2O8TA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q) in complex with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
231
Chain Sequence
IIGGEFTTIENQPWFAAIYRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase plasminogen activator
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 231
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA01
4YLQH 3RXLA 2GD4B 1RTKA 1GI1A 1JXPA 4X2VA 3RXCA 5C1UA 1W10U 3BEFB 3P8FA 1EX3A 2FOHA 1ETTH 1J17T 3CENA 2IOTA 3V12A 2ZG0H 5I25A 3HKIB 1BOQA 5EQRA 1C1WH 4ABJA 1CGIE 2CHAB 3SHAH 4D8NA 4AX9H 4BOHA 1BMNH 5CE1A 3BTGE 3P8GA 4H6TA 1P2IA 1O2YA 4K8YA 1EXFA 3LJOA 5H4IB 4GVUA 2WPKS 5F8ZA 4K2YA 1GI4A 5DP5A 1O3EA 1PQ8A 4H4FA 1TPOA 1Z1JA 2YOLA 2AYWA 1ZTLA 3UY9A 1LTOA 1JRSA 3ZYEA 4NG9H 3MH6A 1Z8JB 3VXEH 4X2YA 5GPIB 2B5TB 4YTAA 1IQMA 1SGCA 1J16A 3TK9A 1P8VC 2H6MA 2VIDA 1GHBG 1YLCA 1UTPA 3AAUA 5LH8A 1C1UH 3HATH 4Q2KA 1BA8B 3MNSA 3SV9A 3U1JB 1TOCB 1G2MA 2BYAX 1TA6A 1PQ7A 1TGCA 3MNCA 3BTKE 2VB0A 4AGKA 1SQTA 1NT1A 1F5KU 1GJ4H 1PPGE 2BMGB 2G00A 3RLWH 1T31A 2GCHF 1ELBA 1RS0A 2ZU1A 4MDSA 1QL9A 2VIVA 2EI7A 2OC0A 2OBQA 3QGNB 2VINA 2BDAA 3MH7A 2ZU3A 2ILNA 4DT7B 1CBWB 3QGJA 1C1VH 4LK4A 1DXWA 1NESE 1IQEA 3M5NA 2HNTE 2ZCHP 2ANYA 2SGEE 3VGCC 1Q3XA 2BVRH 3D23A 3SORA 1SHYA 3BTFE 2Z94A 5A09A 5FXLA 4NWKA 4DGJA 6CHAB 1SPJA 2Y5FA 3ODDA 2FO9A 4WF8A 4TPYA 2TPIZ 1GJ6A 1QGFA 1QTFA 2OC1A 3MNBA 1TFXA 2D26C 4Q80A 3SZNA 1DVAH 1GGDC 1HAVB 2LNCA 1O3CA 2J4IA 2ZKSA 1G3DA 1MAYA 4WWYA 2AMPA 3QN7A 3RP2A 1A0LA 3RXRA 2BTCE 2DUCA 3PWBA 6LPRA 3ELAH 5C3NA 1BTYA 2GT8A 1GMHG 2D2DA 2A5KA 2Z9JA 1O2JA 2ZCLP 4Y6DA 3AW0A 1WV7H 2V35A 1KTSB 4X8TH 3TNSA 5DG6A 2Z9IA 1TE0A 1HCGA 1KTTB 4YOIA 2VWLA 1PYTC 3TU7H 1SSXA 4B2AA 2XW9A 1GHXH 2ZGXH 3GCHC 3GY6A 1AO5A 2HNTC 3GISB 1OP8A 2PV9B 1W7XH 1UHBA 3BTME 4DG4A 4NSYA 1CGJE 1SGRE 2AERH 3CP7A 2BHGA 4BAMB 1FUJA 1LPZB 4XBCA 1ZHPA 3IG6B 4FVBA 3QX5H 2ZECA 1Y5UT 3Q3XA 3A83A 2VIPA 1O2TA 1TGNA 4IMZA 1FY5A 5DP3A 2H9TH 1P11E 2OBOA 1TMBH 2F83A 1DITH 2ZDLA 4TY7A 2GKVE 4DJZB 1J9CH 1ZTJA 1OWHA 3P8NA 4YT6H 3SV2H 4GCHF 5C20A 1O2KA 3BEIB 2BDIA 3TJUA 4DW2U 4I32A 2BX3A 1B7XB 4Y79A 1W0ZU 3GDUA 1CT2E 2OUAA 5E8EH 4JK5A 1W11U 1BIOA 2BQ6B 2J2UA 2VWNA 1NFYA 3ZZ4A 3K65B 4CHAB 2GDEH 3PMAB 1GJBB 4JZIA 1O2WA 3KQEA 1GI8B 3ATIA 3SW2B 1D4PB 2EA3A 1P06A 1KXAA 2XBYA 1LQEA 1B0EA 1Z8RA 5GCHG 1BQYA 2UWOA 4LZ4B 2BZ6H 3M5OA 3BTTE 1AKSB 1MTUA 6ESTA 1WCZA 4KKDA 3S69A 1VCQA 3LH1A 1FY8E 4QT8C 2HRVA 1E34B 4IN1A 2FOBA 1P12E 3NXPA 4H6SB 1SGFG 1YPKH 1LVOA 1QRXA 1OWDA 4RKOB 2F9PA 2UUFB 5B6OA 3LH3A 1GI5A 1TABE 3UNQA 4VGCC 3SU1A 2PHBA 1PYTD 3ENSB 3ZVDA 1ARBA 1TPSA 2ZQ1A 4NZLA 3RC5A 3ZVAA 1KLJH 4B76A 3UR6A 1ZMJA 1ZOMA 2ANKH 1BTWA 4JZDH 3RXDA 1LHDH 3CS7A 4Z0KA 1IQJA 5F8XA 3VEQB 2D8WA 4D76A 1ZSKA 1BDAA 1GVKB 5EQSA 2A7JA 1SGTA 4KTSA 1GPZA 1HIAB 3PMJA 2KAIA 3RU4D 1BBRK 1C9PA 3BG4C 3QZQA 2QXJA 1UHBB 5AF9H 1MKWH 1UCYK 1W14U 4GUXA 1O5DH 2ZGBH 2BD3A 2HPPH 1BZXE 4FUHA 3QK1A 5DP6A 3STIA 4BAOB 4FUIA 1WQSA 2P3FH 2Y7ZA 1GG6C 2ZDAH 1NRSH 1DICA 3I78A 2NU1E 1XXDA 2XCNA 3STJA 5J4SA 1HDTH 5K0HA 1GMCF 2O8MA 1YCPH 2TGPZ 3PTBA 3SUFA 9LPRA 1UJ1A 1HXFH 4A1XA 1IQIA 2J38A 1FY1A 3HGPA 4X8UH 1Z8GA 4MPXA 3JZ2B 2P59A 4KP0A 1JBUH 2P8OB 1JIRA 1CHOG 1C5NH 1P05A 1A7SA 1TRYA 2EEKA 3A8DA 5T6FA 2AGEX 2XC5A 3EA9A 3P17H 4K1SA 5C1YA 3TGIE 2FI4E 8GCHG 2FOMB 3TLOA 4R8TB 1BRUP 2HGTH 4INHA 4OS7A 3A88A 2C93B 2ZPSA 2RA3A 2YNAA 2BXTH 1FY4A 3MNXA 1TALA 1QQ4A 2ALVA 2ZQ2A 1TLDA 1H1BA 2AH4X 3EA7A 3WY8A 3MH5A 5F8TA 1ELFA 3ZVGA 1ZGVA 2IPHA 1WTHD 1XUGA 4XE4A 1S0RA 1DFPA 1EZSC 1K22H 3KQDA 3M7TA 1JMOH 3LGIA 3ZVCA 4ZHLU 1SI5H 3B8JA 1SR5C 2GX4A 1P02A 2STBE 4OS5A 3U69H 2FTMA 4I33A 1NRNH 1U6QA 1Z7KA 2ZZUH 2ZDNA 1MAXA 1OYTH 2R9PA 5T6DA 1P3EA 3VB3A 3Q76A 2BLWA 1QBVH 2FS8A 3MWIU 4ZKOU 1YKTA 2G81E 1O2MA 1BJUA 1D6RA 4Y71A 1NRPH 1NFWA 2ZWLH 1EB2A 3SJIA 1HAHH 2PGBB 5LPFA 2HLCA 1UTOA 1ABIH 4GLYA 1EOJA 2UWPA 2A7HA 2H9HA 2ZFSA 1NC6A 1TQ0B 3E90B 5TJXA 1A2CH 1N6XA 3LJJA 5GJ4B 1VITG 1UVOA 1SB1H 1GJ8B 1V2NT 1C4Y2 1N8OC 4KTUA 5A0CA 4OGXA 3SUGA 2FX6A 5I46H 2FLRH 5CHAB 1ZMNA 4UEHH 1SLXB 2O8TA 4PROA 1D3TB 4GHQA 3F68H 3RXMA 1CT0E 3LGTA 2FYQA 4BNRA 2FDAA 1P01A 3V7TA 2W7UA 1IQKA 2FX4A 2VVCA 1HJ9A 1C5WB 1O5BB 1P03A 2FPZA 1QQUA 1GBFA 3OU0A 5A8ZA 1V2OT 4OGYA 3B23B 4U32A 2JH5D 5EXLA 1BRCE 1DX5M 1ZPZA 2J95A 1HBTH 1BTPA 1TNGA 1EAIA 2FOEA 3SU6A 2WYJA 1GBMA 2KAIB 5L2YH 4JCNA 4D9QA 5FX6A 1S85A 5G4BA 1HRTH 3D62A 3A7WA 1ZYOA 2M5TA 4DURA 1O2HA 1SGQE 2NU0E 1A3BH 1O5GH 1K1PA 4Y76A 5HXFA 3SU3A 1BRBE 1K9OE 4X1PU 5HMAA 3A8AA 1MH0A 1K2I1 3GY2A 4UD9H 1XX9A 4INLA 3S9CA 2BDGA 1DT2A 1V2RT 1CA0B 7KMEH 4IC6A 4X0WU 2I6SA 1G30B 1NN6A 2IJOB 1CQQA 3OY6U 3GYLB 5EW1H 1O5FH 4SGBE 4ZMAH 1DWCH 1BMAA 5E0JA 1EP6A 5L6NH 1FPCH 1GWAA 5FPYA 1EJNA 4CRAA 3IITA 2OD3B 1AI8H 2SGDE 3MO9A 2BDCA 1YPLH 4X1SU 1C2HA 1G3CA 2QC2A 3L6PA 1C1OA 1E37B 3BN9A 2PSXA 1RTFB 4RN6A 1YP9A 2ZHEH 2H5DA 5EPYA 3UNSA 2P94A 1FXYA 1GMDG 1Q31A 1VCPA 1DXPA 3T5FH 4CRCA 2C8WB 2NU4E 1HAVA 1CSOE 1XUJA 3VXFH 1K1MA 1K28D 1LMWB 3SNDA 1AZ8A 3SJ8A 4XFQA 4B1TA 1FV9A 4AOQA 1CBWC 1VZQH 3OY5U 3ESTA 