2O8TA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q) in complex with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
231
Chain Sequence
IIGGEFTTIENQPWFAAIYRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase plasminogen activator
total genus 52
structure length 231
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA01
2HALA 3CS0A 3UFAA 1A61H 1GG6C 4KTUA 3PYHA 1O37A 1D3QB 1MKWH 1HAYB 1FIWA 2UWLA 1CA8B 1Q2WA 1GHBF 1O2PA 4E05H 2VWOA 1RTLA 3V12A 3ZZ8A 1LTOA 2TGPZ 2ANYA 1KXEA 5FCRA 3V13A 1O5GH 2HPQH 4IC6A 3A87A 3M5NA 3GY2A 2FZZA 3CP7A 1KLJH 1NFXA 1C2LA 4AFUA 4NIYA 4JK6A 4KP0A 3Q00A 4JYVH 3TNTA 5DP5A 2ZF0H 3MU5A 1XVOA 1AKSA 4YOIA 2AGGX 1O2WA 2ZFFH 1ELFA 5FX5A 1O31A 3U9AH 1C5UA 1C5SA 2FDAA 3GY6A 2BYAX 1O32A 2FOEA 1W3CA 3KF2A 4MNXA 1OWDA 1IQHA 3PV4A 1HNEE 3RXPA 3RXEA 2IJOB 2W26A 1THRH 4KELA 1WBGB 1TNKA 1DWDH 1GI0A 1O3HA 2QGRA 1HAOH 1B0EA 1G2LA 3ENSB 4INLA 3SGBE 1BUIA 2GDDA 2NU0E 4NFEA 4CRBA 2FIRH 1XUJA 3K6ZA 2FEQH 5PTPA 2BLQA 1OWJA 1FY1A 3NWUA 4JZDH 1W14U 3BTKE 3I78A 1ZSLA 3QGNB 7GCHF 1ELAA 1GBCA 1C1PA 4Y8YA 1GVZA 1FY4A 3DFJA 3E0PB 4THNH 3D49H 1BJUA 4WY3A 4MDSA 3P8GA 5DK1A 4DY7B 1P10A 8GCHG 1EJNA 1Y3UA 2ZU5A 2BVXH 2LPRA 3E6PH 1Y59T 4XFQA 1TMUH 5ESTE 1MZDA 1ZPCA 4LZ4B 1RRKA 2R2MB 5AF9H 1EP6A 3RU4D 1HLTH 2Y5FA 1LHFH 2XBVA 1SGDE 1O5BB 2IPHA 2SFAA 1MU8B 2QIQA 4DT7B 1ZSJA 2Z9IA 3M37A 4MLFB 4AGKA 1C2GA 2ZEBA 1MZAA 4Z6AH 1EAXA 1W11U 2Y81A 4X6PA 1MKXK 3A89A 3SGAE 1K21H 2NU3E 3BIVH 3SBKA 3TK5A 1IHTH 1UTLM 2BQ6B 1TGTA 1QHRB 5G4BA 1K28D 4NSYA 2F9PA 1GJ9B 2FMJA 1SHHB 1RFNA 1IQNA 4NG9H 4BNRA 3FZDA 8KME2 1V2NT 1F5KU 4TYDA 1ZZZA 1A1RA 3MNCA 1C2HA 3FFGA 3SU3A 2A4QA 4I33A 3H7TA 6ESTA 1GMHG 4HI3A 4ABFA 1G3EA 1PFXC 4TWWA 4WMEA 1HB0B 2SGPE 2H9EH 3ZZ7A 1IQKA 2FOFA 1YBWA 2ZGHA 1O5DH 1INCA 1UTKA 2ZHQH 4CRFA 2ODYB 4IN2A 1VGCC 3R3GB 1AE8H 5HM2A 4UFDH 1FAXA 2OC8A 2ULLA 3OYPA 1O5CB 4JZEH 1MMJN 1MKXH 1P2KA 4KGAA 2OD3B 2B8OH 4BXWA 1JBUH 1C2EA 1F0SA 1HAXB 1D6RA 1OWHA 2AIQA 1TNGA 2CXVA 3QDZB 5EQSA 3OU0A 1MTNB 1G30B 1GBAA 1V2WT 1V2QT 1SGCA 4WMFA 1NY22 1O2KA 3A8BA 3F9GA 2J9NA 4DCDA 3LGIA 2R3UA 1QB1A 1UVTH 2OP9A 1C4V2 3DUXH 3LC5A 4AYYB 3SV2H 2B5TB 1Y5UT 1GBDA 2W3KA 1ZOMA 3JZ1B 1GI5A 1GI9B 2WUCA 2ZHDA 3MWIU 4ZKRU 3P6ZB 2FLRH 1DE7H 2HPPH 2JH6D 3OY5U 4YO9A 1PQAA 3BTHE 3PLBA 3AVZA 1IOEA 1BRUP 1L0ZA 2TGAA 1E34B 1O3CA 1SOTA 2OQ5A 2QV1A 1O2YA 1XUIA 5SGAE 1VR1H 3F9HA 3A83A 1BHXB 3T25A 2QN5T 3TNSA 3EQ0H 3GOVB 1N8OB 1TB6H 2Z9JA 1Y3VA 5JB8S 3LGTA 1ESBA 2BDHA 1SGIB 1OXGA 1G2MA 1T8MA 5AHGH 2VB0A 1SGQE 5F03A 5GXPA 4YESB 4BXSA 1FJSA 3PO1C 4AYVB 4OS1A 3RP2A 1BMLA 1HPGA 2BLWA 3NK8A 2Y6TA 3LONA 3GCOA 3MH5A 4YT7H 5GDSH 1A0HB 5A8XA 2HNTC 4D7FA 1MH0A 4AX9H 3L6PA 4IW4E 1RJXB 1DWCH 1HIAA 5GCHF 2JETB 1C5TA 3ZV8A 1A46H 3RXGA 4BOHA 1GDUA 3AW1A 1IQGA 2ZO3H 1BRBE 2P59A 3BTEE 1O3IA 3LGVA 2ZFSA 4BAKB 1EP5A 1DT2A 1P03A 1W7XH 1O2NA 3M3TA 4ZKNU 2GT8A 4AB9A 3SJOA 2EI8A 1NRRH 1SQTA 2ZQ1A 4GCHF 4OGYA 4I8HA 1SSXA 2XNIA 2VIQA 1ZR0A 1OOKB 1AE5A 3VB7A 1P2JA 1C2JA 3RXMA 1C5WB 2C8ZB 1ZHRA 4H6SB 3UQOA 1G9IE 1O3BA 3P8NA 3S7HB 4QT8C 2BMGB 5GPIB 3GY7A 1C2KA 4Y71A 2C3SA 5EODA 1TGSZ 3STJA 4ABHA 3TIUA 2DE9A 2B0FA 1PJPA 1OP0A 1HUTH 1WV7H 4ABAA 3ZZ4A 1AZZA 4Y10E 5F8ZA 1GVKB 1GJAB 3SV8A 2SGAA 4AGJA 1TPPA 1MU6B 1EJMA 5T6DA 1P11E 4GSOA 5DP3A 2WINI 2O8LA 1QRZA 4UE7H 1UCYK 2FS9A 5HM9A 2VIWA 1F5RA 1TA2A 1FV9A 3R0FA 3UUZA 4X2VA 5AVDA 3LGUA 1Y3YA 1SQOA 1LPZB 3C27B 1UJ1A 2DUCA 3RXJA 3A82A 3RXQA 1AD8H 5EQRA 3TGIE 2BDIA 1N6XA 1VITG 3MH4A 4OS5A 7LPRA 1QBNA 4CBOA 1GBLA 1BOQA 1SOZA 1EZUC 5DPAA 1S84A 2IN2A 2W7SA 1XM1A 2OC7A 3M5MA 1GBMA 3A7XA 2ZHWH 1SGYE 1E37B 1PPCE 4FUCA 1GBIA 2PKSB 1O30A 1GHVH 1QFKH 3FAOA 1K1OA 1PPZA 2HOBA 1LKAA 1HAVA 1LMWB 3B9FH 2ZCLP 4K8BA 2Q6DA 3M3VA 4RSPA 1TPAE 1GJCB 1VCQA 1XUGA 1OWIA 1O2RA 2ZIQH 2TGDA 1MTVA 3SO3A 5DP7A 2FYRA 3P17H 4B2CA 4A5TS 2ZDLA 1QA0A 3O8BA 3RMMH 1YPKH 5GWZA 1BBRE 1LHCH 1BCUH 5EPNA 1HAVB 1UTOA 2VU8E 2Z9LA 3RXFA 1C5XB 1LVBA 1S6FA 1DXPA 1KSNA 4O3TA 1P2QA 1GJ8B 1O3JA 1SLVB 1HJAC 3A85A 1BBRK 1X7AC 2A45B 1J15A 1MBQA 3DD2H 1FZZA 1O3OA 4LXBH 2ZNKH 3MYWA 1CA0C 2GD4B 1GL1A 3S0NA 1C5LH 5A0AE 1P09A 3FP6E 1J17T 1O3MA 4ABJA 2HNTE 3TU7H 1A4WH 1QR3E 2BDYA 1LCYA 3T27A 1TWXB 1NU7B 1V6DA 3I77A 3ZVCA 1BIOA 2ZC9H 5GJ4B 1TFXA 2ANKH 4ZROA 2CGAA 1UK4A 1ELCA 1XMNB 2Y7ZA 5IYTA 3S9CA 1H4WA 1AFEH 4B2AA 5FPYA 3SJ8A 1DX5M 1QJ7B 4K1SA 3ZVEA 3Q76A 2B7DH 1F5LA 2AH4X 3UR9A 3UTUH 3W94A 1TBRH 1UHBA 2ZWLH 1O38A 2BD7A 5LGOA 2VWNA 4MTBA 2ZDAH 2BDCA 1CBWC 3RMNH 3UREA 1A5GH 1GI2A 1NZQH 3U8OH 2JKHA 2ZGJA 2AMDA 3U8RH 2A7CA 2XYAA 4YLUA 3MTYA 1C5NH 4OS4A 1K1IA 3CENA 2ZECA 3HGPA 5LPRA 1WYKA 1A2CH 3PWCA 5BRRE 2P3UB 2Q1JA 3GY8A 1F0UA 2IOTA 1JRSA 3MNXA 2P8OB 3LJOA 1TALA 4YOJA 1P02A 4DURA 2BD5A 1QIXB 4WH8A 3MO3A 2QF3A 5T3HA 2C93B 1AO5A 2Z3CA 1G32B 4DGJA 1ZHMA 1P3EA 2BZAA 4TY6A 1TYNA 1C1MA 4GAWA 1BTUA 3E16B 2G00A 1GBBA 3RXDA 1AWFH 5A0CA 1YPHC 1AI8H 1Y5BT 1PPGE 2SNVA 1FAKH 4YT6H 1V3XA 1D9IA 1QTFA 5EGMA 2F83A 3LT3A 2GT7A 3KHVA 4NIWA 4ZH8A 1NRNH 3F68H 1LO6A 1SHYA 4XE4A 4FUFA 1V2JT 1OWKA 1DWBH 1W13U 1YYY1 