2O8TA

Crystal structure and binding epitopes of urokinase-type plasminogen activator (c122a/n145q) in complex with inhibitors
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
245
structure length
231
Chain Sequence
IIGGEFTTIENQPWFAAIYRVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSAAHHNDIALLKIRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase plasminogen activator
publication title Crystal Structure and Binding Epitopes of Urokinase-type Plasminogen Activator (C122A/N145Q/S195A) in complex with Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 231
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2006-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2o8tA01
3DFLA 4Y8XA 3KN2A 1ANEA 1X7AC 1IOEA 1XUHA 3F9HA 4LXBH 5DO4H 3RXBA 1C1OA 2VU8E 2PKSC 3RMMH 1GG6C 1WAYB 1DITH 1GHWH 3ZZ8A 3LONA 1K1OA 1ESAA 1C4V2 1WCZA 3IG6B 1XMNB 1O3DA 1V3XA 2D1JA 2XCNA 1GHXH 4B74A 5BPEA 1J9CH 3S69A 4BANB 4OS1A 3A89A 4WH6A 1AVXA 3FANA 1YPLH 3GY4A 5EQQA 1XUJA 3QZQA 4X2YA 1FZZA 4XE4A 2G00A 3LU9B 2HNTE 1IQMA 1AFQC 1LCYA 4BTUB 1P2QA 4ISIH 4VGCC 4UFFH 5EPYA 1GI3A 4WXVA 5EG4A 1DANH 3RXLA 3BG8A 1ELBA 5GDSH 1YPHC 3MH6A 4ZH8A 1FLEE 2VIOA 1VITG 3U8RH 4O9VA 1YPGH 1HAHH 3TLOA 2GTBA 1CE5A 3SHAH 1AD8H 3PLBA 1TFXA 1ZPZA 4HGCA 2GMTC 1B7XB 3BEFB 4MTBA 1EZSC 1TABE 1BRCE 3KQCA 3RU4E 4CHAB 1H1BA 1L1GA 4E05H 2A4OA 3PM3A 2A32A 1S0QA 5DP3A 1BTPA 3E3TA 5A8ZA 1P9SA 2FI3E 1RD3B 2ALPA 4B76A 2NU4E 1OP8A 3TVJB 1N8OB 2Z9KA 4H6SB 1RTLA 4ABIA 1SLXB 2Z9LA 2ZU2A 4X8SH 3RXSA 3B23B 3MNXA 4E06H 1YCPM 2AGIX 1FJSA 3HKIB 4Y71A 1SFIA 4OS5A 1BRUP 3OYPA 7GCHG 1AGJA 1Y5UT 4GHTA 1SQOA 5E0JA 1QFKH 2QC2A 4AG2A 1QB6A 5C20A 1SGPE 1GI5A 1SBWA 1LPZB 1G2LA 1SSXA 2PSYA 2BXUH 2HPQH 2SGDE 1F2SE 3Q00A 1C1MA 1XXFA 5ESBA 3GCTG 1FN6A 5DP9A 3KHVA 4IGDA 4CRGA 3RC5A 1YPHE 1NTPA 1OYQA 3W95A 2ZFTA 2QYIA 2LNCA 2BX3A 1C1RA 1O37A 3SU6A 3PLPA 1Z8RA 2JETC 5JB9S 1EB2A 2ANWA 1GVZA 1O3JA 3SJOA 4DURA 1OWDA 4NZLA 2VIPA 1UTNA 4X1NU 1ELGA 2VH0A 3ZZ5A 1HAOH 3U69H 1ZR0A 3RC6A 1LMWB 1P2NA 3VXEH 2TGTA 4MG3A 4Y6DA 1O36A 3MU8A 1ARCA 1QB9A 1E38B 4TY6A 1OSSA 1DWBH 5IYTA 2BHGA 2OLGA 2RDLA 4JZ1A 1G30B 1GI1A 1AMHA 4Z0KA 3RMNH 4XSKU 5A0BA 1LO6A 2GDEH 4X6OA 2AIPA 2P3FH 4JCNA 1V2RT 5LH8A 1H4WA 3SOSA 3LT3A 1TQ0B 2Y6TA 2OP9A 4H42U 1PPHE 4X2VA 1EOJA 4IS5A 1YKTA 2WUCA 2SGAA 4ZXXH 1IQNA 2P16A 3T29A 1GVLA 3URCA 1BUIA 2ZDLA 1ACBE 3RDZA 2PGBB 1O3IA 4CRBA 2THFB 1O2OA 3BN9A 2BD3A 4U30A 3P6ZB 2VWLA 5C5OA 3D62A 2ZFSA 2BD2A 4O03A 3RXDA 2ZWLH 1T4VH 1CBWC 2SGFE 1PFXC 1GHZA 2UUYA 2OQ5A 2C8ZB 1EAXA 6LPRA 4WVPE 1EPTB 1PPCE 3QO6A 1D6WA 1C9TA 3F68H 3A82A 1CA0C 1DWCH 1ELTA 1NS3A 2UWOA 2B5TB 3MU1A 1OWIA 1GJAB 3TJUA 3MNCA 2VINA 4HTCH 1H9HE 1SG8B 3SNBA 2Y81A 1QBVH 1DX5M 1OXGA 2ZFFH 1GBJA 4QT8C 1MAYA 4M7GA 1Z71A 5F8XA 1TPAE 1F0TA 3D23A 4BAQB 3Q3YA 1EKBB 3ELAH 1OKXA 1ELEE 2FX4A 1O2VA 1NRRH 2VNTA 2OQUA 3MO3A 1GMHF 2BYAX 2HLCA 3K6YA 2EI6A 1FY1A 1K22H 3E16B 1H9LB 2A1DB 1GBLA 2DE9A 4X6MA 2AMPA 1THRH 2ZC9H 2PW8H 1OP0A 1L4ZA 4WY3A 3T62A 1O2YA 1IHSH 5DP4A 4Y7AA 1VGCB 3SGAE 1GBIA 1DY8A 1KY9A 3MHWU 4SGBE 2GT7A 2J9NA 1PPFE 2BDCA 1AIXH 2NU3E 3FZZA 2TGAA 4MPVA 1QQUA 3ATWA 3DFJA 3GY7A 3GCHC 3SJ8A 3NCLA 3FVFB 2ZPQA 5GCHG 1A0HB 2PKAB 1MTWA 4U01A 1QIXB 4A92A 5E2OA 2FYRA 1OYTH 4NFEA 5LPEA 2AH4X 1ZGIA 3I77A 1W0YH 3ODDA 1DOJA 5F8ZA 5EXLA 4KTSA 4Y76A 1LVBA 1WU1A 3QTVH 1HIAA 4MDSA 4Q7ZA 2XTTB 1Y3UA 1WOFA 1KTTB 3C1KA 4GHQA 3MOCA 1HJ9A 1XVMA 1O2RA 3LH3A 2FO9A 3ITIA 5FXLA 2H5DA 1MD7A 1QRWA 4NSYA 2BD7A 1YM0A 4ABEA 1ZGVA 3E1XB 2WYGA 1C5LH 1ELCA 1NRPH 2ZIQH 2GD4B 3O8DA 1V2TT 1G3BA 1D6RA 1GI6A 3M5NA 1HJAB 3CP7A 4I31A 3CENA 1T8OA 1TBQH 3TITA 1HJ8A 1GL0E 3TIUA 1CT2E 4CBNA 1XUIA 2ANYA 3T26A 1KDQB 5L6NH 3S9CA 2P8OB 3AAVA 5GWZA 3EQ0H 4UONA 1ZJKA 1W12U 2AYWA 5A8XA 5FCKA 2TBSA 1UCYK 1QJ1B 2ZG0H 5A09A 1HXFH 3EE0B 4NA8A 4YO9A 4FU9A 4ZHLU 1P2KA 3QGJA 4DIHH 3BSQA 1TAWA 1EP6A 4GVUA 4ZXYH 1TMBH 3UOUA 4MLFB 1TOMH 2BZ6H 4GSOA 1O3AA 1V2OT 4I8JA 1EXFA 2BDAA 1SGIB 3TNTA 3PMBB 1RFNA 2O8TA 1C5QA 4JZEH 1DUAA 3ZVGA 2A7CA 2FESH 1FMGA 1QA7A 1BMAA 1BCUH 2ZDVH 2ZPSA 1BJUA 4I8KA 1LVMA 1BMMH 3T5FH 2H9EH 8KME2 1W13U 2Z9JA 3ZVCA 2ESTE 2C8XB 4BTIB 5DG6A 1QURH 2XXLA 4BXSA 2BY5X 2A5IA 5A8YA 5EQRA 1CGIE 5T6FA 2ZFQH 5FPYA 1TALA 1P04A 4TPYA 3RXVA 4ZKRU 2UUKB 1ETSH 2ZCKP 5EPNA 1ZTKA 2V3OH 4Y8YA 1PQAA 3Q77A 2GP9B 1YC0A 1ZRBA 2SGEE 1B5GH 4SGAE 1DWEH 1GI7B 4AX9H 1BOQA 1GJ6A 1V2QT 1W7GH 2VGCB 1A61H 1MU8B 1K1NA 1AB9B 2RA3A 4U32A 1C9PA 2G55A 2CMYA 3M7UA 4UE7H 1P2IA 4HFPB 4DT7B 4OS7A 4RKOB 2ZHDA 1O38A 5H4IB 2BD8A 5C1UA 2ZO3H 2VB0A 2FI4E 4MQAA 4Y0ZE 1TGBA 2P3TB 2ZGJA 1IQHA 4OS4A 1AY6H 5GXPA 3VB7A 4I33A 2CXVA 1P2JA 3RXFA 1P9UA 2ULLA 3ZZ4A 3UPEA 1GDNA 1SPJA 4WMDA 1VCQA 3MU5A 4I8LA 1NESE 3ZYDA 4MPUA 1LHDH 1N6XA 1V2MT 3PTBA 3SI4H 5L30H 1GI4A 1BBRE 1ZMNA 4NA7A 4KKDA 1LQDB 3ZVFA 1ELFA 2WV4A 3UWIA 5JDUB 3SJ9A 2F9VA 3F9GA 1CVWH 2R2MB 1DVAH 1ETRH 1MKXK 1N1LA 4X8TH 3E8LA 3MU4A 3ZVAA 2PFEA 1QTFA 2PHBA 1V2PT 1MZAA 1J15A 2W5EA 3BTME 5A2MH 1A5HA 3P8GA 4Y11E 1ELVA 5LPRA 5FAHA 1BZXE 4DY7B 1S6FA 2BVRH 1O39A 2CGAA 5ABWA 1CHOF 1NRNH 1Q3XA 1TNHA 1Z7KA 3HK6B 