3SJKA 4MPWA 4K1EA 1PPZA 2ULLA 2ZEBA 1ZJKA 3VFEA 4ZHMU 2H5CA 4CRDA 3D65E 4NIWA 4BANB 1BJVA 1O30A 6CHAC 3KF2A 4YESB 2Z9GA 1YPJH 1IQGA 4X6OA 3V0XA 2I6QA 3KCGH 4WMDA 4E05H 1K1IA 2JH0D 3SGAE 1CHGA 3GCTG 2QAAA 3SNCA 3M35A 3M3TA 3A8BA 5EQQA 3MU8A 1MD8A 1C5SA 1AB9B 4D7FA 1AUJA 2R2WU 1M9UA 2BY6X 1XMNB 2GMTB 1IHSH 1AVXA 1O2PA 2OC8A 4JZFH 1UVUH 1Z6JH 2ZPQA 1EAWA 2ZHFH 3MH4A 3ZZ8A 1J8AA 1ACBE 3GY3A 1OXGA 3KIDU 1VITH 4INKA 1G3BA 1MBQA 1OWJA 4FU7A 1EATA 1THPB 1Y3YA 2UUJB 2G55A 3SU5A 1QRZA 3UWJH 3QZRA 3RC6A 4AYVB 3A82A 3SJ9A 1T32A 2PKAB 3G01A 1N6YA 1FAXA 1C1TA 4DIHH 5GXPA 3DFLA 3Q3YA 1OWKA 1UTKA 2ZA5A 3BTQE 1O31A 4BTUB 3RMMH 4I8LA 1AE5A 1HLTH 5T3HA 1W13U 2XRCA 1BUIA 3TJVA 3Q77A 1C4U2 2OINA 2OLGA 3FFGA 1ID5H 1ZR0A 3S7KB 2VIWA 1Y59T 1W7GH 1Y8TA 1KXFA 1SFIA 2ZGCA 2R0LA 1TYNA 1PQAA 2Z9KA 1GI0A 3QTVH 1FJSA 1ESTA 1GJ7B 4ZHAA 1TIOA 1V6DA 2C8YB 1FDPA 2CF9H 3L33A 1ANDA 3PROA 2ZCKP 3AASA 4IC5A 3E1XB 1KLIH 1H9LB 1SC8U 2BDYA 5AVDA 2XBWA 8LPRA 1T8MA 3A80A 4RSPA 1SLVB 1GVZA 1VITF 1HAXB 2ASUB 1BTXA 1ELGA 1ESBA 1GCTB 1OX1A 3GY8A 1EQ9A 1QJ6B 2F9UA 1MZDA 4SGAE 4E06H 1AKSA 2FOGA 1PPCE 1RRKA 4Y7BA 1XKAC 1HJ8A 3RMNH 4AGJA 4WH8A 2GV6A 5LGOA 3OX7U 1TX7A 1L4ZA 1Z71A 1MKXH 2UWLA 5C1XA 1UVTH 4NCYA 1IQLA 2Y81A 2FYRA 7GCHG 3MU0A 1TPPA 2PR3A 4CHAC 5DP4A 1O2NA 4MNVA 1TNHA 1H4WA 1HGTH 1BHXF 4KGAA 2Y7XA 3O8RA 4WJG2 3GY5A 2A2QH 1K1JA 1K1OA 1OWEA 1W0YH 3FVFB 2ANWA 1LCYA 3HKJB 5EPNA 2OQUA 1A5HA 3QDZB 1ZHMA 1W8BH 1GHAF 4B2CA 1JWTA 3A86A 1T4UH 3D49H 3NK8A 1MZAA 3NKKA 1LKBA 1WU1A 2AMQA 2Z7FE 4OS2A 1HIAA 4JZEH 1EZQA 3SJOA 3ODFA 4XBBA 1Y3UA 3DUXH 5C5NA 9ESTA 3FAOA 2VWOA 4I7YH 5FPSA 1Y5BT 1DUEA 1DLKB 2JKHA 1W12U 4UDWH 4YM9A 2W26A 4YO9A 5FPTA 2QIQA 1MCTA 3K6YA 1RIWB 3I77A 1NRRH 3ZZ5A 2G5NA 5JB8S 2GCTB 1HNEE 5L30H 1UTJA 5DJ7A 1C1PA 3QWCH 2A4GA 1IAUA 7LPRA 1O3JA 4ABGA 4CH8B 2WINI 3ZV9A 3S9AA 1AUTC 1Q2WA 2XYAA 5DPAA 2VGCB 3PLKA 1BCUH 5DKMA 1G2LA 1BTZA 1LO6A 4K60A 3LKWA 3NUMA 3T26A 3E3TA 2R3YA 6GCHG 2ZFQH 3BF6H 4O9VA 1YPEH 1MUEB 2CN0H 3GOVB 1C5LH 2ZTYA 2WV5A 3KNXA 4UONA 1GDQA 1AIXH 1V2KT 5DGJA 3FP8E 1V2LT 1VGCC 2BDHA 2F9OA 1J15A 3RXKA 4ZROA 2XNIA 3UTUH 2BY7X 1NTPA 4FU8A 2G8TA 2BD8A 3PV4A 1NROH 4CRBA 4B71A 4ISOA 1TNJA 4IW4E 3F9FA 1GI2A 1SGFA 2FS9A 2ZTXA 4HGCA 4X1NU 3GYMA 1EUFA 2P8OC 1OKXA 2H9EH 4IGDA 1KSNA 2PUXB 4O3TA 3ZZCA 1DANH 1ZRBA 3QO6A 3HGNA 1WQVH 1S84A 1TNLA 4A1VA 2LPRA 1N1LA 1O2LA 1MTNB 2BY9X 2WPMS 2GZ7A 5FBEA 1LKAA 4BTIB 3VPKA 4GAWA 3TITA 2BLQA 2G4TA 1V2JT 3PO1B 2FP7B 2HOBA 1L0ZA 2QGRA 1AVWA 4ISLA 4NFEA 3E91A 4AFQA 2AS9A 4Y8YA 1O2QA 1O3KA 2WV4A 1O2IA 2F9VA 4OS6A 3RXTA 4X6PA 4DY7B 1MMJN 3F9GA 3M61U 1ELVA 2TGDA 4HTCH 4Y0YE 3UFAA 3UREA 2GZ9A 3RXFA 5FX5A 1C5PA 1AY6H 2A5AA 1HJAB 2A32A 1IOEA 4JYTA 2P3UB 4IMQA 1Y3WA 4GSOA 1LVBA 4WY3A 1TONA 2GGVB 2QCYA 3SGQE 3HK6B 4WVPE 1KXBA 3RXQA 2ZO3H 1TMTH 4M7GA 1THSH 3EE0B 1YPMH 4Y0ZE 1XKBC 3P8OA 1CT4E 3K6ZA 1SGDE 2H1UA 1QJ7B 3UUZA 1TX6A 5ESTE 5TCAA 4UE7H 2ZPRA 4U2WA 4UFEH 5TCCA 2D1JA 1F2SE 4GHTA 3E0NB 1GHBF 1QB6A 1NRQH 2ZDKA 2P93A 4FUEA 4IBLH 3T62A 2UUYA 5CHAC 1V2PT 3TH3H 3M36A 2UUKB 3OSYA 2O8WA 1QL8A 2OCVB 1GBIA 3RDZA 1P09A 4I8JA 3M5LA 5AFZH 3T2NA 1MD7A 1QB1A 1TPAE 5A2MH 4JK6A 2BQWB 4NIXA 1HAYB 1CE5A 3SBKA 2JETB 2Z3EA 4A5TS 5EG4A 1TRMA 1LQDB 1QFKH 4HFPB 3MOCA 2RCEA 2AFQB 1GVLA 3LIWA 2PKSB 4ASHA 1SLUB 8ESTE 1PPHE 3F9HA 3EDXB 2ODQA 1ZLRA 2W3IA 3A7YA 1L2EA 1DLEA 4Y11E 3ZVEA 4AFSA 1ZTKA 1O39A 3LGVA 1O2ZA 2QA9E 1FNIA 1XUFA 1NU9A 2R0KA 7GCHF 3RXOA 3QUMP 5EW2H 1GHYH 1F0TA 2SFAA 3SOSA 1C9TA 1P57B 2J92A 3A8CA 2F3CE 1GJ9B 3A81A 1AD8H 1T8LA 1PFXC 2B0FA 1CA0C 4NA7A 1QB9A 2ZHDA 3UOPA 5HGGA 4TY6A 1QHRB 2FOCA 1C2LA 2OC7A 1E35B 2ZC9H 1GJCB 1OOKB 4OS4A 3TJOA 1GMHF 1EJAA 3RXEA 3C1KA 3NZIA 1ZSJA 2ZDMA 2BZAA 4B2BA 1TMUH 5DP8A 2A4OA 3KQBA 1YPHE 2ZI2H 3KGPA 3A7XA 4ABEA 5JDUB 2PFEA 4CBOA 5HM9A 3URCA 1NZQH 2FIRH 4VGCB 1EP5A 1HAZB 2TRMA 3MHWU 4ISNA 1SGNE 2BX4A 2QYIA 1F5RA 1TGSZ 2FWWA 3P6ZB 1SOZA 4CRFA 1FN8A 2Q6FA 1SGEE 3RM2H 3BTWE 4YOGA 4LOYH 1EPTA 1O2XA 3SGBE 1KY9A 2GCHG 1C5TA 3RXIA 1S6FA 4CR9A 2BD2A 4K69A 2DE8A 1T8NA 2DE9A 2NU2E 1SGYE 5EGMA 3TK5A 1O3IA 3SQEE 2RG3A 3UIRA 3SQHE 1Z1IA 7ESTE 4D7GA 2A0QB 2A2XH 2TBSA 1YPGH 3M3SA 3A89A 1PPBH 3EAJA 1O2RA 1C2JA 3GDVA 1C2KA 3V13A 2VVUA 4CRGA 2TIOA 2Z3CA 3BEUA 1A5IA 1ANCA 1YF4A 2J94A 2Y5GA 3EGKH 5T6GA 2V3HH 1C2FA 2PKAA 4UFFH 2JH6D 1MTSA 5FBIA 1C1MA 2TGAA 4ZKRU 1AE8H 1AFEH 1AB9C 3UOUA 1CU1A 5J4QA 1QBNA 2A31A 3U1IB 1LHCH 1OSSA 2GMTC 2SGPE 4THNH 2F9NA 3CS0A 2XXLA 3LGUA 3RXAA 1PJPA 1NFUA 3NPSA 1EAUA 1O2GH 1ZPBA 2CHAC 3TNTA 3EYDA 4XOJA 5GIBA 1DSUA 2AGGX 1D6WA 3QTOH 1A5GH 1G37A 2ZU4A 5GCHF 4AN7A 4K1TA 3LU9B 4X2XA 1TNKA 5DP9A 4AFZA 5FHTA 3T28A 1C5UA 2GVFA 3EQ0H 2ALPA 3VB7A 5FAHA 2P3TB 2B7DH 4Y10E 4FXGH 3LGWA 2ZGHA 1ANBA 1SL3A 4MQAA 3SU2A 4Q7YA 4F4OC 1C5YB 2FESH 1OPHB 1E38B 1T8OA 2V0BA 3K2UA 1P2KA 3MMGA 1O0DH 5EU8A 3DHKH 1EB1H 1V2QT 2WYGA 4AZ2B 4NIYA 4CREA 1PPFE 1WAYB 2A7CA 3PMHB 1GJAB 1AMHA 3TJNA 2A5IA 1EJMA 1P0SH 1X7AC 4JMYA 3U8OH 1ELTA 4RKJB 4Z6AH 1FONA 1RD3B 2J9NA 3RXHA 2QF3A 1ETRH 3RXSA 1AFQB 1H8DH 1TA2A 3RXJA 3SV8A 