3TPIZ

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords TRYPSINOGEN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tpiZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tpiZ02
2AERH 1GCTB 2BX3A 3LU9B 1QJ6B 1TPAE 3TJNA 4AFSA 2HWLB 5AFYH 1MD8A 1YPKH 1MTSA 4Q7ZA 5LPEA 1D9IA 2ZHQH 3SOSA 1TGCA 1KXAA 1NTPA 4E7RG 2EC9H 1W10U 1TMUH 1BTWA 4B2CA 1P9SA 2HOBA 4BTUB 1CGJE 5FPTA 1W7XH 4INHA 3EAJA 1WSSH 4ABDA 4AFZA 1WAYB 1OYQA 4YOJA 2VIWA 2PHBA 2IPHA 2FX4A 3ZZDA 2CXVA 4MVNA 3SI3H 1UTOA 1AY6H 2V3OH 5ESBA 2ODYB 4A1VA 2A7JA 1GJBB 1EP6A 1O3HA 1ZMLA 3AAVA 1A1RA 2PSXA 2WYGA 1YLDA 2BDIA 2PSYA 4JYVH 2RG3A 1XX9A 3MWIU 1EZUC 4WY3A 3LJOA 1VJAU 3SQHE 1JWTA 1IQNA 1SQOA 1Y3YA 4D7FA 3SJKA 2C93B 3GCTG 3CS0A 1CO7E 1O3JA 1D3PB 1GJ4H 3TH3H 1AKSB 5A0CA 5FBIA 4JMYA 2AS9A 2VB0A 3A7YA 2ZU3A 1Y8TA 1CA8B 3TK6A 2ZDMA 2GZ9A 1XUIA 2BLVA 5E8EH 4DURA 2ODPA 1O33A 3F68H 2XWAA 1YGCH 4UONA 2WPIS 1S81A 2YNBA 1A7SA 1ARBA 3KNXA 1C5YB 3GCTF 1BQYA 3D23A 2ALPA 4AG1A 1IQJA 1IQKA 3BTTE 4D8NA 4NGAH 1ARCA 1F0SA 2XBWA 3LGVA 1TPPA 2OLGA 3SUFA 4NIYA 2P59A 1V2UT 3LPRA 2P8OB 1A3EH 4Y11E 2F9VA 2BDGA 2EI6A 3BIUH 3KQBA 1AWHB 2VIDA 2GV6A 4ISLA 1TIOA 3VGCB 2BY8X 6LPRA 3BTGE 1BMLA 1EAIA 3K6ZA 3CP7A 3UTUH 1SGFA 1YP9A 1V2TT 3GISB 1BRBE 4LK4A 1C1WH 2ZG0H 3OU0A 2FOGA 1SQTA 2O8UA 1HUTH 2QN5T 1TNIA 3LH1A 3ZVDA 1P11E 4UFFH 2FWWA 1DANH 1P05A 2ZHDA 3STIA 1Z6JH 4MG3A 3GCHC 4FUHA 3TH4H 4DIIH 3GOVB 1KTTB 1SVPA 2R9PA 4X6MA 1O2LA 2XRCA 2FLRH 2ZEBA 3IWMA 1NZQH 1ZRKA 2F9UA 3TK5A 2VWMA 2V6NA 1AMHA 3PROA 1EOLA 3AW1A 5C5OA 5E0HA 3L6PA 1LO6A 5FAHA 1EPTC 1C2LA 1YCPK 2ILNA 1XMNB 3EE0B 2QY0B 3SV2H 3LGWA 5A8XA 1GVLA 1XKAC 3ZZ8A 3KL6A 1L4ZA 3P17H 1O37A 3P92A 3TVJB 1TNJA 3U69H 2W7UA 1BMMH 1G3DA 1MCTA 1ZGVA 3U1JB 1GVZA 1F0RA 5FX5A 2ZDLA 1A0LA 4CBNA 4BAQB 4SGBE 1THRH 3TJVA 2QA9E 1DY8A 3UNRA 1TWXB 2ZPRA 4FUGA 2A0QB 1O36A 2Y82A 2HNTC 4Y8ZA 4WXVA 1SR5C 2W5EA 3BG8A 5DG6A 2Z6BD 2B8OH 2P94A 1S6FA 3MU0A 1C5QA 3A81A 4KTUA 4K5ZA 3GY7A 5DGJA 1BTHH 2KAIB 1ZSLA 1DWEH 4K1EA 3TGJE 1Y3WA 1HJAC 1S84A 3M5MA 1O39A 1RIWC 4WXIA 3BIVH 3F9FA 4AGKA 3RXHA 2BMGB 1QCPA 1S0QA 2BOKA 2I6SA 2NWNA 2O8TA 3RXQA 1SGYE 1IHSH 5L6NH 1FONA 2QXIA 1TYNA 2A5KA 3A7TA 1IQFA 4MNVA 3LOXA 1W3CA 1MMJN 5ABWA 5C1XA 1SOTA 4XOJA 1BCUH 1QJ1B 1W12U 2XW9A 2VWNA 1L2EA 1SSXA 5HYOA 1H4WA 1IOEA 1SMFE 2THFB 4KGAA 1GHXH 1KTSB 4GVUA 3KIDU 2C8YB 4H6SB 3T5FH 1KXFA 2WPJS 1OOKB 4NIXA 1P3EA 1QRXA 3F1SB 4Y8XA 2V35A 1EAWA 1SGDE 3MI4A 2H9TH 5FCKA 1OP0A 3FANA 1GBFA 1W11U 3FP8E 5AF9H 3ZVGA 4O3TA 3E0NB 6CHAC 2BDCA 5HGGA 1GBHA 5HMAA 4PROA 1QQUA 2P3TB 4YZUA 1D6RA 2TGTA 3ZZ7A 1TX6A 3FVFB 3EDXB 3Q3YA 2BD3A 1W14U 2FOMB 3EQ0H 1NRNH 2UWLA 1RS0A 3BTKE 4WH6A 2BY9X 4X0WU 2O8WA 2SNWA 2UUYA 1H9IE 2A4GA 4Y7BA 2G55A 5GWZA 1O5AB 3BTQE 4X2YA 1TABE 1C5VA 1P57B 3EYDA 3V7TA 2AMQA 1EUFA 5JB9S 2QF3A 3P70B 4BAOB 1A5IA 1TPOA 1VJ9U 2C8ZB 2NU4E 3UIRA 4SGAE 2FTLE 2CN0H 1CU1A 1O2QA 1KXCA 2VWLA 3ZVFA 1BB0B 2FM2A 1LVOA 4IMQA 4K1SA 1AE8H 7LPRA 2EA3A 1HAIH 1SGEE 2NU0E 4D9RA 1BTUA 3H5CB 7GCHG 4MNWA 1ZOMA 3GYMA 4I8GA 1B0EA 1O31A 1RGQA 4Q2KA 3UWIA 4ZHMU 2HALA 1V3XA 3MOCA 1UCYH 1NFUA 2STAE 3A8CA 1JMOH 1ELAA 1G2MA 2TGDA 1YPHC 1KLTA 1NU7B 1ZSJA 4DY7B 4I8KA 1GI5A 3ZZ9A 4O9VA 1DFPA 4MQAA 1Z1JA 3SV9A 1J16A 1YKTA 5LPRA 7GCHF 1GJ7B 1HRTH 1OKXA 3SJIA 1AE5A 1C1MA 5C1YA 1AWFH 5L2ZH 1DS2E 1F5LA 3RXFA 2FMJA 2FOCA 1MTNB 1XM1A 1HNEE 4K8YA 2ZF0H 2ZFQH 3UOPA 2R2MB 2A7HA 4MPUA 1GBIA 1GBCA 4LOYH 4B73A 1K1OA 2Q6GA 5LH8A 1TOCB 3RXBA 4DW2U 1O3CA 1QA0A 1T8MA 2F91A 5DPAA 1CT0E 1EZQA 3RXUA 1BMAA 1EAUA 2Z3CA 1JOUB 3KGPA 3O8BA 2BY7X 1NY22 3ZZ5A 1RD3B 3RXMA 1F92A 3AASA 3HPTB 4K69A 3I77A 4NIWA 4XBBA 1Y5AT 1TRYA 5JDUB 4CHAC 1PFXC 2BB4A 4X8UH 4AORA 1BTXA 1O34A 4ISNA 4K8BA 1SGRE 1DLEA 1NROH 3T26A 1AFQC 2PR3A 1TFXA 3SV8A 1U6QA 2VIQA 1VITG 2Z9IA 3NWUA 4MNXA 2AYWA 1ELCA 1ZR0A 4GSOA 1C5ZB 4BXWA 2OQ5A 4WJG2 1P9UA 1T8OA 4YOGA 2AMDA 1QFKH 2BYAX 3M5OA 1NRPH 1ELFA 3A7VA 1DT2A 2RA3A 2SFAA 1CT4E 1F5RA 2O9QA 4X1SU 5T6GA 2OD3B 2D26C 1QBNA 2JETB 1A0JA 1V2OT 1VITF 4NFEA 3ZVAA 3SZNA 1A2CH 3P95A 1FIZA 1GBKA 4BNRA 1L1NA 3TU7H 4B71A 1BTZA 2ZGCA 3DD2H 1QR3E 3SNEA 3ZZCA 3UQOA 3PV4A 3UR9A 1O2XA 3RXTA 5E0JA 4ABAA 1GJ6A 3QTOH 1N6YA 4FUDA 4B1TA 4RKJB 1XUJA 1VZQH 5CHAC 1HAXB 3RXJA 2GZ8A 2ZC9H 1EJMA 2A5IA 2ZGJA 2PWXA 4BANB 1C5WB 2SNVA 1O3NA 5LGOA 2ESTE 1ELGA 7ESTE 2GTBA 1EZSC 1G37A 3ZV8A 2B7DH 4CRGA 2TGPZ 4X8SH 4ISOA 1ELDE 4U32A 2R3UA 3BTME 1YPEH 3BV9B 1ZJDA 1O2GH 1P8VC 1OWHA 3DFLA 4RN6A 3UNQA 1N8OB 5F6MA 1EB2A 4AYYB 1LQDB 3I29A 1E34B 1ZJKA 2HPPH 5EXMA 1OXGA 1GL0E 1AZZA 5I46H 3UOUA 4LXBH 3F9EA 3UREA 4AOQA 1PYTD 3T29A 4OS1A 2A45B 3QZRA 2H2ZA 1P09A 1BBRH 4WMEA 2EI8A 1UK2A 1YPMH 1SLXB 2RCEA 1NM6A 2WPMS 2BD4A 1HJ9A 3M5NA 4A6LA 3KN2A 5FCRA 3RXVA 3PMBB 3F6UH 3VEQB 1KXDA 2AIQA 1ZSKA 1T4UH 1GDNA 1UVOA 4IN2A 1UTMA 3DT0H 1PQ7A 3QK1A 1TNHA 5IDKA 4Y76A 2C8WB 2ALVA 4NZLA 2FS9A 2I6QA 5AVDA 2P3UB 1J9CH 4DJZB 1GCDA 3NPSA 4IC5A 5DP9A 2GD4B 3LIWA 5F8ZA 1EP5A 4AFUA 2GCTC 1O0DH 1P02A 1P10A 2Y5HA 3GCOA 4X2WA 1WQSA 1P2OA 8ESTE 1HIAB 3QLPH 1AB9C 3AVZA 7KMEH 