4HZHA 4AYVB 3CS0A 1TMUH 2XC4A 1UVOA 2OXSA 2CHAB 1ESBA 1GMCF 3VB4A 1U6QA 1W0ZU 1EQ9A 1O33A 1AI8H 1S0RA 2RG3A 4OS6A 3P17H 1P3CA 3SUGA 2C4FH 2BQ7B 1GGDC 2AERH 3PTNA 3SJKA 1P10A 2JH6D 3GY2A 1TB6H 1TGTA 5EOKA 2OC8A 3K9XB 1WQSA 1C1VH 2FPZA 1E35B 2ZDKA 2V0BA 5FHTA 1G3EA 1PPEE 4B2AA 2UWPA 2BDIA 1W10U 2ZHWH 4CH8B 1BJVA 1ZHPA 1KXFA 1O5GH 4WMEA 2BY7X 5E0GA 3EA7A 2FX6A 1HAIH 4RKJB 2FI5E 3QZRA 1SGCA 1Y3WA 1RIWB 4YOIA 1ID5H 4D9RA 1P2MA 4IN2A 1SGFG 1GBEA 4Y79A 1TQ7B 4FUBA 1QBOA 3VGCC 2G8TA 3MU0A 1ANDA 1K1JA 1P01A 1S85A 5TJXA 1NU9A 2XC0A 2J95A 2UWLA 3RXMA 1GHYH 2FOFA 1SFQB 4D76A 1YBWA 1XX9A 3M3VA 1GBAA 4OGXA 1XXDA 1L0ZA 5DPAA 2FXRA 3MH5A 3PMHB 2ZP0H 3DA9B 1MTUA 1ESTA 1IQEA 1GHBG 3E91A 3GOVB 4KTUA 1HAPH 2ALVA 1Y5BT 1AQ7A 1IQFA 1MZDA 2FOGA 2ZCHP 2TGDA 4DOQA 1KXAA 1V2ST 3T2NA 1C4Y2 5LGOA 4D8NA 1CU1A 3SV2H 3SN8A 3UREA 1C2KA 1F0UA 5DP7A 1KLTA 1UTPA 3ZYEA 3NKKA 3F9EA 3UR6A 1IQJA 1F5KU 1AN1E 4JZDH 2QY0B 2ZGHA 3BEIB 1Z6JH 3PLKA 3VFEA 1WUNH 4XDEA 5T3HA 3SNDA 3ZZBA 1RTFB 3SU2A 2XYAA 4MPWA 1GBFA 3P8FA 1EPTA 1O5FH 1SHHB 1Z8JB 3SU3A 3SZNA 4KGAA 1LDTT 2Z3CA 1BMLA 1JXPA 2ZDNA 4ABJA 1IQIA 1O3OA 6GCHF 5BRRE 1WV7H 3F1SB 3HGPA 3URDA 1SGQE 1KXEA 4B1TA 1Y8TA 2BD5A 1D4PB 4DG4A 4Y8ZA 5EW1H 2FEQH 2ZHQH 5TCAA 1DT2A 3BTGE 4B2BA 3GCNA 2FOMB 1UTQA 1SGDE 1CGHA 3EA9A 1ZOMA 1C5OH 1XKBC 2B0FA 2XW9A 3KQEA 1EAWA 3L33A 1F5RA 1O5DH 2ZEBA 2A4QA 3UWJH 2J38A 1JOUB 2HRVA 3MFJA 4BAHB 1T4UH 3B9FH 1K28D 1FV9A 3QGNB 3MWIU 2QXGA 3LH1A 1TRYA 2P94A 1GMCG 4NZQA 2EI8A 1MBMA 1GI8B 4CRFA 1QRZA 1O3LA 4NFFA 1ZTLA 4KP0A 1G9IE 4ZUHA 1A3EH 1O3HA 4AFUA 1UK3A 2A5KA 4YOGA 3RXAA 3MMGA 2G4UA 3LGIA 5ESTE 1C2GA 1DDJA 4AB9A 4K60A 3RU4D 1L1NA 1O35A 2ZHEH 1F7ZA 2GCTB 3M35A 4FUGA 4AZ2B 2AFQB 3RXTA 8LPRA 1HLTH 1GJ5H 2BD4A 3SQHE 4AFZA 1UTLM 1TNJA 3SV8A 2A7JA 4WJG2 1QGFA 2ZGXH 2BQ6B 3FZDA 2OCVB 4IBLH 3MNBA 4GLYA 3E6PH 3KQDA 2PKAA 1W8BH 2B8OH 2JH0D 1FPCH 2F91A 4ABAA 2F9PA 1GBTA 3QUMP 3PO1C 1TPOA 3JZ2B 5CHAC 2EA3A 1OWEA 5C3NA 1MQ6A 1UCYE 3SUFA 1P2OA 2D8WA 1V2UT 3P70B 5F03A 3RXOA 1SL3A 1ORFA 1ZPCA 1CSOE 2WPLS 5DJ7A 5AFYH 4LK4A 1A0JA 2Y7ZA 2H9TH 1TX6A 1J14A 1RXPA 3FP7E 3V0XA 4K3JA 2ZA5A 3BIUH 3TH3H 1K9OE 3A85A 2ZECA 2XRCA 3TGIE 3E0NB 1PPGE 1O2PA 2G5NA 2Y80A 3FAOA 3O8CA 4INHA 3KL6A 2STBE 1KDQA 1S82A 2NWNA 4TPIZ 3MH4A 4K1TA 5J4QA 2BDBA 3A87A 3L6PA 3O8RA 2FWWA 3A8DA 2NU2E 1C5VA 2Z7FE 2BOHB 5EGMA 3RXQA 2FIRH 1DUEA 2BDGA 1SOZA 1QL7A 3TNSA 1GI2A 4X1RU 4Q80A 1GHVH 3ZVBA 4GCHF 1TPSA 4MNYA 4JK6A 3C27B 1HNEE 2H9HA 3PWBA 1P8VC 2IJOB 1L4DA 4MNVA 1GCTB 3UNRA 1ARBA 4BTTB 2GDDA 1CO7E 5E2PA 4ZAEA 2FOCA 3GISB 1EAUA 4DGJA 3ENSB 3ZZAA 1LKAA 1EJNA 5HGGA 1V6DA 1VJAU 2GT8A 1SVPA 2BVSH 1BRBE 2BY8X 1C5SA 1GPZA 1MTNC 3PMJA 4I7YH 4UD9H 2R0KA 5K7RA 2CJIA 1H8IH 2ZU1A 3GDVA 3B8JA 1DXWA 1YPKH 3RLWH 4X8UH 4A1VA 1VR1H 1C1TA 1C2FA 3RM2H 1J16A 2HVXA 3S7HB 3BTEE 2O8UA 3U1IB 1OOKB 5AF9H 1UCYH 4JMYA 1Y5AT 1HUTH 1NROH 3MNSA 3BG4C 2M5TA 3A7VA 1UO6A 5DP6A 5PTPA 1FN8A 2Y5GA 4ABBA 2QGRA 1ZPBA 4FUCA 3VB6A 1TONA 2XBVA 2YOLA 1O3GA 1Z8GA 4K5ZA 1CHGA 1O3FA 1BB0B 3T28A 2TGPZ 3K2UA 2GV6A 2JH5D 2BDYA 1MH0A 1SGNE 1HAVB 1WTGH 3M36A 4IW4E 1PPBH 3MYWA 1THSH 1C5YB 2RCEA 1SQTA 4OGYA 1O3BA 3EDXB 5FPTA 5JYIA 3KQBA 4LOYH 4J2YB 1TYNA 1GI0A 3STJA 1EATA 2D26C 2PKSB 1A5IA 2Q6FA 4THNH 1ZHMA 4FVBA 1GG6B 6CHAC 1O3MA 2O8LA 3MI4A 2P93A 2Y5HA 3RXRA 2OUAA 4JYVH 3SNAA 3A80A 1DLKB 3TJVA 3A7WA 1AUJA 1HGTH 4A6LA 3SU4A 5GPIB 2Z9IA 1HDTH 2IOTA 2ZFRH 3A88A 5JPMH 3A83A 3AW1A 4KELA 4X6PA 3HPTB 1C5MD 1UMAH 4FXGH 4AN7A 1JWTA 1MUEB 4Q7YA 4X8VH 2G81E 3ATKA 4ABDA 2PTCE 1T8LA 5B6OA 1AFQB 3O8BA 4MNWA 4CRDA 4VGCB 1P57B 3QX5H 1GHAF 3M7TA 1QRXA 3G01A 4FVDA 3K6ZA 3SO3A 5L2ZH 4RN6A 2WUBA 5CMXH 3TH2H 2BM2A 1W3CA 4NWLA 2AEIH 1GI9B 2XBXA 4MNXA 2AMDA 3SUDA 2NU1E 1ANCA 5HM2A 2GMTB 1NM6A 2GKVE 2R3UA 3VB3A 3GCOA 1O31A 4CRAA 2QIQA 3QK1A 1HPGA 1XM1A 2QXHA 2Z94A 2VIDA 4XOJA 4ZKOU 2OD3B 1ABIH 1RS0A 1MBQA 4NWKA 2VWMA 3SU5A 1ELDE 3L3TA 3SI3H 2HALA 1FQ3A 1MCVA 1MTVA 4CR9A 3SORA 3KIDU 3RP2A 1HB0B 1A46H 1GDUA 1W2KH 4BAMB 2VWOA 3LPRA 3Q3KA 4BXWA 1D3TB 3GYMA 1UHBB 2FTLE 4ABFA 1A4WH 1W14U 2P3UB 2PUXB 8GCHF 1OWHA 1V2LT 2VWNA 3NUMA 1TGNA 4YT7H 1DE7H 4Y10E 1MKXH 2SNVA 1C1NA 1T8MA 4XBCA 4WWYA 3P8OA 1FY4A 2TRMA 1YPEH 2ZTZA 3A7ZA 1WQVH 1F5LA 4D7GA 4BOHA 4FUEA 3RU4T 2CN0H 2G52A 1C5XB 3HGNA 3SW2B 2ZTXA 2ZNKH 1EASA 2ODPA 4JK5A 1TA2A 3UIRA 1BDAA 2QCYA 4Y0YE 3LGYA 1KXCA 1AO5A 1QL9A 5ETXA 3EA8A 2JETB 3TK5A 3F6UH 1GJCB 2J94A 2WPIS 3UNSA 4X0WU 1O2MA 3BTQE 1TNGA 5GJ4B 1O2HA 4AOQA 5L2YH 4IN1A 2HNTF 2H1UA 2BLQA 7KMEH 1GMHG 2Q6DA 3TJNA 1SHYA 1AWFH 3LC5A 4FUFA 1PQ7A 2ZI2H 4CHAC 1ZMJA 3QDZB 4F49A 2FTMA 5FCRA 1AUTC 1QL8A 1JRSA 6ESTA 3BTHE 1TNLA 4ABGA 1C5ZB 3R3GB 4IC6A 2J2UA 1O0DH 1AKSB 3NK8A 1N8OC 3MO6A 2QXIA 1O34A 1MKWK 1DPOA 1IHTH 1GBKA 2PTNA 3VXFH 7ESTE 2PSXA 1O3EA 1TMTH 4FU7A 4ABHA 2C3SA 3PROA 3U8TH 1KIGH 2IPHA 3JZ1B 4INLA 5F8TA 3LJOA 2ZTYA 3S9AA 1YCPK 4K1EA 2F83A 3RXGA 3LGWA 2OINA 1NRSH 2ZGBH 3M5OA 1YPMH 1PPZA 1SI5H 2SNWA 4BNRA 1BTHH 2QN5T 1Z8IB 4NIYA 3SQEE 4A1XA 3R0FA 1TIOA 1IQGA 5TCCA 4JYTA 2A5AA 2Z9GA 4AG1A 1EB1H 1A0LA 3H5CB 1UVPA 4KTCA 1FAXA 5AHGH 2VJ1A 4INKA 