2BVXH 4ABHA 2CMYA 3BIUH 5EXNA 1ELEE 1KIGH 2STAE 1GCTC 2CJIA 2AIPA 1UVPA 1S82A 1SGIB 1C2EA 2GDDA 1W2KH 1WTGH 2B8OH 3PLPA 5IDKA 2G51A 2A4RA 3LPRA 2AEIH 3M37A 4GCHG 4B75A 2FEQH 4CBNA 2ZFTA 1ZZZA 4BAQB 1V2TT 2OXSA 2G52A 1EPTB 1FIZA 3MTYA 2FOAA 5ETXA 1EKBB 5A8XA 3TH2H 4NIVA 1LPKB 2AIQA 2XC4A 1DWDH 3MO6A 1GBHA 3SUEA 1O5CB 1SFQB 2V3OH 2WUBA 4O03A 5A8YA 3W94A 2BDBA 1CHOF 5DP7A 2WPJS 4NGAH 4UFDH 1HV7A 1ESAA 5JPMH 1C4V2 1O3OA 1E0FD 8GCHF 4JZ1A 1BTUA 1GJDB 1XXFA 1DY8A 2ZP0H 4AFUA 1JIMA 4Q7ZA 1Y3VA 4TWWA 1L1JA 2VIOA 1O5AB 1F92A 1C1SA 2FODA 3A84A 2ZIQH 2GP9B 2PLXA 4OS1A 1DS2E 3MFJA 1NY22 4ZXXH 3LOXA 5AFYH 3TK6A 3C27B 1TWXB 4I8HA 2FZZA 2VIQA 5E0GA 1IQNA 1HAPH 4D9RA 1S81A 3AW1A 1RIWC 5A0AE 1OWIA 1ABJH 1ZGIA 3MU1A 3PM3A 2O9QA 2GCTC 1O2VA 1C1NA 4DCDA 1EASA 1K1NA 2CF8H 3GY4A 2BD5A 1F0UA 2NWNA 2BY8X 1AVGH 4U01A 1MQ5A 3H7TA 1AQ7A 4WMFA 1GL0E 2VGCC 4MNWA 2PUQH 1P2OA 1ZPCA 4AB9A 1KXCA 1V2ST 4AB8A 1QURH 3T29A 3LC5A 2Z3DA 1FZZA 2P16A 4FUCA 1QJ1B 1QL7A 1ARCA 2B9LA 3SNEA 5E2OA 2XBVA 1T7CA 2VWMA 4I8GA 1SMFE 5K7RA 2QN5T 5EXMA 1BTHH 1O32A 1AWHB 4UFGH 4X8SH 4I31A 1O33A 2ZHWH 2HALA 2NU3E 2EC9H 1LVMA 2Y82A 1NM6A 1GMCG 1SOTA 4K8BA 3ZZ3A 3M3VA 1GBAA 4J2YB 1FLEE 1DY9A 1GDUA 1IQFA 4X6MA 5JBCS 2AMDA 1KXEA 1FN6A 3AVZA 1EZXC 3ATKA 3E0PB 3N7OA 1ZJDA 4IS5A 1RJXB 3RC4A 1MTNC 1WBGB 1S6HA 1A46H 3O8BA 1CVWH 3R0FA 2OP9A 4AG2A 3PO1C 1NFXA 4WMEA 1F0RA 2ZFFH 2ZFRH 3KL6A 1WUNH 1QRWA 3RU4E 2PTCE 3FANA 3U8RH 1Y3XA 1TNIA 3GCOA 3HPTB 4X2WA 1GBLA 2EI6A 1IQHA 1XVMA 2PTNA 1TB6H 1OP0A 4E7NA 4MTBA 1A61H 4ABBA 1HJAC 2O8LA 1DM4B 1FI8A 3B9FH 3MYWA 1UK2A 1BRAA 3SV7A 1C5VA 1EAXA 1EOLA 1O3MA 1DPOA 4TPIZ 3RXGA 1VR1H 4WH6A 3UNRA 1FAKH 2BLVA 2R2MB 2WPIS 4NA8A 1O5EH 2BOKA 1F7ZA 2FXRA 4JYVH 2K1QA 1ZSLA 3PMBB 4A7IB 1IHTH 1BBRH 3UPEA 4ZUHA 1D3QB 1YC0A 2TGTA 1UCYH 3MU5A 3Q3KA 5DO4H 1TX8A 3ZYDA 1ELCA 1AWFH 1L1NA 1O3DA 4O97A 4U30A 5FCRA 1KYNA 1W3CA 4HI3A 3O8DA 1LVYA 8KME2 3TGJE 5FCKA 3UQOA 4DVAU 5C2ZA 1H9HE 2VVVA 3ZZ7A 5JB9S 1QA0A 1D3PB 1THRH 2BB4A 2F9BH 3GY7A 4HZHA 1ZMLA 1GMDF 3H5CB 2GT7A 4Y8XA 1VCWA 1ETSH 1V3XA 1GBKA 2BXUH 1A4WH 2ZDVH 3GCNA 1ELAA 5EODA 1YCPM 3AAVA 2YNBA 1UMAH 3SHCH 1WSSH 4X6NA 3QLPH 1QBOA 4ABFA 1K21H 1V2UT 3SNAA 1OP2A 1SVPA 2XWBI 2XBXA 3TPIZ 1UTNA 2JETC 1A0HB 1GHWH 1C2DA 5BRRE 2FLBH 2BLOA 3UWIA 1AZZA 5A0BA 2PKSC 2SGFE 1BT7A 2ANMH 1NU7B 1C2MA 3VGCB 4ABAA 2H2ZA 3SV6A 3SUDA 3TGKE 3DFJA 3ITIA 1A1RA 1AGJA 2HVXA 3GCTF 2VH6A 1F0SA 4NSVA 1HFDA 1WOFA 5JBAS 1O37A 3M7UA 1GGDB 4LZ1H 3ZZAA 2FI5E 3MO3A 1C5QA 2BD9A 2IN2A 4MG3A 3SU0A 3ZZ9A 3ATMA 1VJAU 2EI8A 4B73A 4ESTE 1UVSH 2XTTB 2V6NA 5DK1A 1GBEA 2QY0B 1BITA 4FUDA 3SI4H 3S7HB 2FM2A 1GI9B 1KDQA 5L2ZH 2QXIA 1MKXK 2VH0A 2C8ZB 5JBBS 2CV3A 2HPQH 1AN1E 5PTPA 3LC3A 5F6MA 5HYOA 3UQVA 2OTVA 4BTTB 3OYPA 3I29A 4F49A 1GBCA 1XVOA 2VJ1A 3RXVA 1AU8A 4ZKNU 1A0JA 1GL1A 1O3NA 1TRNA 1G36A 2Q1JA 1HXEH 4MPVA 4XDEA 1K1LA 1C5OH 3L3TA 4FUGA 3RXUA 3GCHB 2QXGA 2ODYB 3MI4A 3A7TA 1GJ5H 3ZZ6A 4K5ZA 1INCA 1O3PB 1UK3A 2BD4A 4Y7AA 2QV1A 1GCDA 4BXSA 2WPHS 1LHGH 1C5RA 5ABWA 2PGQB 3P92A 2F91A 4XSKU 2SGQE 4YLUA 1V2MT 2G4UA 4XBDA 4DIIH 1HYLA 3LT3A 3RM0H 3P95A 2BD7A 3R3GB 4IN2A 1O34A 1Z8IB 2P95A 5JYIA 4ISIH 1QA7A 4YZUA 1HAOH 3RMOH 3M5MA 1GDNA 1P9UA 3A85A 4ZXYH 4ISHH 1O38A 4A1TA 5GWZA 4FVDA 2VU8E 3A7VA 1LHFH 3O8CA 3BSQA 4DOQA 3BTHE 3JZ1B 1OS8A 3Q00A 5GDSH 1YM0A 3ATLA 4AG1A 4ABDA 1F5LA 4E7RG 1MU6B 3BTEE 1L4DA 3LONA 2C3SA 1MTWA 2R3UA 1TBZH 1VGCB 1MTVA 1HUTH 3T25A 2WUCA 3SN8A 2ZGJA 1MBMA 1LHEH 1SG8B 2WPLS 1DDJA 1CA8B 4A92A 1O3BA 3U8TH 2J34A 4BAHB 1QCPA 1SQOA 1WYKA 1CO7E 1TBRH 3VB6A 2W5EA 4LXBH 1SHHB 1YLDA 1NPMA 3NWUA 5BPEA 3TIUA 4MNXA 5LPEA 1L1GA 3GDSA 4Q7XA 1O36A 3ZZBA 4MVNA 1B5GH 1TOMH 1P3CA 1J14A 4BAKB 5HM2A 1QNJA 1YYY1 1GBBA 1C5ZB 1RXPA 3V3MA 1MU8B 2RDLA 1XM1A 2ZU5A 3ATWA 4CH2B 1VJ9U 1HB0B 1P10A 2SGAA 3PTNA 1DWBH 2ODPA 1P2QA 3SNBA 1ELDE 1C2IA 1O2UA 1B0FA 1RFNA 2A4QA 5ESBA 2C4FH 4R0IA 1KXDA 5E0HA 1O3AA 1UTLM 3U98H 1P2MA 1DSTA 4GPGA 1G32B 1AHTH 4FUBA 2W7SA 2RA0A 1P04A 1HAGE 4A6LA 1KDQB 3ZZDA 1XUIA 1Z6EA 2HNTF 2BY5X 1PQ5A 3VB5A 5C67A 1TQ7B 3KHVA 3RUOA 1AFQC 1LPGB 4FU9A 1BMMH 1O2OA 3FZZA 5CMXH 4AYYB 3RLYH 4TWYA 3BIVH 1GHVH 3OTJE 2GZ8A 1SQAA 3KQCA 1O3GA 3SO3A 3S0NA 3PYHA 5LPRA 1ANEA 1H8IH 4KTCA 1EZUC 4X8VH 3EA8A 3A87A 6GCHF 1GHZA 3H7OA 1DOJA 4ABIA 1HAIH 3BG4B 2ZHQH 5F03A 4ZAEA 1CGHA 1SGPE 2FI3E 2GTBA 2Y5HA 1LDTT 2XC0A 1DWEH 4H42U 2AGIX 1EPTC 2ZNKH 1BB0B 1RGQA 3PB1E 1PPEE 1YPHC 3DD2H 2QF0A 3DT0H 1YBWA 4WXVA 3T27A 1FY3A 1D3DB 1GG6B 3RXPA 1NO9H 2A1DB 1G3EA 1ZHRA 1ORFA 4MPUA 1O2SA 2O8UA 3NCLA 2ZTZA 1DE7H 2GV7A 2ZF0H 4NZQA 2QXHA 2BOHB 2XWAA 1MKWK 3ZVBA 3FZDA 2XCFA 1QR3E 4CR5A 2ZU2A 3PWCA 5JBTA 1HPGA 1XUHA 1GI6A 4KELA 3A7ZA 1YGCH 1UK4A 3F9EA 1UTMA 2Y80A 1C5MD 3HK3B 4BXWA 3BTDE 1RTLA 3KN2A 1E36B 3DA9B 1Y5AT 1BBRE 3LGYA 3URDA 1GHAG 1YCPK 4WXIA 3P70B 1TAWA 4X1QU 2C90B 1UCYE 3M7QA 2PW8H 3F1SB 4K3JA 1C1RA 3KEEA 1TBQH 4JYUH 2BQ7B 1C1QA 4YOJA 3RU4T 1A3EH 1P2JA 3PLBA 1S5SA 1QY6A 3TVJB 2CGAA 2FOFA 1O35A 3BV9B 1G9IE 1D9IA 5C5OA 5AHGH 1UO6A 1O3FA 1JOUB 3FP6E 4TYDA 3SI3H 3VB4A 2G5VA 1C2GA 3E8LA 4Y8ZA 5IYTA 1SBWA 4MNYA 2HWLB 2OQ5A 1S0QA 3F6UH 4YT7H 4MLFB 3LDXH 4X1RU 3E16B 2ESTE 1BMLA 2BM2A 3SU4A 2PWXA 2A45B 2Z6BD 5SGAE 3K9XB 3ZVFA 2BVSH 4J1YA 4FUFA 1GI7B 1SLWB 4AORA 1N8OB 1QIXB 3RXBA 2Z9LA 3UR9A 1KLTA 1GI3A 3E6PH 4FUJA 5EOKA 1TGTA 1V2WT 2FMJA 1T4VH 3MU4A 4NA9H 2THFB 1XUKA 1V2VT 1H9IE 1FIWA 1JRTA 2CXVA 2FTLE 5E2PA 1FPHH 1O3LA 1GBTA 2Y6TA 4ZH8A 2C8XB 1GBDA 3IWMA 2ZFPH 3S9BA 1P9SA 4O3UA 2SNVA 1FQ3A 1S83A 1UTQA 1P2NA 1ZRKA 1FMGA 2VNTA 3RMLH 4B74A 2W3KA 2SNWA 4NWLA 1GBJA 3ZV8A 2PSYA 1C5XB 1NS3A 1TGBA 4I8KA 3BG8A 1OYQA 1MQ6A 1DUAA 1MCVA 2Q6GA 3FP7E 3U9AH 4NFFA 4ZKSU 3GICB 1O3HA 1BHXB 3W95A 3TH4H 2Q6DA