2BLOA 3M61U 3VB5A 3K6YA 4TWYA 4AFQA 1O3EA 3RXHA 3U69H 3V7TA 5L6NH 4I8GA 1TRMA 5A2MH 4X8TH 2BVRH 1GI6A 2WPMS 4TPYA 4UDWH 4CREA 4BAQB 4MPUA 1O39A 2ZPRA 2ZKSA 2HVXA 4B1TA 1O5FH 2PWXA 1Y3WA 3MOCA 4OGXA 1GPZA 4FU7A 3ZVFA 1N8OC 2ZGCA 1FNIA 2ZI2H 1DANH 1NRQH 1P2NA 3CS7A 1KYNA 3RMLH 3SNDA 2ZHFH 3L3TA 1ZTJA 1F7ZA 1GCDA 3A81A 2A7HA 3BTFE 3RLYH 3BV9B 2GDEH 5T6FA 1CO7E 1KDQB 2GV7A 3BTWE 3BTQE 1S85A 1O35A 3PM3A 5F8TA 1T8OA 1EAWA 1XUFA 2SGFE 3HATH 4X0WU 1V2LT 3MU4A 2PFEA 1SGNE 3RXSA 4NSVA 1MCTA 5DJ7A 5CHAC 1UVOA 3SN8A 2WPHS 3T26A 1AUJA 2GMTB 4XBDA 1SC8U 1BB0B 3KEEA 1T8LA 2XTTB 2OXSA 2OCVB 1P8VC 1RS0A 2V0BA 1XKAC 2FI3E 1CT2E 2UWOA 2BY5X 3BTTE 1GJ5H 4R8TB 1NRPH 1YC0A 2EA3A 3S7KB 4X2YA 1GI3A 2EI7A 4Y0YE 4I32A 1GMDG 1K2I1 3I29A 4CR5A 2P95A 3TH2H 1D6WA 2BY9X 1O3FA 4NIVA 1GHWH 1PPFE 5GIBA 4CRGA 1MD7A 2PKSC 2QA9E 4KKDA 2ZFPH 4VGCB 1K1PA 1HAPH 2FOHA 1LHDH 3ATLA 5GCHG 1IQJA 2ZGBH 4XOJA 9LPRA 2Y7XA 1EXFA 1DUAA 1DS2E 1KXCA 2FI5E 2BM2A 2Q6FA 1ZYOA 3TGKE 5EPYA 3SUDA 1P04A 4DG4A 4Q7ZA 2WYGA 2PGBB 2ALPA 4F4OC 1GBHA 1UVSH 2H5DA 1EPTA 1FMGA 4NA8A 1LDTT 4E7RG 3UQVA 1AFQC 1QGFA 3FP7E 2BXTH 4GUXA 3PLKA 1V2MT 1UTJA 2QXIA 1GCTB 2AIPA 3RXRA 2Z3DA 4MVNA 1P9UA 1P05A 2ZCKP 4MNWA 1HCGA 2ZG0H 1DICA 3URCA 4B74A 4ABDA 1HV7A 3E1XB 2ZTYA 3RLWH 2PTCE 1WU1A 4BTTB 4FXGH 5FHTA 4MPXA 1QB9A 3UIRA 1LHGH 1UVPA 3SU5A 2VH0A 4ISHH 3E91A 4JK5A 4SGAE 1YGCH 2VVUA 4JMYA 2H1UA 5AFYH 2NWNA 4FUBA 4FUGA 1XUHA 2BDAA 1J9CH 2A4RA 3S9BA 1NESE 1YPGH 1TONA 3B23B 3SQEE 3M7TA 4NZLA 3T29A 1EZXC 1C9TA 1O2HA 1UCYH 3SV9A 5EOKA 3SJ9A 4JCNA 4IBLH 2BVSH 1P2MA 2F9BH 1KY9A 1ZRBA 2GP9B 1YCPK 2RA0A 3ZVDA 4K60A 2XRCA 3E8LA 4O97A 3FZZA 2WYJA 3M36A 4ABGA 4DJZB 1WUNH 3RU4T 5L30H 3QN7A 1FN6A 1DUEA 5ABWA 2UUYA 2FM2A 1O0DH 1QBOA 2C8YB 1O34A 2TPIZ 2ZHEH 3PWBA 4XSKU 4ZAEA 1WOFA 2TIOA 1DVAH 1EAIA 2HGTH 1NO9H 2PKAB 1TMTH 4ISOA 1TBZH 1VITF 4X1SU 1BTWA 1LKBA 1O5AB 4A1TA 1JXPA 3BG4C 2TRMA 4O9VA 4ESTE 5DP6A 2ZU4A 4D7GA 1IQIA 4NA7A 1ANCA 2UUJB 2XBWA 3GYMA 2C4FH 2A5AA 1DY9A 1ZGIA 4X8UH 1SGFG 3GCHC 2W7UA 1WTHD 1V2VT 2Y82A 4WWYA 1RTKA 3B8JA 1HAZB 1C1UH 4TY7A 4YLQH 1WSSH 1K1LA 2G55A 3U98H 4E06H 5JBTA 1Y5AT 1ZSKA 2XW9A 1A5IA 1TABE 2M5TA 1O3AA 4H6TA 2FLBH 4SGBE 3RDZA 2BD4A 1CBWB 4Q7XA 4DVAU 3EAJA 1TX7A 3GDSA 1TNJA 4AOQA 1OYQA 2FO9A 1S5SA 4Q2KA 3GCTF 1UTMA 3SU0A 4B75A 1Z6JH 2O8WA 3A8DA 5LPFA 1EQ9A 1ELDE 1GHZA 7ESTE 1O3KA 2FOAA 1O3PB 4X2XA 5FCKA 1ZJDA 2XBXA 1KXFA 4ZXYH 2VGCC 3ZYDA 1AWHB 2FOMB 3D23A 1IQMA 5HMAA 3BN9A 1P06A 2FESH 1VCWA 5FAHA 3A8CA 1BA8B 1HJ9A 2CMYA 4LOYH 1Q31A 3FANA 2BHGA 3SQHE 4CHAC 1HBTH 1YKTA 2OLGA 1T8NA 4NCYA 2AFQB 4NA9H 5FBEA 3VB3A 2F9UA 5EQQA 2NU4E 1ELTA 2BD8A 3QLPH 4CR9A 2EC9H 3TJNA 4Y79A 1HAHH 2UUKB 4X8SH 1IAUA 2TBSA 1BQYA 1C1OA 1Z71A 1UTPA 2BDBA 2O8TA 2XBYA 1SGTA 1FDPA 1CGHA 5DG6A 3LGYA 4B2BA 1T31A 1W7GH 4CRAA 4Y8ZA 4UD9H 2O8MA 1EZSC 1GHXH 4OS2A 6LPRA 1P12E 2OBOA 2TGTA 1QRXA 2P16A 3TJOA 1NRSH 3HGNA 1AMHA 1PPEE 2H9HA 2BY8X 1EPTB 1O2ZA 1ZPBA 1BTXA 1HJ8A 2FXRA 1A5HA 3JZ2B 3TJVA 3HKIB 4Q80A 1H9IE 2ESTE 2BOHB 1MQ6A 3HPTB 3ODDA 1LVYA 1TIOA 3M5LA 3LIWA 3EA7A 1ZTKA 3OSYA 5CE1A 5E0HA 1MD8A 2O9QA 2W3IA 2A5KA 1M9UA 5EXNA 1E35B 2KAIA 4BAMB 3N7OA 4KTCA 1C1NA 1OP8A 5E0GA 3KQCA 1HXFH 1UVUH 3GDUA 1J14A 3LDXH 2GV6A 2WV4A 3MNBA 3SORA 4LZ1H 4ZHAA 1Y8TA 1WQVH 1LHEH 4CHAB 1NFUA 2HRVA 2ZFTA 3MH7A 3VXFH 1RXPA 3FVFB 5CMXH 4FUIA 2AGEX 1DOJA 2ZU2A 1GBFA 2CHAC 4Y0ZE 1TNHA 5CHAB 1L1JA 1C2FA 4XBCA 2QXJA 1P01A 4Y76A 5A0BA 2AMPA 4JZFH 1O2XA 2AS9A 5H4IB 1T7CA 2GCTB 3PTNA 3UOPA 3A86A 1L4ZA 2GTBA 4X6NA 3NUMA 4ZHLU 2J2UA 1P57B 1ZHPA 3RC4A 4IN1A 3LOXA 1MKWK 3A7TA 4FVDA 3STIA 3GYLB 2DE8A 2VGCB 1H8DH 3EYDA 2ZGXH 1SMFE 1J16A 1EPTC 4GLYA 2VINA 1VJ9U 1D4PB 1C4Y2 3A88A 1SG8B 4BANB 1SLUB 3K2UA 2QCYA 1H9LB 4WVPE 1HRTH 1HAIH 3E3TA 3PTBA 4MG3A 3Q3XA 2ZCHP 1OP2A 1BTYA 2QF0A 1MAXA 1T4UH 5K7RA 2FYQA 3SJIA 3QTVH 3GCHB 1BRCE 3BF6H 4AORA 3GISB 3QTOH 3SUFA 1AVWA 3K9XB 2PSXA 2ZZUH 3GY3A 3ZZAA 1DM4B 3AW0A 1RGQA 1S0RA 2FX4A 2ZP0H 1TX6A 3URDA 1AVGH 3RXVA 1FPCH 2Q6GA 2BZ6H 3ATMA 1O2GH 3P95A 3RXCA 3IG6B 3SHAH 5EXMA 1FY8E 2UWPA 4YZUA 5FPTA 3P8OA 2P3TB 2A7JA 1C2IA 2XWAA 1AN1E 1O3GA 1K1MA 2QY0B 4GPGA 5C67A 3QK1A 2A31A 3BSQA 3L33A 2P8OC 1GVLA 1EZQA 1SBWA 3C1KA 1EASA 1BMMH 1ANEA 3IWMA 4CRDA 4RKJB 2ILNA 1MBMA 3SU4A 3QO6A 2G8TA 1GDQA 2J4IA 4OS7A 1O2TA 1GJBB 2EI6A 3ITIA 4RN6A 1C2MA 1Z8RA 3DHKH 4UEHH 1QNJA 1OWEA 5LH8A 3SU1A 3KNXA 5BPEA 1ELVA 1ARBA 1TOCB 5C2ZA 3ESTA 1CHOG 1F92A 4TPIZ 2F9OA 1OX1A 1L1NA 1KTSB 2CF8H 1UO6A 1GJDB 1G3BA 1QQUA 1FQ3A 2ANMH 3RM2H 1DSTA 2BOKA 1BTZA 1A0JA 2BTCE 2J94A 3D65E 4K1TA 2R3YA 4ASHA 1QJ6B 3MH6A 3A8AA 3QGJA 3VXEH 3W95A 1TNIA 1YPJH 2Y5GA 2PHBA 1CGIE 1CHOF 1NTPA 1D3PB 3LKWA 3NXPA 4PROA 3UNSA 3KQDA 2GVFA 1B7XB 5DKMA 2V3HH 3OY6U 1QCPA 2ZTZA 2GZ8A 1EX3A 3Q3YA 4D9RA 4HTCH 3MI4A 4INHA 1TOMH 1D3DB 4HFPB 1P2OA 1AY6H 2RCEA 3BEFB 5LPEA 2GGVB 1AIXH 4YM9A 3MO9A 2WUBA 3K65B 3RC6A 5JPMH 4DW2U 2D8WA 7KMEH 3O8CA 2NU1E 3PMJA 3EA8A 1C9PA 1AQ7A 3UY9A 1TNLA 1BITA 2ALVA 1TMBH 4ZUHA 3KN2A 2CN0H 3MU1A 1FI8A 3GDVA 1SLWB 4X1NU 3AAVA 1DDJA 5EXLA 1K9OE 2QYIA 