1F5LA

Urokinase plasminogen activator b-chain-amiloride complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title Crystals of the urokinase type plasminogen activator variant beta(c)-uPAin complex with small molecule inhibitors open the way towards structure-based drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 60
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2000-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1f5lA01
3RUOA 5JYIA 2ODYB 3P17H 1AIXH 1ZYOA 5T6GA 3M7TA 1Z6JH 5GPIB 1IQNA 1V2UT 1AUTC 1NFUA 1O36A 3RXGA 4H4FA 2W7UA 1Q3XA 3F9GA 1BB0B 2R2WU 3LC5A 4VGCC 2RDLA 1AE5A 1OYQA 4H6TA 1O2MA 3MMGA 2M5TA 1LPGB 1GPZA 4HTCH 2PV9B 2GCHG 2F9VA 3SBKA 1V2QT 2YNAA 1UTJA 4BXSA 1OX1A 3GDUA 3DFJA 1P9SA 2GDEH 3A83A 2BOHB 4ISOA 1SQAA 2AGEX 2Z9GA 1O5FH 1CO7E 2ZO3H 3GY4A 4B2BA 1O5AB 2KAIA 2H9EH 1BDAA 1TX7A 3AW1A 1GVKB 4X1NU 5EU8A 1CGJE 3E91A 4DVAU 2V35A 4MNVA 1P12E 1RJXB 2BD7A 4FXGH 1LHEH 3GCOA 4JZIA 4CR5A 2XBVA 1KXEA 1AKSB 1ESBA 1UVOA 2FIRH 2ZPQA 7GCHG 3Q3XA 3RU4E 3QGNB 1V2JT 1BQYA 1KXAA 5EOKA 1C1TA 4JZEH 2UUYA 4Y0ZE 1C2IA 1CBWC 1F5RA 1GDQA 2IN2A 3PM3A 1MKWK 3BTGE 4M7GA 2EC9H 3D23A 1LCYA 1K1NA 3GYMA 3SORA 1BTUA 2F9BH 2GX4A 2YNBA 1AFQB 2G55A 2JETC 5EPYA 1BMLA 1L2EA 1IAUA 1GMDF 3SI4H 1A2CH 3V7TA 3ZYDA 2J4IA 1O2GH 1NC6A 2HWLB 2ZU3A 1NT1A 2FOAA 3E6PH 3SO3A 3RP2A 1ABJH 1D3DB 1PFXC 1SGTA 2XCNA 1EZXC 1HJ9A 1J16A 4K1SA 4DG4A 1MTUA 2BLOA 1DS2E 1PYTC 3U98H 5AHGH 3TH3H 2OCVB 3TJNA 1LDTT 4B2AA 4K3JA 1ABIH 1T8OA 3RLWH 1SSXA 3KGPA 4NIXA 5GCHF 4WMEA 5G4BA 2ANWA 3SJIA 1FMGA 3A87A 4BAQB 4B71A 2BDAA 3GCNA 3RC6A 1DITH 2A2XH 5EG4A 1C4Y2 3QO6A 5DP9A 2XTTB 5F8ZA 1HAYB 3VB3A 3A84A 1S85A 1A3BH 1HJ8A 2DE9A 5A8XA 3A7VA 2BQ6B 5LPEA 1THSH 2ZHWH 1V2WT 1MTSA 1EP6A 3A89A 1EZQA 1HFDA 2ALVA 2BQ7B 1BOQA 1T4UH 2WYGA 2QCYA 2LNCA 1P2IA 3VFEA 2SNVA 3BTHE 1GJ9B 3QLPH 1SGIB 1GBAA 4ABJA 2FDAA 1TFXA 1H9HE 3LDXH 1LMWB 2C8XB 3MFJA 2D26C 1TX6A 3L6PA 4Q80A 1O2QA 3VGCC 1O5EH 3MU5A 1FV9A 2Y82A 4KELA 5B6OA 2TBSA 1W3CA 5CHAC 1ELDE 5ESTE 1Y8TA 5CMXH 3MNXA 3RXUA 1T4VH 1MBQA 2P95A 2BDHA 2CXVA 3HK6B 2ZGXH 3GDSA 1ARBA 2ZCLP 5AVDA 1MQ6A 3KQDA 3D49H 1MU8B 1HCGA 4ABFA 4I7YH 1ZSJA 4BAHB 1WTHD 2BTCE 3LOXA 1UJ1A 1B5GH 1L4DA 2XC5A 4KKDA 3KQCA 3OSYA 1GHZA 4MPWA 4Q7XA 1BHXF 2OC8A 1QCPA 4NA8A 3MWIU 3F9FA 1W0ZU 2R0KA 1GI2A 4AYYB 2ZU2A 1HBTH 4A6LA 4JK5A 1G3DA 2P3FH 4Y8YA 4YTAA 3M61U 2B7DH 1MKXH 3EGKH 1FPCH 1PPEE 3SJKA 1SPJA 1LPKB 1YM0A 1G3EA 2Y80A 2PSXA 3BTWE 2PUXB 5T6DA 1HAZB 3GISB 2ZPSA 1A7SA 4ESTE 1C1WH 2VJ1A 1CGHA 4K69A 2CMYA 3SUEA 1H4WA 1O35A 1L1NA 2OBOA 4Y8ZA 1RRKA 1MH0A 3RM2H 3SUDA 2BDGA 3PROA 4DGJA 1AD8H 1TPAE 1EX3A 4U30A 3LONA 3ZZBA 1EJNA 3RXJA 1C2GA 4NG9H 3QWCH 3VB4A 5EODA 1DFPA 2HVXA 3E3TA 3NKKA 3KNXA 3VXFH 1Y5UT 1W13U 3EAJA 2HOBA 1Z8JB 1NESE 2GTBA 3RXVA 3A82A 1C4U2 1P8VC 8GCHF 1TNHA 3Q76A 4X8TH 5DP4A 1DVAH 1V2MT 2B9LA 1HPGA 1SMFE 4JK6A 1BRAA 2QIQA 2VB0A 2XBWA 4GLYA 3DHKH 2ZFPH 3S0NA 1ELTA 1RD3B 5ABWA 1XVOA 4DIIH 5HXFA 4CRBA 1LQDB 1ORFA 5GWZA 1KDQA 4NSVA 4F49A 1G30B 3O8BA 1NFWA 1RIWB 2OC1A 1S83A 1EP5A 1L4ZA 2STBE 5K7RA 4IN1A 3PMHB 4ABHA 2XBXA 1SGRE 3STIA 1YPLH 1YBWA 3A80A 1FLEE 3N7OA 4CBOA 1KY9A 1XMNB 3PMAB 1BITA 1HAIH 2BVXH 2JKHA 4AGJA 1F2SE 1N8OC 4GCHF 1S0QA 3MO3A 3M36A 3P95A 1TMTH 2VH0A 4K2YA 4BAKB 3P8FA 1S5SA 3ZVBA 2UUKB 1NS3A 1Y3XA 1WV7H 5DO4H 1Q2WA 3Q77A 4B75A 1MD7A 5H4IB 1F0UA 3ZYEA 1LKAA 1FI8A 1Y5BT 3M37A 2SGPE 2B5TB 3A8CA 1UCYK 2OINA 1ESAA 4IS5A 2Y5GA 3A7YA 2VGCC 1CQQA 1O3AA 4SGBE 2J94A 4BTTB 1WQVH 1PPZA 1ZGIA 1UTQA 2F9PA 1GWAA 2GD4B 3QTVH 3RMOH 2O8MA 1ZZZA 1GMCG 1SL3A 1ELEE 2QF0A 1C5MD 5FBEA 1DWDH 1XX9A 1WAYB 1DLEA 1W7GH 1LPZB 1P9UA 1O3MA 2Y7ZA 4ZKSU 2BX3A 2H5CA 2H9TH 3SGQE 2XCFA 5LH8A 5FX5A 5I46H 2C8WB 2WINI 5JB9S 3B9FH 1EPTB 4X2XA 1QQUA 1QFKH 1FN6A 4NWKA 3K9XB 3ZZDA 5AFYH 2FZZA 4NA9H 1EKBB 3O8DA 1W2KH 3BG4C 2ZECA 3R0FA 3E8LA 2A4RA 3P8GA 1TMBH 1N6YA 2BD3A 2ODPA 3SNEA 2F83A 4AFQA 2FEQH 4DW2U 1P05A 4KP0A 1GHBG 1QNJA 2OP9A 1AWFH 1FN8A 4U01A 3OX7U 1TA6A 1YCPH 1BMAA 5FX6A 4AFUA 4AGKA 1CHGA 1VGCB 4Y71A 1C5XB 2RA3A 3BN9A 3ESTA 3M5OA 1QB6A 1O0DH 2O8LA 1LKBA 4YZUA 2FS8A 3PB1E 4I8KA 4NIYA 3SV2H 3VB7A 1Y3YA 1OPHB 1OWEA 1GBBA 4WXVA 4DIHH 1HV7A 2FLRH 4MNXA 3RM0H 1QJ7B 4X6OA 4K8BA 4JZ1A 2A45B 1QQ4A 4HZHA 2WPJS 1K1PA 2QXGA 2D8WA 1GBJA 1UTPA 1P04A 3SNCA 3A7XA 2OC0A 1FAXA 1OP0A 1QHRB 2JH0D 2A31A 2PUQH 2WUCA 3GY7A 3T2NA 2C90B 1TGBA 3TK9A 2ZFQH 4XBCA 1CHOG 4LZ4B 8KME2 1LO6A 2FOEA 2GMTB 4AG2A 4CHAB 4CH8B 1ELGA 3RXOA 2BD9A 2G81E 3ATLA 9LPRA 4Y7AA 2FTMA 1JIRA 3S7KB 1O2SA 1YYY1 2OUAA 2RCEA 1EATA 1NROH 3A86A 1S6FA 4CRCA 1HIAB 3RXBA 3SI3H 3KEEA 2XC0A 1ANEA 5JBTA 4YOJA 1O2JA 2J2UA 2QAAA 4INLA 9ESTA 1BZXE 3H5CB 3LGYA 1TONA 3SZNA 5DPAA 4ZKOU 3QDZB 4AFZA 3ZZ6A 1GHAF 1QBVH 3PTNA 5PTPA 2G51A 3TNSA 2OBQA 1QTFA 1GDNA 2Y5HA 1YPHC 5L2ZH 1GJ7B 2J34A 5FBIA 3B8JA 2P3TB 3JZ2B 1PPFE 4KTUA 1ETRH 2Z9KA 3KF2A 5J4SA 1OKXA 1F5KU 3KL6A 3SOSA 1O30A 2BLWA 1EASA 1QY6A 2BX4A 4FUIA 3U1JB 1XUGA 3CENA 5IYTA 2CV3A 4I8JA 3VB5A 3U8OH 3UNSA 2XWAA 1XKBC 1ZTJA 1GCTB 4INKA 3ATWA 1AY6H 1C5ZB 5L6NH 3GCHB 1YF4A 1J17T 