chains in the Genus database with same CATH superfamily
4YLQH 3RXLA 2GD4B 1RTKA 1GI1A 1JXPA 4X2VA 3RXCA 5C1UA 1W10U 3BEFB 3P8FA 1EX3A 2FOHA 1ETTH 1J17T 3CENA 2IOTA 5EJZA 3V12A 2ZG0H 5I25A 3HKIB 1BOQA 5EQRA 1C1WH 4ABJA 1CGIE 2CHAB 3SHAH 4D8NA 1E79D 4AX9H 4BOHA 1BMNH 5CE1A 3BTGE 3P8GA 4H6TA 1P2IA 1O2YA 4K8YA 1EXFA 3LJOA 5H4IB 4GVUA 2WPKS 5F8ZA 4K2YA 1GI4A 5DP5A 1O3EA 1PQ8A 4H4FA 1TPOA 1Z1JA 2YOLA 2AYWA 1ZTLA 3UY9A 1LTOA 1JRSA 3ZYEA 4NG9H 3MH6A 1Z8JB 3VXEH 4X2YA 5GPIB 2B5TB 4YTAA 1IQMA 1SGCA 1J16A 3TK9A 1P8VC 2H6MA 2VIDA 1GHBG 1YLCA 1UTPA 3AAUA 5LH8A 1C1UH 3HATH 4Q2KA 1BA8B 3MNSA 3SV9A 3U1JB 1TOCB 1G2MA 2BYAX 1TA6A 1PQ7A 1TGCA 3MNCA 4FOUC 3BTKE 2VB0A 4AGKA 3PV5A 1SQTA 1NT1A 1F5KU 1GJ4H 1PPGE 2BMGB 2G00A 3RLWH 1T31A 2GCHF 1ELBA 1RS0A 3DSGA 2ZU1A 4MDSA 1QL9A 2VIVA 2EI7A 2OC0A 2OBQA 3QGNB 2VINA 2BDAA 3MH7A 2ZU3A 2ILNA 4DT7B 1CBWB 3QGJA 1C1VH 4LK4A 1DXWA 1NESE 2KX4A 1IQEA 3M5NA 2HNTE 2ZCHP 2ANYA 2SGEE 3VGCC 4YXWD 1Q3XA 2BVRH 3D23A 3SORA 1SHYA 3BTFE 2Z94A 5A09A 2F4LA 4NWKA 5FXLA 4DGJA 6CHAB 1SPJA 2Y5FA 3ODDA 2FO9A 4WF8A 4TPYA 2TPIZ 1GJ6A 2JJ1D 1QGFA 1QTFA 2OC1A 3MNBA 1TFXA 2D26C 4Q80A 3SZNA 1DVAH 1GGDC 1HAVB 2LNCA 1O3CA 2J4IA 2ZKSA 1G3DA 1MAYA 2QF4A 4WWYA 2AMPA 3QN7A 3RP2A 1A0LA 3RXRA 2BTCE 5FL7D 2DUCA 3PWBA 6LPRA 1H8ED 3ELAH 5C3NA 1BTYA 2XNDD 2JJ2D 2GT8A 1GMHG 2D2DA 2A5KA 2Z9JA 1O2JA 2ZCLP 4Y6DA 3AW0A 1WV7H 2V35A 1KTSB 4X8TH 3TNSA 5DG6A 2Z9IA 2L74A 1TE0A 1HCGA 1KTTB 4YOIA 2VWLA 1PYTC 3TU7H 1SSXA 4B2AA 2XW9A 2KCPA 1GHXH 2ZGXH 3GCHC 3GY6A 1AO5A 2HNTC 3GISB 1OP8A 2PV9B 1W7XH 1UHBA 3BTME 4DG4A 4NSYA 1CGJE 1SGRE 2AERH 3CP7A 2BHGA 4BAMB 1FUJA 1LPZB 4XBCA 1ZHPA 3IG6B 4FVBA 3MQKC 3QX5H 2RDEA 2ZECA 1Y5UT 3Q3XA 3A83A 2VIPA 1O2TA 1TGNA 4B6FA 4IMZA 1FY5A 5DP3A 3F2GA 2H9TH 1P11E 2OBOA 1TMBH 2F83A 1DITH 2ZDLA 4TY7A 2GKVE 4DJZB 1J9CH 1ZTJA 1OWHA 3P8NA 4YT6H 3SV2H 4GCHF 5C20A 1O2KA 3BEIB 2BDIA 3TJUA 4DW2U 4I32A 2BX3A 1B7XB 4Y79A 1W0ZU 3GDUA 1CT2E 2OUAA 5E8EH 4JK5A 1W11U 1BIOA 2BQ6B 2J2UA 2VWNA 1NFYA 3ZZ4A 3K65B 1BMFD 4CHAB 5HIYA 2GDEH 3PMAB 1GJBB 4JZIA 1O2WA 3KQEA 1GI8B 3ATIA 2YMSD 3SW2B 1D4PB 2EA3A 1P06A 1KXAA 2XBYA 1LQEA 1B0EA 1Z8RA 5GCHG 1BQYA 2UWOA 4LZ4B 2BZ6H 3M5OA 1E1QD 3BTTE 5C94A 1AKSB 1MTUA 6ESTA 1WCZA 4KKDA 3S69A 1VCQA 3LH1A 1FY8E 4QT8C 2HRVA 1E34B 4IN1A 2FOBA 1P12E 3NXPA 4H6SB 1SGFG 1YPKH 1LVOA 1QRXA 1OWDA 4RKOB 2F9PA 2UUFB 5B6OA 2RFKC 3LH3A 1GI5A 1TABE 3UNQA 4VGCC 3SU1A 2PHBA 1PYTD 3ENSB 2KCYA 3ZVDA 1ARBA 1TPSA 1YWUA 4XRNA 2ZQ1A 4NZLA 3RC5A 3ZVAA 5C0TA 1KLJH 3KYFA 4B76A 3UR6A 1ZMJA 4ACBA 1ZOMA 2ANKH 1BTWA 4JZDH 3RXDA 1LHDH 3CS7A 4Z0KA 1IQJA 5F8XA 3VEQB 2D8WA 4D76A 1ZSKA 1BDAA 1GVKB 5EQSA 2A7JA 1SGTA 4KTSA 1GPZA 1HIAB 3PMJA 2KAIA 3RU4D 1BBRK 1C9PA 3BG4C 3QZQA 2QXJA 4TT3D 1UHBB 5AF9H 1MKWH 1UCYK 1W14U 4GUXA 1O5DH 2ZGBH 2BD3A 2HPPH 1BZXE 4FUHA 3QK1A 5DP6A 3STIA 4BAOB 4FUIA 1WQSA 2P3FH 2Y7ZA 1GG6C 2ZDAH 1NRSH 1DICA 3I78A 2NU1E 1XXDA 2XCNA 3STJA 5J4SA 1HDTH 5K0HA 1GMCF 2O8MA 1YCPH 2TGPZ 3PTBA 3SUFA 9LPRA 1UJ1A 1HXFH 4A1XA 1IQIA 2J38A 1FY1A 3HGPA 4X8UH 1Z8GA 4MPXA 3JZ2B 2P59A 4KP0A 1JBUH 2KM0A 2P8OB 1JIRA 1CHOG 1C5NH 1KMHB 1A7SA 1P05A 1TRYA 2EEKA 3A8DA 5T6FA 2AGEX 5KECA 2XC5A 3EA9A 3P17H 4K1SA 5C1YA 3TGIE 2FI4E 8GCHG 2FOMB 3TLOA 5HKKD 4R8TB 1BRUP 2HGTH 4INHA 4OS7A 3A88A 2C93B 2ZPSA 2RA3A 2YNAA 2BXTH 1FY4A 3MNXA 1TALA 1QQ4A 2ALVA 2ZQ2A 1TLDA 1H1BA 2AH4X 3EA7A 3WY8A 3MH5A 5F8TA 1ELFA 3ZVGA 1ZGVA 2IPHA 1WTHD 1XUGA 4XE4A 1S0RA 1DFPA 1EZSC 1K22H 3KQDA 3M7TA 1JMOH 3LGIA 3ZVCA 4ZHLU 1SI5H 3B8JA 1SR5C 2GX4A 1P02A 2STBE 4OS5A 3U69H 2FTMA 4I33A 1NRNH 1U6QA 1Z7KA 2ZZUH 2ZDNA 1MAXA 1OYTH 2R9PA 5T6DA 1P3EA 3VB3A 3Q76A 2BLWA 1QBVH 2FS8A 3MWIU 4ZKOU 1YKTA 2G81E 1O2MA 1BJUA 1D6RA 4Y71A 2W6ID 1NRPH 1NFWA 2ZWLH 1EB2A 3SJIA 1HAHH 2PGBB 5LPFA 2HLCA 1UTOA 1ABIH 4GLYA 1EOJA 2UWPA 2A7HA 2H9HA 2ZFSA 1NC6A 1TQ0B 3E90B 5TJXA 1A2CH 1N6XA 3LJJA 3AK5A 5GJ4B 1VITG 1UVOA 1SB1H 1GJ8B 1V2NT 2V3MA 1C4Y2 1N8OC 4KTUA 5A0CA 4OGXA 3SUGA 2FX6A 5I46H 2FLRH 5CHAB 1ZMNA 4UEHH 1SLXB 2O8TA 4PROA 3SZEA 1D3TB 4GHQA 3F68H 3RXMA 1CT0E 4P00A 3LGTA 2FYQA 4BNRA 2FDAA 1P01A 3V7TA 2W7UA 4TSFD 1IQKA 2FX4A 2VVCA 1HJ9A 1C5WB 1O5BB 1P03A 2FPZA 2IPQX 1QQUA 1GBFA 3OU0A 5A8ZA 1V2OT 4OGYA 3B23B 4U32A 2JH5D 5EXLA 1BRCE 1DX5M 1ZPZA 2J95A 1HBTH 1BTPA 1TNGA 1EAIA 2WPDD 2FOEA 3SU6A 2WYJA 1GBMA 2KAIB 5L2YH 2EQNA 4JCNA 4D9QA 5FX6A 1S85A 5G4BA 1HRTH 3D62A 3A7WA 1ZYOA 2M5TA 4DURA 1O2HA 1SGQE 