1F5LA

Urokinase plasminogen activator b-chain-amiloride complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of the urokinase type plasminogen activator variant beta(c)-uPAin complex with small molecule inhibitors open the way towards structure-based drug design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 60
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5lA01
3TIUA 1O2KA 5T6DA 4BTTB 3BTGE 4UE7H 2VVUA 2EC9H 1T8LA 1F5KU 1VJAU 3SQEE 1PQ8A 1D3QB 1OP0A 2JKHA 1C5OH 1GI7B 2ZGXH 3OX7U 3GDUA 1BHXB 3BTQE 2Z9IA 1C5MD 1MQ5A 3S9CA 4INKA 4CRBA 3GY8A 3O8RA 1FV9A 1HCGA 4IMQA 2I6QA 3A7ZA 3MNSA 1O2QA 2OLGA 3RXOA 1XVOA 4CHAB 2PV9B 5F8TA 1FMGA 5L2YH 2P3TB 4YT6H 4K8YA 2CXVA 1DWBH 1SMFE 2J95A 3QX5H 3UNSA 4DW2U 3M37A 3RXQA 6CHAC 1OWEA 3MO6A 2V0BA 1IQGA 5GCHG 4AYYB 1QRWA 1JMOH 1O3AA 1QBVH 1EZXC 1OPHB 1G3EA 2G5NA 3BEIB 4FUCA 2ANMH 2OC8A 3U9AH 3M5LA 5FX6A 4B76A 1HDTH 2A7CA 4UFFH 4K3JA 2A4OA 3MU4A 1XUKA 1XXFA 3F68H 3QGNB 2SNVA 2A1DB 2WV4A 5A09A 1MZAA 3FFGA 5EU8A 4AB9A 4Q7XA 3T62A 3VB7A 3KQDA 1ZRBA 4BAQB 1UCYK 1V2NT 2BLWA 2ZDNA 4K1TA 2EI7A 1GJ5H 3E0PB 2B8OH 4FUGA 4K1EA 2UWPA 1O39A 1C4Y2 1F0SA 5DP9A 3SV9A 3QDZB 1CQQA 4Z6AH 2Y5GA 1BBRE 1V2QT 2ZGJA 4OS4A 1EXFA 1BTWA 3BG4C 3M3SA 5A8YA 1Z71A 3KNXA 5J4QA 1GWAA 1HJAC 2BQ7B 2VU8E 3LGWA 4Q80A 1HAVB 1GI4A 1OOKB 3RMNH 4HGCA 1TNKA 2R2WU 3P8OA 4AFZA 2PHBA 4UD9H 2HGTH 1XUGA 4CR5A 3U8RH 4KTUA 2ZG0H 2QN5T 3QN7A 4Q7ZA 1PQ7A 3GY6A 1TBRH 2IJOB 1C5TA 1CT2E 1ELAA 5DP8A 4BXSA 5EXMA 4Y8ZA 2XC5A 1H1BA 3GY2A 3ZYDA 1C5XB 2BD9A 4ABGA 4A1XA 4JZFH 1HV7A 4GUXA 3PTBA 1EJNA 2BLOA 3UIRA 2G8TA 1F2SE 1HAZB 1F92A 2AMQA 4A1TA 4K1SA 4OS1A 3CP7A 4Y6DA 2H6MA 1KLJH 4Y11E 3PWCA 4GLYA 2WPHS 3TVJB 3ZZCA 1BCUH 3AAVA 2GGVB 3QZRA 5C67A 1FJSA 2ZU5A 4QT8C 3HGNA 3A83A 1W8BH 1YKTA 1QJ1B 1QA0A 1W11U 4KKDA 4AN7A 1SGFG 2GKVE 5A8XA 1C2DA 1N6XA 3RUOA 3BSQA 1ESAA 1WBGB 2FM2A 3VB3A 1UJ1A 2GT8A 1T7CA 3B9FH 7ESTE 3A82A 1FAKH 1EZUC 1BTUA 1WOFA 1WU1A 3GY5A 3OTJE 5J4SA 1TA2A 1HIAA 1DX5M 1KYNA 1KXCA 1SGCA 1CA8B 4MNWA 1GPZA 1WTHD 3H5CB 3UR6A 5AF9H 3LOXA 3GCNA 5DG6A 3MFJA 2DE8A 4AFUA 3LJJA 1BMAA 2A4GA 3UY9A 1QJ7B 4AGKA 2B5TB 3BF6H 1HNEE 1P9SA 1GJ7B 1T4VH 2O9QA 4BAKB 1WSSH 1C1UH 5DP4A 1GDUA 2XC0A 1L4DA 3RXRA 1QFKH 2B0FA 1K21H 3BEFB 3SU0A 3GYMA 4Y79A 8KME2 3RXMA 1M9UA 1A3BH 5G4BA 3EA9A 4WY3A 1EPTB 2GV7A 5GCHF 1AGJA 3HPTB 1O3LA 3K65B 3TITA 1K2I1 2BDHA 2OBOA 1BRAA 1J17T 1QQUA 1KXEA 2GCTC 3SNBA 3VB6A 1QBNA 5FBEA 3A8AA 1EQ9A 3TK5A 1ZJKA 3SJOA 1AVWA 1G32B 1ZPCA 2FLRH 4B74A 4JZDH 1S6FA 2G5VA 2HNTF 4WMEA 1LHEH 1SLXB 3SNEA 1C2FA 4MDSA 3SQHE 4GVUA 1NFUA 4DIIH 2O8MA 1DUAA 7GCHF 2OD3B 4K69A 4BTIB 1IQMA 3C1KA 5JPMH 4YOJA 1SGQE 1GBJA 1FNIA 3TJOA 2WPMS 1QGFA 3DA9B 1TB6H 2AS9A 1TNJA 2AERH 5L2ZH 2FYQA 2BDAA 1ELDE 2CGAA 5EODA 1CGJE 3KIDU 3U8OH 3S0NA 4GHTA 1K1OA 2XBYA 1SQAA 2FPZA 4DIHH 1P2QA 3LC5A 1ZRKA 1ORFA 2FESH 1UTJA 4XSKU 1QB9A 1ZLRA 3SUEA 3E90B 1O2RA 1RIWC 2GTBA 1OYTH 1TX8A 1KY9A 4ZHLU 5H4IB 4XOJA 2G52A 3SNCA 2J38A 3ZZ9A 2P94A 5JDUB 1UVPA 2V3OH 4TWYA 1O5EH 2FI4E 4JYVH 4WMFA 3E16B 2CMYA 2ZPQA 2Y7ZA 1FY1A 4FU9A 1HAPH 1C5PA 2GDDA 1OS8A 4WJG2 2ZU1A 6ESTA 1AU8A 2XWAA 1GCTC 4K5ZA 1YC0A 1A5IA 4O97A 2O8LA 4BAMB 1MQ6A 3RXUA 1HYLA 1WCZA 3S7KB 5HMAA 2GMTB 5JBBS 1O2SA 5LPRA 3M5MA 3P6ZB 3LGTA 1LKBA 2WPJS 4ABAA 1SHHB 4NIXA 2F83A 1HGTH 2FI5E 1IHTH 2H2ZA 3PYHA 3A86A 5ESTE 2G4UA 4I8HA 1XUIA 1Y5BT 5CHAB 2PWXA 3SU5A 5EQQA 2Z6BD 1K9OE 3I77A 3M7UA 2FOMB 2P3UB 3RXFA 3KF2A 4GSOA 1SL3A 2FX4A 2QCYA 1C2KA 1GBLA 5AFYH 3RLYH 5DP6A 1CHOG 1OWHA 3S7HB 2NWNA 3BG8A 5JYIA 2GP9B 3TK9A 3A84A 4WH8A 1HJ9A 3SGQE 2A31A 3UFAA 2ZU2A 5B6OA 1INCA 2VWNA 4D9QA 1THSH 2XC4A 4AFQA 1AO5A 3M61U 2Q1JA 1ZHRA 4X2XA 1NPMA 2WPIS 3UUZA 3NKKA 3QTVH 1BOQA 2BX4A 3ZZ8A 1AB9B 5JB9S 4MVNA 3DFLA 3RM2H 2ZTYA 3OY6U 5ABWA 4OGXA 2BQ6B 1F0RA 4INHA 2SGDE 1GBTA 3OU0A 2O8TA 1GMCG 3P8NA 1ELBA 1EOJA 3TJNA 3CENA 4LK4A 1YCPK 1O3PB 1TBZH 2Z9JA 2YNBA 3ZV9A 1CO7E 3EGKH 2EA3A 1BRCE 1PPZA 2OP9A 1NY22 1QIXB 1SG8B 1WTGH 1YPJH 2SFAA 1D6RA 3ENSB 5I25A 5DGJA 1O2WA 1IQEA 1K1JA 3P8FA 1MBMA 2TGDA 3TJUA 2G81E 1S84A 5FAHA 2Z7FE 2QIQA 3M36A 1CBWB 2V3HH 1TONA 1B7XB 4I33A 1TMUH 3BN9A 4SGBE 1C1TA 4CRGA 1SC8U 2DE9A 3A89A 3MH5A 2PKAA 1FY8E 3EQ0H 2RA3A 1RTKA 1RD3B 3P8GA 3UPEA 1C2HA 4E06H 5JB8S 4XBDA 1AKSA 3KQCA 3MI4A 5ETXA 4Y10E 2ODYB 1O5BB 1KLTA 5A2MH 5DJ7A 1UK2A 3NWUA 5LPFA 2UUFB 2QY0B 2OQ5A 3SU3A 2VNTA 1D9IA 3RXDA 3M5NA 2B9LA 1SR5C 3FAOA 4Y76A 4A5TS 3AASA 1FQ3A 1AFEH 4ABFA 4OS5A 1A46H 3U8TH 2GX4A 1T32A 3A80A 4LXBH 5DP5A 2BDBA 3K2UA 1MTNB 1O5DH 1DLKB 2G55A 4U32A 3SV8A 5T3HA 3LKWA 1GJ8B 4WVPE 2H1UA 4AB8A 1T8MA 1JIRA 2ZDLA 1NFYA 3GCHC 1GVZA 3P95A 5L6NH 3GCTF 1VITH 1NFXA 1IOEA 1TPPA 5TCAA 3ODDA 3F6UH 1UK4A 2FIRH 4B2BA 1MZDA 4ZKOU 2VVCA 5AHGH 1G2MA 1EAWA 1G30B 1GJBB 4D7FA 2FS9A 1PPFE 1GHBG 3E91A 4D9RA 4I7YH 1UTLM 1TGCA 2ZWLH 1AQ7A 5SGAE 3BIUH 3EA7A 3PO1C 3SJIA 1TE0A 1MU6B 2XBVA 4K8BA 1CT0E 1NC6A 1Z8JB 2UUJB 2ALVA 3SN8A 2WYGA 4DCDA 1Y3YA 3ZZ3A 1CGHA 3LC3A 1JBUH 4AGJA 5C20A 1UTPA 5EQSA 1V2WT 2ZEBA 4IMZA 4ZKRU 3AAUA 3SU4A 4OS7A 1LDTT 1MH0A 2TGPZ 