1YP9A 2A32A 2I6SA 1TNLA 1FJSA 4XE4A 3SV9A 1O2TA 1SOTA 2D2DA 1GI7B 1J9CH 3M3SA 1ELAA 1TBRH 4JYUH 5C3NA 1IQFA 3U1IB 6CHAB 4FUBA 3GY2A 1O31A 1Y3VA 4UFDH 4X1RU 1BTZA 3ZVEA 1CA0C 1QB9A 1SLXB 4LOYH 1AVWA 5AFZH 2B8OH 4Y7BA 2CHAC 4IC5A 3K6YA 1GMHG 4ZAEA 2ZDKA 1BCUH 1V2VT 4XBBA 2FI5E 1V2OT 2Z6BD 3CP7A 1P09A 1W11U 2BB4A 2ZHEH 5FPSA 4BXWA 4MNYA 4NWLA 2AEIH 1HDTH 4FU7A 2KAIB 1TB6H 1W12U 3SJ8A 4LXBH 1AGJA 1O3IA 2WPHS 1WBGB 1QL7A 5FPYA 1LTOA 2Y6TA 1ZPBA 1MU6B 1UVSH 1O5DH 5GJ4B 3AAVA 1SVPA 3H7OA 4D7FA 2V0BA 2YOLA 1NFYA 1PQAA 3A8BA 1DICA 3MH7A 2BYAX 4X8SH 1C1SA 3SV7A 1YPHE 3SU0A 1KXDA 3I29A 1FIZA 4A7IB 3W94A 3BTDE 3D65E 4CH2B 1GVZA 2A2QH 2SGAA 1ANDA 2ZU4A 1C1QA 1SG8B 1C5VA 4X0WU 4ZHLU 1GMDG 1PQ5A 1TIOA 1BBRE 4FVDA 1TWXB 1ZTLA 2AIQA 1UTOA 3M7QA 1GJAB 1T8MA 2BQWB 4TYDA 3UUZA 4AX9H 3EA9A 4QT8C 1SQTA 3SU2A 4ZKRU 1DY9A 1ZHPA 1MZAA 1NU7B 1THPB 2ZCKP 3FANA 1G2MA 1BA8B 2PHBA 4GUXA 1U6QA 4X1SU 1Z8IB 1E0FD 4ZMAH 2PGQB 4MLFB 3A88A 3TJUA 3QN7A 5A09A 1BTWA 5L2YH 2OLGA 1UTKA 2ESTE 5TJXA 4GSOA 2A1DB 1C5RA 1FQ3A 1GI0A 1O3EA 2Z94A 5GCHG 2FXRA 4OS1A 4FUHA 2TGTA 3ZZAA 2NU1E 3BTEE 4WXIA 1SOZA 1QL9A 1K2I1 1XM1A 4ZHMU 1DANH 3ZZ4A 1A0LA 1C9TA 2BLQA 5CE1A 2FOFA 1GVLA 3PO1B 2ILNA 4WY3A 1GJBB 1UHBA 3T26A 4NIVA 2G52A 1O37A 4WJG2 3PLKA 5A2MH 1F92A 1O2XA 2C8ZB 2BVSH 1IQKA 1L1GA 2A7JA 4ASHA 1IQJA 3LJJA 4NSYA 1O34A 1AFEH 1EJAA 2BOKA 2GZ7A 3V13A 4NGAH 1GI1A 1ID5H 5BRRE 1D3TB 4ABBA 1EB1H 1C2LA 3LKWA 2P3UB 3SU5A 5J4QA 3TK6A 1TNIA 3LGIA 4O9VA 4CRGA 1LVYA 2G5VA 1G3BA 1O2KA 1DSUA 3K2UA 4X6PA 1P10A 3SW2B 5C2ZA 1P11E 1FPHH 3A7ZA 2VWOA 1UMAH 1GBMA 1TNKA 1TPPA 3TGJE 2A5IA 2P8OC 4I32A 3VXEH 2ZI2H 2ZTYA 1NU9A 1W10U 1C2KA 1S82A 2VNTA 3RMMH 4RSPA 5C67A 1D4PB 3G01A 1BTYA 3MTYA 2P93A 2ZGHA 5GDSH 1TYNA 1W7XH 2R0LA 3R3GB 5FCRA 4A92A 3URCA 4B76A 2FX4A 1DLKB 3QK1A 1CU1A 2W3KA 4UD9H 1T8NA 4JCNA 1FY5A 3P8OA 4CRDA 2GCHF 4J2YB 2VWLA 3DA9B 2QA9E 3SGBE 1F0SA 2XYAA 3AAUA 4UFGH 4X6NA 4UEHH 2ZDMA 5IDKA 1WUNH 1A46H 1V3XA 1VZQH 3FP6E 3OY5U 4GAWA 4Y6DA 1ZSKA 4SGAE 3AW0A 1EUFA 1CGIE 3PMBB 1GBCA 2Q6GA 2HRVA 1C1OA 2F9OA 4BAMB 1EPTC 1AKSA 1RTKA 2RG3A 4IW4E 5C1XA 1MTNB 5EW2H 1D3PB 4KTSA 2ODQA 4JMYA 2Z9JA 4CREA 3QZRA 3NUMA 2BDBA 2VVUA 1BBRH 2H9HA 7GCHF 1GBEA 1QJ6B 1O2IA 5E8EH 4Y76A 2UUJB 1OP8A 4DY7B 2A7CA 1KSNA 1MAXA 3HGNA 1VGCC 4XBDA 1O2LA 1UVTH 1DWCH 1THRH 1T31A 8GCHG 3BEUA 2EA3A 4BTIB 1AE8H 2PKAA 2VVVA 4Y79A 2V3HH 2VIQA 3BIUH 4HI3A 1A3EH 4MNWA 4NA7A 3S69A 1C5OH 3RLYH 5HYOA 2SGQE 4TY6A 2WV4A 3BIVH 4K5ZA 3LT3A 1KIGH 3A8DA 2AS9A 3FP7E 1HJAC 3UIRA 7KMEH 1AI8H 1GI8B 4AYVB 2OQ5A 1A0HB 4FVBA 2TGDA 1PJPA 2C8YB 1SLVB 1TX8A 2PTNA 4OS7A 1H9IE 1C5YB 2ZEBA 3P70B 2ZQ2A 1MZDA 1NRNH 3RXFA 1C1PA 4GPGA 2STAE 1K28D 3LH3A 1YCPM 1KDQB 4ZHAA 2QY0B 2FOMB 3SHAH 1IOEA 3SJ9A 5HMAA 4FUJA 4WVPE 2ZDLA 2GCTC 4WMDA 2Y5FA 1MQ5A 3UR6A 5EPNA 1GGDC 2R2MB 2GMTC 1SGEE 4OS5A 1O3CA 1SGFA 2FTLE 1T7CA 1SR5C 1A5IA 1Y59T 2BXUH 5EGMA 6GCHF 2AYWA 1ELFA 1MUEB 1TRYA 1GBFA 1EAXA 2Z3DA 3ZZCA 4E7NA 3S7HB 2G5NA 3UNRA 2ZFSA 3RXSA 4TWYA 4Y0YE 3P8NA 2GGVB 4VGCB 2FP7B 1AU8A 3RXEA 3TNTA 4UFEH 1HAXB 1WCZA 1ZMNA 1ZJKA 4JYTA 1RXPA 7LPRA 2ALPA 1P2MA 4O3TA 3ATMA 2UWOA 1Y3UA 1F0TA 2H5DA 1A5HA 2UWLA 1SQOA 1HLTH 1IHSH 2FI3E 1TOMH 1C5WB 2GT8A 1VR1H 3CS0A 2GT7A 2BXTH 4F4OC 1UK3A 4D76A 1GI3A 1VCQA 5HM9A 1VITF 3EYDA 3DFLA 3IITA 1SHYA 1TABE 2GV6A 3TH4H 1XUKA 3UWJH 1BMMH 1HAVB 1O5CB 3P92A 3TH2H 1CA8B 1GCTC 4AZ2B 1IQMA 2VU8E 1P2OA 2BY8X 3MH5A 1DXWA 3LGUA 1EXFA 4K1EA 5C20A 1EOLA 2UWPA 1ACBE 3A7TA 1O3HA 2ZHFH 3VEQB 3JZ1B 5JB8S 4YO9A 5A0AE 5F6MA 3M5NA 3FZZA 2DE8A 1RGQA 2C4FH 5EQQA 1UK2A 3FFGA 2ZDVH 5EXNA 2JETB 3BTME 3MI4A 4DOQA 1SGCA 3UOPA 1YCPK 2AMPA 2FLBH 4AB8A 5LPFA 2PSYA 1HAOH 2J9NA 5JPMH 3BTKE 1E37B 1TGTA 2TPIZ 2BM2A 2VH6A 5JBAS 1OWKA 2Z9LA 3WY8A 1S6HA 3LGTA 2FWWA 3E0PB 2BD8A 1GHYH 1BJVA 5DP8A 2PKSC 1YLCA 1K22H 2BD5A 3LH1A 3SV8A 4THNH 1GG6C 5EW1H 5TCAA 1ZGVA 3GCTF 1DY8A 2IOTA 8ESTE 2GZ8A 1AB9C 3OU0A 4H6SB 2A4QA 1H1BA 1IQLA 1HB0B 1QRXA 4CRAA 1D3QB 1OOKB 2ZTXA 1GHXH 2D1JA 3SJOA 4KTCA 3E0NB 5DG6A 4UONA 1C1MA 2HLCA 1NTPA 1V2PT 3HKJB 4MPVA 1BRUP 4JZDH 1K1LA 4R0IA 1W14U 1GBLA 1K1JA 3ELAH 2ZHQH 1MAYA 1TLDA 2F91A 1JRSA 2Z3EA 4YESB 5EXLA 1GHAG 3IWMA 5ETXA 3CS7A 5T3HA 4D8NA 1DUEA 3GY6A 1XXFA 4IN2A 5EQSA 1XUIA 2OC7A 3GYLB 3TGKE 1C1UH 1P2KA 1O2OA 1K21H 2G8TA 1VITH 1FIWA 3VGCB 3FAOA 4GVUA 2BZ6H 2W7SA 3T28A 3NK8A 5CHAB 1PQ7A 3SQEE 3LGWA 3BEFB 1TAWA 1Z8RA 4BANB 1G37A 3C1KA 3GY5A 2CGAA 3SGAE 3ZVDA 3SN8A 1LVBA 3FVFB 5JBBS 3LIWA 1QL8A 3PO1C 3ODDA 4ABEA 2HPPH 3MNBA 1UTMA 2BDIA 4AORA 4UFFH 1HAPH 5ESBA 3F68H 3MNSA 1YPGH 1YLDA 1JMOH 5JDUB 1TBQH 1GI4A 1C1NA 3S9CA 2GKVE 1IHTH 2UUFB 1GDUA 2ZIQH 1Z1JA 2NU0E 3UNQA 2FYRA 1AFQC 2NU3E 4X1PU 1BUIA 3RXPA 5DP6A 1TQ7B 3FZDA 3KN2A 1O3PB 3PMJA 1EPTA 1EB2A 1GI6A 1P01A 1GJ6A 1GHWH 1FXYA 3IG6B 5A8YA 5FAHA 2Q6FA 1XUJA 1GJ8B 1HGTH 2ZU1A 4ABDA 1MD8A 4I33A 5E0HA 5HM2A 1S84A 3M7UA 1SGYE 1O2PA 1SC8U 5C1YA 1B7XB 4MDSA 4X2WA 3RC4A 5I25A 1TRMA 1Z6EA 3BTQE 1CT0E 1SGDE 1EZSC 3RXKA 4MG3A 2EI7A 2BVRH 4ZXYH 1EAIA 5LPRA 1UVUH 1W0YH 1XUFA 3K65B 1WU1A 3I77A 2WUBA 5K0HA 