2NU0E 1A3BH 1O5GH 1K1PA 4Y76A 5HXFA 3SU3A 1BRBE 1K9OE 4X1PU 5HMAA 3A8AA 1MH0A 1K2I1 3GY2A 4UD9H 1XX9A 1SQRA 4INLA 3S9CA 2BDGA 1DT2A 1V2RT 1CA0B 7KMEH 4IC6A 4X0WU 2I6SA 1G30B 1NN6A 2IJOB 5CHBA 1CQQA 3OY6U 3GYLB 5EW1H 1O5FH 4SGBE 4ZMAH 1DWCH 1BMAA 5E0JA 4ZCNA 1EP6A 5L6NH 1FPCH 1GWAA 5FPYA 1EJNA 4CRAA 3IITA 1WXRA 2OD3B 3FOAA 1AI8H 2SGDE 3MO9A 2BDCA 3UB0A 1YPLH 4X1SU 1C2HA 1G3CA 2QC2A 3L6PA 1C1OA 1E37B 3BN9A 2PSXA 1RTFB 4RN6A 1YP9A 3W1EA 2ZHEH 2H5DA 5EPYA 3UNSA 2P94A 1FXYA 1GMDG 1Q31A 1VCPA 1DXPA 3T5FH 4CRCA 2C8WB 2NU4E 1HAVA 1CSOE 1XUJA 3VXFH 1K1MA 1K28D 1LMWB 3SNDA 4HG6A 1AZ8A 3SJ8A 4XFQA 4B1TA 3DSPA 1FV9A 4AOQA 1CBWC 1VZQH 5KGOA 3OY5U 3ESTA 3SJKA 4MPWA 4K1EA 1PPZA 3F2FA 2ULLA 2ZEBA 1ZJKA 3VFEA 4ZHMU 2H5CA 4CRDA 3D65E 4NIWA 4BANB 1BJVA 1O30A 6CHAC 3KF2A 4YESB 2Z9GA 1YPJH 1IQGA 4X6OA 3V0XA 2I6QA 3KCGH 4WMDA 4E05H 1K1IA 2JH0D 3SGAE 1CHGA 3GCTG 2QAAA 1YY3A 3SNCA 3M35A 3M3TA 3A8BA 5EQQA 3MU8A 1MD8A 1C5SA 1AB9B 4D7FA 1AUJA 2R2WU 1M9UA 2BY6X 1XMNB 2GMTB 1IHSH 1AVXA 1O2PA 2OC8A 4JZFH 1UVUH 1Z6JH 2ZPQA 1EAWA 2ZHFH 3MH4A 3ZZ8A 1J8AA 1ACBE 3GY3A 1OXGA 3H09A 1VITH 3KIDU 4INKA 4M9FA 1G3BA 1MBQA 1OWJA 4FU7A 1W0JD 1EATA 1THPB 1Y3YA 2UUJB 2G55A 3SU5A 1QRZA 5IK2D 3UWJH 3QZRA 3RC6A 4AYVB 3A82A 3SJ9A 1T32A 2PKAB 3G01A 1N6YA 1FAXA 1C1TA 4DIHH 5GXPA 3DFLA 3Q3YA 1OWKA 1UTKA 2ZA5A 3BTQE 1O31A 4BTUB 3RMMH 4I8LA 1AE5A 4AC9A 1HLTH 5T3HA 1W13U 2XRCA 1BUIA 3TJVA 2V7QD 5CDFE 3Q77A 1C4U2 2OINA 2OLGA 3FFGA 1ID5H 1ZR0A 3S7KB 2VIWA 1Y59T 1W7GH 3F0OA 1Y8TA 1KXFA 1SFIA 2ZGCA 2R0LA 3FO8D 1TYNA 3N7EA 1PQAA 2Z9KA 1GI0A 3QTVH 1FJSA 1ESTA 1GJ7B 4OM9A 4ZHAA 1TIOA 1V6DA 2C8YB 1FDPA 2CF9H 3L33A 1ANDA 3PROA 2ZCKP 3AASA 4IC5A 3E1XB 2BDYA 1KLIH 1H9LB 1NBMD 1SC8U 5AVDA 2XBWA 8LPRA 1T8MA 3A80A 4RSPA 1SLVB 1GVZA 1VITF 1HAXB 2ASUB 1BTXA 1ELGA 1ESBA 1GCTB 1OX1A 3GY8A 1EQ9A 1QJ6B 2F9UA 1MZDA 4SGAE 4E06H 1AKSA 2FOGA 3N7DA 2J5UA 2CK3D 3OE7D 1PPCE 1RRKA 4Y7BA 1XKAC 1HJ8A 3RMNH 4AGJA 4WH8A 2GV6A 5LGOA 3OX7U 1TX7A 1L4ZA 1Z71A 1MKXH 2UWLA 2J98B 5C1XA 1UVTH 4NCYA 1IQLA 2Y81A 2FYRA 7GCHG 3MU0A 1TPPA 2PR3A 4CHAC 2JIZD 5DP4A 1O2NA 2VBCA 4MNVA 1TNHA 1H4WA 1HGTH 1BHXF 4KGAA 2W6JD 2Y7XA 3O8RA 4WJG2 3GY5A 2A2QH 1K1JA 1K1OA 1OWEA 1W0YH 3FVFB 2ANWA 1LCYA 3HKJB 5EPNA 2OQUA 1A5HA 3QDZB 1ZHMA 1W8BH 1GHAF 4B2CA 1JWTA 3A86A 1T4UH 3D49H 3NK8A 1MZAA 3NKKA 1LKBA 1WU1A 2AMQA 2QF5A 2Z7FE 4OS2A 1HIAA 4JZEH 1EZQA 3SJOA 4P02A 2HVYB 3ODFA 4RT0A 4XBBA 1Y3UA 3DUXH 5C5NA 9ESTA 3F2HA 3FAOA 2VWOA 4I7YH 5FPSA 1Y5BT 1DUEA 1DLKB 2JKHA 1W12U 4UDWH 4YM9A 2W26A 4YO9A 5FPTA 2QIQA 1MCTA 3K6YA 1RIWB 4F55A 3I77A 1NRRH 3ZZ5A 2G5NA 4RT1A 5JB8S 2GCTB 1HNEE 5L30H 1UTJA 5DJ7A 1C1PA 3QWCH 2A4GA 1IAUA 2J97A 7LPRA 1O3JA 4ABGA 3KQ5A 4CH8B 2WINI 3ZV9A 3S9AA 1AUTC 1Q2WA 2XYAA 5DPAA 2VGCB 3PLKA 1BCUH 5DKMA 1G2LA 3EE7A 1BTZA 1LO6A 4K60A 3LKWA 3NUMA 3T26A 3E3TA 2R3YA 6GCHG 2ZFQH 3BF6H 4O9VA 1YPEH 1MUEB 2CN0H 3GOVB 1C5LH 2ZTYA 2WV5A 3KNXA 4UONA 1GDQA 1AIXH 1V2KT 5DGJA 3FP8E 1V2LT 1VGCC 2BDHA 2F9OA 1J15A 3RXKA 4ZROA 2XNIA 3UTUH 2BY7X 1NTPA 4FU8A 2G8TA 2BD8A 3PV4A 1NROH 4CRBA 4B71A 4ISOA 1TNJA 4IW4E 3F9FA 1GI2A 1SGFA 2FS9A 2ZTXA 4HGCA 4X1NU 3GYMA 3SYJA 1EUFA 2P8OC 1OKXA 2H9EH 4IGDA 1KSNA 2PUXB 4O3TA 3ZZCA 1DANH 1ZRBA 3QO6A 3HGNA 1WQVH 1S84A 1TNLA 4A1VA 2LPRA 1N1LA 1O2LA 1MTNB 2BY9X 2WPMS 2GZ7A 5FBEA 1LKAA 4BTIB 4I86A 1EFRD 4GAWA 3TITA 2BLQA 3VPKA 2G4TA 1V2JT 3PO1B 2FP7B 2HOBA 1L0ZA 2QGRA 1AVWA 2YMSB 4ISLA 4NFEA 3E91A 4AFQA 2AS9A 4Y8YA 1O2QA 1O3KA 2WV4A 1O2IA 5EJ1A 2F9VA 4OS6A 3RXTA 4X6PA 5HIZA 1MMJN 3F9GA 3M61U 4DY7B 1ELVA 2AHME 2TGDA 4HTCH 4Y0YE 3UFAA 3UREA 2GZ9A 3RXFA 5FX5A 1C5PA 2KFWA 1AY6H 2A5AA 1HJAB 2A32A 1IOEA 4JYTA 2P3UB 4IMQA 1Y3WA 4GSOA 1LVBA 3KYGA 4WY3A 1TONA 2GGVB 2QCYA 3SGQE 3HK6B 4WVPE 1KXBA 3RXQA 2ZO3H 1TMTH 4M7GA 1THSH 3EE0B 1YPMH 4Y0ZE 1XKBC 3P8OA 1CT4E 3K6ZA 1SGDE 2H1UA 1QJ7B 3UUZA 1TX6A 5ESTE 5TCAA 4UE7H 2ZPRA 4U2WA 4UFEH 5C0UA 5TCCA 2D1JA 1F2SE 4GHTA 3E0NB 1GHBF 1QB6A 1NRQH 2ZDKA 2L6OA 2P93A 4FUEA 4IBLH 3T62A 2UUYA 5CHAC 1V2PT 3TH3H 3M36A 2UUKB 3OSYA 2O8WA 1QL8A 2OCVB 1GBIA 3RDZA 1P09A 4I8JA 3M5LA 5AFZH 3T2NA 1MD7A 1QB1A 1TPAE 5A2MH 4JK6A 2BQWB 3FKSD 4NIXA 1HAYB 1CE5A 3SBKA 2JETB 2Z3EA 3NRLA 4A5TS 5EG4A 1TRMA 1LQDB 1QFKH 4HFPB 3MOCA 2RCEA 2AFQB 1GVLA 3LIWA 2PKSB 4ASHA 1SLUB 8ESTE 1PPHE 3F9HA 3EDXB 2ODQA 1ZLRA 2W3IA 3A7YA 1L2EA 1DLEA 4Y11E 3ZVEA 4AFSA 1ZTKA 1O39A 3LGVA 1O2ZA 2QA9E 1FNIA 1XUFA 1NU9A 2R0KA 7GCHF 3RXOA 3QUMP 2WZQA 3CNRA 4FETA 1S6LA 2K0QA 1GHYH 5EW2H 1F0TA 2SFAA 3SOSA 1C9TA 1P57B 2J92A 3A8CA 2F3CE 1GJ9B 3A81A 1AD8H 1T8LA 1PFXC 2B0FA 1CA0C 4NA7A 1QB9A 2ZHDA 3UOPA 3FN8A 5HGGA 4TY6A 1QHRB 2FOCA 1C2LA 2OC7A 1E35B 2ZC9H 1GJCB 1OOKB 4OS4A 3TJOA 1GMHF 1EJAA 3RXEA 3C1KA 3NZIA 1ZSJA 2ZDMA 2BZAA 4B2BA 1TMUH 5DP8A 2A4OA 3KQBA 1YPHE 2ZI2H 3KGPA 3A7XA 4ABEA 5JDUB 2PFEA 4CBOA 5HM9A 3URCA 1NZQH 3N99A 2FIRH 4VGCB 1EP5A 1HAZB 2TRMA 3MHWU 4ISNA 1SGNE 2BX4A 2QYIA 1F5RA 1TGSZ 2FWWA 3P6ZB 1SOZA 4CRFA 1FN8A 2Q6FA 1SGEE 3RM2H 3BTWE 4YOGA 4LOYH 1EPTA 1O2XA 3SGBE 1KY9A 2GCHG 1C5TA 3RXIA 1S6FA 4CR9A 2BD2A 4K69A 2DE8A 