3TPIZ

The geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSINOGEN
publication title The Geometry of the Reactive Site and of the Peptide Groups in Trypsin, Trypsinogen and its Complexes with Inhibitors
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1982-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tpiZ01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3tpiZ02
3NCLA 2C8XB 2DE9A 6CHAB 1O2LA 1AWHB 4TWWA 4WXIA 4NA8A 1MTNB 2EEKA 2FI5E 4ZKOU 7ESTE 4CRAA 1IAUA 3JZ1B 1CHOG 2QXGA 1MBMA 1A0HB 4NIVA 1BOQA 2V3OH 5IDKA 1GMDG 1LVYA 2A7JA 2GD4B 3UWJH 3OU0A 2G4UA 3TK5A 1O3AA 1L4DA 4HZHA 2PHBA 3MU1A 2BY7X 2FOMB 4DCDA 1BMMH 1DFPA 1W0ZU 1C2IA 2D26C 3UPEA 1PPGE 3MYWA 3R3GB 5FCRA 1ID5H 3HK3B 1YPLH 2VIOA 2RG3A 4HGCA 5DP4A 4WWYA 2A7CA 4B74A 2AS9A 3E1XB 5F6MA 1C1OA 1BBRK 2OC0A 1IQIA 3KIDU 3SUDA 2D8WA 2B7DH 1O3OA 1JMOH 4NGAH 1NESE 3NXPA 1CHOF 3LKWA 1K1PA 3RU4E 1KDQB 1GMDF 5JBTA 1O3KA 1WCZA 1WBGB 3I77A 1TQ7B 3KL6A 1FJSA 2BHGA 5EW1H 3GYMA 1SLVB 1GI1A 1Z7KA 1AHTH 3KQDA 1XVMA 3LGVA 2EI6A 2C90B 4BAOB 1NRSH 1QGFA 1TA6A 1SOZA 5EXLA 1CT0E 3V0XA 4ABDA 5CHAC 3PMBB 1GWAA 4BXWA 5F03A 1ZRKA 5A2MH 1GJ7B 1MU6B 3MOCA 2C3SA 4U32A 4CRFA 3SUFA 1QBNA 3UNSA 3RXDA 4YT6H 1MMJN 1TA2A 1T4UH 1MTUA 1O34A 2BLVA 1N6XA 1TRYA 1OXGA 1BA8B 5C67A 1QCPA 2BQWB 2KAIB 3W94A 1S5SA 1UVOA 4TY7A 1Z1IA 5F8ZA 2YNBA 1J17T 3BTGE 3G01A 4KTCA 1THPB 4ISNA 1NO9H 2ZDAH 2ZG0H 1SGEE 3IG6B 5C20A 1CE5A 1A3EH 2BY9X 2RA0A 1V2JT 4Y8XA 2GT7A 3UQOA 1NY22 2ZHDA 1P2JA 3ZVCA 4IMQA 1FN8A 3E0NB 1ANDA 4GVUA 1TQ0B 1GI9B 1H4WA 4A1XA 1N8OC 2OQ5A 4I8JA 1CA0B 2XC5A 1ZJDA 4UD9H 2BDGA 3U8TH 2QY0B 5LPRA 1O3GA 5DP7A 1HRTH 1P10A 4WMDA 4JCNA 3LC3A 2Y6TA 1O2ZA 1UCYH 2FI3E 1C4V2 1Y8TA 3RXJA 1NZQH 2XCNA 1CVWH 4K1EA 1MD8A 5C2ZA 1WUNH 1FY5A 4ABJA 1Q31A 2BZAA 2FWWA 1AB9C 1W7GH 3QUMP 2HVXA 3ZZCA 4CRGA 3BEFB 1TNJA 1DX5M 1B7XB 4J1YA 1F0SA 5TCCA 3KQBA 3ZZ4A 1TBRH 3A81A 1FZZA 1W13U 2SGEE 4IN2A 5FBIA 2VIVA 3A89A 4ABBA 2XCFA 3RXHA 1GBKA 3MH6A 4E06H 4BANB 2G5NA 2GT8A 3I29A 1ELCA 3NWUA 2XTTB 1O2KA 1L0ZA 2FI4E 2M5TA 1LMWB 4THNH 8LPRA 1H9HE 5LH8A 2XBVA 2AH4X 3RXKA 1T7CA 1SG8B 1DVAH 2YNAA 3SV8A 4YOJA 5A0CA 2F91A 1HAXB 1UJ1A 1UK3A 1YPHE 1BCUH 1NROH 1O2WA 1DWBH 1QHRB 3SO3A 3PROA 1HAYB 1JRTA 1LKAA 1ZPZA 5JBBS 4D7FA 1HIAB 5EPYA 1P01A 3SJ9A 3SUGA 2TGPZ 1VCWA 3S9CA 3UFAA 4H42U 5EXMA 4FUHA 1TPAE 3GCNA 2QIQA 4Y0ZE 1O30A 3LU9B 1P8VC 4Y79A 1KXCA 3D65E 3QX5H 5TJXA 1C4U2 4X2YA 4CRBA 1FUJA 1IQHA 2OLGA 1N8OB 1L1GA 3SQHE 2FOCA 3LDXH 2K1QA 4IBLH 3T5FH 1WAYB 2FEQH 3B23B 1A2CH 1ESBA 1S82A 4INLA 5C3NA 2KAIA 4LOYH 1SQTA 1O3MA 2Q6FA 3LIWA 1Z8GA 2ALPA 2BZ6H 1O3DA 1TNIA 1GI7B 6GCHG 1HGTH 1YC0A 1OP8A 1TE0A 1GBTA 4INHA 3RXOA 2ZFQH 1K9OE 2ZDKA 3A83A 2BYAX 1VJAU 2A1DB 3M3SA 1A5GH 4FXGH 3NZIA 1AB9B 1Z6EA 4Q7YA 3VB5A 3RMLH 4Y76A 1YPGH 1FQ3A 1EKBB 4CBNA 3RLWH 1O33A 1ESTA 5FCKA 3OYPA 4IC6A 4GPGA 1C1UH 2ZEBA 1GJ8B 2XBWA 1VCQA 3A85A 2NU1E 1QJ6B 3CS0A 1RIWB 2VJ1A 3OX7U 2ZNKH 1C1RA 4X0WU 2ZFFH 4U2WA 4A1VA 3TGJE 2QAAA 3RXBA 1V2VT 4H6TA 1UCYE 4XFQA 5I25A 1KLJH 1BJUA 2ZCKP 3DFLA 3TK9A 3MHWU 2BDYA 5EG4A 2HNTC 1UVPA 1EASA 1OX1A 2G00A 6GCHF 3L3TA 2H5DA 1THSH 1DANH 3EAJA 4INKA 2Y5GA 3R0FA 1G9IE 4AN7A 3BG8A 1T4VH 4BOHA 1TMBH 1Y5AT 2G4TA 2F9NA 3RXTA 3TNTA 3LGYA 3SNCA 1OWJA 2V3HH 4ISHH 2B9LA 3SNAA 2XW9A 1BTYA 2AGGX 3ZYEA 1E34B 3VFEA 1TPOA 3QLPH 4FUBA 2TIOA 4DIIH 3K6YA 1VGCC 3EA7A 1P2OA 1BRAA 1EZUC 1O3PB 1QRWA 1WOFA 2PV9B 3EQ0H 5SGAE 4CREA 1C5OH 3BIVH 1PQAA 4CBOA 2A31A 7GCHF 2OBOA 2AERH 5DP5A 4ZH8A 2O9QA 1C5QA 1MD7A 1EZXC 3U9AH 1BTZA 1O5CB 2ZGXH 3NK8A 1G2MA 1FY8E 1QQUA 2OBQA 4ZHAA 2F9PA 3ZZ8A 1QB1A 1EATA 5L30H 3PLBA 1GJ9B 2XWAA 1GI6A 1W10U 2A5IA 1SQAA 1LHDH 1SLXB 3TVJB 1QR3E 3VEQB 1ZSJA 3CENA 5CE1A 1OWEA 2ANYA 1ZSKA 2B5TB 2TBSA 3BN9A 5T6FA 2C4FH 3BV9B 2FS8A 1FONA 1SOTA 1K1OA 4D9RA 2ZKSA 2ZU2A 4D9QA 1F0RA 1HV7A 1UO6A 3FZDA 2TGDA 3SU2A 1C2HA 1Z8IB 4AG2A 5FPYA 2BY6X 2V6NA 1P9UA 4CRCA 1A4WH 3GCHC 3P6ZB 3OSYA 1SHYA 2PKAB 3S0NA 4IN1A 3MU8A 5ESBA 3B9FH 1CSOE 1OP2A 3E3TA 4FUFA 1RTKA 4MNWA 2ZHEH 5K0HA 4X8TH 1O2YA 1QL7A 2WPJS 3LPRA 4AGJA 3V3MA 2BD2A 5I46H 3LC5A 3OY5U 1O35A 1FAKH 3GY2A 9LPRA 3MH7A 2Z3DA 4MG3A 1GHWH 3V13A 5C1XA 1ELTA 1B5GH 2TRMA 4MTBA 1MKXK 3PTBA 4WF8A 2FESH 1AVWA 1L1JA 5PTPA 1HB0B 4Q7ZA 1D3PB 3RXMA 3AAUA 2PSXA 1HJ8A 3K2UA 2LPRA 1O39A 3M3TA 1MBQA 3H5CB 1K1MA 1VGCB 5GXPA 1BZXE 1GDUA 1O2RA 1SPJA 2TGAA 4BTIB 2FDAA 1ZGVA 3A7VA 3D62A 1OSSA 3A84A 1QNJA 3EYDA 1TMUH 4AGKA 5HM9A 2A5AA 1RXPA 1G3CA 2XYAA 7LPRA 4B1TA 1GCDA 1C5RA 1YYY1 2ZQ1A 1P03A 2CGAA 1GHAF 3Q3XA 3PWCA 5DKMA 1IQJA 4AYVB 2BDBA 2BTCE 4FUCA 1JOUB 1F2SE 2XXLA 3F1SB 4FU7A 1SR5C 2Z9GA 3ZZ9A 3GCOA 4J2YB 2SNVA 2IPHA 2CF9H 1GDQA 1C5UA 1K1IA 1NS3A 1GGDB 2ULLA 1CT4E 1GBJA 2FOBA 1XUGA 5GWZA 1W7XH 5F8TA 1ARBA 1O3LA 4TPYA 4BAHB 1C5SA 2Z6BD 1J8AA 1V2ST 3A8AA 4DIHH 1UVTH 5FPSA 2B0FA 3A82A 1EAIA 2P59A 1IQLA 1XUIA 3VB6A 1FPHH 1N6YA 2FXRA 2ILNA 4ABAA 3EA8A 3CS7A 1EJAA 5T6GA 3EGKH 1TGNA 1UTQA 3BTQE 4OS5A 1A0LA 3GCHB 3Q00A 4BTTB 3K6ZA 1GI2A 4I8KA 1UHBA 4FUIA 2ZCHP 1BJVA 1WQSA 4GCHG 3GDUA 4NFEA 4WH8A 3AAVA 3T2NA 