1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Alkylmercury lyase
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
3CO7C 1Z1DA 4HF2A 4LJZF 4GO1A 5DV5A 1T2KA 3VEPA 1G6NA 4RGRA 4XRFA 5HDNA 3GYHX 5D5UB 3ZMVA 2YX7A 2QENA 2JPBA 1S3JA 3ROUA 1LVAA 2WC2A 2Z9OA 3K69A 1ULYA 5HDKA 1FWZA 3V8KA 2OBPA 1WSUA 1HXDA 4ENMA 2LKPA 2XAQA 1OR7A 3FHZA 1UHWA 1U3EM 4B8XA 3MAJA 4CXFA 5ICFA 1HW5A 4M9SA 2FQ3A 5DCFA 3E6DA 3IC7A 4OOIA 3LQQA 2VC1A 4F7ZA 2AXLA 5AONA 1TQMA 4L5IA 2K7LA 1IAWA 2DQRA 2ACJA 2QBYA 4Y17A 3EETA 1ODDA 2PEXA 3ELKA 2C6YA 1C0WA 4P5OA 3T1BA 1HKQA 1R1TA 2KIUA 1TTYA 2COMA 2F5DA 3RDIA 3IRQA 2O61A 2VT3A 2RC4A 4WXHA 5J8CA 1WQ2A 1IN6A 4Y15A 3SZPA 3ECOA 4KYWA 4HV6A 3LQRA 3K2ZA 2EV6A 1U8RA 4L18B 2LF7A 2IW5A 1R1UA 3HOTA 2Y75A 4LG0A 4M73A 5ILUA 3IWZA 4WXCA 3CUQB 1TNSA 1CGPA 5CLSA 5LHHA 5HLGA 1Z6TA 3ECHA 4PGGA 3KE2A 2XAHA 1J59A 2HKXA 3M9AA 4ENKA 2E1CA 3GFMA 2AS5F 2XKPA 3ZP5A 3HTSB 2V79A 4JBAA 3CDHA 2XHKA 4OMZA 5D5VB 5FLXK 3BOQA 2LNBA 1R7JA 4Q48A 3VOEA 5ICEA 2FA5A 1XN7A 2X0LA 3F8CA 1B6AA 2G7HA 4YIFA 2A5YB 2PFBA 1FT9A 3RKYA 4N0BA 3ZQ7A 4KIGA 1TQPA 2FBKA 4HZFA 1RI7A 1ZG3A 4L9NA 1J7KA 4HW0A 4KMUX 4U0YA 1GVJA 3WTTC 1PP7U 2XAFA 1KU3A 2QQAA 3C1DA 2QM3A 3FWEA 3KEOA 3TO9A 1ON2A 2CW0F 1TBXA 3C3WA 4HF1A 2VOOA 3Q9SA 1IRGA 4JK1X 4RS8A 2H6BA 4WF2A 3L09A 3LSTA 5IT9Z 5FB2A 4MNUA 2FEZA 4YIIA 2D2WA 4ETSA 2A6HF 1W5SA 5LEKA 3WTSC 3J7AO 4LMYA 1QPMA 2L4AA 1BBYA 2OQRA 2BYVE 3TDZC 4CICA 2P5VA 5FGMA 2PLYA 5JR3A 3KP4A 4B09A 1ZN2A 2YPRA 5HLIA 1D8KA 4G7OF 3ZN0A 4G6DA 3I5UA 2ESHA 4G8XA 5E1XA 4LK1F 2ISZA 1YQAA 3BJOA 3R60A 3HRMA 5FD6A 4HX4A 3AAFA 1FSEA 2L4MA 3HSRA 2HGCA 1XMKA 3G3ZA 4AWXB 4RAZA 4OINF 1E17A 5LRRA 4UVBA 5BPIA 1O3RA 1USTA 3DFGA 1KGSA 4EQQA 4ZZDA 2V1UA 1SFUA 1SD5A 3I71A 3WTYC 4CO8A 4A12A 4HQEA 1ZLKA 5D6EA 2EFPA 1JHHA 4GGGA 2Z33A 4EJVA 4HLXA 3W6KB 3F6OA 5CVJA 1OPCA 4ZZLA 2M45A 3R0AA 3WODF 4I0BA 2IT0A 4BYYA 2H6CA 1CF7A 2P7VB 3GWZA 5LHGA 