1T8NA 2DE9A 2NU2E 1SGYE 5EGMA 3TK5A 1SKYE 1O3IA 2WHXA 3SQEE 2RG3A 3UIRA 3SQHE 5F53A 1Z1IA 7ESTE 4D7GA 2A0QB 2A2XH 2TBSA 1YPGH 3M3SA 3OTPA 3A89A 1PPBH 3EAJA 1O2RA 1C2JA 3GDVA 1C2KA 3V13A 2VVUA 4CRGA 2TIOA 2Z3CA 3BEUA 1A5IA 1ANCA 1YF4A 2J94A 2Y5GA 3EGKH 5T6GA 3UAIC 2V3HH 1C2FA 2PKAA 4UFFH 2JH6D 1MTSA 5FBIA 1C1MA 2TGAA 4ZKRU 1AE8H 1AFEH 1AB9C 3UOUA 1CU1A 5J4QA 1QBNA 2A31A 1W0KD 3U1IB 1LHCH 1OSSA 2GMTC 2SGPE 4THNH 2F9NA 3CS0A 2XXLA 3LGUA 3RXAA 1PJPA 1NFUA 3NPSA 1EAUA 1O2GH 1ZPBA 2CHAC 3TNTA 3EYDA 4XOJA 3WWFA 5GIBA 1DSUA 2AGGX 4DT4A 1D6WA 2LELA 3QTOH 1A5GH 1G37A 2ZU4A 5GCHF 4AN7A 4K1TA 3LU9B 4X2XA 1TNKA 5DP9A 4AFZA 5FHTA 3T28A 1C5UA 2GVFA 3EQ0H 2ALPA 3VB7A 5FAHA 2P3TB 2B7DH 4Y10E 4FXGH 3LGWA 2ZGHA 1ANBA 1SL3A 4MQAA 3SU2A 4Q7YA 4F4OC 1C5YB 2FESH 1OPHB 1E38B 1T8OA 2V0BA 3K2UA 1P2KA 3MMGA 1O0DH 5EU8A 3DHKH 1EB1H 1V2QT 2WYGA 4AZ2B 4NIYA 4Q4LA 4CREA 1PPFE 1WAYB 2A7CA 3PMHB 1GJAB 1AMHA 3TJNA 3PRDA 3GS9A 2A5IA 1EJMA 1P0SH 1X7AC 2J98A 4JMYA 3U8OH 1ELTA 4RKJB 4Z6AH 1FONA 1RD3B 2J9NA 3RXHA 2QF3A 1ETRH 3RXSA 1AFQB 1H8DH 1TA2A 3RXJA 3SV8A 2BVXH 4ABHA 2CMYA 1YLNA 3BIUH 5EXNA 1ELEE 1KIGH 3OAAD 2STAE 1GCTC 5B6LA 2CJIA 1COWD 2AIPA 1UVPA 1S82A 1SGIB 1C2EA 2GDDA 1W2KH 1WTGH 2B8OH 3PLPA 5IDKA 2G51A 2A4RA 3LPRA 2AEIH 3M37A 4GCHG 4B75A 2FEQH 4CBNA 2ZFTA 1ZZZA 4BAQB 1V2TT 2OXSA 2G52A 1EPTB 1FIZA 3MTYA 2FOAA 5ETXA 1EKBB 5A8XA 4F48B 3TH2H 3OEHD 4NIVA 1LPKB 2AIQA 2XC4A 1DWDH 3MO6A 1GBHA 3SUEA 1O5CB 1SFQB 2V3OH 2WUBA 4O03A 5A8YA 3W94A 2BDBA 1CHOF 5DP7A 2WPJS 4NGAH 4UFDH 1HV7A 1ESAA 5JPMH 1C4V2 1O3OA 1E0FD 8GCHF 4JZ1A 1BTUA 1GJDB 1XXFA 1DY8A 2ZP0H 3OEED 4AFUA 1JIMA 4Q7ZA 1Y3VA 4TWWA 1L1JA 2VIOA 1O5AB 1F92A 1C1SA 2FODA 2KR7A 3A84A 2ZIQH 2GP9B 2PLXA 4OS1A 1DS2E 3MFJA 5DSFA 1NY22 4ZXXH 3LOXA 5AFYH 3TK6A 2WV9A 3C27B 2WSSD 1TWXB 4I8HA 2FZZA 2VIQA 5E0GA 1IQNA 1HAPH 5GNDA 4XD7D 4D9RA 1S81A 3AW1A 1RIWC 5A0AE 1OWIA 1ABJH 1ZGIA 3MU1A 3PM3A 2O9QA 2GCTC 1O2VA 1C1NA 4DCDA 3OFND 1EASA 1K1NA 2CF8H 3GY4A 2BD5A 1F0UA 2NWNA 2BY8X 1AVGH 4U01A 1MQ5A 3H7TA 1AQ7A 4WMFA 1GL0E 2VGCC 4MNWA 2PUQH 1P2OA 1ZPCA 4AB9A 1KXCA 1V2ST 4AB8A 1QURH 3T29A 3LC5A 2Z3DA 1FZZA 2P16A 4FUCA 1QJ1B 1QL7A 1ARCA 2B9LA 3SNEA 5E2OA 2QE7D 2XBVA 1T7CA 2VWMA 4I8GA 1SMFE 5K7RA 2QN5T 5EXMA 1BTHH 4B6EA 1O32A 1AWHB 4UFGH 4X8SH 4I31A 1O33A 2ZHWH 2HALA 2NU3E 2EC9H 1LVMA 2Y82A 1NM6A 1GMCG 1SOTA 4K8BA 3ZZ3A 3M3VA 1GBAA 4J2YB 1FLEE 1DY9A 1GDUA 1IQFA 4X6MA 5JBCS 2AMDA 1KXEA 1FN6A 3AVZA 1EZXC 3ATKA 3E0PB 3PV2A 3N7OA 1ZJDA 4IS5A 1RJXB 3RC4A 1MTNC 1WBGB 1S6HA 1A46H 3DSOA 3O8BA 1CVWH 3R0FA 2OP9A 4AG2A 3PO1C 1NFXA 2YMSC 4WMEA 1F0RA 2ZFFH 2ZFRH 3KL6A 1WUNH 1QRWA 3RU4E 2PTCE 3FANA 3U8RH 1Y3XA 1TNIA 3GCOA 3HPTB 4X2WA 1GBLA 2EI6A 1IQHA 1XVMA 2PTNA 2KCOA 1TB6H 1OP0A 4E7NA 4MTBA 1A61H 4ABBA 1HJAC 2O8LA 1DM4B 1FI8A 3B9FH 3MYWA 1UK2A 1BRAA 3SV7A 2IJD1 1C5VA 1EAXA 1EOLA 1O3MA 1DPOA 4TPIZ 3RXGA 1VR1H 4WH6A 3UNRA 1FAKH 2BLVA 2R2MB 2WPIS 4NA8A 1O5EH 2BOKA 1F7ZA 2FXRA 4JYVH 2K1QA 1ZSLA 3PMBB 4A7IB 1IHTH 1BBRH 3UPEA 4ZUHA 1D3QB 1YC0A 2K8IA 2TGTA 1UCYH 3MU5A 3Q3KA 5DO4H 1TX8A 3ZYDA 1ELCA 1AWFH 1L1NA 1O3DA 4O97A 4U30A 5FCRA 1KYNA 1W3CA 4HI3A 4ACAA 3O8DA 1LVYA 8KME2 3TGJE 5FCKA 3UQOA 4DVAU 5C2ZA 1H9HE 2VVVA 3ZZ7A 5JB9S 1QA0A 1D3PB 1THRH 2BB4A 2F9BH 3GY7A 4HZHA 1ZMLA 1GMDF 3H5CB 2GT7A 3WW7A 4Y8XA 1VCWA 1ETSH 1V3XA 1GBKA 1FX0B 2BXUH 1A4WH 2ZDVH 3GCNA 1ELAA 5EODA 1YCPM 3AAVA 3F3BA 2YNBA 1UMAH 3SHCH 1WSSH 4X6NA 3QLPH 1QBOA 4ABFA 1K21H 1V2UT 3SNAA 1OP2A 1SVPA 2XWBI 2XBXA 4Q63A 1UTNA 2JETC 3TPIZ 1A0HB 1GHWH 1K0HA 1C2DA 5BRRE 2FLBH 2BLOA 3UWIA 1AZZA 5A0BA 2PKSC 2SGFE 1BT7A 2ANMH 1NU7B 1C2MA 3VGCB 4ABAA 2H2ZA 5T1VA 3SV6A 3SUDA 3TGKE 3DFJA 3ITIA 1A1RA 3PRBA 1AGJA 2HVXA 3GCTF 2VH6A 1F0SA 4NSVA 1HFDA 1WOFA 5JBAS 1O37A 3M7UA 1GGDB 2PP6A 4LZ1H 3ZZAA 2FI5E 2LP6A 3MO3A 1C5QA 2BD9A 2IN2A 3DCLA 4MG3A 3SU0A 3ZZ9A 3ATMA 1VJAU 2EI8A 4B73A 4ESTE 1UVSH 2XTTB 2V6NA 5DK1A 1GBEA 2QY0B 1BITA 4FUDA 3SI4H 3S7HB 2FM2A 1GI9B 1KDQA 5L2ZH 2QXIA 1MKXK 2VH0A 2C8ZB 5JBBS 2CV3A 2HPQH 1AN1E 5PTPA 3LC3A 5F6MA 5HYOA 3UQVA 2OTVA 4BTTB 2KCAA 3OYPA 3I29A 2GJGA 4F49A 1GBCA 1XVOA 2VJ1A 3RXVA 2F43B 1AU8A 4ZKNU 1A0JA 1GL1A 1O3NA 1TRNA 1G36A 2Q1JA 1HXEH 4MPVA 4XDEA 1K1LA 1C5OH 3L3TA 4FUGA 3RXUA 3GCHB 2QXGA 2ODYB 3MI4A 3A7TA 1GJ5H 3ZZ6A 4K5ZA 1INCA 1O3PB 1UK3A 2BD4A 4Y7AA 2QV1A 1WDIA 1GCDA 4BXSA 3F0PA 2WPHS 1LHGH 1C5RA 5ABWA 2PGQB 3P92A 5DN6D 2F91A 4XSKU 2SGQE 4YLUA 1V2MT 2G4UA 4XBDA 4DIIH 1HYLA 3LT3A 3RM0H 3P95A 2BD7A 3R3GB 4IN2A 1O34A 1Z8IB 2P95A 5JYIA 4ISIH 1QA7A 4YZUA 3WWBA 1HAOH 3RMOH 3M5MA 1GDNA 1P9UA 2JDID 3A85A 4ZXYH 4ISHH 1O38A 4A1TA 5GWZA 4FVDA 2VU8E 3A7VA 1LHFH 4ASUD 3O8CA 3BSQA 5KEDA 4DOQA 3BTHE 3JZ1B 1OS8A 3Q00A 5GDSH 1YM0A 3ATLA 4AG1A 4ABDA 1F5LA 4E7RG 1MU6B 3BTEE 1L4DA 3LONA 2C3SA 1MTWA 2R3UA 1TBZH 1VGCB 1MTVA 1HUTH 3T25A 2WUCA 3SN8A 2ZGJA 1MBMA 1LHEH 1SG8B 2WPLS 1DDJA 1CA8B 4A92A 1O3BA 3U8TH 2J34A 4BAHB 1QCPA 1SQOA 1WYKA 1CO7E 1TBRH 3VB6A 2W5EA 4LXBH 1SHHB 1YLDA 1NPMA 3NWUA 5BPEA 3TIUA 4MNXA 5LPEA 1L1GA 3GDSA 4Q7XA 1O36A 3ZZBA 4MVNA 1B5GH 1TOMH 1P3CA 1J14A 