2PGBB 2YOLA 2LNCA 2GZ7A 1MUEB 3QO6A 4NIWA 3ZZ4A 4Q2KA 1GBEA 1GVLA 2F3CE 4TY7A 2JETC 2BD8A 5EXNA 3SV6A 3PLKA 3PTNA 2FOBA 1TRNA 2ZZUH 1WQSA 3AVZA 3PLPA 2VIVA 1P2KA 2R2MB 2ZC9H 1EOLA 1V2ST 3JZ1B 4IW4E 2DUCA 3BTWE 1LHFH 1D6WA 5EOKA 2ZQ2A 1P2OA 4UFDH 2SGPE 3AW0A 1Y5UT 4MQAA 1P06A 2PR3A 2FODA 3TK6A 1O3KA 1B5GH 1QTFA 1YBWA 1O34A 2PFEA 2P59A 3E6PH 1Y8TA 3MNBA 1YPGH 2OQUA 1J16A 1GCDA 1TALA 1FY5A 3RXPA 1PJPA 1BT7A 2XBWA 3M35A 2OTVA 1O5CB 1EP5A 1UTNA 4FU7A 3BEUA 1EJAA 1LHGH 2EEKA 3K6YA 3ZVBA 4X8TH 2C8WB 2ZPSA 2ZCHP 1BMLA 1LHCH 2ALPA 4TPIZ 5E8EH 5FHTA 3TLOA 8ESTE 1SGNE 1S83A 4X1QU 1TRYA 2Q6GA 1EB2A 2HRVA 5F03A 3PV4A 1XUFA 1XX9A 4ZAEA 3BTME 5E2PA 5LPEA 2D1JA 1FY4A 1LMWB 1DSUA 1ANBA 2J92A 4ZH8A 1WAYB 2AH4X 1GDNA 1V2UT 1SGIB 4E7NA 1GI0A 3QUMP 4U2WA 1DXPA 4BOHA 2BD5A 2R0KA 4CRDA 1BQYA 3P70B 1O2HA 2ESTE 3MU0A 2W3IA 4ZUHA 1W12U 1LVBA 6CHAB 4X0WU 3LGIA 3VPKA 4JZIA 1DSTA 4ZKSU 2BDGA 2FOFA 1GGDC 2FI3E 2SGEE 4O3UA 1HJ8A 3RC6A 1SGYE 1HLTH 3O8CA 1MD8A 4FUHA 1DPOA 1HIAB 1LPGB 4NG9H 3QLPH 2OC1A 3SJ8A 2G00A 1E34B 1P2IA 1CSOE 1HB0B 2K1QA 1ELCA 1GHWH 1BMNH 2QXJA 5PTPA 2BM2A 5JBAS 1C2EA 5GPIB 1O2IA 4NIYA 4KELA 3T25A 1E38B 1YPMH 4R8TB 4X1RU 4FUBA 4XFQA 2VIQA 4IN2A 2AMDA 2GDEH 4RN6A 1C1QA 1HFDA 2YNAA 3SNAA 4F4OC 1L4ZA 1UTOA 1ZTLA 3BG4B 3CS7A 3NXPA 5C1XA 1NN6A 4AG1A 1GJ4H 1P10A 2WPLS 2ZFSA 1HJAB 1RFNA 1NO9H 4B73A 4HZHA 5FPSA 1QNJA 1ACBE 1Q31A 1CA0C 1G37A 3NPSA 2ZFFH 1H9LB 1OWDA 1HAIH 3GDVA 1RGQA 1W13U 2A32A 1GMDF 1MTUA 2AGIX 1BTXA 3QTOH 1GI2A 1ZYOA 2ZF0H 1VCWA 3IITA 7LPRA 1TLDA 2QV1A 2W3KA 3NCLA 2ZNKH 5FXLA 2BD2A 3HATH 1NZQH 2FP7B 2BTCE 4ISHH 3T27A 4B71A 1TIOA 2F9PA 3N7OA 1DOJA 1GJAB 3TNSA 4D76A 3A7YA 3SGAE 3LU9B 1S0RA 4F49A 1GBDA 1PQ5A 1P3CA 1SLVB 1O2TA 1SGPE 3LONA 3A7TA 2F91A 1EAUA 2GZ9A 1CHGA 1FLEE 1J9CH 1ZPZA 2P3FH 5FPTA 4AZ2B 4J1YA 1IQKA 2RDLA 4CH2B 1AZZA 4MPXA 1DWDH 1IQHA 1BTHH 1H4WA 3KL6A 1KDQB 2Y81A 1DANH 3MO9A 1N8OC 3GY4A 2XBXA 1V2OT 2C90B 2CN0H 3LGVA 1ID5H 2OC0A 2C3SA 1C1VH 3A81A 3RXVA 4CR9A 2J4IA 2AYWA 1MKXK 1AN1E 2AGEX 1O37A 2VVVA 1ZPBA 3IG6B 1YYY1 1BJUA 4NGAH 4X2YA 1MTSA 4I32A 1FIWA 2BXUH 5GWZA 1ZGVA 1LVMA 1YPEH 1QA7A 1QQ4A 1G3DA 2BDYA 2ZDAH 4JYUH 2Y6TA 1GJCB 4H42U 1PPEE 2BVXH 3LGYA 2A5AA 1AE5A 5BPEA 1C5QA 4FUEA 1IQLA 5K7RA 2ZTZA 2QXHA 4VGCC 4KP0A 1TABE 1B0FA 1JOUB 1UCYH 1BBRK 1TAWA 3B23B 2G51A 1TQ0B 3R0FA 1VJ9U 2VB0A 2GCTB 1LVYA 3PM3A 1BITA 1TFXA 1RS0A 3SORA 1QCPA 2BY6X 1P03A 5C5OA 2ZFQH 4A6LA 2CF9H 1Z8IB 1ZOMA 1O2JA 5HGGA 1L1NA 2QGRA 1SGRE 1G9IE 2BOKA 1GDQA 1XMNB 5EPYA 2KAIA 2V6NA 4ISOA 1ESTA 1O3IA 3KEEA 3BV9B 3JZ2B 2BX3A 4O3TA 3SV7A 3T29A 2ANYA 4YLQH 1RTFB 3RC5A 2STBE 1F0UA 1Y3XA 3PMBB 1GBKA 4FVBA 3VFEA 1OP8A 2PUXB 3DT0H 2VIPA 3VB5A 1A0HB 1KXFA 4YO9A 4X8SH 1S82A 2A7HA 2VWOA 1Z7KA 3T26A 1V2JT 4DGJA 1A1RA 1DY8A 2XRCA 3ZV8A 3ZZ5A 5E0JA 4B75A 2W7UA 2PKSC 3D62A 1O2XA 2ZGHA 2Y5FA 4WMDA 4GCHG 1SVPA 2SGAA 1GBBA 2ZGBH 1FY3A 3NUMA 3TGJE 1VZQH 3MMGA 1FAXA 1B0EA 1GJDB 1RIWB 3ATMA 1TGSZ 2Y5HA 2GCHG 2TRMA 3RXGA 4ISLA 1YGCH 4MLFB 4K2YA 3MU8A 4AORA 4B1TA 2G4TA 2BDCA 1CT4E 1C2LA 1O2YA 1OWKA 4GPGA 2ZDMA 2ASUB 5F8ZA 1MU8B 1Z6EA 1TWXB 1MKXH 1MKWK 1UTKA 1TGTA 5IDKA 4OS2A 1TNHA 1GCTB 3K6ZA 3Q77A 2A4RA 1C9TA 3KN2A 5EG4A 1JRTA 2THFB 1C4U2 5HYOA 2AGGX 3S9AA 2RG3A 2XNIA 1QJ6B 3D23A 2VGCC 3ATIA 5ESBA 5DPAA 4RKJB 3PB1E 1AVXA 1ELFA 1ZTJA 2BY5X 5TJXA 1C1WH 3RXEA 1D3DB 3PMHB 2PKAB 3G01A 4XE4A 1OXGA 2F9VA 1SFQB 3MOCA 1AKSB 4X6MA 1S85A 4JK5A 5DP3A 4UONA 2ZI2H 3URCA 5FX5A 3RU4D 2QA9E 2FEQH 1C9PA 2RA0A 3BTTE 4AG2A 4ABIA 3PROA 4X2VA 3FP7E 3RMLH 2SGFE 2F9OA 2WUCA 3UQOA 1PYTD 4MNVA 5TCCA 1YM0A 2NU0E 4AYVB 2ZP0H 1FN8A 2CF8H 1K1NA 1Z1JA 4DURA 1Y3UA 1BZXE 2FTMA 2PTNA 1Z6JH 1ETTH 1C1PA 2IOTA 4DY7B 2ODPA 3ZVAA 2ZFPH 2JH5D 3BIVH 3PWBA 2A7JA 3EDXB 2Y82A 5EXLA 5HXFA 2H9HA 3NZIA 2VIDA 2ZFTA 2XTTB 1GBIA 3TPIZ 1ELGA 4ABJA 2HWLB 4X1NU 3F9HA 1Z8RA 1QB1A 2Q6FA 3VGCC 1O3HA 2AIQA 2UWOA 4ZHMU 4DOQA 1HAGE 5C3NA 2FOEA 3SU2A 8LPRA 1O3JA 3UOUA 1UVUH 1PFXC 1FI8A 5E0GA 1BHXF 4Y71A 1S0QA 3SW2B 2FXRA 2F9BH 1A7SA 5HM2A 1NRQH 4X1SU 1TGBA 1HBTH 2AFQB 3F9GA 3HK3B 3BTEE 1FN6A 2HOBA 2CV3A 2PTCE 1BIOA 5C5NA 1DICA 1P04A 5LGOA 1TNIA 2BXTH 3U1IB 3PLBA 3NK8A 2CHAC 1P12E 1GHVH 1TOMH 2TBSA 3SU1A 3SUFA 3U1JB 1EAXA 1LPZB 2NU2E 1ESBA 1GMHG 1NU9A 1SLUB 2ZFRH 1K28D 2BB4A 3P92A 4ZROA 3SJ9A 1O38A 1ARCA 4INLA 2QAAA 2HPPH 2ILNA 2PUQH 2HLCA 1TNGA 4BNRA 4CRAA 1NESE 1O35A 2XCFA 3UNQA 3LPRA 4WWYA 1N6YA 1D3PB 2VJ1A 1HXFH 4MG3A 1EJMA 5DKMA 1G3BA 1JWTA 4M7GA 4UFGH 4CRCA 5I46H 4NZQA 3LH3A 1HPGA 4R0IA 4J2YB 3MH4A 1GG6C 2I6SA 1QHRB 4FUIA 5T6GA 4H4FA 2BYAX 3GISB 1ANCA 1TRMA 4O03A 1DS2E 3M7TA 2WV5A 3FVFB 3RXHA 4A92A 1V2MT 2H9EH 1V6DA 3GCHB 1LQEA 1O31A 1DDJA 2FDAA 2PSYA 3TH4H 1ETSH 4SGAE 1EB1H 1W10U 4X6PA 3RXSA 2ULLA 1BTPA 1OWJA 1AWHB 1OYQA 1Q2WA 4NWLA 2BY8X 4XBCA 1ETRH 2D8WA 1GI1A 1MTWA 2ODQA 1ZSJA 2HNTC 3A87A 1ELEE 1OP2A 3H7TA 3BTDE 2AIPA 2J2UA 3ZYEA 2Z9KA 3V3MA 1VCQA 1G2LA 5GIBA 3PO1B 5EGMA 1KTTB 1AFQC 2OINA 2SNWA 3L3TA 1A5GH 2OCVB 1GJ9B 1CHOF 1DITH 1BB0B 2PSXA 1P57B 1QRXA 4UFEH 1YCPH 2WUBA 4CREA 2P8OC 4MNXA 4IC6A 3KQEA 