3U9AH 1P02A 1VCPA 4ISLA 2ZC9H 5F8TA 3SU4A 1PPGE 1TOCB 3GDVA 2ZHDA 2QXHA 1VJ9U 4FUFA 3LC3A 1DE7H 2XXLA 1C2DA 5E0GA 1O33A 3RC5A 3MU1A 1DUAA 3RXMA 1T8LA 2XBYA 3ATIA 2GP9B 1XXDA 1MMJN 1P06A 1SFIA 2FOGA 1A0JA 3MH6A 1ZLRA 3UTUH 2G4UA 1F5LA 1AO5A 1SBWA 4FU8A 2W3IA 3O8CA 1GCDA 5A8ZA 3T62A 1O2ZA 3HKIB 1GJ4H 2WPKS 1RS0A 2WV5A 1SGFG 2XW9A 3NWUA 1Z8GA 3LGVA 1ARCA 1N8OB 1ELBA 4NFEA 4E05H 4B1TA 1O2RA 3UFAA 4ISNA 1HIAA 4TPIZ 2F9NA 3Q3KA 1FNIA 2VIOA 2BY5X 1SFQB 4U2WA 1CVWH 3RXDA 2ANMH 3ODFA 1NZQH 1KXBA 1SGNE 4NIWA 2SGDE 3AVZA 5C5OA 1FY3A 1MBMA 2BY9X 1SB1H 2VINA 5GXPA 1BRCE 2VGCB 3BV9B 1PYTD 1V2TT 1SI5H 5E0JA 3T5FH 5DP7A 1ZOMA 3DT0H 2RA0A 4ISHH 3SQHE 2AGGX 3UWIA 1V2NT 1H8IH 1ESTA 3F9HA 3TJOA 3RXAA 1ZHRA 4O3UA 4K60A 5DJ7A 3QZQA 1FUJA 2ZWLH 1Q31A 1S0RA 4YLUA 2A0QB 1C5LH 3NCLA 3U8RH 5E2OA 3BG4B 5EXMA 1V2LT 4OS2A 1FDPA 3KQEA 4I8HA 3E16B 2ZFRH 2ZA5A 1KLIH 1YPJH 3HATH 3PLBA 3K6ZA 1OWDA 2ULLA 3RXIA 2OQUA 1KXCA 2R3YA 4OS6A 1AZZA 1ZRKA 3A85A 5GIBA 1E36B 5C5NA 1HXFH 1BT7A 3MNCA 1XUHA 1EJMA 1BJUA 4O03A 3RMLH 4AN7A 1NM6A 3OY6U 1FZZA 1JXPA 2O9QA 6LPRA 2FODA 3LU9B 2ANYA 2SGEE 2ZGBH 5TCCA 1EAUA 4INHA 1JBUH 1T32A 2XWBI 3V3MA 3T27A 1ANCA 1GMHF 4BNRA 2A7HA 4IBLH 4AOQA 3M5MA 3ZZ7A 1NRPH 2LPRA 2AGIX 1BTXA 4ZROA 1NPMA 1LVOA 1ZR0A 1EQ9A 3NZIA 1IQHA 1DWBH 1RIWC 6ESTA 2P59A 4WH8A 1O3KA 3L3TA 1LQEA 4O97A 2SFAA 3BTFE 3SU1A 2ZU5A 3U69H 2TGPZ 1GI9B 5DK1A 1CSOE 2Q6DA 2VWNA 1JRTA 3ZV8A 1ELVA 1WSSH 1D9IA 3QTOH 1CT4E 1F0RA 2HPQH 3EA7A 1TQ0B 4DT7B 1DWEH 4TY7A 1D6WA 3EDXB 2A4OA 1BBRK 2A5AA 5BPEA 1OP2A 3A81A 4JYVH 1DM4B 2AMDA 2PKAB 4J1YA 1L1JA 2A5KA 1ANBA 1VJAU 3V12A 1O39A 2DUCA 2FOBA 2BHGA 1O38A 3V0XA 1EAWA 1NRQH 2GDDA 4H42U 3OYPA 5LGOA 2Q1JA 4AB9A 1B0FA 1C5SA 1K1MA 1UVPA 4Q7YA 5FCKA 2NU2E 5FPTA 2B0FA 1NRRH 1H8DH 1GJ5H 4TPYA 3UQVA 1PPCE 1IQGA 3KCGH 1ZRBA 1GBHA 1DSTA 5A0BA 1X7AC 2PR3A 2QYIA 2ZQ1A 1P03A 4FUGA 1GJCB 3QUMP 1YKTA 2BZAA 2TIOA 4Q2KA 3D62A 1BTHH 1ZPCA 4Z6AH 1KTSB 6GCHG 2EEKA 4IC6A 1GBDA 3VPKA 1V6DA 1MKXK 1O2HA 1HYLA 1WTGH 1AVGH 1GL1A 1MKWH 4ABIA 2VIPA 2ZDAH 2ZKSA 3BF6H 1O2VA 3QGJA 4I8GA 3TJVA 3KQBA 3HGPA 3M3VA 1GBIA 3MU4A 4NZLA 3URDA 2G00A 4WMFA 3FP8E 2QXIA 1A5GH 4DJZB 1CA0B 1MTWA 2FI4E 4HGCA 1AUJA 1P2QA 2J95A 1O2WA 3AASA 1A61H 2ZZUH 1QA0A 2H6MA 2VIDA 2CHAB 1N1LA 1VITG 1SGQE 2PLXA 4DCDA 3MH4A 5L30H 1GHVH 1WYKA 4XDEA 2K1QA 4MVNA 1E35B 1RTLA 1E38B 2ANKH 3SU3A 2PW8H 3LPRA 1HUTH 4X2VA 2BY6X 1DOJA 1KLTA 2BDYA 2WPLS 1C5QA 3T29A 2QC2A 1KLJH 1UTNA 3SNBA 2SGFE 2J38A 2C3SA 4XOJA 1VCWA 1V2RT 2FO9A 1S81A 1QR3E 5FHTA 3STJA 3SNDA 1ZTKA 1SLWB 2O8UA 4CHAC 4A1TA 1Y5AT 1YGCH 4WWYA 1C5NH 3A7WA 2ZFTA 4K8YA 4GCHG 1XVMA 2OXSA 1JOUB 4X8VH 2ZCHP 3A8AA 1ZHMA 4FUDA 2NU4E 3B23B 1AMHA 3H7TA 1C9PA 4YT6H 3ZVFA 1AVXA 5DP5A 2VIVA 3Q00A 2VWMA 1TNJA 1AQ7A 1D6RA 2FS9A 4B73A 1NY22 3TK5A 3SV6A 5DGJA 1TGSZ 1DDJA 3ZZ3A 2BMGB 5HGGA 3SUFA 3KIDU 2GZ9A 1LVMA 1C5TA 3ZVCA 1DX5M 1EZUC 1UO6A 1ZSLA 2V3OH 1QBOA 1UCYE 1TBZH 3MO9A 4XFQA 1NO9H 4E7RG 3GCTG 2BLVA 3ENSB 2TRMA 1GL0E 4HFPB 1O3GA 3TPIZ 3RXCA 2BY7X 1A1RA 1C1VH 1C4V2 5C1UA 1ZMLA 3T25A 3GY3A 1DT2A 2W5EA 5F03A 1FAKH 1N6XA 3UOUA 3S9BA 1TGNA 2CN0H 4NCYA 4JZFH 1YC0A 2PWXA 4MTBA 4X6MA 3UQOA 1G3CA 1ELCA 3GCHC 4MPXA 4ZH8A 3QX5H 1O2NA 1FY4A 3BG8A 1QIXB 1PQ8A 3TU7H 2FM2A 4Y11E 1CBWB 3TVJB 1FONA 1MCVA 1WQSA 2Y81A 1OWIA 1G9IE 6CHAC 3SU6A 2Z9IA 1IQEA 1O3LA 3HPTB 4YOGA 4NFFA 1C2FA 1JIMA 3TGIE 2FMJA 4I31A 5E2PA 1BHXB 2THFB 5AF9H 4ABGA 1PPHE 3P6ZB 4A1XA 3MHWU 5EQRA 4R8TB 1P2JA 2IPHA 1HXEH 2Z7FE 3PYHA 1Z7KA 2ZFFH 2FPZA 1TPSA 2P8OB 3M3TA 2BD4A 1TA2A 3ZVAA 4D7GA 1TMUH 8LPRA 4YLQH 2R9PA 1NN6A 2ZTZA 3F6UH 1GJDB 2G4TA 3L33A 1O2YA 1LHDH 1QURH 1QB1A 1L0ZA 2O8TA 3EE0B 1YPKH 1HNEE 3MU0A 7ESTE 3SHCH 4RKJB 1WOFA 1MCTA 2QF3A 2ZGCA 1XKAC 4LZ1H 1HRTH 2QGRA 2WPIS 3RXQA 4D9RA 4IMQA 3RXTA 1J8AA 1Z1IA 1O3NA 4FU9A 2HALA 1O3DA 2FX6A 2VVCA 4DURA 5JBCS 3F9EA 3ZZ9A 2EI8A 1F7ZA 2CF9H 4FUCA 4A5TS 1FY8E 4U32A 2FOHA 1TPOA 3LJOA 3EQ0H 2XRCA 3ZZ8A 2AERH 4A1VA 1BMNH 5DP3A 1HAVA 4OGXA 5SGAE 2NWNA 4GHQA 4ZUHA 1FY1A 2R3UA 2HNTC 2PFEA 1W8BH 3PWBA 3RU4T 1TRNA 1O5BB 3PWCA 3W95A 3PTBA 3VB6A 1MTVA 2WPMS 2BD2A 1C5UA 4AG1A 3MYWA 4BOHA 2ZG0H 4ZXXH 1QRZA 4YOIA 1BIOA 4KGAA 1P3EA 5F8XA 1AN1E 1GBKA 2FESH 1QA7A 3O8RA 4PROA 1Z71A 2BDCA 2F3CE 1C2EA 2H1UA 2QN5T 3SUGA 2TGAA 3RDZA 2ZF0H 1UCYH 2CF8H 1O3BA 3E1XB 3I78A 2P94A 4Y8XA 4IGDA 1BRBE 4NZQA 2Y7XA 1GI5A 3OTJE 2OD3B 2ZP0H 3RU4D 4X1QU 3TLOA 1HJAB 1LHCH 2ZDNA 4FUEA 1QJ1B 3F1SB 3HK3B 1KXFA 1SHHB 3UREA 3RXRA 3GICB 1NFXA 4D9QA 2F9UA 2FYQA 2CJIA 1RTFB 1AZ8A 1QBNA 4MPUA 4ABAA 4LK4A 4BAOB 1JWTA 2SNWA 1GMCF 2XNIA 4Z0KA 1HAGE 1OWHA 3E90B 1E34B 1V2ST 4AFSA 2GCTB 1CT2E 5T6FA 4UDWH 3UPEA 2H2ZA 1O5GH 1GGDB 4E06H 1O3JA 1UK4A 1OXGA 1C2JA 3PLPA 2HGTH 2ZPRA 4BTUB 2W26A 3EA8A 1AHTH 1H9LB 4Y10E 1G32B 2A4GA 1QRWA 4OGYA 2AMQA 3RXLA 4CBNA 4WH6A 1C2MA 1TALA 1UTLM 2JH6D 2ZGJA 4YT7H 4TWWA 1J15A 3MOCA 2ZNKH 3M35A 3ZV9A 4GHTA 4ZKNU 1GHBF 5A0CA 1SLUB 3DD2H 1O3OA 2HNTE 1BTPA 1ZJDA 1C5PA 1ZMJA 5DKMA 4RN6A 1LHGH 1INCA 3BEIB 3NXPA 4Q7ZA 1RFNA 1AWHB 4IMZA 1Y3WA 1NRSH 2QXJA 1QGFA 3SNAA 1IQIA 1DXPA 1P2NA 2FOCA 2VIWA 1HAHH 3KHVA 2HNTF 2P16A 4YM9A 1O2UA 3ITIA 2GVFA 2V6NA 1KTTB 1YPEH 3GOVB 4X8UH 3UY9A 4XSKU 1TNGA 1ETTH 1KYNA 3TITA 1EOJA 2PTCE 1MTNC 3RMNH 2ASUB 3ZZ5A 4ISIH 3ATKA 1O32A 3RXHA 2IJOB 1CHOF 4K1TA 3DUXH 3MU8A 2OTVA 3MO6A 3ZVGA 1GBTA 3UR9A 3BTTE 4MQAA 4X2YA 1DPOA 1ZPZA 1G2LA 2PGBB 1A4WH 1P3CA 4WF8A 4I8LA 1M9UA 2AFQB 4CRFA 1OS8A 1SGPE 3NPSA 4OS4A 2JH5D 4B2CA 1G36A 3TIUA 1K1IA 2O8WA 4B74A 2AH4X 1UHBB 3M5LA 2EI6A 3PV4A 2J92A 3GY8A 2I6QA 3Q3YA 1P57B 2PKSB 1O3FA 1LHFH 1YPMH 2XC4A 1K9OE 1OSSA 1CE5A 1GG6B 3U8TH 5FXLA 4UE7H 2WYJA 3C27B 4CR9A 1OWJA 3S9AA 1V2KT 1C1RA 1TE0A 2QV1A 1ETSH 1C2HA 1B0EA 1AB9B 2GV7A 4RKOB 1OYTH 1J14A 3BSQA 1TGCA 2C93B 1PPBH 2Z3CA 2AIPA 1P0SH 1K1OA