4BAKB 5HM2A 1QNJA 1YYY1 1GBBA 1C5ZB 1RXPA 3V3MA 1MU8B 2RDLA 1XM1A 2ZU5A 3ATWA 4CH2B 1VJ9U 1HB0B 1P10A 2SGAA 3PTNA 1DWBH 2ODPA 1P2QA 2M2AA 3SNBA 1ELDE 1C2IA 1O2UA 1B0FA 1RFNA 2A4QA 5ESBA 2C4FH 4R0IA 1KXDA 5E0HA 1O3AA 1UTLM 1QZ8A 3U98H 1P2MA 1DSTA 4GPGA 1G32B 1AHTH 2HLDD 4FUBA 2W7SA 5EJLA 2RA0A 2EY4C 1P04A 1HAGE 4A6LA 1KDQB 3ZZDA 1XUIA 1Z6EA 2HNTF 2BY5X 1PQ5A 3VB5A 5C67A 1TQ7B 3KHVA 3RUOA 1AFQC 1LPGB 4FU9A 1BMMH 1O2OA 3FZZA 5CMXH 4AYYB 3RLYH 4TWYA 3BIVH 4Z1MD 1GHVH 3OTJE 2GZ8A 1SQAA 3KQCA 1O3GA 3SO3A 3S0NA 3PYHA 5LPRA 1ANEA 1H8IH 4KTCA 1EZUC 4X8VH 3EA8A 3A87A 6GCHF 1GHZA 3H7OA 1DOJA 4ABIA 1HAIH 3BG4B 2ZHQH 3U28C 5F03A 4ZAEA 1CGHA 1SGPE 2FI3E 2GTBA 2Y5HA 1LDTT 2XC0A 1DWEH 4H42U 2AGIX 1EPTC 2ZNKH 1BB0B 1RGQA 3PB1E 1PPEE 1YPHC 3DD2H 2QF0A 3DT0H 1YBWA 4WXVA 3T27A 1FY3A 1D3DB 2OK5A 1GG6B 3RXPA 1NO9H 2A1DB 1G3EA 1ZHRA 1ORFA 4MPUA 1O2SA 2O8UA 3NCLA 2ZTZA 1DE7H 2GV7A 2ZF0H 4NZQA 2QXHA 2BOHB 2XWAA 4RI0A 1MKWK 3ZVBA 3FZDA 5C17A 2XCFA 1QR3E 4CR5A 2ZU2A 3PWCA 5JBTA 1HPGA 2XOKD 1XUHA 1GI6A 4KELA 3A7ZA 1YGCH 1UK4A 1UW7A 1E1RD 3F9EA 1UTMA 1NBME 2Y80A 1C5MD 3HK3B 4BXWA 3BTDE 1RTLA 3KN2A 1E36B 3DA9B 1Y5AT 1BBRE 3LGYA 3URDA 1GHAG 1YCPK 4WXIA 3P70B 1TAWA 4X1QU 2C90B 1UCYE 3M7QA 2PW8H 3ZIAD 3F1SB 1H8HD 4K3JA 1C1RA 3KEEA 1TBQH 4JYUH 2BQ7B 1C1QA 4YOJA 3RU4T 1A3EH 1P2JA 3PLBA 1S5SA 1QY6A 3TVJB 2CGAA 2FOFA 1O35A 3BV9B 1G9IE 1D9IA 5C5OA 1VKYA 5AHGH 1UO6A 1O3FA 1JOUB 3FP6E 2KZ4A 4TYDA 3SI3H 3VB4A 2G5VA 1C2GA 3E8LA 4Y8ZA 5IYTA 1SBWA 4MNYA 2HWLB 2OQ5A 1S0QA 3F6UH 4YT7H 4MLFB 3LDXH 5EIYA 4X1RU 3E16B 2ESTE 1BMLA 2BM2A 3SU4A 2PWXA 2A45B 2Z6BD 5SGAE 3K9XB 3ZVFA 2BVSH 4J1YA 4FUFA 1GI7B 1SLWB 4AORA 1N8OB 1QIXB 3RXBA 2Z9LA 3UR9A 1KLTA 1GI3A 3E6PH 4FUJA 5EOKA 3VG8A 1TGTA 1V2WT 2FMJA 1T4VH 3MU4A 4NA9H 2THFB 1XUKA 1V2VT 1H9IE 1FIWA 1JRTA 2CXVA 2FTLE 5E2PA 1FPHH 1O3LA 1GBTA 2Y6TA 4ZH8A 2C8XB 1GBDA 3IWMA 2ZFPH 3S9BA 1P9SA 4O3UA 2SNVA 1FQ3A 1S83A 1UTQA 1P2NA 1ZRKA 1FMGA 1MABB 2VNTA 3RMLH 2W3KA 4B74A 2SNWA 4NWLA 1GBJA 1OHHD 3ZV8A 2PSYA 1C5XB 1NS3A 1TGBA 4I8KA 3BG8A 1OYQA 1MQ6A 1DUAA 1MCVA 2Q6GA 3FP7E 3U9AH 4NFFA 4ZKSU 3GICB 1O3HA 1BHXB 3W95A 3TH4H 2Q6DA
chains in the Genus database with same CATH topology
4YLQH 3RXLA 2GD4B 1RTKA 1GI1A 1JXPA 4X2VA 3RXCA 5C1UA 1W10U 3BEFB 3P8FA 1EX3A 2FOHA 1ETTH 1J17T 3CENA 2IOTA 3V12A 2ZG0H 5I25A 3HKIB 1BOQA 5EQRA 1C1WH 4ABJA 1CGIE 2CHAB 3SHAH 4D8NA 4AX9H 4BOHA 1BMNH 5CE1A 3BTGE 3P8GA 4H6TA 1P2IA 1O2YA 4K8YA 1EXFA 3LJOA 5H4IB 4GVUA 2WPKS 5F8ZA 4K2YA 1GI4A 5DP5A 1O3EA 1PQ8A 4H4FA 1TPOA 1Z1JA 2YOLA 2AYWA 1ZTLA 3UY9A 1LTOA 1JRSA 3ZYEA 4NG9H 3MH6A 1Z8JB 3VXEH 4X2YA 5GPIB 2B5TB 4YTAA 1IQMA 1SGCA 1J16A 3TK9A 1P8VC 2H6MA 2VIDA 1GHBG 1YLCA 1UTPA 3AAUA 5LH8A 1C1UH 3HATH 4Q2KA 1BA8B 3MNSA 3SV9A 3U1JB 1TOCB 1G2MA 2BYAX 1TA6A 1PQ7A 1TGCA 3MNCA 3BTKE 2VB0A 4AGKA 1SQTA 1NT1A 1F5KU 1GJ4H 1PPGE 2BMGB 2G00A 3RLWH 1T31A 2GCHF 1ELBA 1RS0A 2ZU1A 4MDSA 1QL9A 2VIVA 2EI7A 2OC0A 2OBQA 3QGNB 2VINA 2BDAA 3MH7A 2ZU3A 2ILNA 4DT7B 1CBWB 3QGJA 1C1VH 4LK4A 1DXWA 1NESE 1IQEA 3M5NA 2HNTE 2ZCHP 2ANYA 2SGEE 3VGCC 1Q3XA 2BVRH 3D23A 3SORA 1SHYA 3BTFE 2Z94A 5A09A 5FXLA 4NWKA 4DGJA 6CHAB 1SPJA 2Y5FA 3ODDA 2FO9A 4WF8A 4TPYA 2TPIZ 1GJ6A 1QGFA 1QTFA 2OC1A 3MNBA 1TFXA 2D26C 4Q80A 3SZNA 1DVAH 1GGDC 1HAVB 2LNCA 1O3CA 2J4IA 2ZKSA 1G3DA 1MAYA 4WWYA 2AMPA 3QN7A 3RP2A 1A0LA 3RXRA 2BTCE 2DUCA 3PWBA 6LPRA 3ELAH 5C3NA 1BTYA 2GT8A 1GMHG 2D2DA 2A5KA 2Z9JA 1O2JA 2ZCLP 4Y6DA 3AW0A 1WV7H 2V35A 1KTSB 4X8TH 3TNSA 5DG6A 2Z9IA 1TE0A 1HCGA 1KTTB 4YOIA 2VWLA 1PYTC 3TU7H 1SSXA 4B2AA 2XW9A 1GHXH 2ZGXH 3GCHC 3GY6A 1AO5A 2HNTC 3GISB 1OP8A 2PV9B 1W7XH 1UHBA 3BTME 4DG4A 4NSYA 1CGJE 1SGRE 2AERH 3CP7A 2BHGA 4BAMB 1FUJA 1LPZB 4XBCA 1ZHPA 3IG6B 4FVBA 3QX5H 2ZECA 1Y5UT 3Q3XA 3A83A 2VIPA 1O2TA 1TGNA 4IMZA 1FY5A 5DP3A 2H9TH 1P11E 2OBOA 1TMBH 2F83A 1DITH 2ZDLA 4TY7A 2GKVE 4DJZB 1J9CH 1ZTJA 1OWHA 3P8NA 4YT6H 3SV2H 4GCHF 5C20A 1O2KA 3BEIB 2BDIA 3TJUA 4DW2U 4I32A 2BX3A 1B7XB 4Y79A 1W0ZU 3GDUA 1CT2E 2OUAA 5E8EH 4JK5A 1W11U 1BIOA 2BQ6B 2J2UA 2VWNA 1NFYA 3ZZ4A 3K65B 4CHAB 2GDEH 3PMAB 1GJBB 4JZIA 1O2WA 3KQEA 1GI8B 3ATIA 3SW2B 1D4PB 2EA3A 1P06A 1KXAA 2XBYA 1LQEA 1B0EA 1Z8RA 5GCHG 1BQYA 2UWOA 4LZ4B 2BZ6H 3M5OA 3BTTE 1AKSB 1MTUA 6ESTA 1WCZA 4KKDA 3S69A 1VCQA 3LH1A 1FY8E 4QT8C 2HRVA 1E34B 4IN1A 2FOBA 1P12E 3NXPA 4H6SB 1SGFG 1YPKH 1LVOA 1QRXA 1OWDA 4RKOB 2F9PA 2UUFB 5B6OA 3LH3A 1GI5A 1TABE 3UNQA 4VGCC 3SU1A 2PHBA 1PYTD 3ENSB 3ZVDA 1ARBA 1TPSA 2ZQ1A 4NZLA 3RC5A 3ZVAA 1KLJH 4B76A 3UR6A 1ZMJA 1ZOMA 2ANKH 1BTWA 4JZDH 3RXDA 1LHDH 3CS7A 4Z0KA 1IQJA 5F8XA 3VEQB 2D8WA 4D76A 1ZSKA 1BDAA 1GVKB 5EQSA 2A7JA 1SGTA 4KTSA 1GPZA 1HIAB 3PMJA 2KAIA 3RU4D 1BBRK 1C9PA 3BG4C 3QZQA 2QXJA 1UHBB 5AF9H 1MKWH 1UCYK 1W14U 4GUXA 1O5DH 2ZGBH 2BD3A 2HPPH 1BZXE 4FUHA 3QK1A 5DP6A 3STIA 4BAOB 4FUIA 1WQSA 2P3FH 2Y7ZA 1GG6C 2ZDAH 1NRSH 1DICA 3I78A 2NU1E 1XXDA 2XCNA 3STJA 5J4SA 1HDTH 5K0HA 1GMCF 2O8MA 1YCPH 2TGPZ 3PTBA 3SUFA 9LPRA 1UJ1A 1HXFH 4A1XA 1IQIA 2J38A 1FY1A 3HGPA 4X8UH 1Z8GA 4MPXA 3JZ2B 2P59A 4KP0A 1JBUH 2P8OB 1JIRA 1CHOG 1C5NH 1P05A 