2F9VA 2P16A 1EAXA 2ZU3A 3ZZBA 4NZLA 2SGDE 1CBWC 1XXDA 4JZFH 3RXUA 5A0BA 2F9UA 3Q3KA 3F6UH 2F3CE 2QA9E 2Z3CA 1D6RA 4B2AA 2QYIA 2VWNA 1C1VH 1P9SA 3RU4D 3SGBE 4KP0A 2GV7A 1IQGA 2A5KA 1YM0A 4GCHF 5K7RA 1TFXA 1AFQC 3QGNB 1PQ7A 3T29A 1GJ5H 2HGTH 1PYTC 1C2GA 4ZKNU 4O9VA 2QCYA 1J15A 2FYQA 1XXFA 1K21H 3LJJA 1KLTA 3ESTA 4A6LA 4X6NA 4WH6A 4WJG2 1IHTH 1CGIE 1LPZB 2CXVA 3KEEA 3M5MA 2QXJA 3ZVDA 1NT1A 2WPHS 3UOUA 2G51A 1GMCG 4I8LA 2GGVB 4TY6A 1Y3VA 2BQ6B 5DP6A 3RXRA 4YTAA 1HAIH 4XSKU 3TITA 3U98H 4BAMB 5E2PA 4CR5A 3TJVA 1Q3XA 2QXHA 4OS4A 2RDLA 4Q80A 1BRCE 2FS9A 3L33A 2A4RA 4DURA 1RTLA 3PTNA 3U1IB 3VGCC 3SHCH 2R2MB 3BTDE 2BQ7B 2PUQH 1GI8B 3D49H 1TIOA 4ESTE 3AVZA 4B75A 1GMCF 1MTWA 3PO1C 3EA9A 5LPFA 2AMQA 1EPTC 2VIQA 4FVDA 3RXVA 1O2JA 5E2OA 3UY9A 1K1JA 9ESTA 4LZ4B 4B73A 1SB1H 5GCHG 3URDA 3MWIU 1DXPA 3RM0H 3RC6A 1UTNA 1QL9A 1DM4B 3EE0B 4OS2A 4YESB 1MZDA 1ETRH 4Y6DA 3SU0A 2PKSC 4LK4A 2O8TA 3F9EA 4BXSA 1UTJA 4K1TA 1AI8H 1P2MA 1QBVH 2PTNA 4CR9A 1P3CA 1TONA 1Y3YA 1CBWB 1AD8H 3VB7A 1GBEA 4KELA 4GSOA 1ELEE 2D1JA 2QXIA 1E36B 3BF6H 3SV7A 2UUFB 5T6DA 3RLYH 1SGDE 2OP9A 1C1MA 1S83A 1DY9A 3SZNA 1BITA 3PM3A 1ARCA 2FMJA 3O8BA 1TOMH 1RTFB 1YLDA 4UFFH 1GJAB 2VWLA 5GCHF 3QO6A 5A0AE 3ENSB 2IN2A 3P8FA 1NPMA 1QB6A 2PUXB 5GDSH 4AFSA 1NRPH 4DGJA 4A7IB 1SLWB 4B2BA 1UCYK 2Q6DA 1C5XB 2BD9A 1A0JA 1DLKB 1AFQB 2J2UA 2VIDA 4KKDA 2UUYA 3LH1A 4X8SH 2FOFA 3SNBA 2J95A 3BTHE 1GJDB 1XUHA 4YZUA 3HGPA 3PLPA 3TJUA 2ZECA 1A1RA 1C5WB 2XWBI 2I6SA 1ABIH 2R3UA 3LH3A 3LONA 2TGTA 1O31A 2FTLE 3KGPA 2A2QH 2XRCA 2H6MA 3FVFB 1GBLA 2ODYB 4AZ2B 1MH0A 3ZZDA 3ATWA 3A7TA 1MTSA 2GV6A 4AX9H 4TWYA 2WYGA 4ZROA 1SGYE 2ZPQA 1FIZA 5JBAS 4X1QU 2GMTC 1HAVA 1LPGB 2YOLA 3VGCB 1C5LH 1F0UA 5E0HA 1KXFA 2V35A 1C5NH 1Z71A 3BTTE 1D4PB 4MLFB 1P11E 1MQ5A 3SI4H 1INCA 3NUMA 5HYOA 1ZR0A 3RXFA 2W3IA 3SHAH 2JETC 5HMAA 2FODA 1FXYA 1ZOMA 5L6NH 1MU8B 1PPFE 1SGIB 2QN5T 3MO3A 3SOSA 1O5BB 2PKSB 1TYNA 3MH4A 1Y5UT 4FVBA 1A5IA 2VWOA 2BY8X 1Z1JA 4TYDA 3SU4A 3RXAA 2BD4A 2CV3A 1O2HA 4YM9A 1EQ9A 1C9PA 1A46H 2XBXA 3E90B 3UR6A 2BDAA 2OD3B 2GCTC 1GHZA 1O3FA 1MUEB 3KHVA 2ZDMA 3P8GA 1GI5A 5DP9A 3HPTB 2AGIX 5CHAB 2G52A 1C2FA 1D3TB 4UFGH 1IHSH 4NA7A 2JH6D 2QV1A 3RXQA 2VGCC 3A80A 4FUEA 4B76A 2BMGB 3SN8A 5FBEA 1SC8U 3UTUH 1O2OA 2AFQB 1KDQA 1OYTH 1MAYA 1KXDA 1MKWK 4OGXA 3ZVAA 1IQNA 1LHGH 2QGRA 2PSYA 2IJOB 1IOEA 2P95A 4O03A 2BX4A 1K28D 4D76A 3UUZA 1G30B 1TAWA 2SGPE 3CP7A 3NPSA 8GCHG 2Y7ZA 1C5PA 2UUKB 2SGAA 3PYHA 5A8YA 3MNSA 4H6SB 2OCVB 1KTTB 5A8ZA 1PYTD 3SU5A 4K8YA 1HAHH 4JZEH 3TK6A 5A8XA 1SLUB 2FYRA 4WMFA 3KNXA 2J92A 4U30A 1PPCE 1S0RA 1ABJH 2V0BA 4ABFA 3KQCA 2Y5FA 5C1UA 3IITA 1ZZZA 3DFJA 1ANBA 3M3VA 1O2NA 4Z0KA 5F8XA 2Q1JA 3GY8A 1O2IA 1LDTT 3FFGA 2J38A 4DG4A 1HJAC 2GMTB 1MKWH 1ZSLA 4X2VA 8GCHF 1M9UA 1OWDA 1PQ5A 1SQOA 3ATLA 4K60A 1GDNA 5L2YH 2GZ9A 1PPHE 1S6FA 1HNEE 2GDEH 2AIQA 2ODQA 1FMGA 4GHTA 5EQQA 1BTWA 3T62A 3ZV8A 1GJCB 1LVMA 1QJ1B 2GZ7A 1HXEH 2QF3A 2W7UA 3UNQA 1XKAC 1KY9A 2JETB 1ZLRA 4Y7AA 3ZVFA 4OS6A 1HAOH 2SGQE 4H4FA 1HAPH 1EX3A 4MQAA 3UQVA 2H9EH 4Q2KA 2ZTZA 1JBUH 4GAWA 3BSQA 1GJ4H 1GCTC 3ZZ3A 1C1PA 1FV9A 2NU2E 1O3BA 2P8OC 1EXFA 2NWNA 2GCTB 4WY3A 1DDJA 2C8ZB 1RGQA 1DS2E 4X1NU 1SHHB 3OY6U 4XBCA 2BOHB 5GJ4B 1CO7E 1LQEA 4Y71A 3RC4A 3SI3H 3U8RH 4LZ1H 1AQ7A 3P92A 1AZ8A 2P94A 2OXSA 3LGWA 1LVOA 2VGCB 4AFUA 2THFB 4ZAEA 3SU3A 1GHVH 1AO5A 4R0IA 2OINA 1SVPA 2BLWA 1G37A 3VXEH 1HLTH 1EB1H 1WTHD 1BTHH 3M7UA 1MZAA 4FU8A 3W95A 4Y7BA 4K3JA 5JDUB 3RC5A 4OS7A 4AB9A 4HTCH 1H9LB 3P8NA 4AFZA 1TGBA 3P17H 1NU9A 2Y82A 3F68H 3MI4A 5GIBA 4Q7XA 1YKTA 2A0QB 2BVXH 1SGFA 1VITH 5BPEA 1E35B 1NC6A 1LHEH 2D2DA 2QC2A 2NU4E 1ETTH 3ZZAA 4FUJA 3BTFE 2G55A 4I8GA 3Q3YA 4FUGA 2GCHG 3E91A 1PFXC 2H9TH 3IWMA 4NG9H 1ZMNA 3WY8A 4XOJA 3Q77A 5DG6A 1L1NA 3VPKA 1AKSB 5CMXH 5T3HA 3MTYA 4QT8C 4CRDA 1F92A 5B6OA 1HIAA 4LXBH 3NKKA 1Y3WA 1HJAB 2VVUA 2A4GA 3QZQA 1EAWA 5DP3A 1V2TT 1C1QA 1HFDA 2ZFPH 6ESTA 1FNIA 1TX7A 3TJOA 1SFIA 1A3BH 1TGSZ 4F4OC 4MPWA 4JK6A 1FI8A 2R0LA 3LGIA 4NIWA 1O5GH 1AFEH 4HI3A 2WYJA 4KGAA 2FTMA 2Y81A 5DK1A 2QF0A 3GDVA 2BVRH 3O8RA 3UWIA 4OS1A 1EJNA 3M5NA 3RDZA 3C1KA 3ZYDA 1E38B 3MNBA 1XKBC 2GDDA 4M7GA 4NFFA 5FX6A 5LGOA 1BMNH 1KLIH 1FY1A 1GCTB 1GVKB 1JXPA 1P09A 3VB3A 1EP5A 1GHBG 2ZA5A 1DLEA 4ABEA 2OC1A 3S7HB 1TABE 1DWDH 1LHFH 3MO9A 1W3CA 1P05A 4GUXA 1KSNA 2A2XH 5LPEA 4Y10E 1H1BA 1BRBE 1XX9A 2PLXA 1O3IA 2VIPA 3TPIZ 1EAUA 1LVBA 4AFQA 2WV4A 1F0TA 4MNVA 5J4SA 1O38A 5ESTE 1N1LA 3AW0A 3A87A 1YPHC 1ZPBA 4MPUA 2ZDLA 2FZZA 4K8BA 4ABHA 2VIWA 3MMGA 5FX5A 1NFWA 3TU7H 2RA3A 1GHBF 5EOKA 1UTOA 1GI0A 1HJ9A 1SGNE 4DOQA 2CJIA 4XDEA 1TPSA 3EDXB 3M35A 2A4OA 2WV5A 3BTWE 1D3QB 1V2QT 3BEIB 5JB9S 2BD7A 1OWHA 3M7QA 1QIXB 1GBFA 1TX6A 4TPIZ 3P95A 1SGTA 2BD5A 3UIRA 3GY7A 4ISLA 1YF4A 4D8NA 4X1PU 3TGIE 2HPPH 2I6QA 4WXVA 3URCA 1SBWA 1UK4A 2R9PA 1A5HA 1YCPH 2O8UA 2W26A 2EI8A 1SGRE 3BTME 1NN6A 3QN7A 5DJ7A 3M61U 1WU1A 3FP8E 3LGUA 2JKHA 2Z9KA 1IQKA 4ABGA 2HRVA 2J34A 2ZGBH 2FOEA 1AZZA 3M5LA 3Q76A 1ZRBA 3SV2H 1G3EA 2Z9LA 2BDHA 1FAXA 5AHGH 3RP2A 1FIWA 1F5LA 5JBCS 2AMPA 3QGJA 5AVDA 1BB0B 1JIMA 1OWIA 1DT2A 