chains in the Genus database with same CATH superfamily
3RUOA 5JYIA 2ODYB 4ACBA 3P17H 1AIXH 1ZYOA 5T6GA 3M7TA 1Z6JH 5GPIB 1IQNA 1V2UT 1AUTC 2LELA 1NFUA 1O36A 3RXGA 4H4FA 2W7UA 1Q3XA 3F9GA 1BB0B 2R2WU 3LC5A 4VGCC 2RDLA 1AE5A 1OYQA 3ZIAD 4H6TA 1O2MA 3MMGA 2M5TA 1LPGB 1GPZA 4HTCH 2PV9B 2GCHG 2F9VA 3SBKA 1V2QT 2YNAA 1UTJA 4BXSA 1OX1A 3GDUA 3DFJA 1P9SA 2GDEH 3A83A 2BOHB 4ISOA 1SQAA 2AGEX 2Z9GA 1O5FH 1CO7E 2ZO3H 3GY4A 4B2BA 1O5AB 2KAIA 2H9EH 2JIZD 1BDAA 1TX7A 3AW1A 3DSOA 5EJ1A 1GVKB 4X1NU 5EU8A 1CGJE 3E91A 4DVAU 2V35A 3F2FA 4MNVA 1P12E 1RJXB 2BD7A 4FXGH 1LHEH 3GCOA 4JZIA 4CR5A 2XBVA 1KXEA 1AKSB 1ESBA 1UVOA 2FIRH 2ZPQA 7GCHG 3Q3XA 3RU4E 5EJZA 3QGNB 1V2JT 1BQYA 1KXAA 5EOKA 1C1TA 4JZEH 2J98A 2UUYA 4Y0ZE 1C2IA 1CBWC 1F5RA 1GDQA 2IN2A 3PM3A 1MKWK 3BTGE 4M7GA 2EC9H 3D23A 1LCYA 1K1NA 3GYMA 3SORA 1BTUA 2F9BH 2GX4A 2YNBA 1AFQB 2G55A 2JETC 3KYFA 5EPYA 1BMLA 1L2EA 1IAUA 3VG8A 1GMDF 3SI4H 1A2CH 3V7TA 3ZYDA 2J4IA 1O2GH 1NC6A 2HWLB 2KCPA 1NT1A 2FOAA 1OHHD 2ZU3A 3E6PH 3SO3A 3RP2A 2L6OA 2AHME 1ABJH 1D3DB 1PFXC 1SGTA 2XCNA 1EZXC 1HJ9A 1J16A 4K1SA 4DG4A 1MTUA 2BLOA 1DS2E 1PYTC 3U98H 5AHGH 3TH3H 2OCVB 3TJNA 1LDTT 4B2AA 4K3JA 1ABIH 1T8OA 3RLWH 1SSXA 3KGPA 4NIXA 5GCHF 4WMEA 5G4BA 2ANWA 3SJIA 1FMGA 2KFWA 5CDFE 3A87A 4BAQB 4B71A 2BDAA 3GCNA 3RC6A 1DITH 2A2XH 5EG4A 1C4Y2 3QO6A 5DP9A 5C0TA 2XTTB 5F8ZA 1HAYB 3VB3A 3A84A 1S85A 1A3BH 1HJ8A 2DE9A 5A8XA 3A7VA 2BQ6B 5LPEA 1THSH 2ZHWH 1V2WT 1MTSA 1EP6A 3A89A 1EZQA 1HFDA 2ALVA 2BQ7B 1BOQA 1T4UH 2WYGA 2QCYA 2LNCA 1P2IA 2XOKD 3VFEA 2SNVA 3BTHE 1GJ9B 3QLPH 3OE7D 1SGIB 1GBAA 4ABJA 2FDAA 1TFXA 1H9HE 3LDXH 2KM0A 1LMWB 2C8XB 3MFJA 2D26C 1TX6A 3L6PA 4Q80A 1O2QA 3VGCC 1O5EH 3MU5A 4ZCNA 1FV9A 2Y82A 4KELA 5B6OA 2TBSA 1W3CA 5CHAC 1ELDE 5ESTE 1Y8TA 2OK5A 5CMXH 3F3BA 3MNXA 3RXUA 1T4VH 1MBQA 2P95A 2BDHA 2CXVA 3HK6B 2ZGXH 3GDSA 1ARBA 2ZCLP 5AVDA 1MQ6A 3KQDA 3D49H 1MU8B 1HCGA 4ABFA 4I7YH 1ZSJA 4BAHB 1WTHD 2BTCE 3LOXA 1UJ1A 1B5GH 1L4DA 2XC5A 4KKDA 3KQCA 3OSYA 1GHZA 4MPWA 4Q7XA 1BHXF 2OC8A 1QCPA 4NA8A 3MWIU 3F9FA 1W0ZU 2R0KA 1GI2A 4AYYB 2ZU2A 1HBTH 4A6LA 4JK5A 1G3DA 2P3FH 4Y8YA 4YTAA 3M61U 2JDID 2B7DH 1MKXH 1K0HA 3EGKH 1FPCH 1PPEE 3SJKA 1SPJA 1LPKB 1YM0A 1G3EA 2Y80A 2PSXA 3BTWE 2PUXB 5T6DA 1HAZB 3GISB 2ZPSA 1A7SA 4ESTE 1C1WH 2VJ1A 1CGHA 4K69A 2CMYA 3SUEA 1H4WA 1O35A 1L1NA 2OBOA 4Y8ZA 1RRKA 1MH0A 3RM2H 3SUDA 2BDGA 3PROA 4ACAA 4DGJA 1AD8H 1TPAE 1EX3A 4U30A 3LONA 3ZZBA 1EJNA 3RXJA 1C2GA 4NG9H 3QWCH 3VB4A 5EODA 1DFPA 2HVXA 3E3TA 3NKKA 3KNXA 3VXFH 1Y5UT 1W13U 3EAJA 2HOBA 1Z8JB 1NESE 2GTBA 4I86A 3A82A 1C4U2 1P8VC 3RXVA 8GCHF 1TNHA 3Q76A 4X8TH 5DP4A 1DVAH 1V2MT 2B9LA 1HPGA 3F2HA 1SMFE 4JK6A 1BRAA 2PP6A 2QIQA 2VB0A 2XBWA 4GLYA 3DHKH 2ZFPH 3S0NA 1ELTA 2YMSB 1RD3B 5ABWA 1XVOA 4DIIH 5HXFA 4B6EA 4CRBA 1LQDB 1ORFA 5GWZA 1KDQA 4NSVA 4F49A 1G30B 3O8BA 1NFWA 1RIWB 2OC1A 1S83A 5FL7D 1EP5A 1L4ZA 2STBE 5K7RA 4IN1A 3PMHB 2M2AA 4ABHA 2XBXA 1SGRE 3STIA 1YPLH 1YBWA 3A80A 1FLEE 3N7OA 4CBOA 1KY9A 1XMNB 3PMAB 1BITA 1HAIH 2BVXH 3F0OA 2JKHA 4AGJA 1F2SE 3CNRA 1N8OC 3F0PA 4GCHF 1S0QA 3MO3A 3M36A 3P95A 3DCLA 4RT1A 1TMTH 2VH0A 4K2YA 4BAKB 5C17A 3P8FA 1S5SA 3ZVBA 2UUKB 1NS3A 1Y3XA 1WV7H 5DO4H 1Q2WA 3Q77A 4B75A 1MD7A 5H4IB 1F0UA 3ZYEA 1LKAA 1FI8A 1Y5BT 3M37A 2SGPE 2B5TB 3A8CA 1UCYK 2OINA 1ESAA 4IS5A 2Y5GA 3A7YA 2VGCC 1CQQA 1O3AA 3OEHD 2J94A 4M9FA 1WQVH 4SGBE 5F53A 4BTTB 1PPZA 1ZGIA 1UTQA 2F9PA 1GWAA 2GD4B 3QTVH 3RMOH 2O8MA 1ZZZA 1GMCG 1SL3A 1ELEE 2QF0A 1C5MD 5FBEA 1DWDH 1XX9A 1WAYB 1DLEA 1W7GH 1LPZB 1P9UA 1O3MA 2Y7ZA 4ZKSU 2BX3A 2H5CA 2H9TH 3SGQE 2XCFA 5LH8A 5FX5A 5I46H 2C8WB 2WINI 5JB9S 3B9FH 1EPTB 4X2XA 1QQUA 1QFKH 1FN6A 4NWKA 3K9XB 3ZZDA 5AFYH 2FZZA 4NA9H 1EKBB 3O8DA 1W2KH 3BG4C 2ZECA 3R0FA 3E8LA 2A4RA 3P8GA 1TMBH 1N6YA 2BD3A 2ODPA 3SNEA 2F83A 4AFQA 1YWUA 2FEQH 4DW2U 1P05A 4KP0A 1GHBG 1QNJA 2OP9A 1AWFH 1FN8A 4U01A 3OX7U 1TA6A 1YCPH 1BMAA 5FX6A 4AFUA 4AGKA 1CHGA 1VGCB 4Y71A 1C5XB 2RA3A 3BN9A 3ESTA 3M5OA 1QB6A 1O0DH 2O8LA 1LKBA 4YZUA 2FS8A 3PB1E 4I8KA 4NIYA 3SV2H 3SZEA 3VB7A 1Y3YA 1YY3A 1OPHB 1OWEA 1GBBA 4WXVA 2QE7D 4DIHH 1HV7A 2FLRH 4MNXA 3RM0H 1QJ7B 4X6OA 4K8BA 4JZ1A 2A45B 1QQ4A 4HZHA 2WPJS 1K1PA 2QXGA 2D8WA 1GBJA 1UTPA 4AC9A 1P04A 3SNCA 3A7XA 5CHBA 1FAXA 1OP0A 1QHRB 2OC0A 2JH0D 2A31A 2PUQH 2WUCA 3GY7A 3T2NA 2C90B 1TGBA 5C94A 3TK9A 2ZFQH 4XBCA 1CHOG 4LZ4B 8KME2 1LO6A 2FOEA 2GMTB 4AG2A 4CHAB 