3BTDE 2PKSC 1DWCH 1H9HE 2BX4A 1LHFH 2ZCKP 1ANCA 4FUEA 3RXDA 2NU3E 2FYQA 4THNH 3UPEA 3GY8A 1FI8A 4JK6A 4YM9A 3UUZA 5EW1H 1HCGA 3BN9A 2PTCE 3QTVH 1MD7A 2P95A 4U01A 2SGFE 4F4OC 2G8TA 1CBWC 1O3LA 1GGDB 3GY2A 3TGKE 1O2PA 2ZFPH 4X8TH 2GMTB 4I8LA 1CA0C 3ELAH 3FAOA 1C2KA 4I8HA 1C5LH 3NKKA 1GJ9B 2G5VA 3RXCA 1KIGH 2O8MA 1XUHA 2Z7FE 4E05H 1O2UA 1PQ8A 1V2KT 4FUJA 5EQSA 4H42U 2VNTA 4ZKSU 3U1IB 3NUMA 4XSKU 2CHAB 2D8WA 1FAKH 3ZZ6A 1W0ZU 5F8TA 5CE1A 3FZZA 3ZVCA 1Q2WA 1G36A 5A8YA 1Z8JB 4B75A 2BDAA 1GCTC 3RXEA 1F2SE 1YPLH 4Q7XA 3RMOH 4NWLA 2RDLA 1ZTLA 3SJ8A 5DP6A 2ZPQA 2A2XH 4YT7H 4TPIZ 1P2MA 3VB4A 3A84A 1GBMA 3BG4B 2Z9GA 3TH2H 1AI8H 2PKAB 1CHGA 4LZ1H 2BLWA 4I31A 1TALA 4BXSA 1KDQB 1NFWA 1W2KH 3SQEE 2BLOA 2PFEA 2BDBA 2W7SA 1YYY1 2JH5D 4NA8A 3ZZAA 1AGJA 1UCYE 1YLCA 1O3FA 1CGIE 1TA6A 1C5XB 4ABEA 4Y8YA 2FI4E 1QRZA 1MQ5A 2BXUH 2ZI2H 2XC5A 1AN1E 1ZHMA 3SHCH 1Y59T 1MKXH 1ELVA 5CMXH 3LGYA 1MUEB 3R0FA 1SGNE 3BEFB 4Q80A 3AAUA 4TY7A 2Z94A 2NU2E 5A8ZA 1UHBA 2OC8A 4D9QA 4UEHH 2R3YA 1K22H 1FPHH 1G9IE 1T32A 1C2DA 3RMMH 2XNIA 4HI3A 1TMBH 1GI7B 1O5GH 2UWOA 1TB6H 4J1YA 3PLPA 1W8BH 4UFGH 1BTYA 1GI3A 1FDPA 2ZQ1A 1O2OA 2FLBH 2ZIQH 1O3DA 1MQ6A 1QL7A 3JZ2B 3ZVEA 4YOIA 3RM0H 1AHTH 2B5TB 4X1PU 5TJXA 1O5BB 1ZGIA 1MZAA 4FUIA 4D7GA 3EA7A 5EQQA 4AFQA 4TWYA 1O2SA 1V2NT 1ANDA 1VGCC 1WOFA 2QXGA 1LPGB 5T3HA 5JPMH 4WVPE 3ATLA 2ZGXH 5FPSA 1A3BH 3TNTA 1CHOG 2W3KA 3GCHB 3P8OA 3SJ9A 1ACBE 2TGAA 3MYWA 2ANKH 1GI8B 1NU9A 5F03A 3E90B 1GDQA 4FUBA 5LPFA 2A5AA 2H9EH 2DE9A 4B2AA 2BDYA 1HPGA 1VCWA 1XXFA 1V2WT 1K1NA 2JH0D 1ZTJA 3W95A 1TE0A 3URDA 3V3MA 1Y3VA 3OTJE 3SJOA 2O8LA 1CHOF 1P06A 1UTQA 5DP8A 2GT8A 3LKWA 1ID5H 1FN8A 1O3EA 3V0XA 1C2EA 4HFPB 1BDAA 2ULLA 1SFQB 1FXYA 4ZXYH 1EPTB 2QF0A 3A8BA 1HV7A 1AIXH 3RMNH 1Q31A 1INCA 1O32A 4U2WA 1SGFG 3RXPA 4HZHA 2G4TA 3A7XA 4VGCC 3IG6B 5DP4A 1CVWH 1FMGA 1DDJA 3BEIB 4ABIA 1HAVB 1T8NA 2Y7ZA 1QL8A 3H7TA 1C9PA 4AZ2B 3E3TA 3F9GA 2XBYA 3ZZBA 3UR6A 4O03A 3HGPA 3PB1E 1O3BA 1O2VA 1ZLRA 1NS3A 2XCFA 3TGIE 3ODDA 3VB7A 1UTLM 1KLJH 3RDZA 1UVUH 3DHKH 4I33A 1PPZA 1S5SA 1O3AA 4DGJA 3ZVBA 3A87A 1BUIA 3DA9B 4DIHH 1TNGA 4ABFA 4MPXA 3RXAA 1FNIA 1LMWB 1FLEE 1GJAB 2ZDNA 3SV6A 4D76A 1PYTC 2VIVA 4X2VA 4X1QU 3FP6E 1O2WA 1S85A 4OGYA 1RIWB 1WBGB 1FPCH 1TRMA 1AQ7A 1FN6A 1O2NA 2BD9A 2BLQA 3O8DA 3VXEH 1BBRE 1HDTH 2G81E 2H5CA 4YESB 2FOBA 2FXRA 1TGTA 1O30A 2ZDVH 3PO1C 4NFFA 1QJ7B 4ABGA 4FVDA 1K1PA 3F9HA 3CS7A 2ZCHP 1GI6A 3SU1A 1BOQA 1Z8RA 2GT7A 2JKHA 3SO3A 4QT8C 2YNAA 4GLYA 3A88A 3SU0A 3H7OA 3RXLA 4XBCA 3G01A 3TJOA 3ZZ4A 4ZMAH 2G00A 5E0GA 2ZHFH 1O2TA 3ATMA 4K3JA 1ZHPA 5DP3A 1C2MA 3N7OA 4MNYA 2G51A 1QRWA 2FEQH 2GZ7A 1T31A 3BTHE 2ZFTA 1QURH 1L0ZA 4FU9A 3GDSA 2TBSA 4X2XA 1EZXC 1UTKA 5GCHG 3C1KA 1ESBA 4ZAEA 3STJA 1CT2E 3MMGA 5E2OA 2ZU1A 4GCHG 2RA0A 1OSSA 2Y80A 3LGIA 1O2RA 4ZHAA 1EB1H 1BHXB 1TBQH 2J95A 5HM2A 4A1TA 2XC4A 2GDEH 2HVXA 2Y6TA 4Q7YA 3VXFH 1F7ZA 3TJUA 1TOMH 3QN7A 1GBLA 1G3BA 1QB1A 5GCHF 3RC4A 5SGAE 2BY6X 2DE8A 2F3CE 1AKSA 3SU4A 2J92A 3B23B 4GCHF 1NO9H 1MZDA 3PLBA 1N6XA 1UK3A 2VWOA 1PPFE 4DT7B 5K0HA 3IITA 3L33A 8KME2 1V2MT 1LHGH 4KKDA 3ZV9A 1V2QT 4FUFA 4XBDA 2WPHS 4MPWA 2ZHEH 1O5CB 3A8AA 1RXPA 4INKA 2F9OA 2Y5GA 3HATH 4X6OA 3PMHB 1EOJA 3A7WA 1VCPA 5L2YH 1CGHA 1GBAA 4E7NA 1NN6A 3A8DA 1L1GA 1UMAH 4JK5A 1AO5A 3U8RH 1MKWH 1MTNC 1GJCB 3A82A 3K9XB 1O3KA 2TPIZ 2FODA 1DE7H 1RJXB 2SGDE 2VGCC 5GPIB 2ZU5A 4JZDH 3R3GB 1XKBC 3Q3XA 2J94A 4WF8A 3T25A 1DUEA 1BZXE 1T4VH 2VU8E 1GHVH 4JYTA 1QBVH 2A2QH 5T6FA 1O3PB 2CJIA 3MO6A 2P93A 1XUKA 2V0BA 3UWJH 1DSTA 1DLKB 1TNLA 2EEKA 3GCNA 1ZHRA 3PTBA 2G5NA 1D3QB 1LHDH 3PWBA 1SB1H 3MH7A 2R2WU 2FOAA 4Y7AA 3UY9A 4H4FA 1IAUA 1HXFH 2QAAA 2BM2A 3RXGA 1AFQB 1GG6B 3URCA 4YLQH 4CH2B 1RTLA 2XC0A 2SGEE 2UUKB 1Z7KA 3SNAA 1CQQA 4JZEH 3RMLH 6ESTA 1ETRH 5T6DA 5B6OA 3RXRA 3M37A 1GI0A 3QZQA 3TPIZ 1GHAG 1T7CA 4RKOB 1TQ7B 5EG4A 2GV7A 3E16B 2J38A 1D4PB 4K2YA 1V2RT 5FBEA 1HAZB 1FJSA 1DY9A 1BRCE 4NA9H 1O3GA 2BD7A 4AYVB 3MFJA 1TQ0B 1W0YH 1C1NA 1K28D 2JETC 3MTYA 1TBZH 1GMHG 2AGGX 3SV7A 1THPB 2PGBB 4DOQA 1C1VH 4Z0KA 1GHAF 3DUXH 2XYAA 1VITH 1TONA 2ASUB 1W7GH 4RSPA 4IS5A 2BOHB 2QIQA 3BTEE 3P8GA 1C1PA 1Y3UA 3LONA 3SU6A 5CHAB 3PMAB 1GMHF 2BY5X 3MU8A 3RP2A 1AU8A 3ATWA 1P2QA 2FOEA 1SLUB 2KAIA 1BJUA 2BQ7B 1QB6A 2BQWB 4FVBA 5I25A 1J8AA 3PYHA 1C9TA 4NSYA 4TY6A 1Y5BT 1WU1A 2FYRA 1S6HA 1HAGE 1BJVA 1QIXB 2GGVB 3OY5U 1KYNA 1J14A 1ELBA 1E0FD 1EX3A 2ZHWH 2BQ6B 3TITA 1Q3XA 5C1UA 4MPVA 1NRSH 3PTNA 2C4FH 4WMDA 1K1JA 2A1DB 5JBTA 4TPYA 1P2JA 1FY4A 1QHRB 1C4U2 3ZYEA 1A61H 2ZTZA 3ODFA 1WTHD 2A32A 4AG2A 1FY5A 4CR5A 2EI7A 2AEIH 5JBCS 2XTTB 2Q1JA 2HPQH 1OYTH 3HK3B 4XDEA 4AX9H 1GWAA 3M3TA 1PPGE 4I32A 1YPJH 1O2KA 1G32B 3ESTA 3PLKA 2XWBI 2VJ1A 1A5GH 2IN2A 1SHYA 4NWKA 1UVTH 1DM4B 1JXPA 2A4QA 1KY9A 2ANWA 1BIOA 5FHTA 5HXFA 3U8TH 6GCHG 4NCYA 1AZ8A 4ABBA 2HNTF 2AFQB 2AIPA 1FAXA 1EQ9A 1YCPM 1AVWA 1J17T 4IN1A 1O38A 3T27A 1OWKA 5TCCA 3FP7E 1BRAA 3ZYDA 3M7TA 2R0LA 2GCTB 5DP7A 3U8OH 2TIOA 6GCHF 2QV1A 3BSQA 9LPRA 1DICA 3HKIB 4FXGH 4A92A 4AB8A 4NZQA 3K6YA 3A85A 2AGEX 1F0UA 2PKSB 3MU1A 