2O8TA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q) in complex with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
231
Chain Sequence
IIGGEFTTIENQPWFAAIYRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase plasminogen activator
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
total genus 52
structure length 231
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA01
1O34A 3TGKE 3CS0A 1W13U 1O2SA 1VCPA 2ZPRA 3A8DA 3JZ1B 2GKVE 3RM0H 3ZVAA 1SOZA 2C4FH 2H5CA 1GHZA 1KSNA 1UK4A 2ZIQH 3EYDA 1QRZA 3TJOA 1GG6B 5ESTE 1PPEE 4XOJA 1NU9A 1DSTA 4QT8C 1SQAA 2FDAA 2LNCA 1JOUB 1G37A 1FIZA 4I32A 5G4BA 1A0LA 1O39A 3ZV9A 4B75A 1EJAA 1D3DB 4AZ2B 1PPBH 2ZPQA 2XC4A 1CSOE 1GCDA 1TGSZ 1O3LA 2D8WA 4WMEA 2PGQB 4TPIZ 2C8YB 1TIOA 2BX3A 5ETXA 3VFEA 2FP7B 1V2LT 4Y8XA 1HGTH 4CRGA 4ABBA 2ZPSA 4I8JA 4XE4A 1C5OH 1C1RA 1BJVA 3K65B 5HYOA 1C1TA 1GI0A 3SI3H 1Z7KA 1FV9A 4X8UH 3ATWA 2GZ9A 3RXEA 4NSYA 3RXTA 1TRNA 1JRTA 3KIDU 1ESTA 1MTSA 1P04A 4U30A 1CBWC 1C2GA 2UWLA 3P70B 2J2UA 3H7TA 1K2I1 4CREA 1CA0C 1ELTA 2PTCE 3ZVFA 3BTME 4GCHF 4FU7A 2AS9A 1B0FA 2WV5A 5GPIB 1H9LB 3SU6A 2A2QH 3SHCH 1NO9H 5HMAA 1O3KA 1TX6A 1FY5A 4LK4A 3SU5A 1G2LA 3TLOA 3KN2A 1HRTH 3RMLH 1TE0A 2GMTB 1B0EA 1F0SA 1AD8H 1AVGH 4K5ZA 1O2LA 2XBWA 1ETTH 4PROA 1DLEA 2BZ6H 4D9RA 1BJUA 4CRBA 1ELVA 1GMHF 1IQHA 2BZAA 1C9TA 4ABIA 1HDTH 3GY5A 4NIVA 1XUGA 4YT7H 2BVSH 2VGCC 4TWYA 1Z6EA 1ZRKA 1FAKH 4BAHB 1YPJH 4RN6A 2BDAA 2UUKB 3MMGA 1MTWA 1GL0E 2HWLB 2Z3DA 1QTFA 2ZCKP 1XKBC 1THRH 4GLYA 2CHAC 3MOCA 4KKDA 4CH2B 1GJ9B 2VWMA 4GUXA 3A8BA 1RTFB 1F0RA 2ZU4A 1DM4B 3GY2A 2J9NA 5E2OA 3UTUH 3GDSA 1PYTD 1SQTA 3KQBA 2A5IA 3RDZA 5CHAB 1NPMA 2HVXA 4ZXXH 5TJXA 1B5GH 1LQDB 3P17H 4DY7B 3BV9B 2GGVB 1P3EA 2FX4A 4ISOA 5E2PA 2OBOA 2VVVA 2F9UA 1ZJKA 1O2VA 1C5MD 2BY6X 2JETB 1FPHH 4IMQA 3TU7H 1TOMH 4ZHLU 1P0SH 1A5HA 4NG9H 1THPB 1GJAB 2SFAA 3SQEE 8LPRA 2CMYA 2J95A 1C4V2 1CQQA 1ZHMA 3SNAA 3A8CA 2O8LA 1MKWH 5EXMA 1ZSJA 3QO6A 3F9FA 1GBAA 2UUYA 2V3HH 1O3EA 3PMAB 1PQAA 2VNTA 2BB4A 2O8TA 3PTBA 2PFEA 3LC5A 3PB1E 3BIVH 2P3TB 1QY6A 2QXJA 1QBVH 2Q6FA 4BANB 4B76A 4VGCB 3RMOH 3HPTB 1V2OT 4NA7A 1SG8B 1X7AC 2IN2A 4TY6A 1BMMH 5I25A 1O2UA 1ANEA 3MH5A 3QZRA 1BTXA 1C4U2 5C3NA 3T2NA 2PKAB 1SLXB 4FU8A 4X1RU 4X2XA 3VGCB 4ZMAH 1VR1H 1C1VH 1C1UH 3M7QA 1C5QA 4ABAA 1O38A 5LPEA 3E16B 2XBVA 4DIIH 1E38B 1HAYB 1O31A 4IBLH 1MZDA 3KQDA 3V13A 5LPRA 1C1PA 1BB0B 2QY0B 1CGHA 3VB4A 2WYJA 2TGAA 3D62A 1E0FD 2F91A 2AGEX 1Z8JB 1Z1IA 3T25A 5HXFA 1G32B 1GVLA 4MLFB 3R3GB 3QTOH 2ZGJA 3ZYDA 2V6NA 1P2MA 1TONA 3BEUA 3UQVA 3SJKA 1P2IA 3IITA 1P3CA 5C1UA 3S0NA 1PQ7A 1BRAA 4I31A 4ABGA 4AYYB 5T6FA 2VWNA 3QLPH 3ZZBA 1A46H 1LVYA 3BTEE 4DVAU 1BT7A 1THSH 1S0QA 4X8SH 1AN1E 5FPYA 4UE7H 2ZTYA 1Z8IB 1D4PB 2J38A 3KCGH 1CT2E 1P9UA 3AW0A 4K69A 3K2UA 1FMGA 1ZSKA 4X2WA 2WPIS 1A1RA 1LPGB 4GHTA 4X6OA 1BHXB 2VIDA 4GHQA 2AH4X 2CF8H 1GBBA 4E05H 1TBZH 4Y0ZE 2BXTH 4NGAH 3S9CA 2B5TB 4YZUA 1IQIA 1OWIA 3UWIA 2H9EH 1BUIA 1XXDA 4AB9A 2VIVA 1TBRH 1V2QT 1DOJA 2R3UA 4Y10E 3E6PH 2QCYA 3SNDA 2BDIA 1QA0A 1YPHE 2ZNKH 2ZFSA 1FI8A 1L1GA 3SJ8A 3RXRA 1NRPH 2A4GA 1NRQH 1WBGB 1K21H 3FZDA 5T6DA 2PKSC 3V0XA 3LC3A 3LPRA 1ZRBA 3PYHA 1VCWA 1FY3A 1L4DA 1DSUA 3SORA 2PWXA 3ZZ9A 1YCPK 3SJ9A 2OCVB 1J16A 1KXDA 1O5CB 4IMZA 9ESTA 3B8JA 1ELEE 1AZZA 1J15A 3TJUA 1KXCA 2BLWA 3O8DA 4FUCA 3U1JB 1EXFA 1GBMA 3RXKA 3FP6E 2A4QA 2OC0A 3SU2A 5EXLA 4FVDA 4E06H 2PSYA 1C5UA 3QTVH 2OXSA 4JMYA 4BAQB 1GI1A 3MH7A 3RXLA 3SU1A 1BRUP 4H42U 3MYWA 2GVFA 3PLKA 4XDEA 3ZZ6A 3F6UH 1CA0B 1S6FA 4AX9H 5FCRA 1GHVH 4Q80A 2ZP0H 2B8OH 1Z6JH 1MAYA 1HJAC 2RA3A 3P95A 2QIQA 2RA0A 4X6PA 1TWXB 2WYGA 3AVZA 2CF9H 2QYIA 3EA7A 3TH3H 6CHAC 3E90B 1YLDA 4I8LA 3QUMP 1GBEA 3LGTA 2WUBA 3VB3A 2O8UA 3LGYA 1W10U 2Z7FE 4AORA 1P01A 2BVXH 1NFWA 4AG2A 1C2KA 3UPEA 1TABE 2SGEE 3RXBA 1Q2WA 3PMJA 4SGAE 2ZDAH 2R2MB 4HI3A 2VIOA 2VGCB 2V35A 2ZTZA 1GJ6A 3A7WA 1GHXH 3OX7U 4AYVB 5GWZA 3K6ZA 5C1YA 3ZVBA 2O9QA 3KGPA 5EPNA 2EI6A 1BTZA 4KGAA 4OS7A 3RXAA 2NU4E 1D9IA 1FONA 3EGKH 1UHBB 5DJ7A 3D49H 5J4QA 1P09A 1BHXF 1C5ZB 2CHAB 1LTOA 1EPTC 1GBLA 3LGWA 4XBDA 2BD3A 1GBCA 2YNAA 1SFQB 4BXSA 4JZIA 3SOSA 1W0YH 4TY7A 2Z9GA 5HM2A 1C2HA 3T29A 4GCHG 4INKA 1MQ5A 4THNH 1GHYH 5FXLA 1PPZA 1ZMNA 2XBXA 2H5DA 2A7JA 2D1JA 1T4VH 1S85A 1TQ7B 1PFXC 1ACBE 3U9AH 4I7YH 2C90B 1V2VT 1F2SE 2C8WB 1G3EA 3PROA 5GXPA 1WQSA 1N6YA 1SC8U 1P11E 2VVCA 2Z9IA 1SSXA 1KXAA 3QGNB 2Y7ZA 2FI5E 3IG6B 1GBDA 1P12E 1O5AB 1TPAE 2QAAA 2PW8H 3MO9A 1E35B 5E0HA 1O3PB 5DO4H 4K60A 4WF8A 3T26A 1KY9A 2ZG0H 1EAWA 3NWUA 3ZVDA 2Y5GA 4JZEH 4I8GA 5E8EH 4Q7YA 3SN8A 4CR5A 1UO6A 3RLWH 2O8MA 4OS1A 4BTUB 3KL6A 2XC0A 3GYMA 1BTPA 4UFDH 4BTIB 1EPTA 3F9GA 1TFXA 3TK6A 2ZHFH 1SGFA 3O8BA 5GDSH 4TPYA 1G3DA 1Y3YA 4B71A 3AASA 1V2WT 4ISLA 1N8OC 1BBRK 3PV4A 1ZGIA 1FLEE 1TLDA 1EATA 1GBFA 1DX5M 2P95A 2G8TA 1CT4E 4MPUA 3GDUA 4LXBH 2C8ZB 3HGPA 1SGDE 1FJSA 5C20A 1CU1A 1TPSA 3MH6A 4A1TA 3MU8A 2ZU3A 1K1JA 2QXGA 2G00A 3T27A 1SGTA 3QDZB 1CHOG 1QHRB 1FZZA 1P02A 7ESTE 4BXWA 2XRCA 3D65E 1RRKA 2Q6GA 2ZQ2A 3HKJB 2AEIH 1RTLA 1UTPA 3Q76A 3KQCA 1YPMH 2XTTB 3SUDA 5I46H 1T8MA 