4CH8B 1SQRA 1ELGA 3RXOA 2BD9A 2G81E 3ATLA 3PRBA 9LPRA 4Y7AA 2FTMA 1JIRA 3S7KB 1O2SA 1YYY1 2OUAA 2RCEA 1EATA 1NROH 3A86A 1S6FA 4CRCA 1HIAB 3RXBA 3SI3H 3KEEA 2XC0A 1ANEA 5JBTA 4YOJA 1O2JA 2J2UA 2QAAA 4INLA 9ESTA 1BZXE 3H5CB 3LGYA 1TONA 3SZNA 5DPAA 3U28C 4ZKOU 3QDZB 4AFZA 3ZZ6A 1GHAF 1QBVH 3PTNA 5PTPA 2G51A 3TNSA 2KZ4A 2OBQA 1QTFA 1GDNA 2Y5HA 1YPHC 5L2ZH 1GJ7B 5DN6D 2J34A 5FBIA 3B8JA 2P3TB 3JZ2B 1PPFE 4KTUA 1ETRH 2Z9KA 3KF2A 5J4SA 1OKXA 1F5KU 3KL6A 1QZ8A 3SOSA 1O30A 2BLWA 1EASA 1QY6A 2BX4A 4FUIA 3U1JB 1XUGA 3CENA 5IYTA 2V7QD 2CV3A 4I8JA 3VB5A 3U8OH 3UNSA 2XWAA 1XKBC 1ZTJA 1GCTB 4INKA 3ATWA 1W0KD 1AY6H 1C5ZB 5B6LA 5L6NH 3GCHB 1YF4A 1J17T 1YP9A 2A32A 2I6SA 1TNLA 1FJSA 4XE4A 3SV9A 1O2TA 1SOTA 2D2DA 1GI7B 1J9CH 3M3SA 1ELAA 1TBRH 4JYUH 5C3NA 1IQFA 3U1IB 6CHAB 1FX0B 4FUBA 3GY2A 1O31A 1Y3VA 4UFDH 4X1RU 1BTZA 3ZVEA 1CA0C 1QB9A 1SLXB 5C0UA 4LOYH 1AVWA 5AFZH 2B8OH 4Y7BA 2CHAC 4IC5A 3K6YA 1GMHG 4ZAEA 2ZDKA 1BCUH 1V2VT 4XBBA 2FI5E 1V2OT 2Z6BD 3CP7A 1P09A 1W11U 2BB4A 2ZHEH 5FPSA 4BXWA 4MNYA 1H8ED 2AEIH 4NWLA 1HDTH 4FU7A 2KAIB 1TB6H 1W12U 3SJ8A 4LXBH 2KCOA 1AGJA 1O3IA 2WPHS 1WBGB 1QL7A 5FPYA 1LTOA 2Y6TA 1ZPBA 1MU6B 1UVSH 1O5DH 5GJ4B 3AAVA 1SVPA 3H7OA 4D7FA 2V0BA 2YOLA 1NFYA 2JJ1D 1PQAA 3A8BA 1DICA 3MH7A 2BYAX 4X8SH 1COWD 1C1SA 3SV7A 1YPHE 3SU0A 1KXDA 4RI0A 3I29A 1FIZA 4A7IB 3W94A 3BTDE 3D65E 4CH2B 1GVZA 2A2QH 2SGAA 1ANDA 2ZU4A 1C1QA 1SG8B 1C5VA 4X0WU 4ZHLU 1GMDG 1PQ5A 1TIOA 1BBRE 4FVDA 1TWXB 1ZTLA 2AIQA 4Q4LA 1UTOA 3M7QA 1GJAB 1T8MA 2BQWB 4TYDA 3UUZA 4AX9H 3EA9A 4QT8C 1SQTA 4YXWD 3SU2A 4ZKRU 1DY9A 1ZHPA 1MZAA 1NU7B 1THPB 2ZCKP 3FANA 1G2MA 1BA8B 2PHBA 2KR7A 1U6QA 4GUXA 4X1SU 1Z8IB 1E0FD 4ZMAH 2PGQB 4MLFB 3A88A 3TJUA 3QN7A 5A09A 1BTWA 5L2YH 2OLGA 1UTKA 1EFRD 2ESTE 5TJXA 4GSOA 2A1DB 1C5RA 1FQ3A 1GI0A 1O3EA 2Z94A 5GCHG 2FXRA 4OS1A 4FUHA 2TGTA 3ZZAA 2NU1E 3FO8D 3BTEE 4WXIA 1SOZA 1QL9A 1K2I1 1XM1A 4ZHMU 1DANH 3ZZ4A 1A0LA 1C9TA 2BLQA 5CE1A 2FOFA 1GVLA 3PO1B 2ILNA 4WY3A 1GJBB 1UHBA 3T26A 4NIVA 2G52A 5KGOA 1O37A 4WJG2 3PLKA 5A2MH 2WZQA 1F92A 1O2XA 2C8ZB 2BVSH 1IQKA 1L1GA 2A7JA 4ASHA 1IQJA 3LJJA 4NSYA 1O34A 1AFEH 1EJAA 2BOKA 2GZ7A 3V13A 4NGAH 1GI1A 1ID5H 5BRRE 1D3TB 4ABBA 1EB1H 1C2LA 3LKWA 2P3UB 3SU5A 5J4QA 3TK6A 1TNIA 3LGIA 4O9VA 5HIZA 4CRGA 1LVYA 2G5VA 1G3BA 1O2KA 1DSUA 3K2UA 4X6PA 1P10A 3SW2B 5C2ZA 1P11E 1FPHH 3A7ZA 2VWOA 1UMAH 1GBMA 1TNKA 1TPPA 3TGJE 4XRNA 2A5IA 2P8OC 4I32A 3VXEH 2ZI2H 2ZTYA 1NU9A 1W10U 1C2KA 1S82A 3DSPA 2VNTA 3RMMH 4RSPA 5C67A 1S6LA 1D4PB 3G01A 1BTYA 3MTYA 2P93A 2ZGHA 5GDSH 1TYNA 1W7XH 2R0LA 3R3GB 5FCRA 4A92A 3URCA 4B76A 2FX4A 1DLKB 3QK1A 1CU1A 4HG6A 2W3KA 4UD9H 1T8NA 4JCNA 1FY5A 3P8OA 4CRDA 2GCHF 4J2YB 2VWLA 2V3MA 3DA9B 2QA9E 3SGBE 1F0SA 2XYAA 3AAUA 4UFGH 4X6NA 4UEHH 2ZDMA 5IDKA 1WUNH 1A46H 1V3XA 1VZQH 3FP6E 3OY5U 4GAWA 4Y6DA 1ZSKA 4SGAE 3AW0A 1EUFA 1CGIE 3PMBB 1GBCA 2Q6GA 2HRVA 1C1OA 2F9OA 4BAMB 1EPTC 1AKSA 1RTKA 2RG3A 4IW4E 5C1XA 1MTNB 1E1QD 5EW2H 1D3PB 4KTSA 2ODQA 4JMYA 2Z9JA 4CREA 3QZRA 3NUMA 2BDBA 2VVUA 3AK5A 1BBRH 2H9HA 7GCHF 1GBEA 1QJ6B 1O2IA 5E8EH 4Y76A 2UUJB 1OP8A 4DY7B 2A7CA 1KSNA 1MAXA 3HGNA 1VGCC 4XBDA 1O2LA 1UVTH 2K0QA 1DWCH 1THRH 1T31A 8GCHG 3BEUA 2EA3A 4BTIB 1AE8H 2PKAA 1YLNA 2VVVA 4Y79A 2V3HH 3GS9A 2VIQA 3BIUH 4HI3A 1A3EH 4MNWA 4NA7A 3S69A 1C5OH 3RLYH 5HYOA 2SGQE 4TY6A 2WV4A 3BIVH 4K5ZA 3LT3A 1KIGH 3A8DA 4Z1MD 3W1EA 3OAAD 2AS9A 3FP7E 1HJAC 3UIRA 7KMEH 1AI8H 1GI8B 2RDEA 4AYVB 2EY4C 2OQ5A 1A0HB 4FVBA 2TGDA 1PJPA 2C8YB 1SLVB 1TX8A 2PTNA 4OS7A 1H9IE 1W0JD 1C5YB 2ZEBA 3P70B 2ZQ2A 1MZDA 1NRNH 3RXFA 1C1PA 4GPGA 2STAE 1K28D 3LH3A 1YCPM 1KDQB 4ZHAA 2QY0B 2FOMB 3SHAH 1IOEA 3SJ9A 5HMAA 4FUJA 4WVPE 2ZDLA 2GCTC 4WMDA 2Y5FA 1MQ5A 3UR6A 5EPNA 1GGDC 2R2MB 2GMTC 1SGEE 4OS5A 1O3CA 1SGFA 2FTLE 1T7CA 1SR5C 1A5IA 1Y59T 2BXUH 5EGMA 6GCHF 2AYWA 1ELFA 1MUEB 1TRYA 1GBFA 1EAXA 2KCYA 2Z3DA 3ZZCA 4E7NA 3S7HB 2G5NA 3UNRA 2ZFSA 3RXSA 4TWYA 4Y0YE 3P8NA 2GGVB 4VGCB 2FP7B 1AU8A 3RXEA 3TNTA 4UFEH 1HAXB 1WCZA 1ZMNA 1ZJKA 4JYTA 1RXPA 7LPRA 2ALPA 1P2MA 2HLDD 4O3TA 3ATMA 2UWOA 1Y3UA 1F0TA 2H5DA 3WW7A 1A5HA 2UWLA 1SQOA 1HLTH 1IHSH 2FI3E 1TOMH 1C5WB 2GT8A 1VR1H 1NBMD 3CS0A 2GT7A 2BXTH 4F4OC 1UK3A 4D76A 1GI3A 1VCQA 5HM9A 1VITF 1SKYE 3EYDA 3DFLA 3IITA 1SHYA 1TABE 2GV6A 3TH4H 3F2GA 1XUKA 3UWJH 1BMMH 2JJ2D 1HAVB 1O5CB 3P92A 3TH2H 1CA8B 1GCTC 4AZ2B 1IQMA 2VU8E 1P2OA 2BY8X 3MH5A 1DXWA 3LGUA 1EXFA 4K1EA 5C20A 1EOLA 2UWPA 1ACBE 2XNDD 3A7TA 1O3HA 2ZHFH 3VEQB 2WSSD 3JZ1B 5JB8S 4YO9A 5A0AE 5F6MA 3M5NA 3FZZA 2DE8A 1RGQA 2C4FH 5EQQA 1UK2A 3FFGA 2ZDVH 5EXNA 2JETB 1BMFD 3BTME 3MI4A 4DOQA 1SGCA 3UOPA 1YCPK 2AMPA 2FLBH 4AB8A 5LPFA 2PSYA 1HAOH 2J9NA 5JPMH 3BTKE 1E37B 1TGTA 2TPIZ 2BM2A 2VH6A 5JBAS 1OWKA 2Z9LA 3WY8A 1S6HA 3LGTA 2FWWA 3E0PB 2BD8A 1GHYH 1BJVA 5DP8A 2PKSC 1YLCA 1K22H 2BD5A 3LH1A 3SV8A 4OM9A 4THNH 1GG6C 5EW1H 5TCAA 1ZGVA 3GCTF 1DY8A 2IOTA 8ESTE 2GZ8A 1AB9C 3OU0A 4H6SB 2A4QA 1H1BA 1IQLA 1HB0B 1MABB 1QRXA 4CRAA 1D3QB 1OOKB 2ZTXA 1GHXH 2D1JA 3SJOA 4KTCA 5EIYA 3E0NB 5DG6A 4UONA 1C1MA 2HLCA 1NTPA 1V2PT 3HKJB 4MPVA 1BRUP 4JZDH 1K1LA 4R0IA 1W14U 2RFKC 1GBLA 1K1JA 