4ZXXH 3NXPA 2OC1A 1E36B 1MAXA 3ITIA 5DP5A 1K1LA 2FZZA 2ZU2A 1UVSH 2FESH 2CF9H 1CBWB 4BAMB 1G3EA 4JZ1A 1O2HA 1P01A 2H5DA 5EODA 1S0RA 1HJ8A 1KXEA 3SUDA 3SHAH 2WPKS 1CA0B 3LH3A 3OX7U 3Q00A 4DG4A 1GL1A 1QTFA 1CSOE 5A0AE 3E8LA 2GX4A 3QWCH 1LVYA 1NESE 1P2KA 3LJJA 2LPRA 5AHGH 4CRBA 3SNBA 1HXEH 3TNSA 1WTGH 1GJ5H 3S69A 1HAOH 2QCYA 1FUJA 3UQVA 1OX1A 3ATIA 4OS6A 1F5KU 2ZPSA 2PGQB 3MNBA 1P3CA 1ELEE 2PLXA 1FV9A 3M35A 3VB6A 1YCPH 1ZZZA 2C3SA 2GCHG 3SW2B 2C90B 4HTCH 2WUCA 1WQVH 4R0IA 2Y81A 1OWEA 2F9BH 1DVAH 2ZNKH 1JBUH 1BHXF 5A0BA 4E06H 1A5HA 4ISIH 4YO9A 3DFJA 1IQEA 2STBE 5EXNA 3RC6A 1E37B 1SGTA 1HAPH 3P8FA 4JZFH 2ZA5A 3P8NA 4TWWA 2BTCE 3A80A 1SGQE 3RLWH 5DKMA 1O2JA 2ZFRH 1W13U 1SOZA 1RTKA 2GCHF 4BOHA 2BVRH 2D2DA 3QUMP 2D1JA 4WWYA 1UJ1A 2H6MA 4LZ4B 1GI2A 1TNKA 4FU8A 3TLOA 3BG4C 4Y6DA 4HGCA 3BF6H 2H1UA 2FTMA 1OP8A 1DOJA 3M3VA 1ANEA 2B0FA 2G52A 1QB9A 3T62A 2HGTH 4DCDA 4DVAU 1JIRA 1WCZA 4NIVA 5EU8A 1LQEA 1Z8GA 3RXOA 4U30A 1BBRK 4A1XA 3GICB 2A31A 3B8JA 1V2JT 2ZTYA 1KLIH 3O8CA 1ABIH 4O97A 1OS8A 1EKBB 1UTPA 4M7GA 1OWIA 5JB8S 2UUJB 2DUCA 3HGNA 3EA9A 3U98H 4ABJA 1FZZA 1UK4A 2FO9A 1C2IA 3M7UA 3S9CA 2LNCA 2WV4A 4UFDH 1OWDA 3RXSA 1QL9A 3JZ1B 1SLWB 3NZIA 1YBWA 1PPHE 2P8OC 1NC6A 2BZ6H 2ZQ2A 4OS2A 1RTFB 2XCNA 4BTTB 3L3TA 1XVMA 3VGCC 1Z6EA 1P04A 3OY6U 1MBQA 2IOTA 3P6ZB 1C1RA 3VB5A 4FU7A 1HAHH 4CRAA 1MTVA 2PV9B 2YOLA 1YC0A 1EXFA 1BMNH 1C5NH 2F83A 3Q3KA 5PTPA 1VR1H 4YTAA 3D65E 2GP9B 1HLTH 2B9LA 4MDSA 3SGQE 1TLDA 1VGCB 1KSNA 4CR9A 5C5NA 2BD2A 2P16A 1NPMA 2QXJA 1NFYA 1V2ST 1G3CA 1O5FH 2ANMH 3KHVA 2OXSA 1TGSZ 1TX8A 1K1MA 3TK9A 2TRMA 2A4OA 3NK8A 1GI9B 1K2I1 3EA8A 5EQRA 4YLUA 1C5TA 3O8RA 2OTVA 1HFDA 4CREA 1P0SH 3S0NA 4MTBA 1DSUA 1FIWA 1X7AC 2A7CA 5JYIA 1TAWA 3RXIA 1N1LA 4JCNA 2VH0A 1ZRBA 3B9FH 4H6TA 5EXLA 2CF8H 1L4DA 4X6PA 1TRNA 3KF2A 1MU6B 2Q6FA 4AB9A 1RRKA 3MNXA 1O5DH 4CBOA 1H9LB 4VGCB 2ANYA 1SL3A 3M3SA 4ZHLU 1C4V2 1C2HA 1GHZA 1Z1IA 2F9NA 2ZFFH 3S9AA 1D3DB 1IQLA 3PWCA 2IJOB 1GMDG 1HIAA 2SGAA 1DPOA 3SN8A 1D3TB 2ZGBH 1EJAA 3LDXH 1TGBA 4KTCA 4R8TB 1DUAA 2QGRA 4BAKB 3U9AH 1P2NA 1J15A 1LCYA 2GVFA 5A2MH 2GDDA 1O35A 2OC0A 3SU2A 1HJAB 3MU5A 4ZH8A 2ODQA 1ZMJA 1GMDF 1ZPBA 4Z6AH 4K60A 5J4SA 4A5TS 2WV5A 2VVVA 3OYPA 2BDHA 1DXPA 1C5SA 1WYKA 2VVUA 4BTIB 3LT3A 1MH0A 1MKXK 3QGJA 3VFEA 2FIRH 1MTUA 1FY1A 1Z71A 1ORFA 3MU4A 3PO1B 5F8XA 3SGAE 1C1OA 4NSVA 1AVGH 2ZDKA 3RUOA 1PQAA 1BT7A 4CRDA 5EGMA 3SNCA 1D6WA 2WYJA 3RU4E 3T2NA 1GMCG 1SGPE 1XXDA 5GIBA 1M9UA 1LPKB 1K1IA 3HK6B 1C1QA 3EGKH 1LTOA 1SGCA 2XBXA 3SBKA 1G30B 2Q6DA 4F49A 1TGNA 1OWJA 6CHAB 1DWDH 3BTWE 2WINI 1JIMA 1C5RA 1Y5UT 2QYIA 1O3OA 1TX7A 2FI3E 1P2IA 1GMCF 3GY6A 3HKJB 4B76A 3RC5A 4Y79A 1QQ4A 1Z8IB 1AUJA 1ESAA 2BD5A 2W3IA 3GY5A 4GUXA 3UNSA 1C5OH 1H8IH 1MU8B 1YPGH 5BRRE 5GDSH 3KQCA 1MCVA 3MNSA 3SUGA 1HYLA 4BAHB 1HBTH 1LHEH 4ZKOU 1GI4A 2HNTE 1B7XB 3MH6A 5DK1A 2PKAA 1UVPA 4X8VH 1E35B 1YF4A 2CV3A 1OP2A 1KDQA 5TCAA 3E91A 1TPSA 4IW4E 4ZROA 3GYLB 3UFAA 2BHGA 2OUAA 5C2ZA 1E38B 3SU5A 3A89A 3GY4A 1C5MD 1O5EH 1QGFA 4CRCA 2FP7B 3E6PH 3MNCA 2XXLA 2PTNA 4UD9H 3MO9A 5ESTE 2V3HH 4X1RU 1C2JA 2FX6A 1LHCH 2ZZUH 5EPYA 4NA7A 3MO3A 3SU3A 1GVKB 3Q76A 1FY8E 1C2GA 4IBLH 4CRFA 2PUXB 5EW2H 2FDAA 1C4Y2 1QY6A 1V2VT 1SFIA 1L1JA 2C8XB 5C3NA 1GBEA 1NT1A 1P12E 1TA2A 2FOHA 3RU4T 4I7YH 3FZDA 3PMJA 2J2UA 3E0PB 4KELA 3K2UA 3NCLA 4X1NU 1SPJA 3A7ZA 1DITH 1SLVB 1EAXA 2SGPE 5HM9A 3QGNB 2R0KA 1QA7A 2M5TA 1EJNA 3KEEA 1XUFA 1O3IA 2JH6D 2Z3EA 2G4UA 1MBMA 2F9PA 2Z3DA 1H1BA 2WPLS 3ZZ3A 2GKVE 2OBQA 3MH5A 1ZTKA 4AN7A 2FOFA 4A7IB 1LPZB 2OBOA 5H4IB 3BEUA 4GPGA 1LKAA 1GHWH 2PW8H 2VINA 1PPCE 3LGUA 2AGIX 2VGCB 2ZU4A 2WUBA 4CHAB 3A86A 1THSH 3LC5A 5L30H 1RFNA 1JRTA 3WY8A 1SHHB 1A0HB 2J34A 1AD8H 4I8JA 3E1XB 4ISHH 1F0TA 4ABHA 1ZPZA 2Y7XA 3PM3A 4GHTA 5A09A 1IQIA 1A46H 2Z9JA 1O2MA 1MAYA 1GI1A 2OINA 1GG6C 4GHQA 1UTNA 3QDZB 2ZO3H 1LKBA 1YM0A 1IQMA 1YPHE 4XE4A 1A4WH 2BD8A 3I78A 3OSYA 1EPTA 1WV7H 3S9BA 1GPZA 1O3MA 5GXPA 2Y5FA 3ENSB 1S82A 3MHWU 2ZCLP 1VCQA 4J2YB 3SI4H 4B2BA 4XFQA 1ZYOA 1C1UH 4IGDA 1ETTH 2J9NA 2AMPA 2VVCA 1NFXA 4UE7H 4MLFB 3M61U 3M5LA 1HAVA 5BPEA 1GDUA 1UO6A 4Y71A 2QXHA 1B0FA 3RU4D 2NU1E 1S83A 4CH8B 1UHBB 2ZECA 5C67A 3KQDA 1GBJA 4O3UA 1LVBA 1GHYH 2UWPA 4TYDA 1ZPCA 5E2PA 1ABJH 3KCGH 1TMTH 3T28A 2Z9KA 3LGTA 5C20A 1IQHA 2W26A 3KQEA 4WMFA 1JRSA 2J4IA 2QC2A 1PJPA 1O2IA 4IC6A 5IYTA 2SGQE 1T8LA 3S7KB 5FXLA 1PPBH 5G4BA 1C5UA 1AVXA 1ELTA 1GBTA 1LDTT 4OS5A 2FS8A 1V2LT 1NRRH 2OCVB 1EATA 1N8OC 1XVOA 5DO4H 5FPYA 4ESTE 2ZTXA 2VIPA 1UCYK 3M7QA 1DWBH 1SG8B 3GY3A 5JBBS 4X6NA 1B5GH 3RLYH 2BXTH 1ETSH 1AUTC 4WH8A 1K21H 2K1QA 4ZUHA 1V2PT 1G2LA 4Y0YE 8GCHG 1NRQH 4INLA 2UUFB 1UTJA 1V6DA 4ASHA 2BZAA 1WUNH 1XUGA 3C27B 4KTSA 5GJ4B 1BRUP 1OPHB 2XBVA 1DX5M 1IHTH 1DXWA 3QX5H 2CGAA 2AH4X 1EASA 3SGBE 1GJDB 4IMZA 1Y3XA 4UDWH 4OS7A 4OS4A 5ETXA 1GBDA 1QNJA 1MKWK 8GCHF 3LC3A 1PPEE 1GJ8B 5AFZH 3Q77A 2FI5E 3V12A 3W94A 1BITA 2H9HA 2CMYA 3SNDA 3VB3A 5J4QA 1ZMNA 2ZDAH 5EPNA 1BA8B 3AW0A 2BVXH 3RXKA 2ZKSA 1AFEH 4FUCA 2ZWLH 2VH6A 3A83A 1ANBA 3M36A 5EOKA 3V13A 1AB9B 5K7RA 5FX6A 1H8DH 3TIUA 1ESTA 1FQ3A 4KP0A 2OC7A 1KXBA 4JZIA 4K1TA 2Z9LA 4ZKRU 2VIOA 9ESTA 1C1SA 1HAYB 1HB0B 2BVSH 1IQGA 3D49H 1QBOA 3QO6A 3S7HB 3FFGA 3SUEA 1HGTH 1C2FA 3GDUA 3SORA 1TBRH 1SGIB 3CENA 4NG9H 3GDVA 4Y10E 1PQ5A 2FPZA 1GGDC 4B74A 3RM2H 2PUQH 3MH4A 2GMTC 1BTPA 1SI5H 1SQAA 4Y0ZE 4ZKNU 2ZGHA 1C1TA 3K65B 1O2ZA 1MTWA 1GHBG 3D62A 4GAWA 1CE5A 1LVMA 1P03A 1FY3A 5JBAS 2OQUA 5DJ7A 2P3FH 1O2YA 2HLCA 1C5PA 3ATKA 4UFEH 4AGJA 1GBBA 1SC8U 2CHAC 1SBWA 2ZFSA 1K9OE 4OGXA 2ZP0H 4YT6H 8LPRA 3VPKA 2HRVA 3BTFE 1GHBF 4JYUH 2A4RA 2OP9A