3QZQA 1Y5AT 4INHA 4D76A 1SVPA 2XBYA 3RXCA 2GD4B 1O2XA 3ODFA 4WH6A 1HBTH 1UMAH 3LIWA 3UR9A 1EOLA 4UDWH 4BNRA 2A2XH 1O2WA 1IQKA 4Y79A 4FU9A 1K22H 2XCNA 2BMGB 2W7UA 1NFYA 1RS0A 1W12U 1O30A 3SNEA 3PO1C 5EODA 1MTNC 3FVFB 1TRYA 3RP2A 4ZXYH 3UOUA 3BF6H 3SUFA 3UY9A 1DWCH 3RXUA 4B2CA 2SGAA 2XXLA 3ZZCA 5TCCA 4R0IA 2ZQ1A 1H8IH 1GJDB 2FIRH 5SGAE 2Y80A 3TK9A 1IQFA 1CO7E 1UCYK 2H1UA 3LJOA 1FAXA 2PHBA 3HKIB 1LHGH 3BTTE 1YM0A 1SBWA 4D7FA 1Y3XA 3E0NB 1IHTH 1P2NA 5AFZH 1ABIH 1AKSA 3K6YA 1W8BH 4I33A 2A32A 3M3TA 4LOYH 1OWJA 4R8TB 4F49A 1A3BH 1SGCA 3M61U 1GDUA 1HNEE 3GICB 2ZCHP 1FIWA 2ZWLH 4OS5A 2ASUB 4D7GA 1OYTH 4B74A 2RDLA 4KTCA 4IGDA 3RXHA 1C1OA 4WJG2 2A4RA 4K8YA 1AGJA 1LVBA 1TMBH 2B9LA 1BDAA 2DUCA 2UUJB 4JK5A 1IAUA 2Z9JA 1O2TA 2ZGBH 3A82A 1PPCE 3ENSB 2NU1E 5A8XA 1RGQA 3E0PB 1O2OA 3TPIZ 4OS4A 1QQ4A 2NU2E 1JWTA 3M5OA 1ID5H 4U01A 2PKSB 3DHKH 3Q3YA 2HRVA 3S9BA 4FXGH 3KNXA 2FODA 2RCEA 1OS8A 1G30B 3SU3A 5ABWA 1TNLA 4X8VH 1L0ZA 2A31A 1A5IA 2XCFA 4DIHH 3SNBA 3UUZA 1QRWA 1A2CH 1SOTA 1FY4A 1ANDA 3LT3A 4X2YA 4LZ4B 4O03A 1S81A 3GY6A 1BRBE 2FEQH 5JBBS 1VITG 3P6ZB 1PPFE 1E34B 1NN6A 1LPZB 1QB9A 1UVTH 1TALA 4MNXA 5TCAA 8GCHG 1TNKA 1H8DH 1C2DA 5DP9A 1AUTC 1NS3A 1KXEA 2OBQA 4AB8A 1JMOH 1MTVA 4UFEH 1SL3A 2G4TA 1BOQA 1HV7A 5C5OA 1LQEA 1SHYA 2JH0D 4RKJB 4Y11E 1L2EA 4HFPB 4K3JA 4NZLA 1GWAA 4J1YA 3GCHC 1C5NH 1EAXA 1KLIH 2VWOA 3A7ZA 4CH8B 3DD2H 3FP8E 4MQAA 5DP4A 5GCHG 1HJAB 3VXFH 1RJXB 4A5TS 1YPEH 4K1EA 4NWLA 3GCTF 2DE8A 3SHAH 2Z94A 1TNGA 1ZGVA 2XYAA 6CHAB 4Y8ZA 4CRFA 2R2WU 1LHDH 4FUDA 1IHSH 1CHOF 1OSSA 1QB1A 1O2NA 4Y8YA 4O3UA 2STBE 3LH3A 1C5WB 3ZZDA 1P2QA 3P8GA 2GTBA 1AUJA 2FX6A 4ZROA 5A2MH 1CA8B 5EQRA 1Y3VA 1KYNA 2BLVA 3SV2H 1SGFG 1KLJH 4MPXA 3MHWU 5E0GA 3ZZ7A 4X6MA 3EQ0H 2D2DA 5AVDA 1GI2A 3PTNA 3ATMA 2OC8A 2EEKA 3D23A 4JZDH 1FY1A 1EASA 1BBRE 2P16A 2EI8A 4FUIA 1Z8GA 1TNJA 1SGEE 2Y82A 1S0RA 2F9PA 2ZECA 1NM6A 1YPKH 1LVMA 2AIPA 5LPFA 3ZVGA 1TYNA 1QFKH 3MWIU 1OP0A 5J4SA 1OOKB 2V3OH 2BLQA 3QX5H 1ZJDA 3GCNA 2QA9E 3TK5A 3ZYEA 3RU4E 1HIAA 3HGNA 1S83A 3GY4A 1P2KA 1V6DA 1EPTB 1TA2A 2STAE 1OWHA 1YLCA 2XC5A 3ODDA 5HGGA 2BQ7B 1QR3E 3PMBB 1HXEH 1G3BA 1WTGH 2GDDA 1PQ8A 1GL1A 3A81A 3VB5A 1BTUA 1GI7B 1P10A 2OUAA 2QXHA 2R9PA 4JZFH 5AFYH 3FP7E 5DG6A 1DWDH 4K8BA 4FUHA 2OQUA 2XWBI 3OYPA 1DUAA 2ZFPH 1GI5A 1K1OA 1UVSH 1QBOA 1CHGA 1P2OA 3NKKA 4MPWA 3GYLB 1TMUH 1ELDE 1T4UH 1C5VA 5AF9H 2UUFB 3U98H 1UTOA 3ZVCA 1O0DH 2OQ5A 2ZDKA 3MU4A 1E37B 1O3GA 1YCPH 2FZZA 5BRRE 2VH0A 2GZ8A 1EKBB 3BEIB 3SJOA 2FESH 3M5LA 3TVJB 2ZGHA 5B6OA 2ZO3H 3C1KA 2FS9A 3QWCH 1PQ5A 1QGFA 1V3XA 1ELGA 1KXBA 1GMCF 1JBUH 4X8TH 1ELFA 2SGFE 4GSOA 2G5VA 2ZU2A 2SGPE 1SR5C 1ANCA 1L4ZA 3O8CA 2ZHEH 3UIRA 1N8OB 1C1MA 1QL8A 1ETRH 4WXIA 1AWHB 2BDBA 1DPOA 1W0ZU 3GY3A 2H9TH 3F9HA 5EW1H 2BVRH 2IJOB 1AI8H 2FS8A 5L30H 2ZCLP 3BG8A 1GBTA 4CHAC 3HATH 2YOLA 3RC6A 1ORFA 2PGBB 3MI4A 3BG4C 3A83A 1HAVA 1O2MA 2FOGA 1K1PA 1TPPA 4MNVA 1UTNA 1VITF 3RXMA 3BTDE 3T5FH 1VZQH 1XUFA 4NIXA 4UFFH 7LPRA 1AE8H 1V2ST 1NESE 3ELAH 3LGUA 1O2JA 2GCTB 8GCHF 1UTMA 4Y76A 3GDVA 5GJ4B 2VWLA 1O5DH 1P05A 3RXIA 1SGRE 1ELAA 4OS6A 3E8LA 5A8ZA 4YM9A 3VEQB 1MKXK 3FZZA 3LU9B 1XUJA 1AMHA 1NC6A 2EA3A 2FOAA 3TJVA 3E1XB 3NK8A 1LHCH 5GCHF 3P8FA 3PO1B 5PTPA 5EXNA 1MTNB 1NZQH 1SGPE 3BIUH 1M9UA 1GVZA 2GCHG 2Z9LA 1AB9C 1W7XH 1MKWK 2P93A 5BPEA 1Z8RA 4XBCA 1NRSH 5F6MA 3U1IB 8ESTE 1C1QA 3G01A 1K1IA 3A84A 4J2YB 3B9FH 2W3KA 4HGCA 1W3CA 1O3CA 3MNBA 1D6WA 1YGCH 4FUJA 1AIXH 2VIWA 1NRNH 1HCGA 2Z3EA 3RU4D 2TGDA 2DE9A 1ELBA 3IWMA 1BMLA 3BEFB 2SNWA 2NU0E 1O3MA 3KQEA 5C67A 4XFQA 1LPKB 4B73A 3H5CB 3MO6A 5E0JA 2FOMB 5FAHA 1V2NT 3RUOA 4CBNA 2ZKSA 2QC2A 3TNTA 1WCZA 1UK2A 2P59A 1CGIE 1GI6A 2FWWA 3SI4H 2OLGA 3R0FA 2QN5T 2XNIA 2WINI 3MNXA 3ATLA 3SJIA 2BYAX 1NFXA 1NRRH 4AFQA 1IQLA 1EOJA 2F83A 2HNTF 2ALPA 5FHTA 1L1NA 1QNJA 3P8OA 1BQYA 1L1JA 2BDGA 4U2WA 4ABFA 1OWKA 2ZFRH 1J9CH 3GISB 3BSQA 5DP8A 2OP9A 2FLRH 4KELA 4Q2KA 1BBRH 1YPHC 2BXUH 5EQQA 1W11U 4BOHA 2G51A 1HAZB 3ZVEA 2AERH 2A7HA 1GHWH 3F1SB 2A7CA 3UNRA 1TB6H 5L2YH 1XUIA 4Z6AH 3S7KB 1OYQA 1P8VC 1KLTA 5FX6A 4B1TA 3OU0A 2ALVA 1KIGH 2FOFA 1LCYA 3ATKA 1ZLRA 4B2BA 1WU1A 2FOCA 1O33A 2FTLE 2KAIA 1C2FA 3LOXA 1YKTA 2TIOA 1DUEA 2FI3E 5DGJA 1IQEA 2C93B 2A5KA 2BD5A 4O3TA 3TITA 2OINA 3PLPA 4AGKA 3GCHB 6GCHF 1AU8A 2ZC9H 3M3SA 4Y0YE 1HIAB 3W95A 5FBIA 1EP5A 1TNHA 1XUHA 2C8XB 1FNIA 4RKOB 3SQHE 1MCTA 1SMFE 4YO9A 1D3PB 1TBQH 4KTUA 2UWPA 2BD7A 4Y7BA 1SGYE 1RTKA 5DP5A 1GDQA 3PLBA 2R3YA 4DOQA 2HPPH 3V3MA 1O2YA 1IOEA 1ZTLA 1CGJE 3O8RA 2J92A 4Q7XA 2B0FA 2G81E 1JXPA 1HAIH 5A0AE 2R0KA 1C2MA 1LHFH 5EGMA 5K0HA 2QF3A 1GJBB 1OWDA 5JBTA 1O3BA 2CGAA 4IC5A 3RMMH 1TX7A 2ZHWH 4CRCA 1WTHD 1G2MA 4SGBE 1UVPA 1K1LA 3Q3KA 7KMEH 4YOGA 1YF4A 3SV7A 3SV6A 4K1SA 3OSYA 3I77A 3LJJA 1K28D 5FPTA 3LGVA 4AFSA 1MZAA 3UQOA 2WPJS 1V2RT 2FI4E 1DWBH 1WOFA 5JB8S 2UWOA 2ZTXA 3MO3A 2YNBA 3ZZ8A 3A88A 2HNTC 1Q31A 4FUFA 1NU7B 1N1LA 2PTNA 1OKXA 1SGIB 2GCHF 3P92A 3SW2B 2J34A 1SLVB 1FPCH 3M36A 4X0WU 1P57B 2BOHB 1O3IA 1XMNB 1ABJH 2LPRA 2PUXB 4ZHMU 2GX4A 2R0LA 1TGBA 1PJPA 4E7NA 2I6QA 3T62A 2VVUA 1GMDG 1ZZZA 5GIBA 