1WDIA 3ELAH 2ZHQH 1MAYA 1TLDA 2F91A 1JRSA 2Z3EA 4YESB 5EXLA 1GHAG 3FKSD 3N99A 3IWMA 5ETXA 3CS7A 5T3HA 4D8NA 1DUEA 3GY6A 1XXFA 4IN2A 5EQSA 1XUIA 2OC7A 3GYLB 3TGKE 1C1UH 2F43B 2GJGA 1P2KA 1O2OA 1K21H 2G8TA 1VITH 1FIWA 3VGCB 3FAOA 4GVUA 2BZ6H 4XD7D 2W7SA 3T28A 3NK8A 5CHAB 1PQ7A 3SQEE 3LGWA 3BEFB 2IJD1 1TAWA 5HKKD 1Z8RA 4BANB 1G37A 3C1KA 3GY5A 2CGAA 3SGAE 3ZVDA 3SN8A 1LVBA 3FVFB 5JBBS 3LIWA 1QL8A 3PO1C 3ODDA 4ABEA 2HPPH 3MNBA 1UTMA 2BDIA 4AORA 4UFFH 1HAPH 5ESBA 3F68H 3MNSA 1YPGH 1YLDA 1JMOH 5JDUB 1TBQH 1GI4A 1C1NA 3KYGA 3S9CA 2GKVE 1IHTH 4ASUD 2UUFB 1GDUA 2ZIQH 1Z1JA 2NU0E 3UNQA 2FYRA 1AFQC 2NU3E 4X1PU 1BUIA 3RXPA 5DP6A 1TQ7B 3FZDA 3KN2A 1O3PB 3PMJA 1EPTA 1EB2A 1GI6A 1E1RD 1P01A 1GJ6A 1GHWH 1FXYA 3IG6B 5A8YA 5FAHA 2Q6FA 1XUJA 1GJ8B 1HGTH 4B6FA 2ZU1A 4ABDA 1MD8A 4I33A 5E0HA 5HM2A 1S84A 3M7UA 1SGYE 1O2PA 4TT3D 1SC8U 5C1YA 1B7XB 4MDSA 2WV9A 4X2WA 3RC4A 5I25A 1TRMA 1Z6EA 3BTQE 1CT0E 1SGDE 1EZSC 3RXKA 4MG3A 2EQNA 2EI7A 2BVRH 2W6JD 4ZXYH 1EAIA 5LPRA 2YMSD 1UVUH 1W0YH 1XUFA 3K65B 1WU1A 3I77A 2WUBA 5K0HA 3U9AH 1P02A 1VCPA 4ISLA 2ZC9H 5F8TA 3SU4A 1PPGE 1TOCB 3GDVA 2ZHDA 2QXHA 1VJ9U 4FUFA 3LC3A 1DE7H 5KEDA 2XXLA 1C2DA 5E0GA 1O33A 3RC5A 1NBME 3MU1A 1DUAA 3RXMA 1T8LA 2XBYA 3ATIA 2GP9B 1XXDA 1MMJN 1P06A 1SFIA 2FOGA 1A0JA 3MH6A 2LP6A 1ZLRA 3UTUH 2G4UA 1F5LA 1AO5A 1SBWA 4FU8A 2W3IA 3O8CA 5IK2D 1GCDA 2QF5A 5A8ZA 3T62A 1O2ZA 3HKIB 1GJ4H 2WPKS 1RS0A 2WV5A 1SGFG 2XW9A 3NWUA 1Z8GA 3LGVA 1ARCA 1N8OB 1ELBA 4NFEA 4E05H 4B1TA 1O2RA 3UFAA 4ISNA 4DT4A 1HIAA 4TPIZ 2F9NA 3Q3KA 1FNIA 2VIOA 2BY5X 1SFQB 4U2WA 1CVWH 3RXDA 2ANMH 3ODFA 1NZQH 1KXBA 1SGNE 4NIWA 2SGDE 3AVZA 5C5OA 1FY3A 1MBMA 2BY9X 1SB1H 2VINA 5GXPA 1BRCE 2VGCB 3BV9B 1PYTD 1V2TT 1SI5H 5E0JA 3T5FH 5DP7A 1ZOMA 3DT0H 2RA0A 4ISHH 3SQHE 2AGGX 3UWIA 1V2NT 2J98B 1H8IH 1ESTA 3F9HA 3TJOA 3RXAA 1ZHRA 4O3UA 4K60A 5DJ7A 3QZQA 1FUJA 2ZWLH 1Q31A 1S0RA 4YLUA 2A0QB 1C5LH 3NCLA 3U8RH 5E2OA 3BG4B 5EXMA 1V2LT 4OS2A 1FDPA 3KQEA 4I8HA 3E16B 4F55A 2ZFRH 2ZA5A 1KLIH 1YPJH 3HATH 3PLBA 3K6ZA 1OWDA 2ULLA 3RXIA 2OQUA 1KXCA 4FOUC 2R3YA 4OS6A 1AZZA 1ZRKA 3A85A 5GIBA 1E36B 5C5NA 1HXFH 1BT7A 3MNCA 1XUHA 1EJMA 1BJUA 2F4LA 4O03A 3RMLH 4AN7A 1NM6A 3OY6U 1FZZA 1JXPA 2O9QA 6LPRA 2FODA 3LU9B 2ANYA 2SGEE 2ZGBH 5TCCA 1EAUA 4INHA 1JBUH 1T32A 2XWBI 3V3MA 3WWBA 3T27A 1ANCA 1GMHF 4BNRA 2CK3D 2A7HA 4IBLH 4AOQA 2YMSC 3M5MA 3ZZ7A 1NRPH 2LPRA 2AGIX 1BTXA 4ZROA 1NPMA 1LVOA 1ZR0A 1EQ9A 3NZIA 1IQHA 1DWBH 1RIWC 6ESTA 2P59A 4WH8A 1O3KA 3L3TA 1LQEA 4O97A 2SFAA 3BTFE 3SU1A 4F48B 2ZU5A 3U69H 2TGPZ 1GI9B 3MQKC 5DK1A 1CSOE 2Q6DA 2VWNA 1JRTA 3ZV8A 1ELVA 1WSSH 1D9IA 3QTOH 1CT4E 1F0RA 2HPQH 3EA7A 1TQ0B 4DT7B 1DWEH 4TY7A 1D6WA 3EDXB 2A4OA 1BBRK 2A5AA 5BPEA 1OP2A 3A81A 4JYVH 1DM4B 2AMDA 2PKAB 4J1YA 1L1JA 2A5KA 1ANBA 1VJAU 3V12A 1O39A 2DUCA 2FOBA 2BHGA 1O38A 3V0XA 1EAWA 1NRQH 2GDDA 4H42U 3OYPA 5LGOA 2Q1JA 4AB9A 1B0FA 1C5SA 1K1MA 1UVPA 4Q7YA 5FCKA 2NU2E 2VBCA 5FPTA 2B0FA 1NRRH 1H8DH 1GJ5H 4TPYA 3UQVA 1PPCE 5GNDA 1IQGA 3KCGH 1ZRBA 1KMHB 1GBHA 1DSTA 5A0BA 1X7AC 2PR3A 2QYIA 2ZQ1A 2L74A 1P03A 4FUGA 1GJCB 2QF4A 3QUMP 1YKTA 2BZAA 2TIOA 4Q2KA 3D62A 1BTHH 1ZPCA 4Z6AH 1KTSB 6GCHG 2EEKA 4IC6A 1GBDA 3VPKA 3PV2A 1V6DA 1MKXK 1O2HA 1HYLA 3FOAA 1WTGH 1AVGH 1GL1A 1MKWH 4ABIA 2VIPA 2ZDAH 2ZKSA 2IPQX 3BF6H 3EE7A 1O2VA 3QGJA 4I8GA 3TJVA 3KQBA 3HGPA 3M3VA 3N7DA 3UAIC 1GBIA 3MU4A 4NZLA 3URDA 2G00A 4WMFA 3FP8E 2QXIA 1A5GH 4DJZB 1CA0B 1MTWA 2FI4E 4HGCA 1AUJA 1P2QA 2J95A 1O2WA 3AASA 1A61H 2ZZUH 1QA0A 1VKYA 2H6MA 2VIDA 2CHAB 1N1LA 1VITG 1SGQE 2PLXA 4DCDA 3MH4A 5L30H 1GHVH 1WYKA 4XDEA 2K1QA 4MVNA 1E35B 1RTLA 1E38B 2ANKH 3SU3A 2PW8H 3LPRA 1HUTH 4X2VA 2BY6X 1DOJA 1KLTA 2BDYA 2WPLS 1C5QA 3T29A 2QC2A 1KLJH 1UTNA 3SNBA 2SGFE 2J38A 2C3SA 4XOJA 1VCWA 1V2RT 2FO9A 1S81A 1QR3E 5FHTA 3STJA 3SNDA 1ZTKA 1SLWB 2O8UA 4CHAC 4A1TA 1Y5AT 1YGCH 4WWYA 1C5NH 3A7WA 2ZFTA 4K8YA 4GCHG 1XVMA 2OXSA 1JOUB 4X8VH 2ZCHP 3A8AA 3OEED 1ZHMA 4FUDA 2NU4E 3B23B 1AMHA 3H7TA 1C9PA 4YT6H 3ZVFA 1AVXA 5DP5A 2VIVA 3Q00A 2VWMA 1TNJA 1AQ7A 1D6RA 2FS9A 4B73A 4FETA 1NY22 4TSFD 3TK5A 3SV6A 5DGJA 1TGSZ 1DDJA 3ZZ3A 2BMGB 5HGGA 3SUFA 5DSFA 3KIDU 2GZ9A 1LVMA 1C5TA 3ZVCA 1DX5M 1EZUC 1UO6A 1ZSLA 2V3OH 1QBOA 1UCYE 1TBZH 3MO9A 4XFQA 1NO9H 4E7RG 3GCTG 2BLVA 3ENSB 2J97A 2TRMA 1GL0E 4HFPB 1O3GA 3TPIZ 3RXCA 2BY7X 1A1RA 1C1VH 1C4V2 5C1UA 1ZMLA 3T25A 3GY3A 1DT2A 2W5EA 5F03A 1FAKH 1N6XA 3UOUA 3S9BA 1TGNA 2CN0H 4NCYA 4JZFH 1YC0A 2KX4A 2PWXA 4MTBA 1H8HD 4X6MA 3UQOA 1G3CA 1ELCA 3GCHC 4MPXA 4ZH8A 3QX5H 1O2NA 1FY4A 3BG8A 1QIXB 1PQ8A 3TU7H 2FM2A 4Y11E 1CBWB 3TVJB 1FONA 1MCVA 1WQSA 2Y81A 1OWIA 1G9IE 6CHAC 3SU6A 2Z9IA 1IQEA 1O3LA 3HPTB 4YOGA 4NFFA 1C2FA 1JIMA 3TGIE 2FMJA 4I31A 5E2PA 1BHXB 2THFB 5AF9H 4ABGA 3NRLA 1PPHE 3P6ZB 4A1XA 3MHWU 5EQRA 4R8TB 1P2JA 2IPHA 1HXEH 3N7EA 2Z7FE 3PYHA 2WPDD 3OFND 1Z7KA 2ZFFH 2FPZA 1TPSA 2P8OB 3M3TA 2BD4A 1TA2A 3ZVAA 4D7GA 1TMUH 8LPRA 4YLQH 2R9PA 1NN6A 2ZTZA 3F6UH 1GJDB 2G4TA 3L33A 4P02A 1O2YA 1LHDH 1QURH 1QB1A 1L0ZA 2O8TA 3EE0B 1YPKH 1HNEE 3MU0A 7ESTE 3SHCH 4RKJB 1WOFA 1MCTA 2QF3A 5EJLA 2ZGCA 1XKAC 4LZ1H 1HRTH 2QGRA 