1QBVH 2FTLE 1ELEE 4I8JA 2CHAB 1ORFA 1AVXA 4ABIA 1FONA 1ETSH 1MTUA 2K1QA 2BD9A 2FTMA 3A7YA 1CE5A 4I7YH 1BDAA 4NIXA 5E2OA 2G4UA 1OYTH 4FUJA 3ATWA 4ISLA 1GBEA 3BIUH 4AG2A 1RIWC 1Q3XA 6GCHF 4OS6A 1NC6A 4U30A 4K8YA 1B0FA 1SGPE 1A0LA 1HYLA 1Z8JB 1KXBA 1K22H 1ETTH 4UFGH 1BTPA 1G3DA 2BX3A 3QZRA 5C20A 2UUFB 2GCHG 2BB4A 3RXOA 1ESTA 1NU9A 1O33A 2YNBA 4XBBA 3AAUA 2ZDMA 1JRTA 1C5QA 2OUAA 5EG4A 4NWLA 1YPEH 1O2IA 2FOCA 4X6MA 3PMHB 1QB6A 2BDGA 2BQ7B 4Y7AA 4CBNA 3OX7U 3UPEA 1EATA 1HGTH 1E36B 2PLXA 5K0HA 1RTFB 3DFLA 4WJG2 2BY6X 1OPHB 4Z0KA 1WAYB 2PGQB 1C5ZB 4U01A 1TGCA 1F0TA 4MPWA 1GI7B 5A8YA 1E0FD 4GCHG 4AG1A 1QJ1B 1TA6A 2C8WB 2Z7FE 3E0NB 3QZQA 1PQ5A 8LPRA 1ZRKA 3RXLA 1GG6B 4MNVA 1GMCF 3NKKA 2EEKA 1G3CA 1FXYA 1GBJA 4MPVA 1QL7A 3MFJA 6CHAC 1K1JA 3QWCH 1YM0A 3RXAA 1TRNA 4GHQA 1IQFA 1O2MA 3PO1B 1YP9A 2H9TH 2ANWA 4ZKOU 2ZA5A 1BT7A 1HFDA 1BZXE 3BTDE 2HLCA 5FXLA 1ESAA 2VIDA 5E8EH 1C5PA 1GMHF 2OC0A 1SLXB 4H4FA 5FBIA 1W12U 1V2RT 4FUDA 1GCTC 3ZZDA 1GJ4H 4J1YA 4DOQA 2JH0D 5T6GA 1GGDB 1SGFA 8ESTE 1VCPA 4AFZA 3RUOA 1RD3B 1C5MD 2OC1A 1UTNA 2V6NA 1CT0E 1VITH 5JDUB 1MQ5A 1QA7A 1W2KH 2HWLB 3VGCB 5JBCS 3KIDU 4JYTA 4NWKA 2FODA 1V2UT 1A3EH 1W0ZU 4D9QA 1CGJE 1HIAB 1LQDB 1ZGVA 2W5EA 3SNEA 4U32A 1GI8B 5A09A 4FVBA 1GBTA 5J4SA 1KTTB 4MNYA 3SW2B 3ZZ3A 3GCNA 3KQEA 4FU9A 5I46H 4K69A 3ZVBA 1B5GH 3PMBB 1H1BA 3LC3A 4X2WA 2PR3A 1C2DA 2AEIH 3ZZCA 3U1JB 1CVWH 1QL8A 2G81E 1S81A 1KDQA 2ZU1A 4NGAH 3TVJB 1YCPH 3SI3H 2R0KA 1AU8A 4HGCA 2XCFA 4AN7A 1W10U 1O2UA 1EB1H 1H9HE 1YF4A 1FY5A 2XWBI 1ZLRA 4X8VH 1GHAG 2RG3A 3A7ZA 1GMDF 1T4VH 3EGKH 3MHWU 3SNAA 2AYWA 1W0YH 3BTGE 5JBBS 2F9NA 1MUEB 1P2IA 2STAE 1KLTA 1ZJKA 4GHTA 1K1NA 5ETXA 1NFYA 1MTWA 1TRYA 5HYOA 2FOGA 4HZHA 2Z94A 1OS8A 1BBRH 4Q7YA 2KAIB 3ZV9A 4BTUB 2BX4A 3QUMP 3GCTG 1LQEA 5F8XA 3ELAH 1GDNA 3H7OA 1ZPZA 1AB9B 2QAAA 4Y7BA 1EOLA 4WF8A 3HK3B 3RXBA 1ACBE 3MO6A 3SU2A 1Z7KA 1YCPM 1PQ7A 1DITH 3SUEA 3GY5A 2FP7B 1N6YA 1V2PT 1L4DA 2C90B 2BLVA 3H5CB 4CH2B 1TGBA 4CRCA 2FI4E 4JZIA 1Y3XA 2PTNA 1C5RA 2PUQH 4X1QU 4WXIA 1DFPA 5ESBA 5DGJA 3P70B 2ZFRH 2G52A 4J2YB 1BRAA 1LPGB 1DXWA 1GBKA 9ESTA 2ZFQH 3ZZ9A 5DO4H 4FUEA 1MTSA 3UOUA 2A32A 3WY8A 3UWJH 5EW1H 5EW2H 1BJVA 1GWAA 4AFSA 3A7VA 1RIWB 2GZ7A 5HXFA 2QXGA 4IS5A 3RU4E 1O2JA 2JETC 3P8FA 2NU2E 2H6MA 2FWWA 2QC2A 1WTGH 2Z3EA 2J38A 1TAWA 2VIPA 1IQEA 3LPRA 4RKOB 2H5CA 2A4GA 1O36A 1U6QA 3PMAB 2VJ1A 2WPLS 2H2ZA 1DPOA 1O3LA 1GMCG 2STBE 1SL3A 1QRWA 2YOLA 1A7SA 2FPZA 3KQBA 4K5ZA 4KTSA 3SI4H 3F6UH 1AB9C 1NN6A 4B71A 4FUHA 3UWIA 2V35A 4WXVA 3AASA 1Z1IA 3O8RA 2VIVA 2PW8H 3LH3A 4ISNA 4BTIB 1JOUB 3OTJE 4U2WA 1P3CA 1L2EA 4UONA 1PPHE 1O3DA 4GVUA 1BTHH 3PB1E 1PPBH 5DP9A 1CT4E 3GICB 1S0QA 2XC4A 5AFZH 3EE0B 2ZU3A 1ELBA 2WV5A 4YTAA 1FY3A 3ZYEA 2PV9B 3KGPA 1S83A 4ISIH 3ZVAA 1G37A 1O5EH 5L2ZH 1CQQA 5C1YA 1GJ6A 1C1TA 1MTNC 3BG4B 4A1XA 2YNAA 2ZDVH 2JH5D 2G5NA 1OKXA 5C1UA 3S9AA 3HKJB 2PKAA 1NFWA 4A7IB 3SUGA 1EUFA 3F1SB 4JYUH 4K2YA 1BHXF 1VJAU 3SNCA 1TX8A 2CV3A 4AB8A 2Y5HA 2PSYA 3VGCC 2OTVA 3ZZ6A 1GGDC 2AGIX 2SGDE 3PROA 3V3MA 1F0RA 1MCVA 5JYIA 2SGQE 1BMNH 4A92A 3SJKA 3ATKA 3A80A 1AZ8A 3RXKA 3V0XA 4B76A 2ZDNA 1DY8A 3Q3KA 3SV6A 2VNTA 3VFEA 1P9SA 1QL9A 4WH6A 3A84A 1JIRA 3UNQA 1GHYH 1O2LA 3TK6A 2A4OA 3TH4H 2ASUB 4NZQA 4F49A 1SPJA 3E90B 4ZXXH 3RXTA 3TH3H 4A1VA 3RC5A 4ABBA 2Z9GA 1GHAF 1THSH 2D2DA 2P3FH 5E0JA 1CA0B 1AKSB 1H8IH 3VB6A 1XX9A 2BQWB 1ZTLA 5I25A 1TGNA 1YLDA 2GKVE 3RMOH 1C5YB 4M7GA 1FLEE 4I8KA 1ANDA 4BAHB 3LJJA 3PLPA 3S69A 1HJAB 2I6QA 1HAGE 2Y80A 1GI4A 1XKBC 1S82A 5TCAA 3SV7A 1C1SA 2WPJS 1EKBB 5C5NA 3VB4A 2AMQA 1NROH 4E7NA 3KCGH 1V2OT 1TLDA 8GCHF 5C3NA 3UNRA 2GCHF 3KL6A 1V2ST 3NPSA 1QY6A 6CHAB 3TK9A 1OSSA 1O3NA 4R0IA 1TBQH 2GZ9A 2RA3A 3GY4A 1EB2A 3M3SA 3ZZ5A 4X1PU 5L2YH 2VH6A 4Y8XA 5HGGA 3EDXB 3TGJE 3A7WA 1BMAA 1PYTD 3RM0H 1C1RA 4AZ2B 3G01A 1JMOH 1DSUA 3IITA 1Z6EA 1SFQB 2I6SA 2CF9H 3SGQE 1UK2A 1XVMA 2GCTC 4XDEA 1TQ0B 4I8LA 2P93A 1YLCA 2D1JA 1AHTH 4H42U 3VPKA 1THPB 1VZQH 1KXDA 1JWTA 3SZNA 1O2SA 4DIIH 2WPKS 3BG8A 1AUTC 1TE0A 1NT1A 2XC5A 2CJIA 1GI1A 1WQSA 3Q77A 4JZ1A 1ZMLA 1ETRH 1ABIH 3U1IB 4Y6DA 4Y11E 1G36A 1LVOA 1SVPA 4K1EA 2ZPQA 1XXFA 2ZDKA 1KLIH 3RXUA 5JB9S 2BD3A 6GCHG 3RXIA 4UFEH 4MQAA 4X6OA 3T5FH 1SR5C 1J8AA 1KIGH 2OQUA 1IQLA 2ZPSA 3UR6A 2ZTXA 2XXLA 4WMDA 2A0QB 1UK3A 4O3UA 4ZMAH 1SGRE 1XXDA 2F91A 1SGEE 3EA9A 3M5OA 5FPSA 1ID5H 2G51A 1O2QA 4D76A 2V3OH 1TPOA 2A1DB 2OBQA 2B9LA 3QX5H 1VGCB 1YPHE 4LK4A 5TJXA 1FIZA 4ABEA 1P0SH 3NCLA 5C1XA 1D3TB 1QQ4A 2F3CE 1N1LA 2THFB 3SU6A 7GCHG 4ZKSU 1LPKB 2BXUH 3ATIA 3BEUA 1AFQB 1ZMNA 2Z9KA 1SB1H 2FX6A 2LNCA 4BAOB 2J92A 4NFFA 4DIHH 1DLEA 1NPMA 3T28A 1FN8A 5C5OA 1CU1A 3TITA 1O2OA 1IHSH 1KXAA 2QXHA 2VIOA 3F9FA 1PYTC 2P94A 2AERH 3M35A 1W8BH 1C4U2 2O8UA 3SOSA 3VEQB 4X1RU 2Z6BD 3P92A 5TCCA 5EU8A 2ODQA 3D62A 3MMGA 4FU8A 1C1WH 1TQ7B 2GX4A 1TPSA 1O2VA 1Z1JA 3M7QA 2C8XB 1YPMH 1V2TT 2A2QH 1YPLH 4YOGA 1UTQA 4I31A 5DP4A 2ODPA 1SI5H 2BD2A 2XCNA 4CH8B 3TLOA 1UCYE 2R9PA 1A3BH 3LU9B 3ZVGA 1EAUA 2J95A 4INKA 4IMQA 1ZMJA 3NZIA 5FX6A 2G4TA 1T32A 1L1GA 1C5VA 2XC0A 1HXEH 3O8DA 2VVVA 1C5OH 1LVMA 1CHGA 2SGEE 5E2PA 3HK6B 1E38B 2PUXB 2J34A 4O03A 3MNSA 2RDLA 4D8NA 1DWEH 1CSOE 1V2KT 1UMAH 3SHCH 1ELGA 3LGWA 3MU0A 3TJUA 3T62A 4ZHMU 2VWMA 5B6OA 2FS8A 2VWLA 4VGCC 3ODFA 1ANBA 1EOJA 1GHBG 4IMZA 3BTME 3SNBA 1AGJA 2G5VA 4IC5A 3FP8E 4A6LA 1DLKB 4K3JA 1WCZA 3BEIB 3T2NA 2HNTF 3ZZBA 5DP8A 1EJAA 1SFIA 3LH1A 2ZQ2A 5IDKA 2SNWA 1S6HA 1ABJH 2VVCA 1GJ7B 1Z8IB 1F2SE 2FOBA 5F6MA 1ARCA 1SQAA 3F9EA 3MU8A 3U8TH 2R0LA 5J4QA 2WPIS 2D26C 5A8ZA 3M7UA 1GL0E 1MAYA 1QURH 2GMTC 5JBAS 1NS3A 1JIMA 2R2WU 2BY7X 3TPIZ 1PQ8A 1NM6A 1XUKA 4B73A 1Z8GA 1HDTH 1UHBB 4UFFH 1FPHH 1FUJA 4IGDA 1C1VH 2A2XH 1C1QA 2OINA 2A5IA 3DT0H 3DA9B 2F9VA