1TGCA 5A09A 4IC5A 1FPCH 3PLKA 3U8OH 4CHAC 2FO9A 5C5OA 1YPEH 2ODPA 1W2KH 2R3YA 4JYVH 1ZYOA 1V2WT 3MO6A 4UEHH 4XE4A 1ZHMA 2Z9IA 4AYYB 1HAZB 3STIA 1CU1A 2ZZUH 1TNGA 3ATKA 3ZZ5A 4NCYA 5EQRA 1HXFH 2BXTH 2CF8H 4R8TB 2Q6GA 1NRQH 5C5NA 4YOGA 1PQ8A 5GPIB 2FOAA 4JZDH 1SSXA 5FXLA 2AGEX 2O8LA 1UTLM 1O36A 2PKAA 4K5ZA 1LTOA 1O3CA 2FX4A 5EW2H 1F5KU 1EP6A 3O8CA 1V2PT 4DJZB 2O8MA 2PR3A 2WPKS 1HPGA 1LKBA 4BNRA 1E0FD 1G3DA 1G3BA 4K1SA 1SMFE 3SBKA 1BDAA 4YT7H 1QFKH 1WV7H 1WQVH 2GKVE 3I78A 1LO6A 1QRXA 2G8TA 1YBWA 2R2WU 4UE7H 3U1JB 3A7YA 2HLCA 1BTXA 3C27B 3K9XB 1RFNA 1TB6H 1GHYH 2BLQA 3HATH 4DY7B 3FAOA 3RXGA 1SI5H 2ANKH 1P2KA 3SV6A 1C9TA 2P3FH 4YLUA 1FN6A 1TGTA 2GZ8A 1C5MD 2STAE 1ETSH 5HGGA 1AVXA 1QBOA 3TH2H 3ZVBA 1BT7A 4FU9A 1S81A 1AGJA 1TLDA 1XUJA 3GISB 2PGQB 3BEUA 2J4IA 3O8DA 2SFAA 1G36A 3H7OA 1CA0C 3HKJB 2AIPA 1QA0A 1P2QA 1DWCH 2CHAC 4B71A 4GHQA 4BAKB 2WUBA 2XBYA 4CH2B 2UWPA 3F9FA 1D9IA 4K2YA 1D6WA 4X2XA 1Y5BT 1J9CH 3K65B 3PMAB 1GG6C 1LCYA 1GBAA 3T27A 2EA3A 2SGFE 2OQUA 3FP6E 1IQEA 4Y0YE 4CHAB 2ZIQH 1HCGA 1PPZA 1UTMA 4XBBA 3MU5A 2ZU4A 2HPQH 1GBIA 4Y8YA 2WPLS 1QRZA 4MPVA 1GBDA 4JZIA 2HNTE 4B2CA 5EQSA 3GYLB 2JH0D 5EGMA 3BTEE 1VCPA 1AWFH 3PMHB 1GBBA 2O8WA 3P70B 3E16B 1BHXF 4NIXA 5E0GA 1GI4A 1S85A 1OPHB 1FDPA 3H7TA 1GBHA 4X6MA 1O2GH 1ELVA 3AW1A 1UTKA 1NRNH 3SW2B 1H8IH 3MFJA 3GY3A 4U01A 1SGQE 3RXPA 2C93B 1NU7B 2WPIS 1O2TA 1PJPA 4ASHA 3BG4C 1A61H 1BBRH 1BMLA 1XUFA 5JB8S 3SJKA 1C2KA 3SJOA 3SNEA 1TBQH 4NWLA 2ZU1A 1O2VA 2P3UB 1GI3A 3QTVH 3M7TA 4PROA 4GLYA 1T8LA 1HDTH 2UUJB 1EOJA 1ZTJA 2J94A 1JRSA 2ZDNA 1DY8A 1ELDE 1MTVA 2PTCE 1YPKH 4NSVA 1V6DA 3S9BA 1O5AB 4ZHMU 4A1TA 2STBE 4ZHLU 1AIXH 1BTPA 1W8BH 3MNCA 3TH3H 3GICB 4X2WA 2BM2A 3FZZA 3RXEA 1T8OA 2BLOA 3TLOA 1G2LA 4UDWH 1S84A 2ALVA 1ESAA 1W0YH 1OP0A 4JMYA 5ABWA 4NSYA 1C5VA 1Y3UA 1ZJKA 2JH5D 3RXIA 1EZSC 2VU8E 3PO1B 2CHAB 4X6PA 6LPRA 1CQQA 2FLBH 3QZRA 1DPOA 1EPTB 4MNXA 5HXFA 4K69A 3E8LA 1SL3A 1KXBA 1XMNB 3SUEA 2UWLA 3OTJE 1HAGE 1GG6B 1T8NA 2HWLB 1DUEA 3E6PH 4KTSA 1Y59T 2WUCA 3TNSA 2VH6A 1O2PA 3P8OA 2C8WB 3U69H 2WPMS 5H4IB 1ZHPA 3HGNA 1RIWC 1HYLA 2A7HA 2A4QA 4F49A 4X8VH 1UK2A 1C5TA 2HOBA 3DUXH 4OGYA 4AG1A 1V2OT 2ZHWH 1UVSH 3RXSA 2FX6A 2PFEA 3RMMH 4ZXYH 3ZV9A 4YO9A 2Y80A 1H8DH 3SU6A 1ELGA 1GVLA 1NM6A 2HALA 4JK5A 5L2ZH 5AFZH 5C1YA 1KXAA 1VR1H 2ZC9H 1T31A 1DITH 2A45B 1ACBE 2AMDA 1F7ZA 4ABIA 1DUAA 4A5TS 1TBZH 3BG4B 3L6PA 3DA9B 4ISOA 3ZZ7A 2ZGJA 4I31A 1TX8A 1C2JA 3DD2H 3A8BA 1DICA 1OKXA 1DOJA 2ZU5A 1EUFA 2VH0A 1C1NA 2FP7B 1O2UA 1C1WH 1QB9A 2FPZA 2FIRH 3M36A 4ISIH 1C2MA 5DP8A 3DT0H 2ZCLP 1YLCA 1VZQH 1OWKA 2ZHQH 2A32A 3FP7E 4ZXXH 1SGFG 1ANEA 3GY6A 1GVZA 2C8YB 1JWTA 1EZQA 3GY5A 1BBRE 1B0EA 2W3KA 1E37B 1ZMJA 1JIRA 1GBMA 1V3XA 2BXUH 1QJ7B 2GP9B 3B8JA 3RUOA 1W14U 3MNXA 2Z94A 1OYQA 2OUAA 1FLEE 2W5EA 4FUDA 1THRH 4NA9H 1ZPCA 2BB4A 1DSUA 2ANWA 3LOXA 1CGJE 1GJBB 2H2ZA 1O37A 1AE8H 1DE7H 3S7KB 1GMHG 1O32A 3HK6B 2G5VA 3BIUH 3STJA 4E7RG 1EB2A 1P57B 3A8CA 2PW8H 3GCTG 3RMOH 4RN6A 2G81E 3LJOA 1RJXB 1ZTLA 4JYTA 1GL0E 1P04A 5ETXA 5E8EH 1BRUP 2VVVA 2AEIH 1S6HA 5G4BA 3M5OA 4UFDH 2NU0E 1AVGH 1PPBH 2ZI2H 4Y8ZA 3LT3A 3UOPA 1EPTA 4X6OA 1O3EA 1RD3B 3SQEE 1TRNA 1C2LA 1ZHRA 1J14A 7GCHG 2VB0A 4RSPA 1NTPA 1VITG 4AOQA 1W11U 1GMHF 2ZGCA 4WMEA 3RM2H 1QL8A 5DGJA 3A86A 4DT7B 1A7SA 4UONA 1WSSH 1MCVA 4KTUA 2ZFRH 3KCGH 3GCTF 4YLQH 1C4Y2 5BRRE 2Z7FE 1Z6JH 3GY4A 4I33A 1DSTA 1V2KT 1AU8A 1MAXA 1HUTH 1K1LA 3RXCA 1OOKB 1HBTH 1Y3XA 1BMAA 4ZKRU 4A92A 1CGHA 2P93A 1P12E 3SGQE 3TGKE 1S0QA 1U6QA 1IQMA 1KIGH 4XBDA 1V2MT 1BUIA 1RRKA 1CT2E 1RS0A 4X1RU 2VVCA 2R0KA 1VITF 4I7YH 2ZPSA 2ZF0H 3A88A 4Z6AH 3GDSA 2XC4A 4RKOB 1EOLA 3UR9A 1O2QA 2BDCA 1UHBB 1O5EH 3V7TA 3M37A 5IYTA 4O97A 1K1NA 2Y5HA 2SNWA 2PGBB 1LHCH 1PPEE 2BDIA 1KTSB 2WINI 2Z9JA 1YP9A 4I8HA 1SGPE 3QK1A 1IQFA 4JZ1A 1GGDC 1G32B 1SFQB 1C5ZB 2BY5X 4SGAE 5E0JA 5TCAA 4AORA 1NRRH 1O2MA 2FOGA 2W7SA 2ZFSA 2GCHF 3TJNA 5EODA 3F9HA 2ZTXA 1FY3A 1ELBA 4MNYA 1O2SA 2BVSH 2J9NA 3V12A 2H9HA 1O0DH 3AASA 1ELAA 2EI7A 4X1SU 1P06A 1F5RA 3ZVGA 4HFPB 4JYUH 1AN1E 4BTUB 3ZVEA 1W12U 1LPKB 1O3HA 2LNCA 1TMTH 5EPNA 1C1TA 2P8OB 5HM2A 2BD3A 3PV4A 4IS5A 1C2EA 4BAQB 2XNIA 1P0SH 3TIUA 2PWXA 1KYNA 3BTKE 4IGDA 1WYKA 3TH4H 2OTVA 4Y11E 1AE5A 1P2IA 2BD8A 3PMJA 4O3UA 3A7ZA 2H5CA 1K2I1 2AYWA 2VINA 1VJ9U 1TPPA 1BIOA 3T26A 1YCPK 4DW2U 4ZMAH 2F9BH 1YPJH 1SGCA 1XUKA 2ZFTA 3PB1E 3QDZB 5EU8A 1KXEA 2VNTA 1GHAG 3MU4A 1TNLA 3F9GA 3MH5A 1TNHA 2CN0H 3KQEA 1OS8A 4VGCC 2ZWLH 1ZGIA 1QA7A 2ZO3H 1T8MA 2GVFA 3ATMA 3SJIA 1TALA 3ZZ6A 1QTFA 2ZHFH 4I32A 1MCTA 5AFYH 3RU4T 1NFYA 8KME2 4DVAU 6CHAC 1XM1A 1DWEH 4RKJB 1MTNC 2DUCA 1C5YB 1P02A 1V2LT 3GOVB 1K22H 4YOIA 1UVUH 5FPTA 1AMHA 1MQ6A 2ZDVH 1FY4A 1YCPM 3ITIA 3UNRA 2RCEA 2ZTYA 1B0FA 1WTGH 3T28A 1MKXH 4IMZA 3RMNH 1O2XA 3ODDA 3SV9A 4O3TA 3ELAH 5FHTA 2EC9H 3KF2A 5JPMH 1T32A 2ZGHA 2B8OH 4E7NA 2UWOA 4D7GA 1XVOA 3HKIB 1CHGA 1TRMA 3QTOH 4UFEH 1QURH 5EXNA 5AF9H 3DHKH 5DO4H 1NFUA 3A7XA 1O3JA 1O3NA 2Z3EA 4SGBE 1L2EA 3SGAE 2IOTA 3FANA 2DE8A 3A7WA 2HNTF 1TWXB 1AY6H 7KMEH 2P3TB 3S9AA 3UREA 4ZKSU 2FM2A 1QQ4A 1ANCA 4ZUHA 1ZTKA 1AKSA 2VWMA 1V2RT 2BX3A 1GJ6A 1J16A 3S69A 1UMAH 3ODFA 2XC0A 3ATIA 3QWCH 2F9OA 1YGCH 3E0PB 1BTUA 2ESTE 1YPMH 1QY6A 1AUJA 5J4QA 2ZP0H 1GPZA 4NWKA 1Z8RA 1V2NT 3RXLA 1O5DH 2Y7XA 1ELFA 4NZQA 4X8UH 1C2DA 4MPXA 4CH8B 3SU1A 1ORFA 1Q2WA 2FLRH 3LGTA 4AB8A 2FOHA 4NIYA 4MDSA 1Z8JB 2ASUB 4MVNA 1X7AC 4WVPE 3D23A 1C1SA 1EJMA 2CMYA 5FAHA 3N7OA 1DXWA 1L4ZA 2GX4A 2TPIZ 2GTBA 1AUTC 3MU0A 3T25A 1O5FH 2OC7A 1GHXH 1H9IE 3KN2A 3PWBA 1GL1A 1NFXA 1GBCA 3A8DA 4E05H 4VGCB 2H1UA 1TNKA 3JZ2B 5JYIA 1V2UT 1P3EA 1D3DB 1BQYA 1HAVB 8ESTE 2ZQ2A 3VXFH 3VB4A 2ZPRA 1ZMLA 2OC8A 1BHXB 1UTPA 1CA8B 5DPAA 1P2NA 3SORA 2NU3E 4IW4E 2F83A 3SNDA 2ANMH 3SJ8A 1LQDB 1TOCB 2BOKA