1Q1HA 5HS8A 5CVUA 1HSTA 1V3FA 1W7PB 2L3DA 3J81Z 1I5ZA 4WX9A 3O6BB 1R23A 2HYGD 5FFXA 4IPAA 2M1BA 2QVOA 3BJAA 4ENJA 2M30A 1ZREA 1FLIA 4I7HA 5E8GA 3TO7A 1LDKB 1LB2A 1BC7C 1MJBA 4IXAA 2CO5A 2FXAA 2O0YA 5D5WB 1TW3A 4A5MA 2DW4A 2J5OA 1ZGAA 4ESJA 4HA8A 1J2XA 1KQ0A 4EGYA 3S2WA 4KT5C 2W85A 1YIOA 2GIVA 3RPUA 4I01A 3FM3A 5LRSA 5E8IA 2WV0A 2R3SA 5ILSA 3I64A 2PMUA 3EDPA 2J5PA 5HS9A 2A69F 1IXRC 1IN8A 2L54A 3RTRA 1FSHA 4U7DA 5JVTA 2IA2A 1DDNA 1DP7P 1B1BA 1QNTA 4ESBA 3KETA 3T0YA 3KZZA 4LD5A 5CJ9A 5CYVA 4EM0B 4I02A 4L0YB 1STZA 3FXQA 2IPQX 4KMFA 3IKTA 2VBWA 3GXOA 2RVCA 1JHFA 4AIJA 4K2EA 4YFXF 4G7ZF 4A6DA 4KNYA 3HSEA 3BP8A 4PCQA 4HDUA 1KU7A 4HYEA 5LBQA 3GUDA 3DP7A 3MCZA 2HEOA 1U6GA 2STTA 2ZCWA 2GA2A 2BGCA 3WG9A 4KDPA 1OYIA 4QWQA 3BROA 1RZ4A 1T6SA 5ICGA 4FX0A 5H20A 2GQQA 3HHGA 1EH8A 2VBXA 3PFIA 2XV4S 1IN4A 3IKVA 1TQIA 3U1DA 1ZG5A 3F8BA 2XRNA 4E70A 2PQ8A 4MHGA 1SD6A 4KN7X 5DUKA 3WGGA 1XGMA 2MLKA 5JHUA 4KIBA 2KIFA 4A0ZA 2P5LC 3WU1B 4GYGA 1FY7A 4A6EA 4MEXF 1HBXG 4OIOF 1L3LA 3RIRA 3CJNA 2IA1A 5D4SA 1L0OC 1K7AA 4NQWA 4HV5A 1V4RA 2EWNA 2HS5A 3KLNA 2DAOA 2JTVA 3GEZA 3EYIA 4M6XA 3BZ6A 2F2EA 2GWRA 3GZ5A 3JTHA 5LGUA 1TNTA 2MD5A 4LFUA 2G7UA 2PMHA 3C7JA 1YW7A 2E7XA 4GCVA 4ZH4F 4OU0A 3V7SA 1J75A 2P4WA 1G4DA 5DD4A 1FBUA 1J5YA 1IN5A 3HRTA 2RGVA 3TO6A 2D45A 1R58A 4KICA 1B9MA 4O6JA 2CSOA 1GXPA 4I98B 1KQ8A 5LGTA 2KRFA 3V8LA 1LEBA 4QLCU 4UV8A 4HBLA 4HF0A 1R22A 1IN7A 5CVIA 4YG2F 4MTEA 3J80Z 1T0FA 3HYIA 4M74A 1G3YA 5DCMA 4HOBA 2A07F 1D3YA 3LAPA 2NAZA 4FX4A 4IRIA 1O7LA 1HSJA 2VT2A 3VODA 4A5NA 1USSA 2HOEA 4EM1A 3PQJA 4OIQF 1XCVA 1U5TB 1EV7A 1W7PA 1IRFA 5HS7A 3ZMSA 2F5EA 4OIPF 1SMYF 4A0YA 1IW7F 5IT9K 1FBQA 5K5RA 3ZMUA 2FSWA 3EYYA 2EFOA 5FD5A 4CDGA 1BIBA 1PUEE 2OQGA 5EEHA 1K6OA 5FFZA 4UV9A 4L9VA 3J80K 4UVAA 2RDPA 5EEGA 3RKXA 2XKOA 1S6LA 5ILVA 4DNCA 2VOPA 4XSXF 4L0ZB 5DUIA 1H0MA 1FPQA 2QWWA 1KYWA 5HLHA 1H9GA 1MD0A 2BV6A 3F6VA 1HW1A 2PG4A 1MDMA 4M6YA 2DPUA 