4Y7BA 1BHXB 1NT1A 2ZU5A 1QR3E 1CBWB 2XNIA 1OP2A 4TWWA 4A1TA 3HATH 4YLQH 3HKJB 1J8AA 2HGTH 1GJ7B 4R8TB 1K1LA 1GDQA 1TPPA 2VVVA 2Q1JA 3TH4H 1JBUH 4UFEH 4AFQA 3S0NA 3UR9A 3UUZA 1CA0B 2OC7A 3DT0H 5JBTA 1O2ZA 1LTOA 1O3NA 3RUOA 3ATMA 1SGYE 2BTCE 1QBNA 1O3KA 1BT7A 3FP6E 3IITA 5EXMA 1C4U2 1F0SA 4D7FA 2XC5A 1HBTH 4MPXA 1S81A 1HAYB 5JBBS 1O2LA 2H6MA 5E0HA 1DY9A 3LOXA 2C8WB 1PYTC 4XFQA 1QJ7B 1Y3VA 2XBYA 4Q2KA 3RMLH 1VITF 3ZZCA 1C5TA 1TX8A 1O2QA 2A2XH 2GZ8A 2OBQA 5AFZH 3A8BA 2BLVA 3A81A 2AGGX 4NA9H 3UTUH 4B75A 1OPHB 1NFXA 2FOAA 2FZZA 1P06A 2FOHA 3E0PB 2OC1A 3SU1A 1INCA 1BQYA 4UDWH 3GY3A 4NIVA 1QCPA 1BA8B 1XVOA 4D9QA 2FS8A 5G4BA 2BD9A 2GGVB 4YESB 1YYY1 2ZDMA 4DIIH 1ANBA 1GBBA 1LHGH 3NXPA 1BIOA 5T6GA 1VCPA 1EUFA 1O2JA 3GCHB 2PV9B 3KGPA 1NPMA 3ATIA 1CQQA 2G4TA 3A7XA 1YLCA 1AE8H 3PYHA 1BTUA 3TK9A 4TWYA 1DLEA 2B9LA 3ZV9A 1NRQH 2WPMS 1EPTC 2GX4A 2WYJA 7GCHF 3T25A 1C5WB 1L1JA 3BF6H 4XBDA 1O2NA 4YT6H 2R0LA 3MO9A 2GV7A 5C5NA 1XUFA 3KF2A 1F0RA 1G3CA 2DE8A 3Q3XA 4CBOA 3A7TA 1MAXA 1DSUA 2NU0E 4GAWA 1FAKH 3GCTF 1B0FA 5EODA 2LPRA 1KLJH 2AIQA 4Q7XA 1BTYA 2HWLB 4A5TS 1GL1A 4ISLA 2BY9X 1O32A 4A7IB 3DUXH 5GIBA 3OTJE 1TE0A 2BX4A 1CGJE 1MD8A 3PB1E 1TX7A 4NGAH 1AWHB 1AFEH 1EJAA 3AVZA 1CA8B 4I8GA 1PQ8A 3P92A 3M7QA 1OWKA 2ODQA 2H5CA 3ESTA 1K1IA 5JB8S 1PYTD 1BMNH 2W3IA 1BTZA 5JBCS 1IQKA 1SMFE 2KAIB 5I25A 3M5MA 1P11E 3A84A 3VB5A 1JRTA 1KYNA 2ZU3A 3S7KB 2ZPRA 1VGCC 1O2KA 5DGJA 1GBHA 1P05A 5FX6A 1LPGB 1GJ4H 2A2QH 2FDAA 3ATLA 5DK1A 1XUGA 1A5GH 2F3CE 3SUEA 1BHXF 2O9QA 3F9FA 3RXUA 3KEEA 2VVUA 1P3EA 2UUFB 5FBIA 4AORA 3BTFE 1CHOG 2HOBA 2FM2A 4YLUA 1HAVA 1SLUB 1P03A 5A0CA 1UVSH 1SGFA 4K8BA 1QHRB 2WPJS 1C2MA 1FDPA 2BLWA 1O30A 2FYQA 1LVOA 1VCWA 1FONA 1GVKB 2I6SA 3GICB 3V12A 3A8AA 3BTDE 1QQ4A 3P95A 1TWXB 1HJAC 3STIA 4TYDA 2PWXA 1YF4A 3FP8E 2ZCLP 5F6MA 2Q6GA 4K69A 3OY5U 3NZIA 1OWJA 3UFAA 3OSYA 4B2CA 2P8OC 1HAGE 2Y82A 4BAKB 4E7RG 4K8YA 1PJPA 1ZLRA 3TPIZ 2G51A 4I32A 2VIVA 5I46H 3OX7U 2TPIZ 2D2DA 4GUXA 4X1SU 4MVNA 5EXNA 1Y3XA 3ODFA 8ESTE 1A1RA 3UY9A 2CF8H 5FBEA 1LHFH 1C2HA 1BTWA 1OS8A 4WMFA 2FP7B 5FX5A 1C1QA 1IQLA 3D49H 3LJJA 2ZKSA 1V2WT 2BVXH 1NFYA 1ZHRA 3E90B 1CT4E 1BBRK 2FMJA 1EJMA 1TLDA 2FOBA 1O2UA 1OX1A 9LPRA 1T32A 3AASA 1UVTH 1UK4A 1NFWA 3SBKA 3D65E 1UJ1A 5DP8A 2BY6X 4R0IA 2FLBH 4HI3A 1YPJH 4PROA 2YNAA 3SV9A 4NSVA 3RXKA 1GWAA 2Z3EA 1S84A 3BIVH 1K21H 3RXPA 5T6DA 1GJ8B 2FLRH 3RXCA 1W7XH 1EX3A 1FNIA 1WTHD 2QAAA 2ANKH 1IAUA 1UHBA 1NU7B 1TNKA 4RSPA 3OU0A 1FXYA 1M9UA 5GCHF 2OC0A 1S83A 4DW2U 3GY8A 1O2XA 1VJ9U 2VGCC 1LKBA 1D3PB 4X1QU 3GY5A 2SGQE 3A86A 2R9PA 1NY22 1V2VT 1AHTH 1HAXB 2R2WU 1AB9C 3NPSA 6GCHG 2ZDAH 2OBOA 1C2LA 1AE5A 1P0SH 2W3KA 4NG9H 4AFSA 2QF0A 2W26A 3LGTA 1SGEE 3BTTE 1GGDB 3ZV8A 1DFPA 1C5NH 2HPPH 4BAOB 1UVUH 2PGQB 1DXPA 4U2WA 1A3BH 3QTOH 4ZKNU 3ZZ3A 2JKHA 2WINI 1SC8U 3IWMA 4AYYB 1EZQA 1WYKA 4YM9A 1C5UA 2PR3A 4YTAA 1SGTA 2PUQH 4F4OC 1ZRKA 1KTSB 3VGCB 3I78A 1Z1IA 5CE1A 1H9IE 3A7YA 1TNIA 1YP9A 2EEKA 2BQWB 2BOKA 2ZQ2A 3V7TA 1AKSA 1C2JA 3M5LA 2Z6BD 1TGSZ 2P59A 3SHCH 4UFDH 4AGKA 1VITH 2RA0A 1SB1H 3AAUA 4WF8A 1TA6A 3V13A 2YNBA 1K1MA 3KNXA 3A8CA 1WBGB 4O3TA 2ZFPH 3W94A 3UQOA 1GCDA 1P02A 5EW2H 1C2IA 2CV3A 1HAZB 2WPHS 1S6HA 1YGCH 2CHAC 3H7TA 3ZVEA 2EC9H 1HYLA 2XCFA 3VEQB 1O2SA 1SGRE 1K2I1 2QV1A 2H2ZA 3TJOA 1G36A 1O3PB 2DUCA 3ZZ9A 2IN2A 1O2WA 3RM0H 3SNEA 3TU7H 1G2MA 4B71A 1SLVB 2R3YA 4DJZB 1PQ5A 3LDXH 4IMQA 1FPHH 4NIWA 4I8HA 1AZZA 1JIMA 1EP5A 1NC6A 3K65B 1ZTJA 2BXTH 3SU0A 5C1XA 1GJDB 1MKWH 1Q31A 1NFUA 3LC3A 3I29A 2EI7A 1Z6EA 2VVCA 4O97A 1HV7A 1RIWC 2A31A 2STAE 2VIWA 2CF9H 3OY6U 3RLYH 4CREA 4WH8A 3N7OA 1GBMA 1YCPH 1GBDA 1DWDH 5E8EH 3T27A 1FY3A 5LPFA 3PMAB 4GCHG 5EU8A 1C1UH 2ODYB 2F9OA 4ZROA 3M3SA 1MU6B 1G37A 4TY7A 3S9BA 1EAIA 1LHCH 1DM4B 1N6YA 2G5VA 4X2XA 3M3TA 3NWUA 1KXBA 1NO9H 3ZZDA 1XKAC 4AGJA 1O2IA 1Q2WA 4K2YA 2SFAA 1W11U 1LPKB 1MMJN 1YLDA 2P95A 9ESTA 1V2NT 5C2ZA 3LKWA 3ZZ6A 4CRCA 1VZQH 7LPRA 2GVFA 2ANMH 1NN6A 2GCHF 1EOLA 2FOEA 1UK2A 1UTOA 3H7OA 4O3UA 3SGQE 3EYDA 4AB8A 4JZIA 5HXFA 2QA9E 2A4GA 2AGEX 3GDSA 1ELAA 1GJ9B 1LQEA 3BTWE 1XUKA 1GJBB 1ZYOA 2VIQA 3UOPA 1KXDA 1C2EA 1LHEH 1Y59T 1D3QB 2XBWA 2QF3A 1CT0E 2BZAA 4XBBA 1GMDF 5JBAS 1E0FD 1F92A 1O5AB 1B0EA 2A0QB 1LVYA 3DHKH 3PO1B 2ILNA 3QN7A 3TGKE 3EAJA 4CH2B 5CHAB 1T31A 4JYUH 3PV4A 4E7NA 2Y7XA 4K1SA 5A0AE 1BITA 1D9IA 4IMZA 4Z6AH 2K1QA 3RMOH 1RJXB 4B73A 4ASHA 1HRTH 1ETTH 2FS9A 3UNQA 2ZU4A 5AVDA 1G3DA 1RTKA 1TBRH 1WSSH 2F9NA 3U8OH 3WY8A 3RXHA 1MCTA 1ZSJA 3BEUA 3GDUA 3HK3B 1P09A 3SJIA 4FUJA 5HMAA 5K0HA 4CR5A 1J17T 1L2EA 2ZF0H 3UQVA 1NZQH 1O3CA 1UTMA 5IDKA 2QXJA 2O8WA 1QA0A 3MTYA 2SGPE 1AVWA 2KAIA 3P8NA 4YOJA 3MH7A 4WXIA 1A2CH 4ZMAH 2GCTC 1C1WH 2J92A 5C1YA 1GHAG 1FIZA 1AVGH 3SGBE 4LZ4B 1MQ5A 1TRNA 2F9UA 3GYLB 2BLOA 4IC5A 1O5BB 1QJ6B 1GHBF 2V3HH 4ISNA 3SNCA 1G32B 2FODA 1MTNB 1FY8E 1TOCB 2GZ7A 2B7DH 4JZFH 1FIWA 3U1JB 4NIXA 3V3MA 1ZJDA 2J34A 2PLXA 4FUHA 1UTJA 1TBZH 2ASUB 2C90B 3BV9B 4FUIA 1O2TA 2BMGB 1BTXA 2ZHFH 3BG4B 3DD2H 3TGJE 2XWBI 3RXEA 2I6QA 2BB4A 8GCHG 4YZUA 1EZUC 2TIOA 4H6TA 3FFGA 3PWCA 1C1SA 2O8MA 3ZZ7A 2UUJB 3RXIA 1RGQA 3CS7A 2A4RA 4X2WA 1V2JT 1Z1JA 