chains in the Genus database with same CATH superfamily
3NCLA 2C8XB 2DE9A 5F53A 1O2LA 1AWHB 6CHAB 4TWWA 4WXIA 4NA8A 1MTNB 2EEKA 2FI5E 4ZKOU 7ESTE 4CRAA 3OTPA 3PRBA 1IAUA 3JZ1B 1CHOG 2QXGA 1MBMA 1A0HB 4NIVA 1BOQA 2V3OH 5IDKA 1GMDG 1LVYA 2A7JA 2GD4B 3UWJH 3OU0A 2G4UA 3TK5A 1O3AA 1L4DA 2VBCA 4HZHA 2PHBA 3MU1A 3GS9A 2BY7X 2FOMB 4DCDA 1BMMH 1DFPA 1W0ZU 1C2IA 2D26C 3UPEA 1PPGE 3MYWA 3R3GB 5FCRA 1ID5H 3HK3B 1YPLH 2VIOA 2RG3A 4HGCA 4HG6A 4WWYA 5DP4A 2A7CA 4B74A 2AS9A 3E1XB 5F6MA 1C1OA 1BBRK 2OC0A 1IQIA 3KIDU 3SUDA 2D8WA 2AHME 2B7DH 1O3OA 1JMOH 4NGAH 1NESE 3NXPA 1CHOF 3LKWA 1K1PA 3FOAA 3RU4E 1KDQB 1GMDF 5JBTA 1O3KA 1WCZA 2W6ID 1WBGB 3I77A 1TQ7B 3KL6A 1FJSA 2BHGA 5EW1H 3GYMA 1SLVB 1GI1A 1Z7KA 1AHTH 3KQDA 1XVMA 3LGVA 2EI6A 2C90B 4BAOB 1NRSH 1QGFA 1TA6A 1SOZA 5EXLA 1CT0E 3V0XA 4ABDA 5CHAC 3PMBB 1GWAA 4BXWA 5F03A 1ZRKA 5A2MH 1NBME 1GJ7B 1MU6B 3MOCA 2C3SA 4U32A 4CRFA 3SUFA 1QBNA 5B6LA 3UNSA 3RXDA 4YT6H 1MMJN 1TA2A 1T4UH 4ACBA 1MTUA 1O34A 1COWD 2BLVA 1N6XA 1TRYA 1OXGA 1BA8B 5C67A 1QCPA 2BQWB 2KAIB 3W94A 2HVYB 1S5SA 1UVOA 4TY7A 1Z1IA 4OM9A 1SQRA 5F8ZA 2YNBA 1J17T 3BTGE 3G01A 4KTCA 1THPB 4ISNA 1NO9H 2ZDAH 2ZG0H 1SGEE 3IG6B 4ZCNA 5C20A 1CE5A 1A3EH 2BY9X 2RA0A 1V2JT 4Y8XA 2GT7A 3UQOA 1NY22 5C0UA 2ZHDA 1P2JA 3ZVCA 4IMQA 1FN8A 3E0NB 1ANDA 4GVUA 1E79D 1TQ0B 1GI9B 1H4WA 4A1XA 1N8OC 2M2AA 2OQ5A 4I8JA 1CA0B 2XC5A 1ZJDA 4UD9H 2BDGA 3U8TH 2QY0B 5LPRA 1O3GA 2QF5A 1HRTH 1P10A 5DP7A 4WMDA 4JCNA 3LC3A 2Y6TA 1O2ZA 1UCYH 2FI3E 1C4V2 1Y8TA 3RXJA 2YMSD 1NZQH 2XCNA 1CVWH 4K1EA 1MD8A 5C2ZA 1WUNH 1FY5A 4ABJA 1Q31A 2BZAA 2FWWA 1AB9C 3AK5A 1W7GH 3QUMP 2HVXA 3ZZCA 4CRGA 3BEFB 1TNJA 1DX5M 1B7XB 4J1YA 1F0SA 5TCCA 3KQBA 3ZZ4A 1TBRH 3A81A 1FZZA 1W13U 2SGEE 4IN2A 5FBIA 2VIVA 3A89A 4ABBA 2XCFA 3RXHA 3H09A 1GBKA 3MH6A 4E06H 4BANB 2G5NA 2GT8A 3I29A 1ELCA 3NWUA 2XTTB 1O2KA 1L0ZA 2FI4E 2M5TA 1LMWB 4THNH 8LPRA 1H9HE 5LH8A 2XBVA 2AH4X 3RXKA 1T7CA 1SG8B 1DVAH 2YNAA 3SV8A 4YOJA 5A0CA 2F91A 1HAXB 1UJ1A 1UK3A 1YPHE 1BCUH 1NROH 1O2WA 1DWBH 1QHRB 3SO3A 3PROA 1HAYB 1JRTA 1LKAA 1ZPZA 5JBBS 4D7FA 1HIAB 5KEDA 5EPYA 1P01A 3SJ9A 3SUGA 2TGPZ 5DSFA 1VCWA 3S9CA 3UFAA 4H42U 5EXMA 4FUHA 1TPAE 3GCNA 2QIQA 4Y0ZE 1O30A 3LU9B 1P8VC 3F0OA 4Y79A 1KXCA 3D65E 3QX5H 3VG8A 5TJXA 1C4U2 4X2YA 4CRBA 1FUJA 1IQHA 2OLGA 1N8OB 1L1GA 3SQHE 2FOCA 3LDXH 5FL7D 2K1QA 4IBLH 3T5FH 1WAYB 2FEQH 2CK3D 3B23B 5HIZA 1A2CH 1ESBA 1S82A 4INLA 5C3NA 3UAIC 2KAIA 5EJZA 4LOYH 1SQTA 1O3MA 2Q6FA 5HIYA 3LIWA 1Z8GA 2ALPA 2RFKC 2BZ6H 1O3DA 1TNIA 1GI7B 6GCHG 1HGTH 1YC0A 1OP8A 1TE0A 1GBTA 4INHA 3RXOA 1KMHB 2ZFQH 1K9OE 2ZDKA 3A83A 2BYAX 1VJAU 2A1DB 3M3SA 1A5GH 4FXGH 3NZIA 1AB9B 1Z6EA 4Q7YA 3VB5A 3RMLH 4Y76A 1YPGH 1FQ3A 1EKBB 4CBNA 3RLWH 1O33A 1ESTA 5FCKA 3OYPA 3PV2A 4IC6A 4GPGA 1C1UH 2ZEBA 1GJ8B 2XBWA 1VCQA 3A85A 2NU1E 1QJ6B 3CS0A 1RIWB 2VJ1A 3OX7U 2ZNKH 1C1RA 4X0WU 2ZFFH 4U2WA 4A1VA 3TGJE 2QAAA 3RXBA 1V2VT 4H6TA 1UCYE 4XFQA 5I25A 1KLJH 1BJUA 2ZCKP 3DFLA 3TK9A 3MHWU 2BDYA 5EG4A 2HNTC 1UVPA 1EASA 1OX1A 2G00A 6GCHF 3L3TA 2H5DA 1THSH 1DANH 3EAJA 4INKA 3WW7A 2Y5GA 3F2FA 3R0FA 1G9IE 4AN7A 3BG8A 1T4VH 4BOHA 1TMBH 1Y5AT 2G4TA 2F9NA 2XNDD 3RXTA 3TNTA 3LGYA 3SNCA 1OWJA 2V3HH 4ISHH 2B9LA 3SNAA 2XW9A 1BTYA 2AGGX 3ZYEA 1E34B 3VFEA 1TPOA 3QLPH 4FUBA 2TIOA 4DIIH 3K6YA 1VGCC 3EA7A 1P2OA 1BRAA 1EZUC 1O3PB 3CNRA 1QRWA 1WOFA 2PV9B 3EQ0H 5SGAE 4CREA 1C5OH 3BIVH 1PQAA 4CBOA 2A31A 7GCHF 2OBOA 2AERH 5DP5A 4ZH8A 2O9QA 1C5QA 1MD7A 1EZXC 3U9AH 1BTZA 1O5CB 2ZGXH 3NK8A 1G2MA 1FY8E 1QQUA 2OBQA 4ZHAA 2F9PA 3ZZ8A 1QB1A 1EATA 5L30H 3PLBA 1GJ9B 2XWAA 1GI6A 1W10U 2A5IA 1SQAA 1LHDH 1SLXB 3TVJB 1QR3E 3VEQB 3PRDA 1ZSJA 3CENA 5CE1A 1OWEA 2ANYA 1ZSKA 2B5TB 2TBSA 3BN9A 5T6FA 2C4FH 3BV9B 2FS8A 1FONA 1SOTA 1K1OA 4D9RA 2HLDD 2ZKSA 2ZU2A 5EJLA 4D9QA 1F0RA 1HV7A 1UO6A 3FZDA 2TGDA 3SU2A 1C2HA 1Z8IB 4AG2A 5FPYA 2BY6X 2V6NA 1P9UA 4CRCA 1A4WH 3GCHC 3P6ZB 3OSYA 1SHYA 2PKAB 3S0NA 4IN1A 3MU8A 5ESBA 3B9FH 1CSOE 1OP2A 3E3TA 4FUFA 1RTKA 4MNWA 2ZHEH 5K0HA 4X8TH 1O2YA 1QL7A 2WPJS 3LPRA 4AGJA 3V3MA 2BD2A 5I46H 3LC5A 5CHBA 3OY5U 1O35A 1FAKH 3GY2A 9LPRA 4ASUD 3MH7A 2JJ2D 2Z3DA 4MG3A 1GHWH 3V13A 5C1XA 1ELTA 1B5GH 2TRMA 4MTBA 1MKXK 3PTBA 4WF8A 2FESH 1AVWA 1L1JA 5PTPA 1HB0B 4Q7ZA 1D3PB 2KCOA 3RXMA 3AAUA 2PSXA 1HJ8A 3K2UA 2LPRA 1O39A 3M3TA 1MBQA 3H5CB 1K1MA 1VGCB 5GXPA 1BZXE 1GDUA 1O2RA 1SPJA 2TGAA 4BTIB 2FDAA 1ZGVA 3A7VA 3D62A 1OSSA 3A84A 1QNJA 3EYDA 1TMUH 4AGKA 5HM9A 