1C5YB 3ZVEA 1G36A 1IQFA 2ZHQH 3E3TA 4X6NA 2JETB 3Q3YA 5DK1A 1V2LT 2A5IA 1HAHH 4THNH 5BRRE 3BTHE 1ZMNA 2STAE 3M3TA 3FZZA 1GBCA 1Y5AT 2EI8A 4B2CA 1X7AC 2BQWB 2P93A 2ZHWH 1UVSH 3M5OA 1P2MA 3Q3XA 1ZR0A 2Q6DA 1EZSC 1GI8B 2Y80A 3OYPA 4KTSA 4XBBA 3KHVA 5EPNA 5DO4H 1P02A 1D4PB 2P95A 1P11E 2P16A 2VH6A 4ISNA 1GMCF 4NCYA 3UREA 1WUNH 5FBIA 2W7SA 3UOPA 3A8BA 4OS6A 1C4V2 1S5SA 1PPCE 4NA8A 1H8IH 1QL8A 3BTKE 4JYTA 2ZCLP 1K1IA 5HM9A 3QK1A 4YLUA 4WXIA 4NSVA 2ZKSA 3A7XA 2BMGB 4B2AA 4IBLH 1AI8H 3K9XB 1OKXA 1P09A 3M7QA 3ZZDA 2NU3E 3TGIE 1DM4B 1O5FH 1F7ZA 4LOYH 1YLCA 3RXKA 1O5AB 3RP2A 4MPWA 3ATWA 5JBCS 1O32A 4X2WA 2GD4B 1TPSA 2HNTE 1BTZA 1ANEA 1YPKH 1TPAE 4OGYA 1LO6A 2IN2A 3V7TA 5L30H 1BRUP 1F5RA 2BOHB 3Q3KA 2XW9A 1YPHC 1RTLA 1ZJDA 4BAOB 2TPIZ 4TYDA 1Y3WA 3SZNA 1JRSA 1GGDB 1ABJH 3DFJA 2BLVA 4MNYA 1AVGH 4IGDA 1GBHA 2O8WA 4Y0ZE 2BHGA 1O2GH 1DLEA 1C5SA 2FYRA 1AUTC 2FZZA 2OC7A 3UQVA 3SGBE 3O8DA 2GVFA 2F9NA 1XXDA 2A0QB 4FUJA 1Q3XA 1O2VA 4NFFA 1O3CA 1QR3E 4DG4A 2NU4E 1YP9A 1NT1A 1A61H 1NFWA 3TU7H 4JZ1A 1FPHH 3A8DA 2OBQA 4NFEA 1O3GA 2TIOA 3V0XA 2A45B 5E0HA 1AE8H 4CHAC 1ANDA 4ASHA 1GL1A 1KXDA 4DT7B 1GHBF 2ZU4A 1GBMA 3UWIA 1T8NA 2FOAA 4MPUA 2FX6A 2Z9LA 2NU1E 1QRZA 1CA0B 3FP8E 5A0AE 5GDSH 1THRH 1O2PA 4LZ1H 2BD4A 3F1SB 1GI3A 3I29A 1LKAA 1UMAH 3QZQA 1O3NA 2FO9A 3IWMA 1SGFA 1W7GH 1ZZZA 3WY8A 3VEQB 4FUDA 1O3OA 3MHWU 1P0SH 3LH1A 2C8YB 3TH3H 2KAIB 4A1VA 4AFSA 4FU8A 4U30A 2HALA 4BAHB 1GI5A 1N1LA 4WXVA 2R9PA 3FANA 1J15A 2ZDKA 7GCHG 1A4WH 1YF4A 1RJXB 3S9BA 2A4QA 3GY3A 2ZGCA 1BDAA 1YLDA 3D65E 3DD2H 5K0HA 1DXWA 1UHBA 3MU1A 1PYTC 2ZHEH 3U69H 4CBOA 2QXGA 1SQOA 3ZZ7A 1HAYB 1YPHE 3F9EA 1P9UA 1YPLH 1GHZA 5FPYA 1EX3A 3T2NA 3A7WA 2H5DA 3QWCH 1N8OB 1VGCB 1IQJA 1BUIA 2J94A 2W5EA 4X8UH 5EW1H 2V35A 1TOCB 3W95A 1KIGH 3HK6B 4CBNA 4I8KA 1O30A 4I8GA 1TBQH 1DE7H 1J14A 1XKBC 3VXFH 1VGCC 2VIWA 1O0DH 2C8ZB 3A85A 3H7OA 2ZPRA 2FLBH 4Z0KA 1EP6A 1FXYA 4GHQA 1P3EA 1W7XH 2R0LA 1NS3A 4E7RG 5IYTA 1PQAA 1AUJA 1AHTH 4JZEH 3FZDA 2ZU3A 4VGCB 3RM0H 3SJKA 2OXSA 3FP6E 2A2XH 3RC4A 1FPCH 1EAIA 4Q7YA 3ZZAA 3STIA 3STJA 3GYLB 1SGEE 1E36B 4AX9H 1Z1IA 4DVAU 4RKOB 3UTUH 1S6HA 1NU7B 3RXCA 1QL9A 2ZA5A 1SBWA 2HPQH 4X6OA 3ODFA 4I31A 4NSYA 1MD7A 1TMBH 1MAYA 2ZIQH 3A8CA 2FS8A 3A88A 3W94A 2C8XB 2BD3A 1C1OA 4ZHAA 4WH6A 1Z8GA 3SBKA 1DVAH 1A0LA 3HGPA 2FWWA 3RU4E 1THPB 4DJZB 1Y59T 1PPHE 3RDZA 1LTOA 3SOSA 4KTCA 1CVWH 1EZQA 2EI6A 2VH0A 5AVDA 1K1MA 3RXTA 1KXBA 2F9UA 3AW1A 2O8UA 2BLQA 3HKJB 1C2MA 3EE0B 2QYIA 1W0ZU 1ZMJA 3ATLA 4NZLA 2PKSB 4U01A 9LPRA 1QL7A 1SHYA 1CGIE 2Z9GA 1O3DA 1EPTC 1UO6A 1GI9B 3U98H 2BDIA 1HAVA 2R3YA 1WV7H 1H8DH 3C27B 3MNXA 3KCGH 3VXEH 4BXWA 5AFZH 1LCYA 5GJ4B 1ZHMA 3SO3A 5EW2H 1AY6H 1L1GA 1LQDB 1O3EA 1TPOA 2TGTA 3SNDA 1LHDH 3E1XB 3KQBA 3ELAH 1ZSKA 3L33A 4O9VA 3OSYA 1O5GH 4YT7H 1XUHA 5F8XA 2UUKB 3ZVFA 1Y3VA 4XDEA 1ELTA 2FOHA 1BRBE 2ZHFH 1JIMA 1P05A 1ABIH 4ZKNU 3UR9A 3LIWA 2VGCB 5CE1A 3E0NB 1JXPA 5FCRA 1SLWB 3QGJA 4H6TA 3SUDA 4WF8A 2JH0D 4UEHH 1O2ZA 2FOGA 1KDQA 3LDXH 3V13A 2B7DH 2XWBI 1CU1A 1V2PT 3D49H 3HKIB 4NA7A 2ANWA 1NRSH 1P01A 1HXEH 4NIVA 1ZHPA 1IAUA 1BBRH 2J34A 3SHAH 5LH8A 5EQRA 1GHAG 1YCPM 1E35B 1RXPA 2H9TH 4YTAA 4JK6A 1EUFA 2GZ8A 3MH6A 4TPYA 2Z94A 1TYNA 1C5RA 4JCNA 1VR1H 1GJ6A 4TWWA 4Y7AA 1HAXB 4HTCH 1AD8H 4ABHA 3MO3A 1L0ZA 1E0FD 1DWCH 1O2UA 1DFPA 1ZSLA 2BD7A 2JH6D 2D26C 3DUXH 2M5TA 2BVSH 2W26A 4NWKA 3RXLA 4ZMAH 1C2JA 1XVMA 2ZQ1A 2GMTC 3GCTG 4GAWA 1W2KH 2C4FH 3TH2H 2FOCA 3EAJA 1GI6A 3GY7A 5C2ZA 1GVKB 1ELVA 3S69A 2XCNA 2J9NA 3GICB 1SB1H 1AIXH 1EPTA 3EYDA 1GBAA 3MNCA 3GCOA 4ZXYH 1H9IE 3VGCB 5CHAC 3ZVGA 1W14U 1T31A 4MTBA 5A0CA 1A2CH 4HFPB 1C1MA 3Q00A 7KMEH 2Z3EA 3RMOH 2Y7XA 4BANB 2XYAA 1GHXH 1UVTH 1TNLA 1VITG 4IS5A 3UWJH 4D8NA 1SGDE 4Y8XA 1O2MA 1BJVA 1OX1A 3EA8A 3T5FH 1O3BA 6GCHG 3ZVDA 1SSXA 1A3EH 1XM1A 2PGQB 3P17H 8GCHG 4K60A 2ZO3H 2H5CA 2SGQE 1PPBH 3SI4H 3F9FA 1IQIA 3E8LA 4Y7BA 3PMJA 3GOVB 1F0TA 2R3UA 1GHYH 2CHAB 1KSNA 1MKWH 1D3TB 1XKAC 3R3GB 1BTYA 4ESTE 1A5HA 1AB9C 3LJOA 3RLWH 1W0YH 1VCPA 1NRNH 4UDWH 3RXIA 1AMHA 1C5WB 2ZCKP 3ATKA 4YZUA 9ESTA 1RRKA 5C1YA 1L1JA 1DT2A 1P2NA 3I78A 4GCHF 1O33A 2Z3DA 1L2EA 1K22H 4ABDA 1O2NA 1HRTH 5DP7A 4YOGA 2BZ6H 1QURH 1LVOA 2GCHF 3SU6A 2FMJA 1NRPH 1OSSA 3URDA 1V2TT 3CS0A 1SGTA 1FIZA 3T28A 2LPRA 3M3VA 1C5VA 1TMTH 1GG6B 1U6QA 1SQTA 1NRRH 1HUTH 3LT3A 1ZTKA 2HVXA 2VINA 4ISIH 4AOQA 3TGKE 1GBFA 2QC2A 4YOIA 1EATA 4H6SB 2ZDVH 1V2RT 1ZMLA 4X8VH 1S81A 4HI3A 1O36A 1ZGIA 1CBWC 3V12A 1KXAA 1QY6A 4E05H 2GT7A 5A8ZA 1C1RA 2UWLA 2PLXA 3A7VA 1IHSH 1IQNA 3BTFE 1EASA 1OWIA 1A0JA 4TY6A 4NA9H 4IN1A 3SV2H 2Z3CA 1UVOA 1C1SA 2VIOA 1V3XA 2AEIH 4YM9A 1GHAF 2WINI 2WPKS 3RXAA 4CRFA 1C2IA 1BA8B 6LPRA 4KGAA 2D2DA 2WYJA 5CMXH 1O2OA 1AWFH 1O3MA 5E2OA 1NM6A 1TGNA 2VWLA 4IC5A 1T4UH 1TA6A 1G3CA 1C2GA 3LGUA 1AFQB 3ZZBA 1E37B 1DUEA 2BZAA 2ZHDA 1FONA 2QXIA 2AMPA 1F5LA 5FCKA 3MH7A 1TX7A 1TX6A 3L6PA 2A2QH 4I8JA 3SUGA 2P8OB 4CH8B 4PROA 1MTNC 1KLIH 2XXLA 3KGPA 3RMMH 1MCVA 3UNRA 1UTQA 3ITIA 4FVDA 4JMYA 2BVRH 3B8JA 3TNTA 1PPGE 1MTVA 5JBTA 4LZ4B 4RSPA 2PW8H 3Q76A 5F6MA 1MAXA 1SPJA 2IPHA 2C93B 1NTPA 1DWEH 1AZ8A 1CE5A 1FDPA 2CJIA 3ZVCA 4BTUB 4ZXXH 1MCTA 5GXPA 3DHKH 1P2JA 1C5NH 4D7GA 3VB4A 1C1NA 1SOTA 3MWIU 1VITF 3SHCH 2A5KA 3RXBA 3O8BA 4ABBA 3OY5U 1P8VC 1K1LA 2BY7X 3MYWA 2FTLE 1WYKA 1MBQA 1TQ7B 1SFIA 1FZZA 5C1UA 6GCHF 2OUAA 4X1PU 8GCHF 4Y8YA 1C5ZB 2QF3A 3RXJA 1O2LA 1C5UA 1GMDG 5A0BA 1FUJA 3PMAB 1V2KT 3ESTA 1BMMH 1EKBB 1C5LH 4FXGH 3SI3H 1QBOA 5T6FA 3GDSA 2ANKH 1J8AA 1SOZA 3TJVA 1UK3A 2UUYA 1NROH 1SI5H 1ARBA 2QF0A 2RCEA 4FUFA 4MPVA 1WQVH 1QB6A 3MTYA 1HAOH 4ABEA 2BY9X 1K1PA 1MMJN 1GMHF 1H9HE 1V2VT 2ZECA 1DY9A 2VWMA 2TGAA 3MU5A 4Y0YE 1UCYE 1GL0E 1KTSB 1UTMA 1UHBB 1W3CA 1T8OA 2GV6A 1LPKB 2ZTXA 4YESB 3RU4T 4A7IB 4I8LA 1XUJA 1O3FA 3ZZ6A