chains in the Genus database with same CATH superfamily
2HALA 3CS0A 3UFAA 1A61H 1GG6C 4KTUA 3PYHA 1O37A 1D3QB 1MKWH 1HAYB 1FIWA 2UWLA 1CA8B 1Q2WA 1GHBF 1O2PA 4E05H 2VWOA 1RTLA 3V12A 3ZZ8A 1LTOA 2TGPZ 2ANYA 1KXEA 5FCRA 3V13A 1O5GH 2HPQH 4IC6A 3A87A 3M5NA 2F4LA 2FZZA 3GY2A 3CP7A 1KLJH 1NFXA 1C2LA 4AFUA 4NIYA 4JK6A 4KP0A 3Q00A 4JYVH 3TNTA 5DP5A 2ZF0H 3MU5A 1XVOA 1AKSA 4YOIA 2AGGX 1O2WA 3WW7A 2ZFFH 1ELFA 5FX5A 1O31A 3U9AH 1C5UA 1C5SA 2FDAA 3DCLA 3GY6A 2BYAX 1O32A 2FOEA 1W3CA 3KF2A 4MNXA 1OWDA 1IQHA 3PV4A 1HNEE 3RXPA 3RXEA 2IJOB 2W26A 1THRH 4KELA 1WBGB 1TNKA 1DWDH 1GI0A 1O3HA 2QGRA 1HAOH 1B0EA 5B6LA 1G2LA 3ENSB 4INLA 3SGBE 1BUIA 2GDDA 2NU0E 4NFEA 4CRBA 2FIRH 1XUJA 3K6ZA 2FEQH 5PTPA 2BLQA 1OWJA 1FY1A 3NWUA 4JZDH 1W14U 3BTKE 3I78A 1ZSLA 3QGNB 7GCHF 1ELAA 1GBCA 1C1PA 4Y8YA 1GVZA 1FY4A 3DFJA 3E0PB 4THNH 3D49H 1BJUA 4WY3A 4MDSA 3P8GA 5DK1A 3N7DA 4DY7B 1P10A 2K0QA 8GCHG 5GNDA 1EJNA 1Y3UA 2ZU5A 2BVXH 2LPRA 3E6PH 1Y59T 4XFQA 1TMUH 4RI0A 1NBME 4Q63A 1MZDA 5ESTE 1ZPCA 4LZ4B 1RRKA 2KCAA 2R2MB 5AF9H 1EP6A 3RU4D 1HLTH 2Y5FA 1LHFH 2XBVA 1SGDE 1O5BB 2IPHA 2SFAA 1MU8B 2QIQA 4DT7B 1ZSJA 2Z9IA 3M37A 4MLFB 4AGKA 1C2GA 4RT0A 2ZEBA 1MZAA 4Z6AH 1EAXA 1W11U 2Y81A 4X6PA 1MKXK 3A89A 3SGAE 1K21H 2NU3E 3BIVH 3SBKA 3TK5A 1IHTH 1UTLM 2BQ6B 1TGTA 1QHRB 5G4BA 5KGOA 1K28D 4NSYA 2F9PA 1GJ9B 2FMJA 1SHHB 1RFNA 1IQNA 4NG9H 4BNRA 3FZDA 8KME2 1V2NT 1F5KU 4TYDA 1ZZZA 1A1RA 3MNCA 1C2HA 3FFGA 3SU3A 2A4QA 4I33A 3H7TA 6ESTA 2IJD1 1GMHG 4HI3A 4ABFA 1G3EA 1PFXC 4TWWA 4WMEA 1HB0B 2SGPE 2H9EH 3ZZ7A 1IQKA 2FOFA 1YBWA 2ZGHA 1O5DH 3KQ5A 1INCA 1UTKA 2ZHQH 4CRFA 2ODYB 4IN2A 1VGCC 3R3GB 1AE8H 5HM2A 4UFDH 1FAXA 2OC8A 2ULLA 3OYPA 1O5CB 4JZEH 1MMJN 1MKXH 3CNRA 1P2KA 4KGAA 5CDFE 2OD3B 2B8OH 4BXWA 1JBUH 1C2EA 1F0SA 1HAXB 1D6RA 1OWHA 2AIQA 1TNGA 2CXVA 3QDZB 5EQSA 3OU0A 1MTNB 1G30B 1GBAA 1V2WT 1V2QT 5F53A 1SGCA 4WMFA 1NY22 1O2KA 3A8BA 3F9GA 3FO8D 2J9NA 4DCDA 3LGIA 2R3UA 1QB1A 1UVTH 2OP9A 1C4V2 3DUXH 3LC5A 4AYYB 3SV2H 2B5TB 1Y5UT 1GBDA 2W3KA 1ZOMA 3JZ1B 1GI5A 1GI9B 2WUCA 2ZHDA 3MWIU 4ZKRU 2KCOA 3P6ZB 2FLRH 1DE7H 2HPPH 2JH6D 3OY5U 4YO9A 1PQAA 3BTHE 3PLBA 3AVZA 1IOEA 1BRUP 1L0ZA 1W0KD 2TGAA 1E34B 1O3CA 1SOTA 2OQ5A 2QV1A 1O2YA 1XUIA 5SGAE 1VR1H 3F9HA 3A83A 1BHXB 3T25A 2QN5T 3TNSA 3EQ0H 3GOVB 1N8OB 1TB6H 2Z9JA 1Y3VA 5JB8S 3LGTA 1ESBA 2BDHA 1SGIB 1OXGA 1G2MA 1T8MA 5AHGH 2VB0A 1SGQE 5F03A 5GXPA 4YESB 3SZEA 4BXSA 1FJSA 3PO1C 4AYVB 4OS1A 3RP2A 1BMLA 1HPGA 2BLWA 2LP6A 3NK8A 4XRNA 2Y6TA 3LONA 3GCOA 3MH5A 4YT7H 5GDSH 1A0HB 5A8XA 2HNTC 4D7FA 1MH0A 4AX9H 3L6PA 4IW4E 1RJXB 1DWCH 1HIAA 5GCHF 2JETB 1C5TA 3ZV8A 1A46H 3RXGA 4BOHA 1GDUA 3AW1A 1IQGA 2ZO3H 1BRBE 2P59A 3BTEE 1O3IA 3LGVA 2YMSD 2ZFSA 1H8HD 4BAKB 1EP5A 1DT2A 1P03A 1W7XH 1O2NA 3M3TA 4ZKNU 2GT8A 4ZCNA 4AB9A 3SJOA 2EI8A 1NRRH 1SQTA 2ZQ1A 4GCHF 4OGYA 4I8HA 1SSXA 2XNIA 4F48B 2VIQA 1ZR0A 1OOKB 1AE5A 2W6JD 3VB7A 1P2JA 1C2JA 3RXMA 1C5WB 2C8ZB 1ZHRA 4H6SB 3UQOA 1G9IE 1O3BA 3P8NA 3S7HB 4QT8C 2BMGB 5GPIB 3GY7A 1C2KA 4Y71A 2C3SA 5EODA 1TGSZ 3STJA 4ABHA 3TIUA 2DE9A 2B0FA 1PJPA 1OP0A 1HUTH 1WV7H 4ABAA 3ZZ4A 1AZZA 4Y10E 5F8ZA 1GVKB 1GJAB 3SV8A 2SGAA 4AGJA 1TPPA 1MU6B 1EJMA 5T6DA 1P11E 4GSOA 5DP3A 2WINI 2O8LA 1QRZA 4UE7H 1UCYK 2FS9A 5HM9A 2VIWA 1F5RA 1TA2A 1FV9A 3R0FA 3UUZA 4X2VA 5AVDA 3LGUA 1Y3YA 1SQOA 1LPZB 3C27B 1UJ1A 2DUCA 3RXJA 3A82A 3RXQA 1AD8H 5EQRA 3TGIE 2BDIA 1N6XA 1VITG 3MH4A 4OS5A 7LPRA 1KMHB 1QBNA 4CBOA 1GBLA 1BOQA 1SOZA 1EZUC 5DPAA 1S84A 2IN2A 3WWBA 2W7SA 1XM1A 2OC7A 3M5MA 1GBMA 3A7XA 2ZHWH 1SGYE 1E37B 1PPCE 4FUCA 2XNDD 1GBIA 3F0OA 2PKSB 1O30A 1GHVH 1QFKH 3FOAA 3FAOA 1K1OA 1PPZA 2HOBA 1LKAA 1HAVA 1LMWB 3B9FH 1COWD 2ZCLP 2WPDD 4K8BA 2Q6DA 3M3VA 4RSPA 1TPAE 1GJCB 1VCQA 1XUGA 1OWIA 1O2RA 2ZIQH 2TGDA 1MTVA 1E1QD 5DP7A 3SO3A 2FYRA 2WSSD 3P17H 4A5TS 4B2CA 2ZDLA 1QA0A 3O8BA 3RMMH 1YPKH 5GWZA 1BBRE 1LHCH 1BCUH 5EPNA 1HAVB 1UTOA 2VU8E 2Z9LA 3RXFA 1C5XB 1LVBA 1S6FA 1DXPA 1KSNA 4O3TA 1P2QA 1GJ8B 1O3JA 1SLVB 1HJAC 3A85A 1BBRK 2K8IA 1X7AC 2A45B 5EJZA 1J15A 1MBQA 3DD2H 1FZZA 1O3OA 3UAIC 4LXBH 2ZNKH 3MYWA 1CA0C 2GD4B 1GL1A 3S0NA 1C5LH 5A0AE 1P09A 3FP6E 3ZIAD 1J17T 1O3MA 4ABJA 2HNTE 3TU7H 1A4WH 1QR3E 3PRBA 2BDYA 1LCYA 3T27A 1TWXB 1NU7B 1V6DA 3I77A 3ZVCA 1BIOA 2ZC9H 5GJ4B 1TFXA 2ANKH 4ZROA 2CGAA 1UK4A 1ELCA 1XMNB 2Y7ZA 5IYTA 3S9CA 1H4WA 1AFEH 4B2AA 5FPYA 3SJ8A 1DX5M 1QJ7B 4K1SA 3ZVEA 3Q76A 2B7DH 1F5LA 2AH4X 3UR9A 3UTUH 4YXWD 3W94A 1TBRH 1UHBA 2ZWLH 3N99A 1O38A 