3E3VA 5LLQA 1O57A 4P96A 2CGPA 1LEAA 1YW8A 3GO5A 5F6FA 4O5VA 4YFNF 1P4XA 4RGSA 4LG0B 3P9KA 3QP6A 3R6SA 3RYRA 3T5XA 2Z3YA 2Z99A 3ABUA 2PBIA 1FBSA 5LGNA 4P55A 3ULQB 3FMSA 2MH2A 1U2WA 5DYMA 4O3MA 5E1WA 5LEJA 3HRUA 3T8RA 2D1HA 3WE2A 1D8JA 3HSFA 1UB9A 2RV8A 4I2OA 3R4KA 2VC0A 1K78A 1KU9A 2JZYA 4MEYF 1LDDA 3IHUA 3LAJA 2P8TA 2FNPA 2M87A 5DEQA 2VE9A 2UXXA 2JRTA 5K1YA 2A6EF 3E6MA 1Z05A 2P5KA 2K27A 1Z91A 5K5QA 1IXSB 2HFHA 3TOAA 1F9NA 1ZYRF 2DLLA 3GW2A 1OMIA 2DBBA 2GA1A 3WU0A 2P6TA 3CO6C 6PAXA 5H6RA 2EA2A 4G7HF 4MTDA 5L3CA 2RQPA 3E5XA 1P4AA 3ZPLA 4ZYDA 2PJPA 3F21A 1QGPA 3D5LA 4KA4A 3WTXC 1T38A 5L3DA 1XMAA 3L00A 1I27A 1SFXA 2UWMA 1KQ9A 2DT5A 1ZRDA 4BQAA 2OU2A 1BI0A 5LHIA 5K5OA 4AIHA 3I4PA 2XVCA 3BPVA 3TKYA 5TRDA 3R0JA 4MQ9F 2O03A 2QUFA 3Q5FA 4N9IA 3P9IA 1T98A 1Y0UA 3N97A 3L9FA 1ZAOA 3FM5A 2EFQA 4BNCA 4I09A 2HWVA 3F8FA 4KUMA 5BS6A 2GXGA 1X3UA 2EJRA 2RN7A 2EB7A 3ZMZA 5HVQC 1BJAA 2O8XA 5TJJA 1HKSA 4LB5A 5L3BA 5JFRA 4A0XA 3I0TA 1FP2A 3LWFA 3NRVA 2A3SA 1K78B 3MWMA 1XB4A 2K02A 2IVMA 2QBYB 2FF4A 1HW2A 5HOOA 3BWGA 3L2CA 4R8HA 2W25A 3BDDA 2W84A 2HDCA 3GFJA 4Z2YA 3M8FA 3WTZA 4IVNA 2XAGA 3QPHA 2GAUA 3IL2A 5F1RA 3QAHA 2ZMEB 2XROA 2YSRA 5L3FA 3SQNA 3RKWA 3FXRA 1FOKA 4XBFA 1FNNA 1UHMA 4NHJA 4PZJA 3ZN1A 1K79A 1I1SA 3WTVC 2QQBA 1R1VA 1FX7A 3E6BA 3FXUA 4CHUA 2A68F 3GFLA 5DDGA 3P9CA 2YR2A 4LGWA 3TGNA 2Y0MA 4EMSA 1XDSA 1B59A 2BEOA 3F23A 1O3SA 3FMRA 3V7RA 1LDJA 2DK8A 3REOA 4PGHA 2VODA 3DXJF 3J81K 2EA4A 2DO7A 2PN6A 2WTEA 3E97A 1JGSA 4UHTA 2IJLA 1EH6A 4CZZA 3I59A 1G3WA 2E1NA 4HX8A 4KFCA 2O3FA 1W5TA 3FF5A 3GLXA 1FYKA 2A61A 3F72A 4BHPA 1FZPB 5HDGA 2DFIA 2HQRA 2F5CA 3GZ6A 1AWCA 3MEXA 2PI0A 3KLOA 3MZYA 2ZKZA 1UCRA 3RYPA 4M9ZA 4S04A 4HAMA 2MH9A 4HQMA 5ICCA 3SXYA 5FLXZ 3BY6A 2ETHA 2H94A 1A04A 4BHBA 1FC3A 4R1HA 3W6JB 1B4AA 2VE8A 1SD7A 2UXNA 2CG4A 5AIPA 3D0SA 4IRGA 1ZLJA 4RB2C 2OZUA 1J9IA 2WWYA 3GX4X 3MZHA 1WKMA 3QU6A 3I59B 4LB6B 2IA0A 2MLGA 2DQLA 