chains in the Genus database with same CATH superfamily
3TIUA 1O2KA 5T6DA 2JDID 4BTTB 3BTGE 4UE7H 2VVUA 2EC9H 1T8LA 1F5KU 1VJAU 3SQEE 1PQ8A 1D3QB 1OP0A 2JKHA 1C5OH 1GI7B 2KCYA 2ZGXH 3OX7U 3GDUA 1BHXB 3BTQE 5KECA 2Z9IA 1C5MD 1MQ5A 3S9CA 4INKA 4CRBA 3GY8A 3O8RA 1FV9A 1HCGA 4IMQA 2I6QA 3A7ZA 3MNSA 1O2QA 2VBCA 2OLGA 3RXOA 1XVOA 4CHAB 2PV9B 5F8TA 1FMGA 5L2YH 2P3TB 4YT6H 4K8YA 2CXVA 1DWBH 1SMFE 2J95A 3QX5H 5EJZA 3UNSA 4DW2U 3M37A 3RXQA 6CHAC 1OWEA 3MO6A 2V0BA 1IQGA 5GCHG 4AYYB 1QRWA 1JMOH 1O3AA 1QBVH 1EZXC 1OPHB 1YY3A 1G3EA 2G5NA 3BEIB 4FUCA 2ANMH 2OC8A 3U9AH 1YLNA 3M5LA 5FX6A 4B76A 1HDTH 2A7CA 4UFFH 4K3JA 2A4OA 3MU4A 1XUKA 1XXFA 3F68H 3QGNB 2SNVA 2A1DB 2WV4A 2KCAA 2L6OA 5A09A 1MZAA 2KZ4A 3FFGA 5EU8A 4AB9A 4AC9A 4Q7XA 3T62A 3VB7A 3KQDA 3N99A 1ZRBA 4BAQB 1UCYK 1V2NT 2BLWA 2ZDNA 4K1TA 2EI7A 1GJ5H 3E0PB 2B8OH 2XNDD 3DCLA 4FUGA 4K1EA 2UWPA 1O39A 4B6FA 1C4Y2 3FOAA 1F0SA 5DP9A 3SV9A 3QDZB 1CQQA 4Z6AH 2Y5GA 1BBRE 1V2QT 2ZGJA 4OS4A 1EXFA 1BTWA 3BG4C 3M3SA 5A8YA 1Z71A 3F0OA 3KNXA 5J4QA 1GWAA 1HJAC 2BQ7B 2VU8E 3LGWA 4Q80A 1HAVB 1GI4A 1OOKB 3RMNH 4HGCA 1TNKA 2R2WU 3P8OA 4AFZA 2PHBA 4UD9H 2HGTH 1XUGA 4CR5A 3U8RH 4KTUA 2ZG0H 2QN5T 3QN7A 4Q7ZA 1PQ7A 3GY6A 2JJ2D 1TBRH 2IJOB 1C5TA 1CT2E 1ELAA 5DP8A 4BXSA 5EXMA 4Y8ZA 2XC5A 1H1BA 3GY2A 3ZYDA 1C5XB 2BD9A 4ABGA 4A1XA 4JZFH 1HV7A 4GUXA 3PTBA 1NBMD 1EJNA 2BLOA 3UIRA 2G8TA 1F2SE 1HAZB 2XOKD 1F92A 2AMQA 4A1TA 4K1SA 4OS1A 3CP7A 4Y6DA 2H6MA 1KLJH 4Y11E 3PWCA 4GLYA 2WPHS 3TVJB 3ZZCA 1BCUH 3AAVA 2GGVB 3QZRA 5C67A 1FJSA 2ZU5A 4QT8C 3WWBA 3HGNA 3A83A 1W8BH 1YKTA 1QJ1B 1QA0A 1W11U 4KKDA 4AN7A 1SGFG 2GKVE 5A8XA 1C2DA 1N6XA 3RUOA 3BSQA 1ESAA 1WBGB 2FM2A 3VB3A 1UJ1A 2GT8A 1T7CA 3B9FH 7ESTE 3A82A 1FAKH 1EZUC 5DSFA 1BTUA 1WOFA 1WU1A 3GY5A 3OTJE 5J4SA 1TA2A 1HIAA 1DX5M 1KYNA 1KXCA 1SGCA 1CA8B 4MNWA 3WWFA 1GPZA 1WTHD 2V7QD 4HG6A 3H5CB 3UR6A 5AF9H 3LOXA 3GCNA 5DG6A 3MFJA 2DE8A 4AFUA 3LJJA 1BMAA 2A4GA 3UY9A 1QJ7B 3H09A 4AGKA 2B5TB 3BF6H 1HNEE 1P9SA 1GJ7B 1T4VH 2O9QA 4BAKB 1WSSH 1C1UH 5DP4A 1GDUA 2XC0A 3ZIAD 1L4DA 3RXRA 1QFKH 2B0FA 1K21H 3BEFB 3SU0A 3GYMA 4Y79A 8KME2 3RXMA 1M9UA 1A3BH 5G4BA 3EA9A 4WY3A 1EPTB 2GV7A 5FL7D 5GCHF 1AGJA 3F2GA 1O3LA 3HPTB 3K65B 3TITA 1K2I1 2LP6A 3DSOA 2BDHA 2OBOA 1BRAA 1J17T 1QQUA 1KXEA 2GCTC 3SNBA 3VB6A 1QBNA 5FBEA 3A8AA 1EQ9A 3TK5A 1ZJKA 3SJOA 1AVWA 1G32B 1ZPCA 2FLRH 4B74A 4JZDH 1S6FA 2G5VA 2HNTF 4WMEA 1K0HA 1LHEH 1SLXB 3SNEA 1C2FA 4MDSA 3SQHE 4GVUA 1NFUA 1VKYA 4DIIH 2O8MA 1DUAA 7GCHF 2OD3B 4K69A 4BTIB 1IQMA 3C1KA 5JPMH 4YOJA 1SGQE 5HIZA 1GBJA 1FNIA 3TJOA 2WPMS 3KYFA 1QGFA 3DA9B 1TB6H 2AS9A 1TNJA 2AERH 5L2ZH 2FYQA 5T1VA 2BDAA 1ELDE 2CGAA 5EODA 1CGJE 2LELA 3FKSD 3KIDU 3U8OH 3S0NA 4GHTA 1K1OA 2XBYA 1SQAA 2FPZA 4DIHH 1P2QA 3LC5A 1ZRKA 1ORFA 2FESH 1UTJA 4XSKU 1QB9A 1ZLRA 3SUEA 3E90B 1O2RA 1RIWC 2GTBA 4DT4A 1OYTH 1TX8A 1KY9A 4ZHLU 5H4IB 1W0KD 4XOJA 2G52A 3SNCA 2J38A 3ZZ9A 2P94A 5JDUB 1UVPA 2V3OH 4TWYA 2JJ1D 1O5EH 2FI4E 4JYVH 4WMFA 3E16B 2CMYA 2ZPQA 2Y7ZA 1FY1A 4FU9A 1HAPH 1C5PA 2GDDA 1OS8A 4WJG2 2ZU1A 6ESTA 1AU8A 2XWAA 1GCTC 4K5ZA 1YC0A 1A5IA 4O97A 2O8LA 4BAMB 3FO8D 1MQ6A 3RXUA 1HYLA 1WCZA 3S7KB 5HMAA 2GMTB 5JBBS 1O2SA 5LPRA 3M5MA 3P6ZB 3LGTA 1LKBA 2WPJS 4ABAA 1SHHB 4NIXA 2F83A 1HGTH 2FI5E 1IHTH 2H2ZA 3PYHA 3A86A 3FN8A 5ESTE 2G4UA 4I8HA 1XUIA 1Y5BT 5CHAB 2PWXA 3SU5A 5EQQA 2Z6BD 1K9OE 3I77A 3M7UA 3KYGA 2FOMB 2P3UB 3RXFA 3KF2A 4GSOA 1SL3A 2FX4A 2QCYA 1C2KA 1GBLA 5AFYH 3RLYH 5DP6A 1CHOG 1OWHA 3S7HB 2NWNA 3BG8A 5JYIA 2GP9B 3TK9A 3A84A 4WH8A 3N7EA 1HJ9A 3SGQE 2A31A 3UFAA 2ZU2A 5B6OA 1INCA 2VWNA 4D9QA 1THSH 2XC4A 4AFQA 1AO5A 3M61U 3OTPA 2Q1JA 1ZHRA 4X2XA 1NPMA 2WPIS 3UUZA 3NKKA 3QTVH 1BOQA 2BX4A 3ZZ8A 2WHXA 1AB9B 5JB9S 4MVNA 3DFLA 3RM2H 2ZTYA 3OY6U 5ABWA 4OGXA 2WSSD 2BQ6B 1F0RA 4INHA 2SGDE 1GBTA 3OU0A 2O8TA 1GMCG 3P8NA 1ELBA 1EOJA 3TJNA 3CENA 4LK4A 1YCPK 1O3PB 1TBZH 2Z9JA 2YNBA 3ZV9A 1CO7E 3EGKH 2EA3A 1BRCE 1PPZA 1NY22 1QIXB 2OP9A 1SG8B 1WTGH 1YPJH 2SFAA 1D6RA 3ENSB 5I25A 5DGJA 1O2WA 1IQEA 1K1JA 3P8FA 1MBMA 2TGDA 3TJUA 3KQ5A 2G81E 1S84A 5FAHA 2Z7FE 2QIQA 3M36A 1CBWB 2V3HH 1TONA 1B7XB 4I33A 1TMUH 3BN9A 4SGBE 1C1TA 4CRGA 1SC8U 2DE9A 3A89A 3MH5A 2PKAA 1FY8E 3EQ0H 2RA3A 1RTKA 1RD3B 3P8GA 3UPEA 1C2HA 4E06H 5JB8S 4XBDA 1AKSA 3KQCA 3MI4A 5ETXA 4Y10E 2ODYB 1O5BB 1KLTA 5A2MH 5DJ7A 1UK2A 3NWUA 5LPFA 2UUFB 2QY0B 2OQ5A 3SU3A 2VNTA 1D9IA 3RXDA 3M5NA 2B9LA 1BMFD 1SR5C 3FAOA 4Y76A 