chains in the Genus database with same CATH superfamily
2AERH 1GCTB 2BX3A 3LU9B 1QJ6B 1TPAE 3TJNA 4AFSA 2HWLB 5AFYH 1MD8A 1YPKH 1MTSA 4Q7ZA 3FKSD 5LPEA 1D9IA 2ZHQH 3SOSA 1TGCA 1KXAA 1NTPA 4E7RG 2EC9H 1W10U 1TMUH 1BTWA 4B2CA 1P9SA 2HOBA 3FO8D 4BTUB 1CGJE 5FPTA 1W7XH 4INHA 3EAJA 1WSSH 4ABDA 4AFZA 1WAYB 1OYQA 4YOJA 2VIWA 5C94A 2PHBA 2IPHA 2FX4A 2JJ1D 3ZZDA 2CXVA 4MVNA 3SI3H 1UTOA 1AY6H 2V3OH 5ESBA 2ODYB 4A1VA 2A7JA 1GJBB 1EP6A 1O3HA 1ZMLA 3AAVA 1A1RA 2PSXA 2WYGA 1YLDA 2BDIA 2PSYA 4JYVH 2RG3A 1XX9A 3MWIU 1EZUC 4WY3A 3LJOA 1VJAU 3SQHE 1JWTA 1IQNA 1SQOA 1Y3YA 4D7FA 3SJKA 2C93B 3GCTG 3CS0A 1CO7E 1O3JA 1D3PB 5CHBA 1GJ4H 3TH3H 1AKSB 5A0CA 5FBIA 4JMYA 2AS9A 2VB0A 3A7YA 2ZU3A 1Y8TA 1CA8B 3TK6A 2ZDMA 2GZ9A 1XUIA 2BLVA 5E8EH 4DURA 2ODPA 1O33A 3F68H 2XWAA 1YGCH 4UONA 2WPIS 1S81A 2YNBA 1A7SA 1ARBA 3KNXA 1C5YB 3GCTF 1BQYA 3D23A 2ALPA 4AG1A 1IQJA 1IQKA 3BTTE 4D8NA 4NGAH 1ARCA 1F0SA 2XBWA 3LGVA 1TPPA 2OLGA 3SUFA 4NIYA 2P59A 1V2UT 3LPRA 2P8OB 1A3EH 4Y11E 2F9VA 2BDGA 2EI6A 3BIUH 3KQBA 1AWHB 2VIDA 2GV6A 4ISLA 1TIOA 3VGCB 2BY8X 6LPRA 3BTGE 1BMLA 1EAIA 3K6ZA 3CP7A 3UTUH 1SGFA 1YP9A 1V2TT 2QF4A 2JIZD 1BRBE 3GISB 1C1WH 2ZG0H 4LK4A 3OU0A 2FOGA 1SQTA 2O8UA 1HUTH 2QN5T 1TNIA 3LH1A 3ZVDA 1P11E 4UFFH 2FWWA 1DANH 1P05A 2ZHDA 3STIA 1Z6JH 4MG3A 3GCHC 4FUHA 3TH4H 4DIIH 5T1VA 3GOVB 1KTTB 1SVPA 2R9PA 4X6MA 1O2LA 2XRCA 2FLRH 2ZEBA 3IWMA 1NZQH 1ZRKA 2F9UA 3TK5A 2VWMA 2V6NA 1AMHA 3PROA 1EOLA 5C0UA 3AW1A 5C5OA 5E0HA 3L6PA 1LO6A 5FAHA 1EPTC 1C2LA 1YCPK 2ILNA 1XMNB 3SYJA 3EE0B 2QY0B 3SV2H 3LGWA 5A8XA 1GVLA 1XKAC 3ZZ8A 3KL6A 1L4ZA 3P17H 1O37A 3P92A 3TVJB 1TNJA 3U69H 2W7UA 1BMMH 1G3DA 1MCTA 1ZGVA 3U1JB 1GVZA 1F0RA 5FX5A 2ZDLA 1A0LA 4CBNA 4BAQB 4SGBE 1THRH 3TJVA 2QA9E 1DY8A 3UNRA 1TWXB 2ZPRA 4FUGA 3KYGA 2A0QB 1O36A 2Y82A 2HNTC 4Y8ZA 4WXVA 1SR5C 2W5EA 3BG8A 5DG6A 2Z6BD 2B8OH 2P94A 5EJLA 1S6FA 3MU0A 1C5QA 3A81A 4KTUA 4K5ZA 3GY7A 5DGJA 1BTHH 2KAIB 1ZSLA 1DWEH 4K1EA 3TGJE 1Y3WA 1HJAC 1S84A 3M5MA 1O39A 1RIWC 4WXIA 3BIVH 3F9FA 4AGKA 3RXHA 2BMGB 1QCPA 1S0QA 2BOKA 2I6SA 2F4LA 4ZCNA 2NWNA 2O8TA 3RXQA 1SGYE 1IHSH 5L6NH 1FONA 2QXIA 1TYNA 2A5KA 3A7TA 1IQFA 4MNVA 3LOXA 1W3CA 1MMJN 5ABWA 5C1XA 1SOTA 4XOJA 1BCUH 1QJ1B 1W12U 2XW9A 2VWNA 1L2EA 1SSXA 5HYOA 1H4WA 1IOEA 1SMFE 2THFB 4KGAA 1GHXH 1KTSB 4GVUA 3KIDU 2C8YB 4H6SB 3T5FH 1KXFA 2WPJS 1OOKB 4NIXA 1SQRA 1P3EA 1QRXA 3F1SB 4Y8XA 2V35A 3UB0A 1EAWA 1SGDE 3MI4A 2H9TH 5FCKA 1OP0A 3FANA 1GBFA 1W11U 3FP8E 1WDIA 5AF9H 3ZVGA 4O3TA 3E0NB 6CHAC 2BDCA 5HGGA 1GBHA 5HMAA 4PROA 1QQUA 2P3TB 4YZUA 1D6RA 2TGTA 3OAAD 3ZZ7A 1TX6A 3PV2A 3FVFB 3EDXB 3Q3YA 2BD3A 1W14U 2FOMB 3EQ0H 1NRNH 2UWLA 1RS0A 3BTKE 4WH6A 2BY9X 4X0WU 2O8WA 2SNWA 2UUYA 1H9IE 2A4GA 4Y7BA 2G55A 5GWZA 1O5AB 3BTQE 4X2YA 1TABE 1C5VA 1P57B 1YLNA 5EJZA 3EYDA 3V7TA 2AMQA 1EUFA 2XNDD 5JB9S 2QF3A 3P70B 4BAOB 1A5IA 1TPOA 1VJ9U 2C8ZB 2NU4E 3UIRA 4SGAE 2FTLE 2CN0H 1CU1A 1O2QA 1KXCA 2VWLA 3ZVFA 1BB0B 2FM2A 1LVOA 4IMQA 4K1SA 1AE8H 7LPRA 2EA3A 1HAIH 1SGEE 2NU0E 4D9RA 1BTUA 3H5CB 7GCHG 4MNWA 1ZOMA 3GYMA 4I8GA 1B0EA 1O31A 1RGQA 4Q2KA 3UWIA 4ZHMU 2HALA 1V3XA 3MOCA 1UCYH 1NFUA 2STAE 3A8CA 1JMOH 1ELAA 1G2MA 2TGDA 1YPHC 1KLTA 1NU7B 1ZSJA 4DY7B 4I8KA 1GI5A 3ZZ9A 4O9VA 3UAIC 1DFPA 4MQAA 1Z1JA 3SV9A 1J16A 1YKTA 5LPRA 7GCHF 1GJ7B 1HRTH 1OKXA 3SJIA 1AE5A 1E1RD 1C1MA 5C1YA 1AWFH 5L2ZH 1DS2E 1F5LA 3RXFA 2FMJA 2FOCA 1MTNB 1XM1A 1HNEE 4K8YA 2ZF0H 2ZFQH 3UOPA 2R2MB 2A7HA 4MPUA 1GBIA 1GBCA 4LOYH 2KZ4A 4B73A 1K1OA 2Q6GA 5LH8A 1TOCB 3RXBA 4DW2U 1O3CA 1QA0A 1T8MA 2F91A 5DPAA 1CT0E 1EZQA 3RXUA 1BMAA 1EAUA 2Z3CA 1JOUB 2IPQX 3KGPA 3O8BA 2BY7X 1NY22 3ZZ5A 1RD3B 3RXMA 1F92A 3AASA 3HPTB 4K69A 3I77A 4NIWA 4XBBA 1Y5AT 1TRYA 5JDUB 4CHAC 1PFXC 2BB4A 4X8UH 4AORA 1BTXA 1O34A 4ISNA 4K8BA 1SGRE 1DLEA 1NROH 5C0TA 3T26A 1AFQC 2PR3A 1TFXA 3F2GA 3SV8A 1U6QA 2VIQA 1VITG 2Z9IA 3NWUA 4MNXA 2AYWA 1ELCA 2J5UA 1ZR0A 4GSOA 1C5ZB 4BXWA 2OQ5A 4WJG2 1P9UA 1T8OA 4YOGA 2AMDA 1QFKH 2BYAX 2KCPA 3M5OA 1NRPH 1ELFA 3A7VA 1DT2A 2RA3A 2SFAA 1CT4E 1F5RA 2O9QA 4X1SU 5T6GA 2D26C 2OD3B 1QBNA 2JETB 1A0JA 1V2OT 1VITF 4NFEA 3ZVAA 3SZNA 1A2CH 4P00A 3P95A 1FIZA 1GBKA 4BNRA 1L1NA 3TU7H 4B71A 1BTZA 2ZGCA 3DD2H 1QR3E 3SNEA 3ZZCA 3UQOA 3PV4A 3UR9A 1O2XA 3RXTA 2HLDD 5E0JA 4ABAA 1GJ6A 3QTOH 1N6YA 4FUDA 4B1TA 3PRDA 4RKJB 1XUJA 3N99A 1VZQH 5CHAC 1HAXB 3RXJA 2GZ8A 2ZC9H 1EJMA 2A5IA 2ZGJA 2PWXA 4BANB 1C5WB 2SNVA 1O3NA 5LGOA 2ESTE 1ELGA 7ESTE 2GTBA 1EZSC 1G37A 3OEHD 2K8IA 4HG6A 3ZV8A 2KFWA 2B7DH 4CRGA 2TGPZ 4X8SH 4ISOA 1ELDE 4U32A 2R3UA 3BTME 1YPEH 