2BD7A 5LGOA 2VWNA 4MTBA 2ZDAH 2BDCA 1CBWC 3RMNH 3UREA 1A5GH 1GI2A 1NZQH 3U8OH 2JKHA 2ZGJA 2AMDA 3U8RH 2A7CA 2XYAA 4YLUA 3MTYA 1C5NH 4OS4A 1K1IA 3CENA 2ZECA 3HGPA 5LPRA 1WYKA 1A2CH 3PWCA 5BRRE 2P3UB 2Q1JA 3OE7D 3GY8A 1F0UA 2IOTA 1JRSA 3MNXA 2P8OB 3LJOA 3FN8A 1TALA 4YOJA 1P02A 5C0UA 4DURA 4DT4A 2BD5A 1QIXB 4WH8A 3MO3A 2QF3A 5T3HA 2C93B 1AO5A 2Z3CA 1G32B 4DGJA 1ZHMA 1P3EA 2BZAA 4TY6A 1TYNA 1C1MA 4GAWA 1BTUA 3E16B 2G00A 1GBBA 3RXDA 1AWFH 5A0CA 3NRLA 1YPHC 1AI8H 1Y5BT 1PPGE 2SNVA 3W1EA 1FAKH 4YT6H 1V3XA 1D9IA 1QTFA 5EGMA 2F83A 3LT3A 2GT7A 3KHVA 4NIWA 2L6OA 4ZH8A 1NRNH 3F68H 1LO6A 1SHYA 4XE4A 4FUFA 1V2JT 1OWKA 1DWBH 1W13U 1YYY1 2BLOA 3M61U 3VB5A 3K6YA 4TWYA 4AFQA 1O3EA 3RXHA 3U69H 3V7TA 5L6NH 4I8GA 1TRMA 5A2MH 4X8TH 5EJ1A 2BVRH 1GI6A 2WPMS 4TPYA 4UDWH 4CREA 4BAQB 4MPUA 1O39A 2ZPRA 2ZKSA 2HVXA 4B1TA 1O5FH 2PWXA 1Y3WA 3MOCA 4OGXA 1GPZA 4FU7A 3ZVFA 1N8OC 2ZGCA 3DSGA 1FNIA 2ZI2H 1DANH 1NRQH 1P2NA 3CS7A 1KYNA 3RMLH 3SNDA 2ZHFH 3L3TA 1ZTJA 1F7ZA 1GCDA 3A81A 2A7HA 3BTFE 3RLYH 3BV9B 2GDEH 5T6FA 1CO7E 1KDQB 2GV7A 3BTWE 3BTQE 1S85A 1O35A 3PM3A 5F8TA 1T8OA 1EAWA 1XUFA 2SGFE 3HATH 4X0WU 1V2LT 3MU4A 2PFEA 1SGNE 3RXSA 4NSVA 1MCTA 5DJ7A 5CHAC 1UVOA 3SN8A 2WPHS 3T26A 1AUJA 2GMTB 4XBDA 1SC8U 1BB0B 2J98B 3KEEA 1T8LA 2XTTB 2OXSA 2OCVB 1P8VC 1RS0A 2V0BA 1XKAC 2FI3E 1CT2E 2UWOA 2BY5X 3BTTE 1GJ5H 4R8TB 1NRPH 1YC0A 2EA3A 3S7KB 4X2YA 1GI3A 2EI7A 4Y0YE 4I32A 1GMDG 1K2I1 3FKSD 3I29A 4CR5A 2P95A 3TH2H 1D6WA 2BY9X 1O3FA 4NIVA 1GHWH 1PPFE 5GIBA 4CRGA 1MD7A 2PKSC 2QA9E 4KKDA 2ZFPH 4VGCB 1K1PA 1HAPH 2FOHA 1LHDH 3PV5A 3ATLA 1NBMD 5GCHG 1IQJA 2ZGBH 4XOJA 9LPRA 2Y7XA 1EXFA 1DUAA 1DS2E 1KXCA 2FI5E 2BM2A 2Q6FA 1ZYOA 3TGKE 5EPYA 3SUDA 1P04A 4DG4A 4Q7ZA 2WYGA 2PGBB 2ALPA 4F4OC 1GBHA 1UVSH 2CK3D 2H5DA 1EPTA 1FMGA 4NA8A 1LDTT 4E7RG 3UQVA 1AFQC 1QGFA 3FP7E 2BXTH 4GUXA 3PLKA 1V2MT 1UTJA 2QXIA 1GCTB 2AIPA 3RXRA 2Z3DA 4MVNA 1P9UA 1P05A 2ZCKP 4MNWA 1HCGA 2ZG0H 1DICA 3URCA 4B74A 4ABDA 1HV7A 3E1XB 2ZTYA 3RLWH 2PTCE 1WU1A 1WXRA 4BTTB 4FXGH 5FHTA 4MPXA 1QB9A 3UIRA 1LHGH 1UVPA 3SU5A 2VH0A 4ISHH 3E91A 4JK5A 4SGAE 1YGCH 2VVUA 4JMYA 2H1UA 4RT1A 5AFYH 2NWNA 3DSOA 4FUBA 4FUGA 4M9FA 1XUHA 2BDAA 1J9CH 2A4RA 3S9BA 1NESE 1YPGH 1TONA 3B23B 3SQEE 3M7TA 4NZLA 2L74A 3F3BA 3T29A 1EZXC 1C9TA 4Z1MD 1O2HA 1UCYH 3SV9A 5EOKA 1UW7A 3SJ9A 4JCNA 4IBLH 2BVSH 1P2MA 2F9BH 1KY9A 1ZRBA 2GP9B 1YCPK 2RA0A 3ZVDA 4K60A 2XRCA 3E8LA 4O97A 3FZZA 2WYJA 3M36A 4ABGA 4DJZB 1W0JD 1WUNH 3RU4T 5L30H 3QN7A 1FN6A 1DUEA 5ABWA 2UUYA 2FM2A 1O0DH 5C94A 1QBOA 2C8YB 1O34A 2KR7A 2TPIZ 2ZHEH 3PWBA 4XSKU 4ZAEA 1WOFA 2TIOA 1DVAH 1EAIA 2HGTH 1NO9H 2PKAB 1TMTH 4ISOA 1TBZH 1VITF 4TT3D 5HIYA 4X1SU 1BTWA 1LKBA 1O5AB 4A1TA 1JXPA 3BG4C 2TRMA 4O9VA 4ESTE 5DP6A 2ZU4A 4D7GA 1IQIA 4NA7A 1ANCA 2UUJB 2XBWA 3GYMA 4B6FA 2C4FH 2A5AA 1DY9A 1ZGIA 4X8UH 1SGFG 3GCHC 2W7UA 1WTHD 1V2VT 2Y82A 4WWYA 1RTKA 3B8JA 1HAZB 1C1UH 5CHBA 2GJGA 4TY7A 4YLQH 1WSSH 1K1LA 2G55A 3U98H 4E06H 5JBTA 1Y5AT 1ZSKA 2XW9A 1A5IA 1TABE 2M5TA 1O3AA 4H6TA 2FLBH 4SGBE 3RDZA 2BD4A 1CBWB 4Q7XA 4DVAU 3EAJA 1TX7A 3GDSA 1TNJA 4AOQA 3KYGA 1OYQA 2FO9A 1S5SA 4Q2KA 3GCTF 1UTMA 3SU0A 4B75A 1Z6JH 2O8WA 3A8DA 5LPFA 1EQ9A 1ELDE 1GHZA 2KFWA 7ESTE 4TSFD 1O3KA 2FOAA 1O3PB 4X2XA 5FCKA 1QZ8A 1ZJDA 2XBXA 1KXFA 4ZXYH 2VGCC 3ZYDA 1AWHB 2FOMB 3D23A 1IQMA 5HMAA 3BN9A 1P06A 2FESH 1VCWA 3PRDA 5FAHA 3A8CA 1BA8B 1HJ9A 1WDIA 2CMYA 4LOYH 1Q31A 3FANA 2BHGA 3SQHE 4CHAC 1HBTH 1YKTA 2OLGA 1T8NA 4NCYA 2AFQB 4NA9H 5FBEA 3VB3A 2F9UA 5EQQA 2NU4E 1ELTA 2BD8A 4HG6A 3QLPH 4CR9A 2EC9H 3TJNA 4Y79A 1HAHH 2UUKB 4X8SH 1IAUA 2TBSA 1BQYA 2JIZD 1C1OA 1Z71A 2KM0A 4Q4LA 1UTPA 2BDBA 2O8TA 1SGTA 1FDPA 2XBYA 1CGHA 5DG6A 3LGYA 4B2BA 1T31A 1E1RD 1W7GH 4Y8ZA 4CRAA 4UD9H 2O8MA 1EZSC 1GHXH 4OS2A 6LPRA 1P12E 2OBOA 2TGTA 1QRXA 2P16A 3TJOA 1NRSH 3HGNA 1AMHA 1PPEE 2H9HA 2BY8X 1EPTB 1O2ZA 1ZPBA 1BTXA 1HJ8A 2FXRA 1A5HA 3JZ2B 3TJVA 3HKIB 4Q80A 1H9IE 2ESTE 2BOHB 1MQ6A 3HPTB 3ODDA 1LVYA 1TIOA 3M5LA 3LIWA 3EA7A 1ZTKA 3OSYA 5CE1A 5E0HA 1MD8A 2O9QA 2W3IA 2A5KA 1M9UA 5EXNA 1E35B 2KAIA 4BAMB 3N7OA 4KTCA 1C1NA 1OP8A 5E0GA 3KQCA 1HXFH 1UVUH 3GDUA 5C0TA 1J14A 3LDXH 2GV6A 2WV4A 3MNBA 3SORA 1K0HA 4LZ1H 4ZHAA 1Y8TA 1WQVH 1LHEH 4CHAB 1NFUA 2HRVA 2ZFTA 3MH7A 3VXFH 1RXPA 3FVFB 5CMXH 4FUIA 2AGEX 1DOJA 3EE7A 2ZU2A 1GBFA 2CHAC 4Y0ZE 1TNHA 5CHAB 3U28C 1L1JA 1C2FA 4XBCA 2QXJA 3DSPA 1P01A 4Y76A 5A0BA 2AMPA 4JZFH 1O2XA 2AS9A 5H4IB 1T7CA 2GCTB 3PTNA 3UOPA 3A86A 1L4ZA 2GTBA 4X6NA 2WZQA 3NUMA 4ZHLU 2J2UA 1P57B 1ZHPA 1S6LA 2EQNA 3RC4A 4IN1A 3LOXA 1MKWK 3A7TA 4FVDA 3STIA 3GYLB 2DE8A 2VGCB 1H8DH 3EYDA 2ZGXH 1SMFE 2WHXA 1J16A 1EPTC 4GLYA 2VINA 1VJ9U 1D4PB 1C4Y2 3A88A 1SG8B 2V7QD 1OHHD 1SLUB 4BANB 3K2UA 2QCYA 1H9LB 4WVPE 1HRTH 1HAIH 3E3TA 3PTBA 4MG3A 3Q3XA 2ZCHP 1OP2A 1BTYA 2QF0A 1MAXA 1T4UH 5K7RA 2FYQA 3SJIA 3QTVH 3GCHB 2AHME 1BRCE 3BF6H 4AORA 3GISB 3QTOH 3SUFA 1AVWA 3K9XB 2PSXA 2ZZUH 3GY3A 3ZZAA 1DM4B 3AW0A 1RGQA 1S0RA 2FX4A 2ZP0H 1TX6A 3URDA 1AVGH 5FL7D 3RXVA 1FPCH 2Q6GA 2BZ6H 3ATMA 1O2GH 3P95A 3RXCA 3IG6B 3SHAH 5EXMA 1FY8E 2UWPA 4YZUA 5FPTA 3P8OA 3PV2A 