1MKMA 1BI3A 3F3XA 2VBZA 2VBYA 2H09A 5CVVA 3QRFF 1PDNC 2RKHA 3V8JA 3DPTA 1RIOH 3U2RA 4EJWA 1WWXA 4L5JA 1YFHA 1R5HA 1IXCA 2M5WA 4D0PA 5BPDA 5D6FA 2FE3A 3GVAA 4R79A 4LK0F 2KIMA 4LLGF 2IP2A 4XSZF 1XDUA 1VTNC 1F5TA 2GXBA 2FMYA 2CQKA 2YX4A 2FBHA 3B73A 2QYOA 3F22A 2ZMEA 1QO0D 3JAMZ 4G9YA 3JW4A 2DPDA 4AIKA 3RPQA 4U7BA 3L7WA 1OYYA 1YYVA 2JT1A 1BI1A 1BI2A 4G6QA 3T8TA 1S7AA 2L01A 1ZHFA 1S29A 4ZYEA 4OIRF 1REPC 2OA4A 1KA8A 3WTUC 4NB5A 5BQTA 3JAMK 3ABTA 1JXSA 2ADUA 5F64A 4TV7A 4BHCA 4EV0A 3KP3A 1YW9A 1W7PD 2ZXJA 1U78A 3R61A 5DD8A 1LNWA 1KYZA 1BIAA 3FMQA 3M7GA 1J0RA 4YFKF 1BM9A 2ESNA 1IUYA 1LJ9A 1YG2A 1Z9CA 5KVRA 2XGXA 4XLPF 1EH7A 2BE5F 2FMLA 4H0EA 2E7WA 3FX3A 1F4KA 1R00A 4CYDA 3ZMTA 1HKTA 4S05A 5L3GA 1WRJA 2EV0A 2ELHA 1HQCA 3I54A 3SFZA 2P7CB 1ZH5A 4RB1A 3KZYA 4IF4A 2HTSA 3H92A 2V6CA 1O3TA 2Q8KA 3DPLC 2JSCA 4FT8A 1MZBA 1TLHB 4RAYA 3DKWA 5E20A 3F8MA 1I6XA 3IWFA 2V9VA 2XUBA 4G94A 3KP7A 2W57A 1U5TA 3HTUA 4L9JA 4U0WA 4IHSA 4ASNA 1JE8A 2X4HA 2G9WA 4CGZA 2ZJ2A 4ZYHA 3TDUC 2B0LA 1QQIA 3U9GA 2GZWA 2P6SA 4WWCA 1XSDA 4IRHA 2HR3A 3KP5A 2HZTA 5FO5A 1MJAA 1ZARA 2HYFA 5AIQA 2M8EA 1F1ZA 3H3UA 4KN4X 3NQOA 3RJPA 1P6RA 2V1XA 2ISYA 1QZYA 4EM2A 1BN5A 5D4RA 4P9UA 3VB2A 1ZGJA 4N9HA 5IT3A 3WGHA 1ZRFA 1P92A 3C18A 1MDMB 1G3SA 2HKOA 2V1DA 3DEUA 1YS6A 2FBIA 2QQ9A 1YTYA 3ML6A 3HIFA 3ISPA 2NYXA 3I53A 2HQNA 2F5FA 2YU3A 2K4BA 3P7NA 4Q47A 2R7DA 3QPTA 2XIGA 1R5GA 1XGSA 2XASA 3HUGA 4HX7A 3DF8A 2ZO4A 4KIFA 3HHHA 4Q4ZF 4BH9A 3O2PE 2ZBKA 1FYLA 3K1NA 3K1PA 3O3KA 2OD5A 3B02A 1YO5C 4LLNA 3I58A 2QLZA 4EGZA 3HRSA 2DU9A 2Z5UA 3V4GA 2FNAA 2R7FA 2CWEA 1G3TA 5JI6A 3E6CC 2BBYA 5CVRA 1LQ1A 2KJCA 1XCBA 1GXQA 1IF1A 2L02A 4PDKA 3LA7A 2K86A 2DI3A 1FYMA 1ZRCA 5D5XB 3M8EA 1TW2A 2VN2A 5ED4A 5DCMB 4DQ2A 1QBJA 2DTRA 1P2FA 4AVPA 3NEUA 1NHAA 1ONVA 1S7OA 3N4MA 4OMYA 3KP2A 5BMZA 1SFEA 2EK5A 2FU4A 4RB0A 3WTWC 3LFKA 3OV8A 1YLFA 4IHTA 1XSVA 4RB3C 5J6XA 2ZNYA 2UZKA 5A2QZ 3SZTA 3QP5A 