3BV9B 1ZJDA 1O2GH 1P8VC 1OWHA 3DFLA 4RN6A 3UNQA 1N8OB 5F6MA 1EB2A 4AYYB 1LQDB 3I29A 2QF5A 1E34B 1ZJKA 2HPPH 5EXMA 1OXGA 1GL0E 1AZZA 5I46H 4ASUD 3UOUA 4LXBH 3F9EA 3UREA 4AOQA 1PYTD 3T29A 4OS1A 2A45B 3QZRA 2H2ZA 1P09A 3EE7A 1BBRH 4WMEA 1H8ED 2EI8A 1UK2A 1YPMH 1SLXB 2RCEA 1NM6A 2WPMS 1K0HA 2BD4A 1HJ9A 3M5NA 4A6LA 3KN2A 5FCRA 3RXVA 3PMBB 3F6UH 3VEQB 1KXDA 2AIQA 1ZSKA 1T4UH 1GDNA 1UVOA 4IN2A 1UTMA 3DT0H 5FL7D 1PQ7A 3QK1A 1TNHA 5IDKA 4Y76A 2WPDD 2YMSD 2C8WB 2ALVA 4NZLA 2FS9A 2I6QA 5AVDA 1J9CH 2P3UB 4DJZB 1GCDA 3NPSA 4IC5A 5DP9A 2GD4B 3LIWA 5F8ZA 1EP5A 4AFUA 2GCTC 1O0DH 1P02A 1P10A 2Y5HA 3GCOA 4X2WA 1WQSA 1P2OA 8ESTE 1HIAB 3QLPH 1AB9C 3AVZA 7KMEH 3BTDE 2PKSC 1DWCH 1H9HE 2BX4A 1LHFH 2ZCKP 1ANCA 4FUEA 3RXDA 2NU3E 2FYQA 3DSPA 4THNH 3UPEA 3GY8A 1FI8A 4JK6A 4YM9A 3UUZA 5EW1H 1HCGA 3BN9A 2PTCE 3QTVH 4XRNA 1MD7A 2P95A 4U01A 2SGFE 4F4OC 2G8TA 1CBWC 1O3LA 1GGDB 3GY2A 3TGKE 1O2PA 2ZFPH 4X8TH 2GMTB 4I8LA 1CA0C 3ELAH 3FAOA 1C2KA 4I8HA 1C5LH 3NKKA 1GJ9B 2G5VA 3RXCA 1KIGH 2O8MA 1XUHA 2Z7FE 4E05H 1O2UA 1PQ8A 1V2KT 4FUJA 5EQSA 4H42U 3WWFA 2VNTA 4ZKSU 3U1IB 3NUMA 3DSGA 4XSKU 2CHAB 2D8WA 3KQ5A 1FAKH 3ZZ6A 1W0ZU 5F8TA 5CE1A 3FZZA 3ZVCA 3OFND 1Q2WA 3WW7A 1G36A 5A8YA 1Z8JB 4B75A 2BDAA 1GCTC 3RXEA 1F2SE 3DCLA 1YPLH 4Q7XA 3RMOH 4NWLA 2RDLA 2WHXA 1ZTLA 3SJ8A 5DP6A 2CK3D 2ZPQA 2A2XH 4YT7H 4TPIZ 1P2MA 3VB4A 3A84A 1GBMA 3BG4B 2Z9GA 3F0PA 3TH2H 1AI8H 2PKAB 2HVYB 1CHGA 4LZ1H 2BLWA 4I31A 1TALA 4BXSA 1KDQB 1NFWA 1W2KH 3SQEE 2BLOA 2PFEA 2BDBA 4TT3D 2W7SA 1YYY1 2JH5D 3WWBA 4NA8A 3ZZAA 1AGJA 1UCYE 1YLCA 1O3FA 1CGIE 1TA6A 1C5XB 2WSSD 4ABEA 4Y8YA 2FI4E 3PRBA 1QRZA 1MQ5A 2BXUH 2ZI2H 2XC5A 1AN1E 1ZHMA 3SHCH 1Y59T 1MKXH 1ELVA 5CMXH 3LGYA 1MUEB 3R0FA 1SGNE 3BEFB 4Q80A 3AAUA 3N7EA 4TY7A 2Z94A 3F2FA 2NU2E 5A8ZA 1UHBA 2OC8A 4D9QA 4UEHH 2R3YA 1K22H 5EJ1A 1FPHH 1G9IE 1T32A 1C2DA 3RMMH 2XNIA 4HI3A 1EFRD 1TMBH 1GI7B 1O5GH 4TSFD 2UWOA 1TB6H 4J1YA 3PLPA 1W8BH 4UFGH 1BTYA 1GI3A 1FDPA 2ZQ1A 1O2OA 2FLBH 2ZIQH 1O3DA 1MQ6A 1QL7A 3JZ2B 3ZVEA 4YOIA 3RM0H 1AHTH 2B5TB 4X1PU 5TJXA 1O5BB 1ZGIA 1MZAA 4FUIA 4D7GA 2LP6A 3EA7A 5EQQA 4AFQA 4TWYA 1O2SA 1V2NT 1ANDA 1VGCC 1WOFA 2EQNA 1LPGB 2QXGA 4RI0A 5T3HA 5JPMH 4WVPE 3ATLA 2ZGXH 5FPSA 4ACBA 1A3BH 3TNTA 1CHOG 2W3KA 3GCHB 3P8OA 3SJ9A 1ACBE 2TGAA 3MYWA 4F48B 2ANKH 1GI8B 5GNDA 3OTPA 1NU9A 5F03A 3E90B 1GDQA 4FUBA 5LPFA 2A5AA 2H9EH 2DE9A 4B2AA 2BDYA 1HPGA 1VCWA 1XXFA 1V2WT 1K1NA 2JH0D 1ZTJA 3W95A 1TE0A 3URDA 3V3MA 1Y3VA 3OTJE 3SJOA 2O8LA 1CHOF 1P06A 1UTQA 1W0KD 5DP8A 2GT8A 3LKWA 1ID5H 1FN8A 1O3EA 3V0XA 1C2EA 4HFPB 4I86A 1BDAA 2ULLA 1SFQB 1FXYA 4ZXYH 1EPTB 2QF0A 4ACAA 3A8BA 1HV7A 1AIXH 3RMNH 1Q31A 1INCA 1O32A 4U2WA 1SGFG 3RXPA 4HZHA 2G4TA 3A7XA 4VGCC 3IG6B 5DP4A 1CVWH 1FMGA 1DDJA 3BEIB 4ABIA 4RT1A 1HAVB 4AC9A 1T8NA 2Y7ZA 1QL8A 3H7TA 1C9PA 4AZ2B 3E3TA 3F9GA 2XBYA 3ZZBA 3UR6A 4O03A 3HGPA 3PB1E 1O3BA 1O2VA 1ZLRA 1NS3A 2XCFA 3TGIE 3ODDA 3VB7A 1UTLM 1KLJH 3RDZA 1UVUH 3DHKH 4I33A 1WXRA 1PPZA 1S5SA 1O3AA 4DGJA 3ZVBA 3A87A 1BUIA 3DA9B 4DIHH 1TNGA 5KGOA 4ABFA 2J98A 4MPXA 3RXAA 2KX4A 1FNIA 2GJGA 1QZ8A 1LMWB 1FLEE 1GJAB 2ZDNA 3SV6A 4D76A 1PYTC 2VIVA 4X2VA 4X1QU 3FP6E 1O2WA 1S85A 4OGYA 1RIWB 1WBGB 1FPCH 1H8HD 1NBME 1AQ7A 1FN6A 1TRMA 1O2NA 2BD9A 2BLQA 3O8DA 3VXEH 1BBRE 1HDTH 2G81E 2H5CA 4YESB 2FOBA 2FXRA 1TGTA 1O30A 2ZDVH 3PO1C 4NFFA 1QJ7B 4ABGA 4FVDA 1K1PA 3F9HA 3CS7A 2ZCHP 1GI6A 2VBCA 3SU1A 1BOQA 1Z8RA 2GT7A 2JKHA 3SO3A 4QT8C 2YNAA 4GLYA 1VKYA 3A88A 3SU0A 3H7OA 3RXLA 4XBCA 3G01A 3TJOA 2YMSC 3ZZ4A 4ZMAH 2G00A 5E0GA 2ZHFH 1O2TA 3ATMA 4K3JA 1ZHPA 5DP3A 1C2MA 3N7OA 4MNYA 2G51A 1QRWA 2FEQH 2GZ7A 1T31A 3BTHE 2ZFTA 1QURH 1L0ZA 4FU9A 3GDSA 2TBSA 4X2XA 1EZXC 1UTKA 5GCHG 3C1KA 1ESBA 4ZAEA 3STJA 1CT2E 3MMGA 5E2OA 3FN8A 2ZU1A 4GCHG 2RA0A 1OSSA 2Y80A 3LGIA 1O2RA 4ZHAA 1EB1H 2OK5A 1BHXB 1TBQH 2J95A 5HM2A 4A1TA 2XC4A 2GDEH 2HVXA 2Y6TA 4Q7YA 3VXFH 1F7ZA 3TJUA 1TOMH 2LELA 2KCAA 2KCOA 3QN7A 1GBLA 1G3BA 1QB1A 5GCHF 3RC4A 5SGAE 2BY6X 2DE8A 2F3CE 1AKSA 3SU4A 2J92A 3B23B 4GCHF 1NO9H 1MZDA 3PLBA 1N6XA 1UK3A 2VWOA 4XD7D 1PPFE 4DT7B 5K0HA 3IITA 3L33A 8KME2 1V2MT 1LHGH 2L74A 4KKDA 3ZV9A 1V2QT 4FUFA 4XBDA 2WPHS 4MPWA 2ZHEH 1O5CB 3A8AA 1RXPA 4INKA 2F9OA 2Y5GA 3HATH 4X6OA 3PMHB 1EOJA 3A7WA 1VCPA 5L2YH 1CGHA 1GBAA 4E7NA 3KYFA 1NN6A 3NRLA 3A8DA 1L1GA 1UMAH 4JK5A 1AO5A 3U8RH 1MKWH 1MTNC 1GJCB 3A82A 3K9XB 1O3KA 2TPIZ 2FODA 1DE7H 1RJXB 2SGDE 2VGCC 5GPIB 2ZU5A 4JZDH 3R3GB 1XKBC 3Q3XA 2J94A 4WF8A 3T25A 1DUEA 1BZXE 1T4VH 2VU8E 1GHVH 4JYTA 1QBVH 2A2QH 5HIYA 1O3PB 5T6FA 4Z1MD 2CJIA 3MO6A 2P93A 1XUKA 2V0BA 3UWJH 1DSTA 2PP6A 1DLKB 1TNLA 2EEKA 3GCNA 1ZHRA 3PTBA 2G5NA 1D3QB 1LHDH 3PWBA 1SB1H 3MH7A 1UW7A 2FOAA 2R2WU 4Y7AA 3UY9A 4H4FA 1IAUA 1HXFH 2QAAA 2BM2A 3RXGA 1AFQB 1GG6B 3URCA 4YLQH 4CH2B 1RTLA 4DT4A 2XC0A 2SGEE 2UUKB 1Z7KA 3SNAA 1CQQA 4JZEH 3RMLH 6ESTA 1ETRH 5T6DA 5B6OA 3RXRA 3M37A 1GI0A 3QZQA 3TPIZ 1GHAG 1T7CA 4RKOB 1TQ7B 5EG4A 2GV7A 3E16B 2J38A 1D4PB 2QE7D 1V2RT 4K2YA 5FBEA 1HAZB 1FJSA 1DY9A 1BRCE 4NA9H 1O3GA 2BD7A 4AYVB 3MFJA 1TQ0B 1W0YH 1C1NA 1K28D 2JETC 3MTYA 