4A5TS 3AASA 1FQ3A 1AFEH 4ABFA 4OS5A 1A46H 4P00A 3U8TH 2GX4A 1T32A 3A80A 4LXBH 5DP5A 2BDBA 3K2UA 1MTNB 1O5DH 1DLKB 2G55A 4U32A 3SV8A 5T3HA 3LKWA 1GJ8B 1WDIA 4WVPE 2H1UA 4AB8A 1T8MA 1JIRA 2EQNA 2ZDLA 1NFYA 3GCHC 1GVZA 3P95A 5L6NH 3GCTF 1VITH 3SZEA 1NFXA 1IOEA 1TPPA 5TCAA 3ODDA 3F6UH 1UK4A 2FIRH 4B2BA 1MZDA 4ZKOU 2VVCA 5AHGH 1G2MA 1EAWA 1G30B 1GJBB 4D7FA 2FS9A 2IJD1 1H8HD 1PPFE 1GHBG 3E91A 4D9RA 4I7YH 1UTLM 1TGCA 2ZWLH 1AQ7A 3F2HA 5SGAE 3BIUH 3EA7A 3PO1C 3SJIA 1TE0A 1MU6B 2XBVA 4K8BA 1CT0E 1NC6A 1Z8JB 2UUJB 2ALVA 3SN8A 2WYGA 4DCDA 1Y3YA 3ZZ3A 1CGHA 3LC3A 1JBUH 4AGJA 5C20A 1UTPA 5EQSA 1V2WT 2ZEBA 4IMZA 4ZKRU 3AAUA 3SU4A 4OS7A 1LDTT 4ACBA 1MH0A 2TGPZ 2PGBB 2YOLA 2LNCA 2GZ7A 1MUEB 3QO6A 4NIWA 3ZZ4A 4Q2KA 1GBEA 1GVLA 2F3CE 4TY7A 2JETC 2BD8A 5EXNA 3SV6A 4F55A 1MABB 3PLKA 3PTNA 2FOBA 1TRNA 2ZZUH 1WQSA 3AVZA 3PLPA 2VIVA 2J98B 1P2KA 2R2MB 2ZC9H 1EOLA 1V2ST 3JZ1B 4IW4E 2DUCA 3BTWE 1LHFH 1D6WA 5EOKA 2ZQ2A 1P2OA 4UFDH 2SGPE 3AW0A 1Y5UT 4ACAA 4MQAA 1P06A 2PR3A 2FODA 3TK6A 1O3KA 1B5GH 1QTFA 1YBWA 1O34A 2PFEA 2P59A 3E6PH 1Y8TA 3MNBA 1YPGH 3F0PA 2OQUA 1J16A 1GCDA 1TALA 1FY5A 3RXPA 1PJPA 1BT7A 2XBWA 3M35A 2OTVA 1O5CB 1EP5A 1UTNA 4FU7A 3BEUA 1EJAA 1LHGH 2EEKA 3K6YA 3ZVBA 4X8TH 2C8WB 2ZPSA 2ZCHP 1BMLA 1LHCH 2ALPA 4TPIZ 5E8EH 5FHTA 3TLOA 8ESTE 1SGNE 1S83A 4X1QU 1TRYA 2Q6GA 1EB2A 2HRVA 5F03A 3PV4A 1XUFA 1XX9A 4ZAEA 3BTME 5E2PA 5LPEA 2D1JA 1FY4A 1LMWB 1DSUA 1ANBA 2J92A 4ZH8A 1WAYB 2AH4X 1GDNA 1V2UT 1SGIB 4E7NA 1GI0A 5B6LA 5HIYA 3QUMP 4U2WA 1DXPA 4BOHA 2BD5A 2R0KA 4CRDA 1BQYA 3P70B 1O2HA 2ESTE 3MU0A 2W3IA 4ZUHA 1SQRA 1LVBA 1W12U 6CHAB 4X0WU 3LGIA 3VPKA 4JZIA 1DSTA 4ZKSU 2BDGA 2FOFA 1GGDC 4RT0A 2FI3E 2SGEE 4O3UA 1HJ8A 3RC6A 1SGYE 1HLTH 3O8CA 1MD8A 4FUHA 1DPOA 1HIAB 1LPGB 4NG9H 3QLPH 2OC1A 3SJ8A 2G00A 1E34B 1P2IA 1CSOE 1HB0B 2K1QA 1ELCA 1GHWH 1BMNH 2QXJA 5PTPA 2BM2A 5JBAS 1C2EA 5GPIB 1O2IA 4NIYA 4KELA 3T25A 1E38B 2KR7A 1YPMH 4R8TB 4X1RU 4FUBA 4XFQA 2VIQA 4IN2A 2AMDA 2GDEH 4RN6A 1C1QA 1HFDA 2YNAA 3SNAA 4F4OC 5IK2D 1L4ZA 1UTOA 1W0JD 1ZTLA 3BG4B 3CS7A 3NXPA 5C1XA 1NN6A 4AG1A 1GJ4H 1P10A 2WPLS 2ZFSA 1HJAB 1RFNA 1NO9H 4B73A 4HZHA 5EJLA 5FPSA 1QNJA 1ACBE 1Q31A 1CA0C 1G37A 3NPSA 2ZFFH 1H9LB 1OWDA 1HAIH 3GDVA 1RGQA 1W13U 3W1EA 2A32A 1GMDF 1MTUA 2AGIX 1BTXA 1COWD 3QTOH 1GI2A 1ZYOA 2ZF0H 1VCWA 3IITA 7LPRA 1TLDA 2QV1A 2W3KA 3NCLA 2ZNKH 5FXLA 2BD2A 3HATH 1NZQH 2FP7B 2BTCE 4ISHH 3T27A 4B71A 1TIOA 2F9PA 3N7OA 1DOJA 1GJAB 3PV5A 3TNSA 4D76A 3A7YA 3SGAE 5C0UA 2QF4A 3LU9B 1S0RA 4F49A 1GBDA 1PQ5A 1P3CA 1SLVB 1O2TA 1SGPE 3LONA 3A7TA 2F91A 1OHHD 1EAUA 2GZ9A 1CHGA 1FLEE 1J9CH 1ZPZA 2P3FH 5FPTA 4AZ2B 4J1YA 1IQKA 2RDLA 4CH2B 1AZZA 4MPXA 1DWDH 2QE7D 1IQHA 1S6LA 1BTHH 1H4WA 3KL6A 1KDQB 2Y81A 1DANH 3MO9A 1N8OC 3GY4A 2XBXA 1V2OT 2C90B 2CN0H 3LGVA 1ID5H 2OC0A 2C3SA 1C1VH 3A81A 3RXVA 3AK5A 4CR9A 2J4IA 2AYWA 1MKXK 1AN1E 2AGEX 1O37A 2VVVA 1ZPBA 3GS9A 1YYY1 3IG6B 1BJUA 4NGAH 4X2YA 1MTSA 4Z1MD 4I32A 1FIWA 2BXUH 5GWZA 1ZGVA 4OM9A 1LVMA 1YPEH 1QA7A 1QQ4A 1G3DA 2BDYA 2ZDAH 4JYUH 2Y6TA 1GJCB 4H42U 1PPEE 2BVXH 3LGYA 2A5AA 1AE5A 5BPEA 1C5QA 3F2FA 4FUEA 1IQLA 5K7RA 2ZTZA 2QXHA 4VGCC 4KP0A 1TABE 1B0FA 1JOUB 1UCYH 1BBRK 1TAWA 3B23B 2G51A 1TQ0B 3R0FA 1VJ9U 2KX4A 2VB0A 2GCTB 1LVYA 3PM3A 1BITA 1TFXA 1RS0A 3SORA 1QCPA 2BY6X 1P03A 5C5OA 2ZFQH 4A6LA 1SKYE 2CF9H 4M9FA 1Z8IB 1ZOMA 1O2JA 5HGGA 1L1NA 2QGRA 1SGRE 1G9IE 2BOKA 1GDQA 1XMNB 5EPYA 2KAIA 2V6NA 4ISOA 1ESTA 1O3IA 3KEEA 3BV9B 3JZ2B 2BX3A 4O3TA 3SV7A 3T29A 2ANYA 4YLQH 1RTFB 3RC5A 2STBE 1F0UA 1Y3XA 3PMBB 1GBKA 4FVBA 3VFEA 1OP8A 2PUXB 3DT0H 2VIPA 3VB5A 1A0HB 1KXFA 4YO9A 4X8SH 3WW7A 1S82A 2A7HA 2VWOA 1Z7KA 3T26A 1V2JT 4DGJA 1A1RA 1DY8A 1UW7A 2XRCA 3ZV8A 5E0JA 3ZZ5A 4B75A 2W7UA 2PKSC 3D62A 1O2XA 2ZGHA 2Y5FA 4WMDA 4GCHG 1SVPA 2SGAA 1GBBA 2ZGBH 1FY3A 3NUMA 3TGJE 2V3MA 1VZQH 3MMGA 1FAXA 1B0EA 1GJDB 1RIWB 3ATMA 1TGSZ 4F48B 2Y5HA 2GCHG 2TRMA 3RXGA 4ISLA 1YGCH 4MLFB 4K2YA 3MU8A 4AORA 4B1TA 2G4TA 2BDCA 3PRBA 1CT4E 1C2LA 1O2YA 1OWKA 4GPGA 2ZDMA 2ASUB 5F8ZA 1MU8B 1Z6EA 1TWXB 1MKXH 5HKKD 1MKWK 1UTKA 1TGTA 5IDKA 4OS2A 1TNHA 1GCTB 3K6ZA 3Q77A 2A4RA 1C9TA 3KN2A 5EG4A 1JRTA 2THFB 1C4U2 5HYOA 2AGGX 3S9AA 2RG3A 2XNIA 1QJ6B 3D23A 2VGCC 3ATIA 5ESBA 5DPAA 4RKJB 3PB1E 3OFND 1AVXA 1ELFA 1ZTJA 2BY5X 5TJXA 1C1WH 2KCPA 3RXEA 1D3DB 3PMHB 2PKAB 2J5UA 3G01A 4XE4A 1OXGA 2F9VA 1SFQB 3MOCA 1AKSB 4X6MA 1S85A 4JK5A 5DP3A 4UONA 2ZI2H 3URCA 5FX5A 3RU4D 2QA9E 2FEQH 1C9PA 2RA0A 3BTTE 4AG2A 4ABIA 3PROA 4X2VA 3FP7E 3RMLH 2SGFE 2F9OA 2WUCA 3UQOA 1PYTD 4MNVA 5TCCA 1YM0A 2NU0E 4AYVB 2ZP0H 1FN8A 5KGOA 2CF8H 1K1NA 1Z1JA 4DURA 1Y3UA 1BZXE 2FTMA 2PTNA 1Z6JH 1ETTH 1C1PA 2IOTA 4DY7B 2ODPA 3ZVAA 2ZFPH 2JH5D 3BIVH 3PWBA 2A7JA 3EDXB 2Y82A 5EXLA 5HXFA 2H9HA 3NZIA 2VIDA 2ZFTA 2XTTB 1GBIA 3TPIZ 1ELGA 4ABJA 2HWLB 4X1NU 2WPDD 1Z8RA 1QB1A 3F9HA 2Q6FA 3VGCC 1O3HA 2AIQA 2UWOA 4ZHMU 3PRDA 4DOQA 1HAGE 5C3NA 2FOEA 4I86A 3SU2A 8LPRA 1O3JA 3UOUA 1UVUH 1PFXC 1FI8A 5E0GA 3N7DA 1BHXF 4Y71A 1S0QA 3SW2B 2FXRA 2F9BH 1A7SA 5HM2A 1NRQH 4X1SU 1TGBA 1HBTH 2AFQB 3F9GA 3HK3B 3BTEE 1FN6A 2HOBA 2CV3A 2PTCE 1BIOA 