AGJA 1C5NH 3AVZA 1G36A 1GI8B 4TY7A 5G4BA 1P01A 2ZPSA 3SNBA 1A1RA 2ZDMA 1IQMA 3RXBA 1MD8A 3NXPA 1DVAH 1O38A 1ABJH 1TRNA 5CMXH 2TGPZ 2R2WU 2GV7A 1BRBE 1O5BB 3SNEA 4K60A 2YNAA 1SPJA 2A2XH 1Y5UT 1AZ8A 2BY6X 1P9UA 1MQ6A 2JH6D 2R0KA 1RRKA 3SUDA 2ZNKH 1GHBG 1MKWH 1CGHA 1THSH 3SJOA 1CT4E 3PLPA 1QA7A 2XCFA 1EJMA 2OP9A 4JYUH 1V3XA 1BIOA 3JZ1B 3TGIE 1CGIE 2F9VA 1G3CA 4AFQA 2J38A 1LHFH 3MNSA 2FI3E 3OX7U 1BJVA 3UNSA 4XOJA 1GHBF 2XNIA 3KHVA 1GBCA 1KLJH 1P02A 2OCVB 1IQLA 1T8LA 1CSOE 1T4UH 1FONA 1SR5C 4WH6A 6CHAC 3MFJA 3E3TA 1MQ5A 1SOTA 2PV9B 4JK5A 3PO1B 3A7TA 2XTTB 2OC7A 2FI5E 4AOQA 4ISHH 1ORFA 4IN2A 2NU4E 4U30A 1O3KA 3A8DA 4H6TA 1EATA 4WF8A 4I31A 6CHAB 2Z3EA 1BMNH 2O9QA 1A0HB 1QJ1B 1YPJH 4MG3A 1P2NA 1UVOA 2Z9LA 4YT6H 5DP7A 3SJ8A 1A5IA 2ZKSA 1PQAA 2F9OA 1ZJKA 5FPYA 3MHWU 1ZMNA 4JCNA 2Z94A 3RXMA 1ELGA 2UUYA 1GVLA 3ZVBA 1HLTH 5AHGH 1KXCA 4E7NA 5IYTA 3SV9A 3S69A 1CA8B 3QX5H 2ODPA 3RXQA 3SI4H 1O34A 2BY9X 4B75A 2Z6BD 3ZVGA 3F9GA 1VZQH 1CU1A 5A0BA 3E0NB 1BMLA 1GHYH 3GY7A 1LKAA 1H9LB 2BDBA 2FYQA 4DURA 2G5VA 3RM2H 1SL3A 3TU7H 5HYOA 9ESTA 3S7HB 1YPMH 1BHXF 4ABDA 1QHRB 1GWAA 5E8EH 2OC8A 4FUFA 5H4IB 3M3VA 4WY3A 5DP5A 2XWAA 2A32A 2F83A 1DANH 2HNTF 7KMEH 3VEQB 3H7OA 1C1UH 4CBNA 3A89A 1BBRE 1YCPM 1AB9B 4DT7B 3MNCA 1KXAA 2FOEA 4KP0A 3HGNA 2DE8A 1TBQH 3K65B 1YPHE 4DVAU 4XBBA 1O3FA 1XUGA 1DY9A 2Z9KA 3RXAA 2ZU4A 4X6OA 1Z8JB 1P2MA 1HAVB 3KL6A 3GCOA 3U8TH 1UHBA 2P16A 3Q3YA 1C1RA 2GZ9A 3FP6E 3FFGA 1EAXA 4KGAA 2G8TA 3E16B 1NU7B 2ZWLH 1N8OB 2GCTB 1C1VH 1ELVA 2Z9GA 1WOFA 4J2YB 3L3TA 4GSOA 5B6OA 3GCNA 1N6YA 1QJ6B 2ZFQH 3I78A 3RMOH 5JBTA 1N6XA 1SGEE 1Y5AT 1PPBH 2ZGJA 3N7OA 2A7JA 1O2GH 1YGCH 2R2MB 1HAIH 5E0JA 2WV5A 5DP9A 3HATH 1S5SA 3VGCB 3ZZCA 1C1PA 4Y10E 1AVGH 1TGNA 3KEEA 4NIXA 2IJOB 4AFZA 4NWKA 4RKOB 5AFZH 3UQVA 1C2EA 2NU0E 3M37A 2JKHA 3BSQA 1O5CB 1YPEH 3QDZB 4AFSA 3Q3XA 4DJZB 5C1XA 3MH5A 3U8RH 1TABE 1CHGA 2ZPQA 1C2LA 1KXBA 1KSNA 4CR9A 3HKJB 2FOHA 1Y59T 2XBVA 4B2CA 3MU8A 2BY5X 3UIRA 1ZMLA 1H8IH 7LPRA 2ZFPH 1F0SA 1W0YH 1HXFH 1E37B 2F9BH 1OX1A 2VWOA 3VFEA 4INLA 5AF9H 4FUEA 4IC5A 3LGIA 1D6RA 3V7TA 4NA7A 2NU3E 3ODFA 4VGCB 1HJAC 3D62A 1AWHB 1ZHRA 1MH0A 3SV2H 3LJJA 4A1XA 2VH0A 4D8NA 3V3MA 2A7CA 5DKMA 1SHHB 1HDTH 1LVYA 3OSYA 1K28D 3TH3H 4XBCA 2ZHFH 3RP2A 3MH7A 1U6QA 1DXPA 1FDPA 1FIZA 2PKAA 3UNQA 1HJAB 3DFJA 4OGYA 2VIWA 2GDEH 1TPPA 2V0BA 4I7YH 3SGQE 1TPAE 4GHTA 1GBFA 4IS5A 3TK5A 2GGVB 1ZPZA 1L4DA 3GCTG 1O32A 2F91A 1ARCA 1V2WT 3RU4E 1TMUH 3QO6A 3T26A 1NY22 1AI8H 1GCDA 2ZP0H 4ABBA 1EOJA 3A85A 4K2YA 4QT8C 3F6UH 1ANCA 1YYY1 1RXPA 3GCTF 4LOYH 2BLOA 3MO6A 3CENA 3BIVH 1GDNA 3EQ0H 1DWBH 1FLEE 1HCGA 3CS7A 4OS4A 9LPRA 2RA0A 1O3AA 1B0EA 4JK6A 3BEUA 1AWFH 1TWXB 1OWJA 2QXJA 2B5TB 1C5OH 1Z1IA 2C93B 4ZHAA 2FS9A 2GP9B 1YPKH 1AVWA 1UTQA 4X6NA 1ZSLA 2OUAA 2W3KA 1GBHA 3NK8A 4WWYA 2ANMH 5TCAA 2WV4A 2XC5A 3RC4A 2H5DA 5E0GA 1P3EA 3DHKH 1P10A 4AORA 4JZFH 4CRBA 2UUJB 1O2SA 3EGKH 2A2QH 4X1SU 3RXVA 2ZTZA 2FPZA 4NZQA 3GY4A 2QN5T 5L6NH 1KLTA 1PPZA 1HNEE 3RMNH 3SU2A 1CBWC 1ZOMA 1JIRA 1LVBA 3A88A 2AGIX 4CHAB 1C5MD 1XVMA 2TGAA 1V2OT 2BDAA 1H8DH 1JRTA 2FDAA 4B71A 1SLWB 3MU5A 3VXEH 1LKBA 2BVRH 1P2IA 1VITG 1ESTA 3PWBA 1GI5A 2XWBI 2W7SA 1SGTA 1W14U 5A0AE 1A46H 1GJ8B 4ZHLU 1IQIA 1DSUA 2A5IA 1Z8IB 4WMFA 1E0FD 5JB9S 2CF9H 1ETRH 2ZZUH 1VITF 4ISOA 3PLKA 2P3TB 1O2IA 1QBNA 2VVUA 3Q00A 3UOPA 1BT7A 1TNGA 1W0ZU 4X2XA 1O3MA 5E2PA 2IN2A 1GI7B 4XSKU 4NFEA 1G9IE 3HGPA 4DOQA 1D6WA 1QBVH 5FBIA 1LO6A 1O2QA 3U1IB 1TNHA 1PPCE 3BTHE 4THNH 2XRCA 2BD7A 3E1XB 3QWCH 5L30H 3SU6A 3HK3B 1MU8B 1WU1A 5EXMA 1TBZH 1FNIA 1WTGH 1QL9A 4E05H 3KNXA 5K0HA 4JYVH 4D7FA 2AH4X 2QXGA 1GI2A 4X0WU 4FXGH 2NWNA 1O2WA 3ODDA 2P59A 3P8FA 4MTBA 4I8GA 1C5SA 1W2KH 2ZGCA 4FUBA 1WYKA 1DT2A 1GBDA 4CH2B 1AUTC 3TIUA 5AFYH 1NRQH 5HM9A 2QXHA 1GL1A 2ASUB 2O8MA 1IQEA 1C2GA 5F03A 2WUCA 5A0CA 1AE8H 4HGCA 3S9AA 4Z0KA 3A82A 5C1YA 2HWLB 3DD2H 1SVPA 1GHAG 4BAOB 2ZU3A 3NZIA 4CREA 3E90B 1QR3E 2XBXA 3QUMP 3I77A 1YC0A 1DWDH 2VWNA 4AYYB 2Z9IA 1C2HA 3RXOA 1K1PA 1GHAF 1EPTC 1KTSB 1B5GH 1GBEA 1DXWA 1ZZZA 2ZIQH 4OS1A 1OWEA 1HAHH 1HRTH 1RIWB 1TPSA 3LJOA 3D65E 1GMCG 1BOQA 3SNCA 3LGYA 5F8TA 1K1LA 3QZQA 3RC5A 2B7DH 1LPGB 1SGYE 1O2MA 2R0LA 1EPTB 3GY2A 1MUEB 1DOJA 4ABFA 2C8XB 5FXLA 1MBMA 1GMCF 1JRSA 2NU1E 1S82A 2HGTH 5JBAS 2BD4A 1SLXB 3RLWH 2XC4A 1O3JA 3GY5A 3FP8E 2A4GA 1SGIB 5F6MA 5L2ZH 2ZQ1A 1W10U 1GMDF 3LDXH 