5L6NH 1XXFA 4NCYA 4D8NA 1S6HA 3GCTG 1EZQA 1SI5H 3BTWE 1P9SA 1G9IE 1HAVB 1NROH 1TNIA 1YPGH 1LKBA 2Q1JA 2AIQA 1KDQA 1INCA 7GCHF 2PV9B 2CXVA 1HAGE 2TPIZ 1C2LA 2Z6BD 1NY22 4ZKSU 1GI4A 1BZXE 1TMTH 4NFEA 2VIQA 1V2JT 3QGJA 2GCTC 3BTFE 3ZV8A 2W5EA 3UOPA 2GT8A 1HAHH 2PLXA 2FYRA 2AGGX 2FMJA 2P8OB 1K1NA 1WUNH 4Q7ZA 5DP7A 1A5GH 3MNCA 3A7TA 1F5RA 4IN2A 3PMHB 2PKAA 1O5EH 1SPJA 2QV1A 5F8TA 1DFPA 1OP2A 1T8LA 1BMAA 4MVNA 4MG3A 4UFGH 3EA9A 2TGTA 1K1MA 1O3NA 1DVAH 1T32A 1Z71A 1C5SA 1EAIA 2AYWA 2Z3CA 1W2KH 3UR6A 1ZMJA 1C5TA 4CHAB 5H4IB 1Q3XA 3BG4B 3UWJH 1VGCC 1SHHB 2RG3A 3RXSA 1AVWA 1IQMA 3RU4T 2GV6A 2G5NA 3F9EA 2K1QA 1GBJA 4X2VA 1QJ7B 1WSSH 1E36B 2NWNA 2ZI2H 1MU6B 5FBEA 1LMWB 4X1NU 2BHGA 4I8KA 1SGQE 4CRDA 1OWEA 1LHEH 1GHBF 3SZNA 3U69H 4M7GA 1O35A 3CENA 4E7RG 2FOBA 2ZU5A 1O37A 2VJ1A 2XWAA 1C5YB 2BLOA 5JBAS 3M37A 1D3QB 2HGTH 4JCNA 1EJNA 2C3SA 3UNSA 2CV3A 1EAUA 3PWBA 1EJMA 1GMCG 3VPKA 1ZSLA 1AB9B 1PPGE 1PYTC 3SGAE 3RXVA 4A1VA 1IQGA 6ESTA 2ANKH 1OPHB 1N6XA 2H6MA 4WXVA 1V2PT 4KP0A 3EE0B 3MNSA 1TRMA 3URDA 2ZGCA 3TH2H 4Y7AA 1DWEH 2V0BA 2ZEBA 1GJ7B 1ESAA 3BTQE 1ZPBA 3SU0A 3JZ2B 4K2YA 1WV7H 2Z9KA 4HTCH 4ASHA 1GHAG 3STJA 4I8HA 1O2GH 4NSVA 2GZ7A 1ZYOA 5F8ZA 4DCDA 5IDKA 4MPVA 1YC0A 2OTVA 4NA9H 3U8TH 5EG4A 2BOKA 1IQJA 4WMDA 3U8RH 2FTMA 3RXJA 2BTCE 3NXPA 1KTSB 2VU8E 2KAIB 1XVMA 5T6GA 1NT1A 1P2JA 2ZA5A 3MU0A 3STIA 2TRMA 1J14A 5IYTA 3OY5U 1XVOA 3TNSA 1C2EA 3AAVA 2ULLA 4DT7B 1VCQA 4BAOB 1F92A 3MU5A 2BD8A 4YT6H 1XUKA 3A7XA 1AHTH 3TJNA 1HYLA 4WWYA 4MNWA 4DGJA 4FUBA 2IPHA 5C5NA 1GMDF 1O3DA 4H4FA 4DG4A 2NU3E 3U8OH 1SB1H 4A6LA 2SGQE 4TYDA 1OX1A 3L33A 1D3TB 3LKWA 3SGBE 3ESTA 5L2ZH 1HJ8A 1HFDA 1UTLM 2P3FH 1EB1H 1DXWA 1QL9A 2VH6A 3E3TA 4YTAA 1AY6H 1WQVH 1H4WA 3GY8A 1O3FA 3E91A 5CE1A 2BDHA 4IC6A 2JH5D 3TGIE 1V2UT 1FDPA 4NIWA 1GI9B 2F9BH 1CT0E 4A7IB 4OGYA 2ZFTA 1DITH 4GPGA 1WYKA 2J4IA 2H2ZA 2JH6D 4AG1A 4MDSA 3SUEA 3V7TA 1BRCE 3M5MA 2AFQB 2W3IA 1HAPH 2PSXA 1GJCB 2ZZUH 4FUGA 2F9VA 5AHGH 2M5TA 1V2KT 1DY8A 5F8XA 2SGDE 1O2ZA 1AFQC 1O5FH 4JYUH 1W14U 4ZAEA 1HXFH 3BTHE 1MKXH 2ZDNA 2FYQA 3Q00A 1GGDC 2AMDA 1MMJN 2BD9A 1YBWA 1KXFA 1LDTT 1GDNA 1SFIA 1SGNE 2JKHA 4UONA 1HPGA 3K9XB 4WVPE 5F03A 5FX5A 1V2TT 1K9OE 3C27B 3MTYA 4YLUA 2BX4A 2G52A 1TPOA 2ANWA 2ZGXH 1O32A 6LPRA 1RIWC 1UHBA 2Y81A 1MU8B 3UREA 2OC1A 4FUEA 1O2HA 2BQWB 1KDQB 1O2RA 5HM9A 1HAXB 3I78A 1HUTH 2FPZA 1OXGA 3ZZAA 1FQ3A 4MNYA 4MTBA 2VINA 3T28A 1YCPM 4ZUHA 2ODQA 1O3HA 2Y7XA 1LKAA 1EB2A 3GY7A 3RM2H 2ZHDA 4ABDA 2TGPZ 2ZFFH 2ZDLA 4ISIH 2BY5X 1QURH 2P8OC 1P03A 1O3OA 1Y5UT 1UCYE 1FUJA 2ZHQH 4A1XA 1XM1A 1EZXC 2OC7A 1C2IA 4GAWA 3DUXH 3NCLA 3Q77A 3I29A 1BITA 2CN0H 3EA8A 1CE5A 5EPYA 1HAOH 1F7ZA 1YP9A 2PUQH 1EQ9A 3RXPA 3AAUA 4X1QU 5JYIA 1GCTC 6GCHG 5JDUB 3Q3XA 4IS5A 3GCOA 1MAXA 1AO5A 2ANMH 1JRSA 3WY8A 2Y6TA 1TQ0B 3RC5A 1C1SA 4NZQA 4BAKB 3M3VA 3SGQE 2ILNA 1B7XB 1GHAF 1QL7A 1H1BA 3BN9A 9LPRA 3KF2A 2I6SA 1HB0B 3A80A 2P94A 1ESBA 1SQOA 1GVKB 1AWFH 3N7OA 1O3AA 2GP9B 3RXGA 1LVOA 1AKSB 4NIYA 1GG6C 1ZHPA 4IW4E 1NTPA 1JIRA 2EC9H 2D26C 4AN7A 5A0BA 1O5BB 3MU1A 1ZMLA 1RFNA 4F4OC 1C5XB 3ZZ3A 2ZDVH 3S69A 1Z1JA 1TGTA 3M7TA 3TIUA 1A0HB 2QXIA 2BDYA 1GBHA 1VJ9U 1P06A 4DJZB 4NFFA 5JB9S 1TX8A 3RLYH 3A7YA 1O2IA 1UVOA 1O3JA 1HJ9A 3S9AA 3QN7A 1QB6A 1TOCB 1Y8TA 2F9OA 4K1TA 1O36A 5C1XA 2H9HA 2B7DH 3KEEA 1AE5A 1VGCB 4AGJA 1BTYA 4X1SU 1CVWH 2G4UA 3MH4A 3SBKA 1F0TA 3SNCA 1NFUA 1A0JA 3W94A 1FN6A 3S7HB 1F5KU 3FFGA 4UEHH 1G36A 4ISNA 1W7GH 1SLWB 1U6QA 3ATIA 3SV8A 3FAOA 1G3CA 3PM3A 4GVUA 2OD3B 1Y3UA 2A1DB 1ZTKA 1ARCA 7GCHG 1BTHH 1DXPA 1HLTH 1A3EH 1TGNA 1EUFA 1QQUA 1UTQA 1A4WH 3HK6B 5DK1A 1ANBA 4DW2U 3BTKE 4OGXA 4X1PU 2HOBA 2HPQH 1AFEH 3A87A 3NPSA 2BM2A 4JK6A 3SUGA 1UTKA 1AQ7A 1J17T 1T7CA 1ARBA 1QJ6B 2GMTC 4D9QA 2W7SA 3GOVB 3RC4A 5EQSA 1A61H 1C4Y2 1QCPA 2GV7A 3LH1A 3DT0H 2BQ6B 1ZPZA 2G55A 1YYY1 4CR9A 5JPMH 1QA7A 2AMPA 2FOEA 3RXOA 4WH8A 1GBKA 1ZOMA 2J94A 1DANH 5DPAA 2GT7A 3NUMA 2ZU1A 1GBIA 1BCUH 2PR3A 3QK1A 3M5NA 1CBWB 1C5PA 3HK3B 1BIOA 1S5SA 5FCKA 1DLKB 3OTJE 1C5LH 4CRAA 1S82A 8KME2 1WAYB 1MD8A 1SLUB 1MTUA 4ABJA 1DE7H 1VJAU 5EW2H 2AGIX 4JYTA 4BTTB 4AFZA 2FM2A 2WPKS 1RD3B 3UNQA 2BY9X 4JZ1A 2O8WA 3F68H 2ODPA 5A8YA 1UK3A 4ABEA 3DA9B 1T31A 1DDJA 1O5GH 1DY9A 1PPHE 1GJ5H 4A92A 4ABHA 1AVXA 1QBNA 5CHAC 1GHBG 2BY7X 4FVBA 2CJIA 1GI3A 2ODYB 3NZIA 1EZUC 1GJ4H 2HNTE 1UVUH 2JETC 1D6RA 1MUEB 2BDCA 5DP6A 3A7VA 3FANA 2ANYA 4O97A 3RXQA 1RXPA 5DKMA 3ITIA 3VXEH 2WPMS 5A0CA 1IQNA 2FO9A 2SNVA 3PWCA 1FN8A 2BD2A 4ZKOU 2A5AA 1A7SA 3P8NA 1QJ1B 1Y5BT 4NA8A 4ZHAA 4LZ1H 2HALA 1ZR0A 3A86A 3EAJA 3VB7A 5T3HA 3L6PA 1O2QA 1FY8E 3VB6A 1H9IE 4ESTE 3LGIA 1DT2A 3ZZ4A 4YESB 1MH0A 3RXDA 2AMQA 1UCYH 2F3CE 1C1NA 3DFJA 4H6TA 2WPHS 4X6NA 3H7OA 2QGRA 2P3UB 1LO6A 1XKAC 5C2ZA 3BTGE 1UJ1A 1YPLH 1FXYA 2Y5HA 1ETSH 2A0QB 1V2MT 3CP7A 4VGCC 2Q6DA 1C5RA 1F0UA 1S84A 3L3TA 1MD7A 1MQ6A 3RXFA 1MCVA 1AFQB 1TGCA 2ZDMA 1BA8B 2IOTA 2VIPA 1J8AA 4JYVH 1O2PA 2ZF0H 1GGDB 1MBQA 4CBOA 3ZZ5A 5EU8A 2QF0A 3VGCC 1C9PA 1MBMA 2TBSA 2A4OA 1GMHG 4ZKNU 2FLBH 2ZFQH 3V12A 4UD9H 2ESTE 3LDXH 3TH4H 3KHVA 3SO3A 2WUCA 1RIWB 4KTSA 1DS2E 5FPSA 5JBCS 4WMFA 1ZPCA 3MFJA 3UFAA 4OS2A 3TGJE 2HLCA 1Y59T 3URCA 3A89A 4U32A 4INLA 3CS7A 4YOJA 1TAWA 3B23B 4WY3A 1T8OA 5K7RA 1DICA 2VB0A 3LONA 4IN1A 1EX3A 1BTWA 3OY6U 4TWWA 4O9VA 1ZHRA 3DFLA 4Z0KA 1F5LA 2GDEH 1TA6A 5A09A 1UTJA 2F9NA 2Y5FA 2WV4A 1EP6A 1OP8A 2EI7A 3SU4A 4H6SB 4ZKRU 4HZHA 3EDXB 1Y3WA 2XW9A 4RSPA 1C1WH 1GPZA 2BY8X 3A85A 1GJ8B 4B2AA 1C2JA 1KTTB 4ZH8A 5ESBA 1BMNH 4XSKU 4Y6DA 2WPLS 4Y71A 2FOHA 3AW1A 1QRXA 1XX9A 4YOIA 4ISHH 1JIMA 1VITH 3A8AA 4BAMB 3M7UA 2THFB 1AZ8A 3SV9A 1QIXB 1GCTB 4NWKA 1T8NA 2W26A 5CMXH 3RMNH 4DURA 4XBBA 1ELCA 2FXRA 4AOQA 1ZTJA 5DP3A 3M35A 5EOKA 1H9HE 1O2KA 4YLQH 5LGOA 1EZSC 5LH8A 2BD4A 1GI8B 2A45B 4AFUA