1TBZH 1GMHG 2AGGX 3OE7D 3SV7A 1THPB 2PGBB 4DOQA 1C1VH 4Z0KA 1GHAF 3DUXH 2XYAA 1VITH 1TONA 2ASUB 1W7GH 4RSPA 4IS5A 2BOHB 2QIQA 3BTEE 3F0OA 3P8GA 1C1PA 1Y3UA 3LONA 3SU6A 4FETA 5CHAB 3PMAB 1GMHF 2BY5X 3MU8A 3RP2A 1AU8A 3ATWA 1P2QA 2FOEA 1SLUB 2KAIA 1BJUA 2BQ7B 1QB6A 2BQWB 4FVBA 5I25A 1J8AA 3PYHA 1C9TA 4NSYA 4TY6A 1Y5BT 1WU1A 2FYRA 1S6HA 1HAGE 1BJVA 1QIXB 2GGVB 3OY5U 3VG8A 1KYNA 1J14A 1ELBA 1E0FD 1EX3A 2ZHWH 2BQ6B 3TITA 1Q3XA 5C1UA 4MPVA 1NRSH 1S6LA 3PTNA 2C4FH 4WMDA 1K1JA 2A1DB 5JBTA 4TPYA 1P2JA 1FY4A 1QHRB 1C4U2 3ZYEA 1A61H 2ZTZA 3ODFA 1WTHD 2A32A 4AG2A 1FY5A 4CR5A 4B6EA 2EI7A 2AEIH 5JBCS 2XTTB 2Q1JA 4Q63A 2HPQH 1OYTH 3HK3B 4XDEA 4AX9H 1GWAA 3M3TA 1PPGE 4I32A 1YPJH 1O2KA 5KEDA 1G32B 3ESTA 3PLKA 2XWBI 2VJ1A 1A5GH 2IN2A 1SHYA 4NWKA 1UVTH 1DM4B 1JXPA 2A4QA 1KY9A 2ANWA 1BIOA 2KCYA 5FHTA 5HXFA 3U8TH 6GCHG 4NCYA 1AZ8A 4ABBA 2HNTF 2AFQB 2AIPA 1FAXA 1EQ9A 1YCPM 1AVWA 1J17T 4IN1A 1O38A 3T27A 1OWKA 5TCCA 4F55A 3FP7E 1BRAA 3ZYDA 3M7TA 2R0LA 2GCTB 5DP7A 3U8OH 4B6FA 2TIOA 6GCHF 2QV1A 3BSQA 2RFKC 9LPRA 1DICA 3HKIB 4FXGH 4A92A 4AB8A 4NZQA 3K6YA 3A85A 2AGEX 1F0UA 2PKSB 3MU1A 4ZXXH 3NXPA 2OC1A 1E36B 1MAXA 3ITIA 5DP5A 1K1LA 2W6ID 2FZZA 2ZU2A 1UVSH 2FESH 2CF9H 1CBWB 4BAMB 1G3EA 4JZ1A 1O2HA 1P01A 2H5DA 5EODA 1S0RA 1HJ8A 1KXEA 3SUDA 3SHAH 2WPKS 1CA0B 3LH3A 3OX7U 3Q00A 4DG4A 1GL1A 1QTFA 1CSOE 5A0AE 3E8LA 2GX4A 3QWCH 1LVYA 1NESE 1P2KA 3LJJA 2LPRA 5AHGH 4CRBA 3SNBA 1HXEH 3TNSA 1WTGH 1GJ5H 1SKYE 3S69A 1HAOH 2QCYA 1FUJA 3UQVA 1OX1A 3ATIA 4OS6A 1F5KU 2ZPSA 2PGQB 3MNBA 1P3CA 1ELEE 2PLXA 1FV9A 3M35A 3VB6A 1YCPH 1ZZZA 2C3SA 3ZIAD 2GCHG 3SW2B 2C90B 4HTCH 2WUCA 1WQVH 4R0IA 2Y81A 1OWEA 2F9BH 1DVAH 2ZNKH 1JBUH 1BHXF 5A0BA 4E06H 1A5HA 4ISIH 4YO9A 3DFJA 1IQEA 2STBE 5EXNA 3RC6A 1E37B 1SGTA 1HAPH 3P8FA 4JZFH 2ZA5A 3P8NA 4TWWA 2BTCE 3A80A 1SGQE 3RLWH 5DKMA 1O2JA 2M2AA 2ZFRH 1W13U 1SOZA 1RTKA 2GCHF 4BOHA 2BVRH 2D2DA 3QUMP 2D1JA 3AK5A 4WWYA 1UJ1A 2H6MA 4LZ4B 1GI2A 1TNKA 4FU8A 3TLOA 3BG4C 4Y6DA 4HGCA 3BF6H 2H1UA 2FTMA 1OP8A 1DOJA 2RDEA 3M3VA 1ANEA 2B0FA 2G52A 1QB9A 3T62A 2HGTH 3OEED 4DCDA 4DVAU 1JIRA 1WCZA 4NIVA 5EU8A 1LQEA 1Z8GA 3RXOA 4U30A 1BBRK 4A1XA 3GICB 2A31A 3B8JA 1V2JT 1E1QD 2ZTYA 1KLIH 3O8CA 1ABIH 4O97A 1OS8A 1EKBB 1UTPA 4M7GA 1OWIA 5JB8S 2UUJB 2DUCA 3HGNA 3EA9A 3U98H 4ABJA 1FZZA 1UK4A 2FO9A 1C2IA 3M7UA 3S9CA 2LNCA 2WV4A 4UFDH 1OWDA 3RXSA 1QL9A 3JZ1B 1SLWB 3NZIA 1YBWA 1PPHE 2P8OC 1NC6A 2BZ6H 2JDID 2ZQ2A 4OS2A 2KR7A 1RTFB 2XCNA 4BTTB 3L3TA 1XVMA 3VGCC 1Z6EA 1P04A 3OY6U 1MBQA 2IOTA 3P6ZB 1C1RA 3VB5A 4FU7A 1HAHH 4CRAA 5DN6D 1MTVA 2PV9B 2YOLA 1YC0A 1EXFA 1BMNH 1C5NH 2F83A 3Q3KA 5PTPA 1VR1H 4YTAA 3D65E 2GP9B 1HLTH 2B9LA 4MDSA 3SGQE 1TLDA 1VGCB 1KSNA 1YWUA 4CR9A 5C5NA 2BD2A 2P16A 1NPMA 2QXJA 1NFYA 1V2ST 1G3CA 1O5FH 3DSOA 2ANMH 3KHVA 2OXSA 5CDFE 1TGSZ 1TX8A 1K1MA 3TK9A 2TRMA 2A4OA 3NK8A 5DSFA 1GI9B 1K2I1 3EA8A 5EQRA 4YLUA 1C5TA 3O8RA 2OTVA 1HFDA 4CREA 1P0SH 3S0NA 4MTBA 1DSUA 1FIWA 1X7AC 2A7CA 5JYIA 1TAWA 1KMHB 3RXIA 1N1LA 4JCNA 2VH0A 1ZRBA 3B9FH 5KECA 4H6TA 5EXLA 2CF8H 1L4DA 4X6PA 1TRNA 3KF2A 1MU6B 3N7DA 2Q6FA 4AB9A 1RRKA 3MNXA 1O5DH 4Q4LA 4CBOA 1H9LB 4VGCB 2ANYA 1SL3A 3M3SA 4ZHLU 1C4V2 1C2HA 3F2HA 1GHZA 1Z1IA 2F9NA 2ZFFH 3S9AA 1D3DB 1IQLA 3PWCA 2IJOB 3PV5A 1GMDG 1HIAA 2SGAA 1DPOA 3SN8A 1D3TB 3FOAA 2ZGBH 1EJAA 3LDXH 1TGBA 4KTCA 4R8TB 1DUAA 2QGRA 4BAKB 3U9AH 1P2NA 1J15A 1LCYA 2GVFA 3SZEA 5A2MH 2GDDA 1O35A 2OC0A 3SU2A 3GS9A 1HJAB 3MU5A 4ZH8A 2ODQA 1ZMJA 1GMDF 1ZPBA 5B6LA 4Z6AH 4K60A 5J4SA 4A5TS 2WV5A 2VVVA 3OYPA 2BDHA 2EY4C 1DXPA 5EIYA 1C5SA 1WYKA 2VVUA 4BTIB 3LT3A 1MH0A 1MKXK 3QGJA 3VFEA 4YXWD 2FIRH 1MTUA 1FY1A 1Z71A 1ORFA 3MU4A 3PO1B 2WV9A 5IK2D 5F8XA 3SGAE 1C1OA 4NSVA 1AVGH 2ZDKA 3RUOA 1PQAA 1BT7A 4CRDA 1OHHD 5EGMA 1D6WA 2WYJA 3RU4E 3SNCA 3T2NA 1GMCG 1SGPE 1XXDA 5GIBA 1M9UA 1LPKB 1K1IA 3HK6B 1C1QA 3EGKH 1LTOA 1SGCA 2XBXA 3SBKA 1G30B 1W0JD 2Q6DA 4F49A 1TGNA 1OWJA 6CHAB 1DWDH 2YMSB 3BTWE 5HKKD 2WINI 1JIMA 1C5RA 1Y5UT 2QYIA 1O3OA 1TX7A 2FI3E 1P2IA 1GMCF 3GY6A 3HKJB 4B76A 2V7QD 3RC5A 4Y79A 1QQ4A 1Z8IB 1AUJA 1ESAA 2BD5A 2W3IA 3GY5A 4GUXA 3UNSA 1C5OH 1H8IH 1MU8B 1YPGH 5BRRE 5GDSH 2XOKD 2W6JD 3KQCA 2JJ2D 1MCVA 3MNSA 3SUGA 1HYLA 4BAHB 1HBTH 1LHEH 4ZKOU 1GI4A 2HNTE 1B7XB 3MH6A 5DK1A 2PKAA 1UVPA 4X8VH 1E35B 1YF4A 2CV3A 1OP2A 1KDQA 5TCAA 3E91A 1TPSA 4IW4E 4ZROA 3GYLB 3UFAA 2BHGA 2OUAA 1YY3A 5C2ZA 1E38B 3SU5A 3A89A 3GY4A 1FX0B 1C5MD 1O5EH 1QGFA 4CRCA 2FP7B 3E6PH 3MNCA 2XXLA 2K0QA 2PTNA 4UD9H 3MO9A 5ESTE 5C17A 2V3HH 4X1RU 1C2JA 2FX6A 1LHCH 2ZZUH 5EPYA 4NA7A 3MO3A 3SU3A 1GVKB 3Q76A 3W1EA 3CNRA 1FY8E 1C2GA 4IBLH 4CRFA 2PUXB 5EW2H 2FDAA 1C4Y2 1QY6A 1V2VT 1SFIA 1L1JA 2C8XB 5C3NA 1GBEA 1NT1A 1P12E 1TA2A 2FOHA 2V3MA 3RU4T 4I7YH 3FZDA 3PMJA 2J2UA 3E0PB 4KELA 3K2UA 3NCLA 4X1NU 1SPJA 3A7ZA 1DITH 1SLVB 1EAXA 2SGPE 4OM9A 5HM9A 3QGNB 2R0KA 1QA7A 2M5TA 1EJNA 3KEEA 1XUFA 1O3IA 2JH6D 2Z3EA 2G4UA 1MBMA 2F9PA 2Z3DA 1H1BA 2WPLS 3ZZ3A 2GKVE 2OBQA 3MH5A 1ZTKA 4AN7A 2FOFA 4A7IB 1LPZB 2OBOA 5H4IB 3BEUA 4GPGA 1LKAA 1GHWH 2PW8H 2VINA 1PPCE 3LGUA 2AGIX 2VGCB 2ZU4A 2WUBA 