2A5AA 1RXPA 1G3CA 2XYAA 7LPRA 4B1TA 1GCDA 1C5RA 1YYY1 2ZQ1A 1P03A 2CGAA 1GHAF 3Q3XA 3PWCA 5DKMA 1IQJA 2KFWA 2YMSC 4AYVB 2BDBA 2BTCE 4FUCA 1JOUB 1F2SE 1S6LA 2XXLA 3F1SB 4FU7A 1SR5C 2Z9GA 3ZZ9A 3GCOA 4J2YB 2SNVA 2IPHA 2CF9H 1GDQA 1C5UA 1K1IA 1NS3A 1GGDB 2ULLA 1CT4E 1GBJA 2FOBA 1XUGA 1W0KD 5GWZA 1W7XH 5F8TA 1ARBA 1O3LA 4TPYA 4BAHB 1C5SA 2Z6BD 1J8AA 1V2ST 3A8AA 4DIHH 1UVTH 5FPSA 2B0FA 3A82A 1EAIA 2P59A 1IQLA 1XUIA 3DSPA 3VB6A 1FPHH 1N6YA 2FXRA 2ILNA 4ABAA 3EA8A 3CS7A 4P00A 1EJAA 5T6GA 3EGKH 1TGNA 1UTQA 3BTQE 4OS5A 1A0LA 3GCHB 3Q00A 4BTTB 3K6ZA 1GI2A 4I8KA 1UHBA 4FUIA 2ZCHP 1BJVA 1WQSA 4GCHG 2OK5A 3GDUA 4NFEA 4WH8A 3AAVA 3T2NA 2F9VA 2P16A 1EAXA 2L74A 2ZU3A 3ZZBA 4NZLA 2SGDE 1CBWC 1XXDA 4JZFH 3RXUA 5A0BA 2F9UA 3Q3KA 3F6UH 2F3CE 2QA9E 2WPDD 2Z3CA 1D6RA 4B2AA 2QYIA 2VWNA 1C1VH 1P9SA 3RU4D 3SGBE 2QF4A 4KP0A 2IJD1 2GV7A 4XRNA 1IQGA 2A5KA 1YM0A 4GCHF 5K7RA 1TFXA 1AFQC 3QGNB 1PQ7A 3T29A 1GJ5H 2HGTH 1PYTC 1C2GA 2JJ1D 4ZKNU 4O9VA 2QCYA 1J15A 2FYQA 1XXFA 1K21H 3LJJA 1KLTA 3ESTA 4A6LA 4X6NA 4WH6A 4WJG2 1IHTH 1CGIE 1LPZB 2CXVA 3KEEA 3M5MA 1NBMD 2QXJA 3ZVDA 1NT1A 2WPHS 3UOUA 2G51A 1GMCG 4I8LA 2GGVB 4TY6A 1Y3VA 2BQ6B 5DP6A 3RXRA 4YTAA 1HAIH 4XSKU 3TITA 2YMSB 3U98H 4BAMB 5E2PA 4CR5A 3TJVA 1Q3XA 2QXHA 4OS4A 4YXWD 2RDLA 3KYFA 3UB0A 4Q80A 1BRCE 2FS9A 3L33A 2A4RA 4DURA 1RTLA 3PTNA 3U1IB 3VGCC 3SHCH 2R2MB 3BTDE 4M9FA 2BQ7B 5KGOA 2PUQH 1GI8B 3D49H 1TIOA 4ESTE 3FN8A 3AVZA 4B75A 1GMCF 2F43B 1MTWA 3PO1C 3EA9A 5LPFA 2AMQA 1EPTC 2VIQA 4FVDA 4Z1MD 3RXVA 1O2JA 5E2OA 3UY9A 1K1JA 9ESTA 4LZ4B 1WXRA 4B73A 1SB1H 5GCHG 4RI0A 3URDA 3MWIU 1DXPA 3RM0H 3RC6A 1UTNA 1QL9A 1DM4B 3EE0B 4OS2A 4YESB 1MZDA 1ETRH 4Y6DA 3SU0A 2PKSC 4LK4A 2O8TA 3F9EA 4BXSA 1UTJA 4K1TA 1AI8H 1P2MA 1QBVH 2PTNA 4CR9A 4F55A 1P3CA 1TONA 1Y3YA 1CBWB 2KX4A 1AD8H 3VB7A 1GBEA 4KELA 4GSOA 1ELEE 2D1JA 2QXIA 1E36B 3BF6H 3SV7A 2UUFB 5T6DA 3RLYH 1SGDE 2OP9A 4F48B 1C1MA 1S83A 1DY9A 3SZNA 1BITA 3PM3A 1ARCA 2FMJA 3O8BA 1TOMH 1RTFB 1YLDA 4UFFH 1GJAB 2VWLA 5GCHF 3QO6A 5A0AE 3ENSB 2IN2A 3P8FA 1NPMA 1QB6A 2PUXB 5GDSH 4AFSA 1NRPH 4DGJA 4A7IB 1SLWB 4B2BA 1UCYK 2Q6DA 1C5XB 2BD9A 1A0JA 1DLKB 1AFQB 2J2UA 2VIDA 4KKDA 2UUYA 3LH1A 4X8SH 2FOFA 2WZQA 3SNBA 2J95A 3BTHE 1GJDB 1XUHA 1YLNA 1YWUA 4YZUA 3HGPA 3PLPA 3TJUA 2ZECA 1A1RA 1C5WB 2XWBI 2I6SA 1ABIH 2R3UA 3LH3A 3LONA 2TGTA 1O31A 2FTLE 3KGPA 2A2QH 2XRCA 2H6MA 3FVFB 1GBLA 2ODYB 4FOUC 1MH0A 3ZZDA 4AZ2B 2J97A 3ATWA 3A7TA 1MTSA 2GV6A 4AX9H 4TWYA 2WYGA 4ZROA 1SGYE 4I86A 2ZPQA 1FIZA 5JBAS 4X1QU 2GMTC 1HAVA 1LPGB 2YOLA 3VGCB 1C5LH 1F0UA 5E0HA 1KXFA 2V35A 1C5NH 1Z71A 3BTTE 1D4PB 4MLFB 1P11E 1MQ5A 3SI4H 1INCA 3NUMA 5HYOA 1ZR0A 2W6JD 3RXFA 2W3IA 3SHAH 2JETC 5HMAA 2FODA 1FXYA 1ZOMA 5L6NH 1MU8B 1PPFE 1SGIB 2IPQX 2QN5T 3MO3A 3SOSA 1O5BB 2PKSB 1TYNA 3MH4A 1Y5UT 4FVBA 1A5IA 2VWOA 2BY8X 1Z1JA 4TYDA 3FKSD 1WDIA 3RXAA 2BD4A 3SU4A 2CV3A 1O2HA 4YM9A 1EQ9A 1C9PA 1A46H 2XBXA 3E90B 3UR6A 2BDAA 2OD3B 2GCTC 1GHZA 1O3FA 1MUEB 3KHVA 2ZDMA 3P8GA 1GI5A 5DP9A 3HPTB 2AGIX 5CHAB 2G52A 1C2FA 1D3TB 1K0HA 4UFGH 1IHSH 4NA7A 2JH6D 3KQ5A 2QV1A 3RXQA 2VGCC 2LP6A 3A80A 4FUEA 4B76A 2BMGB 3SN8A 5FBEA 1SC8U 3UTUH 1O2OA 2AFQB 5T1VA 1KDQA 1OYTH 1MAYA 1KXDA 1MKWK 4OGXA 3ZVAA 1IQNA 1LHGH 2QGRA 2PSYA 2IJOB 1IOEA 2P95A 4O03A 2BX4A 1K28D 4D76A 3UUZA 1G30B 1TAWA 2SGPE 3CP7A 3NPSA 8GCHG 2Y7ZA 1C5PA 2UUKB 2SGAA 3PYHA 5A8YA 3MNSA 4Q4LA 4H6SB 2OCVB 1KTTB 5A8ZA 1H8ED 1PYTD 3SU5A 4K8YA 1HAHH 4JZEH 3TK6A 5A8XA 1SLUB 2FYRA 4WMFA 3KNXA 2J92A 4U30A 1PPCE 1S0RA 1ABJH 2V0BA 4ABFA 2J98B 3KQCA 2Y5FA 5C1UA 3IITA 1ZZZA 3DFJA 1ANBA 3M3VA 1O2NA 4Z0KA 5F8XA 2Q1JA 3GY8A 1O2IA 1LDTT 3FFGA 2J38A 2WSSD 4DG4A 1HJAC 2GMTB 1MKWH 1ZSLA 4X2VA 8GCHF 1M9UA 1OWDA 1PQ5A 1SQOA 3ATLA 4K60A 1GDNA 5L2YH 2GZ9A 1PPHE 1S6FA 1HNEE 2GDEH 2AIQA 2ODQA 1FMGA 4GHTA 5EQQA 1BTWA 3T62A 3ZV8A 1GJCB 1LVMA 1QJ1B 2GZ7A 1HXEH 2QF3A 2W7UA 3UNQA 1XKAC 1KY9A 2JETB 1VKYA 1ZLRA 4Y7AA 3ZVFA 4OS6A 1HAOH 2SGQE 4H4FA 1HAPH 1EX3A 4MQAA 3UQVA 2H9EH 4Q2KA 2ZTZA 3EE7A 1JBUH 4GAWA 3BSQA 1GJ4H 1GCTC 3ZZ3A 1C1PA 1FV9A 2NU2E 4TSFD 1O3BA 2P8OC 1EXFA 2NWNA 2GCTB 4WY3A 1DDJA 2C8ZB 1RGQA 1DS2E 4X1NU 1SHHB 3OY6U 4XBCA 2BOHB 5GJ4B 1CO7E 1LQEA 4Y71A 3RC4A 3SI3H 3U8RH 4LZ1H 1AQ7A 3P92A 1AZ8A 2P94A 2OXSA 2KCYA 3LGWA 1LVOA 2VGCB 4AFUA 2THFB 4ZAEA 3SU3A 3F2HA 1GHVH 1AO5A 4DT4A 4R0IA 2OINA 1SVPA 2BLWA 1G37A 3VXEH 1HLTH 1EB1H 1WTHD 3DSOA 1BTHH 3M7UA 1MZAA 4FU8A 3W95A 4Y7BA 4K3JA 5JDUB 3RC5A 4OS7A 4AB9A 4HTCH 1H9LB 3P8NA 4AFZA 1TGBA 3P17H 1NU9A 2Y82A 3F68H 3MI4A 5GIBA 4Q7XA 1YKTA 2A0QB 2BVXH 1SGFA 1VITH 5BPEA 1E35B 1NC6A 1LHEH 2D2DA 2QC2A 2NU4E 1ETTH 3ZZAA 4FUJA 3BTFE 2G55A 4I8GA 3Q3YA 4FUGA 2GCHG 3E91A 1PFXC 2H9TH 3IWMA 4NG9H 1ZMNA 4B6FA 3WY8A 4XOJA 3Q77A 5DG6A 1L1NA 3VPKA 1AKSB 5CMXH 5T3HA 3MTYA 4QT8C 4CRDA 1F92A 1OHHD 5B6OA 1HIAA 4LXBH 3NKKA 1Y3WA 1HJAB 2VVUA 2A4GA 3QZQA 1EAWA 5DP3A 1V2TT 1C1QA 1HFDA 2ZFPH 6ESTA 1FNIA 1TX7A 3TJOA 1SFIA 1A3BH 1TGSZ 4F4OC 4MPWA 4JK6A 1FI8A 2R0LA 3LGIA 4NIWA 1O5GH 3KYGA 1AFEH 4HI3A 2WYJA 4KGAA 2FTMA 2Y81A 5DK1A 2QF0A 3GDVA 2BVRH 3O8RA 3UWIA 4OS1A 1EJNA 3M5NA 3RDZA 