2EV5A 2FOKA 2OAZA 3V7CA 1P4WA 1O3QA 4IJAA 3CUQC 3BPXA 3CUOA 1W4MA 2KKOA 3TOBA 2Y48A 5BOXA 4GYIA 2FRHA 2IRFG 1MJ9A 4HDVA 4L9TA 4RGXA 3HOSA 1BC8C 1ZG1A 2STWA 3QOPA 3E5QA 3LA2A 2TDXA 1OYWA 3PQKA 3KEQA 1GHCA 2NNNA 3Q9VA 3GF2A 1WI9A 1UFMA 1RNLA 1BOAA 3CUQA 2W24A 4WK8F 3BJ6A 3TQNA 2VONA 1YS7A 3COAC 4ON0A 1I1GA 5D8LB 2XAJA 4U88A 2CFXA 4WCGA 5A2QK 2EFNA 4FHTA 1QZZA 4A2UA 2NRAC 4I0AA 4XLNF 3KFWX 2RNJA 1R36A 3CLOA 1DPRA 1D5VA 4LLLA 3MQ0A 4WXDA 1SMTA 4Q5SF 4Y13A 1SAXA 2Q2EA 4M72A 2QZ8A 1MGTA 1E2XA 2K4JA 1RUNA 3IRRA 2MBFA 3K0LA 1CF7B 5E17F 5H6QA 2D1VA 4ZYGA 2CYYA 1PP8F 2ZFWA 4M9XA 4BXUA 1XGNA 3JSOA 2HTJA 2VXZA 3WGIA 1ON1A 3K1MA 3SHFA 2LSOA 1DUXC 1DPUA 4JQFA 1H9TA 5E1ZB 3FZVA 5E18F 3VFZA 3DV8A 2NNYA 1U5TC 4EJUA 2ZNZA 3ERED 2LF8A 3CTAA 4MQVA 3F8NA 3QU3A 1KU2A 2OZ6A 1RUOA 5ERIA 4RGUA 4EJTA 1XD7A 4ENNA 1FP1D 2MA3A 4UVCA 4UXNA 2DK5A 3ZMDA 4BAYA 2JPCA 3MFKA 5J8FA 4EJOA 4UNOA 4HLYA 4UUVA 3JSPA 3M1EA 4M71A 2KJBA 4ESFA 1B9NA 3WE3A 1XSXA 1Z6RA 1T39A 2MC3A 3EQLF 1AOYA 5L3EA 4EVIA 3G73A 2O6GE 4AD9A 4MGRA 3EUHA 3K9TA 1OKRA 1O7FA 3RI4A 4U0VA 1XGOA 3OOPA 2NS0A 2EFWA 3DQVC 5KK1A 3KP6A 1Z7UA 3KCCA 3JTGA 5D8KB 2Q0OA 1IZ1A 3LA3A 4P9FA 1S8NA 3H3ZA 3GFIA 2H27A 1SD4A 2LDUA 3E5UA 4GXOA
chains in the Genus database with same CATH superfamily
1H1BA 3M5NA 3QGJA 3CO7C 4YT7H 2HRVA 1TP4A 1Z71A 3VEPA 3RMOH 3ZQIA 1CO7E 1TB6H 1F43A 5EXNA 2YX7A 2QENA 4D1QA 3W3CA 2FOBA 1J16A 3RDZA 4A3DJ 4HZHA 3QTVH 4ACAA 2SGFE 2ZDLA 1SANA 2Z9OA 2JKHA 1TX6A 1S85A 3OFND 2WPDD 4F4OC 2OBPA 1WSUA 1HXDA 5CQEA 4ENMA 2XAQA 2V7QD 2X6WA 4BXFA 1U3EM 4B8XA 3S2HJ 1GVKB 2FQ3A 2BD2A 3E6DA 1UCYH 1JRTA 1EOJA 2ODQA 4I8KA 4DY7B 5AONA 6CHAC 2K7LA 3PIOF 1IAWA 1W8BH 3UIRA 4X1RU 1ODDA 1QVTA 1V5FA 3ELKA 1C0WA 2P94A 4P5OA 3T1BA 1K28D 4MNWA 1R1TA 2JJ7A 2COMA 3RDIA 2O61A 3ERMA 2XBVA 5ETXA 1IN6A 4I8GA 3MH7A 2OQ5A 3IH4A 3T62A 1WJAA 4A6LA 4TPIZ 1SAUA 2HVXA 2Y75A 1G59A 4AG1A 4J01A 5ILUA 1FN6A 1T7CA 3SJ8A 