4CHAB 3A86A 1THSH 3LC5A 5L30H 1RFNA 1JRTA 3WY8A 1SHHB 1A0HB 2J34A 1AD8H 4I8JA 3E1XB 4ISHH 1F0TA 4ABHA 1ZPZA 2Y7XA 3PM3A 4GHTA 5A09A 1IQIA 1A46H 2Z9JA 2KM0A 1O2MA 1MAYA 1GI1A 2OINA 1GG6C 4GHQA 1UTNA 3QDZB 2ZO3H 1LKBA 1YM0A 1IQMA 1YPHE 4XE4A 1A4WH 2BD8A 3I78A 3OSYA 1E79D 5HIZA 1EPTA 1WV7H 3S9BA 1GPZA 1O3MA 1NBMD 5GXPA 2Y5FA 3ENSB 1S82A 3MHWU 2ZCLP 1VCQA 4J2YB 3SI4H 4B2BA 4XFQA 1ZYOA 1C1UH 4IGDA 1ETTH 2J9NA 2AMPA 2VVCA 4P02A 1NFXA 4UE7H 4MLFB 3M61U 3M5LA 1HAVA 4RT0A 5BPEA 1GDUA 1UO6A 4Y71A 2QXHA 1B0FA 3RU4D 2NU1E 1S83A 4CH8B 1UHBB 2ZECA 5C67A 3KQDA 1GBJA 4M9FA 4O3UA 1LVBA 1GHYH 2UWPA 4TYDA 1ZPCA 5E2PA 1ABJH 3KCGH 1TMTH 3T28A 2Z9KA 3LGTA 5C20A 1IQHA 2W26A 3KQEA 4WMFA 1JRSA 2J4IA 2QC2A 1PJPA 1O2IA 4IC6A 5IYTA 2SGQE 1T8LA 3S7KB 5FXLA 1PPBH 5G4BA 1C5UA 1AVXA 1ELTA 1GBTA 1LDTT 4OS5A 2FS8A 1V2LT 1NRRH 2OCVB 1EATA 1N8OC 1XVOA 5DO4H 5FPYA 4ESTE 2ZTXA 2VIPA 1UCYK 3M7QA 1DWBH 1SG8B 3GY3A 5JBBS 4X6NA 1B5GH 3RLYH 2BXTH 1ETSH 1AUTC 4WH8A 1K21H 2K1QA 4ZUHA 1V2PT 1G2LA 4Y0YE 8GCHG 1NRQH 4INLA 2UUFB 1UTJA 1V6DA 4ASHA 2BZAA 1WUNH 1XUGA 3C27B 4KTSA 5GJ4B 1BRUP 1OPHB 2XBVA 1DX5M 1IHTH 1DXWA 3QX5H 2CGAA 1COWD 2AH4X 1EASA 3SGBE 1GJDB 4IMZA 1Y3XA 1MABB 4OS7A 4UDWH 4OS4A 5ETXA 1GBDA 1QNJA 2J97A 3U28C 1MKWK 8GCHF 3LC3A 1PPEE 1GJ8B 5AFZH 3Q77A 2FI5E 3V12A 3W94A 1BITA 2H9HA 2CMYA 3SNDA 3VB3A 5J4QA 1ZMNA 2WZQA 2ZDAH 5EPNA 1BA8B 3AW0A 2BVXH 3RXKA 2ZKSA 1AFEH 4FUCA 2ZWLH 2IJD1 4FOUC 2VH6A 3A83A 1ANBA 3M36A 5EOKA 3V13A 1AB9B 5K7RA 5FX6A 1BMFD 1H8DH 3TIUA 1ESTA 1FQ3A 4KP0A 2OC7A 1KXBA 4JZIA 4K1TA 2Z9LA 4ZKRU 2VIOA 9ESTA 1C1SA 2F43B 1HAYB 3H09A 1HB0B 2BVSH 1IQGA 3D49H 1QBOA 3QO6A 3S7HB 3FFGA 3SUEA 1HGTH 1C2FA 3GDUA 3SORA 1TBRH 1SGIB 3CENA 4NG9H 3GDVA 4Y10E 1PQ5A 2FPZA 2J98B 1GGDC 4B74A 5F53A 3RM2H 2PUQH 3MH4A 2GMTC 1BTPA 1SI5H 1SQAA 4Y0ZE 4ZKNU 2ZGHA 1C1TA 3K65B 1O2ZA 1MTWA 1GHBG 2AHME 3D62A 4GAWA 1CE5A 1LVMA 1P03A 1FY3A 5JBAS 3MQKC 2OQUA 5DJ7A 2P3FH 1O2YA 2HLCA 1C5PA 3ATKA 4UFEH 4AGJA 1GBBA 1SC8U 2CHAC 3F3BA 1SBWA 2L6OA 2ZFSA 1K9OE 4OGXA 2ZP0H 4YT6H 8LPRA 3VPKA 2HRVA 3BTFE 1GHBF 4JYUH 2A4RA 2OP9A
chains in the Genus database with same CATH topology
2AERH 1GCTB 2BX3A 3LU9B 1QJ6B 1TPAE 3TJNA 4AFSA 2HWLB 5AFYH 1MD8A 1YPKH 1MTSA 4Q7ZA 5LPEA 1D9IA 2ZHQH 3SOSA 1TGCA 1KXAA 1NTPA 4E7RG 2EC9H 1W10U 1TMUH 1BTWA 4B2CA 1P9SA 2HOBA 4BTUB 1CGJE 5FPTA 1W7XH 4INHA 3EAJA 1WSSH 4ABDA 4AFZA 1WAYB 1OYQA 4YOJA 2VIWA 2PHBA 2IPHA 2FX4A 3ZZDA 2CXVA 4MVNA 3SI3H 1UTOA 1AY6H 2V3OH 5ESBA 2ODYB 4A1VA 2A7JA 1GJBB 1EP6A 1O3HA 1ZMLA 3AAVA 1A1RA 2PSXA 2WYGA 1YLDA 2BDIA 2PSYA 4JYVH 2RG3A 1XX9A 3MWIU 1EZUC 4WY3A 3LJOA 1VJAU 3SQHE 1JWTA 1IQNA 1SQOA 1Y3YA 4D7FA 3SJKA 2C93B 3GCTG 3CS0A 1CO7E 1O3JA 1D3PB 1GJ4H 3TH3H 1AKSB 5A0CA 5FBIA 4JMYA 2AS9A 2VB0A 3A7YA 2ZU3A 1Y8TA 1CA8B 3TK6A 2ZDMA 2GZ9A 1XUIA 2BLVA 5E8EH 4DURA 2ODPA 1O33A 3F68H 2XWAA 1YGCH 4UONA 2WPIS 1S81A 2YNBA 1A7SA 1ARBA 3KNXA 1C5YB 3GCTF 1BQYA 3D23A 2ALPA 4AG1A 1IQJA 1IQKA 3BTTE 4D8NA 4NGAH 1ARCA 1F0SA 2XBWA 3LGVA 1TPPA 2OLGA 3SUFA 4NIYA 2P59A 1V2UT 3LPRA 2P8OB 1A3EH 4Y11E 2F9VA 2BDGA 2EI6A 3BIUH 3KQBA 1AWHB 2VIDA 2GV6A 4ISLA 1TIOA 3VGCB 2BY8X 6LPRA 3BTGE 1BMLA 1EAIA 3K6ZA 3CP7A 3UTUH 1SGFA 1YP9A 1V2TT 3GISB 1BRBE 4LK4A 1C1WH 2ZG0H 3OU0A 2FOGA 1SQTA 2O8UA 1HUTH 2QN5T 1TNIA 3LH1A 3ZVDA 1P11E 4UFFH 2FWWA 1DANH 1P05A 2ZHDA 3STIA 1Z6JH 4MG3A 3GCHC 4FUHA 3TH4H 4DIIH 3GOVB 1KTTB 1SVPA 2R9PA 4X6MA 1O2LA 2XRCA 2FLRH 2ZEBA 3IWMA 1NZQH 1ZRKA 2F9UA 3TK5A 2VWMA 2V6NA 1AMHA 3PROA 1EOLA 3AW1A 5C5OA 5E0HA 3L6PA 1LO6A 5FAHA 1EPTC 1C2LA 1YCPK 2ILNA 1XMNB 3EE0B 2QY0B 3SV2H 3LGWA 5A8XA 1GVLA 1XKAC 3ZZ8A 3KL6A 1L4ZA 3P17H 1O37A 3P92A 3TVJB 1TNJA 3U69H 2W7UA 1BMMH 1G3DA 1MCTA 1ZGVA 3U1JB 1GVZA 1F0RA 5FX5A 2ZDLA 1A0LA 4CBNA 4BAQB 4SGBE 1THRH 3TJVA 2QA9E 1DY8A 3UNRA 1TWXB 2ZPRA 4FUGA 2A0QB 1O36A 2Y82A 2HNTC 4Y8ZA 4WXVA 1SR5C 2W5EA 3BG8A 5DG6A 2Z6BD 2B8OH 2P94A 1S6FA 3MU0A 1C5QA 3A81A 4KTUA 4K5ZA 3GY7A 5DGJA 1BTHH 2KAIB 1ZSLA 1DWEH 4K1EA 3TGJE 1Y3WA 1HJAC 1S84A 3M5MA 1O39A 1RIWC 4WXIA 3BIVH 3F9FA 4AGKA 3RXHA 2BMGB 1QCPA 1S0QA 2BOKA 2I6SA 2NWNA 2O8TA 3RXQA 1SGYE 1IHSH 5L6NH 1FONA 2QXIA 1TYNA 2A5KA 3A7TA 1IQFA 4MNVA 3LOXA 1W3CA 1MMJN 5ABWA 5C1XA 1SOTA 4XOJA 1BCUH 1QJ1B 1W12U 2XW9A 2VWNA 1L2EA 1SSXA 5HYOA 1H4WA 1IOEA 1SMFE 2THFB 4KGAA 1GHXH 1KTSB 4GVUA 3KIDU 2C8YB 4H6SB 3T5FH 1KXFA 2WPJS 1OOKB 4NIXA 1P3EA 1QRXA 3F1SB 4Y8XA 2V35A 1EAWA 1SGDE 3MI4A 2H9TH 5FCKA 1OP0A 3FANA 1GBFA 1W11U 3FP8E 5AF9H 3ZVGA 4O3TA 3E0NB 6CHAC 2BDCA 5HGGA 1GBHA 5HMAA 4PROA 1QQUA 2P3TB 4YZUA 1D6RA 2TGTA 3ZZ7A 1TX6A 3FVFB 3EDXB 3Q3YA 2BD3A 1W14U 2FOMB 3EQ0H 1NRNH 2UWLA 1RS0A 3BTKE 4WH6A 2BY9X 4X0WU 2O8WA 2SNWA 2UUYA 1H9IE 2A4GA 4Y7BA 2G55A 5GWZA 1O5AB 3BTQE 4X2YA 1TABE 1C5VA 1P57B 3EYDA 3V7TA 2AMQA 1EUFA 5JB9S 2QF3A 3P70B 4BAOB 1A5IA 1TPOA 1VJ9U 2C8ZB 2NU4E 3UIRA 4SGAE 2FTLE 2CN0H 1CU1A 1O2QA 1KXCA 2VWLA 3ZVFA 1BB0B 2FM2A 1LVOA 4IMQA 4K1SA 1AE8H 7LPRA 2EA3A 1HAIH 1SGEE 2NU0E 4D9RA 1BTUA 3H5CB 7GCHG 4MNWA 1ZOMA 3GYMA 4I8GA 1B0EA 1O31A 1RGQA 4Q2KA 3UWIA 4ZHMU 