3C1KA 3ZYDA 1E38B 3MNBA 1XKBC 2GDDA 4M7GA 4NFFA 5FX6A 5LGOA 1BMNH 1KLIH 1FY1A 1GCTB 2F4LA 1GVKB 1JXPA 1P09A 3VB3A 1EP5A 1GHBG 2ZA5A 1DLEA 4ABEA 2OC1A 3S7HB 1TABE 1DWDH 1LHFH 3MO9A 1W3CA 1P05A 4GUXA 1KSNA 2A2XH 5LPEA 4Y10E 1H1BA 1BRBE 1XX9A 2PLXA 1O3IA 2VIPA 3TPIZ 1EAUA 1LVBA 4AFQA 2EY4C 2WV4A 1F0TA 4MNVA 5J4SA 1QZ8A 1O38A 5ESTE 5HKKD 5IK2D 1N1LA 3AW0A 3A87A 1YPHC 1ZPBA 4MPUA 2ZDLA 2FZZA 4K8BA 4ABHA 2VIWA 3F0PA 3MMGA 5FX5A 1NFWA 3TU7H 2RA3A 1GHBF 5EOKA 1UTOA 1GI0A 1HJ9A 1SGNE 4DOQA 2CJIA 4XDEA 2KM0A 1TPSA 3EDXB 3M35A 1MABB 2KZ4A 2A4OA 2WV5A 3BTWE 1D3QB 1V2QT 3BEIB 5JB9S 2BD7A 1OWHA 3M7QA 1QIXB 1GBFA 1TX6A 1BMFD 4TPIZ 3P95A 1SGTA 2BD5A 3UIRA 3GY7A 4ISLA 1YF4A 2LELA 4D8NA 4X1PU 3TGIE 2HPPH 2I6QA 4WXVA 3URCA 1SBWA 1UK4A 2R9PA 1A5HA 1YCPH 2O8UA 2W26A 2EI8A 1SGRE 3BTME 1NN6A 2RDEA 4FETA 3QN7A 5DJ7A 3M61U 1WU1A 3FP8E 1UW7A 3LGUA 2JKHA 2Z9KA 1IQKA 4ABGA 2HRVA 2J34A 2ZGBH 2FOEA 1AZZA 3M5LA 3Q76A 1ZRBA 3SV2H 1G3EA 2Z9LA 2BDHA 1FAXA 5AHGH 3RP2A 3NRLA 1FIWA 1F5LA 5JBCS 2AMPA 3QGJA 5AVDA 1BB0B 1JIMA 1OWIA 1DT2A 1TGCA 5A09A 4IC5A 1FPCH 3PLKA 3U8OH 4CHAC 2FO9A 5C5OA 1YPEH 2ODPA 1W2KH 2R3YA 4JYVH 2JIZD 5GNDA 1ZYOA 1V2WT 3MO6A 4UEHH 4XE4A 1ZHMA 2Z9IA 3N7EA 4AYYB 1HAZB 3STIA 1CU1A 2ZZUH 1TNGA 3ATKA 4B6EA 3ZZ5A 4NCYA 5EQRA 1HXFH 2BXTH 2CF8H 4RT0A 4R8TB 2KCPA 2Q6GA 1NRQH 5C5NA 4YOGA 1PQ8A 5GPIB 2FOAA 4JZDH 1SSXA 5FXLA 2AGEX 2O8LA 3OAAD 1UTLM 1O36A 2PKAA 4K5ZA 1LTOA 1O3CA 2FX4A 5EW2H 1F5KU 1EP6A 3O8CA 1V2PT 4DJZB 2O8MA 2PR3A 2WPKS 1HPGA 1LKBA 4BNRA 1E0FD 1G3DA 1G3BA 4K1SA 1SMFE 3SBKA 1BDAA 4YT7H 1QFKH 1WV7H 1WQVH 2GKVE 3I78A 1LO6A 1QRXA 2G8TA 1YBWA 2R2WU 4UE7H 3U1JB 3A7YA 2HLCA 1BTXA 3C27B 3K9XB 1RFNA 1TB6H 1GHYH 4ACAA 2BLQA 3HATH 4DY7B 3FAOA 3RXGA 1SI5H 2ANKH 1P2KA 3SV6A 1C9TA 2P3FH 4YLUA 1FN6A 1TGTA 2GZ8A 1C5MD 2STAE 1ETSH 5HGGA 1AVXA 2WHXA 1QBOA 3TH2H 3ZVBA 1BT7A 4FU9A 4RT1A 1S81A 1AGJA 1TLDA 1XUJA 3GISB 2PGQB 3BEUA 2J4IA 3O8DA 2SFAA 1G36A 3W1EA 3H7OA 2XOKD 1CA0C 3HKJB 2AIPA 1QA0A 1P2QA 1DWCH 2CHAC 4B71A 4GHQA 4BAKB 2WUBA 2XBYA 4CH2B 2UWPA 3F9FA 1D9IA 4K2YA 1D6WA 4X2XA 1Y5BT 1J9CH 3K65B 3PMAB 1GG6C 1LCYA 1GBAA 3T27A 2EA3A 3F3BA 2SGFE 2OQUA 2V7QD 3FP6E 1IQEA 4Y0YE 4CHAB 2ZIQH 1HCGA 1PPZA 1UTMA 4XBBA 3MU5A 2ZU4A 2HPQH 1GBIA 4Y8YA 2WPLS 1QRZA 4MPVA 1GBDA 4JZIA 2HNTE 4B2CA 3WWBA 5EQSA 3GYLB 2JH0D 5EGMA 1EFRD 3BTEE 1VCPA 1AWFH 3PMHB 1GBBA 2O8WA 3P70B 3E16B 1BHXF 4NIXA 5E0GA 1GI4A 1S85A 1OPHB 1FDPA 3H7TA 1GBHA 2QE7D 4X6MA 1O2GH 1ELVA 3FO8D 3AW1A 1UTKA 3DCLA 1NRNH 3SW2B 5EJ1A 1H8IH 3MFJA 3GY3A 5KECA 4U01A 1SGQE 3RXPA 2C93B 1NU7B 2WPIS 1O2TA 1PJPA 4ASHA 3SZEA 3BG4C 1A61H 1BBRH 1BMLA 1XUFA 5JB8S 3SJKA 1C2KA 3SJOA 3SNEA 1TBQH 4NWLA 2ZU1A 1O2VA 2P3UB 1GI3A 3QTVH 3M7TA 4PROA 4GLYA 1T8LA 1HDTH 2UUJB 1EOJA 1ZTJA 2J94A 1JRSA 2ZDNA 1DY8A 1ELDE 1MTVA 2PTCE 1YPKH 4NSVA 1V6DA 3S9BA 5C17A 1E1QD 1O5AB 4ZHMU 4A1TA 2STBE 4ZHLU 1AIXH 1BTPA 1W8BH 3MNCA 3TH3H 3GICB 4X2WA 2BM2A 3FZZA 3RXEA 1T8OA 2BLOA 3TLOA 1G2LA 4UDWH 1S84A 2ALVA 1ESAA 1W0YH 1OP0A 4JMYA 5ABWA 4NSYA 1C5VA 1Y3UA 1ZJKA 2JH5D 3RXIA 1EZSC 2VU8E 3PO1B 2CHAB 3N99A 4X6PA 6LPRA 1CQQA 2FLBH 3QZRA 1DPOA 1EPTB 4MNXA 5HXFA 4K69A 3E8LA 1SL3A 1KXBA 1XMNB 3SUEA 2UWLA 3OTJE 1HAGE 1GG6B 1T8NA 2HWLB 1DUEA 3E6PH 4KTSA 1Y59T 2WUCA 3TNSA 1YY3A 2VH6A 1O2PA 3P8OA 2C8WB 3U69H 3PV5A 2WPMS 5H4IB 1ZHPA 3HGNA 1RIWC 1HYLA 2A7HA 2A4QA 4F49A 4X8VH 1UK2A 1C5TA 2HOBA 3DUXH 4OGYA 4AG1A 1V2OT 2ZHWH 1UVSH 3RXSA 2FX6A 2PFEA 3RMMH 4ZXYH 3ZV9A 4YO9A 2Y80A 1H8DH 3OEHD 3SU6A 1ELGA 1GVLA 1NM6A 2HALA 4XD7D 4JK5A 5L2ZH 5AFZH 5C1YA 1KXAA 1VR1H 2ZC9H 1T31A 1DITH 2A45B 1ACBE 2AMDA 1F7ZA 4ABIA 1DUAA 4A5TS 1TBZH 3BG4B 3L6PA 3DA9B 4ISOA 3OE7D 2ZGJA 3ZZ7A 4I31A 1TX8A 1C2JA 3DD2H 3A8BA 1DICA 1OKXA 1DOJA 2ZU5A 1EUFA 2VH0A 1C1NA 2FP7B 1O2UA 1C1WH 1QB9A 2FPZA 2FIRH 5EIYA 2KR7A 3M36A 4ISIH 1C2MA 5DP8A 3DT0H 2ZCLP 1YLCA 1VZQH 1OWKA 2ZHQH 2A32A 3FP7E 4ZXXH 1SGFG 1ANEA 3GY6A 1GVZA 2C8YB 1JWTA 1E1RD 1EZQA 3GY5A 3ZIAD 1BBRE 1B0EA 2W3KA 1E37B 1ZMJA 1JIRA 1GBMA 1V3XA 2BXUH 1QJ7B 2GP9B 1H8HD 2K8IA 3B8JA 3RUOA 1W14U 3MNXA 2Z94A 1OYQA 2OUAA 1FLEE 2W5EA 4FUDA 1THRH 3OEED 4NA9H 1ZPCA 2BB4A 1DSUA 2ANWA 3LOXA 1CGJE 1GJBB 2H2ZA 1O37A 1AE8H 1DE7H 3S7KB 1GMHG 1O32A 2J5UA 3HK6B 2G5VA 3BIUH 3STJA 4E7RG 1EB2A 1P57B 3A8CA 2PW8H 3GCTG 3RMOH 4RN6A 2G81E 3LJOA 1RJXB 1ZTLA 4JYTA 1GL0E 1P04A 5ETXA 5E8EH 1BRUP 2VVVA 3U28C 3N7DA 2AEIH 1S6HA 5G4BA 3M5OA 4UFDH 2NU0E 1AVGH 2PP6A 1PPBH 2ZI2H 4Y8ZA 3LT3A 1SKYE 3UOPA 1EPTA 4X6OA 1O3EA 1RD3B 3SQEE 1TRNA 1C2LA 1ZHRA 1J14A 7GCHG 2VB0A 4RSPA 3DSGA 1NTPA 1VITG 4AOQA 1W11U 1GMHF 2ZGCA 4WMEA 3RM2H 1QL8A 5DGJA 3A86A 4DT7B 1A7SA 4UONA 1WSSH 1MCVA 4KTUA 2ZFRH 3KCGH 3GCTF 4YLQH 1C4Y2 5BRRE 2Z7FE 1Z6JH 3GY4A 4I33A 1DSTA 1V2KT 5C94A 1AU8A 1MAXA 1HUTH 1K1LA 3RXCA 1OOKB 1HBTH 1Y3XA 1BMAA 4ZKRU 4A92A 1CGHA 2P93A 1P12E 3SGQE 3TGKE 1S0QA 1U6QA 1IQMA 1KIGH 4XBDA 1V2MT 1BUIA 1RRKA 1CT2E 1RS0A 4X1RU 2VVCA 2R0KA 1VITF 4I7YH 2ZPSA 2ZF0H 3A88A 4Z6AH 3GDSA 2XC4A 4RKOB 1EOLA 3UR9A 1O2QA 2BDCA 1UHBB 1O5EH 3V7TA 3M37A 5IYTA 4O97A 4P02A 1K1NA 2Y5HA 2SNWA 2PGBB 