2AYWA 4NIWA 3H5CB 1NFYA 2V3OH 1DICA 4J1YA 2I6QA 1FN8A 2OQUA 5GIBA 4O97A 3GY6A 2W26A 1GBBA 1GJAB 2A45B 4KKDA 5GJ4B 3TH2H 3ZYDA 3ZVAA 1P2JA 1Z6JH 2OD3B 2WPIS 2VJ1A 4ABAA 1P3CA 3ZZ3A 2BLQA 1KXDA 2OC1A 2BDGA 1VGCC 1QB6A 2AFQB 2GTBA 2TBSA 4JZIA 2A7HA 1GDUA 2PTNA 2OQ5A 4A5TS 1O2OA 1BBRH 1YM0A 1A0JA 1MCTA 3U98H 1SC8U 2JETB 1NFUA 2ZHWH 3M5NA 1LHDH 1GJ6A 3TLOA 3BTKE 1SOZA 3RXPA 1HGTH 1EAWA 1K1OA 2HPQH 2ZQ2A 1F5KU 2WPMS 4CRAA 1BJUA 2P95A 1ZTLA 1P0SH 2JH5D 2BB4A 2CGAA 2BD5A 5C1UA 1BITA 3MMGA 3EA8A 2H1UA 4TWWA 1C1MA 4FUJA 3DUXH 1QL8A 2Y81A 3SUEA 1ANEA 4LXBH 1C5TA 1MTVA 3SORA 1FAXA 2G5NA 4WXIA 4X2VA 1BRAA 4FVBA 2NU2E 3T28A 4AX9H 1QL7A 2R3YA 4YOJA 1GVKB 2VVCA 1SMFE 2LPRA 4H6SB 4IC6A 1LPZB 4MNXA 1O3EA 5JB8S 1BCUH 3E8LA 1ZYOA 3LGUA 3TK6A 1QFKH 4TYDA 2PTCE 2ZGXH 3P8NA 2BM2A 1TX7A 3GOVB 1J16A 2VIOA 3SHCH 3SNDA 3SJIA 2BVSH 4TPYA 1RD3B 3RXHA 3PO1C 2FYRA 3KF2A 2QF0A 1QRXA 1C9PA 4FVDA 2BD2A 4MLFB 4HZHA 1J9CH 4NFFA 3E6PH 4X8SH 3V12A 2H9TH 5CE1A 1MTUA 1QY6A 4XFQA 2HVXA 5TJXA 1IHTH 1EJAA 1UHBB 4DIIH 1BTUA 1C2DA 1C4U2 2GT7A 3PROA 3A8CA 1EP6A 1HIAA 1SLVB 5GCHG 4LZ1H 4UEHH 2PSYA 1DLEA 3MU4A 5IDKA 4A92A 3ZVCA 2THFB 1GJBB 1NS3A 4LK4A 1HUTH 1TYNA 2BD9A 1ZHMA 2P3FH 2QV1A 1HAOH 1TIOA 1TMBH 1H1BA 4YOIA 3A7XA 3AW0A 4YT7H 1IQKA 1E35B 1ELAA 1S81A 5GCHF 8GCHG 1LDTT 3ZZDA 2A4QA 1TAWA 1SGFG 3U8OH 1PPFE 2ZDKA 3UWJH 1G2LA 1DM4B 4X8TH 2ZU1A 2BXUH 4BXWA 5SGAE 1TPOA 2FWWA 1PQ5A 5DPAA 1Y3XA 1OS8A 1A4WH 4Y8YA 1C2FA 4ZXXH 3VB5A 2SGFE 1NROH 3KGPA 1UK2A 8GCHF 1V2UT 2CN0H 2FZZA 4Y7AA 1F5LA 1CA0B 2ZHEH 1NFXA 3SJKA 4NCYA 2GVFA 2A1DB 4Y0ZE 1GHZA 1P06A 3RXLA 5LPEA 2Z3DA 4KTCA 4ZKSU 3UWIA 3RXRA 1HAPH 3SI3H 2FP7B 2P93A 2B0FA 3M3SA 1EZSC 4X8UH 1AB9C 1GI9B 3TPIZ 1GCTC 1XMNB 4JZEH 1PPHE 1NT1A 1VJAU 2BD8A 3STIA 3KQEA 1ID5H 3ZZ7A 4A1VA 1AMHA 2ZHDA 4OGXA 1O5EH 1IHSH 3SUGA 1ZPCA 4I8JA 1F92A 3ZVEA 1NU9A 2UWLA 6ESTA 2BD3A 1NTPA 1GCTB 4Y0YE 5AVDA 2QA9E 3TJVA 1CE5A 3ZZ5A 3IITA 3UOUA 4AG1A 1NFWA 2HNTE 1N8OC 2GCTC 4MDSA 1ZRBA 2BXTH 2PKAB 1PPEE 3MO9A 3ZYEA 4A6LA 2G51A 2XBYA 1JMOH 3T5FH 2ZI2H 2H9HA 2QF3A 1UCYE 3RXCA 4DCDA 1KY9A 4R0IA 4MQAA 3ZZAA 4BAQB 1S6FA 4ISIH 1LTOA 2AIPA 2LNCA 1D9IA 2W5EA 1HPGA 5DP8A 3VGCC 4WMDA 1SFQB 4BAHB 3QTOH 4YOGA 5EQSA 2JH0D 1IQGA 2AIQA 1C2MA 1GHVH 1C5UA 2SGDE 4WJG2 1MKWK 4FU9A 2EA3A 1O2LA 2OBQA 1ZPBA 2C8WB 2PLXA 3ITIA 5EQRA 2VINA 4Q80A 1OSSA 2G55A 4K1EA 1C5XB 1BTXA 2J2UA 1TBRH 5BPEA 3U1JB 4R8TB 1LVOA 3A84A 1V2VT 2RCEA 4ABEA 2KAIA 1O30A 5I46H 3FVFB 3Q77A 3RXFA 1EP5A 4NWLA 1EJNA 3MNBA 1THRH 3A7YA 3RDZA 3AAUA 1G3DA 1WBGB 3OU0A 4MPXA 1HJ9A 1O5AB 1VCQA 1RFNA 4IGDA 4IMQA 3T2NA 3LH3A 1WSSH 3ENSB 1EZXC 1SI5H 2PR3A 1KXEA 3QK1A 1WQVH 3ATKA 3LU9B 4D9QA 4VGCC 1GBKA 1O5DH 2ZDNA 3ESTA 3PMJA 2B9LA 2RA3A 1FPCH 1O3HA 4E7RG 3F1SB 4SGBE 3BTGE 3W94A 1KIGH 2FOAA 1O35A 2RDLA 5GPIB 3LONA 4UFFH 1V6DA 2FO9A 2Y5GA 3SU0A 2YOLA 1T7CA 1S6HA 1LCYA 2FXRA 2P8OB 2TGDA 2TIOA 4I8KA 5GDSH 2ZTYA 4JYTA 4XBDA 4D7GA 2G4TA 5I25A 1S84A 1SQOA 1UTKA 3LGTA 2H9EH 1FAKH 2FX4A 1K1MA 2FMJA 1N1LA 3MYWA 2ZU5A 3PYHA 2GX4A 1QQ4A 1Z8GA 2GCHG 2BTCE 1PYTD 3VB3A 1O0DH 1O3GA 1RS0A 1AGJA 3TJUA 2Z9JA 1V2MT 3SV7A 5EPNA 3L6PA 1L1NA 1MU6B 4ZUHA 1K1JA 1YF4A 2GCHF 1XUFA 3V13A 1XKAC 2FESH 1K21H 4GAWA 1DUEA 1G37A 1MZAA 1C1OA 1QGFA 3UQOA 1KTTB 1S83A 3MTYA 1C5WB 4MPWA 1J14A 1LPKB 5BRRE 2CJIA 7ESTE 3LT3A 3LC5A 2FM2A 4Q7ZA 2HALA 8KME2 1O3DA 2PFEA 1W13U 4TPIZ 3RXDA 2Q6DA 2VGCB 1H4WA 1D3DB 4X6PA 4YZUA 1FJSA 1GL0E 3SNAA 1WCZA 5A2MH 5LPFA 1O2NA 2O8TA 3EA9A 4UE7H 2M5TA 5LH8A 2J9NA 1LHCH 5J4QA 1AQ7A 1HV7A 2Q6FA 1UO6A 1XKBC 4X6MA 3RC6A 1JOUB 5T6DA 3TK9A 4HI3A 1A61H 2W7UA 1EOLA 1P03A 2SGPE 4KTSA 4B1TA 2ODQA 1LQDB 3B9FH 2XW9A 3KIDU 2SGAA 1GI0A 1NRNH 1XUKA 1SQTA 2EC9H 2ZHQH 1EQ9A 4CHAC 3M5LA 5FCKA 3ZZ6A 1F5RA 3M5MA 3TH4H 1SLUB 4I33A 1O3BA 5JDUB 1B0FA 1OKXA 4GPGA 3VB6A 4Y11E 2PWXA 2Z3CA 3CS0A 3M7TA 2W3IA 3RXIA 1O2XA 6GCHF 5C67A 5DJ7A 1ETSH 4Y79A 2HRVA 5FPSA 4Q2KA 2SNWA 1NO9H 5EW2H 1OP2A 4AFUA 1O39A 2R3UA 1GBJA 2DUCA 3KN2A 4UFDH 5EU8A 3LIWA 3TNTA 1FN6A 4HTCH 1HBTH 4FUGA 2QXIA 2AMDA 3LPRA 3SJ9A 2WPJS 1BTZA 2SFAA 1SGPE 1FZZA 3ZVDA 1OYQA 2ZEBA 4ZHMU 2CF8H 3BTFE 2BY7X 1SFIA 3A83A 1Z7KA 1ZTJA 3UR9A 3EAJA 2BOKA 3STJA 1S0QA 5EPYA 3RUOA 2Y6TA 1T8OA 1OP8A 2TRMA 1C5PA 3OY5U 1O2UA 3QN7A 4IBLH 1A0LA 3GDUA 2UUFB 2F9PA 3BEFB 3PB1E 4NA9H 1ELBA 3WY8A 2GKVE 4ABHA 1BQYA 3DA9B 1JBUH 1O5GH 