chains in the Genus database with same CATH superfamily
1O34A 3TGKE 3CS0A 1W13U 2JIZD 1O2SA 1VCPA 2ZPRA 3A8DA 3JZ1B 2GKVE 3RM0H 3ZVAA 1SOZA 2C4FH 2H5CA 1GHZA 1KSNA 1UK4A 2ZIQH 3EYDA 1QRZA 3TJOA 1GG6B 5ESTE 1PPEE 4XOJA 1NU9A 1DSTA 4QT8C 1SQAA 2FDAA 2LNCA 1JOUB 1G37A 1FIZA 4I32A 5G4BA 4B6FA 1A0LA 1O39A 3ZV9A 4B75A 1EJAA 1D3DB 4AZ2B 1PPBH 2ZPQA 3UB0A 1YY3A 2XC4A 1CSOE 1GCDA 1TGSZ 1O3LA 2D8WA 4WMEA 5EJLA 2PGQB 4TPIZ 2C8YB 1TIOA 2BX3A 5ETXA 3VFEA 2FP7B 1V2LT 4Y8XA 1HGTH 4CRGA 4ABBA 2ZPSA 4I8JA 4XE4A 1C5OH 4AC9A 1C1RA 1BJVA 3K65B 5HYOA 1C1TA 1GI0A 3SI3H 1Z7KA 1FV9A 4X8UH 3ATWA 2GZ9A 3RXEA 4NSYA 3RXTA 1TRNA 2V3MA 1JRTA 3KIDU 1ESTA 1MTSA 1P04A 4U30A 1CBWC 1C2GA 2UWLA 3P70B 2J2UA 3H7TA 1K2I1 4CREA 1CA0C 1ELTA 2PTCE 3ZVFA 3BTME 4GCHF 2J98A 4FU7A 2AS9A 1B0FA 2WV5A 5GPIB 1H9LB 3SU6A 2A2QH 3SHCH 1NO9H 5HMAA 1O3KA 1TX6A 1FY5A 5C0TA 4LK4A 5HKKD 3SU5A 1G2LA 3TLOA 3KN2A 1HRTH 3RMLH 1TE0A 2GMTB 1B0EA 1F0SA 1AD8H 1AVGH 4K5ZA 1O2LA 2XBWA 1ETTH 4PROA 1DLEA 2BZ6H 4D9RA 1BJUA 4CRBA 1ELVA 1GMHF 1IQHA 2BZAA 1C9TA 3CNRA 4ABIA 1HDTH 3GY5A 4NIVA 1XUGA 4YT7H 2BVSH 2VGCC 4TWYA 1Z6EA 1ZRKA 4F55A 5DSFA 1FAKH 4BAHB 1YPJH 2KCAA 4RN6A 2BDAA 2UUKB 3N7DA 3MMGA 1MTWA 1GL0E 2HWLB 2Z3DA 1QTFA 2ZCKP 1XKBC 1THRH 4GLYA 2CHAC 3MOCA 4KKDA 4CH2B 1GJ9B 2VWMA 4GUXA 3A8BA 1RTFB 1F0RA 2YMSB 2ZU4A 1DM4B 3GY2A 2J9NA 5E2OA 3UTUH 3GDSA 1PYTD 1SQTA 3KQBA 2A5IA 3RDZA 5CHAB 1NPMA 2HVXA 4ZXXH 5TJXA 1B5GH 1LQDB 3P17H 4DY7B 3EE7A 3BV9B 2GGVB 1P3EA 2FX4A 4ISOA 5E2PA 2OBOA 2VVVA 2F9UA 1ZJKA 1O2VA 1C5MD 2BY6X 2JETB 1FPHH 4IMQA 3TU7H 1TOMH 4ZHLU 1P0SH 1A5HA 4NG9H 1THPB 3VG8A 1GJAB 2SFAA 3SQEE 8LPRA 2CMYA 2J95A 1C4V2 1CQQA 1ZHMA 3SNAA 3A8CA 2O8LA 3F0PA 1MKWH 5EXMA 1ZSJA 3QO6A 3F9FA 1GBAA 2UUYA 2V3HH 1O3EA 3PMAB 1PQAA 2VNTA 2BB4A 2O8TA 3PTBA 2PFEA 3LC5A 3PB1E 3BIVH 2P3TB 1QY6A 2QXJA 1QBVH 2Q6FA 4BANB 2WHXA 4B76A 4VGCB 3RMOH 3HPTB 1V2OT 4NA7A 1SG8B 1X7AC 2IN2A 4TY6A 1BMMH 5I25A 1O2UA 1ANEA 3MH5A 3QZRA 1BTXA 1C4U2 5C3NA 3T2NA 2PKAB 1H8HD 2KFWA 1SLXB 4FU8A 4X1RU 4X2XA 3KYGA 3VGCB 4ZMAH 1VR1H 1C1VH 2J97A 1C1UH 3M7QA 4Z1MD 1C5QA 4ABAA 1O38A 5LPEA 3E16B 2XBVA 4DIIH 1E38B 1HAYB 1O31A 2RFKC 4IBLH 2F4LA 5C17A 1MZDA 3KQDA 1NBME 3V13A 5LPRA 1C1PA 1BB0B 2QY0B 1CGHA 3VB4A 2WYJA 2TGAA 5HIYA 3D62A 1E0FD 2F91A 2AGEX 1Z8JB 1Z1IA 3T25A 5HXFA 1G32B 1GVLA 4MLFB 3R3GB 3QTOH 2ZGJA 3ZYDA 2V6NA 1P2MA 1TONA 3BEUA 3UQVA 3SJKA 1P2IA 3IITA 1P3CA 5C1UA 3S0NA 1PQ7A 1BRAA 4I31A 2KCYA 4ASUD 4ABGA 4AYYB 5T6FA 2VWNA 3QLPH 3F2HA 3ZZBA 1A46H 1LVYA 3BTEE 4DVAU 5FL7D 1BT7A 1THSH 1S0QA 4X8SH 2LP6A 1AN1E 5FPYA 4DT4A 4UE7H 2ZTYA 1Z8IB 2W6ID 2KZ4A 1D4PB 2J38A 3KCGH 1CT2E 1P9UA 3AW0A 4K69A 3K2UA 1FMGA 1ZSKA 4X2WA 4OM9A 2WPIS 1A1RA 1LPGB 4GHTA 4X6OA 1BHXB 2VIDA 4GHQA 2AH4X 2CF8H 1GBBA 4E05H 1TBZH 4Y0ZE 2KR7A 4P02A 2BXTH 4NGAH 3S9CA 2B5TB 4YZUA 1IQIA 1OWIA 3UWIA 2H9EH 1BUIA 1XXDA 4AB9A 2VIVA 1TBRH 1V2QT 1DOJA 2R3UA 4Y10E 3E6PH 2QCYA 3SNDA 2BDIA 1QA0A 1YPHE 2ZNKH 2GJGA 2ZFSA 1FI8A 1L1GA 3SJ8A 3RXRA 1NRPH 2A4GA 2J98B 1NRQH 1WBGB 1K21H 3FZDA 5T6DA 2PKSC 3V0XA 3DSPA 3LC3A 3LPRA 1ZRBA 3PYHA 1VCWA 1FY3A 1L4DA 1DSUA 3SORA 2PWXA 3ZZ9A 1YCPK 2AHME 3SJ9A 2OCVB 1J16A 1KXDA 1O5CB 4IMZA 9ESTA 3B8JA 1ELEE 1AZZA 1J15A 3TJUA 1KXCA 2BLWA 3O8DA 4FUCA 3U1JB 1EXFA 1GBMA 3RXKA 3FP6E 2A4QA 2OC0A 3SU2A 5EXLA 4FVDA 4E06H 2PSYA 1C5UA 3QTVH 1QZ8A 2OXSA 5F53A 4JMYA 4BAQB 1GI1A 3MH7A 3RXLA 3SU1A 1BRUP 4H42U 3PRBA 3MYWA 2GVFA 3PLKA 4XDEA 3ZZ6A 3F6UH 1CA0B 1S6FA 4AX9H 5FCRA 1GHVH 1S6LA 4Q80A 2ZP0H 2B8OH 1Z6JH 1MAYA 1HJAC 2RA3A 3P95A 3PV5A 2QIQA 2RA0A 4X6PA 1TWXB 2WYGA 3AVZA 2CF9H 2QYIA 3EA7A 3TH3H 6CHAC 3E90B 1YLDA 4I8LA 3QUMP 1GBEA 3LGTA 4RI0A 2WUBA 3VB3A 2O8UA 3LGYA 1NBMD 1W10U 2Z7FE 4AORA 1P01A 2BVXH 1NFWA 5KGOA 4AG2A 1C2KA 3UPEA 1TABE 2SGEE 3RXBA 1Q2WA 3PMJA 4SGAE 2QF4A 2ZDAH 2R2MB 4HI3A 2VIOA 2VGCB 2V35A 2ZTZA 1GJ6A 3A7WA 1GHXH 3OX7U 4AYVB 5GWZA 3K6ZA 5C1YA 3ZVBA 2O9QA 3KGPA 5EPNA 2EI6A 1BTZA 4KGAA 4OS7A 3RXAA 2NU4E 1D9IA 1FONA 3EGKH 1UHBB 5DJ7A 3D49H 5J4QA 1P09A 1BHXF 1C5ZB 2CHAB 1LTOA 1EPTC 1GBLA 3LGWA 4XBDA 2BD3A 1GBCA 2YNAA 1SFQB 2JJ2D 4BXSA 4JZIA 3FO8D 3SOSA 1W0YH 4Q4LA 4TY7A 2Z9GA 5HM2A 1C2HA 3T29A 4GCHG 4INKA 1MQ5A 4THNH 1GHYH 5FXLA 1PPZA 1ZMNA 2XBXA 2H5DA 2A7JA 2D1JA 1T4VH 1S85A 1TQ7B 1PFXC 1ACBE 3U9AH 4I7YH 2C90B 1V2VT 1F2SE 2C8WB 1G3EA 3PROA 5GXPA 1BMFD 1WQSA 1N6YA 1SC8U 1YWUA 1P11E 2VVCA 2Z9IA 1SSXA 1KXAA 3QGNB 