2HALA 1V3XA 3MOCA 1UCYH 1NFUA 2STAE 3A8CA 1JMOH 1ELAA 1G2MA 2TGDA 1YPHC 1KLTA 1NU7B 1ZSJA 4DY7B 4I8KA 1GI5A 3ZZ9A 4O9VA 1DFPA 4MQAA 1Z1JA 3SV9A 1J16A 1YKTA 5LPRA 7GCHF 1GJ7B 1HRTH 1OKXA 3SJIA 1AE5A 1C1MA 5C1YA 1AWFH 5L2ZH 1DS2E 1F5LA 3RXFA 2FMJA 2FOCA 1MTNB 1XM1A 1HNEE 4K8YA 2ZF0H 2ZFQH 3UOPA 2R2MB 2A7HA 4MPUA 1GBIA 1GBCA 4LOYH 4B73A 1K1OA 2Q6GA 5LH8A 1TOCB 3RXBA 4DW2U 1O3CA 1QA0A 1T8MA 2F91A 5DPAA 1CT0E 1EZQA 3RXUA 1BMAA 1EAUA 2Z3CA 1JOUB 3KGPA 3O8BA 2BY7X 1NY22 3ZZ5A 1RD3B 3RXMA 1F92A 3AASA 3HPTB 4K69A 3I77A 4NIWA 4XBBA 1Y5AT 1TRYA 5JDUB 4CHAC 1PFXC 2BB4A 4X8UH 4AORA 1BTXA 1O34A 4ISNA 4K8BA 1SGRE 1DLEA 1NROH 3T26A 1AFQC 2PR3A 1TFXA 3SV8A 1U6QA 2VIQA 1VITG 2Z9IA 3NWUA 4MNXA 2AYWA 1ELCA 1ZR0A 4GSOA 1C5ZB 4BXWA 2OQ5A 4WJG2 1P9UA 1T8OA 4YOGA 2AMDA 1QFKH 2BYAX 3M5OA 1NRPH 1ELFA 3A7VA 1DT2A 2RA3A 2SFAA 1CT4E 1F5RA 2O9QA 4X1SU 5T6GA 2OD3B 2D26C 1QBNA 2JETB 1A0JA 1V2OT 1VITF 4NFEA 3ZVAA 3SZNA 1A2CH 3P95A 1FIZA 1GBKA 4BNRA 1L1NA 3TU7H 4B71A 1BTZA 2ZGCA 3DD2H 1QR3E 3SNEA 3ZZCA 3UQOA 3PV4A 3UR9A 1O2XA 3RXTA 5E0JA 4ABAA 1GJ6A 3QTOH 1N6YA 4FUDA 4B1TA 4RKJB 1XUJA 1VZQH 5CHAC 1HAXB 3RXJA 2GZ8A 2ZC9H 1EJMA 2A5IA 2ZGJA 2PWXA 4BANB 1C5WB 2SNVA 1O3NA 5LGOA 2ESTE 1ELGA 7ESTE 2GTBA 1EZSC 1G37A 3ZV8A 2B7DH 4CRGA 2TGPZ 4X8SH 4ISOA 1ELDE 4U32A 2R3UA 3BTME 1YPEH 3BV9B 1ZJDA 1O2GH 1P8VC 1OWHA 3DFLA 4RN6A 3UNQA 1N8OB 5F6MA 1EB2A 4AYYB 1LQDB 3I29A 1E34B 1ZJKA 2HPPH 5EXMA 1OXGA 1GL0E 1AZZA 5I46H 3UOUA 4LXBH 3F9EA 3UREA 4AOQA 1PYTD 3T29A 4OS1A 2A45B 3QZRA 2H2ZA 1P09A 1BBRH 4WMEA 2EI8A 1UK2A 1YPMH 1SLXB 2RCEA 1NM6A 2WPMS 2BD4A 1HJ9A 3M5NA 4A6LA 3KN2A 5FCRA 3RXVA 3PMBB 3F6UH 3VEQB 1KXDA 2AIQA 1ZSKA 1T4UH 1GDNA 1UVOA 4IN2A 1UTMA 3DT0H 1PQ7A 3QK1A 1TNHA 5IDKA 4Y76A 2C8WB 2ALVA 4NZLA 2FS9A 2I6QA 5AVDA 2P3UB 1J9CH 4DJZB 1GCDA 3NPSA 4IC5A 5DP9A 2GD4B 3LIWA 5F8ZA 1EP5A 4AFUA 2GCTC 1O0DH 1P02A 1P10A 2Y5HA 3GCOA 4X2WA 1WQSA 1P2OA 8ESTE 1HIAB 3QLPH 1AB9C 3AVZA 7KMEH 3BTDE 2PKSC 1DWCH 1H9HE 2BX4A 1LHFH 2ZCKP 1ANCA 4FUEA 3RXDA 2NU3E 2FYQA 4THNH 3UPEA 3GY8A 1FI8A 4JK6A 4YM9A 3UUZA 5EW1H 1HCGA 3BN9A 2PTCE 3QTVH 1MD7A 2P95A 4U01A 2SGFE 4F4OC 2G8TA 1CBWC 1O3LA 1GGDB 3GY2A 3TGKE 1O2PA 2ZFPH 4X8TH 2GMTB 4I8LA 1CA0C 3ELAH 3FAOA 1C2KA 4I8HA 1C5LH 3NKKA 1GJ9B 2G5VA 3RXCA 1KIGH 2O8MA 1XUHA 2Z7FE 4E05H 1O2UA 1PQ8A 1V2KT 4FUJA 5EQSA 4H42U 2VNTA 4ZKSU 3U1IB 3NUMA 4XSKU 2CHAB 2D8WA 1FAKH 3ZZ6A 1W0ZU 5F8TA 5CE1A 3FZZA 3ZVCA 1Q2WA 1G36A 5A8YA 1Z8JB 4B75A 2BDAA 1GCTC 3RXEA 1F2SE 1YPLH 4Q7XA 3RMOH 4NWLA 2RDLA 1ZTLA 3SJ8A 5DP6A 2ZPQA 2A2XH 4YT7H 4TPIZ 1P2MA 3VB4A 3A84A 1GBMA 3BG4B 2Z9GA 3TH2H 1AI8H 2PKAB 1CHGA 4LZ1H 2BLWA 4I31A 1TALA 4BXSA 1KDQB 1NFWA 1W2KH 3SQEE 2BLOA 2PFEA 2BDBA 2W7SA 1YYY1 2JH5D 4NA8A 3ZZAA 1AGJA 1UCYE 1YLCA 1O3FA 1CGIE 1TA6A 1C5XB 4ABEA 4Y8YA 2FI4E 1QRZA 1MQ5A 2BXUH 2ZI2H 2XC5A 1AN1E 1ZHMA 3SHCH 1Y59T 1MKXH 1ELVA 5CMXH 3LGYA 1MUEB 3R0FA 1SGNE 3BEFB 4Q80A 3AAUA 4TY7A 2Z94A 2NU2E 5A8ZA 1UHBA 2OC8A 4D9QA 4UEHH 2R3YA 1K22H 1FPHH 1G9IE 1T32A 1C2DA 3RMMH 2XNIA 4HI3A 1TMBH 1GI7B 1O5GH 2UWOA 1TB6H 4J1YA 3PLPA 1W8BH 4UFGH 1BTYA 1GI3A 1FDPA 2ZQ1A 1O2OA 2FLBH 2ZIQH 1O3DA 1MQ6A 1QL7A 3JZ2B 3ZVEA 4YOIA 3RM0H 1AHTH 2B5TB 4X1PU 5TJXA 1O5BB 1ZGIA 1MZAA 4FUIA 4D7GA 3EA7A 5EQQA 4AFQA 4TWYA 1O2SA 1V2NT 1ANDA 1VGCC 1WOFA 2QXGA 1LPGB 5T3HA 5JPMH 4WVPE 3ATLA 2ZGXH 5FPSA 1A3BH 3TNTA 1CHOG 2W3KA 3GCHB 3P8OA 3SJ9A 1ACBE 2TGAA 3MYWA 2ANKH 1GI8B 1NU9A 5F03A 3E90B 1GDQA 4FUBA 5LPFA 2A5AA 2H9EH 2DE9A 4B2AA 2BDYA 1HPGA 1VCWA 1XXFA 1V2WT 1K1NA 2JH0D 1ZTJA 3W95A 1TE0A 3URDA 3V3MA 1Y3VA 3OTJE 3SJOA 2O8LA 1CHOF 1P06A 1UTQA 5DP8A 2GT8A 3LKWA 1ID5H 1FN8A 1O3EA 3V0XA 1C2EA 4HFPB 1BDAA 2ULLA 1SFQB 1FXYA 4ZXYH 1EPTB 2QF0A 3A8BA 1HV7A 1AIXH 3RMNH 1Q31A 1INCA 1O32A 4U2WA 1SGFG 3RXPA 4HZHA 2G4TA 3A7XA 4VGCC 3IG6B 5DP4A 1CVWH 1FMGA 1DDJA 3BEIB 4ABIA 1HAVB 1T8NA 2Y7ZA 1QL8A 3H7TA 1C9PA 4AZ2B 3E3TA 3F9GA 2XBYA 3ZZBA 3UR6A 4O03A 3HGPA 3PB1E 1O3BA 1O2VA 1ZLRA 1NS3A 2XCFA 3TGIE 3ODDA 3VB7A 1UTLM 1KLJH 3RDZA 1UVUH 3DHKH 4I33A 1PPZA 1S5SA 1O3AA 4DGJA 3ZVBA 3A87A 1BUIA 3DA9B 4DIHH 1TNGA 4ABFA 4MPXA 3RXAA 1FNIA 1LMWB 1FLEE 1GJAB 2ZDNA 3SV6A 4D76A 1PYTC 2VIVA 4X2VA 4X1QU 3FP6E 1O2WA 1S85A 4OGYA 1RIWB 1WBGB 1FPCH 1TRMA 1AQ7A 1FN6A 1O2NA 2BD9A 2BLQA 3O8DA 3VXEH 1BBRE 1HDTH 2G81E 2H5CA 4YESB 2FOBA 2FXRA 1TGTA 1O30A 2ZDVH 3PO1C 4NFFA 1QJ7B 4ABGA 4FVDA 1K1PA 3F9HA 3CS7A 2ZCHP 1GI6A 3SU1A 1BOQA 1Z8RA 2GT7A 2JKHA 3SO3A 4QT8C 2YNAA 4GLYA 3A88A 3SU0A 3H7OA 3RXLA 4XBCA 3G01A 3TJOA 3ZZ4A 4ZMAH 2G00A 5E0GA 2ZHFH 1O2TA 3ATMA 4K3JA 1ZHPA 5DP3A 1C2MA 3N7OA 4MNYA 2G51A 1QRWA 2FEQH 2GZ7A 1T31A 3BTHE 2ZFTA 1QURH 1L0ZA 4FU9A 3GDSA 2TBSA 4X2XA 1EZXC 1UTKA 5GCHG 3C1KA 1ESBA 4ZAEA 3STJA 1CT2E 3MMGA 5E2OA 2ZU1A 4GCHG 2RA0A 1OSSA 2Y80A 3LGIA 1O2RA 4ZHAA 1EB1H 1BHXB 1TBQH 2J95A 5HM2A 4A1TA 2XC4A 2GDEH 2HVXA 2Y6TA 4Q7YA 3VXFH 1F7ZA 3TJUA 1TOMH 3QN7A 1GBLA 1G3BA 1QB1A 5GCHF 3RC4A 5SGAE 2BY6X 2DE8A 2F3CE 1AKSA 3SU4A 2J92A 3B23B 4GCHF 1NO9H 1MZDA 3PLBA 1N6XA 1UK3A 2VWOA 1PPFE 4DT7B 5K0HA 3IITA 3L33A 8KME2 1V2MT