2P3TB 2A7JA 4ACAA 1C2IA 1AN1E 2XWAA 1O3GA 1K1MA 2QY0B 4GPGA 5C67A 3QK1A 2A31A 3BSQA 3L33A 2P8OC 3KYFA 1GVLA 1EZQA 1SBWA 3C1KA 1EASA 1BMMH 1ANEA 3IWMA 3F2FA 4CRDA 4RKJB 2ILNA 1MBMA 3SU4A 3QO6A 2G8TA 1GDQA 2J4IA 4OS7A 1O2TA 1GJBB 2EI6A 3ITIA 4RN6A 1C2MA 1Z8RA 3DHKH 4UEHH 1QNJA 1OWEA 5LH8A 3SU1A 3KNXA 5BPEA 1ELVA 1ARBA 1TOCB 5C2ZA 3ESTA 1CHOG 1F92A 4TPIZ 2F9OA 1OX1A 1L1NA 1KTSB 2CF8H 4B6EA 1UO6A 1GJDB 1G3BA 1QQUA 1FQ3A 2ANMH 3RM2H 1DSTA 2BOKA 1BTZA 1A0JA 2BTCE 2J94A 3D65E 4K1TA 2R3YA 4ASHA 1QJ6B 3MH6A 3A8AA 3QGJA 3VXEH 3W95A 1TNIA 1YPJH 2Y5GA 2PHBA 1CGIE 1CHOF 1NTPA 1D3PB 3LKWA 3NXPA 4PROA 3UNSA 3KQDA 2GVFA 1B7XB 5DKMA 2V3HH 4AC9A 3OY6U 1QCPA 2ZTZA 2GZ8A 1EX3A 3Q3YA 4D9RA 4HTCH 3MI4A 4INHA 1TOMH 1D3DB 3F2HA 4HFPB 1P2OA 1AY6H 2RCEA 3BEFB 5LPEA 2GGVB 1AIXH 4YM9A 3MO9A 2WUBA 2W6ID 3K65B 3RC6A 5JPMH 4DW2U 2D8WA 2RFKC 7KMEH 3O8CA 2NU1E 3PMJA 3EA8A 3N7EA 1C9PA 1AQ7A 3UY9A 1TNLA 2JJ1D 1BITA 2ALVA 1TMBH 4ZUHA 3KN2A 2CN0H 3MU1A 1FI8A 3GDVA 5KECA 1SLWB 4X1NU 3AAVA 1DDJA 5EXLA 1K9OE 2QYIA 1QBVH 2FTLE 1ELEE 4I8JA 2CHAB 1ORFA 1AVXA 4ABIA 1FONA 1ETSH 1MTUA 3H09A 2K1QA 2BD9A 2FTMA 3A7YA 1CE5A 4I7YH 1BDAA 4NIXA 5E2OA 2G4UA 1OYTH 4FUJA 3ATWA 4ISLA 1GBEA 3BIUH 4AG2A 1RIWC 1Q3XA 6GCHF 4OS6A 1NC6A 4U30A 4K8YA 1B0FA 5EJLA 1SGPE 1A0LA 1HYLA 1Z8JB 1KXBA 1K22H 1ETTH 2HVYB 4UFGH 1BTPA 1G3DA 2BX3A 3QZRA 5C20A 2UUFB 2GCHG 2OK5A 2BB4A 3RXOA 1ESTA 1NU9A 3OTPA 1O33A 2YNBA 4XBBA 3AAUA 2ZDMA 1JRTA 1C5QA 2OUAA 5EG4A 4NWLA 1YPEH 1O2IA 2FOCA 4X6MA 3PMHB 3OFND 1QB6A 2BDGA 2BQ7B 4Y7AA 2J97A 4CBNA 3OX7U 3UPEA 1EATA 1HGTH 1E36B 2PLXA 5K0HA 1RTFB 3DFLA 4WJG2 2BY6X 1OPHB 4Z0KA 1WAYB 2PGQB 1C5ZB 4U01A 1TGCA 1F0TA 4MPWA 1GI7B 5A8YA 1E0FD 4GCHG 4AG1A 1QJ1B 1TA6A 2C8WB 2Z7FE 3E0NB 3QZQA 1PQ5A 8LPRA 1ZRKA 3RXLA 1GG6B 4MNVA 1GMCF 3NKKA 2EEKA 1G3CA 1FXYA 1GBJA 4P00A 4MPVA 1QL7A 3MFJA 6CHAC 1K1JA 2KCPA 3QWCH 1YM0A 3RXAA 1TRNA 4GHQA 1IQFA 1O2MA 3PO1B 1YP9A 2H9TH 2ANWA 4ZKOU 2ZA5A 1BT7A 1HFDA 1BZXE 3BTDE 2HLCA 5FXLA 1ESAA 2VIDA 5E8EH 1C5PA 2LELA 1GMHF 2OC0A 1SLXB 4H4FA 5FBIA 1W12U 1V2RT 4FUDA 1GCTC 1MABB 1GJ4H 3ZZDA 4J1YA 4DOQA 2JH0D 5T6GA 1GGDB 1SGFA 8ESTE 1VCPA 4AFZA 3WWFA 3RUOA 1RD3B 1C5MD 2OC1A 1UTNA 2QF4A 2V6NA 1CT0E 1VITH 5JDUB 1MQ5A 1QA7A 1W2KH 2HWLB 3VGCB 5JBCS 3KIDU 4JYTA 4NWKA 2FODA 5HKKD 1V2UT 1A3EH 1W0ZU 1VKYA 4D9QA 1CGJE 1HIAB 1LQDB 3F0PA 1ZGVA 2W5EA 3SNEA 4U32A 1GI8B 5A09A 4FVBA 1GBTA 5J4SA 1KTTB 4MNYA 3SW2B 3ZZ3A 3GCNA 3KQEA 4FU9A 5I46H 2J5UA 5KEDA 4K69A 3ZVBA 1B5GH 3PMBB 1H1BA 3LC3A 4X2WA 2PR3A 1C2DA 2AEIH 3ZZCA 3U1JB 1CVWH 1QL8A 2G81E 5HIZA 1S81A 1KDQA 2ZU1A 4NGAH 3TVJB 1YCPH 3SI3H 2R0KA 1AU8A 4HGCA 2XCFA 4AN7A 1W10U 1O2UA 1EB1H 1H9HE 1YF4A 1FY5A 2XWBI 1ZLRA 4X8VH 1GHAG 2RG3A 3A7ZA 1GMDF 1T4VH 3EGKH 3MHWU 3SNAA 2AYWA 1W0YH 2V3MA 3BTGE 5JBBS 2F9NA 1MUEB 1P2IA 2STAE 1KLTA 1ZJKA 4GHTA 1K1NA 5ETXA 1NFYA 1MTWA 1TRYA 5HYOA 4XD7D 2FOGA 3SYJA 4HZHA 2F43B 2Z94A 1OS8A 5IK2D 1BBRH 4Q7YA 1BMFD 2KAIB 3ZV9A 4BTUB 2BX4A 3QUMP 3GCTG 2JJ2D 1LQEA 5F8XA 3ELAH 1GDNA 3H7OA 1ZPZA 1AB9B 2QAAA 4Y7BA 1EOLA 4WF8A 3HK3B 3RXBA 1ACBE 3MO6A 3SU2A 1Z7KA 1YCPM 1PQ7A 1DITH 3SUEA 3GY5A 2FP7B 1N6YA 1V2PT 5T1VA 1L4DA 2C90B 2BLVA 3H5CB 4CH2B 1TGBA 4CRCA 2FI4E 4JZIA 1Y3XA 2KZ4A 2PTNA 1C5RA 2PUQH 4X1QU 4WXIA 1DFPA 5ESBA 5DGJA 3P70B 2ZFRH 2G52A 4J2YB 1BRAA 1LPGB 1DXWA 1GBKA 9ESTA 2ZFQH 3ZZ9A 5DO4H 4FUEA 1MTSA 3UOUA 2A32A 3WY8A 3UWJH 5EW1H 5EW2H 1BJVA 1GWAA 4AFSA 3A7VA 1RIWB 2GZ7A 5HXFA 2QXGA 4IS5A 3RU4E 1O2JA 4F55A 2JETC 3P8FA 2NU2E 2H6MA 2FWWA 2QC2A 1WTGH 2RDEA 2Z3EA 2J38A 1TAWA 2VIPA 1IQEA 3LPRA 4RKOB 2H5CA 2A4GA 2HLDD 1O36A 1U6QA 1YLNA 3PMAB 2VJ1A 2WPLS 2H2ZA 1DPOA 1O3LA 1GMCG 2STBE 1SL3A 1QRWA 2YOLA 1A7SA 2FPZA 3KQBA 4K5ZA 4KTSA 3SI4H 3F6UH 1AB9C 1NN6A 4B71A 4FUHA 3UWIA 2V35A 4WXVA 3AASA 1Z1IA 3O8RA 2VIVA 2PW8H 3LH3A 4ISNA 4BTIB 1JOUB 3OTJE 4U2WA 1P3CA 1L2EA 4UONA 4ASUD 1PPHE 1O3DA 4GVUA 1BTHH 3PB1E 1PPBH 5DP9A 1CT4E 3GICB 1S0QA 2XC4A 4FOUC 5AFZH 3EE0B 2ZU3A 1ELBA 2WV5A 4YTAA 3OEED 1FY3A 3ZYEA 2PV9B 3KGPA 1S83A 4ISIH 3ZVAA 1G37A 1O5EH 5L2ZH 1CQQA 5C1YA 1GJ6A 1C1TA 1MTNC 3BG4B 4A1XA 2YNAA 2ZDVH 2JH5D 2G5NA 1OKXA 5C1UA 3S9AA 3HKJB 2PKAA 1NFWA 4A7IB 3SUGA 1EUFA 3F1SB 4JYUH 4K2YA 1BHXF 2JDID 1VJAU 2XOKD 3SNCA 1TX8A 2CV3A 4AB8A 2Y5HA 2PSYA 3VGCC 2OTVA 3ZZ6A 1GGDC 2AGIX 2SGDE 3PROA 3V3MA 1F0RA 1MCVA 5JYIA 2SGQE 1BMNH 2M2AA 4A92A 3SJKA 3ATKA 3A80A 1AZ8A 3RXKA 3V0XA 4B76A 2ZDNA 5EIYA 1DY8A 3Q3KA 3SV6A 2VNTA 3VFEA 1P9SA 3AK5A 1QL9A 4WH6A 3A84A 1JIRA 3UNQA 1GHYH 1O2LA 3TK6A 2A4OA 2QE7D 3TH4H 2ASUB 4NZQA 4F49A 1SPJA 3E90B 4ZXXH 3RXTA 3TH3H 4A1VA 3RC5A 4ABBA 2Z9GA 4P02A 1GHAF 1THSH 2D2DA 2P3FH 5E0JA 1CA0B 1AKSB 1H8IH 3VB6A 1XX9A 2BQWB 1ZTLA 5I25A 1TGNA 1YLDA 2GKVE 3RMOH 1C5YB 4M7GA 1FLEE 3F2GA 2IPQX 1ANDA 4I8KA 3LJJA 4BAHB 3PLPA 3S69A 1HJAB 2I6QA 1HAGE 2Y80A 1GI4A 1XKBC 1S82A 5TCAA 3SV7A 1C1SA 2WPJS 1EKBB 5C5NA 3VB4A 2AMQA 3OEHD 1NROH 4E7NA 3KCGH 1V2OT 1H8ED 1TLDA 1YWUA 5C3NA 8GCHF 3UNRA 2GCHF 3KL6A 1V2ST 3NPSA 1QY6A 6CHAB 3TK9A 1OSSA 1O3NA 4R0IA 1TBQH 2YMSB 2GZ9A 2RA3A 3GY4A 1EB2A 3M3SA 3ZZ5A 