1XUHA 3Q3XA 1TNSA 2ZECA 1DU0A 4XLHA 5CLSA 1Z6TA 3GCMA 5F8TA 3KE2A 1O2UA 2BD9A 2ZJRF 2BZTA 4ENKA 3OEED 3FBIB 4WMEA 1GBDA 1WGXA 4XE4A 4B1RA 5EQQA 1U9NA 5EJZA 2XHKA 1IRZA 3K9XB 1I3AA 1UVOA 3BOQA 3TJNA 2QSHX 4QTRA 1ZK8A 1EOLA 1MH3A 3ZYDA 2FS8A 4P02A 3F8CA 1B6AA 1Z6JH 2G7HA 1FUJA 4CZCA 3KEYA 2ZC2A 1FT9A 3MU0A 3P70B 4KIGA 1TQPA 2KRCA 3FXMA 1G3EA 2FBKA 2G81E 1BTXA 4M9FA 3TK5A 1RI7A 1WI3A 4L9NA 4HW0A 2ZI2H 5E0JA 4U0YA 2OXSA 2LOOA 5FHTA 8GCHF 3M8JA 2LPRA 4B76A 4CREA 5L2ZH 1MTUA 1K6YA 1KU3A 2QQAA 4NNJA 3C1DA 2QM3A 4Z6YA 1MAXA 4H42U 3ZQFA 2CW0F 4AG2A 4UDWH 3Q9SA 4A1TA 2H6BA 1ELDE 1O2LA 5IT9Z 2J98A 4GDFA 3IUOA 2GCTB 2KL4A 1W5SA 4O9VA 3SUGA 1Z8JB 1FPCH 3J7AO 2GD4B 1QPMA 1ETOA 1Y5UT 4V2FA 2LLKA 1Z7KA 1W12U 2P5VA 1FAXA 4CBNA 4B09A 1ZN2A 5IP7J 3N7OA 3ZN0A 1YP9A 3I5UA 4XM3A 1OCCH 3R60A 2ZJPF 2ZFSA 4NA7A 4HSTA 4HX4A 2ZXWH 1XMKA 3G3ZA 1USTA 3HKZA 2V1UA 3ZRGA 1J8AA 3RXPA 4PJMA 4XBBA 2CFOA 1HJAB 2AEIH 4IGDA 3WTYC 4CO8A 3UNGC 3EA7A 4Y7BA 1ZLKA 5D6EA 4DYQA 3G01A 1SPJA 2EFPA 3I4NJ 1JHHA 4GGGA 4YM9A 3P95A 2ZWLH 3U69H 4HLXA 2DA2A 3FXJA 4EEFG 4AYYB 5KEDA 3JRIA 2E1MB 3R0AA 4I0BA 4BYYA 1VJAU 1C5QA 2SNWA 5IYDJ 2H8RA 5C0TA 2F43B 5A0BA 1W7PB 1TALA 1YGCH 4UB6C 3SO3A 9ESTA 4YOJA 1ZOMA 2HWLB 3S14J 1LKAA 5FFXA 4H4KC 1QHRB 3RXIA 2QVOA 4O3TA 1UMQA 4I7HA 1HAPH 4FETA 2DE8A 1BC7C 2R7XA 4IXAA 1OHHD 3GYLB 3FK7A 1JI8A 3MU1A 2R7WA 2FYQA 2PP6A 3CCRI 2OTVA 5E3NA 4BANB 3VPRA 4UONA 2R7RA 4ESJA 1SSXA 1YRNA 3S2WA 1AD8H 4WXVA 4ESTE 2XCNA 2MD0A 4K60A 2R3SA 2PMUA 1ETWA 2R5ZA 1SC8U 1FJSA 1EZUC 2LY9A 4YELA 3FN8A 4FUBA 1GDUA 2DFEA 3CF2A 1IN8A 2BXZA 2D8WA 1N8OB 1D5YA 3ZVGA 3HGYA 3KETA 1DITH 2E60A 1O3PB 3SHAH 2P0WA 5CJ9A 5CYVA 4EM0B 1P57B 5E3LA 1F2SE 2TGTA 1SGQE 1P2QA 1KLJH 2LG4A 2ZFUA 3QGNB 1FJLA 2M5TA 4YLQH 5C17A 1GJCB 5J47A 3VPKA 1N25A 1D1BA 2M2EA 3ZZ5A 4G7ZF 1YCPH 4KNYA 2DA3A 3J7AY 1BL0A 4HYEA 1F92A 2IPHA 4LZ4B 1AA7A 3PFYA 3TH3H 1UJ8A 3FO8D 3DP7A 2MW8A 3ZZDA 