2V6NA 4ZKSU 2GCHG 1HIAB 3LIWA 1THPB 1RRKA 1ABJH 1C5RA 1ZMLA 4DCDA 2C8YB 1KSNA 2WV5A 5C67A 1DS2E 4ESTE 1BRAA 1DSTA 5DP5A 1C1PA 3RXJA 1TGCA 5DKMA 5HM9A 1KLIH 1C2DA 3U9AH 4X1PU 2W7UA 3VPKA 1HFDA 1GMDG 3QWCH 1SR5C 2F9BH 3SV6A 1E36B 4GPGA 6CHAB 2V35A 1SQAA 4LZ1H 1GCTC 4NCYA 2AMQA 1FY5A 1ZSLA 3GY6A 3QLPH 2C93B 1AU8A 4FUDA 4ZHAA 1FI8A 1QB1A 3LGUA 2Y5FA 3RC4A 2Z3DA 4DVAU 3SV7A 4ZHMU 1T8NA 1JMOH 4FU8A 1D3DB 5SGAE 1V2KT 1FUJA 1HXEH 3EGKH 3LGVA 1AZ8A 2ZQ1A 1MTSA 2GZ9A 3U98H 2W7SA 1P12E 4ISOA 2OTVA 5EQSA 1ZSKA 3AW0A 4UFGH 1SLWB 1QY6A 1T7CA 5HYOA 1H8DH 3BTKE 1ZZZA 2HNTC 1E34B 1EZXC 1O5CB 1QNJA 4H4FA 1A7SA 3M61U 5FPSA 2VH6A 2A7HA 1SOTA 1Y3YA 1K1PA 3Q76A 1BBRH 3M37A 1S5SA 2WPKS 1O5EH 1TRMA 2AS9A 4J1YA 1C5PA 1O2GH 4ISHH 1GBCA 4UEHH 5J4SA 2BDHA 2ZZUH 4X6NA 2ZGCA 2J4IA 3TK6A 1JIRA 2XWAA 1DICA 3KCGH 1UTKA 1HCGA 4OS2A 2A45B 3ZVDA 1E37B
chains in the Genus database with same CATH superfamily
2XOKD 3DFLA 4Y8XA 3KN2A 1ANEA 1X7AC 1IOEA 1XUHA 3F9HA 4LXBH 5DO4H 3RXBA 1C1OA 2VU8E 2PKSC 3RMMH 1GG6C 1WAYB 1DITH 1GHWH 3ZZ8A 3LONA 1K1OA 3AK5A 1ESAA 1C4V2 1WCZA 3F2GA 3IG6B 1XMNB 1O3DA 1V3XA 2D1JA 2XCNA 1GHXH 2WZQA 4B74A 5BPEA 1J9CH 3S69A 4BANB 4OS1A 3A89A 4WH6A 1AVXA 3FANA 1YPLH 3GY4A 5EQQA 1XUJA 3QZQA 4X2YA 1FZZA 4XE4A 2G00A 3LU9B 2HNTE 1IQMA 1AFQC 1LCYA 4F48B 4BTUB 1P2QA 4ISIH 4VGCC 4UFFH 5EPYA 1GI3A 4WXVA 5EG4A 1DANH 3RXLA 3BG8A 1ELBA 5GDSH 1YPHC 3MH6A 4ZH8A 1FLEE 2VIOA 1VITG 3U8RH 4O9VA 1YPGH 2K0QA 1HAHH 3TLOA 2GTBA 1CE5A 3SHAH 1S6LA 1AD8H 3PLBA 4FOUC 1TFXA 1ZPZA 4HGCA 2GMTC 2WPDD 1B7XB 3BEFB 4MTBA 1EZSC 1TABE 1BRCE 3KQCA 3RU4E 4CHAB 1H1BA 1L1GA 4E05H 2A4OA 3PM3A 2A32A 1S0QA 5DP3A 1BTPA 3E3TA 1VKYA 5A8ZA 1P9SA 2FI3E 1RD3B 2ALPA 4B76A 2NU4E 1OP8A 3TVJB 1N8OB 2Z9KA 4H6SB 1RTLA 4ABIA 1SLXB 2Z9LA 2ZU2A 4X8SH 3RXSA 3B23B 3MNXA 5C94A 4E06H 1YCPM 2AGIX 1FJSA 3HKIB 4Y71A 1SFIA 4OS5A 1BRUP 3OYPA 7GCHG 1AGJA 1Y5UT 4GHTA 3DSPA 1SQOA 5E0JA 1QFKH 2QC2A 4AG2A 1QB6A 5C20A 1SGPE 1GI5A 1SBWA 1LPZB 1G2LA 1SSXA 2PSYA 2BXUH 2V3MA 2HPQH 2SGDE 1F2SE 3Q00A 1C1MA 1XXFA 5ESBA 3GCTG 1FN6A 5DP9A 3KHVA 4IGDA 4CRGA 3RC5A 1YPHE 1NTPA 1OYQA 3W95A 2ZFTA 2QYIA 2LNCA 2BX3A 1C1RA 1O37A 3SU6A 3PLPA 1Z8RA 1FX0B 2JETC 5JB9S 1EB2A 2ANWA 1GVZA 5DSFA 1O3JA 3SJOA 1YY3A 4DURA 3FO8D 2KZ4A 1OWDA 4NZLA 2VIPA 1UTNA 4X1NU 1ELGA 2VH0A 3ZZ5A 1HAOH 3U69H 1ZR0A 3RC6A 1LMWB 1P2NA 3VXEH 2TGTA 4MG3A 4Y6DA 1O36A 3MU8A 1ARCA 1QB9A 1E38B 4TY6A 1OSSA 1DWBH 5IYTA 2BHGA 2OLGA 2RDLA 4JZ1A 2JDID 1G30B 1GI1A 1AMHA 4Z0KA 3RMNH 4XSKU 5A0BA 1LO6A 2GDEH 4X6OA 2AIPA 2P3FH 4JCNA 1V2RT 5LH8A 1H4WA 3SOSA 3LT3A 1TQ0B 2Y6TA 2OP9A 4H42U 2VBCA 2J98B 1PPHE 5DN6D 4X2VA 1EOJA 4IS5A 1YKTA 2V7QD 2WUCA 2SGAA 4ZXXH 1IQNA 2P16A 3T29A 1GVLA 3URCA 1BUIA 2ZDLA 1ACBE 3RDZA 2PGBB 1O3IA 4CRBA 2THFB 1O2OA 3BN9A 2BD3A 4U30A 3P6ZB 2VWLA 5C5OA 3D62A 2ZFSA 2BD2A 4O03A 3RXDA 2ZWLH 1T4VH 1CBWC 2SGFE 1PFXC 1GHZA 2UUYA 2OQ5A 2C8ZB 1EAXA 6LPRA 4WVPE 1EPTB 1PPCE 3QO6A 1D6WA 1C9TA 3F68H 3OAAD 3A82A 1CA0C 1DWCH 1ELTA 1NS3A 2UWOA 4P02A 2B5TB 3MU1A 1OWIA 1GJAB 3NRLA 3TJUA 3MNCA 2VINA 3F0PA 1H9HE 4HTCH 1SG8B 3SNBA 2Y81A 1QBVH 1DX5M 1OXGA 2ZFFH 1GBJA 3W1EA 4QT8C 1MAYA 4M7GA 1Z71A 5F8XA 1TPAE 1F0TA 3D23A 4BAQB 3Q3YA 1EKBB 4AC9A 3ELAH 3CNRA 1OKXA 2JJ1D 1ELEE 5GNDA 2FX4A 1O2VA 1NRRH 2VNTA 2OQUA 3MO3A 1GMHF 2BYAX 2HLCA 3K6YA 3F0OA 2EI6A 1FY1A 1K22H 3E16B 1H9LB 2A1DB 1GBLA 2DE9A 4X6MA 2AMPA 1THRH 2ZC9H 2PW8H 1OP0A 1L4ZA 4WY3A 3T62A 1O2YA 1IHSH 5DP4A 4Y7AA 1VGCB 3SGAE 1GBIA 1DY8A 1KY9A 3MHWU 4SGBE 2GT7A 2J9NA 1PPFE 2BDCA 1AIXH 2NU3E 3FZZA 2TGAA 3KYGA 4MPVA 4ASUD 1QQUA 3ATWA 3DFJA 3GY7A 3GCHC 3SJ8A 3NCLA 3FVFB 2ZPQA 5GCHG 1A0HB 2PKAB 1MTWA 4U01A 1QIXB 4A92A 5E2OA 2FYRA 1OYTH 4NFEA 5LPEA 2AH4X 1ZGIA 3I77A 1W0YH 3ODDA 1DOJA 5F8ZA 5EXLA 4KTSA 1WDIA 4Y76A 1LVBA 1WU1A 3QTVH 1HIAA 4MDSA 3FOAA 4Q7ZA 2XTTB 1Y3UA 1WOFA 1KTTB 3C1KA 4GHQA 3MOCA 1HJ9A 1XVMA 1O2RA 3LH3A 2FO9A 3ITIA 5FXLA 2H5DA 1MD7A 1QRWA 4NSYA 2BD7A 1YM0A 4ABEA 1ZGVA 3E1XB 2WYGA 1C5LH 1ELCA 1NRPH 2ZIQH 2GD4B 3O8DA 1V2TT 1G3BA 1D6RA 1GI6A 3M5NA 1HJAB 5EJ1A 3CP7A 2WHXA 4I31A 3CENA 1T8OA 1TBQH 3TITA 1HJ8A 1GL0E 3TIUA 1CT2E 4CBNA 1XUIA 2ANYA 3T26A 1KDQB 5L6NH 3S9CA 2P8OB 3AAVA 5GWZA 3EQ0H 4UONA 1ZJKA 1W12U 2AYWA 5A8XA 5FCKA 2TBSA 1UCYK 1QJ1B 2ZG0H 5A09A 1HXFH 3EE0B 4NA8A 4YO9A 4FU9A 4ZHLU 1P2KA 3QGJA 4DIHH 3BSQA 5F53A 1TAWA 1EP6A 4GVUA 4ZXYH 1TMBH 3UOUA 2LP6A 4MLFB 1TOMH 2BZ6H 4GSOA 1O3AA 1V2OT 4I8JA 1EXFA 2BDAA 3OEHD 1SGIB 3TNTA 2WV9A 5HIZA 3PMBB 1RFNA 2O8TA 1C5QA 4JZEH 1DUAA 3ZVGA 2A7CA 2FESH 1FMGA 1QA7A 1BMAA 1BCUH 2ZDVH 2ZPSA 1BJUA 4I8KA 1LVMA 1BMMH 3T5FH 2H9EH 8KME2 1W13U 2Z9JA 3ZVCA 2ESTE 2C8XB 4BTIB 5DG6A 1QURH 3PRBA 2XXLA 4BXSA 2BY5X 2A5IA 5A8YA 5EQRA 1CGIE 5T6FA 2ZFQH 5FPYA 1TALA 1P04A 4TPYA 3RXVA 4ZKRU 2UUKB 1W0KD 1ETSH 2ZCKP 5EPNA 1ZTKA 2V3OH 4Y8YA 1PQAA 3Q77A 2GP9B 1YC0A 1ZRBA 2SGEE 1SKYE 1B5GH 4SGAE 1DWEH 1GI7B 4AX9H 1W0JD 1BOQA 1GJ6A 1V2QT 1W7GH 2VGCB 1EFRD 1A61H 1MU8B 1K1NA 1AB9B 2RA3A 4U32A 1C9PA 2G55A 2CMYA 3M7UA 4UE7H 1P2IA 4HFPB 4DT7B 4OS7A 4RKOB 2ZHDA 2K8IA 1O38A 5H4IB 2BD8A 5C1UA 2ZO3H 1NBME 1OHHD 2VB0A 2FI4E 4MQAA 4Y0ZE 