2AGEX 1AO5A 2V6NA 2O8LA 4BAMB 4E06H 2Y7XA 2YNBA 2DE9A 2ZG0H 1MCVA 5HMAA 1UMAH 1KDQA 2BQ6B 1HAYB 1P04A 5ETXA 2CHAB 3BEIB 2QY0B 2ANWA 2BHGA 2FOCA 4AB9A 3ZZ4A 1IQFA 3Q76A 3UREA 2FTLE 1WUNH 4OS2A 1IOEA 1O31A 1HJ8A 5DP6A 1AE5A 1GMHG 4BTTB 3FANA 1VR1H 2ODYB 3RLYH 1AFQC 3ZV8A 4AG2A 4K8YA 1THPB 2FS8A 1Z71A 2BDYA 1BDAA 2GT8A 2HLCA 4ABIA 3SU3A 5A8YA 3QGJA 2PKSC 1G30B 1UK3A 1INCA 4IN1A 1P2QA 2VVVA 4BXSA 1GMHF 1C1TA 4PROA 3R3GB 4BANB 1P05A 4BTIB 1C5QA 5C5NA 2C90B 1C5VA 1XVOA 5K7RA 6LPRA 3PWCA 2C8ZB 2H5CA 1AFQB 2VNTA 1YP9A 2Y5HA 3NUMA 1ZTKA 2ZGBH 3S9BA 2ALPA 1FQ3A 2ZCLP 4XDEA 2PKSB 1RIWC 1WV7H 3FP7E 2ZDVH 1P2KA 1DUAA 4FUCA 3ELAH 1O2PA 3I29A 4GVUA 2PHBA 4U32A 2PSXA 1OWIA 2AERH 2SNVA 3A81A 4U2WA 3TJNA 2HOBA 2G81E 3AASA 3UPEA 4JMYA 2FLBH 1G3EA 2BQWB 5A09A 2ZFFH 1ELTA 5FCRA 4GHQA 1AY6H 1GG6B 1YBWA 2QGRA 1TGTA 8ESTE 1QA0A 1GMDG 1QCPA 3PMAB 2XBWA 2AEIH 3S9CA 3A7WA 1SGNE 3SN8A 1TRMA 2VU8E 2P94A 1T8MA 3BV9B 4X1RU 5HGGA 3SHAH 1EZUC 1O36A 4WXVA 1XM1A 1QB1A 2GZ8A 4WH8A 4UFGH 1CT0E 1C1NA 3K9XB 2VWMA 3ZZBA 4ZH8A 3SGBE 1CQQA 2A5AA 1HIAB 1ELFA 1NC6A 4FU7A 1JXPA 3C1KA 1TNLA 1E38B 3OY6U 1GI6A 1L1JA 1GVZA 1TGCA 1TLDA 2A4RA 2XYAA 1C2KA 2J94A 2OLGA 2JETC 3TGJE 1Z1JA 5CHAC 4KTUA 1GPZA 4ISNA 1MD7A 2AMQA 4NA8A 4YLQH 2ZPRA 1GHWH 2FIRH 2Z7FE 3P95A 3SQHE 1GHXH 2Q6GA 2J95A 4NGAH 1P11E 3D49H 1K22H 1SG8B 2D1JA 1X7AC 4Y6DA 4X1PU 1ZSJA 3M36A 4Q7YA 1O3NA 3GYLB 5CHAB 1EUFA 1C5RA 1UTMA
chains in the Genus database with same CATH superfamily
4IW4E 3VPKA 1C5ZB 4ABGA 1O2RA 5GWZA 1BUIA 3PV2A 5LPRA 1V2QT 2QIQA 4Q7XA 3P70B 4ASHA 1AN1E 2PGBB 1UCYH 1LHEH 1ZLRA 5FBEA 1C2JA 5FAHA 4X2WA 1D3QB 1GJ4H 2ZU2A 1FY3A 3E0PB 1YKTA 2R9PA 3BTDE 3Q3KA 1YPHC 4GCHF 3RM0H 3T29A 3UY9A 3ZV9A 2WUBA 2ZGHA 1MABB 3HKIB 1EXFA 1FY4A 5GNDA 3QGNB 1EASA 1ACBE 3NCLA 4CR5A 1BHXB 1C2IA 1Q3XA 1TNIA 3PTBA 4F49A 7GCHG 2TGTA 3MU1A 3CP7A 3IG6B 5J4SA 1O2ZA 3A8BA 1C9TA 2W6JD 3OYPA 2Y7ZA 3A7VA 2XCNA 1QTFA 1DS2E 1ANBA 5FX6A 4B73A 2WINI 5PTPA 1AZZA 1T31A 2BLVA 7GCHF 1OYTH 1BMFD 2VH6A 1M9UA 4ZXYH 2ALVA 4OS7A 5TCCA 3GY3A 1BTYA 2UWOA 3DCLA 1MTNC 3PMBB 1Z8RA 1MTSA 1D3TB 4MVNA 1PPGE 4K5ZA 2BX3A 1DFPA 1HB0B 1VCPA 3F0OA 1GI3A 4CRGA 2Q1JA 1XXFA 1EPTA 4TWYA 4H4FA 1FPHH 3PTNA 2GDDA 3WWFA 1ESBA 1ARBA 1Y3YA 3LGVA 1OWDA 1IQJA 1GBAA 1HXEH 4IMZA 4AN7A 1MTNB 3GDVA 2D2DA 1H9IE 1ELCA 1V2LT 2C3SA 4B76A 1CA0C 3URCA 3ZVFA 4A1TA 8LPRA 3TVJB 1D4PB 1QRZA 1UTPA 4B2BA 1IAUA 4MNWA 1FY5A 2KAIB 1BB0B 1HYLA 3GY8A 2XNDD 3P6ZB 1YY3A 1ELEE 1SGCA 1CHOG 1UK4A 3KQBA 1FUJA 1AFEH 1A5HA 4O3TA 2FODA 4K1TA 5JBCS 1UTJA 1OHHD 3GICB 4HFPB 1NPMA 1A3BH 5C2ZA 4NZLA 1ZSKA 2C8YB 2ESTE 1H9HE 4DIHH 1TB6H 5EOKA 1CHOF 4I8LA 1H8HD 1JIMA 3M7UA 4JZ1A 4M7GA 3TGKE 4B2AA 4SGAE 2OC0A 5T6GA 2V3MA 4GLYA 1V2NT 1HAZB 1TMTH 1SGFA 2ZFSA 3F2FA 3LOXA 4H42U 4CH8B 3OTJE 2IOTA 3RXKA 2TPIZ 1MMJN 2ZECA 2L74A 3SU1A 2UUKB 1C4V2 3M35A 4ESTE 1AKSA 2WYGA 1Z6EA 1QURH 4CRFA 1WQSA 3MO3A 1TA2A 1BBRK 1WAYB 4ZKNU 3AAVA 5KECA 3BG4C 2L6OA 2D26C 1Y3VA 1BRCE 5EJ1A 4K1SA 4CRDA 2P3UB 2FTMA 3BTWE 4ZROA 2J4IA 3VB7A 3RXUA 3TJOA 4BTUB 1C1SA 1K9OE 1C5LH 3N99A 1J15A 5DK1A 2QF4A 1K1IA 2AMPA 5EQQA 3IWMA 3DSPA 1F0UA 1DY8A 1KLIH 1BTWA 2XC0A 1SHYA 1FY1A 1UCYK 1UTOA 3R0FA 3BG4B 1MZDA 1ETTH 3H7TA 1P09A 1K2I1 2ILNA 3BIUH 3UTUH 1DITH 1AD8H 3URDA 2I6SA 2F9NA 1DE7H 1O3LA 2ULLA 1O2VA 1GBMA 1TRYA 3RXEA 1GBTA 1Y8TA 1J17T 3P92A 1BZXE 2A31A 1PJPA 5E2OA 3LKWA 2WYJA 1BTHH 3ZZ8A 3EA7A 2ZDAH 1TONA 1G32B 5E0HA 3BTME 1QQUA 2YMSD 2RG3A 1E36B 1G3BA 1GI4A 3P8GA 2EI8A 1EAIA 2AS9A 4O9VA 3BTTE 1QBOA 1TX8A 3GCHC 1ZMJA 1A7SA 3F68H 1O33A 1L0ZA 2G52A 1CO7E 1V2TT 2PUXB 1O3IA 1AVXA 1T8NA 1UVTH 4DY7B 1L2EA 2GD4B 4AB8A 2Y82A 3UNRA 1DX5M 3O8CA 3A7ZA 4Y76A 3RXJA 1GBLA 1MAXA 1RJXB 3B23B 2STBE 2Y80A 3GCHB 3UB0A 5FX5A 1UVUH 4DG4A 1TNKA 3DSGA 3GDSA 4AYVB 1A5GH 1KYNA 1TQ0B 3BTQE 3QLPH 2BYAX 1O5FH 1P2OA 3A86A 4NSYA 1DLKB 1SGRE 4DGJA 1FMGA 2FI4E 3MH6A 1GJ5H 1V2KT 4ZKOU 1TQ7B 1YLCA 3M7QA 2P8OC 2PW8H 2ZDLA 1XXDA 3D23A 5DP4A 5JYIA 3SV6A 1RGQA 4P02A 2ANYA 2ZF0H 2WPHS 3F9HA 3GYMA 5ESTE 1LHGH 3SOSA 1F7ZA 2PUQH 4FUIA 1HFDA 2G00A 4X2YA 3RMLH 5DN6D 3EE7A 4O3UA 2FOBA 2V3HH 1DWEH 2UWPA 3EE0B 3U69H 1VITH 1UVSH 4D76A 4RN6A 1QB9A 1O37A 1OWKA 4RI0A 4INKA 1QRWA 3V0XA 2EI7A 2ZFTA 1RTLA 1OOKB 1IQHA 1O2KA 1V2RT 1YWUA 1CGJE 3M5OA 1IQNA 3T25A 2ZFRH 1F0TA 2F9UA 2BZ6H 1AIXH 4ISLA 5IK2D 4ZAEA 3RMMH 1GDQA 