2KX4A 2Y7ZA 2FI5E 3IG6B 1GBDA 1P12E 1O5AB 1TPAE 2QAAA 3H09A 2PW8H 3MO9A 1E35B 5E0HA 1UW7A 1O3PB 5DO4H 4K60A 4WF8A 3T26A 1KY9A 2ZG0H 1EAWA 2K8IA 3NWUA 3ZVDA 2Y5GA 4JZEH 4I8GA 5E8EH 4Q7YA 3SN8A 4CR5A 1UO6A 3RLWH 2O8MA 4OS1A 4BTUB 3KL6A 2XC0A 3GYMA 1BTPA 4UFDH 4BTIB 1EPTA 3F9GA 1TFXA 3TK6A 2ZHFH 1SGFA 3O8BA 5GDSH 4TPYA 1G3DA 1Y3YA 4B71A 3AASA 1V2WT 4ISLA 1N8OC 1BBRK 3PV4A 1ZGIA 1FLEE 1TLDA 2PP6A 1EATA 1GBFA 1DX5M 2W6JD 2P95A 2G8TA 1CT4E 4MPUA 3GDUA 4LXBH 2C8ZB 3HGPA 1SGDE 1FJSA 5C20A 1CU1A 1TPSA 3MH6A 1E79D 4A1TA 3MU8A 2ZU3A 1K1JA 2QXGA 2G00A 3T27A 1SGTA 3QDZB 1CHOG 1QHRB 1FZZA 1P02A 7ESTE 4BXWA 2XRCA 3D65E 1RRKA 2Q6GA 2ZQ2A 3HKJB 2AEIH 1RTLA 1UTPA 3Q76A 3KQCA 1YPMH 2XTTB 3SUDA 5I46H 1T8MA 3QZQA 1Y5AT 4INHA 4D76A 1SVPA 2XBYA 3RXCA 2GD4B 1O2XA 3ODFA 4WH6A 1HBTH 1UMAH 3LIWA 3UR9A 1EOLA 4UDWH 2KCOA 4Q63A 4BNRA 2A2XH 1O2WA 1IQKA 4Y79A 4FU9A 1K22H 2JJ1D 2XCNA 2BMGB 2W7UA 1NFYA 1RS0A 1W12U 1O30A 3SNEA 3PO1C 4FETA 5EODA 1MTNC 3FVFB 1TRYA 3RP2A 4ZXYH 3UOUA 3BF6H 3SUFA 3UY9A 1DWCH 3RXUA 4B2CA 2SGAA 2XXLA 3ZZCA 4XD7D 5TCCA 4R0IA 2ZQ1A 1H8IH 1GJDB 2FIRH 5SGAE 2Y80A 3TK9A 1IQFA 1CO7E 1UCYK 2H1UA 3LJOA 1FAXA 2PHBA 3HKIB 1LHGH 3BTTE 5C0UA 1YM0A 1SBWA 4D7FA 2IJD1 1Y3XA 3E0NB 1IHTH 1P2NA 5AFZH 1ABIH 1AKSA 3K6YA 1W8BH 4I33A 2A32A 2K0QA 3M3TA 4LOYH 1OWJA 4R8TB 4F49A 1A3BH 1SGCA 3M61U 1GDUA 1HNEE 3GICB 2ZCHP 1FIWA 2ZWLH 4OS5A 2ASUB 4D7GA 1OYTH 4B74A 2QF5A 2RDLA 4KTCA 4IGDA 3RXHA 1C1OA 4WJG2 2A4RA 4K8YA 1AGJA 1LVBA 1TMBH 2B9LA 1BDAA 2DUCA 2UUJB 4JK5A 1IAUA 2Z9JA 1O2TA 2ZGBH 3A82A 1PPCE 3ENSB 2NU1E 3KYFA 5A8XA 1RGQA 3E0PB 1O2OA 3F3BA 3TPIZ 4OS4A 1QQ4A 2NU2E 1JWTA 3M5OA 1ID5H 4U01A 2PKSB 3DHKH 3Q3YA 2HRVA 3S9BA 4FXGH 3KNXA 2FODA 2RCEA 1OS8A 1G30B 3SU3A 5ABWA 1TNLA 4XRNA 4X8VH 1L0ZA 2A31A 1A5IA 2XCFA 4DIHH 3SNBA 3UUZA 1QRWA 1A2CH 3KQ5A 1SOTA 1FY4A 1ANDA 3LT3A 4X2YA 4LZ4B 4O03A 1S81A 3GY6A 1BRBE 2FEQH 5JBBS 1VITG 3P6ZB 1PPFE 1E34B 1NN6A 1LPZB 1QB9A 1UVTH 1TALA 4MNXA 5TCAA 8GCHG 1TNKA 1H8DH 1C2DA 5DP9A 1AUTC 1NS3A 1KXEA 2OBQA 4AB8A 1JMOH 1MTVA 4UFEH 1SL3A 2G4TA 1BOQA 1HV7A 5C5OA 1LQEA 1SHYA 2JH0D 1K0HA 4RKJB 4Y11E 1L2EA 4HFPB 4K3JA 4NZLA 1GWAA 4J1YA 3GCHC 1C5NH 1EAXA 1KLIH 2VWOA 3A7ZA 4CH8B 3DD2H 3FP8E 4MQAA 5DP4A 5GCHG 1HJAB 3VXFH 1RJXB 4A5TS 1YPEH 4K1EA 4NWLA 3GCTF 2DE8A 3SHAH 5EJ1A 2Z94A 1TNGA 1ZGVA 2XYAA 6CHAB 4Y8ZA 4CRFA 2R2WU 1LHDH 4FUDA 3NRLA 1IHSH 1CHOF 1OSSA 1QB1A 1H8ED 1O2NA 4Y8YA 4O3UA 2STBE 3LH3A 1C5WB 3ZZDA 1P2QA 2WV9A 3P8GA 2GTBA 1AUJA 2FX6A 4ZROA 5A2MH 1CA8B 5EQRA 1Y3VA 1KYNA 2BLVA 3SV2H 1SGFG 1KLJH 4MPXA 3MHWU 5E0GA 3ZZ7A 4X6MA 3EQ0H 4RT0A 2D2DA 5AVDA 1GI2A 3PTNA 3ATMA 2OC8A 2EEKA 3D23A 4JZDH 1FY1A 1EASA 1BBRE 2P16A 2EI8A 4FUIA 1Z8GA 1TNJA 1SGEE 2Y82A 1S0RA 2F9PA 2ZECA 1NM6A 1YPKH 1LVMA 2AIPA 5LPFA 3AK5A 3ZVGA 3ZIAD 1TYNA 1QFKH 3MWIU 1OP0A 5J4SA 1OOKB 2V3OH 2BLQA 3QX5H 1ZJDA 3GCNA 2QA9E 3TK5A 3ZYEA 3RU4E 5DN6D 1HIAA 3HGNA 1S83A 3GY4A 1P2KA 1V6DA 1EPTB 1TA2A 2STAE 3DSGA 1OWHA 1YLCA 2XC5A 3ODDA 2XNDD 2BQ7B 5HGGA 1QR3E 3PMBB 1HXEH 2J5UA 1G3BA 1WTGH 2GDDA 1PQ8A 2IPQX 1GL1A 3A81A 3VB5A 1BTUA 1GI7B 1P10A 2OUAA 2QXHA 2R9PA 4JZFH 3DCLA 3FP7E 5AFYH 5DG6A 1DWDH 4K8BA 4FUHA 2KM0A 2OQUA 2XWBI 3OYPA 1DUAA 2ZFPH 1GI5A 1K1OA 3SZEA 1UVSH 1QBOA 1CHGA 1P2OA 3NKKA 4MPWA 3GYLB 1TMUH 1ELDE 1T4UH 1C5VA 5AF9H 2UUFB 3U98H 1UTOA 3ZVCA 1O0DH 2OQ5A 2ZDKA 3MU4A 1E37B 1O3GA 1YCPH 2FZZA 5BRRE 2VH0A 2GZ8A 1EKBB 3BEIB 3SJOA 2FESH 3M5LA 3TVJB 2ZGHA 5B6OA 2ZO3H 3C1KA 2FS9A 3QWCH 1PQ5A 1QGFA 1V3XA 1ELGA 1KXBA 1GMCF 1JBUH 4X8TH 1ELFA 2EY4C 2SGFE 2G5VA 4GSOA 2ZU2A 2SGPE 1SR5C 1ANCA 1L4ZA 3O8CA 2ZHEH 3UIRA 1N8OB 1C1MA 1QL8A 1ETRH 4WXIA 1AWHB 2BDBA 1DPOA 1W0ZU 3GY3A 2H9TH 3F9HA 5EW1H 2BVRH 2IJOB 1AI8H 2FS8A 5L30H 2ZCLP 3BG8A 1GBTA 4CHAC 3HATH 2YOLA 3RC6A 5GNDA 1ORFA 2PGBB 3MI4A 3BG4C 3A83A 1HAVA 1O2MA 2FOGA 1K1PA 1TPPA 4MNVA 1UTNA 1VITF 3RXMA 3BTDE 3T5FH 1VZQH 1XUFA 4NIXA 4UFFH 7LPRA 1AE8H 1V2ST 1NESE 3ELAH 3LGUA 1O2JA 2GCTB 8GCHF 1UTMA 4Y76A 3GDVA 5GJ4B 2VWLA 1O5DH 1P05A 3RXIA 1SGRE 1ELAA 4OS6A 3E8LA 5A8ZA 4YM9A 3VEQB 1MKXK 3FZZA 3LU9B 1XUJA 1AMHA 1NC6A 2EA3A 2FOAA 3TJVA 3E1XB 3NK8A 1LHCH 5GCHF 3P8FA 3PO1B 5PTPA 5EXNA 1MTNB 1NZQH 1SGPE 3BIUH 1M9UA 5C94A 1GVZA 2GCHG 4YXWD 2Z9LA 2L6OA 1AB9C 1W7XH 1MKWK 2P93A 1OHHD 5BPEA 1Z8RA 4XBCA 2WSSD 1NRSH 5F6MA 3U1IB 8ESTE 1C1QA 3G01A 3OE7D 1E1RD 1K1IA 3A84A 4J2YB 3B9FH 2W3KA 2WZQA 4HGCA 1W3CA 1O3CA 3MNBA 1D6WA 1YGCH 4FUJA 1AIXH 2VIWA 1NRNH 1HCGA 2Z3EA 3RU4D 2TGDA 2DE9A 1ELBA 3IWMA 1BMLA 3BEFB 2SNWA 2NU0E 1O3MA 3KQEA 5C67A 4XFQA 1LPKB 1E1QD 3OEHD 4B73A 3H5CB 3MO6A 3FN8A 5E0JA 2FOMB 5FAHA 1V2NT 3FOAA 3RUOA 4CBNA 2ZKSA 2QC2A 3TNTA 1WCZA 1UK2A 2P59A 1CGIE 1GI6A 2FWWA 3SI4H 2OLGA 3R0FA 2QN5T 2XNIA 2WINI 5KEDA 3MNXA 3ATLA 3SJIA 2BYAX 1NFXA 3MQKC 1NRRH 4AFQA 1IQLA 1EOJA 2F83A 2HNTF 2ALPA 5FHTA 1L1NA 1QNJA 3P8OA 1BQYA 1L1JA 2BDGA 4U2WA 4ABFA 1OWKA 2ZFRH 1J9CH 3GISB 3BSQA 5DP8A 2OP9A 2FLRH 4KELA 4Q2KA 1BBRH 1YPHC 2BXUH 5EQQA 1W11U 4BOHA 2G51A 1HAZB 3ZVEA 2AERH 2A7HA 1GHWH 3F1SB 2A7CA 3UNRA 1TB6H 5L2YH 1XUIA 4Z6AH 3S7KB 1OYQA 1P8VC 