2WPIS 3RXQA 4D9RA 4IMQA 3RXTA 1J8AA 1Z1IA 1O3NA 4FU9A 2HALA 1O3DA 2FX6A 2VVCA 4DURA 5JBCS 3F9EA 3ZZ9A 2EI8A 1F7ZA 2CF9H 4FUCA 2KCAA 4A5TS 4P00A 1FY8E 4U32A 2FOHA 1TPOA 3LJOA 3EQ0H 2XRCA 3ZZ8A 2AERH 4A1VA 1BMNH 5DP3A 1HAVA 4OGXA 5SGAE 2NWNA 4GHQA 4ZUHA 1FY1A 2R3UA 2HNTC 2PFEA 1W8BH 3PWBA 3RU4T 1TRNA 1O5BB 3PWCA 3W95A 3PTBA 3VB6A 1MTVA 2WPMS 2BD2A 1C5UA 4AG1A 3MYWA 4BOHA 2ZG0H 4ZXXH 1QRZA 3PV5A 4YOIA 1BIOA 4KGAA 1P3EA 5F8XA 3DSGA 1AN1E 1GBKA 2FESH 1QA7A 3O8RA 4PROA 1Z71A 2BDCA 2F3CE 1C2EA 2H1UA 2QN5T 3SUGA 2TGAA 3RDZA 2ZF0H 1UCYH 2CF8H 1O3BA 3E1XB 3I78A 2P94A 4Y8XA 4IGDA 1BRBE 4NZQA 2Y7XA 1GI5A 3OTJE 2OD3B 2ZP0H 3RU4D 4X1QU 3TLOA 1HJAB 1LHCH 2K8IA 2ZDNA 4FUEA 1QJ1B 3F1SB 3HK3B 1KXFA 1SHHB 3UREA 3RXRA 3GICB 1NFXA 3UB0A 4D9QA 2F9UA 1UW7A 2FYQA 2CJIA 1RTFB 1AZ8A 1QBNA 4MPUA 4ABAA 4LK4A 4BAOB 1JWTA 2SNWA 1GMCF 2XNIA 5HIYA 4Z0KA 1HAGE 1OWHA 1E79D 3E90B 1E34B 3KQ5A 1V2ST 3FN8A 4AFSA 2GCTB 1CT2E 5T6FA 4UDWH 3UPEA 2H2ZA 1O5GH 1GGDB 4E06H 1O3JA 1UK4A 1OXGA 1C2JA 3PLPA 2HGTH 2ZPRA 4BTUB 2W26A 3EA8A 1AHTH 1H9LB 4Y10E 1G32B 2A4GA 1QRWA 4OGYA 2AMQA 3RXLA 4CBNA 4WH6A 1C2MA 1TALA 1UTLM 2JH6D 2ZGJA 4YT7H 4TWWA 1J15A 3MOCA 3WWFA 2ZNKH 3M35A 3ZV9A 4GHTA 4ZKNU 1GHBF 5A0CA 1SLUB 3DD2H 1O3OA 2HNTE 1BTPA 1ZJDA 1C5PA 1ZMJA 5DKMA 4RN6A 1LHGH 1INCA 3BEIB 3PRDA 3NXPA 4Q7ZA 1RFNA 1AWHB 4IMZA 1Y3WA 1NRSH 2QXJA 1QGFA 3SNAA 5KECA 1IQIA 1DXPA 1P2NA 2FOCA 2VIWA 2HVYB 1HAHH 3KHVA 2HNTF 2P16A 4YM9A 1O2UA 3ITIA 2GVFA 2V6NA 1KTTB 1YPEH 3GOVB 4X8UH 3UY9A 4XSKU 1TNGA 1ETTH 1KYNA 3TITA 1EOJA 2PTCE 1MTNC 3RMNH 2ASUB 3ZZ5A 4ISIH 5T1VA 1WXRA 3ATKA 1O32A 3RXHA 2IJOB 1CHOF 4K1TA 4Q63A 3DUXH 3MU8A 2OTVA 3MO6A 3ZVGA 1GBTA 3UR9A 3BTTE 4MQAA 3SYJA 4X2YA 1DPOA 1ZPZA 1G2LA 2PGBB 1A4WH 2J5UA 1P3CA 4WF8A 4I8LA 1M9UA 2AFQB 4CRFA 2WHXA 1OS8A 1SGPE 3NPSA 4OS4A 2JH5D 4B2CA 1G36A 3TIUA 1K1IA 2O8WA 4B74A 2AH4X 1UHBB 3M5LA 2EI6A 3PV4A 2J92A 3GY8A 2I6QA 4RT0A 3Q3YA 3H09A 1P57B 2PKSB 1O3FA 1LHFH 1YPMH 2XC4A 1K9OE 1OSSA 1CE5A 3OTPA 1GG6B 3U8TH 5FXLA 4UE7H 2WYJA 3C27B 4CR9A 1OWJA 3S9AA 1V2KT 1C1RA 1TE0A 2QV1A 1ETSH 1C2HA 1B0EA 1AB9B 2GV7A 4RKOB 1OYTH 1J14A 3BSQA 1TGCA 2C93B 1PPBH 2Z3CA 2AIPA 1P0SH 2W6ID 1K1OA
chains in the Genus database with same CATH topology
3RUOA 5JYIA 2ODYB 3P17H 1AIXH 1ZYOA 5T6GA 3M7TA 1Z6JH 5GPIB 1IQNA 1V2UT 1AUTC 1NFUA 1O36A 3RXGA 4H4FA 2W7UA 1Q3XA 3F9GA 1BB0B 2R2WU 3LC5A 4VGCC 2RDLA 1AE5A 1OYQA 4H6TA 1O2MA 3MMGA 2M5TA 1LPGB 1GPZA 4HTCH 2PV9B 2GCHG 2F9VA 3SBKA 1V2QT 2YNAA 1UTJA 4BXSA 1OX1A 3GDUA 3DFJA 1P9SA 2GDEH 3A83A 2BOHB 4ISOA 1SQAA 2AGEX 2Z9GA 1O5FH 1CO7E 2ZO3H 3GY4A 4B2BA 1O5AB 2KAIA 2H9EH 1BDAA 1TX7A 3AW1A 1GVKB 4X1NU 5EU8A 1CGJE 3E91A 4DVAU 2V35A 4MNVA 1P12E 1RJXB 2BD7A 4FXGH 1LHEH 3GCOA 4JZIA 4CR5A 2XBVA 1KXEA 1AKSB 1ESBA 1UVOA 2FIRH 2ZPQA 7GCHG 3Q3XA 3RU4E 3QGNB 1V2JT 1BQYA 1KXAA 5EOKA 1C1TA 4JZEH 2UUYA 4Y0ZE 1C2IA 1CBWC 1F5RA 1GDQA 2IN2A 3PM3A 1MKWK 3BTGE 4M7GA 2EC9H 3D23A 1LCYA 1K1NA 3GYMA 3SORA 1BTUA 2F9BH 2GX4A 2YNBA 1AFQB 2G55A 2JETC 5EPYA 1BMLA 1L2EA 1IAUA 1GMDF 3SI4H 1A2CH 3V7TA 3ZYDA 2J4IA 1O2GH 1NC6A 2HWLB 2ZU3A 1NT1A 2FOAA 3E6PH 3SO3A 3RP2A 1ABJH 1D3DB 1PFXC 1SGTA 2XCNA 1EZXC 1HJ9A 1J16A 4K1SA 4DG4A 1MTUA 2BLOA 1DS2E 1PYTC 3U98H 5AHGH 3TH3H 2OCVB 3TJNA 1LDTT 4B2AA 4K3JA 1ABIH 1T8OA 3RLWH 1SSXA 3KGPA 4NIXA 5GCHF 4WMEA 5G4BA 2ANWA 3SJIA 1FMGA 3A87A 4BAQB 4B71A 2BDAA 3GCNA 3RC6A 1DITH 2A2XH 5EG4A 1C4Y2 3QO6A 5DP9A 2XTTB 5F8ZA 1HAYB 3VB3A 3A84A 1S85A 1A3BH 1HJ8A 2DE9A 5A8XA 3A7VA 2BQ6B 5LPEA 1THSH 2ZHWH 1V2WT 1MTSA 1EP6A 3A89A 1EZQA 1HFDA 2ALVA 2BQ7B 1BOQA 1T4UH 2WYGA 2QCYA 2LNCA 1P2IA 3VFEA 2SNVA 3BTHE 1GJ9B 3QLPH 1SGIB 1GBAA 4ABJA 2FDAA 1TFXA 1H9HE 3LDXH 1LMWB 2C8XB 3MFJA 2D26C 1TX6A 3L6PA 4Q80A 1O2QA 3VGCC 1O5EH 3MU5A 1FV9A 2Y82A 4KELA 5B6OA 2TBSA 1W3CA 5CHAC 1ELDE 5ESTE 1Y8TA 5CMXH 3MNXA 3RXUA 1T4VH 1MBQA 2P95A 2BDHA 2CXVA 3HK6B 2ZGXH 3GDSA 1ARBA 2ZCLP 5AVDA 1MQ6A 3KQDA 3D49H 1MU8B 1HCGA 4ABFA 4I7YH 1ZSJA 4BAHB 1WTHD 2BTCE 3LOXA 1UJ1A 1B5GH 1L4DA 2XC5A 4KKDA 3KQCA 3OSYA 1GHZA 4MPWA 4Q7XA 1BHXF 2OC8A 1QCPA 4NA8A 3MWIU 3F9FA 1W0ZU 2R0KA 1GI2A 4AYYB 2ZU2A 1HBTH 4A6LA 4JK5A 1G3DA 2P3FH 4Y8YA 4YTAA 3M61U 2B7DH 1MKXH 3EGKH 1FPCH 1PPEE 3SJKA 1SPJA 1LPKB 1YM0A 1G3EA 2Y80A 2PSXA 3BTWE 2PUXB 5T6DA 1HAZB 3GISB 2ZPSA 1A7SA 4ESTE 1C1WH 2VJ1A 1CGHA 4K69A 2CMYA 3SUEA 1H4WA 1O35A 1L1NA 2OBOA 4Y8ZA 1RRKA 1MH0A 3RM2H 3SUDA 2BDGA 3PROA 4DGJA 1AD8H 1TPAE 1EX3A 4U30A 3LONA 3ZZBA 1EJNA 3RXJA 1C2GA 4NG9H 3QWCH 3VB4A 5EODA 1DFPA 2HVXA 3E3TA 3NKKA 3KNXA 3VXFH 1Y5UT 1W13U 3EAJA 2HOBA 1Z8JB 1NESE 2GTBA 3RXVA 3A82A 1C4U2 1P8VC 8GCHF 1TNHA 3Q76A 4X8TH 5DP4A 1DVAH 1V2MT 2B9LA 1HPGA 1SMFE 4JK6A 1BRAA 2QIQA 2VB0A 2XBWA 4GLYA 3DHKH 2ZFPH 3S0NA 1ELTA 1RD3B 5ABWA 1XVOA 4DIIH 5HXFA 4CRBA 1LQDB 1ORFA 5GWZA 1KDQA 4NSVA 4F49A 1G30B 3O8BA 1NFWA 1RIWB 2OC1A 1S83A 1EP5A 1L4ZA 2STBE 5K7RA 4IN1A 3PMHB 4ABHA 2XBXA 1SGRE 3STIA 1YPLH 1YBWA 3A80A 1FLEE 3N7OA 4CBOA 1KY9A 1XMNB 3PMAB 1BITA 1HAIH 2BVXH 2JKHA 4AGJA 1F2SE 1N8OC 4GCHF 1S0QA 3MO3A 3M36A 3P95A 1TMTH 2VH0A 4K2YA 4BAKB 3P8FA 1S5SA 