1LHCH 1PPEE 2BDIA 4TT3D 1KTSB 2WINI 3MQKC 2Z9JA 1YP9A 4I8HA 1SGPE 3QK1A 1IQFA 2WV9A 4JZ1A 1GGDC 1G32B 1SFQB 1C5ZB 2BY5X 4SGAE 5E0JA 5TCAA 4AORA 1NRRH 1O2MA 2FOGA 2W7SA 2ZFSA 2GCHF 3TJNA 5EODA 3F9HA 2ZTXA 1FY3A 1ELBA 4MNYA 1O2SA 2BVSH 2J98A 2J9NA 3V12A 2H9HA 1O0DH 3AASA 1ELAA 2EI7A 4X1SU 1P06A 1F5RA 3ZVGA 4HFPB 4JYUH 1AN1E 4BTUB 3ZVEA 1W12U 1LPKB 1O3HA 2LNCA 1TMTH 5EPNA 1C1TA 2P8OB 5HM2A 2BD3A 3PV4A 4IS5A 1C2EA 4BAQB 2XNIA 1P0SH 3TIUA 2PWXA 1KYNA 3BTKE 4IGDA 1WYKA 3TH4H 2OTVA 4Y11E 1AE5A 1P2IA 2BD8A 3PMJA 4O3UA 3A7ZA 2H5CA 1K2I1 2AYWA 2VINA 1VJ9U 2L6OA 1TPPA 4AC9A 1BIOA 3T26A 1YCPK 4DW2U 4ZMAH 2F9BH 4Q63A 1YPJH 1SGCA 1XUKA 2ZFTA 3PB1E 3QDZB 5EU8A 1KXEA 3SYJA 2VNTA 1GHAG 3MU4A 1TNLA 3F9GA 3MH5A 1TNHA 2CN0H 3KQEA 1OS8A 4VGCC 2ZWLH 1ZGIA 1QA7A 2ZO3H 1T8MA 2GVFA 3ATMA 3SJIA 1TALA 3ZZ6A 1QTFA 2ZHFH 4I32A 5C0TA 1MCTA 5AFYH 3RU4T 1NFYA 8KME2 4DVAU 2KCAA 6CHAC 1XM1A 1DWEH 4RKJB 1MTNC 2DUCA 1C5YB 1P02A 1V2LT 3GOVB 1K22H 4YOIA 1UVUH 5FPTA 1AMHA 1MQ6A 3OFND 2ZDVH 1FY4A 1YCPM 3ITIA 3UNRA 2RCEA 2ZTYA 1B0FA 1WTGH 3T28A 1MKXH 4IMZA 3RMNH 1O2XA 3ODDA 3SV9A 4O3TA 3ELAH 5FHTA 2EC9H 3KF2A 3WWFA 5JPMH 1T32A 2ZGHA 2B8OH 4E7NA 2UWOA 4D7GA 2V3MA 1XVOA 3HKIB 1CHGA 1TRMA 3QTOH 4UFEH 1QURH 5EXNA 5AF9H 3DHKH 5DO4H 1NFUA 3A7XA 1O3JA 1O3NA 2Z3EA 4SGBE 1L2EA 3SGAE 2IOTA 3FANA 2DE8A 3A7WA 2HNTF 1TWXB 1AY6H 7KMEH 2P3TB 3S9AA 3UREA 4ZKSU 2FM2A 1QQ4A 1ANCA 4ZUHA 1ZTKA 1AKSA 2VWMA 1V2RT 2BX3A 2K0QA 1GJ6A 1J16A 3S69A 1W0JD 1UMAH 3ODFA 2XC0A 3ATIA 3QWCH 2F9OA 1YGCH 5DN6D 3E0PB 1BTUA 2ESTE 1YPMH 1QY6A 1AUJA 5J4QA 2ZP0H 1GPZA 4NWKA 1Z8RA 1V2NT 3RXLA 1O5DH 2Y7XA 3F2GA 1ELFA 2EQNA 4NZQA 4X8UH 1C2DA 4MPXA 4CH8B 3SU1A 1ORFA 1Q2WA 2FLRH 3LGTA 4AB8A 2FOHA 4NIYA 4MDSA 1Z8JB 2ASUB 4MVNA 2JDID 1X7AC 4WVPE 3D23A 1C1SA 1EJMA 2CMYA 5FAHA 3N7OA 1DXWA 1L4ZA 2GX4A 2TPIZ 2GTBA 1AUTC 3MU0A 3T25A 1O5FH 2OC7A 1GHXH 1H9IE 3KN2A 3PWBA 1GL1A 1NFXA 1GBCA 3A8DA 4E05H 4VGCB 2H1UA 1TNKA 3JZ2B 5JYIA 1V2UT 1P3EA 1D3DB 1BQYA 1HAVB 8ESTE 2ZQ2A 3VXFH 3VB4A 2ZPRA 1ZMLA 5CDFE 2OC8A 1BHXB 1UTPA 1FX0B 1CA8B 5DPAA 1P2NA 3SORA 2NU3E 4IW4E 2F83A 3SNDA 2ANMH 2GJGA 3SJ8A 1LQDB 1TOCB 2BOKA
chains in the Genus database with same CATH topology
3NCLA 2C8XB 2DE9A 6CHAB 1O2LA 1AWHB 4TWWA 4WXIA 4NA8A 1MTNB 2EEKA 2FI5E 4ZKOU 7ESTE 4CRAA 1IAUA 3JZ1B 1CHOG 2QXGA 1MBMA 1A0HB 4NIVA 1BOQA 2V3OH 5IDKA 1GMDG 1LVYA 2A7JA 2GD4B 3UWJH 3OU0A 2G4UA 3TK5A 1O3AA 1L4DA 4HZHA 2PHBA 3MU1A 2BY7X 2FOMB 4DCDA 1BMMH 1DFPA 1W0ZU 1C2IA 2D26C 3UPEA 1PPGE 3MYWA 3R3GB 5FCRA 1ID5H 3HK3B 1YPLH 2VIOA 2RG3A 4HGCA 5DP4A 4WWYA 2A7CA 4B74A 2AS9A 3E1XB 5F6MA 1C1OA 1BBRK 2OC0A 1IQIA 3KIDU 3SUDA 2D8WA 2B7DH 1O3OA 1JMOH 4NGAH 1NESE 3NXPA 1CHOF 3LKWA 1K1PA 3RU4E 1KDQB 1GMDF 5JBTA 1O3KA 1WCZA 1WBGB 3I77A 1TQ7B 3KL6A 1FJSA 2BHGA 5EW1H 3GYMA 1SLVB 1GI1A 1Z7KA 1AHTH 3KQDA 1XVMA 3LGVA 2EI6A 2C90B 4BAOB 1NRSH 1QGFA 1TA6A 1SOZA 5EXLA 1CT0E 3V0XA 4ABDA 5CHAC 3PMBB 1GWAA 4BXWA 5F03A 1ZRKA 5A2MH 1GJ7B 1MU6B 3MOCA 2C3SA 4U32A 4CRFA 3SUFA 1QBNA 3UNSA 3RXDA 4YT6H 1MMJN 1TA2A 1T4UH 1MTUA 1O34A 2BLVA 1N6XA 1TRYA 1OXGA 1BA8B 5C67A 1QCPA 2BQWB 2KAIB 3W94A 1S5SA 1UVOA 4TY7A 1Z1IA 5F8ZA 2YNBA 1J17T 3BTGE 3G01A 4KTCA 1THPB 4ISNA 1NO9H 2ZDAH 2ZG0H 1SGEE 3IG6B 5C20A 1CE5A 1A3EH 2BY9X 2RA0A 1V2JT 4Y8XA 2GT7A 3UQOA 1NY22 2ZHDA 1P2JA 3ZVCA 4IMQA 1FN8A 3E0NB 1ANDA 4GVUA 1TQ0B 1GI9B 1H4WA 4A1XA 1N8OC 2OQ5A 4I8JA 1CA0B 2XC5A 1ZJDA 4UD9H 2BDGA 3U8TH 2QY0B 5LPRA 1O3GA 5DP7A 1HRTH 1P10A 4WMDA 4JCNA 3LC3A 2Y6TA 1O2ZA 1UCYH 2FI3E 1C4V2 1Y8TA 3RXJA 1NZQH 2XCNA 1CVWH 4K1EA 1MD8A 5C2ZA 1WUNH 1FY5A 4ABJA 1Q31A 2BZAA 2FWWA 1AB9C 1W7GH 3QUMP 2HVXA 3ZZCA 4CRGA 3BEFB 1TNJA 1DX5M 1B7XB 4J1YA 1F0SA 5TCCA 3KQBA 3ZZ4A 1TBRH 3A81A 1FZZA 1W13U 2SGEE 4IN2A 5FBIA 2VIVA 3A89A 4ABBA 2XCFA 3RXHA 1GBKA 3MH6A 4E06H 4BANB 2G5NA 2GT8A 3I29A 1ELCA 3NWUA 2XTTB 1O2KA 1L0ZA 2FI4E 2M5TA 1LMWB 4THNH 8LPRA 1H9HE 5LH8A 2XBVA 2AH4X 3RXKA 1T7CA 1SG8B 1DVAH 2YNAA 3SV8A 4YOJA 5A0CA 2F91A 1HAXB 1UJ1A 1UK3A 1YPHE 1BCUH 1NROH 1O2WA 1DWBH 1QHRB 3SO3A 3PROA 1HAYB 1JRTA 1LKAA 1ZPZA 5JBBS 4D7FA 1HIAB 5EPYA 1P01A 3SJ9A 3SUGA 2TGPZ 1VCWA 3S9CA 3UFAA 4H42U 5EXMA 4FUHA 1TPAE 3GCNA 2QIQA 4Y0ZE 1O30A 3LU9B 1P8VC 4Y79A 1KXCA 3D65E 3QX5H 5TJXA 1C4U2 4X2YA 4CRBA 1FUJA 1IQHA 2OLGA 1N8OB 1L1GA 3SQHE 2FOCA 3LDXH 2K1QA 4IBLH 3T5FH 1WAYB 2FEQH 3B23B 1A2CH 1ESBA 1S82A 4INLA 5C3NA 2KAIA 4LOYH 1SQTA 1O3MA 2Q6FA 3LIWA 1Z8GA 2ALPA 2BZ6H 1O3DA 1TNIA 1GI7B 6GCHG 1HGTH 1YC0A 1OP8A 1TE0A 1GBTA 4INHA 3RXOA 2ZFQH 1K9OE 2ZDKA 3A83A 2BYAX 1VJAU 2A1DB 3M3SA 1A5GH 4FXGH 3NZIA 1AB9B 1Z6EA 4Q7YA 3VB5A 3RMLH 4Y76A 1YPGH 1FQ3A 1EKBB 4CBNA 3RLWH 1O33A 1ESTA 5FCKA 3OYPA 4IC6A 4GPGA 1C1UH 2ZEBA 1GJ8B 2XBWA 1VCQA 3A85A 2NU1E 1QJ6B 3CS0A 1RIWB 2VJ1A 3OX7U 2ZNKH 1C1RA 4X0WU 2ZFFH 4U2WA 4A1VA 3TGJE 2QAAA 3RXBA 1V2VT 4H6TA 1UCYE 4XFQA 5I25A 1KLJH 1BJUA 2ZCKP 3DFLA 3TK9A 3MHWU 2BDYA 5EG4A 2HNTC 1UVPA 1EASA 1OX1A 2G00A 6GCHF 3L3TA 2H5DA 1THSH 1DANH 3EAJA 4INKA 2Y5GA 3R0FA 1G9IE 4AN7A 3BG8A 1T4VH 4BOHA 1TMBH 1Y5AT 2G4TA 2F9NA 3RXTA 3TNTA 3LGYA 3SNCA 1OWJA 