2HLDD 1KLTA 5FX6A 4B1TA 3OU0A 2ALVA 1KIGH 2FOFA 1LCYA 3ATKA 1ZLRA 4B2BA 1WU1A 2FOCA 3PV2A 1O33A 2FTLE 2KAIA 1C2FA 3LOXA 1YKTA 2TIOA 1DUEA 2FI3E 5DGJA 1IQEA 1SQRA 2C93B 2A5KA 2BD5A 4O3TA 3TITA 2OINA 3PLPA 4AGKA 3GCHB 6GCHF 1AU8A 2ZC9H 4FOUC 3M3SA 4Y0YE 1HIAB 3W95A 5FBIA 1EP5A 1TNHA 1XUHA 2C8XB 1FNIA 4RKOB 3SQHE 1MCTA 1SMFE 4YO9A 1D3PB 1TBQH 4KTUA 2UWPA 2BD7A 4Y7BA 1SGYE 1RTKA 5DP5A 1GDQA 3PLBA 2R3YA 4DOQA 2HPPH 3V3MA 3OEED 1O2YA 1IOEA 1ZTLA 1CGJE 3O8RA 2J92A 4Q7XA 2B0FA 2G81E 1JXPA 1HAIH 5A0AE 2R0KA 1C2MA 1LHFH 5EGMA 5K0HA 2QF3A 1GJBB 1OWDA 5JBTA 1O3BA 2CGAA 3OAAD 4IC5A 3RMMH 1TX7A 2ZHWH 4CRCA 1WTHD 1G2MA 4SGBE 1UVPA 1K1LA 3Q3KA 7KMEH 4YOGA 1YF4A 3SV7A 3SV6A 4K1SA 3OSYA 3I77A 3LJJA 1K28D 5FPTA 3LGVA 4AFSA 1MZAA 3UQOA 2WPJS 1V2RT 2FI4E 3WW7A 1DWBH 1WOFA 5JB8S 2UWOA 2ZTXA 3MO3A 2YNBA 5HIZA 3ZZ8A 3A88A 2HNTC 1Q31A 4FUFA 1NU7B 1N1LA 2PTNA 1OKXA 2YMSD 1SGIB 2GCHF 3U28C 3P92A 3SW2B 2J34A 1SLVB 1FPCH 3M36A 5IK2D 4X0WU 1P57B 2BOHB 1O3IA 1XMNB 1ABJH 2LPRA 2VBCA 2PUXB 1W0KD 4ZHMU 2GX4A 2R0LA 1TGBA 1PJPA 4E7NA 2I6QA 3F0OA 3T62A 2VVUA 1GMDG 1ZZZA 5GIBA 5L6NH 1XXFA 4NCYA 4D8NA 1S6HA 3GCTG 1EZQA 1SI5H 3BTWE 1P9SA 1G9IE 1HAVB 1NROH 1TNIA 1YPGH 1LKBA 1WDIA 2Q1JA 2AIQA 1KDQA 1INCA 7GCHF 2PV9B 2CXVA 1HAGE 2TPIZ 1C2LA 2Z6BD 1NY22 4ZKSU 1GI4A 1BZXE 1TMTH 4NFEA 2VIQA 1V2JT 3QGJA 2GCTC 3BTFE 3ZV8A 2W5EA 3UOPA 2GT8A 1HAHH 2PLXA 2OK5A 2FYRA 2AGGX 2FMJA 2P8OB 1K1NA 1WUNH 4Q7ZA 5DP7A 1A5GH 3MNCA 3A7TA 1F5RA 4IN2A 3PMHB 2LELA 2PKAA 1O5EH 3SYJA 1SPJA 2QV1A 5F8TA 1DFPA 1OP2A 1T8LA 1BMAA 4MVNA 4MG3A 4UFGH 3EA9A 2TGTA 1K1MA 1O3NA 1DVAH 1T32A 1Z71A 1C5SA 1EAIA 2AYWA 2Z3CA 1W2KH 3UR6A 1ZMJA 1C5TA 4CHAB 2HVYB 5H4IB 1Q3XA 3BG4B 3UWJH 1VGCC 1SHHB 2RG3A 3RXSA 1AVWA 1IQMA 3RU4T 2GV6A 2G5NA 3F9EA 2K1QA 1GBJA 4X2VA 1QJ7B 1WSSH 1E36B 2NWNA 2ZI2H 1SKYE 1MU6B 5FBEA 1LMWB 4X1NU 3FKSD 2BHGA 4I8KA 1SGQE 4CRDA 1OWEA 1LHEH 1GHBF 3SZNA 3U69H 4M7GA 1O35A 3CENA 4E7RG 2FOBA 2ZU5A 1O37A 2VJ1A 2XWAA 1C5YB 2BLOA 5JBAS 3M37A 1D3QB 2HGTH 4JCNA 1EJNA 2C3SA 3UNSA 2CV3A 1EAUA 3PWBA 2XOKD 1EJMA 1GMCG 3VPKA 1ZSLA 1AB9B 1PPGE 1PYTC 3SGAE 3RXVA 4A1VA 1IQGA 6ESTA 2ANKH 1OPHB 1N6XA 2H6MA 4WXVA 1V2PT 4KP0A 3EE0B 3MNSA 1TRMA 3URDA 2ZGCA 3TH2H 4Y7AA 2M2AA 1DWEH 2V0BA 2ZEBA 1GJ7B 1ESAA 1KMHB 3BTQE 1ZPBA 3SU0A 3JZ2B 4K2YA 1WV7H 2Z9KA 4HTCH 4ASHA 1GHAG 3F2FA 3STJA 4I8HA 1O2GH 4NSVA 2GZ7A 1ZYOA 5F8ZA 4DCDA 5IDKA 4MPVA 1YC0A 2OTVA 4NA9H 3U8TH 5EG4A 2BOKA 1IQJA 4WMDA 3OTPA 3U8RH 2FTMA 3RXJA 2BTCE 3NXPA 1KTSB 2VU8E 2KAIB 1XVMA 5T6GA 1NT1A 1P2JA 2ZA5A 3MU0A 3STIA 2TRMA 1J14A 5IYTA 3OY5U 1XVOA 3TNSA 1C2EA 3AAVA 2ULLA 4DT7B 1VCQA 4BAOB 1F92A 3MU5A 2BD8A 4YT6H 1XUKA 3A7XA 1AHTH 3TJNA 1HYLA 4WWYA 4MNWA 4DGJA 4FUBA 2IPHA 5C5NA 1GMDF 1O3DA 4H4FA 4DG4A 2NU3E 3U8OH 1SB1H 4A6LA 2SGQE 4TYDA 1OX1A 3L33A 1D3TB 3LKWA 3SGBE 3ESTA 5L2ZH 1HJ8A 1HFDA 1UTLM 2P3FH 1EB1H 1DXWA 1QL9A 2VH6A 3E3TA 4YTAA 1AY6H 1WQVH 1H4WA 1EFRD 3GY8A 1O3FA 3E91A 5CE1A 2BDHA 4IC6A 2JH5D 3TGIE 1V2UT 1FDPA 4NIWA 1GI9B 2F9BH 1CT0E 4A7IB 4OGYA 2ZFTA 1DITH 4GPGA 1WYKA 2J4IA 2H2ZA 2JH6D 4AG1A 4MDSA 3SUEA 3V7TA 1BRCE 3M5MA 2AFQB 2W3IA 1HAPH 2PSXA 1GJCB 2ZZUH 4FUGA 2F9VA 5AHGH 2M5TA 1V2KT 1DY8A 5F8XA 2SGDE 1O2ZA 2RDEA 1AFQC 1O5FH 4JYUH 1W14U 4ZAEA 1HXFH 3BTHE 1MKXH 2ZDNA 2FYQA 3Q00A 1GGDC 2AMDA 1MMJN 2BD9A 1YBWA 1KXFA 1LDTT 1GDNA 1SFIA 1SGNE 2JKHA 4UONA 1HPGA 3K9XB 4WVPE 5F03A 2JDID 5FX5A 1V2TT 1K9OE 3C27B 3MTYA 4YLUA 2BX4A 2G52A 1TPOA 2ANWA 2ZGXH 1O32A 6LPRA 1RIWC 1UHBA 2Y81A 1MU8B 3UREA 2OC1A 4FUEA 1O2HA 2BQWB 1KDQB 1O2RA 5HM9A 1HAXB 3I78A 1HUTH 2FPZA 1OXGA 3ZZAA 1FQ3A 4MNYA 4MTBA 2VINA 3T28A 3DSOA 1YCPM 4ZUHA 2ODQA 1O3HA 2Y7XA 1LKAA 1EB2A 1YLNA 3GY7A 3RM2H 2ZHDA 4ABDA 2TGPZ 2ZFFH 2ZDLA 4ISIH 2BY5X 1QURH 2P8OC 1P03A 1O3OA 1Y5UT 1UCYE 1FUJA 2ZHQH 4A1XA 1XM1A 1EZXC 2OC7A 5EIYA 1C2IA 4GAWA 3DUXH 3NCLA 3Q77A 3I29A 1BITA 2CN0H 3EA8A 1CE5A 5EPYA 1HAOH 1F7ZA 1YP9A 2PUQH 1EQ9A 3RXPA 3AAUA 4X1QU 5JYIA 1GCTC 3F2GA 6GCHG 5JDUB 3Q3XA 4IS5A 3GCOA 1MAXA 1AO5A 2ANMH 1JRSA 3WY8A 2Y6TA 1TQ0B 4TT3D 3RC5A 1C1SA 4NZQA 5CHBA 4BAKB 3M3VA 3SGQE 2ILNA 1B7XB 1GHAF 1QL7A 1H1BA 4B6EA 3BN9A 9LPRA 3KF2A 2I6SA 1HB0B 3A80A 2P94A 1ESBA 1SQOA 1GVKB 1AWFH 3N7OA 1O3AA 2GP9B 3RXGA 1LVOA 1AKSB 4NIYA 1GG6C 1ZHPA 4IW4E 1NTPA 1JIRA 2EC9H 2D26C 4AN7A 5A0BA 1O5BB 3MU1A 1ZMLA 1RFNA 4M9FA 4F4OC 1C5XB 3ZZ3A 2ZDVH 3S69A 1Z1JA 1TGTA 3M7TA 3TIUA 1A0HB 2QXIA 2BDYA 1GBHA 1VJ9U 1P06A 4DJZB 4NFFA 5JB9S 1TX8A 3RLYH 3A7YA 1O2IA 1UVOA 1O3JA 1HJ9A 4HG6A 4RT1A 3S9AA 3QN7A 1QB6A 1TOCB 1Y8TA 2F9OA 4K1TA 1O36A 5C1XA 2H9HA 2B7DH 3KEEA 1AE5A 1VGCB 3N7EA 4AGJA 1BTYA 4X1SU 1CVWH 2G4UA 3MH4A 3SBKA 1F0TA 3SNCA 1NFUA 1A0JA 3W94A 1FN6A 3S7HB 2F43B 1F5KU 3FFGA 4UEHH 2EQNA 1G36A 5T1VA 1MABB 3PRDA 4ISNA 1W7GH 1SLWB 1U6QA 4ACAA 3ATIA 3SV8A 3FAOA 1G3CA 3PM3A 4GVUA 2OD3B 1Y3UA 2A1DB 1ZTKA 1ARCA 7GCHG 1BTHH 1DXPA 1HLTH 1A3EH 1TGNA 1EUFA 1QQUA 1UTQA 1A4WH 3HK6B 5DK1A 1ANBA 4DW2U 3BTKE 4OGXA 4X1PU 2HOBA 2HPQH 1AFEH 3A87A 3NPSA 2BM2A 4JK6A 3SUGA 1UTKA 1AQ7A 1J17T 1T7CA 1ARBA 1QJ6B 2GMTC 4D9QA 2W7SA 3GOVB 3RC4A 5EQSA 