1O3OA 2ZA5A 1OWHA 3PM3A 3TNSA 1QNJA 1XUHA 4HG6A 4Y8ZA 1W11U 2VGCC 2VB0A 1BMAA 2BQ7B 4CRCA 2H2ZA 4I8HA 2J5UA 5EXLA 5FHTA 2OINA 2PP6A 1HAVA 3ZZ9A 3DFLA 4RSPA 2OBOA 2WPLS 3FZDA 4Y7BA 1DSTA 5T3HA 2BOHB 1W7GH 1ZGVA 1T4VH 1LQEA 4F4OC 2GZ7A 1TNJA 4OM9A 1KDQB 2J34A 3F2HA 3EDXB 3LH1A 1J8AA 1YPGH 5ABWA 5DO4H 1B7XB 2O8UA 4AZ2B 4A7IB 1G2MA 1W12U 3BG8A 3UR6A 1UVPA 3FAOA 3SQEE 4JZDH 4RT1A 1GJ7B 1P57B 3VB4A 2CXVA 5T6FA 3RXTA 4U01A 2V35A 3TITA 2VWLA 3K6ZA 4INHA 2FOFA 3BN9A 2QCYA 1ZGIA 4NG9H 4MPUA 1ZJDA 1NM6A 4UFEH 3UAIC 2CMYA 2EI6A 1P12E 1Y3UA 1TA6A 1EZQA 1OP0A 3CNRA 2OXSA 6GCHG 5F8ZA 2SGEE 1O3PB 3NKKA 1C4Y2 1S0RA 2PGQB 4UONA 1NRSH 1O2YA 1EAUA 1RTKA 2ZO3H 1O3CA 1ZR0A 5DGJA 3SZNA 2D8WA 1YPLH 1K1NA 1MAYA 4FU8A 1FXYA 3GISB 2J92A 2IPHA 1W3CA 1PQ8A 4Y8XA 3KQCA 1QJ7B 1YCPH 4X1QU 4Z6AH 4BOHA 3C27B 2BDIA 3JZ2B 1ANDA 1YLDA 4ABJA 1UTLM 1EB2A 1NESE 1TGBA 3SU4A 4K3JA 3O8BA 4Q4LA 1S85A 3MWIU 3UUZA 1OPHB 5HXFA 1BMMH 1HAXB 5HIYA 3M61U 1MTWA 3QTVH 1GJDB 3ATIA 4ZKRU 1MBQA 5A8XA 4BNRA 2B8OH 5HM2A 1MKXH 2ZC9H 1A3EH 3G01A 3HPTB 4XRNA 2VIVA 3SV8A 1SBWA 1UTNA 4X1NU 4O03A 4GUXA 2CHAC 2F3CE 4K8BA 4X8VH 4NIVA 2F43B 4YO9A 1JWTA 2XXLA 1V2ST 3SBKA 2SGQE 1CBWB 4TY6A 3A87A 5EXNA 4MNYA 3KCGH 2CK3D 2H6MA 3AW1A 1PFXC 4YESB 1FIWA 3QZRA 4YM9A 1VKYA 2BX4A 3SUFA 3RXGA 3E91A 1GBIA 4FUDA 3HK6B 2A4OA 1AUJA 4YLUA 1DWCH 3ATWA 4ZMAH 3RU4D 2EEKA 2ZCHP 5GXPA 4I32A 1TOMH 4DW2U 2ZCKP 2C4FH 3F3BA 1CT2E 3A80A 4WMEA 1C5YB 3PLBA 2BDHA 3BTEE 1GI1A 5C5OA 2Y5FA 4MNVA 1SSXA 3FZZA 1VJ9U 3F9EA 1A2CH 4UD9H 3MU0A 3P8OA 1CVWH 3ATLA 1V2JT 3MI4A 1VCWA 4D9RA 5EG4A 3OE7D 1TGSZ 3MNXA 5DG6A 3VXFH 5EW1H 1T32A 1FY8E 1NRPH 5C0TA 5F8XA 2BLWA 1C1WH 3SO3A 4LZ4B 2G4UA 3MOCA 2OK5A 1ELDE 1GGDC 2F4LA 2WPKS 3K2UA 2A5KA 2BZAA 3LGWA 4BAKB 4TT3D 3RXSA 5C20A 3PV4A 3EYDA 1BTPA 1UJ1A 2IJD1 4YTAA 1EKBB 5DP3A 2QAAA 1TE0A 1GG6C 3PMHB 2WZQA 3T27A 1KXFA 5JBBS 1Y3WA 1P9SA 4K69A 1GGDB 3S0NA 1SGDE 1ZRKA 1TOCB 2BY8X 1DDJA 5FL7D 2ANKH 1FI8A 2FX6A 5LGOA 3LC3A 1O2JA 5EGMA 5L2YH 1O2HA 4Q63A 5JPMH 3U9AH 1NZQH 1BRUP 2GV6A 4RKJB 5ESBA 2A0QB 2K1QA 1RTFB 2AGGX 1QIXB 2BVXH 1BA8B 1XUIA 2VIQA 1OXGA 4AGKA 1W0KD 2ZTXA 1DPOA 2VIPA 3SGAE 1LVMA 4MPVA 2O8WA 4UDWH 4NSVA 3W95A 3ATMA 1F0RA 4WVPE 1C1QA 1V2PT 1L4ZA 1YCPK 1WTHD 3B8JA 1ESAA 2FOMB 1XUJA 2VIDA 1EB1H 3T62A 5FPTA 3UFAA 1HAGE 3M3TA 3O8DA 4NIYA 1Q2WA 3AK5A 1ABIH 2FLRH 3SW2B 1NRRH 1SB1H 3DT0H 1AHTH 1SQAA 3O8RA 3A8AA 1MKXK 2BMGB 1E34B 3NWUA 1EX3A 1F2SE 1TFXA 1XX9A 2CV3A 3BF6H 1Q31A 2OTVA 2KFWA 5C3NA 3S7KB 2BDCA 1W8BH 2QYIA 3F9FA 3SU5A 2QC2A 1GJ9B 3NPSA 1LMWB 3MH4A 3NRLA 1L1GA 1Y5BT 2GMTC 1NN6A 2HPPH 3RU4T 1TX6A 2FEQH 4OS6A 1SGQE 4FUHA 4GCHG 3KQDA 4B74A 1AU8A 1W7XH 1PQ7A 1P8VC 4CBOA 1O2TA 1D3PB 1GJCB 4OS5A 1VGCB 2QE7D 2GMTB 2FOGA 1ZHPA 1AKSB 2STAE 1PYTC 1TALA 5EODA 1FV9A 3L33A 2HNTC 5A8ZA 4Y71A 3K6YA 4XE4A 4KELA 3P17H 4AGJA 1C5NH 3AVZA 1G36A 1GI8B 4TY7A 5G4BA 1P01A 2ZPSA 3SNBA 4Z1MD 1A1RA 2ZDMA 3OFND 1IQMA 3RXBA 1MD8A 3NXPA 3F2GA 1DVAH 1O38A 2VBCA 1ABJH 1TRNA 5CMXH 2TGPZ 2R2WU 2GV7A 1BRBE 1O5BB 3SNEA 4K60A 2YNAA 1SPJA 2A2XH 1Y5UT 1AZ8A 2BY6X 1P9UA 5KEDA 1MQ6A 2JH6D 2R0KA 1RRKA 3SUDA 2ZNKH 1GHBG 1MKWH 1CGHA 1THSH 3SJOA 1CT4E 3PLPA 1QA7A 2XCFA 1EJMA 2OP9A 4JYUH 1V3XA 1BIOA 3JZ1B 3TGIE 1CGIE 2F9VA 1G3CA 1UW7A 4AFQA 2J38A 1LHFH 3MNSA 2FI3E 3OX7U 1BJVA 3UNSA 4XOJA 1GHBF 2XNIA 3KHVA 1GBCA 1KLJH 1P02A 2OCVB 3DSOA 1IQLA 1T8LA 1CSOE 1T4UH 1FONA 1SR5C 4WH6A 6CHAC 3MFJA 2KCOA 1MQ5A 3E3TA 1SOTA 2PV9B 4JK5A 3PO1B 3A7TA 2XTTB 2OC7A 2FI5E 4AOQA 4ISHH 1ORFA 4IN2A 2NU4E 4U30A 1O3KA 3A8DA 3FO8D 4H6TA 1EATA 4WF8A 4I31A 6CHAB 2Z3EA 1BMNH 2O9QA 1A0HB 1QJ1B 1YPJH 4MG3A 1P2NA 1UVOA 2LP6A 2Z9LA 4YT6H 5DP7A 3SJ8A 1A5IA 2ZKSA 1PQAA 2F9OA 2KCYA 1ZJKA 5FPYA 3MHWU 1ZMNA 3MQKC 4JCNA 2Z94A 3RXMA 1ELGA 2UUYA 1GVLA 3ZVBA 1HLTH 5AHGH 1KXCA 4E7NA 5IYTA 3SV9A 3S69A 1CA8B 3QX5H 2ODPA 3RXQA 3SI4H 1O34A 2BY9X 4B75A 2Z6BD 3ZVGA 3F9GA 1VZQH 1CU1A 5A0BA 3E0NB 1BMLA 1GHYH 3GY7A 1LKAA 2J98B 1H9LB 2BDBA 2FYQA 4DURA 2G5VA 3RM2H 1SL3A 3TU7H 5B6LA 9ESTA 5HYOA 3S7HB 1YPMH 1BHXF 4ABDA 1QHRB 1GWAA 5E8EH 4I86A 2OC8A 4FUFA 5H4IB 3FOAA 3M3VA 4WY3A 5DP5A 2XWAA 2A32A 2F83A 1DANH 2HNTF 7KMEH 3VEQB 3H7OA 1C1UH 4CBNA 3A89A 1BBRE 1YCPM 1AB9B 4DT7B 3MNCA 1KXAA 2FOEA 4KP0A 3HGNA 2DE8A 1TBQH 3K65B 1YPHE 4DVAU 4XBBA 1O3FA 1XUGA 1DY9A 2Z9KA 3RXAA 2ZU4A 4X6OA 1Z8JB 1P2MA 1HAVB 3KL6A 3U28C 