4X1PU 5L2YH 2VH6A 4Y8XA 3MQKC 5HGGA 3EDXB 3TGJE 3A7WA 1BMAA 1PYTD 3RM0H 1C1RA 4AZ2B 3G01A 1JMOH 1DSUA 3IITA 1Z6EA 1SFQB 2I6SA 2CF9H 3SGQE 1UK2A 1XVMA 2GCTC 1SQRA 4XDEA 1TQ0B 4I8LA 2P93A 1YLCA 2D1JA 1AHTH 4H42U 3VPKA 1THPB 1VZQH 1KXDA 1JWTA 3SZNA 1O2SA 4DIIH 2WPKS 3BG8A 1AUTC 1TE0A 1NT1A 1E79D 1GI1A 2CJIA 2XC5A 4ACBA 1WQSA 3Q77A 4JZ1A 1ZMLA 1ETRH 1ABIH 3U1IB 4Y6DA 4Y11E 1G36A 2KCYA 1LVOA 1SVPA 4K1EA 2ZPQA 1XXFA 2ZDKA 1KLIH 3RXUA 3GS9A 5JB9S 2BD3A 6GCHG 3RXIA 4UFEH 4MQAA 4X6OA 3OAAD 3T5FH 1SR5C 1J8AA 1KIGH 2OQUA 1IQLA 2ZPSA 3UR6A 2ZTXA 2XXLA 4WMDA 2A0QB 1UK3A 4O3UA 4ZMAH 1SGRE 1XXDA 2F91A 1SGEE 3EA9A 3M5OA 5FPSA 1ID5H 2G51A 4I86A 1O2QA 4D76A 2V3OH 1TPOA 2A1DB 2OBQA 1SKYE 2KX4A 5DSFA 2B9LA 3QX5H 2J98A 1VGCB 1YPHE 4LK4A 5TJXA 1FIZA 4ABEA 1P0SH 3NCLA 5C1XA 1D3TB 1QQ4A 2F3CE 1N1LA 2THFB 3SU6A 2QF5A 7GCHG 4ZKSU 1LPKB 2BXUH 3ATIA 2PP6A 3BEUA 1AFQB 1ZMNA 2Z9KA 1SB1H 2FX6A 2LNCA 4BAOB 2J92A 4NFFA 4DIHH 1DLEA 1NPMA 3T28A 2EY4C 1FN8A 5C5OA 1CU1A 3TITA 1O2OA 1IHSH 1KXAA 2QXHA 2VIOA 3F9FA 3UB0A 1PYTC 2P94A 2AERH 1YY3A 3M35A 1W8BH 1C4U2 2O8UA 3SOSA 3VEQB 4X1RU 2Z6BD 3P92A 5TCCA 5EU8A 2ODQA 3D62A 3MMGA 4FU8A 1C1WH 1TQ7B 2GX4A 1TPSA 1O2VA 1Z1JA 3M7QA 2C8XB 1YPMH 1V2TT 2A2QH 1YPLH 4YOGA 1UTQA 4I31A 5DP4A 2ODPA 1SI5H 2BD2A 2XCNA 4CH8B 3TLOA 1UCYE 2R9PA 1A3BH 3LU9B 3ZVGA 1EAUA 2J95A 4INKA 4IMQA 1ZMJA 3NZIA 5FX6A 2G4TA 1FX0B 1T32A 1L1GA 1C5VA 2XC0A 1HXEH 3O8DA 1C5OH 2SGEE 1LVMA 1CHGA 2VVVA 5E2PA 3HK6B 1E38B 2PUXB 2J34A 4O03A 3MNSA 4FETA 2RDLA 4D8NA 1DWEH 1CSOE 1V2KT 1UMAH 3SHCH 2WV9A 1ELGA 3LGWA 3MU0A 3TJUA 3T62A 4ZHMU 2VWMA 5B6OA 2FS8A 2VWLA 4VGCC 3ODFA 1ANBA 1EOJA 1GHBG 4IMZA 3BTME 3SNBA 1AGJA 2G5VA 4IC5A 3FP8E 4A6LA 1DLKB 4K3JA 1WCZA 3BEIB 3T2NA 2HNTF 3ZZBA 5DP8A 1EJAA 1SFIA 3LH1A 2ZQ2A 5IDKA 2SNWA 1S6HA 1ABJH 2VVCA 1GJ7B 1Z8IB 1F2SE 2FOBA 5F6MA 1ARCA 1SQAA 3F9EA 3MU8A 3U8TH 2R0LA 5J4QA 1EFRD 2WPIS 2D26C 5A8ZA 3M7UA 1GL0E 1MAYA 1QURH 2GMTC 5JBAS 1NS3A 1JIMA 2R2WU 2BY7X 3TPIZ 1PQ8A 1NM6A 1XUKA 4B73A 1Z8GA 4OM9A 2YMSC 1HDTH 1UHBB 4UFFH 1FPHH 5DN6D 2VBCA 1FUJA 4IGDA 1C1VH 2A2XH 1C1QA 5C17A 2OINA 2A5IA 3DT0H 3DA9B 2F9VA 3VG8A
chains in the Genus database with same CATH topology
2HALA 3CS0A 3UFAA 1A61H 1GG6C 4KTUA 3PYHA 1O37A 1D3QB 1MKWH 1HAYB 1FIWA 2UWLA 1CA8B 1Q2WA 1GHBF 1O2PA 4E05H 2VWOA 1RTLA 3V12A 3ZZ8A 1LTOA 2TGPZ 2ANYA 1KXEA 5FCRA 3V13A 1O5GH 2HPQH 4IC6A 3A87A 3M5NA 3GY2A 2FZZA 3CP7A 1KLJH 1NFXA 1C2LA 4AFUA 4NIYA 4JK6A 4KP0A 3Q00A 4JYVH 3TNTA 5DP5A 2ZF0H 3MU5A 1XVOA 1AKSA 4YOIA 2AGGX 1O2WA 2ZFFH 1ELFA 5FX5A 1O31A 3U9AH 1C5UA 1C5SA 2FDAA 3GY6A 2BYAX 1O32A 2FOEA 1W3CA 3KF2A 4MNXA 1OWDA 1IQHA 3PV4A 1HNEE 3RXPA 3RXEA 2IJOB 2W26A 1THRH 4KELA 1WBGB 1TNKA 1DWDH 1GI0A 1O3HA 2QGRA 1HAOH 1B0EA 1G2LA 3ENSB 4INLA 3SGBE 1BUIA 2GDDA 2NU0E 4NFEA 4CRBA 2FIRH 1XUJA 3K6ZA 2FEQH 5PTPA 2BLQA 1OWJA 1FY1A 3NWUA 4JZDH 1W14U 3BTKE 3I78A 1ZSLA 3QGNB 7GCHF 1ELAA 1GBCA 1C1PA 4Y8YA 1GVZA 1FY4A 3DFJA 3E0PB 4THNH 3D49H 1BJUA 4WY3A 4MDSA 3P8GA 5DK1A 4DY7B 1P10A 8GCHG 1EJNA 1Y3UA 2ZU5A 2BVXH 2LPRA 3E6PH 1Y59T 4XFQA 1TMUH 5ESTE 1MZDA 1ZPCA 4LZ4B 1RRKA 2R2MB 5AF9H 1EP6A 3RU4D 1HLTH 2Y5FA 1LHFH 2XBVA 1SGDE 1O5BB 2IPHA 2SFAA 1MU8B 2QIQA 4DT7B 1ZSJA 2Z9IA 3M37A 4MLFB 4AGKA 1C2GA 2ZEBA 1MZAA 4Z6AH 1EAXA 1W11U 2Y81A 4X6PA 1MKXK 3A89A 3SGAE 1K21H 2NU3E 3BIVH 3SBKA 3TK5A 1IHTH 1UTLM 2BQ6B 1TGTA 1QHRB 5G4BA 1K28D 4NSYA 2F9PA 1GJ9B 2FMJA 1SHHB 1RFNA 1IQNA 4NG9H 4BNRA 3FZDA 8KME2 1V2NT 1F5KU 4TYDA 1ZZZA 1A1RA 3MNCA 1C2HA 3FFGA 3SU3A 2A4QA 4I33A 3H7TA 6ESTA 1GMHG 4HI3A 4ABFA 1G3EA 1PFXC 4TWWA 4WMEA 1HB0B 2SGPE 2H9EH 3ZZ7A 1IQKA 2FOFA 1YBWA 2ZGHA 1O5DH 1INCA 1UTKA 2ZHQH 4CRFA 2ODYB 4IN2A 1VGCC 3R3GB 1AE8H 5HM2A 4UFDH 1FAXA 2OC8A 2ULLA 3OYPA 1O5CB 4JZEH 1MMJN 1MKXH 1P2KA 4KGAA 2OD3B 2B8OH 4BXWA 1JBUH 1C2EA 1F0SA 1HAXB 1D6RA 1OWHA 2AIQA 1TNGA 2CXVA 3QDZB 5EQSA 3OU0A 1MTNB 1G30B 1GBAA 1V2WT 1V2QT 1SGCA 4WMFA 1NY22 1O2KA 3A8BA 3F9GA 2J9NA 4DCDA 3LGIA 2R3UA 1QB1A 1UVTH 2OP9A 1C4V2 3DUXH 3LC5A 4AYYB 3SV2H 2B5TB 1Y5UT 1GBDA 2W3KA 1ZOMA 3JZ1B 1GI5A 1GI9B 2WUCA 2ZHDA 3MWIU 4ZKRU 3P6ZB 2FLRH 1DE7H 2HPPH 2JH6D 3OY5U 4YO9A 1PQAA 3BTHE 3PLBA 3AVZA 1IOEA 1BRUP 1L0ZA 2TGAA 1E34B 1O3CA 1SOTA 2OQ5A 2QV1A 1O2YA 1XUIA 5SGAE 1VR1H 3F9HA 3A83A 1BHXB 3T25A 2QN5T 3TNSA 3EQ0H 3GOVB 1N8OB 1TB6H 2Z9JA 1Y3VA 5JB8S 3LGTA 1ESBA 2BDHA 1SGIB 1OXGA 1G2MA 1T8MA 5AHGH 2VB0A 1SGQE 5F03A 5GXPA 4YESB 4BXSA 1FJSA 3PO1C 4AYVB 4OS1A 3RP2A 1BMLA 1HPGA 2BLWA 3NK8A 2Y6TA 3LONA 3GCOA 3MH5A 4YT7H 5GDSH 1A0HB 5A8XA 2HNTC 4D7FA 1MH0A 4AX9H 3L6PA 4IW4E 1RJXB 1DWCH 1HIAA 5GCHF 2JETB 1C5TA 3ZV8A 1A46H 3RXGA 4BOHA 1GDUA 3AW1A 1IQGA 2ZO3H 1BRBE 2P59A 3BTEE 1O3IA 3LGVA 2ZFSA 4BAKB 1EP5A 1DT2A 1P03A 1W7XH 1O2NA 3M3TA 4ZKNU 2GT8A 4AB9A 3SJOA 2EI8A 1NRRH 1SQTA 2ZQ1A 4GCHF 4OGYA 4I8HA 1SSXA 2XNIA 2VIQA 1ZR0A 1OOKB 1AE5A 3VB7A 1P2JA 1C2JA 3RXMA 1C5WB 2C8ZB 1ZHRA 4H6SB 3UQOA 1G9IE 1O3BA 3P8NA 3S7HB 4QT8C 2BMGB 5GPIB 3GY7A 1C2KA 4Y71A 2C3SA 5EODA 1TGSZ 3STJA 4ABHA 3TIUA 2DE9A 2B0FA 1PJPA 1OP0A 1HUTH 1WV7H 4ABAA 3ZZ4A 1AZZA 4Y10E 