1A61H 1C4Y2 1QCPA 2GV7A 3LH1A 3DT0H 2BQ6B 1ZPZA 2G55A 1YYY1 4CR9A 5JPMH 1QA7A 2AMPA 2L74A 2FOEA 3RXOA 4WH8A 1GBKA 1ZOMA 2J94A 1DANH 5DPAA 2GT7A 3NUMA 2ZU1A 1GBIA 1BCUH 2PR3A 3QK1A 3M5NA 1CBWB 1C5PA 3HK3B 1BIOA 1S5SA 5FCKA 1DLKB 3OTJE 1C5LH 4CRAA 1S82A 8KME2 1WAYB 1MD8A 1SLUB 1MTUA 4ABJA 1DE7H 1VJAU 5EW2H 2AGIX 4JYTA 4BTTB 4AFZA 1W0JD 4F48B 2FM2A 2WPKS 1RD3B 3UNQA 2BY9X 2YMSC 2O8WA 4JZ1A 3GS9A 3F68H 2ODPA 5A8YA 1UK3A 3N99A 4ABEA 3DA9B 1T31A 1DDJA 1O5GH 1DY9A 1PPHE 1GJ5H 4A92A 4ABHA 1AVXA 4I86A 1QBNA 5CHAC 1GHBG 2BY7X 4FVBA 2CJIA 1GI3A 5CDFE 2ODYB 3NZIA 5EJZA 1EZUC 1GJ4H 2HNTE 1UVUH 2JETC 1D6RA 1MUEB 2BDCA 5DP6A 3A7VA 3FANA 2ANYA 4O97A 3RXQA 1RXPA 5DKMA 3ITIA 3VXEH 1VKYA 2WPMS 5A0CA 1IQNA 2FO9A 2SNVA 3PWCA 3WWBA 1FN8A 2BD2A 4ZKOU 2A5AA 1A7SA 3P8NA 1QJ1B 1Y5BT 4NA8A 4ZHAA 4LZ1H 2HALA 1ZR0A 3A86A 3EAJA 3VB7A 5T3HA 3L6PA 1O2QA 1FY8E 3VB6A 1H9IE 1COWD 4ESTE 3LGIA 1DT2A 3ZZ4A 4YESB 2CK3D 1MH0A 3WWFA 2WPDD 3RXDA 2AMQA 1UCYH 2F3CE 1C1NA 3DFJA 4H6TA 2WPHS 4X6NA 3H7OA 2QGRA 2P3UB 1LO6A 1XKAC 5C2ZA 3BTGE 1UJ1A 1YPLH 1FXYA 2Y5HA 1ETSH 2A0QB 1V2MT 3CP7A 4VGCC 2Q6DA 1C5RA 1F0UA 1FX0B 1S84A 3L3TA 1MD7A 1MQ6A 3RXFA 1MCVA 1AFQB 1TGCA 2ZDMA 1BA8B 2IOTA 2VIPA 1J8AA 4JYVH 1O2PA 2ZF0H 5B6LA 1GGDB 1MBQA 4CBOA 3ZZ5A 5EU8A 2QF0A 3VGCC 1C9PA 1MBMA 4TSFD 2TBSA 4ZCNA 2A4OA 1GMHG 4ZKNU 2FLBH 2ZFQH 3V12A 4UD9H 2ESTE 3LDXH 3TH4H 3KHVA 3SO3A 2WUCA 1RIWB 4KTSA 3UAIC 1DS2E 4P00A 5FPSA 5JBCS 4WMFA 1ZPCA 3MFJA 3UFAA 4OS2A 4ACBA 3TGJE 2HLCA 1Y59T 3URCA 3A89A 4U32A 1WXRA 4INLA 3CS7A 4YOJA 1TAWA 3B23B 4WY3A 1T8OA 5K7RA 1DICA 2VB0A 3LONA 4IN1A 1EX3A 1BTWA 3OY6U 4TWWA 4O9VA 1ZHRA 3DFLA 4Z0KA 1F5LA 2GDEH 1TA6A 5A09A 1UTJA 2F9NA 2Y5FA 2WV4A 1EP6A 1OP8A 2EI7A 3SU4A 4H6SB 4ZKRU 4HZHA 3EDXB 1Y3WA 2XW9A 4RSPA 1C1WH 1GPZA 2BY8X 3A85A 1GJ8B 4B2AA 1C2JA 1KTTB 4ZH8A 5ESBA 1BMNH 4XSKU 4Y6DA 2WPLS 4Y71A 2FOHA 3AW1A 1QRXA 1XX9A 4YOIA 4ISHH 1JIMA 1VITH 3A8AA 4BAMB 3M7UA 2THFB 1AZ8A 3OFND 5KECA 1QIXB 1GCTB 4NWKA 1T8NA 2W26A 5CMXH 3SV9A 3RMNH 4DURA 4XBBA 1ELCA 2FXRA 2QE7D 4AOQA 1ZTJA 3W1EA 5DP3A 3M35A 5EOKA 2V7QD 1H9HE 1O2KA 4YLQH 5LGOA 1EZSC 2KCPA 2BD4A 5LH8A 1GI8B 2A45B 4AFUA
chains in the Genus database with same CATH topology
1O34A 3TGKE 3CS0A 1W13U 1O2SA 1VCPA 2ZPRA 3A8DA 3JZ1B 2GKVE 3RM0H 3ZVAA 1SOZA 2C4FH 2H5CA 1GHZA 1KSNA 1UK4A 2ZIQH 3EYDA 1QRZA 3TJOA 1GG6B 5ESTE 1PPEE 4XOJA 1NU9A 1DSTA 4QT8C 1SQAA 2FDAA 2LNCA 1JOUB 1G37A 1FIZA 4I32A 5G4BA 1A0LA 1O39A 3ZV9A 4B75A 1EJAA 1D3DB 4AZ2B 1PPBH 2ZPQA 2XC4A 1CSOE 1GCDA 1TGSZ 1O3LA 2D8WA 4WMEA 2PGQB 4TPIZ 2C8YB 1TIOA 2BX3A 5ETXA 3VFEA 2FP7B 1V2LT 4Y8XA 1HGTH 4CRGA 4ABBA 2ZPSA 4I8JA 4XE4A 1C5OH 1C1RA 1BJVA 3K65B 5HYOA 1C1TA 1GI0A 3SI3H 1Z7KA 1FV9A 4X8UH 3ATWA 2GZ9A 3RXEA 4NSYA 3RXTA 1TRNA 1JRTA 3KIDU 1ESTA 1MTSA 1P04A 4U30A 1CBWC 1C2GA 2UWLA 3P70B 2J2UA 3H7TA 1K2I1 4CREA 1CA0C 1ELTA 2PTCE 3ZVFA 3BTME 4GCHF 4FU7A 2AS9A 1B0FA 2WV5A 5GPIB 1H9LB 3SU6A 2A2QH 3SHCH 1NO9H 5HMAA 1O3KA 1TX6A 1FY5A 4LK4A 3SU5A 1G2LA 3TLOA 3KN2A 1HRTH 3RMLH 1TE0A 2GMTB 1B0EA 1F0SA 1AD8H 1AVGH 4K5ZA 1O2LA 2XBWA 1ETTH 4PROA 1DLEA 2BZ6H 4D9RA 1BJUA 4CRBA 1ELVA 1GMHF 1IQHA 2BZAA 1C9TA 4ABIA 1HDTH 3GY5A 4NIVA 1XUGA 4YT7H 2BVSH 2VGCC 4TWYA 1Z6EA 1ZRKA 1FAKH 4BAHB 1YPJH 4RN6A 2BDAA 2UUKB 3MMGA 1MTWA 1GL0E 2HWLB 2Z3DA 1QTFA 2ZCKP 1XKBC 1THRH 4GLYA 2CHAC 3MOCA 4KKDA 4CH2B 1GJ9B 2VWMA 4GUXA 3A8BA 1RTFB 1F0RA 2ZU4A 1DM4B 3GY2A 2J9NA 5E2OA 3UTUH 3GDSA 1PYTD 1SQTA 3KQBA 2A5IA 3RDZA 5CHAB 1NPMA 2HVXA 4ZXXH 5TJXA 1B5GH 1LQDB 3P17H 4DY7B 3BV9B 2GGVB 1P3EA 2FX4A 4ISOA 5E2PA 2OBOA 2VVVA 2F9UA 1ZJKA 1O2VA 1C5MD 2BY6X 2JETB 1FPHH 4IMQA 3TU7H 1TOMH 4ZHLU 1P0SH 1A5HA 4NG9H 1THPB 1GJAB 2SFAA 3SQEE 8LPRA 2CMYA 2J95A 1C4V2 1CQQA 1ZHMA 3SNAA 3A8CA 2O8LA 1MKWH 5EXMA 1ZSJA 3QO6A 3F9FA 1GBAA 2UUYA 2V3HH 1O3EA 3PMAB 1PQAA 2VNTA 2BB4A 2O8TA 3PTBA 2PFEA 3LC5A 3PB1E 3BIVH 2P3TB 1QY6A 2QXJA 1QBVH 2Q6FA 4BANB 4B76A 4VGCB 3RMOH 3HPTB 1V2OT 4NA7A 1SG8B 1X7AC 2IN2A 4TY6A 1BMMH 5I25A 1O2UA 1ANEA 3MH5A 3QZRA 1BTXA 1C4U2 5C3NA 3T2NA 2PKAB 1SLXB 4FU8A 4X1RU 4X2XA 3VGCB 4ZMAH 1VR1H 1C1VH 1C1UH 3M7QA 1C5QA 4ABAA 1O38A 5LPEA 3E16B 2XBVA 4DIIH 1E38B 1HAYB 1O31A 4IBLH 1MZDA 3KQDA 3V13A 5LPRA 1C1PA 1BB0B 2QY0B 1CGHA 3VB4A 2WYJA 2TGAA 3D62A 1E0FD 2F91A 2AGEX 1Z8JB 1Z1IA 3T25A 5HXFA 1G32B 1GVLA 4MLFB 3R3GB 3QTOH 2ZGJA 3ZYDA 2V6NA 1P2MA 1TONA 3BEUA 3UQVA 3SJKA 1P2IA 3IITA 1P3CA 5C1UA 3S0NA 1PQ7A 1BRAA 4I31A 4ABGA 4AYYB 5T6FA 2VWNA 3QLPH 3ZZBA 1A46H 1LVYA 3BTEE 4DVAU 1BT7A 1THSH 1S0QA 4X8SH 1AN1E 5FPYA 4UE7H 2ZTYA 1Z8IB 1D4PB 2J38A 3KCGH 1CT2E 1P9UA 3AW0A 4K69A 3K2UA 1FMGA 1ZSKA 4X2WA 2WPIS 1A1RA 1LPGB 4GHTA 4X6OA 1BHXB 2VIDA 4GHQA 2AH4X 2CF8H 1GBBA 4E05H 1TBZH 4Y0ZE 2BXTH 4NGAH 3S9CA 2B5TB 4YZUA 1IQIA 1OWIA 3UWIA 2H9EH 1BUIA 1XXDA 4AB9A 2VIVA 1TBRH 1V2QT 1DOJA 2R3UA 4Y10E 3E6PH 2QCYA 3SNDA 2BDIA 1QA0A 1YPHE 2ZNKH 2ZFSA 1FI8A 1L1GA 3SJ8A 3RXRA 1NRPH 2A4GA 1NRQH 1WBGB 1K21H 3FZDA 5T6DA 2PKSC 3V0XA 3LC3A 3LPRA 1ZRBA 3PYHA 1VCWA 1FY3A 1L4DA 1DSUA 3SORA 2PWXA 3ZZ9A 1YCPK 3SJ9A 2OCVB 1J16A 1KXDA 1O5CB 4IMZA 