3ZVBA 2UUKB 1NS3A 1Y3XA 1WV7H 5DO4H 1Q2WA 3Q77A 4B75A 1MD7A 5H4IB 1F0UA 3ZYEA 1LKAA 1FI8A 1Y5BT 3M37A 2SGPE 2B5TB 3A8CA 1UCYK 2OINA 1ESAA 4IS5A 2Y5GA 3A7YA 2VGCC 1CQQA 1O3AA 4SGBE 2J94A 4BTTB 1WQVH 1PPZA 1ZGIA 1UTQA 2F9PA 1GWAA 2GD4B 3QTVH 3RMOH 2O8MA 1ZZZA 1GMCG 1SL3A 1ELEE 2QF0A 1C5MD 5FBEA 1DWDH 1XX9A 1WAYB 1DLEA 1W7GH 1LPZB 1P9UA 1O3MA 2Y7ZA 4ZKSU 2BX3A 2H5CA 2H9TH 3SGQE 2XCFA 5LH8A 5FX5A 5I46H 2C8WB 2WINI 5JB9S 3B9FH 1EPTB 4X2XA 1QQUA 1QFKH 1FN6A 4NWKA 3K9XB 3ZZDA 5AFYH 2FZZA 4NA9H 1EKBB 3O8DA 1W2KH 3BG4C 2ZECA 3R0FA 3E8LA 2A4RA 3P8GA 1TMBH 1N6YA 2BD3A 2ODPA 3SNEA 2F83A 4AFQA 2FEQH 4DW2U 1P05A 4KP0A 1GHBG 1QNJA 2OP9A 1AWFH 1FN8A 4U01A 3OX7U 1TA6A 1YCPH 1BMAA 5FX6A 4AFUA 4AGKA 1CHGA 1VGCB 4Y71A 1C5XB 2RA3A 3BN9A 3ESTA 3M5OA 1QB6A 1O0DH 2O8LA 1LKBA 4YZUA 2FS8A 3PB1E 4I8KA 4NIYA 3SV2H 3VB7A 1Y3YA 1OPHB 1OWEA 1GBBA 4WXVA 4DIHH 1HV7A 2FLRH 4MNXA 3RM0H 1QJ7B 4X6OA 4K8BA 4JZ1A 2A45B 1QQ4A 4HZHA 2WPJS 1K1PA 2QXGA 2D8WA 1GBJA 1UTPA 1P04A 3SNCA 3A7XA 2OC0A 1FAXA 1OP0A 1QHRB 2JH0D 2A31A 2PUQH 2WUCA 3GY7A 3T2NA 2C90B 1TGBA 3TK9A 2ZFQH 4XBCA 1CHOG 4LZ4B 8KME2 1LO6A 2FOEA 2GMTB 4AG2A 4CHAB 4CH8B 1ELGA 3RXOA 2BD9A 2G81E 3ATLA 9LPRA 4Y7AA 2FTMA 1JIRA 3S7KB 1O2SA 1YYY1 2OUAA 2RCEA 1EATA 1NROH 3A86A 1S6FA 4CRCA 1HIAB 3RXBA 3SI3H 3KEEA 2XC0A 1ANEA 5JBTA 4YOJA 1O2JA 2J2UA 2QAAA 4INLA 9ESTA 1BZXE 3H5CB 3LGYA 1TONA 3SZNA 5DPAA 4ZKOU 3QDZB 4AFZA 3ZZ6A 1GHAF 1QBVH 3PTNA 5PTPA 2G51A 3TNSA 2OBQA 1QTFA 1GDNA 2Y5HA 1YPHC 5L2ZH 1GJ7B 2J34A 5FBIA 3B8JA 2P3TB 3JZ2B 1PPFE 4KTUA 1ETRH 2Z9KA 3KF2A 5J4SA 1OKXA 1F5KU 3KL6A 3SOSA 1O30A 2BLWA 1EASA 1QY6A 2BX4A 4FUIA 3U1JB 1XUGA 3CENA 5IYTA 2CV3A 4I8JA 3VB5A 3U8OH 3UNSA 2XWAA 1XKBC 1ZTJA 1GCTB 4INKA 3ATWA 1AY6H 1C5ZB 5L6NH 3GCHB 1YF4A 1J17T 1YP9A 2A32A 2I6SA 1TNLA 1FJSA 4XE4A 3SV9A 1O2TA 1SOTA 2D2DA 1GI7B 1J9CH 3M3SA 1ELAA 1TBRH 4JYUH 5C3NA 1IQFA 3U1IB 6CHAB 4FUBA 3GY2A 1O31A 1Y3VA 4UFDH 4X1RU 1BTZA 3ZVEA 1CA0C 1QB9A 1SLXB 4LOYH 1AVWA 5AFZH 2B8OH 4Y7BA 2CHAC 4IC5A 3K6YA 1GMHG 4ZAEA 2ZDKA 1BCUH 1V2VT 4XBBA 2FI5E 1V2OT 2Z6BD 3CP7A 1P09A 1W11U 2BB4A 2ZHEH 5FPSA 4BXWA 4MNYA 4NWLA 2AEIH 1HDTH 4FU7A 2KAIB 1TB6H 1W12U 3SJ8A 4LXBH 1AGJA 1O3IA 2WPHS 1WBGB 1QL7A 5FPYA 1LTOA 2Y6TA 1ZPBA 1MU6B 1UVSH 1O5DH 5GJ4B 3AAVA 1SVPA 3H7OA 4D7FA 2V0BA 2YOLA 1NFYA 1PQAA 3A8BA 1DICA 3MH7A 2BYAX 4X8SH 1C1SA 3SV7A 1YPHE 3SU0A 1KXDA 3I29A 1FIZA 4A7IB 3W94A 3BTDE 3D65E 4CH2B 1GVZA 2A2QH 2SGAA 1ANDA 2ZU4A 1C1QA 1SG8B 1C5VA 4X0WU 4ZHLU 1GMDG 1PQ5A 1TIOA 1BBRE 4FVDA 1TWXB 1ZTLA 2AIQA 1UTOA 3M7QA 1GJAB 1T8MA 2BQWB 4TYDA 3UUZA 4AX9H 3EA9A 4QT8C 1SQTA 3SU2A 4ZKRU 1DY9A 1ZHPA 1MZAA 1NU7B 1THPB 2ZCKP 3FANA 1G2MA 1BA8B 2PHBA 4GUXA 1U6QA 4X1SU 1Z8IB 1E0FD 4ZMAH 2PGQB 4MLFB 3A88A 3TJUA 3QN7A 5A09A 1BTWA 5L2YH 2OLGA 1UTKA 2ESTE 5TJXA 4GSOA 2A1DB 1C5RA 1FQ3A 1GI0A 1O3EA 2Z94A 5GCHG 2FXRA 4OS1A 4FUHA 2TGTA 3ZZAA 2NU1E 3BTEE 4WXIA 1SOZA 1QL9A 1K2I1 1XM1A 4ZHMU 1DANH 3ZZ4A 1A0LA 1C9TA 2BLQA 5CE1A 2FOFA 1GVLA 3PO1B 2ILNA 4WY3A 1GJBB 1UHBA 3T26A 4NIVA 2G52A 1O37A 4WJG2 3PLKA 5A2MH 1F92A 1O2XA 2C8ZB 2BVSH 1IQKA 1L1GA 2A7JA 4ASHA 1IQJA 3LJJA 4NSYA 1O34A 1AFEH 1EJAA 2BOKA 2GZ7A 3V13A 4NGAH 1GI1A 1ID5H 5BRRE 1D3TB 4ABBA 1EB1H 1C2LA 3LKWA 2P3UB 3SU5A 5J4QA 3TK6A 1TNIA 3LGIA 4O9VA 4CRGA 1LVYA 2G5VA 1G3BA 1O2KA 1DSUA 3K2UA 4X6PA 1P10A 3SW2B 5C2ZA 1P11E 1FPHH 3A7ZA 2VWOA 1UMAH 1GBMA 1TNKA 1TPPA 3TGJE 2A5IA 2P8OC 4I32A 3VXEH 2ZI2H 2ZTYA 1NU9A 1W10U 1C2KA 1S82A 2VNTA 3RMMH 4RSPA 5C67A 1D4PB 3G01A 1BTYA 3MTYA 2P93A 2ZGHA 5GDSH 1TYNA 1W7XH 2R0LA 3R3GB 5FCRA 4A92A 3URCA 4B76A 2FX4A 1DLKB 3QK1A 1CU1A 2W3KA 4UD9H 1T8NA 4JCNA 1FY5A 3P8OA 4CRDA 2GCHF 4J2YB 2VWLA 3DA9B 2QA9E 3SGBE 1F0SA 2XYAA 3AAUA 4UFGH 4X6NA 4UEHH 2ZDMA 5IDKA 1WUNH 1A46H 1V3XA 1VZQH 3FP6E 3OY5U 4GAWA 4Y6DA 1ZSKA 4SGAE 3AW0A 1EUFA 1CGIE 3PMBB 1GBCA 2Q6GA 2HRVA 1C1OA 2F9OA 4BAMB 1EPTC 1AKSA 1RTKA 2RG3A 4IW4E 5C1XA 1MTNB 5EW2H 1D3PB 4KTSA 2ODQA 4JMYA 2Z9JA 4CREA 3QZRA 3NUMA 2BDBA 2VVUA 1BBRH 2H9HA 7GCHF 1GBEA 1QJ6B 1O2IA 5E8EH 4Y76A 2UUJB 1OP8A 4DY7B 2A7CA 1KSNA 1MAXA 3HGNA 1VGCC 4XBDA 1O2LA 1UVTH 1DWCH 1THRH 1T31A 8GCHG 3BEUA 2EA3A 4BTIB 1AE8H 2PKAA 2VVVA 4Y79A 2V3HH 2VIQA 3BIUH 4HI3A 1A3EH 4MNWA 4NA7A 3S69A 1C5OH 3RLYH 5HYOA 2SGQE 4TY6A 2WV4A 3BIVH 4K5ZA 3LT3A 1KIGH 3A8DA 2AS9A 3FP7E 1HJAC 3UIRA 7KMEH 1AI8H 1GI8B 4AYVB 2OQ5A 1A0HB 4FVBA 2TGDA 1PJPA 2C8YB 1SLVB 1TX8A 2PTNA 4OS7A 1H9IE 1C5YB 2ZEBA 3P70B 2ZQ2A 1MZDA 1NRNH 3RXFA 1C1PA 4GPGA 2STAE 1K28D 3LH3A 1YCPM 1KDQB 4ZHAA 2QY0B 2FOMB 3SHAH 1IOEA 3SJ9A 5HMAA 4FUJA 4WVPE 2ZDLA 2GCTC 4WMDA 2Y5FA 1MQ5A 3UR6A 5EPNA 1GGDC 2R2MB 2GMTC 1SGEE 4OS5A 1O3CA 1SGFA 2FTLE 1T7CA 1SR5C 1A5IA 1Y59T 2BXUH 5EGMA 6GCHF 2AYWA 1ELFA 1MUEB 1TRYA 1GBFA 1EAXA 2Z3DA 3ZZCA 4E7NA 3S7HB 2G5NA 3UNRA 2ZFSA 3RXSA 4TWYA 4Y0YE 3P8NA 2GGVB 4VGCB 2FP7B 1AU8A 3RXEA 3TNTA 4UFEH 1HAXB 1WCZA 1ZMNA 1ZJKA 4JYTA 1RXPA 7LPRA 2ALPA 1P2MA 4O3TA 3ATMA 2UWOA 1Y3UA 1F0TA 2H5DA 1A5HA 2UWLA 1SQOA 1HLTH 1IHSH 2FI3E 1TOMH 1C5WB 2GT8A 1VR1H 3CS0A 2GT7A 2BXTH 4F4OC 1UK3A 4D76A 1GI3A 1VCQA 5HM9A 1VITF 3EYDA