3GCOA 3U8TH 1SKYE 1UHBA 1KMHB 2P16A 3Q3YA 1C1RA 2GZ9A 3FP6E 3FFGA 1EAXA 4KGAA 2G8TA 3E16B 1NU7B 2ZWLH 1N8OB 2GCTB 1C1VH 1ELVA 2Z9GA 1WOFA 4J2YB 3L3TA 4GSOA 5B6OA 3GCNA 1N6YA 1QJ6B 2ZFQH 3I78A 3RMOH 5JBTA 4FETA 1N6XA 1SGEE 1Y5AT 1PPBH 2ZGJA 3N7OA 2A7JA 1O2GH 1YGCH 2R2MB 1HAIH 5E0JA 2WV5A 5DP9A 2JIZD 3HATH 1S5SA 3VGCB 3ZZCA 1C1PA 4Y10E 1AVGH 1TGNA 3KEEA 4NIXA 2IJOB 4AFZA 4NWKA 4RKOB 5AFZH 3UQVA 1C2EA 2NU0E 3M37A 3SZEA 2JKHA 3BSQA 1O5CB 1YPEH 3QDZB 4AFSA 3Q3XA 4DJZB 5C1XA 3MH5A 3U8RH 1TABE 1CHGA 2ZPQA 1C2LA 1KXBA 1KSNA 4CR9A 3HKJB 2FOHA 1Y59T 2XBVA 4B2CA 3MU8A 2BY5X 3UIRA 1ZMLA 1H8IH 7LPRA 2ZFPH 1F0SA 1W0YH 3N7DA 1HXFH 1E37B 2F9BH 1OX1A 2VWOA 3VFEA 4INLA 5AF9H 4FUEA 4IC5A 3LGIA 1D6RA 3V7TA 4NA7A 2NU3E 3ODFA 4VGCB 1HJAC 3D62A 1AWHB 1ZHRA 1MH0A 3SV2H 3LJJA 4A1XA 2VH0A 4D8NA 3V3MA 2A7CA 5DKMA 1SHHB 1HDTH 1LVYA 3OSYA 1K28D 3TH3H 4XBCA 2ZHFH 3RP2A 3MH7A 1U6QA 1DXPA 1FDPA 5HKKD 1FIZA 2PKAA 3UNQA 1HJAB 3DFJA 4OGYA 2VIWA 2GDEH 1TPPA 2V0BA 1COWD 4I7YH 3SGQE 1TPAE 4GHTA 1GBFA 4IS5A 3TK5A 2GGVB 5C0UA 1ZPZA 1L4DA 3GCTG 1O32A 2F91A 1ARCA 1V2WT 3RU4E 1TMUH 3QO6A 3T26A 1NY22 1AI8H 1GCDA 2ZP0H 4ABBA 1EOJA 3A85A 4K2YA 2K0QA 4QT8C 3F6UH 1ANCA 1YYY1 1RXPA 3GCTF 4LOYH 2BLOA 3MO6A 3CENA 2JDID 3BIVH 1GDNA 3EQ0H 1DWBH 1FLEE 1HCGA 3CS7A 4OS4A 9LPRA 2LELA 2RA0A 1O3AA 1B0EA 4JK6A 3BEUA 1AWFH 1TWXB 1OWJA 2QXJA 2B5TB 1C5OH 1Z1IA 4TSFD 2C93B 4ZHAA 2FS9A 2GP9B 1YPKH 1AVWA 1UTQA 4X6NA 1ZSLA 3PRBA 2OUAA 2W3KA 1GBHA 1NBMD 3NK8A 4WWYA 2ANMH 5TCAA 2WV4A 2XC5A 3RC4A 2H5DA 5E0GA 1E1QD 1P3EA 3DHKH 1P10A 4AORA 4JZFH 4CRBA 2UUJB 5C17A 1O2SA 3EGKH 2A2QH 4X1SU 3RXVA 2ZTZA 2FPZA 4NZQA 3GY4A 2QN5T 5L6NH 1KLTA 1PPZA 4FOUC 5T1VA 1HNEE 3RMNH 3SU2A 1CBWC 1ZOMA 1JIRA 1LVBA 3A88A 2AGIX 4CHAB 1C5MD 1XVMA 2TGAA 1V2OT 2BDAA 1H8DH 1JRTA 2FDAA 3FKSD 4B71A 3H09A 1SLWB 3MU5A 3VXEH 1LKBA 2BVRH 3OAAD 1P2IA 1VITG 1ESTA 3PWBA 1GI5A 2XWBI 2W7SA 1SGTA 1W14U 5A0AE 1A46H 1GJ8B 4ZHLU 1IQIA 1DSUA 2A5IA 1Z8IB 4WMFA 1E0FD 5JB9S 2CF9H 1ETRH 2ZZUH 4AC9A 1VITF 4ISOA 3PLKA 2P3TB 1O2IA 1QBNA 2VVUA 3Q00A 3UOPA 1BT7A 1TNGA 1W0ZU 4X2XA 1O3MA 5E2PA 2IN2A 1GI7B 4XSKU 2XOKD 4NFEA 1G9IE 3HGPA 4DOQA 1D6WA 1QBVH 5FBIA 1LO6A 1O2QA 3U1IB 1TNHA 1PPCE 3BTHE 4THNH 2XRCA 2BD7A 3E1XB 3QWCH 5L30H 3SU6A 3HK3B 1MU8B 1WDIA 1E1RD 1WU1A 1TBZH 5EXMA 1FNIA 1WTGH 1QL9A 4E05H 3KNXA 5K0HA 4JYVH 4D7FA 2AH4X 2QXGA 1GI2A 4X0WU 4FXGH 2NWNA 1O2WA 3ODDA 5F53A 2P59A 3P8FA 4MTBA 4I8GA 1C5SA 1W2KH 2ZGCA 4FUBA 1WYKA 1DT2A 1GBDA 4CH2B 1AUTC 5CHBA 3TIUA 5AFYH 1NRQH 3KQ5A 2QXHA 5HM9A 1GL1A 2ASUB 2O8MA 1IQEA 1C2GA 5F03A 2WUCA 5A0CA 1AE8H 4HGCA 3S9AA 4Z0KA 3A82A 5C1YA 2HWLB 3DD2H 1SVPA 1GHAG 4BAOB 2ZU3A 3NZIA 4CREA 3E90B 1QR3E 2XBXA 3QUMP 3I77A 1YC0A 1DWDH 2VWNA 4AYYB 2Z9IA 1C2HA 3RXOA 1K1PA 1GHAF 1EPTC 1KTSB 1B5GH 1GBEA 1DXWA 1ZZZA 2ZIQH 4OS1A 1OWEA 1HAHH 2YMSC 1HRTH 1RIWB 1TPSA 3LJOA 3D65E 1GMCG 1BOQA 3SNCA 4P00A 3LGYA 5F8TA 1K1LA 3QZQA 3RC5A 2B7DH 1LPGB 1SGYE 1O2MA 2R0LA 1EPTB 3GY2A 1MUEB 1DOJA 4ABFA 2C8XB 5FXLA 1MBMA 1GMCF 3SYJA 1JRSA 2YMSB 2RFKC 2NU1E 1S82A 2HGTH 5JBAS 2BD4A 1SLXB 3RLWH 2XC4A 1O3JA 3GY5A 3FP8E 2A4GA 1SGIB 5F6MA 5L2ZH 2ZQ1A 1W10U 1GMDF 3LDXH 2AYWA 4NIWA 3H5CB 1NFYA 2V3OH 1DICA 4J1YA 2I6QA 1FN8A 2OQUA 5GIBA 4O97A 3GY6A 2W26A 1GBBA 1GJAB 2A45B 4KKDA 5GJ4B 3TH2H 3ZYDA 3ZVAA 1P2JA 1Z6JH 2OD3B 2WPIS 2KM0A 2VJ1A 4ABAA 3VG8A 1P3CA 3ZZ3A 2BLQA 1KXDA 2OC1A 2BDGA 1VGCC 1QB6A 2AFQB 1SQRA 2GTBA 2TBSA 4JZIA 2A7HA 1GDUA 2PTNA 2OQ5A 4A5TS 1O2OA 1BBRH 1YM0A 1A0JA 1MCTA 3U98H 1SC8U 2JETB 1NFUA 2ZHWH 3M5NA 1LHDH 1GJ6A 3TLOA 3BTKE 1SOZA 2JJ2D 3OEHD 3RXPA 1HGTH 1EAWA 2HPQH 1K1OA 2ZQ2A 1F5KU 2AHME 2WPMS 4CRAA 1BJUA 2P95A 1ZTLA 1P0SH 2JH5D 2K8IA 2BB4A 2CGAA 3KYFA 2BD5A 5C1UA 1BITA 3MMGA 3EA8A 2H1UA 4TWWA 1C1MA 4FUJA 3DUXH 1QL8A 2Y81A 3GS9A 2KZ4A 3SUEA 5EJZA 1ANEA 4LXBH 1C5TA 1MTVA 3SORA 1FAXA 2G5NA 4WXIA 4X2VA 1BRAA 4FVBA 2NU2E 3T28A 4AX9H 1QL7A 2R3YA 4YOJA 1GVKB 2VVCA 1SMFE 2LPRA 4H6SB 4IC6A 1LPZB 4MNXA 1O3EA 5JB8S 1BCUH 3E8LA 2JJ1D 1ZYOA 3LGUA 3TK6A 1QFKH 4TYDA 2PTCE 3OTPA 2ZGXH 3P8NA 2BM2A 1TX7A 3GOVB 1J16A 2VIOA 3SHCH 3SNDA 3SJIA 2BVSH 4TPYA 1RD3B 3RXHA 3PO1C 2FYRA 3KF2A 2QF0A 1QRXA 1C9PA 4FVDA 2BD2A 4MLFB 4HZHA 3WW7A 1J9CH 4NFFA 3E6PH 4X8SH 3V12A 2RDEA 2H9TH 5CE1A 1MTUA 1QY6A 4XFQA 2HVXA 5TJXA 1FX0B 1IHTH 1EJAA 1UHBB 4DIIH 1BTUA 1C2DA 1C4U2 2GT7A 3PROA 3A8CA 