5C5NA 1DICA 1P04A 5LGOA 1TNIA 2BXTH 3U1IB 4YXWD 2KM0A 3PLBA 3NK8A 2CHAC 1P12E 1GHVH 1TOMH 2TBSA 3SU1A 3SUFA 3U1JB 1EAXA 1LPZB 2NU2E 1ESBA 1GMHG 1NU9A 1SLUB 2ZFRH 1K28D 2BB4A 3P92A 4ZROA 3SJ9A 1O38A 1ARCA 4INLA 2QAAA 2HPPH 2ILNA 2PUQH 2HLCA 1TNGA 4BNRA 4CRAA 1NESE 1O35A 2XCFA 3UNQA 3LPRA 4WWYA 1N6YA 1D3PB 2VJ1A 1HXFH 4MG3A 1EJMA 5DKMA 1G3BA 1JWTA 4M7GA 4UFGH 4CRCA 5I46H 4NZQA 3LH3A 1HPGA 4R0IA 4J2YB 3MH4A 1GG6C 2I6SA 1QHRB 4FUIA 5T6GA 4H4FA 2BYAX 3GISB 1ANCA 1TRMA 4O03A 1DS2E 3M7TA 2WV5A 3FVFB 3RXHA 4A92A 1V2MT 3CNRA 2H9EH 1V6DA 3GCHB 2PP6A 5CHBA 1LQEA 1O31A 1DDJA 2FDAA 2PSYA 3TH4H 1ETSH 4SGAE 1EB1H 1W10U 4X6PA 3RXSA 2ULLA 1BTPA 1OWJA 1AWHB 1OYQA 1Q2WA 4NWLA 2BY8X 4XBCA 1ETRH 2D8WA 1GI1A 1MTWA 2KCOA 2ODQA 1ZSJA 2HNTC 3A87A 1ELEE 1OP2A 3H7TA 3BTDE 2AIPA 2J2UA 3ZYEA 2Z9KA 3V3MA 1VCQA 1G2LA 5GIBA 3PO1B 5EGMA 1KTTB 2F43B 3NRLA 1AFQC 2OINA 2SNWA 3L3TA 1A5GH 2OCVB 1GJ9B 1CHOF 1DITH 1BB0B 2PSXA 1P57B 1QRXA 4UFEH 1YCPH 2WUBA 4CREA 2P8OC 4MNXA 4IC6A 3KQEA 1C5YB 3ZVEA 1G36A 1IQFA 2ZHQH 3E3TA 4X6NA 2JETB 3Q3YA 5DK1A 1V2LT 4XRNA 2A5IA 1HAHH 1QZ8A 4THNH 5BRRE 3BTHE 1ZMNA 2STAE 3M3TA 3FZZA 1GBCA 1Y5AT 2EI8A 4B2CA 1X7AC 2BQWB 2P93A 2ZHWH 1UVSH 3M5OA 1P2MA 3Q3XA 1ZR0A 2Q6DA 1EZSC 1GI8B 2Y80A 3OYPA 4KTSA 4XBBA 3KHVA 5EPNA 4B6EA 2YMSC 5DO4H 1P02A 1D4PB 2GJGA 1P11E 2P95A 2P16A 2VH6A 4ISNA 1GMCF 4NCYA 3UREA 1WUNH 4Q4LA 5FBIA 1FX0B 2W7SA 3UOPA 3A8BA 3OEHD 4OS6A 1C4V2 1S5SA 1PPCE 4NA8A 1H8IH 1QL8A 3BTKE 4JYTA 2ZCLP 1KMHB 1K1IA 5HM9A 3QK1A 4YLUA 4WXIA 4NSVA 2ZKSA 3A7XA 2BMGB 4B2AA 4IBLH 1AI8H 3K9XB 1OKXA 1P09A 3M7QA 3ZZDA 2NU3E 3TGIE 1DM4B 1O5FH 1F7ZA 4LOYH 1YLCA 3RXKA 1O5AB 3RP2A 4MPWA 3ATWA 5JBCS 1O32A 4X2WA 4P02A 2GD4B 5CDFE 1TPSA 2HNTE 1BTZA 1ANEA 1YPKH 1TPAE 4FETA 4OGYA 1LO6A 2IN2A 3V7TA 5L30H 1BRUP 1F5RA 2BOHB 3Q3KA 2XW9A 1YPHC 1RTLA 1ZJDA 4BAOB 2TPIZ 4TYDA 1Y3WA 3SZNA 1JRSA 1GGDB 1ABJH 3DFJA 2BLVA 1NBME 4MNYA 1AVGH 4IGDA 1GBHA 2O8WA 4Y0ZE 2BHGA 1O2GH 1DLEA 1C5SA 2FYRA 1AUTC 2FZZA 2OC7A 3UQVA 3SGBE 3O8DA 2GVFA 2F9NA 1XXDA 5F53A 2A0QB 4FUJA 1Q3XA 1O2VA 4NFFA 1O3CA 1QR3E 4DG4A 2NU4E 1YP9A 2WV9A 1NT1A 1A61H 2W6JD 1NFWA 2IPQX 4Q63A 3TU7H 4JZ1A 1FPHH 3A8DA 2OBQA 4NFEA 1O3GA 2TIOA 4RI0A 3V0XA 2A45B 3F3BA 5E0HA 1AE8H 4CHAC 1ANDA 4ASHA 1GL1A 1KXDA 4DT7B 1GHBF 3MQKC 2ZU4A 1GBMA 3UWIA 1T8NA 2FOAA 4MPUA 2FX6A 2Z9LA 2NU1E 1QRZA 1CA0B 3FP8E 5A0AE 5GDSH 1THRH 1O2PA 4LZ1H 2BD4A 3F1SB 1GI3A 3I29A 1LKAA 1UMAH 3QZQA 1O3NA 2FO9A 3IWMA 1SGFA 1W7GH 1ZZZA 3WY8A 3SYJA 3VEQB 4FUDA 1O3OA 3MHWU 1P0SH 3LH1A 4ZCNA 2C8YB 3TH3H 2KAIB 4A1VA 4AFSA 2K0QA 4FU8A 2J98A 2HALA 4U30A 4BAHB 1GI5A 1N1LA 4WXVA 2R9PA 3FANA 1J15A 2ZDKA 7GCHG 1A4WH 1EFRD 1YF4A 1RJXB 3S9BA 2A4QA 3GY3A 2ZGCA 1BDAA 1YLDA 3D65E 3DD2H 5K0HA 1DXWA 1UHBA 3MU1A 1PYTC 2ZHEH 3U69H 5GNDA 4CBOA 2QXGA 1SQOA 3ZZ7A 1HAYB 1YPHE 3F9EA 1P9UA 1YPLH 1GHZA 5FPYA 1EX3A 3T2NA 3A7WA 2H5DA 3QWCH 1N8OB 1VGCB 1IQJA 1BUIA 2J94A 2W5EA 4X8UH 5EW1H 2V35A 1TOCB 3W95A 1KIGH 3HK6B 4CBNA 4I8KA 1O30A 4I8GA 1TBQH 1DE7H 1J14A 1XKBC 3VXFH 1VGCC 2VIWA 1O0DH 2C8ZB 3A85A 3H7OA 2ZPRA 2FLBH 4Z0KA 1EP6A 1FXYA 4GHQA 1P3EA 1W7XH 2R0LA 1NS3A 2YMSD 4E7RG 5IYTA 1PQAA 3UB0A 1AUJA 1AHTH 4JZEH 3FZDA 3OAAD 1E1QD 2ZU3A 4VGCB 3RM0H 3SJKA 2OXSA 3FP6E 2A2XH 3RC4A 1FPCH 1EAIA 4Q7YA 3ZZAA 3STIA 3STJA 3GYLB 1SGEE 1E36B 4AX9H 1Z1IA 4DVAU 4RKOB 3UTUH 1S6HA 1NU7B 3RXCA 1QL9A 2ZA5A 1SBWA 5C94A 2HPQH 4X6OA 3ODFA 2JIZD 3EE7A 4I31A 4NSYA 1MD7A 1TMBH 1MAYA 2ZIQH 3A8CA 2FS8A 3A88A 3W94A 2C8XB 2BD3A 1C1OA 4ZHAA 4WH6A 1Z8GA 3SBKA 1DVAH 1A0LA 3HGPA 2FWWA 3OEED 3UAIC 3RU4E 1THPB 4DJZB 1Y59T 1PPHE 3RDZA 1LTOA 3SOSA 4KTCA 1CVWH 1EZQA 2EI6A 2VH0A 5AVDA 5EIYA 1K1MA 3RXTA 1KXBA 2F9UA 3U28C 3AW1A 2O8UA 2BLQA 3HKJB 1C2MA 3EE0B 2QYIA 1W0ZU 1ZMJA 5C0TA 3ATLA 4NZLA 2PKSB 4U01A 9LPRA 1QL7A 1SHYA 1CGIE 2Z9GA 1O3DA 1EPTC 1UO6A 1GI9B 3U98H 2BDIA 1HAVA 2R3YA 2RFKC 1WV7H 1H8DH 3C27B 3MNXA 3KCGH 3VXEH 4BXWA 5AFZH 1LCYA 5GJ4B 1ZHMA 3SO3A 5EW2H 1AY6H 1L1GA 1LQDB 1O3EA 1TPOA 2TGTA 3SNDA 1LHDH 3E1XB 3KQBA 3ELAH 1ZSKA 3L33A 4O9VA 3OSYA 1O5GH 4TSFD 4YT7H 1XUHA 5F8XA 2UUKB 3ZVFA 1Y3VA 4XDEA 1ELTA 2FOHA 1BRBE 2ZHFH 1JIMA 1P05A 1ABIH 4ZKNU 3UR9A 3LIWA 2VGCB 5CE1A 3E0NB 2M2AA 1JXPA 5FCRA 1SLWB 3QGJA 4H6TA 3SUDA 4WF8A 2JH0D 4TT3D 4UEHH 1O2ZA 2FOGA 1KDQA 3LDXH 3V13A 2B7DH 2XWBI 1CU1A 1V2PT 3D49H 3HKIB 4NA7A 2KFWA 2ANWA 1NRSH 1P01A 1HXEH 4NIVA 1ZHPA 1IAUA 1BBRH 2J34A 3SHAH 5LH8A 5EQRA 1GHAG 1YCPM 1E35B 1RXPA 2H9TH 4YTAA 4JK6A 1EUFA 3OE7D 2GZ8A 3MH6A 4TPYA 2Z94A 1TYNA 1C5RA 4JCNA 1VR1H 1GJ6A 4TWWA 4Y7AA 1HAXB 4HTCH 1AD8H 4ABHA 3MO3A 1L0ZA 1E0FD 1DWCH 1O2UA 1DFPA 1ZSLA 2BD7A 2JH6D 2D26C 3DUXH 2M5TA 2BVSH 2W26A 4NWKA 3RXLA 4ZMAH 1C2JA 1XVMA 2ZQ1A 2GMTC 3GCTG 4GAWA 1W2KH 2C4FH 3TH2H 2FOCA 3EAJA 4XD7D 1GI6A 3GY7A 5C2ZA 1GVKB 1ELVA 3S69A 2XCNA 2J9NA 3GICB 1SB1H 1AIXH 1EPTA 3EYDA 1GBAA 3MNCA 3GCOA 4ZXYH 1H9IE 3VGCB 5CHAC 3ZVGA 3DSGA 1W14U 2WZQA 1T31A 4MTBA 5A0CA 1A2CH 4HFPB 1C1MA 3Q00A 7KMEH 2Z3EA 3RMOH 2Y7XA 4BANB 2XYAA 1GHXH 1UVTH 1TNLA 1VITG 4IS5A 3UWJH 4D8NA 5DN6D 1SGDE 4Y8XA 1O2MA 5EJ1A 1BJVA 