1TGBA 2P3TB 2ZGJA 1IQHA 4OS4A 1AY6H 5GXPA 3VB7A 4I33A 2CXVA 1P2JA 3RXFA 1P9UA 5IK2D 2ULLA 3ZZ4A 2KCPA 3SZEA 3UPEA 1GDNA 1SPJA 4WMDA 1VCQA 3MU5A 4I8LA 1NESE 3ZYDA 4MPUA 1LHDH 1N6XA 1V2MT 3PTBA 3SI4H 5L30H 1GI4A 1BBRE 1ZMNA 4NA7A 4KKDA 1LQDB 3ZVFA 1ELFA 2WV4A 3UWIA 5JDUB 3SJ9A 2F9VA 3F9GA 1CVWH 2YMSC 4YXWD 2R2MB 1DVAH 1ETRH 1MKXK 1N1LA 4X8TH 3E8LA 3MU4A 3ZVAA 2PFEA 1QTFA 2PHBA 1V2PT 1MZAA 1J15A 2W5EA 3BTME 5A2MH 1A5HA 3P8GA 4Y11E 1ELVA 5LPRA 5FAHA 1BZXE 4DY7B 4ACBA 1S6FA 4HG6A 2BVRH 1O39A 2CGAA 3KYFA 5ABWA 1CHOF 1NRNH 1Q3XA 1TNHA 1Z7KA 3HK6B 4HZHA 4AYVB 3CS0A 1TMUH 2XC4A 1UVOA 2OXSA 2CHAB 1ESBA 1GMCF 3VB4A 1U6QA 1W0ZU 1EQ9A 1O33A 1AI8H 1S0RA 2RG3A 4OS6A 3P17H 1P3CA 3SUGA 2C4FH 2BQ7B 1GGDC 2AERH 3PTNA 3SJKA 1P10A 2JH6D 3GY2A 1E1QD 1TB6H 1TGTA 5EOKA 2OC8A 3EE7A 3K9XB 1WQSA 1C1VH 2FPZA 1E35B 2ZDKA 2V0BA 5FHTA 1G3EA 1PPEE 4B2AA 2UWPA 2BDIA 1W10U 2ZHWH 4CH8B 1BJVA 1ZHPA 1KXFA 1O5GH 4WMEA 2BY7X 5E0GA 3EA7A 2FX6A 1HAIH 4RKJB 2FI5E 3QZRA 1SGCA 1Y3WA 1RIWB 4YOIA 1ID5H 4D9RA 1P2MA 4IN2A 1SGFG 2GJGA 1GBEA 4Y79A 1TQ7B 4FUBA 1QBOA 3VGCC 2G8TA 3MU0A 1ANDA 1K1JA 1P01A 1S85A 5TJXA 1NU9A 2XC0A 2J95A 2UWLA 3RXMA 1GHYH 2FOFA 1SFQB 4D76A 1YBWA 2EY4C 1XX9A 3M3VA 1GBAA 4OGXA 1XXDA 1L0ZA 5DPAA 2FXRA 3MH5A 3PMHB 2ZP0H 3DA9B 1MTUA 1ESTA 1IQEA 1GHBG 3E91A 2M2AA 3GOVB 4KTUA 1HAPH 2ALVA 1Y5BT 1AQ7A 1IQFA 1MZDA 2FOGA 2ZCHP 2TGDA 4DOQA 1KXAA 2YMSD 1V2ST 3T2NA 1C4Y2 2J98A 4D8NA 5LGOA 1CU1A 3SV2H 3SN8A 3UREA 1C2KA 1F0UA 5DP7A 1KLTA 1UTPA 3ZYEA 3NKKA 3F9EA 3UR6A 1IQJA 1F5KU 1AN1E 2RDEA 4JZDH 2QY0B 2ZGHA 3BEIB 1Z6JH 3PLKA 3VFEA 1WUNH 4XDEA 5T3HA 3SNDA 3ZZBA 1RTFB 3SU2A 2XYAA 4MPWA 3GS9A 1GBFA 3P8FA 1EPTA 1O5FH 1SHHB 1Z8JB 3SU3A 3SZNA 4KGAA 1LDTT 2Z3CA 1BMLA 1JXPA 2ZDNA 4ABJA 1IQIA 1O3OA 6GCHF 5BRRE 1WV7H 2QF5A 3F1SB 3HGPA 3URDA 1SGQE 1KXEA 2KR7A 4B1TA 1Y8TA 2BD5A 1D4PB 4DG4A 4Y8ZA 5EW1H 2FEQH 2ZHQH 5TCAA 1DT2A 3BTGE 4B2BA 3GCNA 2FOMB 1UTQA 1SGDE 1CGHA 3EA9A 1ZOMA 1C5OH 1XKBC 2B0FA 2XW9A 3KQEA 1EAWA 3L33A 1F5RA 1O5DH 2ZEBA 2A4QA 4TT3D 2J38A 1JOUB 2HRVA 3MFJA 4BAHB 1T4UH 3B9FH 1K28D 1FV9A 3QGNB 3MWIU 2QXGA 3LH1A 1TRYA 2P94A 1GMCG 4NZQA 2EI8A 1MBMA 1GI8B 4CRFA 2PP6A 1QRZA 1O3LA 4NFFA 1ZTLA 4KP0A 1G9IE 4ZUHA 1A3EH 1O3HA 4AFUA 1UK3A 2A5KA 4YOGA 3RXAA 4Z1MD 3MMGA 2G4UA 3MQKC 3LGIA 5ESTE 1C2GA 1DDJA 4AB9A 4K60A 3RU4D 1L1NA 1O35A 2ZHEH 1F7ZA 2GCTB 3M35A 4FUGA 4AZ2B 2AFQB 3RXTA 8LPRA 1HLTH 1GJ5H 2BD4A 3SQHE 3F2FA 4AFZA 1UTLM 1TNJA 3SV8A 3OEED 2A7JA 4WJG2 5C17A 1QGFA 2ZGXH 2BQ6B 3FZDA 2OCVB 4IBLH 3MNBA 4GLYA 3E6PH 3KQDA 2PKAA 1W8BH 2B8OH 2JH0D 1FPCH 2F91A 4ABAA 2F9PA 3DSGA 1GBTA 3QUMP 2L6OA 3PO1C 1TPOA 3JZ2B 5CHAC 2EA3A 1OWEA 5C3NA 1MQ6A 1UCYE 3SUFA 1P2OA 2D8WA 1V2UT 3P70B 5F03A 4ACAA 3RXOA 1SL3A 1ORFA 1ZPCA 1CSOE 2WPLS 5DJ7A 5AFYH 4LK4A 1A0JA 2Y7ZA 2H9TH 1TX6A 1J14A 1RXPA 3FP7E 3V0XA 4K3JA 2J5UA 2ZA5A 3BIUH 2KCYA 3TH3H 1K9OE 3A85A 2ZECA 2XRCA 3TGIE 3E0NB 1PPGE 1O2PA 2G5NA 2Y80A 3FAOA 2IPQX 3O8CA 4INHA 3KL6A 4OM9A 2STBE 1KDQA 1S82A 2NWNA 4TPIZ 3MH4A 4K1TA 5J4QA 2BDBA 3A87A 3L6PA 3O8RA 2FWWA 3A8DA 2KCOA 2NU2E 1C5VA 2Z7FE 5FL7D 2BOHB 5EGMA 3RXQA 2FIRH 1DUEA 2BDGA 1SOZA 1QL7A 3TNSA 1GI2A 4X1RU 4Q80A 1GHVH 3ZVBA 4GCHF 1TPSA 4MNYA 4JK6A 3C27B 1HNEE 2HLDD 3N7EA 2H9HA 3PWBA 1P8VC 2IJOB 1L4DA 4MNVA 1GCTB 3UNRA 1ARBA 4BTTB 2GDDA 1CO7E 5E2PA 4ZAEA 2FOCA 5B6LA 3GISB 2QF4A 1EAUA 4DGJA 3ENSB 3ZZAA 1LKAA 1EJNA 5HGGA 1V6DA 1VJAU 2GT8A 1SVPA 2BVSH 1BRBE 2BY8X 1C5SA 1GPZA 1MTNC 3PMJA 4I7YH 4UD9H 2R0KA 5K7RA 2CJIA 1H8IH 2ZU1A 3GDVA 3B8JA 1DXWA 1YPKH 3RLWH 4X8UH 4A1VA 1VR1H 1C1TA 1C2FA 3RM2H 1J16A 2HVXA 3S7HB 3BTEE 2O8UA 3U1IB 1OOKB 5AF9H 1UCYH 4JMYA 1Y5AT 2KCAA 1HUTH 1NROH 3MNSA 3BG4C 2M5TA 3A7VA 1UO6A 5DP6A 5PTPA 1FN8A 2Y5GA 4ABBA 2QGRA 1ZPBA 4FUCA 3VB6A 1TONA 2XBVA 2YOLA 4M9FA 1O3GA 1Z8GA 4K5ZA 1CHGA 1O3FA 1BB0B 3T28A 2TGPZ 3K2UA 2GV6A 2JH5D 2BDYA 1MH0A 1SGNE 1HAVB 1WTGH 3M36A 4IW4E 1PPBH 3MYWA 1BMFD 1THSH 1C5YB 2RCEA 1SQTA 4OGYA 1O3BA 3EDXB 5FPTA 5JYIA 3KQBA 4LOYH 4J2YB 1TYNA 1GI0A 3STJA 1EATA 2D26C 2PKSB 1A5IA 2Q6FA 4THNH 1ZHMA 4FVBA 1GG6B 6CHAC 1O3MA 2O8LA 3MI4A 2P93A 2Y5HA 3OE7D 2OUAA 4JYVH 3RXRA 3A80A 3SNAA 1DLKB 3TJVA 3A7WA 1AUJA 1HGTH 4A6LA 3SU4A 5GPIB 2Z9IA 1HDTH 2IOTA 2ZFRH 3A88A 5JPMH 3A83A 3AW1A 4KELA 4X6PA 3HPTB 1C5MD 1UMAH 4FXGH 5EIYA 4AN7A 1JWTA 1MUEB 4Q7YA 2WSSD 2G81E 3ATKA 4X8VH 4ABDA 2PTCE 1T8LA 5B6OA 1AFQB 3O8BA 4MNWA 4CRDA 4VGCB 1P57B 3QX5H 1GHAF 3M7TA 1QRXA 3G01A 1YWUA 4FVDA 3K6ZA 3SO3A 5L2ZH 4RN6A 2WUBA 5CMXH 3TH2H 2BM2A 1W3CA 4NWLA 2AEIH 1GI9B 2XBXA 4MNXA 2AMDA 3SUDA 2NU1E 1ANCA 5HM2A 2GMTB 1NM6A 2GKVE 2R3UA 3VB3A 3GCOA 1O31A 4CRAA 2QIQA 3QK1A 1HPGA 1XM1A 2QXHA 2Z94A 2VIDA 4XOJA 4ZKOU 2OD3B 4RT1A 1ABIH 1RS0A 1MBQA 4NWKA 2VWMA 3SU5A 1ELDE 3L3TA 3SI3H 2HALA 1FQ3A 1MCVA 1MTVA 4CR9A 3SORA 3KIDU 3RP2A 5EJZA 1HB0B 1A46H 1GDUA 1W2KH 2JIZD 4BAMB 2VWOA 3LPRA 3Q3KA 4BXWA 1D3TB 3GYMA 1UHBB 3F3BA 2FTLE 4ABFA 1A4WH 1W14U 2P3UB 2PUXB 8GCHF 1OWHA 1V2LT 2VWNA 3NUMA 1TGNA 4YT7H 1DE7H 4Y10E 1MKXH 2SNVA 1C1NA 1T8MA 4XBCA 4WWYA 3P8OA 1FY4A 2TRMA 1YPEH 2ZTZA 3A7ZA 1WQVH 1F5LA 4D7GA 4BOHA 4FUEA 3N7DA 3RU4T 2CN0H 