9ESTA 3B8JA 1ELEE 1AZZA 1J15A 3TJUA 1KXCA 2BLWA 3O8DA 4FUCA 3U1JB 1EXFA 1GBMA 3RXKA 3FP6E 2A4QA 2OC0A 3SU2A 5EXLA 4FVDA 4E06H 2PSYA 1C5UA 3QTVH 2OXSA 4JMYA 4BAQB 1GI1A 3MH7A 3RXLA 3SU1A 1BRUP 4H42U 3MYWA 2GVFA 3PLKA 4XDEA 3ZZ6A 3F6UH 1CA0B 1S6FA 4AX9H 5FCRA 1GHVH 4Q80A 2ZP0H 2B8OH 1Z6JH 1MAYA 1HJAC 2RA3A 3P95A 2QIQA 2RA0A 4X6PA 1TWXB 2WYGA 3AVZA 2CF9H 2QYIA 3EA7A 3TH3H 6CHAC 3E90B 1YLDA 4I8LA 3QUMP 1GBEA 3LGTA 2WUBA 3VB3A 2O8UA 3LGYA 1W10U 2Z7FE 4AORA 1P01A 2BVXH 1NFWA 4AG2A 1C2KA 3UPEA 1TABE 2SGEE 3RXBA 1Q2WA 3PMJA 4SGAE 2ZDAH 2R2MB 4HI3A 2VIOA 2VGCB 2V35A 2ZTZA 1GJ6A 3A7WA 1GHXH 3OX7U 4AYVB 5GWZA 3K6ZA 5C1YA 3ZVBA 2O9QA 3KGPA 5EPNA 2EI6A 1BTZA 4KGAA 4OS7A 3RXAA 2NU4E 1D9IA 1FONA 3EGKH 1UHBB 5DJ7A 3D49H 5J4QA 1P09A 1BHXF 1C5ZB 2CHAB 1LTOA 1EPTC 1GBLA 3LGWA 4XBDA 2BD3A 1GBCA 2YNAA 1SFQB 4BXSA 4JZIA 3SOSA 1W0YH 4TY7A 2Z9GA 5HM2A 1C2HA 3T29A 4GCHG 4INKA 1MQ5A 4THNH 1GHYH 5FXLA 1PPZA 1ZMNA 2XBXA 2H5DA 2A7JA 2D1JA 1T4VH 1S85A 1TQ7B 1PFXC 1ACBE 3U9AH 4I7YH 2C90B 1V2VT 1F2SE 2C8WB 1G3EA 3PROA 5GXPA 1WQSA 1N6YA 1SC8U 1P11E 2VVCA 2Z9IA 1SSXA 1KXAA 3QGNB 2Y7ZA 2FI5E 3IG6B 1GBDA 1P12E 1O5AB 1TPAE 2QAAA 2PW8H 3MO9A 1E35B 5E0HA 1O3PB 5DO4H 4K60A 4WF8A 3T26A 1KY9A 2ZG0H 1EAWA 3NWUA 3ZVDA 2Y5GA 4JZEH 4I8GA 5E8EH 4Q7YA 3SN8A 4CR5A 1UO6A 3RLWH 2O8MA 4OS1A 4BTUB 3KL6A 2XC0A 3GYMA 1BTPA 4UFDH 4BTIB 1EPTA 3F9GA 1TFXA 3TK6A 2ZHFH 1SGFA 3O8BA 5GDSH 4TPYA 1G3DA 1Y3YA 4B71A 3AASA 1V2WT 4ISLA 1N8OC 1BBRK 3PV4A 1ZGIA 1FLEE 1TLDA 1EATA 1GBFA 1DX5M 2P95A 2G8TA 1CT4E 4MPUA 3GDUA 4LXBH 2C8ZB 3HGPA 1SGDE 1FJSA 5C20A 1CU1A 1TPSA 3MH6A 4A1TA 3MU8A 2ZU3A 1K1JA 2QXGA 2G00A 3T27A 1SGTA 3QDZB 1CHOG 1QHRB 1FZZA 1P02A 7ESTE 4BXWA 2XRCA 3D65E 1RRKA 2Q6GA 2ZQ2A 3HKJB 2AEIH 1RTLA 1UTPA 3Q76A 3KQCA 1YPMH 2XTTB 3SUDA 5I46H 1T8MA 3QZQA 1Y5AT 4INHA 4D76A 1SVPA 2XBYA 3RXCA 2GD4B 1O2XA 3ODFA 4WH6A 1HBTH 1UMAH 3LIWA 3UR9A 1EOLA 4UDWH 4BNRA 2A2XH 1O2WA 1IQKA 4Y79A 4FU9A 1K22H 2XCNA 2BMGB 2W7UA 1NFYA 1RS0A 1W12U 1O30A 3SNEA 3PO1C 5EODA 1MTNC 3FVFB 1TRYA 3RP2A 4ZXYH 3UOUA 3BF6H 3SUFA 3UY9A 1DWCH 3RXUA 4B2CA 2SGAA 2XXLA 3ZZCA 5TCCA 4R0IA 2ZQ1A 1H8IH 1GJDB 2FIRH 5SGAE 2Y80A 3TK9A 1IQFA 1CO7E 1UCYK 2H1UA 3LJOA 1FAXA 2PHBA 3HKIB 1LHGH 3BTTE 1YM0A 1SBWA 4D7FA 1Y3XA 3E0NB 1IHTH 1P2NA 5AFZH 1ABIH 1AKSA 3K6YA 1W8BH 4I33A 2A32A 3M3TA 4LOYH 1OWJA 4R8TB 4F49A 1A3BH 1SGCA 3M61U 1GDUA 1HNEE 3GICB 2ZCHP 1FIWA 2ZWLH 4OS5A 2ASUB 4D7GA 1OYTH 4B74A 2RDLA 4KTCA 4IGDA 3RXHA 1C1OA 4WJG2 2A4RA 4K8YA 1AGJA 1LVBA 1TMBH 2B9LA 1BDAA 2DUCA 2UUJB 4JK5A 1IAUA 2Z9JA 1O2TA 2ZGBH 3A82A 1PPCE 3ENSB 2NU1E 5A8XA 1RGQA 3E0PB 1O2OA 3TPIZ 4OS4A 1QQ4A 2NU2E 1JWTA 3M5OA 1ID5H 4U01A 2PKSB 3DHKH 3Q3YA 2HRVA 3S9BA 4FXGH 3KNXA 2FODA 2RCEA 1OS8A 1G30B 3SU3A 5ABWA 1TNLA 4X8VH 1L0ZA 2A31A 1A5IA 2XCFA 4DIHH 3SNBA 3UUZA 1QRWA 1A2CH 1SOTA 1FY4A 1ANDA 3LT3A 4X2YA 4LZ4B 4O03A 1S81A 3GY6A 1BRBE 2FEQH 5JBBS 1VITG 3P6ZB 1PPFE 1E34B 1NN6A 1LPZB 1QB9A 1UVTH 1TALA 4MNXA 5TCAA 8GCHG 1TNKA 1H8DH 1C2DA 5DP9A 1AUTC 1NS3A 1KXEA 2OBQA 4AB8A 1JMOH 1MTVA 4UFEH 1SL3A 2G4TA 1BOQA 1HV7A 5C5OA 1LQEA 1SHYA 2JH0D 4RKJB 4Y11E 1L2EA 4HFPB 4K3JA 4NZLA 1GWAA 4J1YA 3GCHC 1C5NH 1EAXA 1KLIH 2VWOA 3A7ZA 4CH8B 3DD2H 3FP8E 4MQAA 5DP4A 5GCHG 1HJAB 3VXFH 1RJXB 4A5TS 1YPEH 4K1EA 4NWLA 3GCTF 2DE8A 3SHAH 2Z94A 1TNGA 1ZGVA 2XYAA 6CHAB 4Y8ZA 4CRFA 2R2WU 1LHDH 4FUDA 1IHSH 1CHOF 1OSSA 1QB1A 1O2NA 4Y8YA 4O3UA 2STBE 3LH3A 1C5WB 3ZZDA 1P2QA 3P8GA 2GTBA 1AUJA 2FX6A 4ZROA 5A2MH 1CA8B 5EQRA 1Y3VA 1KYNA 2BLVA 3SV2H 1SGFG 1KLJH 4MPXA 3MHWU 5E0GA 3ZZ7A 4X6MA 3EQ0H 2D2DA 5AVDA 1GI2A 3PTNA 3ATMA 2OC8A 2EEKA 3D23A 4JZDH 1FY1A 1EASA 1BBRE 2P16A 2EI8A 4FUIA 1Z8GA 1TNJA 1SGEE 2Y82A 1S0RA 2F9PA 2ZECA 1NM6A 1YPKH 1LVMA 2AIPA 5LPFA 3ZVGA 1TYNA 1QFKH 3MWIU 1OP0A 5J4SA 1OOKB 2V3OH 2BLQA 3QX5H 1ZJDA 3GCNA 2QA9E 3TK5A 3ZYEA 3RU4E 1HIAA 3HGNA 1S83A 3GY4A 1P2KA 1V6DA 1EPTB 1TA2A 2STAE 1OWHA 1YLCA 2XC5A 3ODDA 5HGGA 2BQ7B 1QR3E 3PMBB 1HXEH 1G3BA 1WTGH 2GDDA 1PQ8A 1GL1A 3A81A 3VB5A 1BTUA 1GI7B 1P10A 2OUAA 2QXHA 2R9PA 4JZFH 5AFYH 3FP7E 5DG6A 1DWDH 4K8BA 4FUHA 2OQUA 2XWBI 3OYPA 1DUAA 2ZFPH 1GI5A 1K1OA 1UVSH 1QBOA 1CHGA 1P2OA 3NKKA 4MPWA 3GYLB 1TMUH 1ELDE 1T4UH 1C5VA 5AF9H 2UUFB 3U98H 1UTOA 3ZVCA 1O0DH 2OQ5A 2ZDKA 3MU4A 1E37B 1O3GA 1YCPH 2FZZA 5BRRE 2VH0A 2GZ8A 1EKBB 3BEIB 3SJOA 2FESH 3M5LA 3TVJB 2ZGHA 5B6OA 2ZO3H 3C1KA 2FS9A 3QWCH 1PQ5A 1QGFA 1V3XA 1ELGA 1KXBA 1GMCF 1JBUH 4X8TH 1ELFA 2SGFE 4GSOA 2G5VA 2ZU2A 2SGPE 1SR5C 1ANCA 1L4ZA 3O8CA 2ZHEH 3UIRA 1N8OB 1C1MA 1QL8A 1ETRH 4WXIA 1AWHB 2BDBA 1DPOA 1W0ZU 3GY3A 2H9TH 3F9HA 5EW1H 2BVRH 2IJOB 1AI8H 2FS8A 5L30H 2ZCLP 3BG8A 1GBTA 4CHAC 3HATH 2YOLA 3RC6A 1ORFA 2PGBB 3MI4A 3BG4C 3A83A 1HAVA 1O2MA 2FOGA 1K1PA 1TPPA 4MNVA 1UTNA 1VITF 3RXMA 3BTDE 3T5FH 1VZQH 1XUFA 4NIXA 4UFFH 7LPRA 1AE8H 1V2ST 1NESE 3ELAH 3LGUA 1O2JA 2GCTB 8GCHF 1UTMA 4Y76A 3GDVA 5GJ4B 2VWLA 1O5DH 1P05A 3RXIA 1SGRE 1ELAA 4OS6A 3E8LA 5A8ZA 4YM9A 3VEQB 1MKXK 3FZZA 3LU9B 1XUJA 1AMHA 1NC6A 2EA3A 2FOAA 3TJVA 3E1XB 3NK8A 1LHCH 5GCHF 3P8FA 3PO1B 5PTPA 5EXNA 1MTNB 1NZQH 1SGPE 3BIUH 1M9UA