1OX1A 3EA8A 3T5FH 1O3BA 6GCHG 3ZVDA 1SSXA 1A3EH 1XM1A 2PGQB 3P17H 8GCHG 4K60A 2ZO3H 2H5CA 2SGQE 1PPBH 3SI4H 3F9FA 1IQIA 3E8LA 4Y7BA 3PMJA 3GOVB 1F0TA 2R3UA 1GHYH 2CHAB 1KSNA 1MKWH 1D3TB 1XKAC 3R3GB 1BTYA 4ESTE 1A5HA 1AB9C 3LJOA 3RLWH 1W0YH 1VCPA 1NRNH 4UDWH 3RXIA 1AMHA 1C5WB 2ZCKP 3ATKA 4YZUA 9ESTA 1RRKA 5C1YA 1L1JA 1DT2A 1P2NA 3I78A 4GCHF 1O33A 2Z3DA 1L2EA 1K22H 4ABDA 1O2NA 1HRTH 5DP7A 1E1RD 4YOGA 2BZ6H 1QURH 3DSPA 4FOUC 1LVOA 2GCHF 3SU6A 3PV2A 2FMJA 1NRPH 1OSSA 3URDA 1V2TT 3CS0A 1SGTA 1FIZA 5C17A 3T28A 2LPRA 3M3VA 2EY4C 1C5VA 1TMTH 1GG6B 1U6QA 1SQTA 1NRRH 1HUTH 3LT3A 4ASUD 1ZTKA 2HVXA 2VINA 4ISIH 4AOQA 2AHME 3TGKE 1GBFA 2QC2A 4YOIA 1EATA 4H6SB 2ZDVH 1V2RT 2L74A 1ZMLA 4X8VH 1S81A 4HI3A 1O36A 1ZGIA 2OK5A 1CBWC 3V12A 1KXAA 1QY6A 4E05H 2GT7A 5A8ZA 1C1RA 2UWLA 2PLXA 3A7VA 1IHSH 1IQNA 3BTFE 1EASA 1OWIA 1A0JA 4TY6A 4NA9H 4IN1A 3SV2H 2Z3CA 1UVOA 2RDEA 1C1SA 2VIOA 1V3XA 2AEIH 4YM9A 1GHAF 2WINI 2WPKS 3RXAA 4CRFA 1C2IA 1BA8B 6LPRA 4KGAA 2D2DA 2WYJA 5CMXH 1O2OA 2HVYB 1AWFH 1O3MA 5E2OA 1NM6A 1TGNA 2VWLA 4IC5A 1T4UH 1TA6A 1G3CA 1C2GA 3LGUA 1AFQB 3ZZBA 1E37B 2W6ID 1DUEA 2BZAA 2ZHDA 1FONA 2QXIA 2AMPA 1F5LA 5FCKA 3MH7A 1TX7A 1TX6A 3L6PA 2A2QH 4I8JA 3SUGA 2P8OB 4CH8B 4PROA 1MTNC 1KLIH 2XXLA 3KGPA 3RMMH 1MCVA 3UNRA 1UTQA 3ITIA 4FVDA 4JMYA 2J97A 2BVRH 3B8JA 3TNTA 1PPGE 1MTVA 5JBTA 4LZ4B 4RSPA 2PW8H 3Q76A 5F6MA 1MAXA 1SPJA 2IPHA 2C93B 1NTPA 1DWEH 1AZ8A 1CE5A 1FDPA 2CJIA 3ZVCA 4BTUB 4ZXXH 1WXRA 1MCTA 5GXPA 3DHKH 1P2JA 1C5NH 4D7GA 2YMSB 3VB4A 3VG8A 1C1NA 1SOTA 2K8IA 3MWIU 1VITF 3SHCH 2A5KA 3RXBA 3O8BA 4ABBA 3OY5U 2F4LA 1P8VC 1K1LA 2BY7X 3MYWA 2FTLE 1WYKA 1MBQA 1TQ7B 1SFIA 1FZZA 5C1UA 6GCHF 2OUAA 4X1PU 8GCHF 4Y8YA 1C5ZB 2QF3A 3RXJA 1O2LA 1C5UA 1GMDG 5A0BA 1FUJA 1H8ED 3PMAB 1V2KT 3ESTA 1BMMH 1EKBB 1C5LH 4FXGH 3SI3H 1QBOA 5T6FA 3GDSA 2ANKH 1J8AA 1SOZA 3TJVA 1UK3A 2UUYA 1NROH 1SI5H 1ARBA 2QF0A 2RCEA 4FUFA 4MPVA 1WQVH 1QB6A 3MTYA 1HAOH 4ABEA 2BY9X 4RT1A 2QF5A 1K1PA 1MMJN 1GMHF 1H9HE 1V2VT 2ZECA 1DY9A 1YWUA 2VWMA 2TGAA 3MU5A 4Y0YE 1UCYE 5KEDA 1GL0E 2CK3D 1KTSB 1UTMA 1UHBB 1W3CA 1T8OA 2GV6A 1LPKB 2ZTXA 4YESB 1E79D 3RU4T 4A7IB 4I8LA 1XUJA 2HLDD 1O3FA 3ZZ6A
chains in the Genus database with same CATH topology
3TIUA 1O2KA 5T6DA 4BTTB 3BTGE 4UE7H 2VVUA 2EC9H 1T8LA 1F5KU 1VJAU 3SQEE 1PQ8A 1D3QB 1OP0A 2JKHA 1C5OH 1GI7B 2ZGXH 3OX7U 3GDUA 1BHXB 3BTQE 2Z9IA 1C5MD 1MQ5A 3S9CA 4INKA 4CRBA 3GY8A 3O8RA 1FV9A 1HCGA 4IMQA 2I6QA 3A7ZA 3MNSA 1O2QA 2OLGA 3RXOA 1XVOA 4CHAB 2PV9B 5F8TA 1FMGA 5L2YH 2P3TB 4YT6H 4K8YA 2CXVA 1DWBH 1SMFE 2J95A 3QX5H 3UNSA 4DW2U 3M37A 3RXQA 6CHAC 1OWEA 3MO6A 2V0BA 1IQGA 5GCHG 4AYYB 1QRWA 1JMOH 1O3AA 1QBVH 1EZXC 1OPHB 1G3EA 2G5NA 3BEIB 4FUCA 2ANMH 2OC8A 3U9AH 3M5LA 5FX6A 4B76A 1HDTH 2A7CA 4UFFH 4K3JA 2A4OA 3MU4A 1XUKA 1XXFA 3F68H 3QGNB 2SNVA 2A1DB 2WV4A 5A09A 1MZAA 3FFGA 5EU8A 4AB9A 4Q7XA 3T62A 3VB7A 3KQDA 1ZRBA 4BAQB 1UCYK 1V2NT 2BLWA 2ZDNA 4K1TA 2EI7A 1GJ5H 3E0PB 2B8OH 4FUGA 4K1EA 2UWPA 1O39A 1C4Y2 1F0SA 5DP9A 3SV9A 3QDZB 1CQQA 4Z6AH 2Y5GA 1BBRE 1V2QT 2ZGJA 4OS4A 1EXFA 1BTWA 3BG4C 3M3SA 5A8YA 1Z71A 3KNXA 5J4QA 1GWAA 1HJAC 2BQ7B 2VU8E 3LGWA 4Q80A 1HAVB 1GI4A 1OOKB 3RMNH 4HGCA 1TNKA 2R2WU 3P8OA 4AFZA 2PHBA 4UD9H 2HGTH 1XUGA 4CR5A 3U8RH 4KTUA 2ZG0H 2QN5T 3QN7A 4Q7ZA 1PQ7A 3GY6A 1TBRH 2IJOB 1C5TA 1CT2E 1ELAA 5DP8A 4BXSA 5EXMA 4Y8ZA 2XC5A 1H1BA 3GY2A 3ZYDA 1C5XB 2BD9A 4ABGA 4A1XA 4JZFH 1HV7A 4GUXA 3PTBA 1EJNA 2BLOA 3UIRA 2G8TA 1F2SE 1HAZB 1F92A 2AMQA 4A1TA 4K1SA 4OS1A 3CP7A 4Y6DA 2H6MA 1KLJH 4Y11E 3PWCA 4GLYA 2WPHS 3TVJB 3ZZCA 1BCUH 3AAVA 2GGVB 3QZRA 5C67A 1FJSA 2ZU5A 4QT8C 3HGNA 3A83A 1W8BH 1YKTA 1QJ1B 1QA0A 1W11U 4KKDA 4AN7A 1SGFG 2GKVE 5A8XA 1C2DA 1N6XA 3RUOA 3BSQA 1ESAA 1WBGB 2FM2A 3VB3A 1UJ1A 2GT8A 1T7CA 3B9FH 7ESTE 3A82A 1FAKH 1EZUC 1BTUA 1WOFA 1WU1A 3GY5A 3OTJE 5J4SA 1TA2A 1HIAA 1DX5M 1KYNA 1KXCA 1SGCA 1CA8B 4MNWA 1GPZA 1WTHD 3H5CB 3UR6A 5AF9H 3LOXA 3GCNA 5DG6A 3MFJA 2DE8A 4AFUA 3LJJA 1BMAA 2A4GA 3UY9A 1QJ7B 4AGKA 2B5TB 3BF6H 1HNEE 1P9SA 1GJ7B 1T4VH 2O9QA 4BAKB 1WSSH 1C1UH 5DP4A 1GDUA 2XC0A 1L4DA 3RXRA 1QFKH 2B0FA 1K21H 3BEFB 3SU0A 3GYMA 4Y79A 8KME2 3RXMA 1M9UA 1A3BH 5G4BA 3EA9A 4WY3A 1EPTB 2GV7A 5GCHF 1AGJA 3HPTB 1O3LA 3K65B 3TITA 1K2I1 2BDHA 2OBOA 1BRAA 1J17T 1QQUA 1KXEA 2GCTC 3SNBA 3VB6A 1QBNA 5FBEA 3A8AA 1EQ9A 3TK5A 1ZJKA 3SJOA 1AVWA 1G32B 1ZPCA 2FLRH 4B74A 4JZDH 1S6FA 2G5VA 2HNTF 4WMEA 1LHEH 1SLXB 3SNEA 1C2FA 4MDSA 3SQHE 4GVUA 1NFUA 4DIIH 2O8MA 1DUAA 7GCHF 2OD3B 4K69A 4BTIB 1IQMA 3C1KA 5JPMH 4YOJA 1SGQE 1GBJA 1FNIA 3TJOA 2WPMS 1QGFA 3DA9B 1TB6H 2AS9A 1TNJA 2AERH 5L2ZH 2FYQA 2BDAA 1ELDE 2CGAA 5EODA 1CGJE 3KIDU 3U8OH 3S0NA 4GHTA 1K1OA 2XBYA 1SQAA 2FPZA 4DIHH 1P2QA 3LC5A 1ZRKA 1ORFA 2FESH 1UTJA 4XSKU 1QB9A 1ZLRA 3SUEA 3E90B 1O2RA 1RIWC 2GTBA 1OYTH 1TX8A 1KY9A 4ZHLU 5H4IB 4XOJA 2G52A 3SNCA 2J38A 3ZZ9A 2P94A 5JDUB 1UVPA 2V3OH 4TWYA 1O5EH 2FI4E 4JYVH 4WMFA 3E16B 2CMYA 2ZPQA 2Y7ZA 1FY1A 4FU9A 1HAPH 1C5PA 2GDDA 1OS8A 4WJG2 2ZU1A 6ESTA 1AU8A 2XWAA 1GCTC 4K5ZA 1YC0A 1A5IA 4O97A 2O8LA 4BAMB 1MQ6A 3RXUA 1HYLA 1WCZA 3S7KB 5HMAA 2GMTB 5JBBS 