1EP6A 1HIAA 1SLVB 5GCHG 4LZ1H 4UEHH 2PSYA 1DLEA 3MU4A 5IDKA 1K0HA 4A92A 3ZVCA 2THFB 1GJBB 1NS3A 4LK4A 1HUTH 1TYNA 2BD9A 1ZHMA 2P3FH 2QV1A 1HAOH 1TIOA 1TMBH 1H1BA 4YOIA 3A7XA 3AW0A 4ASUD 4YT7H 1IQKA 1E35B 1ELAA 1S81A 5GCHF 8GCHG 1LDTT 3ZZDA 2A4QA 1TAWA 1SGFG 3U8OH 1PPFE 2ZDKA 3UWJH 1G2LA 1DM4B 4X8TH 2ZU1A 2BXUH 4BXWA 5SGAE 1TPOA 2FWWA 1PQ5A 5DPAA 1Y3XA 1OS8A 1A4WH 5HIZA 4Y8YA 1C2FA 4ZXXH 3VB5A 4DT4A 2SGFE 1NROH 3KGPA 1UK2A 8GCHF 1V2UT 2CN0H 2FZZA 4Y7AA 1F5LA 1CA0B 2ZHEH 1NFXA 3SJKA 4NCYA 2GVFA 3W1EA 2A1DB 4Y0ZE 1GHZA 1P06A 3RXLA 5LPEA 2Z3DA 4KTCA 4ZKSU 3UWIA 3RXRA 1HAPH 3SI3H 2FP7B 2P93A 2B0FA 3M3SA 1EZSC 4X8UH 1AB9C 1GI9B 3TPIZ 2HVYB 1GCTC 1XMNB 4JZEH 1PPHE 1NT1A 1VJAU 2BD8A 3STIA 3KQEA 1ID5H 3ZZ7A 2WSSD 4A1VA 1AMHA 2HLDD 2ZHDA 4OGXA 1O5EH 1EFRD 1IHSH 5KGOA 3SUGA 1ZPCA 4I8JA 1F92A 3ZVEA 2IPQX 1NU9A 2UWLA 6ESTA 2BD3A 1NTPA 1GCTB 4Y0YE 5AVDA 2QA9E 3TJVA 1CE5A 3ZZ5A 3IITA 3UOUA 4AG1A 1NFWA 2HNTE 1N8OC 2GCTC 4MDSA 1ZRBA 2BXTH 2PKAB 1PPEE 3MO9A 2WV9A 2M2AA 3ZYEA 4A6LA 2G51A 5C94A 2XBYA 1JMOH 3T5FH 2ZI2H 2H9HA 2QF3A 1UCYE 3RXCA 4DCDA 1KY9A 4R0IA 4MQAA 3ZZAA 4BAQB 1S6FA 4ISIH 1LTOA 2AIPA 2LNCA 3N7EA 1D9IA 2W5EA 1HPGA 5DP8A 3VGCC 4WMDA 1SFQB 4BAHB 3QTOH 4YOGA 5EQSA 2JH0D 1IQGA 2AIQA 4F48B 1C2MA 1GHVH 1C5UA 2SGDE 4WJG2 1MKWK 4FU9A 2EA3A 4XD7D 1O2LA 2OBQA 1ZPBA 2C8WB 2PLXA 3ITIA 5EQRA 2VINA 4Q80A 1OSSA 2G55A 4K1EA 1C5XB 1QZ8A 1BTXA 2J2UA 1TBRH 5BPEA 3U1JB 4R8TB 1LVOA 3A84A 1V2VT 2RCEA 4ABEA 2KAIA 1O30A 5I46H 3FVFB 3Q77A 3RXFA 1EP5A 4NWLA 1EJNA 3MNBA 1S6LA 1THRH 3A7YA 3RDZA 3AAUA 1G3DA 1WBGB 3OU0A 4MPXA 1HJ9A 1O5AB 1VCQA 1NBME 1RFNA 4IGDA 4IMQA 3T2NA 3LH3A 1WSSH 3ENSB 1EZXC 1SI5H 2PR3A 1KXEA 3QK1A 1WQVH 3ATKA 3LU9B 4D9QA 4VGCC 1GBKA 1O5DH 2ZDNA 4B6EA 3ESTA 3PMJA 2B9LA 2RA3A 1FPCH 1O3HA 4E7RG 4M9FA 3F1SB 4SGBE 3BTGE 3W94A 1KIGH 2FOAA 1O35A 2RDLA 5GPIB 3LONA 4UFFH 1V6DA 2FO9A 2Y5GA 3SU0A 5CDFE 2YOLA 1T7CA 3WWBA 2J98A 1S6HA 1LCYA 2FXRA 2P8OB 2TGDA 2TIOA 4I8KA 5GDSH 2ZTYA 4JYTA 4XBDA 4D7GA 2G4TA 5I25A 1S84A 1SQOA 1UTKA 3LGTA 2H9EH 1FAKH 2FX4A 2V7QD 1K1MA 2FMJA 1N1LA 2KR7A 2ZU5A 3MYWA 3PYHA 2GX4A 1QQ4A 1Z8GA 2GCHG 2BTCE 1PYTD 3VB3A 1O0DH 1O3GA 1RS0A 1AGJA 3TJUA 2Z9JA 3OEED 1V2MT 3SV7A 5EPNA 3L6PA 1L1NA 5DSFA 1MU6B 4ZUHA 1K1JA 1YF4A 3KYGA 2GCHF 1XUFA 3V13A 1XKAC 2FESH 1K21H 4GAWA 1DUEA 1G37A 1MZAA 1C1OA 1QGFA 3UQOA 1KTTB 1S83A 3MTYA 1C5WB 4MPWA 1J14A 1LPKB 5BRRE 2CJIA 7ESTE 3LT3A 3LC5A 2FM2A 2J97A 4Q7ZA 2HALA 8KME2 1O3DA 2PFEA 1W13U 4TPIZ 3RXDA 2Q6DA 2VGCB 1H4WA 1D3DB 4X6PA 4YZUA 1FJSA 1GL0E 2EY4C 3SNAA 1WCZA 5A2MH 5LPFA 1O2NA 2O8TA 3EA9A 4UE7H 2M5TA 5LH8A 2J9NA 1LHCH 5J4QA 1AQ7A 1HV7A 2Q6FA 1UO6A 1XKBC 4X6MA 3RC6A 1JOUB 5T6DA 3TK9A 4HI3A 1A61H 2W7UA 1EOLA 1P03A 2SGPE 4KTSA 4B1TA 3F0PA 2ODQA 1LQDB 3B9FH 2XW9A 3KIDU 2SGAA 1GI0A 1NRNH 1XUKA 1SQTA 2EC9H 2ZHQH 1EQ9A 4CHAC 3M5LA 5FCKA 2KCPA 3ZZ6A 4RT0A 1F5RA 3M5MA 3TH4H 1YLNA 1SLUB 4I33A 1O3BA 5JDUB 1B0FA 1OKXA 4GPGA 3VB6A 4Y11E 2PWXA 2Z3CA 3CS0A 3M7TA 2W3IA 3RXIA 1O2XA 6GCHF 5C67A 5DJ7A 1ETSH 4Y79A 2HRVA 5FPSA 4Q2KA 2SNWA 1NO9H 5EW2H 1OP2A 4AFUA 1O39A 2R3UA 1GBJA 2DUCA 3KN2A 4UFDH 5EU8A 3LIWA 3TNTA 1FN6A 4HTCH 1HBTH 4FUGA 2QXIA 2AMDA 3LPRA 3SJ9A 2WPJS 1BTZA 2SFAA 1SGPE 1FZZA 3ZVDA 1OYQA 2ZEBA 4ZHMU 2CF8H 3BTFE 2BY7X 1SFIA 3A83A 1W0JD 1Z7KA 1ZTJA 3UR9A 1WXRA 3EAJA 2BOKA 2KCAA 3STJA 1S0QA 5EPYA 3RUOA 2Y6TA 1T8OA 1OP8A 2TRMA 1C5PA 3OY5U 1O2UA 3QN7A 4IBLH 1A0LA 3GDUA 2UUFB 2F9PA 3BEFB 3PB1E 4NA9H 1ELBA 3WY8A 2GKVE 4ABHA 1BQYA 3DA9B 1JBUH 1O5GH 2AGEX 1AO5A 2V6NA 2O8LA 4BAMB 4E06H 2Y7XA 2YNBA 2DE9A 2ZG0H 1MCVA 5HMAA 1UMAH 1KDQA 2BQ6B 4YXWD 1HAYB 1P04A 5ETXA 2CHAB 4ACAA 3BEIB 2QY0B 2ANWA 2BHGA 2FOCA 4AB9A 3ZZ4A 1IQFA 3Q76A 3UREA 2FTLE 1WUNH 4OS2A 2WHXA 1IOEA 1O31A 1HJ8A 5DP6A 1AE5A 1GMHG 4BTTB 3FANA 1VR1H 2ODYB 3RLYH 2WPDD 1AFQC 3FN8A 3ZV8A 4AG2A 3ZIAD 4K8YA 1THPB 2FS8A 1Z71A 2BDYA 4B6FA 1BDAA 2GT8A 2HLCA 4ABIA 3SU3A 5A8YA 3QGJA 2PKSC 1G30B 1UK3A 1INCA 4IN1A 1P2QA 2VVVA 4BXSA 1GMHF 1C1TA 4PROA 3R3GB 4BANB 1P05A 4BTIB 1C5QA 5C5NA 2C90B 1C5VA 1XVOA 5K7RA 6LPRA 3PWCA 2C8ZB 2H5CA 1AFQB 2VNTA 1YP9A 1H8ED 2Y5HA 3NUMA 1ZTKA 2ZGBH 3S9BA 2ALPA 1FQ3A 2ZCLP 4XDEA 2PKSB 1RIWC 1WV7H 3FP7E 4F55A 2ZDVH 1P2KA 1DUAA 4FUCA 3ELAH 1O2PA 3I29A 4GVUA 2PHBA 4U32A 1E79D 1OWIA 2AERH 2PSXA 2SNVA 3A81A 4U2WA 3TJNA 2EQNA 2HOBA 2G81E 3AASA 3UPEA 2W6ID 4JMYA 