2G52A 1C5XB 3HGNA 3SW2B 2ZTXA 2ZNKH 1EASA 2ODPA 4JK5A 1TA2A 3UIRA 1BDAA 2QCYA 4Y0YE 3UWJH 3LGYA 1KXCA 1AO5A 1QL9A 5ETXA 3EA8A 2JETB 3TK5A 3F6UH 1GJCB 2J94A 2WPIS 3UNSA 4X0WU 1O2MA 3BTQE 1TNGA 5GJ4B 1O2HA 4AOQA 5L2YH 4IN1A 2HNTF 2H1UA 2BLQA 7KMEH 1GMHG 2Q6DA 3TJNA 1SHYA 1AWFH 3LC5A 4FUFA 1PQ7A 2ZI2H 4CHAC 1ZMJA 2W6ID 3QDZB 4F49A 2FTMA 5FCRA 1AUTC 1QL8A 1JRSA 6ESTA 3BTHE 1TNLA 4ABGA 1C5ZB 2F43B 3R3GB 4IC6A 2J2UA 1O0DH 1AKSB 3NK8A 1UW7A 1N8OC 3MO6A 2QXIA 1O34A 1MKWK 1DPOA 1IHTH 1GBKA 2PTNA 3VXFH 7ESTE 2PSXA 1O3EA 1TMTH 4FU7A 4ABHA 2C3SA 3PROA 3U8TH 1KIGH 2IPHA 3JZ1B 4INLA 5F8TA 3LJOA 2ZTYA 3S9AA 1YCPK 4K1EA 2F83A 3RXGA 3LGWA 2OINA 1NRSH 2ZGBH 3M5OA 1YPMH 1PPZA 1SI5H 2SNWA 4BNRA 1BTHH 2QN5T 1Z8IB 4NIYA 3SQEE 4A1XA 3R0FA 1TIOA 1IQGA 5TCCA 4JYTA 2A5AA 2Z9GA 4AG1A 1EB1H 1A0LA 3H5CB 1UVPA 4KTCA 1FAXA 5AHGH 2VJ1A 4INKA 4Y7BA 1BHXB 2EQNA 1NT1A 2ZU5A 1QR3E 1CBWB 2XNIA 1OP2A 4TWWA 4A1TA 1YLNA 3HATH 4YLQH 3HKJB 1J8AA 2HGTH 1GJ7B 4R8TB 1NBMD 1K1LA 1GDQA 2HVYB 1TPPA 2VVVA 2Q1JA 3TH4H 3WW7A 1JBUH 4UFEH 4AFQA 3S0NA 3UR9A 3UUZA 1CA0B 2OC7A 3DT0H 5JBTA 1O2ZA 1LTOA 1O3NA 3RUOA 3ATMA 1SGYE 2BTCE 1QBNA 1O3KA 1BT7A 3FP6E 3IITA 5EXMA 1C4U2 1F0SA 4D7FA 2XC5A 1E1RD 1HBTH 4MPXA 1S81A 1HAYB 5JBBS 1O2LA 3OTPA 2H6MA 5EJLA 5E0HA 1DY9A 3LOXA 2C8WB 1PYTC 4XFQA 1QJ7B 1Y3VA 2XBYA 4Q2KA 4Q63A 3RMLH 1VITF 3ZZCA 1C5TA 1TX8A 1O2QA 2A2XH 2GZ8A 2OBQA 5AFZH 3A8BA 2BLVA 3A81A 2AGGX 4NA9H 3UTUH 4B75A 1OPHB 1NFXA 2FOAA 2FZZA 1P06A 2FOHA 3E0PB 2OC1A 3SU1A 2QE7D 1INCA 1BQYA 3WWFA 4UDWH 3GY3A 4NIVA 1QCPA 1BA8B 1XVOA 4D9QA 2FS8A 5G4BA 2BD9A 2CK3D 2GGVB 4YESB 1YYY1 2ZDMA 4DIIH 1ANBA 1GBBA 1LHGH 3NXPA 1BIOA 2KFWA 5T6GA 1VCPA 1EUFA 1O2JA 3GCHB 2PV9B 3KGPA 1NPMA 3ATIA 1CQQA 2G4TA 3A7XA 1YLCA 1AE8H 3PYHA 1BTUA 3TK9A 4TWYA 1DLEA 2B9LA 3ZV9A 1NRQH 2WPMS 1EPTC 2GX4A 2WYJA 7GCHF 3T25A 1C5WB 1L1JA 3BF6H 4XBDA 1O2NA 4YT6H 2R0LA 3SYJA 3MO9A 2GV7A 5C5NA 1XUFA 3KF2A 1F0RA 1G3CA 2DE8A 3Q3XA 1MABB 4CBOA 3A7TA 1MAXA 1DSUA 2NU0E 4GAWA 1FAKH 3GCTF 1B0FA 5EODA 2LPRA 3H09A 1KLJH 2AIQA 4RI0A 4Q7XA 1BTYA 2HWLB 4A5TS 1GL1A 4ISLA 2BY9X 1O32A 4A7IB 3DUXH 5GIBA 4B6FA 3OTJE 1TE0A 2BX4A 1CGJE 1WXRA 1MD8A 3PB1E 1TX7A 4NGAH 1AWHB 1AFEH 1EJAA 3AVZA 1CA8B 4I8GA 1PQ8A 3P92A 3M7QA 1OWKA 2ODQA 2H5CA 3ESTA 1K1IA 5JB8S 1PYTD 1BMNH 2W3IA 1BTZA 5JBCS 1IQKA 1SMFE 2KAIB 5I25A 2RFKC 3M5MA 1P11E 3UAIC 3A84A 3VB5A 1JRTA 1KYNA 2ZU3A 3S7KB 2ZPRA 1VGCC 1O2KA 4TSFD 5DGJA 1GBHA 1P05A 5FX6A 1LPGB 1GJ4H 2A2QH 2FDAA 4XD7D 5KGOA 3ATLA 5DK1A 1XUGA 1A5GH 2F3CE 3SUEA 1BHXF 2O9QA 3F9FA 3RXUA 5HIYA 3KEEA 2VVUA 1P3EA 2UUFB 5FBIA 4AORA 3BTFE 1CHOG 2HOBA 2FM2A 4YLUA 1HAVA 1SLUB 1P03A 5A0CA 1UVSH 1SGFA 5CHBA 4K8BA 1QHRB 2WPJS 1COWD 2XNDD 1C2MA 1FDPA 3DSOA 2BLWA 1O30A 2FYQA 1LVOA 3PRDA 1VCWA 1FONA 1GVKB 2I6SA 3GICB 3V12A 3A8AA 3BTDE 1QQ4A 3P95A 1TWXB 1HJAC 3STIA 4TYDA 2PWXA 1YF4A 3FP8E 2ZCLP 5F6MA 2Q6GA 4K69A 3OY5U 3NZIA 1OWJA 3UFAA 3OSYA 4B2CA 2P8OC 1HAGE 2Y82A 4BAKB 4E7RG 4K8YA 1PJPA 1ZLRA 3TPIZ 2G51A 4I32A 2VIVA 5I46H 4Q4LA 3OX7U 2TPIZ 2D2DA 4GUXA 4X1SU 4MVNA 1K0HA 5EXNA 1Y3XA 3ODFA 8ESTE 1A1RA 3UY9A 2CF8H 5FBEA 1LHFH 1C2HA 1BTWA 1OS8A 4WMFA 2FP7B 5FX5A 1C1QA 1IQLA 3D49H 3LJJA 2ZKSA 1V2WT 2BVXH 1NFYA 1ZHRA 3E90B 1CT4E 1BBRK 5HKKD 2FMJA 3U28C 1EJMA 1TLDA 2FOBA 1O2UA 1OX1A 9LPRA 4F55A 1T32A 3AASA 1UVTH 1UK4A 1NFWA 3SBKA 3D65E 1UJ1A 5DP8A 2BY6X 4R0IA 2FLBH 4HI3A 1YPJH 4PROA 3KQ5A 2YNAA 3SV9A 2JJ2D 4NSVA 3RXKA 1GWAA 2Z3EA 1S84A 3BIVH 1K21H 3RXPA 5T6DA 1GJ8B 2FLRH 3RXCA 2YMSB 1W7XH 1EX3A 1FNIA 1WTHD 2QAAA 2ANKH 1IAUA 1UHBA 1NU7B 1TNKA 4RSPA 3OU0A 1FXYA 1M9UA 5GCHF 2OC0A 1S83A 4DW2U 3GY8A 1O2XA 1VJ9U 2AHME 2VGCC 1LKBA 1D3PB 4X1QU 3GY5A 2SGQE 3A86A 2J97A 2R9PA 1NY22 1V2VT 1AHTH 1HAXB 2R2WU 1AB9C 4FETA 3NPSA 6GCHG 2ZDAH 2OBOA 1C2LA 1AE5A 1P0SH 2W3KA 4NG9H 4AFSA 2QF0A 2W26A 3LGTA 1SGEE 3BTTE 1GGDB 3ZV8A 1DFPA 1C5NH 3UB0A 2HPPH 4BAOB 1UVUH 2PGQB 1DXPA 4U2WA 1A3BH 2KX4A 3QTOH 4ZKNU 3ZZ3A 2JKHA 2WINI 1SC8U 4RT0A 3IWMA 4AYYB 1EZQA 1WYKA 4YM9A 5KEDA 1C5UA 2PR3A 4YTAA 1SGTA 1H8ED 2PUQH 4F4OC 1ZRKA 1KTSB 3VGCB 3I78A 1Z1IA 5CE1A 1H9IE 4B6EA 3A7YA 1TNIA 1YP9A 2EEKA 2BQWB 2BOKA 2ZQ2A 3V7TA 1AKSA 1C2JA 3M5LA 2Z6BD 1TGSZ 2P59A 3SHCH 4UFDH 4AGKA 1VITH 2RA0A 3N99A 1SB1H 3AAUA 4WF8A 1TA6A 3V13A 2YNBA 3OFND 1K1MA 3KNXA 3A8CA 1WBGB 2KM0A 4O3TA 2ZFPH 3W94A 3UQOA 1GCDA 1P02A 5EW2H 1C2IA 2CV3A 2IJD1 1HAZB 1SQRA 2WPHS 1S6HA 1YGCH 2CHAC 3H7TA 3ZVEA 2EC9H 1HYLA 2XCFA 3VEQB 1O2SA 1SGRE 1K2I1 2QV1A 2H2ZA 3PV5A 3TJOA 3VG8A 1G36A 1O3PB 2DUCA 3ZZ9A 2IN2A 1O2WA 3RM0H 3SNEA 3TU7H 1G2MA 4B71A 1SLVB 4ZCNA 2R3YA 4DJZB 3FN8A 1PQ5A 3LDXH 4IMQA 1FPHH 4NIWA 4I8HA 1AZZA 1JIMA 1EP5A 1NC6A 3K65B 1ZTJA 2BXTH 3SU0A 5C1XA 1GJDB 1MKWH 1Q31A 1NFUA 3LC3A 3I29A 2EI7A 1Z6EA 2VVCA 4O97A 5T1VA 1HV7A 1RIWC 2A31A 2STAE 2VIWA 2CF9H 3OY6U 3RLYH 4CREA 4WH8A 2W6JD 3N7OA 1GBMA 1YCPH 1GBDA 1DWDH 5E8EH 2LELA 3T27A 1FY3A 5LPFA 3PMAB 4GCHG 5EU8A 1C1UH 2ODYB 2F9OA 4ZROA 3M3SA 1MU6B 1G37A 4TY7A 3S9BA 1EAIA 1LHCH 1DM4B 1N6YA 2G5VA 4X2XA 3M3TA 4DT4A 3NWUA 1KXBA 1NO9H 4XRNA 1XKAC 3ZZDA 4AGJA 1O2IA 1Q2WA 4K2YA 2SFAA 1W11U 1LPKB 1MMJN 