5F8ZA 1GVKB 1GJAB 3SV8A 2SGAA 4AGJA 1TPPA 1MU6B 1EJMA 5T6DA 1P11E 4GSOA 5DP3A 2WINI 2O8LA 1QRZA 4UE7H 1UCYK 2FS9A 5HM9A 2VIWA 1F5RA 1TA2A 1FV9A 3R0FA 3UUZA 4X2VA 5AVDA 3LGUA 1Y3YA 1SQOA 1LPZB 3C27B 1UJ1A 2DUCA 3RXJA 3A82A 3RXQA 1AD8H 5EQRA 3TGIE 2BDIA 1N6XA 1VITG 3MH4A 4OS5A 7LPRA 1QBNA 4CBOA 1GBLA 1BOQA 1SOZA 1EZUC 5DPAA 1S84A 2IN2A 2W7SA 1XM1A 2OC7A 3M5MA 1GBMA 3A7XA 2ZHWH 1SGYE 1E37B 1PPCE 4FUCA 1GBIA 2PKSB 1O30A 1GHVH 1QFKH 3FAOA 1K1OA 1PPZA 2HOBA 1LKAA 1HAVA 1LMWB 3B9FH 2ZCLP 4K8BA 2Q6DA 3M3VA 4RSPA 1TPAE 1GJCB 1VCQA 1XUGA 1OWIA 1O2RA 2ZIQH 2TGDA 1MTVA 3SO3A 5DP7A 2FYRA 3P17H 4B2CA 4A5TS 2ZDLA 1QA0A 3O8BA 3RMMH 1YPKH 5GWZA 1BBRE 1LHCH 1BCUH 5EPNA 1HAVB 1UTOA 2VU8E 2Z9LA 3RXFA 1C5XB 1LVBA 1S6FA 1DXPA 1KSNA 4O3TA 1P2QA 1GJ8B 1O3JA 1SLVB 1HJAC 3A85A 1BBRK 1X7AC 2A45B 1J15A 1MBQA 3DD2H 1FZZA 1O3OA 4LXBH 2ZNKH 3MYWA 1CA0C 2GD4B 1GL1A 3S0NA 1C5LH 5A0AE 1P09A 3FP6E 1J17T 1O3MA 4ABJA 2HNTE 3TU7H 1A4WH 1QR3E 2BDYA 1LCYA 3T27A 1TWXB 1NU7B 1V6DA 3I77A 3ZVCA 1BIOA 2ZC9H 5GJ4B 1TFXA 2ANKH 4ZROA 2CGAA 1UK4A 1ELCA 1XMNB 2Y7ZA 5IYTA 3S9CA 1H4WA 1AFEH 4B2AA 5FPYA 3SJ8A 1DX5M 1QJ7B 4K1SA 3ZVEA 3Q76A 2B7DH 1F5LA 2AH4X 3UR9A 3UTUH 3W94A 1TBRH 1UHBA 2ZWLH 1O38A 2BD7A 5LGOA 2VWNA 4MTBA 2ZDAH 2BDCA 1CBWC 3RMNH 3UREA 1A5GH 1GI2A 1NZQH 3U8OH 2JKHA 2ZGJA 2AMDA 3U8RH 2A7CA 2XYAA 4YLUA 3MTYA 1C5NH 4OS4A 1K1IA 3CENA 2ZECA 3HGPA 5LPRA 1WYKA 1A2CH 3PWCA 5BRRE 2P3UB 2Q1JA 3GY8A 1F0UA 2IOTA 1JRSA 3MNXA 2P8OB 3LJOA 1TALA 4YOJA 1P02A 4DURA 2BD5A 1QIXB 4WH8A 3MO3A 2QF3A 5T3HA 2C93B 1AO5A 2Z3CA 1G32B 4DGJA 1ZHMA 1P3EA 2BZAA 4TY6A 1TYNA 1C1MA 4GAWA 1BTUA 3E16B 2G00A 1GBBA 3RXDA 1AWFH 5A0CA 1YPHC 1AI8H 1Y5BT 1PPGE 2SNVA 1FAKH 4YT6H 1V3XA 1D9IA 1QTFA 5EGMA 2F83A 3LT3A 2GT7A 3KHVA 4NIWA 4ZH8A 1NRNH 3F68H 1LO6A 1SHYA 4XE4A 4FUFA 1V2JT 1OWKA 1DWBH 1W13U 1YYY1 2BLOA 3M61U 3VB5A 3K6YA 4TWYA 4AFQA 1O3EA 3RXHA 3U69H 3V7TA 5L6NH 4I8GA 1TRMA 5A2MH 4X8TH 2BVRH 1GI6A 2WPMS 4TPYA 4UDWH 4CREA 4BAQB 4MPUA 1O39A 2ZPRA 2ZKSA 2HVXA 4B1TA 1O5FH 2PWXA 1Y3WA 3MOCA 4OGXA 1GPZA 4FU7A 3ZVFA 1N8OC 2ZGCA 1FNIA 2ZI2H 1DANH 1NRQH 1P2NA 3CS7A 1KYNA 3RMLH 3SNDA 2ZHFH 3L3TA 1ZTJA 1F7ZA 1GCDA 3A81A 2A7HA 3BTFE 3RLYH 3BV9B 2GDEH 5T6FA 1CO7E 1KDQB 2GV7A 3BTWE 3BTQE 1S85A 1O35A 3PM3A 5F8TA 1T8OA 1EAWA 1XUFA 2SGFE 3HATH 4X0WU 1V2LT 3MU4A 2PFEA 1SGNE 3RXSA 4NSVA 1MCTA 5DJ7A 5CHAC 1UVOA 3SN8A 2WPHS 3T26A 1AUJA 2GMTB 4XBDA 1SC8U 1BB0B 3KEEA 1T8LA 2XTTB 2OXSA 2OCVB 1P8VC 1RS0A 2V0BA 1XKAC 2FI3E 1CT2E 2UWOA 2BY5X 3BTTE 1GJ5H 4R8TB 1NRPH 1YC0A 2EA3A 3S7KB 4X2YA 1GI3A 2EI7A 4Y0YE 4I32A 1GMDG 1K2I1 3I29A 4CR5A 2P95A 3TH2H 1D6WA 2BY9X 1O3FA 4NIVA 1GHWH 1PPFE 5GIBA 4CRGA 1MD7A 2PKSC 2QA9E 4KKDA 2ZFPH 4VGCB 1K1PA 1HAPH 2FOHA 1LHDH 3ATLA 5GCHG 1IQJA 2ZGBH 4XOJA 9LPRA 2Y7XA 1EXFA 1DUAA 1DS2E 1KXCA 2FI5E 2BM2A 2Q6FA 1ZYOA 3TGKE 5EPYA 3SUDA 1P04A 4DG4A 4Q7ZA 2WYGA 2PGBB 2ALPA 4F4OC 1GBHA 1UVSH 2H5DA 1EPTA 1FMGA 4NA8A 1LDTT 4E7RG 3UQVA 1AFQC 1QGFA 3FP7E 2BXTH 4GUXA 3PLKA 1V2MT 1UTJA 2QXIA 1GCTB 2AIPA 3RXRA 2Z3DA 4MVNA 1P9UA 1P05A 2ZCKP 4MNWA 1HCGA 2ZG0H 1DICA 3URCA 4B74A 4ABDA 1HV7A 3E1XB 2ZTYA 3RLWH 2PTCE 1WU1A 4BTTB 4FXGH 5FHTA 4MPXA 1QB9A 3UIRA 1LHGH 1UVPA 3SU5A 2VH0A 4ISHH 3E91A 4JK5A 4SGAE 1YGCH 2VVUA 4JMYA 2H1UA 5AFYH 2NWNA 4FUBA 4FUGA 1XUHA 2BDAA 1J9CH 2A4RA 3S9BA 1NESE 1YPGH 1TONA 3B23B 3SQEE 3M7TA 4NZLA 3T29A 1EZXC 1C9TA 1O2HA 1UCYH 3SV9A 5EOKA 3SJ9A 4JCNA 4IBLH 2BVSH 1P2MA 2F9BH 1KY9A 1ZRBA 2GP9B 1YCPK 2RA0A 3ZVDA 4K60A 2XRCA 3E8LA 4O97A 3FZZA 2WYJA 3M36A 4ABGA 4DJZB 1WUNH 3RU4T 5L30H 3QN7A 1FN6A 1DUEA 5ABWA 2UUYA 2FM2A 1O0DH 1QBOA 2C8YB 1O34A 2TPIZ 2ZHEH 3PWBA 4XSKU 4ZAEA 1WOFA 2TIOA 1DVAH 1EAIA 2HGTH 1NO9H 2PKAB 1TMTH 4ISOA 1TBZH 1VITF 4X1SU 1BTWA 1LKBA 1O5AB 4A1TA 1JXPA 3BG4C 2TRMA 4O9VA 4ESTE 5DP6A 2ZU4A 4D7GA 1IQIA 4NA7A 1ANCA 2UUJB 2XBWA 3GYMA 2C4FH 2A5AA 1DY9A 1ZGIA 4X8UH 1SGFG 3GCHC 2W7UA 1WTHD 1V2VT 2Y82A 4WWYA 1RTKA 3B8JA 1HAZB 1C1UH 4TY7A 4YLQH 1WSSH 1K1LA 2G55A 3U98H 4E06H 5JBTA 1Y5AT 1ZSKA 2XW9A 1A5IA 1TABE 2M5TA 1O3AA 4H6TA 2FLBH 4SGBE 3RDZA 2BD4A 1CBWB 4Q7XA 4DVAU 3EAJA 1TX7A 3GDSA 1TNJA 4AOQA 1OYQA 2FO9A 1S5SA 4Q2KA 3GCTF 1UTMA 3SU0A 4B75A 1Z6JH 2O8WA 3A8DA 5LPFA 1EQ9A 1ELDE 1GHZA 7ESTE 1O3KA 2FOAA 1O3PB 4X2XA 5FCKA 1ZJDA 2XBXA 1KXFA 4ZXYH 2VGCC 3ZYDA 1AWHB 2FOMB 3D23A 1IQMA 5HMAA 3BN9A 1P06A 2FESH 1VCWA 5FAHA 3A8CA 1BA8B 1HJ9A 2CMYA 4LOYH 1Q31A 3FANA 2BHGA 3SQHE 4CHAC 1HBTH 1YKTA 2OLGA 1T8NA 4NCYA 2AFQB 4NA9H 5FBEA 3VB3A 2F9UA 5EQQA 2NU4E 1ELTA 2BD8A 3QLPH 4CR9A 2EC9H 3TJNA 4Y79A 1HAHH 2UUKB 4X8SH 1IAUA 2TBSA 1BQYA 1C1OA 1Z71A 1UTPA 2BDBA 2O8TA 2XBYA 1SGTA 1FDPA 1CGHA 5DG6A 3LGYA 4B2BA 1T31A 1W7GH 4CRAA 4Y8ZA 4UD9H 2O8MA 1EZSC 1GHXH 4OS2A 6LPRA 1P12E 2OBOA 2TGTA 1QRXA 2P16A 3TJOA 1NRSH 3HGNA 1AMHA 1PPEE 2H9HA 2BY8X 1EPTB 1O2ZA 1ZPBA 1BTXA 1HJ8A 2FXRA 1A5HA 3JZ2B 3TJVA 3HKIB 4Q80A 1H9IE 2ESTE 2BOHB 1MQ6A 3HPTB 3ODDA 1LVYA 1TIOA 3M5LA 3LIWA 3EA7A 1ZTKA 3OSYA 5CE1A 5E0HA 1MD8A 2O9QA 2W3IA 2A5KA 1M9UA 5EXNA 1E35B 2KAIA 4BAMB 3N7OA 4KTCA 1C1NA 1OP8A 5E0GA 3KQCA 1HXFH 1UVUH