2FLBH 1G3EA 2BQWB 5A09A 2ZFFH 1ELTA 5FCRA 4GHQA 1AY6H 1GG6B 1YBWA 2QGRA 1TGTA 8ESTE 1QA0A 1GMDG 1QCPA 5EIYA 3PMAB 2XBWA 2AEIH 3S9CA 3A7WA 1SGNE 5EJLA 2GJGA 3SN8A 1TRMA 2VU8E 2P94A 1T8MA 3BV9B 4X1RU 5HGGA 3SHAH 1EZUC 1O36A 4WXVA 1XM1A 3PV5A 1QB1A 2GZ8A 4WH8A 4UFGH 1CT0E 1C1NA 3K9XB 2VWMA 4ZCNA 2QF5A 3ZZBA 3PRDA 4ZH8A 3SGBE 1CQQA 2A5AA 1HIAB 1ELFA 1NC6A 4FU7A 1JXPA 3C1KA 1TNLA 1E38B 3OY6U 1GI6A 1L1JA 1GVZA 1TGCA 1TLDA 2A4RA 2XYAA 1C2KA 2J94A 2OLGA 2JETC 3TGJE 1Z1JA 5CHAC 4KTUA 1GPZA 4ISNA 1MD7A 2AMQA 4NA8A 4ACBA 4YLQH 2ZPRA 1GHWH 2FIRH 2Z7FE 3P95A 3SQHE 1GHXH 2Q6GA 2J95A 4NGAH 1P11E 3D49H 1K22H 1SG8B 2D1JA 2KX4A 1X7AC 4Y6DA 4X1PU 1ZSJA 3M36A 4Q7YA 1O3NA 3GYLB 5CHAB 1EUFA 1C5RA 1UTMA
chains in the Genus database with same CATH topology
4IW4E 3VPKA 1C5ZB 4ABGA 1O2RA 5GWZA 1BUIA 5LPRA 1V2QT 2QIQA 4Q7XA 3P70B 4ASHA 1AN1E 2PGBB 1UCYH 1LHEH 1ZLRA 5FBEA 1C2JA 5FAHA 4X2WA 1D3QB 1GJ4H 2ZU2A 1FY3A 3E0PB 1YKTA 2R9PA 3BTDE 3Q3KA 1YPHC 4GCHF 3RM0H 3T29A 3UY9A 3ZV9A 2WUBA 2ZGHA 3HKIB 1EXFA 1FY4A 3QGNB 1EASA 1ACBE 3NCLA 4CR5A 1BHXB 1C2IA 1Q3XA 1TNIA 3PTBA 4F49A 7GCHG 2TGTA 3MU1A 3CP7A 3IG6B 5J4SA 1O2ZA 3A8BA 1C9TA 3OYPA 2Y7ZA 3A7VA 2XCNA 1QTFA 1DS2E 1ANBA 5FX6A 4B73A 2WINI 5PTPA 1AZZA 1T31A 2BLVA 7GCHF 1OYTH 2VH6A 1M9UA 4ZXYH 2ALVA 4OS7A 5TCCA 3GY3A 1BTYA 2UWOA 1MTNC 3PMBB 1Z8RA 1MTSA 1D3TB 4MVNA 1PPGE 4K5ZA 2BX3A 1DFPA 1HB0B 1VCPA 1GI3A 4CRGA 2Q1JA 1XXFA 1EPTA 4TWYA 4H4FA 1FPHH 3PTNA 2GDDA 1ESBA 1ARBA 1Y3YA 3LGVA 1OWDA 1IQJA 1GBAA 1HXEH 4IMZA 4AN7A 1MTNB 3GDVA 2D2DA 1H9IE 1ELCA 1V2LT 2C3SA 4B76A 1CA0C 3URCA 3ZVFA 4A1TA 8LPRA 3TVJB 1D4PB 1QRZA 1UTPA 4B2BA 1IAUA 4MNWA 1FY5A 2KAIB 1BB0B 1HYLA 3GY8A 3P6ZB 1ELEE 1SGCA 1CHOG 1UK4A 3KQBA 1FUJA 1AFEH 1A5HA 4O3TA 2FODA 4K1TA 5JBCS 1UTJA 3GICB 4HFPB 1NPMA 1A3BH 5C2ZA 4NZLA 1ZSKA 2C8YB 2ESTE 1H9HE 4DIHH 1TB6H 5EOKA 1CHOF 4I8LA 4JZ1A 1JIMA 3M7UA 4M7GA 3TGKE 4B2AA 4SGAE 2OC0A 5T6GA 4GLYA 1V2NT 1HAZB 1TMTH 1SGFA 2ZFSA 3LOXA 4H42U 4CH8B 3OTJE 2IOTA 3RXKA 2TPIZ 1MMJN 2ZECA 3SU1A 2UUKB 1C4V2 3M35A 4ESTE 1AKSA 2WYGA 1Z6EA 1QURH 4CRFA 1WQSA 3MO3A 1TA2A 1BBRK 1WAYB 4ZKNU 3AAVA 3BG4C 2D26C 1Y3VA 1BRCE 4K1SA 4CRDA 2P3UB 2FTMA 3BTWE 4ZROA 2J4IA 3VB7A 3RXUA 3TJOA 4BTUB 1C1SA 1K9OE 1C5LH 1J15A 5DK1A 1K1IA 2AMPA 5EQQA 3IWMA 1F0UA 1DY8A 1KLIH 1BTWA 2XC0A 1SHYA 1FY1A 1UCYK 1UTOA 3R0FA 3BG4B 1MZDA 1ETTH 3H7TA 1P09A 1K2I1 2ILNA 3BIUH 3UTUH 1DITH 1AD8H 3URDA 2I6SA 2F9NA 1DE7H 1O3LA 2ULLA 1O2VA 1GBMA 1TRYA 3RXEA 1GBTA 1Y8TA 1J17T 3P92A 1BZXE 2A31A 1PJPA 5E2OA 3LKWA 2WYJA 1BTHH 3ZZ8A 3EA7A 2ZDAH 1TONA 1G32B 5E0HA 3BTME 1QQUA 2RG3A 1E36B 1G3BA 1GI4A 3P8GA 2EI8A 1EAIA 2AS9A 4O9VA 3BTTE 1QBOA 1TX8A 3GCHC 1ZMJA 1A7SA 3F68H 1O33A 1L0ZA 2G52A 1CO7E 1V2TT 2PUXB 1O3IA 1AVXA 1T8NA 1UVTH 4DY7B 1L2EA 2GD4B 4AB8A 2Y82A 3UNRA 1DX5M 3O8CA 3A7ZA 4Y76A 3RXJA 1GBLA 1MAXA 1RJXB 3B23B 2STBE 2Y80A 3GCHB 5FX5A 1UVUH 4DG4A 1TNKA 3GDSA 4AYVB 1A5GH 1KYNA 1TQ0B 3BTQE 3QLPH 2BYAX 1O5FH 1P2OA 3A86A 4NSYA 1DLKB 1SGRE 4DGJA 1FMGA 2FI4E 3MH6A 1GJ5H 1V2KT 4ZKOU 1TQ7B 1YLCA 3M7QA 2P8OC 2PW8H 2ZDLA 1XXDA 3D23A 5DP4A 5JYIA 3SV6A 1RGQA 2ANYA 2ZF0H 2WPHS 3F9HA 3GYMA 5ESTE 1LHGH 3SOSA 1F7ZA 2PUQH 4FUIA 1HFDA 2G00A 4X2YA 3RMLH 4O3UA 2FOBA 2V3HH 1DWEH 2UWPA 3EE0B 3U69H 1VITH 1UVSH 4D76A 4RN6A 1QB9A 1O37A 1OWKA 4INKA 1QRWA 3V0XA 2EI7A 2ZFTA 1RTLA 1OOKB 1IQHA 1O2KA 1V2RT 1CGJE 3M5OA 1IQNA 3T25A 2ZFRH 1F0TA 2F9UA 2BZ6H 1AIXH 4ISLA 4ZAEA 3RMMH 1GDQA 1O3OA 2ZA5A 1OWHA 3PM3A 3TNSA 1QNJA 1XUHA 4Y8ZA 1W11U 2VGCC 2VB0A 1BMAA 2BQ7B 4CRCA 2H2ZA 4I8HA 5EXLA 5FHTA 2OINA 1HAVA 3ZZ9A 3DFLA 4RSPA 2OBOA 2WPLS 3FZDA 4Y7BA 1DSTA 5T3HA 2BOHB 1W7GH 1ZGVA 1T4VH 1LQEA 4F4OC 2GZ7A 1TNJA 1KDQB 2J34A 3EDXB 3LH1A 1J8AA 1YPGH 5ABWA 5DO4H 1B7XB 2O8UA 4AZ2B 4A7IB 1G2MA 1W12U 3BG8A 3UR6A 1UVPA 3FAOA 3SQEE 4JZDH 1GJ7B 1P57B 3VB4A 2CXVA 5T6FA 3RXTA 4U01A 2V35A 3TITA 2VWLA 3K6ZA 4INHA 2FOFA 3BN9A 2QCYA 1ZGIA 4NG9H 4MPUA 1ZJDA 1NM6A 4UFEH 2CMYA 2EI6A 1P12E 1Y3UA 1TA6A 1EZQA 1OP0A 2OXSA 6GCHG 5F8ZA 2SGEE 1O3PB 3NKKA 1C4Y2 1S0RA 2PGQB 4UONA 1NRSH 1O2YA 1EAUA 1RTKA 2ZO3H 1O3CA 1ZR0A 5DGJA 3SZNA 2D8WA 1YPLH 1K1NA 1MAYA 4FU8A 1FXYA 3GISB 2J92A 2IPHA 1W3CA 1PQ8A 4Y8XA 3KQCA 1QJ7B 1YCPH 4X1QU 4Z6AH 4BOHA 3C27B 2BDIA 3JZ2B 1ANDA 1YLDA 4ABJA 1UTLM 1EB2A 1NESE 1TGBA 3SU4A 4K3JA 3O8BA 1S85A 3MWIU 3UUZA 1OPHB 5HXFA 1BMMH 1HAXB 