1O2SA 5LPRA 3M5MA 3P6ZB 3LGTA 1LKBA 2WPJS 4ABAA 1SHHB 4NIXA 2F83A 1HGTH 2FI5E 1IHTH 2H2ZA 3PYHA 3A86A 5ESTE 2G4UA 4I8HA 1XUIA 1Y5BT 5CHAB 2PWXA 3SU5A 5EQQA 2Z6BD 1K9OE 3I77A 3M7UA 2FOMB 2P3UB 3RXFA 3KF2A 4GSOA 1SL3A 2FX4A 2QCYA 1C2KA 1GBLA 5AFYH 3RLYH 5DP6A 1CHOG 1OWHA 3S7HB 2NWNA 3BG8A 5JYIA 2GP9B 3TK9A 3A84A 4WH8A 1HJ9A 3SGQE 2A31A 3UFAA 2ZU2A 5B6OA 1INCA 2VWNA 4D9QA 1THSH 2XC4A 4AFQA 1AO5A 3M61U 2Q1JA 1ZHRA 4X2XA 1NPMA 2WPIS 3UUZA 3NKKA 3QTVH 1BOQA 2BX4A 3ZZ8A 1AB9B 5JB9S 4MVNA 3DFLA 3RM2H 2ZTYA 3OY6U 5ABWA 4OGXA 2BQ6B 1F0RA 4INHA 2SGDE 1GBTA 3OU0A 2O8TA 1GMCG 3P8NA 1ELBA 1EOJA 3TJNA 3CENA 4LK4A 1YCPK 1O3PB 1TBZH 2Z9JA 2YNBA 3ZV9A 1CO7E 3EGKH 2EA3A 1BRCE 1PPZA 2OP9A 1NY22 1QIXB 1SG8B 1WTGH 1YPJH 2SFAA 1D6RA 3ENSB 5I25A 5DGJA 1O2WA 1IQEA 1K1JA 3P8FA 1MBMA 2TGDA 3TJUA 2G81E 1S84A 5FAHA 2Z7FE 2QIQA 3M36A 1CBWB 2V3HH 1TONA 1B7XB 4I33A 1TMUH 3BN9A 4SGBE 1C1TA 4CRGA 1SC8U 2DE9A 3A89A 3MH5A 2PKAA 1FY8E 3EQ0H 2RA3A 1RTKA 1RD3B 3P8GA 3UPEA 1C2HA 4E06H 5JB8S 4XBDA 1AKSA 3KQCA 3MI4A 5ETXA 4Y10E 2ODYB 1O5BB 1KLTA 5A2MH 5DJ7A 1UK2A 3NWUA 5LPFA 2UUFB 2QY0B 2OQ5A 3SU3A 2VNTA 1D9IA 3RXDA 3M5NA 2B9LA 1SR5C 3FAOA 4Y76A 4A5TS 3AASA 1FQ3A 1AFEH 4ABFA 4OS5A 1A46H 3U8TH 2GX4A 1T32A 3A80A 4LXBH 5DP5A 2BDBA 3K2UA 1MTNB 1O5DH 1DLKB 2G55A 4U32A 3SV8A 5T3HA 3LKWA 1GJ8B 4WVPE 2H1UA 4AB8A 1T8MA 1JIRA 2ZDLA 1NFYA 3GCHC 1GVZA 3P95A 5L6NH 3GCTF 1VITH 1NFXA 1IOEA 1TPPA 5TCAA 3ODDA 3F6UH 1UK4A 2FIRH 4B2BA 1MZDA 4ZKOU 2VVCA 5AHGH 1G2MA 1EAWA 1G30B 1GJBB 4D7FA 2FS9A 1PPFE 1GHBG 3E91A 4D9RA 4I7YH 1UTLM 1TGCA 2ZWLH 1AQ7A 5SGAE 3BIUH 3EA7A 3PO1C 3SJIA 1TE0A 1MU6B 2XBVA 4K8BA 1CT0E 1NC6A 1Z8JB 2UUJB 2ALVA 3SN8A 2WYGA 4DCDA 1Y3YA 3ZZ3A 1CGHA 3LC3A 1JBUH 4AGJA 5C20A 1UTPA 5EQSA 1V2WT 2ZEBA 4IMZA 4ZKRU 3AAUA 3SU4A 4OS7A 1LDTT 1MH0A 2TGPZ 2PGBB 2YOLA 2LNCA 2GZ7A 1MUEB 3QO6A 4NIWA 3ZZ4A 4Q2KA 1GBEA 1GVLA 2F3CE 4TY7A 2JETC 2BD8A 5EXNA 3SV6A 3PLKA 3PTNA 2FOBA 1TRNA 2ZZUH 1WQSA 3AVZA 3PLPA 2VIVA 1P2KA 2R2MB 2ZC9H 1EOLA 1V2ST 3JZ1B 4IW4E 2DUCA 3BTWE 1LHFH 1D6WA 5EOKA 2ZQ2A 1P2OA 4UFDH 2SGPE 3AW0A 1Y5UT 4MQAA 1P06A 2PR3A 2FODA 3TK6A 1O3KA 1B5GH 1QTFA 1YBWA 1O34A 2PFEA 2P59A 3E6PH 1Y8TA 3MNBA 1YPGH 2OQUA 1J16A 1GCDA 1TALA 1FY5A 3RXPA 1PJPA 1BT7A 2XBWA 3M35A 2OTVA 1O5CB 1EP5A 1UTNA 4FU7A 3BEUA 1EJAA 1LHGH 2EEKA 3K6YA 3ZVBA 4X8TH 2C8WB 2ZPSA 2ZCHP 1BMLA 1LHCH 2ALPA 4TPIZ 5E8EH 5FHTA 3TLOA 8ESTE 1SGNE 1S83A 4X1QU 1TRYA 2Q6GA 1EB2A 2HRVA 5F03A 3PV4A 1XUFA 1XX9A 4ZAEA 3BTME 5E2PA 5LPEA 2D1JA 1FY4A 1LMWB 1DSUA 1ANBA 2J92A 4ZH8A 1WAYB 2AH4X 1GDNA 1V2UT 1SGIB 4E7NA 1GI0A 3QUMP 4U2WA 1DXPA 4BOHA 2BD5A 2R0KA 4CRDA 1BQYA 3P70B 1O2HA 2ESTE 3MU0A 2W3IA 4ZUHA 1W12U 1LVBA 6CHAB 4X0WU 3LGIA 3VPKA 4JZIA 1DSTA 4ZKSU 2BDGA 2FOFA 1GGDC 2FI3E 2SGEE 4O3UA 1HJ8A 3RC6A 1SGYE 1HLTH 3O8CA 1MD8A 4FUHA 1DPOA 1HIAB 1LPGB 4NG9H 3QLPH 2OC1A 3SJ8A 2G00A 1E34B 1P2IA 1CSOE 1HB0B 2K1QA 1ELCA 1GHWH 1BMNH 2QXJA 5PTPA 2BM2A 5JBAS 1C2EA 5GPIB 1O2IA 4NIYA 4KELA 3T25A 1E38B 1YPMH 4R8TB 4X1RU 4FUBA 4XFQA 2VIQA 4IN2A 2AMDA 2GDEH 4RN6A 1C1QA 1HFDA 2YNAA 3SNAA 4F4OC 1L4ZA 1UTOA 1ZTLA 3BG4B 3CS7A 3NXPA 5C1XA 1NN6A 4AG1A 1GJ4H 1P10A 2WPLS 2ZFSA 1HJAB 1RFNA 1NO9H 4B73A 4HZHA 5FPSA 1QNJA 1ACBE 1Q31A 1CA0C 1G37A 3NPSA 2ZFFH 1H9LB 1OWDA 1HAIH 3GDVA 1RGQA 1W13U 2A32A 1GMDF 1MTUA 2AGIX 1BTXA 3QTOH 1GI2A 1ZYOA 2ZF0H 1VCWA 3IITA 7LPRA 1TLDA 2QV1A 2W3KA 3NCLA 2ZNKH 5FXLA 2BD2A 3HATH 1NZQH 2FP7B 2BTCE 4ISHH 3T27A 4B71A 1TIOA 2F9PA 3N7OA 1DOJA 1GJAB 3TNSA 4D76A 3A7YA 3SGAE 3LU9B 1S0RA 4F49A 1GBDA 1PQ5A 1P3CA 1SLVB 1O2TA 1SGPE 3LONA 3A7TA 2F91A 1EAUA 2GZ9A 1CHGA 1FLEE 1J9CH 1ZPZA 2P3FH 5FPTA 4AZ2B 4J1YA 1IQKA 2RDLA 4CH2B 1AZZA 4MPXA 1DWDH 1IQHA 1BTHH 1H4WA 3KL6A 1KDQB 2Y81A 1DANH 3MO9A 1N8OC 3GY4A 2XBXA 1V2OT 2C90B 2CN0H 3LGVA 1ID5H 2OC0A 2C3SA 1C1VH 3A81A 3RXVA 4CR9A 2J4IA 2AYWA 1MKXK 1AN1E 2AGEX 1O37A 2VVVA 1ZPBA 3IG6B 1YYY1 1BJUA 4NGAH 4X2YA 1MTSA 4I32A 1FIWA 2BXUH 5GWZA 1ZGVA 1LVMA 1YPEH 1QA7A 1QQ4A 1G3DA 2BDYA 2ZDAH 4JYUH 2Y6TA 1GJCB 4H42U 1PPEE 2BVXH 3LGYA 2A5AA 1AE5A 5BPEA 1C5QA 4FUEA 1IQLA 5K7RA 2ZTZA 2QXHA 4VGCC 4KP0A 1TABE 1B0FA 1JOUB 1UCYH 1BBRK 1TAWA 3B23B 2G51A 1TQ0B 3R0FA 1VJ9U 2VB0A 2GCTB 1LVYA 3PM3A 1BITA 1TFXA 1RS0A 3SORA 1QCPA 2BY6X 1P03A 5C5OA 2ZFQH 4A6LA 2CF9H 1Z8IB 1ZOMA 1O2JA 5HGGA 1L1NA 2QGRA 1SGRE 1G9IE 2BOKA 1GDQA 1XMNB 5EPYA 2KAIA 2V6NA 4ISOA 1ESTA 1O3IA 3KEEA 3BV9B 3JZ2B 2BX3A 4O3TA 3SV7A 3T29A 2ANYA 4YLQH 1RTFB 3RC5A 2STBE 1F0UA 1Y3XA 3PMBB 1GBKA 4FVBA 3VFEA 1OP8A 2PUXB 3DT0H 2VIPA 3VB5A 1A0HB 1KXFA 4YO9A 4X8SH 1S82A 2A7HA 2VWOA 1Z7KA 3T26A 1V2JT 4DGJA 1A1RA 1DY8A 2XRCA 3ZV8A 3ZZ5A 5E0JA 4B75A 2W7UA 2PKSC 3D62A 1O2XA 2ZGHA 2Y5FA 4WMDA 4GCHG 1SVPA 2SGAA 1GBBA 2ZGBH 1FY3A 3NUMA 3TGJE 1VZQH 3MMGA 1FAXA 1B0EA 1GJDB 1RIWB 3ATMA 1TGSZ 2Y5HA 2GCHG 2TRMA 3RXGA 4ISLA 1YGCH 4MLFB 4K2YA 3MU8A 4AORA 4B1TA 2G4TA 2BDCA 1CT4E 1C2LA 1O2YA 1OWKA 4GPGA 2ZDMA 2ASUB 5F8ZA 1MU8B 1Z6EA 1TWXB 1MKXH 1MKWK 1UTKA 1TGTA 5IDKA 4OS2A 1TNHA 1GCTB 3K6ZA 3Q77A 2A4RA 1C9TA 3KN2A 5EG4A 1JRTA 2THFB 1C4U2 5HYOA 2AGGX 3S9AA