1YLDA 2P95A 9ESTA 1V2NT 5C2ZA 3LKWA 3ZZ6A 4CRCA 1KMHB 1VZQH 7LPRA 2GVFA 2ANMH 1NN6A 2GCHF 1EOLA 2FOEA 1UK2A 1UTOA 3H7OA 4O3UA 3SGQE 3EYDA 4AB8A 4JZIA 5HXFA 2QA9E 2A4GA 2AGEX 3GDSA 1ELAA 1GJ9B 1LQEA 3BTWE 1XUKA 1GJBB 5C0UA 1ZYOA 2VIQA 3UOPA 1KXDA 1C2EA 1LHEH 1Y59T 1D3QB 2XBWA 2QF3A 1CT0E 2BZAA 4XBBA 1GMDF 5JBAS 1E0FD 1F92A 1O5AB 1B0EA 2A0QB 1LVYA 3DHKH 3PO1B 2ILNA 3QN7A 3TGKE 3EAJA 3FKSD 4CH2B 5CHAB 1T31A 4JYUH 3PV4A 4E7NA 2Y7XA 4K1SA 5A0AE 1BITA 5CDFE 1D9IA 4IMZA 4Z6AH 2K1QA 3RMOH 1RJXB 3DCLA 4B73A 4ASHA 1HRTH 1ETTH 2FS9A 3UNQA 2ZU4A 5AVDA 1G3DA 1RTKA 1TBRH 1WSSH 2F9NA 3U8OH 3WY8A 3RXHA 1MCTA 1ZSJA 3WWBA 3BEUA 3GDUA 3HK3B 1P09A 3SJIA 4FUJA 5HMAA 5K0HA 2L74A 4CR5A 1J17T 4I86A 1L2EA 2ZF0H 3UQVA 1NZQH 1O3CA 1UTMA 5IDKA 2QXJA 2O8WA 1QA0A 3MTYA 2SGPE 1AVWA 2KAIA 3P8NA 4YOJA 3MH7A 4WXIA 1A2CH 4ZMAH 2GCTC 1C1WH 2J92A 1QZ8A 5C1YA 1GHAG 1FIZA 1AVGH 3SGBE 4LZ4B 1MQ5A 1TRNA 2F9UA 3GYLB 2BLOA 4IC5A 1O5BB 1QJ6B 1GHBF 2V3HH 4ISNA 3SNCA 1G32B 2FODA 1MTNB 1FY8E 1TOCB 2GZ7A 2B7DH 4JZFH 1FIWA 3U1JB 4NIXA 3V3MA 1ZJDA 2J34A 2PLXA 4FUHA 1UTJA 1TBZH 2OK5A 3F2HA 2ASUB 2C90B 3BV9B 4FUIA 3PV2A 1O2TA 2BMGB 1BTXA 2ZHFH 3BG4B 3DD2H 3TGJE 5KECA 2XWBI 3RXEA 2I6QA 2BB4A 8GCHG 4YZUA 1EZUC 2TIOA 4H6TA 3FFGA 3PWCA 1C1SA 2O8MA 3ZZ7A 2UUJB 3RXIA 1RGQA 3CS7A 2A4RA 4X2WA 1V2JT 1Z1JA 2V6NA 4ZKSU 2GCHG 1HIAB 3LIWA 1THPB 1RRKA 1ABJH 1C5RA 1ZMLA 4DCDA 2C8YB 1KSNA 2WV5A 5C67A 1DS2E 4ESTE 1BRAA 1DSTA 5DP5A 1C1PA 3RXJA 1TGCA 5DKMA 5HM9A 1KLIH 1C2DA 3U9AH 4X1PU 2W7UA 3VPKA 1HFDA 1GMDG 3QWCH 1SR5C 2F9BH 3SV6A 1E36B 4GPGA 6CHAB 2V35A 1SQAA 4LZ1H 1GCTC 4NCYA 2AMQA 3ZIAD 1FY5A 1ZSLA 1E79D 2F4LA 3GY6A 3QLPH 2C93B 1AU8A 1H8HD 4FUDA 4ZHAA 1FI8A 1QB1A 3LGUA 2Y5FA 3RC4A 2Z3DA 4DVAU 3SV7A 4ZHMU 1T8NA 1JMOH 4FU8A 1D3DB 5SGAE 1V2KT 1FUJA 1HXEH 3EGKH 3LGVA 1AZ8A 2ZQ1A 1MTSA 2GZ9A 3U98H 2W7SA 1P12E 4ISOA 2OTVA 5EQSA 1ZSKA 3AW0A 4UFGH 1SLWB 1QY6A 1T7CA 5HYOA 1H8DH 3BTKE 1ZZZA 2HNTC 1E34B 1EZXC 1O5CB 1QNJA 4H4FA 1A7SA 3M61U 5FPSA 2VH6A 2A7HA 1SOTA 1Y3YA 1K1PA 3Q76A 1BBRH 3M37A 4P00A 1S5SA 2WPKS 1O5EH 1TRMA 2AS9A 4J1YA 1C5PA 1O2GH 4ISHH 1GBCA 4UEHH 5C0TA 5J4SA 2BDHA 2ZZUH 4X6NA 2ZGCA 2J4IA 3TK6A 1JIRA 2XWAA 1DICA 3KCGH 1UTKA 1HCGA 4OS2A 2A45B 3ZVDA 1E37B
chains in the Genus database with same CATH topology
3DFLA 4Y8XA 3KN2A 1ANEA 1X7AC 1IOEA 1XUHA 3F9HA 4LXBH 5DO4H 3RXBA 1C1OA 2VU8E 2PKSC 3RMMH 1GG6C 1WAYB 1DITH 1GHWH 3ZZ8A 3LONA 1K1OA 1ESAA 1C4V2 1WCZA 3IG6B 1XMNB 1O3DA 1V3XA 2D1JA 2XCNA 1GHXH 4B74A 5BPEA 1J9CH 3S69A 4BANB 4OS1A 3A89A 4WH6A 1AVXA 3FANA 1YPLH 3GY4A 5EQQA 1XUJA 3QZQA 4X2YA 1FZZA 4XE4A 2G00A 3LU9B 2HNTE 1IQMA 1AFQC 1LCYA 4BTUB 1P2QA 4ISIH 4VGCC 4UFFH 5EPYA 1GI3A 4WXVA 5EG4A 1DANH 3RXLA 3BG8A 1ELBA 5GDSH 1YPHC 3MH6A 4ZH8A 1FLEE 2VIOA 1VITG 3U8RH 4O9VA 1YPGH 1HAHH 3TLOA 2GTBA 1CE5A 3SHAH 1AD8H 3PLBA 1TFXA 1ZPZA 4HGCA 2GMTC 1B7XB 3BEFB 4MTBA 1EZSC 1TABE 1BRCE 3KQCA 3RU4E 4CHAB 1H1BA 1L1GA 4E05H 2A4OA 3PM3A 2A32A 1S0QA 5DP3A 1BTPA 3E3TA 5A8ZA 1P9SA 2FI3E 1RD3B 2ALPA 4B76A 2NU4E 1OP8A 3TVJB 1N8OB 2Z9KA 4H6SB 1RTLA 4ABIA 1SLXB 2Z9LA 2ZU2A 4X8SH 3RXSA 3B23B 3MNXA 4E06H 1YCPM 2AGIX 1FJSA 3HKIB 4Y71A 1SFIA 4OS5A 1BRUP 3OYPA 7GCHG 1AGJA 1Y5UT 4GHTA 1SQOA 5E0JA 1QFKH 2QC2A 4AG2A 1QB6A 5C20A 1SGPE 1GI5A 1SBWA 1LPZB 1G2LA 1SSXA 2PSYA 2BXUH 2HPQH 2SGDE 1F2SE 3Q00A 1C1MA 1XXFA 5ESBA 3GCTG 1FN6A 5DP9A 3KHVA 4IGDA 4CRGA 3RC5A 1YPHE 1NTPA 1OYQA 3W95A 2ZFTA 2QYIA 2LNCA 2BX3A 1C1RA 1O37A 3SU6A 3PLPA 1Z8RA 2JETC 5JB9S 1EB2A 2ANWA 1GVZA 1O3JA 3SJOA 4DURA 1OWDA 4NZLA 2VIPA 1UTNA 4X1NU 1ELGA 2VH0A 3ZZ5A 1HAOH 3U69H 1ZR0A 3RC6A 1LMWB 1P2NA 3VXEH 2TGTA 4MG3A 4Y6DA 1O36A 3MU8A 1ARCA 1QB9A 1E38B 4TY6A 1OSSA 1DWBH 5IYTA 2BHGA 2OLGA 2RDLA 4JZ1A 1G30B 1GI1A 1AMHA 4Z0KA 3RMNH 4XSKU 5A0BA 1LO6A 2GDEH 4X6OA 2AIPA 2P3FH 4JCNA 1V2RT 5LH8A 1H4WA 3SOSA 3LT3A 1TQ0B 2Y6TA 2OP9A 4H42U 1PPHE 4X2VA 1EOJA 4IS5A 1YKTA 2WUCA 2SGAA 4ZXXH 1IQNA 2P16A 3T29A 1GVLA 3URCA 1BUIA 2ZDLA 1ACBE 3RDZA 2PGBB 1O3IA 4CRBA 2THFB 1O2OA 3BN9A 2BD3A 4U30A 3P6ZB 2VWLA 5C5OA 3D62A 2ZFSA 2BD2A 4O03A 3RXDA 2ZWLH 1T4VH 1CBWC 2SGFE 1PFXC 1GHZA 2UUYA 2OQ5A 2C8ZB 1EAXA 6LPRA 4WVPE 1EPTB 1PPCE 3QO6A 1D6WA 1C9TA 3F68H 3A82A 1CA0C 1DWCH 1ELTA 1NS3A 2UWOA 2B5TB 3MU1A 1OWIA 1GJAB 3TJUA 3MNCA 2VINA 4HTCH 1H9HE 1SG8B 3SNBA 2Y81A 1QBVH 1DX5M 1OXGA 2ZFFH 1GBJA 4QT8C 1MAYA 4M7GA 1Z71A 5F8XA 1TPAE 1F0TA 3D23A 4BAQB 3Q3YA 1EKBB 3ELAH 1OKXA 1ELEE 2FX4A 1O2VA 1NRRH 2VNTA 2OQUA 3MO3A 1GMHF 2BYAX 2HLCA 3K6YA 2EI6A 1FY1A 1K22H 3E16B 1H9LB 2A1DB 1GBLA 2DE9A 4X6MA 2AMPA 1THRH 2ZC9H 2PW8H 1OP0A 1L4ZA 4WY3A 3T62A 1O2YA 1IHSH 5DP4A 4Y7AA 1VGCB 3SGAE 1GBIA 1DY8A 1KY9A 3MHWU 4SGBE 2GT7A 2J9NA 1PPFE 2BDCA 1AIXH 2NU3E 3FZZA 2TGAA 4MPVA 1QQUA 3ATWA 3DFJA 3GY7A 3GCHC 3SJ8A 3NCLA 3FVFB 2ZPQA 5GCHG 1A0HB 2PKAB 1MTWA 4U01A 1QIXB 4A92A 5E2OA 2FYRA 1OYTH 4NFEA 5LPEA 2AH4X 1ZGIA 3I77A 1W0YH 3ODDA 1DOJA 5F8ZA 5EXLA 4KTSA 4Y76A 1LVBA 1WU1A 3QTVH 1HIAA 4MDSA 4Q7ZA 2XTTB 1Y3UA 1WOFA 1KTTB 3C1KA 4GHQA 3MOCA 1HJ9A 1XVMA 1O2RA 3LH3A 2FO9A 3ITIA 5FXLA 2H5DA 1MD7A 1QRWA 4NSYA 2BD7A 1YM0A 4ABEA 1ZGVA 3E1XB 2WYGA 