3D5RC 3BROA 3ZVCA 4QT8C 2GQQA 4KGAA 1TLDA 3GTLJ 3PFIA 1IN4A 1QRZA 2OTLI 2XRNA 2PQ8A 2BZ6H 2Z6BD 2XF7A 1X58A 3C2BA 1C5OH 1OLTA 5JHUA 4KIBA 1LVBA 4Y8XA 2C8ZB 3MHWU 5EQSA 1DPOA 1G8XA 1TPSA 1QJ1B 1ZJKA 4OIOF 3CJNA 1P9QC 2N8GA 1B7XB 4NQWA 1QGFA 1WTGH 2HS5A 3OYBA 2BQ7B 4DURA 1JBUH 3HUGB 5LPFA 1P2KA 1ENHA 4CCOA 3JTHA 3VYUB 1B0EA 5IP9J 1C2HA 4AC0A 4CYCB 1AHTH 3FZZA 3C7JA 5EODA 2ZF0H 2E2IJ 1TGTA 5DD4A 1UZCA 2D45A 1P11E 1XM1A 2WUBA 1B9MA 3SV6A 3BT9A 3U9AH 3VB3A 4AFSA 2JH5D 3MH5A 5LGTA 3V8LA 2BOLA 4HBLA 3UB0A 1R22A 1NBMD 2KR7A 1O3NA 1T0FA 2FI4E 1G3YA 2A07F 1DY8A 3LAPA 2GZ7A 1GVDA 2H1LA 4E7JA 3KPHA 1SVMA 4DT4A 3LONA 1EF4A 5F53A 3MWIU 2OD3B 1USSA 4WY3A 2HOEA 1C5WB 4M3FA 3UR3C 1UVPA 4OIQF 4LG3A 5HLTA 2O5RA 2DOAA 2HQAA 1S6FA 1W10U 3BTWE 1RIWC 3AKZA 4OIPF 4A0YA 1B72A 1IOEA 5IT9K 4OAYA 1GBCA 4XL9A 1A5IA 2AIQA 2FSWA 1MQ6A 2EFOA 2LREA 1GI0A 2ZJQF 1GJ8B 3RU4E 3BTTE 2B0FA 5G4BA 5C5OA 4CR9A 1IJWC 2BOKA 4ZXYH 3NKKA 3NPSA 1MMGA 2ZB9A 4A3GJ 1DWCH 1O3FA 3PLBA 1GV5A 4A3MJ 2BVSH 3M3SA 1P01A 2R3UA 1XXDA 3LGVA 4DNCA 1WH5A 4FOUC 3CCMI 4L0ZB 1YPGH 1FPQA 2H1UA 5HLHA 2BV6A 3F6VA 1HW1A 5C44J 2L74A 3E3VA 2VWMA 5LLQA 1O57A 1EAWA 3CENA 1LEAA 3IWMA 2CQNA 4O5VA 4YFNF 5JB9S 1C5MD 4LG0B 2UUJB 4IS5A 5EEAA 3P9KA 3R6SA 3RYRA 3RXDA 2Z99A 2VU8E 1T95A 3KIOA 1D3TB 5EPYA 1YC0A 3ASNH 3OYGA 3ULQB 3DT0H 3GTMJ 3M3VA 3AG3H 1NT1A 3P8NA 2B9SA 5LEJA 3HRUA 3T8RA 3WE2A 4X6PA 2HOBA 1WPKA 2ZG0H 3SYTA 1HPGA 2AGEX 1LPZB 2P8TA 2DDBA 4KJZA 4E7RG 3KNXA 1CHOG 2FQ4A 3GCTF 3SZNA 5L30H 5K1YA 1HOMA 1Z05A 1OOKB 2P5KA 6LPRA 1FAKH 5K5QA 3GS9A 3SNCA 3O8BA 3JRGA 4JK6A 3X2QH 1BOBA 3PRBA 1DXPA 2EA2A 1O3LA 1DLEA 4G7HF 1ZHPA 5L3CA 2RQPA 1MKXH 1BTHH 1P4AA 4I6ZA 5EG0A 3F21A 2TRMA 2XBWA 3D5LA 2BD4A 1N78A 1T38A 1G37A 5FKOA 2W7UA 2ZPRA 3M35A 3OSFA 5F8XA 1ZRDA 1ZHMA 4Q7ZA 4ABBA 2CUEA 3OY5U 2XW9A 3TKYA 1NS3A 3ASOH 1FY3A 3P9IA 4CRGA 3QTOH 3N97A 3L9FA 1ZAOA 3D65E 3ESWB 5GIBA 4UEHH 3KQBA 1ETTH 