3M61U 1MTWA 3QTVH 1GJDB 3ATIA 4ZKRU 1MBQA 5A8XA 4BNRA 2B8OH 5HM2A 1MKXH 2ZC9H 1A3EH 3G01A 3HPTB 2VIVA 3SV8A 1SBWA 1UTNA 4X1NU 4O03A 4GUXA 2CHAC 2F3CE 4K8BA 4X8VH 4NIVA 4YO9A 1JWTA 2XXLA 1V2ST 3SBKA 2SGQE 1CBWB 4TY6A 3A87A 5EXNA 4MNYA 3KCGH 2H6MA 3AW1A 1PFXC 4YESB 1FIWA 3QZRA 4YM9A 2BX4A 3SUFA 3RXGA 3E91A 1GBIA 4FUDA 3HK6B 2A4OA 1AUJA 4YLUA 1DWCH 3ATWA 4ZMAH 3RU4D 2EEKA 2ZCHP 5GXPA 4I32A 1TOMH 4DW2U 2ZCKP 2C4FH 1CT2E 3A80A 4WMEA 1C5YB 3PLBA 2BDHA 3BTEE 1GI1A 5C5OA 2Y5FA 4MNVA 1SSXA 3FZZA 1VJ9U 3F9EA 1A2CH 4UD9H 3MU0A 3P8OA 1CVWH 3ATLA 1V2JT 3MI4A 1VCWA 4D9RA 5EG4A 1TGSZ 3MNXA 5DG6A 3VXFH 5EW1H 1T32A 1FY8E 1NRPH 5F8XA 2BLWA 1C1WH 3SO3A 4LZ4B 2G4UA 3MOCA 1ELDE 1GGDC 2WPKS 3K2UA 2A5KA 2BZAA 3LGWA 4BAKB 3RXSA 5C20A 3PV4A 3EYDA 1BTPA 1UJ1A 4YTAA 1EKBB 5DP3A 2QAAA 1TE0A 1GG6C 3PMHB 3T27A 1KXFA 5JBBS 1Y3WA 1P9SA 4K69A 1GGDB 3S0NA 1SGDE 1ZRKA 1TOCB 2BY8X 1DDJA 2ANKH 1FI8A 2FX6A 5LGOA 3LC3A 1O2JA 5EGMA 5L2YH 1O2HA 5JPMH 3U9AH 1NZQH 1BRUP 2GV6A 4RKJB 5ESBA 2A0QB 2K1QA 1RTFB 2AGGX 1QIXB 2BVXH 1BA8B 1XUIA 2VIQA 1OXGA 4AGKA 2ZTXA 1DPOA 2VIPA 3SGAE 1LVMA 4MPVA 2O8WA 4UDWH 4NSVA 3W95A 3ATMA 1F0RA 4WVPE 1C1QA 1V2PT 1L4ZA 1YCPK 1WTHD 3B8JA 1ESAA 2FOMB 1XUJA 2VIDA 1EB1H 3T62A 5FPTA 3UFAA 1HAGE 3M3TA 3O8DA 4NIYA 1Q2WA 1ABIH 2FLRH 3SW2B 1NRRH 1SB1H 3DT0H 1AHTH 1SQAA 3O8RA 3A8AA 1MKXK 2BMGB 1E34B 3NWUA 1EX3A 1F2SE 1TFXA 1XX9A 2CV3A 3BF6H 1Q31A 2OTVA 5C3NA 3S7KB 2BDCA 1W8BH 2QYIA 3F9FA 3SU5A 2QC2A 1GJ9B 3NPSA 1LMWB 3MH4A 1L1GA 1Y5BT 2GMTC 1NN6A 2HPPH 3RU4T 1TX6A 2FEQH 4OS6A 1SGQE 4FUHA 4GCHG 3KQDA 4B74A 1AU8A 1W7XH 1PQ7A 1P8VC 4CBOA 1O2TA 1D3PB 1GJCB 4OS5A 1VGCB 2GMTB 2FOGA 1ZHPA 1AKSB 2STAE 1PYTC 1TALA 5EODA 1FV9A 3L33A 2HNTC 5A8ZA 4Y71A 3K6YA 4XE4A 4KELA 3P17H 4AGJA 1C5NH 3AVZA 1G36A 1GI8B 4TY7A 5G4BA 1P01A 2ZPSA 3SNBA 1A1RA 2ZDMA 1IQMA 3RXBA 1MD8A 3NXPA 1DVAH 1O38A 1ABJH 1TRNA 5CMXH 2TGPZ 2R2WU 2GV7A 1BRBE 1O5BB 3SNEA 4K60A 2YNAA 1SPJA 2A2XH 1Y5UT 1AZ8A 2BY6X 1P9UA 1MQ6A 2JH6D 2R0KA 1RRKA 3SUDA 2ZNKH 1GHBG 1MKWH 1CGHA 1THSH 3SJOA 1CT4E 3PLPA 1QA7A 2XCFA 1EJMA 2OP9A 4JYUH 1V3XA 1BIOA 3JZ1B 3TGIE 1CGIE 2F9VA 1G3CA 4AFQA 2J38A 1LHFH 3MNSA 2FI3E 3OX7U 1BJVA 3UNSA 4XOJA 1GHBF 2XNIA 3KHVA 1GBCA 1KLJH 1P02A 2OCVB 1IQLA 1T8LA 1CSOE 1T4UH 1FONA 1SR5C 4WH6A 6CHAC 3MFJA 3E3TA 1MQ5A 1SOTA 2PV9B 4JK5A 3PO1B 3A7TA 2XTTB 2OC7A 2FI5E 4AOQA 4ISHH 1ORFA 4IN2A 2NU4E 4U30A 1O3KA 3A8DA 4H6TA 1EATA 4WF8A 4I31A 6CHAB 2Z3EA 1BMNH 2O9QA 1A0HB 1QJ1B 1YPJH 4MG3A 1P2NA 1UVOA 2Z9LA 4YT6H 5DP7A 3SJ8A 1A5IA 2ZKSA 1PQAA 2F9OA 1ZJKA 5FPYA 3MHWU 1ZMNA 4JCNA 2Z94A 3RXMA 1ELGA 2UUYA 1GVLA 3ZVBA 1HLTH 5AHGH 1KXCA 4E7NA 5IYTA 3SV9A 3S69A 1CA8B 3QX5H 2ODPA 3RXQA 3SI4H 1O34A 2BY9X 4B75A 2Z6BD 3ZVGA 3F9GA 1VZQH 1CU1A 5A0BA 3E0NB 1BMLA 1GHYH 3GY7A 1LKAA 1H9LB 2BDBA 2FYQA 4DURA 2G5VA 3RM2H 1SL3A 3TU7H 5HYOA 9ESTA 3S7HB 1YPMH 1BHXF 4ABDA 1QHRB 1GWAA 5E8EH 2OC8A 4FUFA 5H4IB 3M3VA 4WY3A 5DP5A 2XWAA 2A32A 2F83A 1DANH 2HNTF 7KMEH 3VEQB 3H7OA 1C1UH 4CBNA 3A89A 1BBRE 1YCPM 1AB9B 4DT7B 3MNCA 1KXAA 2FOEA 4KP0A 3HGNA 2DE8A 1TBQH 3K65B 1YPHE 4DVAU 4XBBA 1O3FA 1XUGA 1DY9A 2Z9KA 3RXAA 2ZU4A 4X6OA 1Z8JB 1P2MA 1HAVB 3KL6A 3GCOA 3U8TH 1UHBA 2P16A 3Q3YA 1C1RA 2GZ9A 3FP6E 3FFGA 1EAXA 4KGAA 2G8TA 3E16B 1NU7B 2ZWLH 1N8OB 2GCTB 1C1VH 1ELVA 2Z9GA 1WOFA 4J2YB 3L3TA 4GSOA 5B6OA 3GCNA 1N6YA 1QJ6B 2ZFQH 3I78A 3RMOH 5JBTA 1N6XA 1SGEE 1Y5AT 1PPBH 2ZGJA 3N7OA 2A7JA 1O2GH 1YGCH 2R2MB 1HAIH 5E0JA 2WV5A 5DP9A 3HATH 1S5SA 3VGCB 3ZZCA 1C1PA 4Y10E 1AVGH 1TGNA 3KEEA 4NIXA 2IJOB 4AFZA 4NWKA 4RKOB 5AFZH 3UQVA 1C2EA 2NU0E 3M37A 2JKHA 3BSQA 1O5CB 1YPEH 3QDZB 4AFSA 3Q3XA 4DJZB 5C1XA 3MH5A 3U8RH 1TABE 1CHGA 2ZPQA 1C2LA 1KXBA 1KSNA 4CR9A 3HKJB 2FOHA 1Y59T 2XBVA 4B2CA 3MU8A 2BY5X 3UIRA 1ZMLA 1H8IH 7LPRA 2ZFPH 1F0SA 1W0YH 1HXFH 1E37B 2F9BH 1OX1A 2VWOA 3VFEA 4INLA 5AF9H 4FUEA 4IC5A 3LGIA 1D6RA 3V7TA 4NA7A 2NU3E 3ODFA 4VGCB 1HJAC 3D62A 1AWHB 1ZHRA 1MH0A 3SV2H 3LJJA 4A1XA 2VH0A 4D8NA 3V3MA 2A7CA 5DKMA 1SHHB 1HDTH 1LVYA 3OSYA 1K28D 3TH3H 4XBCA 2ZHFH 3RP2A 3MH7A 1U6QA 1DXPA 1FDPA 1FIZA 2PKAA 3UNQA 1HJAB 3DFJA 4OGYA 2VIWA 2GDEH 1TPPA 2V0BA 4I7YH 3SGQE 1TPAE 4GHTA 1GBFA 4IS5A 3TK5A 2GGVB 1ZPZA 1L4DA 3GCTG 1O32A 2F91A 1ARCA 1V2WT 3RU4E 1TMUH 3QO6A 3T26A 1NY22 1AI8H 1GCDA 2ZP0H 4ABBA 1EOJA 3A85A 4K2YA 4QT8C 3F6UH 1ANCA 1YYY1 1RXPA 3GCTF 4LOYH 2BLOA 3MO6A 3CENA 3BIVH