1C5LH 1ELCA 1NRPH 2ZIQH 2GD4B 3O8DA 1V2TT 1G3BA 1D6RA 1GI6A 3M5NA 1HJAB 3CP7A 4I31A 3CENA 1T8OA 1TBQH 3TITA 1HJ8A 1GL0E 3TIUA 1CT2E 4CBNA 1XUIA 2ANYA 3T26A 1KDQB 5L6NH 3S9CA 2P8OB 3AAVA 5GWZA 3EQ0H 4UONA 1ZJKA 1W12U 2AYWA 5A8XA 5FCKA 2TBSA 1UCYK 1QJ1B 2ZG0H 5A09A 1HXFH 3EE0B 4NA8A 4YO9A 4FU9A 4ZHLU 1P2KA 3QGJA 4DIHH 3BSQA 1TAWA 1EP6A 4GVUA 4ZXYH 1TMBH 3UOUA 4MLFB 1TOMH 2BZ6H 4GSOA 1O3AA 1V2OT 4I8JA 1EXFA 2BDAA 1SGIB 3TNTA 3PMBB 1RFNA 2O8TA 1C5QA 4JZEH 1DUAA 3ZVGA 2A7CA 2FESH 1FMGA 1QA7A 1BMAA 1BCUH 2ZDVH 2ZPSA 1BJUA 4I8KA 1LVMA 1BMMH 3T5FH 2H9EH 8KME2 1W13U 2Z9JA 3ZVCA 2ESTE 2C8XB 4BTIB 5DG6A 1QURH 2XXLA 4BXSA 2BY5X 2A5IA 5A8YA 5EQRA 1CGIE 5T6FA 2ZFQH 5FPYA 1TALA 1P04A 4TPYA 3RXVA 4ZKRU 2UUKB 1ETSH 2ZCKP 5EPNA 1ZTKA 2V3OH 4Y8YA 1PQAA 3Q77A 2GP9B 1YC0A 1ZRBA 2SGEE 1B5GH 4SGAE 1DWEH 1GI7B 4AX9H 1BOQA 1GJ6A 1V2QT 1W7GH 2VGCB 1A61H 1MU8B 1K1NA 1AB9B 2RA3A 4U32A 1C9PA 2G55A 2CMYA 3M7UA 4UE7H 1P2IA 4HFPB 4DT7B 4OS7A 4RKOB 2ZHDA 1O38A 5H4IB 2BD8A 5C1UA 2ZO3H 2VB0A 2FI4E 4MQAA 4Y0ZE 1TGBA 2P3TB 2ZGJA 1IQHA 4OS4A 1AY6H 5GXPA 3VB7A 4I33A 2CXVA 1P2JA 3RXFA 1P9UA 2ULLA 3ZZ4A 3UPEA 1GDNA 1SPJA 4WMDA 1VCQA 3MU5A 4I8LA 1NESE 3ZYDA 4MPUA 1LHDH 1N6XA 1V2MT 3PTBA 3SI4H 5L30H 1GI4A 1BBRE 1ZMNA 4NA7A 4KKDA 1LQDB 3ZVFA 1ELFA 2WV4A 3UWIA 5JDUB 3SJ9A 2F9VA 3F9GA 1CVWH 2R2MB 1DVAH 1ETRH 1MKXK 1N1LA 4X8TH 3E8LA 3MU4A 3ZVAA 2PFEA 1QTFA 2PHBA 1V2PT 1MZAA 1J15A 2W5EA 3BTME 5A2MH 1A5HA 3P8GA 4Y11E 1ELVA 5LPRA 5FAHA 1BZXE 4DY7B 1S6FA 2BVRH 1O39A 2CGAA 5ABWA 1CHOF 1NRNH 1Q3XA 1TNHA 1Z7KA 3HK6B 4HZHA 4AYVB 3CS0A 1TMUH 2XC4A 1UVOA 2OXSA 2CHAB 1ESBA 1GMCF 3VB4A 1U6QA 1W0ZU 1EQ9A 1O33A 1AI8H 1S0RA 2RG3A 4OS6A 3P17H 1P3CA 3SUGA 2C4FH 2BQ7B 1GGDC 2AERH 3PTNA 3SJKA 1P10A 2JH6D 3GY2A 1TB6H 1TGTA 5EOKA 2OC8A 3K9XB 1WQSA 1C1VH 2FPZA 1E35B 2ZDKA 2V0BA 5FHTA 1G3EA 1PPEE 4B2AA 2UWPA 2BDIA 1W10U 2ZHWH 4CH8B 1BJVA 1ZHPA 1KXFA 1O5GH 4WMEA 2BY7X 5E0GA 3EA7A 2FX6A 1HAIH 4RKJB 2FI5E 3QZRA 1SGCA 1Y3WA 1RIWB 4YOIA 1ID5H 4D9RA 1P2MA 4IN2A 1SGFG 1GBEA 4Y79A 1TQ7B 4FUBA 1QBOA 3VGCC 2G8TA 3MU0A 1ANDA 1K1JA 1P01A 1S85A 5TJXA 1NU9A 2XC0A 2J95A 2UWLA 3RXMA 1GHYH 2FOFA 1SFQB 4D76A 1YBWA 1XX9A 3M3VA 1GBAA 4OGXA 1XXDA 1L0ZA 5DPAA 2FXRA 3MH5A 3PMHB 2ZP0H 3DA9B 1MTUA 1ESTA 1IQEA 1GHBG 3E91A 3GOVB 4KTUA 1HAPH 2ALVA 1Y5BT 1AQ7A 1IQFA 1MZDA 2FOGA 2ZCHP 2TGDA 4DOQA 1KXAA 1V2ST 3T2NA 1C4Y2 5LGOA 4D8NA 1CU1A 3SV2H 3SN8A 3UREA 1C2KA 1F0UA 5DP7A 1KLTA 1UTPA 3ZYEA 3NKKA 3F9EA 3UR6A 1IQJA 1F5KU 1AN1E 4JZDH 2QY0B 2ZGHA 3BEIB 1Z6JH 3PLKA 3VFEA 1WUNH 4XDEA 5T3HA 3SNDA 3ZZBA 1RTFB 3SU2A 2XYAA 4MPWA 1GBFA 3P8FA 1EPTA 1O5FH 1SHHB 1Z8JB 3SU3A 3SZNA 4KGAA 1LDTT 2Z3CA 1BMLA 1JXPA 2ZDNA 4ABJA 1IQIA 1O3OA 6GCHF 5BRRE 1WV7H 3F1SB 3HGPA 3URDA 1SGQE 1KXEA 4B1TA 1Y8TA 2BD5A 1D4PB 4DG4A 4Y8ZA 5EW1H 2FEQH 2ZHQH 5TCAA 1DT2A 3BTGE 4B2BA 3GCNA 2FOMB 1UTQA 1SGDE 1CGHA 3EA9A 1ZOMA 1C5OH 1XKBC 2B0FA 2XW9A 3KQEA 1EAWA 3L33A 1F5RA 1O5DH 2ZEBA 2A4QA 3UWJH 2J38A 1JOUB 2HRVA 3MFJA 4BAHB 1T4UH 3B9FH 1K28D 1FV9A 3QGNB 3MWIU 2QXGA 3LH1A 1TRYA 2P94A 1GMCG 4NZQA 2EI8A 1MBMA 1GI8B 4CRFA 1QRZA 1O3LA 4NFFA 1ZTLA 4KP0A 1G9IE 4ZUHA 1A3EH 1O3HA 4AFUA 1UK3A 2A5KA 4YOGA 3RXAA 3MMGA 2G4UA 3LGIA 5ESTE 1C2GA 1DDJA 4AB9A 4K60A 3RU4D 1L1NA 1O35A 2ZHEH 1F7ZA 2GCTB 3M35A 4FUGA 4AZ2B 2AFQB 3RXTA 8LPRA 1HLTH 1GJ5H 2BD4A 3SQHE 4AFZA 1UTLM 1TNJA 3SV8A 2A7JA 4WJG2 1QGFA 2ZGXH 2BQ6B 3FZDA 2OCVB 4IBLH 3MNBA 4GLYA 3E6PH 3KQDA 2PKAA 1W8BH 2B8OH 2JH0D 1FPCH 2F91A 4ABAA 2F9PA 1GBTA 3QUMP 3PO1C 1TPOA 3JZ2B 5CHAC 2EA3A 1OWEA 5C3NA 1MQ6A 1UCYE 3SUFA 1P2OA 2D8WA 1V2UT 3P70B 5F03A 3RXOA 1SL3A 1ORFA 1ZPCA 1CSOE 2WPLS 5DJ7A 5AFYH 4LK4A 1A0JA 2Y7ZA 2H9TH 1TX6A 1J14A 1RXPA 3FP7E 3V0XA 4K3JA 2ZA5A 3BIUH 3TH3H 1K9OE 3A85A 2ZECA 2XRCA 3TGIE 3E0NB 1PPGE 1O2PA 2G5NA 2Y80A 3FAOA 3O8CA 4INHA 3KL6A 2STBE 1KDQA 1S82A 2NWNA 4TPIZ 3MH4A 4K1TA 5J4QA 2BDBA 3A87A 3L6PA 3O8RA 2FWWA 3A8DA 2NU2E 1C5VA 2Z7FE 2BOHB 5EGMA 3RXQA 2FIRH 1DUEA 2BDGA 1SOZA 1QL7A 3TNSA 1GI2A 4X1RU 4Q80A 1GHVH 3ZVBA 4GCHF 1TPSA 4MNYA 4JK6A 3C27B 1HNEE 2H9HA 3PWBA 1P8VC 2IJOB 1L4DA 4MNVA 1GCTB 3UNRA 1ARBA 4BTTB 2GDDA 1CO7E 5E2PA 4ZAEA 2FOCA 3GISB 1EAUA 4DGJA 3ENSB 3ZZAA 1LKAA 1EJNA 5HGGA 1V6DA 1VJAU 2GT8A 1SVPA 2BVSH 1BRBE 2BY8X 1C5SA 1GPZA 1MTNC 3PMJA 4I7YH 4UD9H 2R0KA 5K7RA 2CJIA 1H8IH 2ZU1A 3GDVA 3B8JA 1DXWA 1YPKH 3RLWH 4X8UH 4A1VA 1VR1H 1C1TA 1C2FA 3RM2H 1J16A 2HVXA 3S7HB 3BTEE 2O8UA 3U1IB 1OOKB 5AF9H 1UCYH 4JMYA 1Y5AT 1HUTH 1NROH 3MNSA 3BG4C 2M5TA 3A7VA 1UO6A 5DP6A 5PTPA 1FN8A 2Y5GA 4ABBA 2QGRA 1ZPBA 4FUCA 3VB6A 1TONA 2XBVA 2YOLA 1O3GA 1Z8GA 4K5ZA 1CHGA 1O3FA 1BB0B 3T28A 2TGPZ 3K2UA 2GV6A 2JH5D 2BDYA 1MH0A 1SGNE 1HAVB 1WTGH 3M36A 4IW4E 1PPBH 3MYWA 1THSH 1C5YB 2RCEA 1SQTA 4OGYA 1O3BA 3EDXB 5FPTA 5JYIA 3KQBA 4LOYH 4J2YB 1TYNA 1GI0A 3STJA 1EATA 2D26C 2PKSB 1A5IA 2Q6FA 4THNH 1ZHMA 4FVBA 1GG6B 6CHAC 1O3MA 2O8LA 3MI4A 2P93A 2Y5HA 3RXRA 2OUAA 4JYVH 3SNAA 3A80A 1DLKB 3TJVA 3A7WA 1AUJA 1HGTH 4A6LA 3SU4A 5GPIB 2Z9IA 1HDTH 2IOTA 2ZFRH 3A88A 5JPMH 3A83A 3AW1A 4KELA 4X6PA 3HPTB 1C5MD 1UMAH 4FXGH 4AN7A 1JWTA 1MUEB 4Q7YA 4X8VH 2G81E 3ATKA 4ABDA 2