1A7SA 1TRYA 2EEKA 3A8DA 5T6FA 2AGEX 2XC5A 3EA9A 3P17H 4K1SA 5C1YA 3TGIE 2FI4E 8GCHG 2FOMB 3TLOA 4R8TB 1BRUP 2HGTH 4INHA 4OS7A 3A88A 2C93B 2ZPSA 2RA3A 2YNAA 2BXTH 1FY4A 3MNXA 1TALA 1QQ4A 2ALVA 2ZQ2A 1TLDA 1H1BA 2AH4X 3EA7A 3WY8A 3MH5A 5F8TA 1ELFA 3ZVGA 1ZGVA 2IPHA 1WTHD 1XUGA 4XE4A 1S0RA 1DFPA 1EZSC 1K22H 3KQDA 3M7TA 1JMOH 3LGIA 3ZVCA 4ZHLU 1SI5H 3B8JA 1SR5C 2GX4A 1P02A 2STBE 4OS5A 3U69H 2FTMA 4I33A 1NRNH 1U6QA 1Z7KA 2ZZUH 2ZDNA 1MAXA 1OYTH 2R9PA 5T6DA 1P3EA 3VB3A 3Q76A 2BLWA 1QBVH 2FS8A 3MWIU 4ZKOU 1YKTA 2G81E 1O2MA 1BJUA 1D6RA 4Y71A 1NRPH 1NFWA 2ZWLH 1EB2A 3SJIA 1HAHH 2PGBB 5LPFA 2HLCA 1UTOA 1ABIH 4GLYA 1EOJA 2UWPA 2A7HA 2H9HA 2ZFSA 1NC6A 1TQ0B 3E90B 5TJXA 1A2CH 1N6XA 3LJJA 5GJ4B 1VITG 1UVOA 1SB1H 1GJ8B 1V2NT 1C4Y2 1N8OC 4KTUA 5A0CA 4OGXA 3SUGA 2FX6A 5I46H 2FLRH 5CHAB 1ZMNA 4UEHH 1SLXB 2O8TA 4PROA 1D3TB 4GHQA 3F68H 3RXMA 1CT0E 3LGTA 2FYQA 4BNRA 2FDAA 1P01A 3V7TA 2W7UA 1IQKA 2FX4A 2VVCA 1HJ9A 1C5WB 1O5BB 1P03A 2FPZA 1QQUA 1GBFA 3OU0A 5A8ZA 1V2OT 4OGYA 3B23B 4U32A 2JH5D 5EXLA 1BRCE 1DX5M 1ZPZA 2J95A 1HBTH 1BTPA 1TNGA 1EAIA 2FOEA 3SU6A 2WYJA 1GBMA 2KAIB 5L2YH 4JCNA 4D9QA 5FX6A 1S85A 5G4BA 1HRTH 3D62A 3A7WA 1ZYOA 2M5TA 4DURA 1O2HA 1SGQE 2NU0E 1A3BH 1O5GH 1K1PA 4Y76A 5HXFA 3SU3A 1BRBE 1K9OE 4X1PU 5HMAA 3A8AA 1MH0A 1K2I1 3GY2A 4UD9H 1XX9A 4INLA 3S9CA 2BDGA 1DT2A 1V2RT 1CA0B 7KMEH 4IC6A 4X0WU 2I6SA 1G30B 1NN6A 2IJOB 1CQQA 3OY6U 3GYLB 5EW1H 1O5FH 4SGBE 4ZMAH 1DWCH 1BMAA 5E0JA 1EP6A 5L6NH 1FPCH 1GWAA 5FPYA 1EJNA 4CRAA 3IITA 2OD3B 1AI8H 2SGDE 3MO9A 2BDCA 1YPLH 4X1SU 1C2HA 1G3CA 2QC2A 3L6PA 1C1OA 1E37B 3BN9A 2PSXA 1RTFB 4RN6A 1YP9A 2ZHEH 2H5DA 5EPYA 3UNSA 2P94A 1FXYA 1GMDG 1Q31A 1VCPA 1DXPA 3T5FH 4CRCA 2C8WB 2NU4E 1HAVA 1CSOE 1XUJA 3VXFH 1K1MA 1K28D 1LMWB 3SNDA 1AZ8A 3SJ8A 4XFQA 4B1TA 1FV9A 4AOQA 1CBWC 1VZQH 3OY5U 3ESTA 3SJKA 4MPWA 4K1EA 1PPZA 2ULLA 2ZEBA 1ZJKA 3VFEA 4ZHMU 2H5CA 4CRDA 3D65E 4NIWA 4BANB 1BJVA 1O30A 6CHAC 3KF2A 4YESB 2Z9GA 1YPJH 1IQGA 4X6OA 3V0XA 2I6QA 3KCGH 4WMDA 4E05H 1K1IA 2JH0D 3SGAE 1CHGA 3GCTG 2QAAA 3SNCA 3M35A 3M3TA 3A8BA 5EQQA 3MU8A 1MD8A 1C5SA 1AB9B 4D7FA 1AUJA 2R2WU 1M9UA 2BY6X 1XMNB 2GMTB 1IHSH 1AVXA 1O2PA 2OC8A 4JZFH 1UVUH 1Z6JH 2ZPQA 1EAWA 2ZHFH 3MH4A 3ZZ8A 1J8AA 1ACBE 3GY3A 1OXGA 3KIDU 1VITH 4INKA 1G3BA 1MBQA 1OWJA 4FU7A 1EATA 1THPB 1Y3YA 2UUJB 2G55A 3SU5A 1QRZA 3UWJH 3QZRA 3RC6A 4AYVB 3A82A 3SJ9A 1T32A 2PKAB 3G01A 1N6YA 1FAXA 1C1TA 4DIHH 5GXPA 3DFLA 3Q3YA 1OWKA 1UTKA 2ZA5A 3BTQE 1O31A 4BTUB 3RMMH 4I8LA 1AE5A 1HLTH 5T3HA 1W13U 2XRCA 1BUIA 3TJVA 3Q77A 1C4U2 2OINA 2OLGA 3FFGA 1ID5H 1ZR0A 3S7KB 2VIWA 1Y59T 1W7GH 1Y8TA 1KXFA 1SFIA 2ZGCA 2R0LA 1TYNA 1PQAA 2Z9KA 1GI0A 3QTVH 1FJSA 1ESTA 1GJ7B 4ZHAA 1TIOA 1V6DA 2C8YB 1FDPA 2CF9H 3L33A 1ANDA 3PROA 2ZCKP 3AASA 4IC5A 3E1XB 1KLIH 1H9LB 1SC8U 2BDYA 5AVDA 2XBWA 8LPRA 1T8MA 3A80A 4RSPA 1SLVB 1GVZA 1VITF 1HAXB 2ASUB 1BTXA 1ELGA 1ESBA 1GCTB 1OX1A 3GY8A 1EQ9A 1QJ6B 2F9UA 1MZDA 4SGAE 4E06H 1AKSA 2FOGA 1PPCE 1RRKA 4Y7BA 1XKAC 1HJ8A 3RMNH 4AGJA 4WH8A 2GV6A 5LGOA 3OX7U 1TX7A 1L4ZA 1Z71A 1MKXH 2UWLA 5C1XA 1UVTH 4NCYA 1IQLA 2Y81A 2FYRA 7GCHG 3MU0A 1TPPA 2PR3A 4CHAC 5DP4A 1O2NA 4MNVA 1TNHA 1H4WA 1HGTH 1BHXF 4KGAA 2Y7XA 3O8RA 4WJG2 3GY5A 2A2QH 1K1JA 1K1OA 1OWEA 1W0YH 3FVFB 2ANWA 1LCYA 3HKJB 5EPNA 2OQUA 1A5HA 3QDZB 1ZHMA 1W8BH 1GHAF 4B2CA 1JWTA 3A86A 1T4UH 3D49H 3NK8A 1MZAA 3NKKA 1LKBA 1WU1A 2AMQA 2Z7FE 4OS2A 1HIAA 4JZEH 1EZQA 3SJOA 3ODFA 4XBBA 1Y3UA 3DUXH 5C5NA 9ESTA 3FAOA 2VWOA 4I7YH 5FPSA 1Y5BT 1DUEA 1DLKB 2JKHA 1W12U 4UDWH 4YM9A 2W26A 4YO9A 5FPTA 2QIQA 1MCTA 3K6YA 1RIWB 3I77A 1NRRH 3ZZ5A 2G5NA 5JB8S 2GCTB 1HNEE 5L30H 1UTJA 5DJ7A 1C1PA 3QWCH 2A4GA 1IAUA 7LPRA 1O3JA 4ABGA 4CH8B 2WINI 3ZV9A 3S9AA 1AUTC 1Q2WA 2XYAA 5DPAA 2VGCB 3PLKA 1BCUH 5DKMA 1G2LA 1BTZA 1LO6A 4K60A 3LKWA 3NUMA 3T26A 3E3TA 2R3YA 6GCHG 2ZFQH 3BF6H 4O9VA 1YPEH 1MUEB 2CN0H 3GOVB 1C5LH 2ZTYA 2WV5A 3KNXA 4UONA 1GDQA 1AIXH 1V2KT 5DGJA 3FP8E 1V2LT 1VGCC 2BDHA 2F9OA 1J15A 3RXKA 4ZROA 2XNIA 3UTUH 2BY7X 1NTPA 4FU8A 2G8TA 2BD8A 3PV4A 1NROH 4CRBA 4B71A 4ISOA 1TNJA 4IW4E 3F9FA 1GI2A 1SGFA 2FS9A 2ZTXA 4HGCA 4X1NU 3GYMA 1EUFA 2P8OC 1OKXA 2H9EH 4IGDA 1KSNA 2PUXB 4O3TA 3ZZCA 1DANH 1ZRBA 3QO6A 3HGNA 1WQVH 1S84A 1TNLA 4A1VA 2LPRA 1N1LA 1O2LA 1MTNB 2BY9X 2WPMS 2GZ7A 5FBEA 1LKAA 4BTIB 3VPKA 4GAWA 3TITA 2BLQA 2G4TA 1V2JT 3PO1B 2FP7B 2HOBA 1L0ZA 2QGRA 1AVWA 4ISLA 4NFEA 3E91A 4AFQA 2AS9A 4Y8YA 1O2QA 1O3KA 2WV4A 1O2IA 2F9VA 4OS6A 3RXTA 4X6PA 4DY7B 1MMJN 3F9GA 3M61U 1ELVA 2TGDA 4HTCH 4Y0YE 3UFAA 3UREA 2GZ9A 3RXFA 5FX5A 1C5PA 1AY6H 2A5AA 1HJAB 2A32A 1IOEA 4JYTA 2P3UB 4IMQA 1Y3WA 4GSOA 1LVBA 4WY3A 1TONA 2GGVB 2QCYA 3SGQE 3HK6B 4WVPE 1KXBA 3RXQA 2ZO3H 1TMTH 4M7GA 1THSH 3EE0B 1YPMH 4Y0ZE 1XKBC 3P8OA 1CT4E 3K6ZA 1SGDE 2H1UA 1QJ7B 3UUZA 1TX6A 5ESTE 5TCAA 4UE7H 2ZPRA 4U2WA 4UFEH 5TCCA 2D1JA 1F2SE 4GHTA 3E0NB 1GHBF 1QB6A 1NRQH 2ZDKA 2P93A 4FUEA 4IBLH 3T62A 2UUYA 5CHAC 1V2PT 3TH3H 3M36A 2UUKB 3OSYA 2O8WA 1QL8A 2OCVB 1GBIA 3RDZA 1P09A 4I8JA 3M5LA 5AFZH 3T2NA 1MD7A 1QB1A 1TPAE 5A2MH 4JK6A 2BQWB 4NIXA 1HAYB 1CE5A 3SBKA 2JETB 2Z3EA 4A5TS 5