2V3HH 4ISHH 2B9LA 3SNAA 2XW9A 1BTYA 2AGGX 3ZYEA 1E34B 3VFEA 1TPOA 3QLPH 4FUBA 2TIOA 4DIIH 3K6YA 1VGCC 3EA7A 1P2OA 1BRAA 1EZUC 1O3PB 1QRWA 1WOFA 2PV9B 3EQ0H 5SGAE 4CREA 1C5OH 3BIVH 1PQAA 4CBOA 2A31A 7GCHF 2OBOA 2AERH 5DP5A 4ZH8A 2O9QA 1C5QA 1MD7A 1EZXC 3U9AH 1BTZA 1O5CB 2ZGXH 3NK8A 1G2MA 1FY8E 1QQUA 2OBQA 4ZHAA 2F9PA 3ZZ8A 1QB1A 1EATA 5L30H 3PLBA 1GJ9B 2XWAA 1GI6A 1W10U 2A5IA 1SQAA 1LHDH 1SLXB 3TVJB 1QR3E 3VEQB 1ZSJA 3CENA 5CE1A 1OWEA 2ANYA 1ZSKA 2B5TB 2TBSA 3BN9A 5T6FA 2C4FH 3BV9B 2FS8A 1FONA 1SOTA 1K1OA 4D9RA 2ZKSA 2ZU2A 4D9QA 1F0RA 1HV7A 1UO6A 3FZDA 2TGDA 3SU2A 1C2HA 1Z8IB 4AG2A 5FPYA 2BY6X 2V6NA 1P9UA 4CRCA 1A4WH 3GCHC 3P6ZB 3OSYA 1SHYA 2PKAB 3S0NA 4IN1A 3MU8A 5ESBA 3B9FH 1CSOE 1OP2A 3E3TA 4FUFA 1RTKA 4MNWA 2ZHEH 5K0HA 4X8TH 1O2YA 1QL7A 2WPJS 3LPRA 4AGJA 3V3MA 2BD2A 5I46H 3LC5A 3OY5U 1O35A 1FAKH 3GY2A 9LPRA 3MH7A 2Z3DA 4MG3A 1GHWH 3V13A 5C1XA 1ELTA 1B5GH 2TRMA 4MTBA 1MKXK 3PTBA 4WF8A 2FESH 1AVWA 1L1JA 5PTPA 1HB0B 4Q7ZA 1D3PB 3RXMA 3AAUA 2PSXA 1HJ8A 3K2UA 2LPRA 1O39A 3M3TA 1MBQA 3H5CB 1K1MA 1VGCB 5GXPA 1BZXE 1GDUA 1O2RA 1SPJA 2TGAA 4BTIB 2FDAA 1ZGVA 3A7VA 3D62A 1OSSA 3A84A 1QNJA 3EYDA 1TMUH 4AGKA 5HM9A 2A5AA 1RXPA 1G3CA 2XYAA 7LPRA 4B1TA 1GCDA 1C5RA 1YYY1 2ZQ1A 1P03A 2CGAA 1GHAF 3Q3XA 3PWCA 5DKMA 1IQJA 4AYVB 2BDBA 2BTCE 4FUCA 1JOUB 1F2SE 2XXLA 3F1SB 4FU7A 1SR5C 2Z9GA 3ZZ9A 3GCOA 4J2YB 2SNVA 2IPHA 2CF9H 1GDQA 1C5UA 1K1IA 1NS3A 1GGDB 2ULLA 1CT4E 1GBJA 2FOBA 1XUGA 5GWZA 1W7XH 5F8TA 1ARBA 1O3LA 4TPYA 4BAHB 1C5SA 2Z6BD 1J8AA 1V2ST 3A8AA 4DIHH 1UVTH 5FPSA 2B0FA 3A82A 1EAIA 2P59A 1IQLA 1XUIA 3VB6A 1FPHH 1N6YA 2FXRA 2ILNA 4ABAA 3EA8A 3CS7A 1EJAA 5T6GA 3EGKH 1TGNA 1UTQA 3BTQE 4OS5A 1A0LA 3GCHB 3Q00A 4BTTB 3K6ZA 1GI2A 4I8KA 1UHBA 4FUIA 2ZCHP 1BJVA 1WQSA 4GCHG 3GDUA 4NFEA 4WH8A 3AAVA 3T2NA 2F9VA 2P16A 1EAXA 2ZU3A 3ZZBA 4NZLA 2SGDE 1CBWC 1XXDA 4JZFH 3RXUA 5A0BA 2F9UA 3Q3KA 3F6UH 2F3CE 2QA9E 2Z3CA 1D6RA 4B2AA 2QYIA 2VWNA 1C1VH 1P9SA 3RU4D 3SGBE 4KP0A 2GV7A 1IQGA 2A5KA 1YM0A 4GCHF 5K7RA 1TFXA 1AFQC 3QGNB 1PQ7A 3T29A 1GJ5H 2HGTH 1PYTC 1C2GA 4ZKNU 4O9VA 2QCYA 1J15A 2FYQA 1XXFA 1K21H 3LJJA 1KLTA 3ESTA 4A6LA 4X6NA 4WH6A 4WJG2 1IHTH 1CGIE 1LPZB 2CXVA 3KEEA 3M5MA 2QXJA 3ZVDA 1NT1A 2WPHS 3UOUA 2G51A 1GMCG 4I8LA 2GGVB 4TY6A 1Y3VA 2BQ6B 5DP6A 3RXRA 4YTAA 1HAIH 4XSKU 3TITA 3U98H 4BAMB 5E2PA 4CR5A 3TJVA 1Q3XA 2QXHA 4OS4A 2RDLA 4Q80A 1BRCE 2FS9A 3L33A 2A4RA 4DURA 1RTLA 3PTNA 3U1IB 3VGCC 3SHCH 2R2MB 3BTDE 2BQ7B 2PUQH 1GI8B 3D49H 1TIOA 4ESTE 3AVZA 4B75A 1GMCF 1MTWA 3PO1C 3EA9A 5LPFA 2AMQA 1EPTC 2VIQA 4FVDA 3RXVA 1O2JA 5E2OA 3UY9A 1K1JA 9ESTA 4LZ4B 4B73A 1SB1H 5GCHG 3URDA 3MWIU 1DXPA 3RM0H 3RC6A 1UTNA 1QL9A 1DM4B 3EE0B 4OS2A 4YESB 1MZDA 1ETRH 4Y6DA 3SU0A 2PKSC 4LK4A 2O8TA 3F9EA 4BXSA 1UTJA 4K1TA 1AI8H 1P2MA 1QBVH 2PTNA 4CR9A 1P3CA 1TONA 1Y3YA 1CBWB 1AD8H 3VB7A 1GBEA 4KELA 4GSOA 1ELEE 2D1JA 2QXIA 1E36B 3BF6H 3SV7A 2UUFB 5T6DA 3RLYH 1SGDE 2OP9A 1C1MA 1S83A 1DY9A 3SZNA 1BITA 3PM3A 1ARCA 2FMJA 3O8BA 1TOMH 1RTFB 1YLDA 4UFFH 1GJAB 2VWLA 5GCHF 3QO6A 5A0AE 3ENSB 2IN2A 3P8FA 1NPMA 1QB6A 2PUXB 5GDSH 4AFSA 1NRPH 4DGJA 4A7IB 1SLWB 4B2BA 1UCYK 2Q6DA 1C5XB 2BD9A 1A0JA 1DLKB 1AFQB 2J2UA 2VIDA 4KKDA 2UUYA 3LH1A 4X8SH 2FOFA 3SNBA 2J95A 3BTHE 1GJDB 1XUHA 4YZUA 3HGPA 3PLPA 3TJUA 2ZECA 1A1RA 1C5WB 2XWBI 2I6SA 1ABIH 2R3UA 3LH3A 3LONA 2TGTA 1O31A 2FTLE 3KGPA 2A2QH 2XRCA 2H6MA 3FVFB 1GBLA 2ODYB 4AZ2B 1MH0A 3ZZDA 3ATWA 3A7TA 1MTSA 2GV6A 4AX9H 4TWYA 2WYGA 4ZROA 1SGYE 2ZPQA 1FIZA 5JBAS 4X1QU 2GMTC 1HAVA 1LPGB 2YOLA 3VGCB 1C5LH 1F0UA 5E0HA 1KXFA 2V35A 1C5NH 1Z71A 3BTTE 1D4PB 4MLFB 1P11E 1MQ5A 3SI4H 1INCA 3NUMA 5HYOA 1ZR0A 3RXFA 2W3IA 3SHAH 2JETC 5HMAA 2FODA 1FXYA 1ZOMA 5L6NH 1MU8B 1PPFE 1SGIB 2QN5T 3MO3A 3SOSA 1O5BB 2PKSB 1TYNA 3MH4A 1Y5UT 4FVBA 1A5IA 2VWOA 2BY8X 1Z1JA 4TYDA 3SU4A 3RXAA 2BD4A 2CV3A 1O2HA 4YM9A 1EQ9A 1C9PA 1A46H 2XBXA 3E90B 3UR6A 2BDAA 2OD3B 2GCTC 1GHZA 1O3FA 1MUEB 3KHVA 2ZDMA 3P8GA 1GI5A 5DP9A 3HPTB 2AGIX 5CHAB 2G52A 1C2FA 1D3TB 4UFGH 1IHSH 4NA7A 2JH6D 2QV1A 3RXQA 2VGCC 3A80A 4FUEA 4B76A 2BMGB 3SN8A 5FBEA 1SC8U 3UTUH 1O2OA 2AFQB 1KDQA 1OYTH 1MAYA 1KXDA 1MKWK 4OGXA 3ZVAA 1IQNA 1LHGH 2QGRA 2PSYA 2IJOB 1IOEA 2P95A 4O03A 2BX4A 1K28D 4D76A 3UUZA 1G30B 1TAWA 2SGPE 3CP7A 3NPSA 8GCHG 2Y7ZA 1C5PA 2UUKB 2SGAA 3PYHA 5A8YA 3MNSA 4H6SB 2OCVB 1KTTB 5A8ZA 1PYTD 3SU5A 4K8YA 1HAHH 4JZEH 3TK6A 5A8XA 1SLUB 2FYRA 4WMFA 3KNXA 2J92A 4U30A 1PPCE 1S0RA 1ABJH 2V0BA 4ABFA 3KQCA 2Y5FA 5C1UA 3IITA 1ZZZA 3DFJA 1ANBA 3M3VA 1O2NA 4Z0KA 5F8XA 2Q1JA 3GY8A 1O2IA 1LDTT 3FFGA 2J38A 4DG4A 1HJAC 2GMTB 1MKWH 1ZSLA 4X2VA 8GCHF 1M9UA 1OWDA 1PQ5A 1SQOA 3ATLA 4K60A 1GDNA 5L2YH 2GZ9A 1PPHE 1S6FA 1HNEE 2GDEH 2AIQA 2ODQA 1FMGA 4GHTA 5EQQA 1BTWA 3T62A 3ZV8A 1GJCB 1LVMA 1QJ1B 2GZ7A 1HXEH 2QF3A 2W7UA 3UNQA 1XKAC 1KY9A 2JETB 1ZLRA 4Y7AA 3ZVFA 4OS6A 1HAOH 2SGQE 4H4FA 1HAPH 1EX3A 4MQAA 3UQVA 2H9EH 4Q2KA 2ZTZA 1JBUH 4GAWA 3BSQA 1GJ4H 1GCTC 3ZZ3A 1C1PA 1FV9A 2NU2E 1O3BA 2P8OC 1EXFA 2NWNA 2GCTB 4WY3A 1DDJA 2C8ZB 1RGQA 1DS2E 4X1NU 1SHHB 3OY6U 4XBCA 2BOHB 5GJ4B 1CO7E 1LQEA 4Y71A 3RC4A 3SI3H 3U8RH 4LZ1H 1AQ7A