4BNCA 1Y59T 4CH8B 3NUMA 3RXGA 2EB7A 2WAQN 2ZCKP 2ZDNA 1BJAA 3VSKA 2O8XA 4MFDA 3FANA 4LB5A 1AIXH 4K5ZA 5CDFE 5JFRA 4A0XA 3L2UA 1FP2A 5E0GA 3NRVA 2KLOA 1TPOA 4XRSA 3MWMA 2P8OC 2K02A 1TOMH 3HG9A 3PRDA 4R8TB 2ZFTA 3MNCA 4R8HA 2P93A 1HIAB 4Y3OA 2FM2A 5FCRA 3R3GB 3UPEA 9LPRA 2XGEA 2JA2A 3DKXA 3UNSA 3WTZA 2EINH 3IL2A 2P81A 2XROA 2YSRA 1L1JA 1SBWA 4Y8YA 3FXRA 1AZZA 1X1CA 5EGOB 1FNNA 3T26A 3FISA 2ZDAH 4PZJA 3TP3A 1GMHG 1O2XA 1K79A 2G8TA 3FKIJ 1I1SA 4GPGA 1MSEC 1FX7A 5HODA 1FNIA 5DDGA 1N75A 1HJAC 4XLEA 3TGNA 2Y0MA 4KKDA 3LSJA 2FX6A 1IGNA 1GHVH 2VODA 2BY6X 3DXJF 1PPFE 2Y7ZA 1RRJA 1THSH 3HDDA 3FZDA 2FODA 2XDVA 2DDAA 1L2EA 1LVKA 2IJLA 1EH6A 3O8CA 5IP6A 1BTWA 1HAIH 3SHCH 1W5TA 3GLXA 3Q77A 3CMAI 4D7FA 2ZGBH 3GZ6A 1K2I1 2F5CA 4BJ5C 3U1JB 1E3HA 1GBAA 3RYPA 4M9ZA 2BDHA 4HAMA 3RUOA 2MH9A 1UTKA 3UR9A 5FLXZ 5BPEA 4M7GA 3TPIZ 1BBRH 3DLAA 3BY6A 6GCHG 1C1RA 1RESA 1A04A 2DYSH 2E5ZA 2ZHEH 2HU9A 1SD7A 2UXNA 3E8LA 3P6ZB 4C3IJ 1SL3A 4RB2C 3CDLA 1XX9A 2Y6TA 4D9JA 1YBWA 3MZHA 3I29A 1WKMA 4DYCA 3QU6A 3I59B 2GCHF 3V42A 1MKMA 1X4PA 2PGBB 1HDPA 3CESA 2F3CE 1LQDB 2EI6A 4ZKSU 4DIQA 3QRFF 1PDNC 3U98H 1PPEE 3DPTA 3U2RA 4Y6DA 3MD2A 3TLOA 1R5HA 4XQFA 2JVGA 1IXCA 1BZXE 5CHBA 4ZHAA 3SV8A 1SGFA 5BPDA 4JYUH 5LGOA 3FXKA 4R79A 1Z67A 2QV1A 3GY8A 4ZH8A 4Y33A 2IP2A 1ELVA 3EGKH 2QY0B 1UTQA 5EG0B 3RPUD 3MO9A 1GMCF 1UELB 1TL8A 4UUSA 2VH6A 3A7TA 3B73A 3CLQA 1O39A 4ISLA 4JX6A 4B1TA 2WAEA 1QO0D 2W6ID 4U32A 1GJ6A 2KM0A 3SNDA 1SGTA 2ZP0H 4ABGA 2P8OB 4U7BA 1IDYA 2SGQE 2JT1A 2NVQJ 2STAE 2RDLA 4G6QA 1MTNC 2QIQA 2BY5X 1S7AA 5FX6A 1S29A 4ZYEA 5DTDA 1DX5M 1KA8A 1E3PA 1V3XA 3WTUC 5GADJ 2ELKA 1HGTH 4DOZA 2VVCA 1JXSA 1I3QJ 5F64A 2HGTH 2AERH 1EPTC 1VNDA 5B1BH 5EU8A 1X19A 1UVUH 4NBQA 1MNEA 3R61A 2UUKB 1LNWA 4Q80A 1BIAA 3FMQA 3M7GA 3ZCOA 1FX0B 3BG9A 1N8OC 2OF7A 1MBGA 1A35A 5KVRA 1YLNA 1YM0A 2XGXA 3QZRA 1L1GA 1SI5H 3DU6A 1TOCB 3ZMTA 4ABDA 3BQZA 2QAAA 2ELHA 4BE2A 3SFZA 4XDEA 4D7GA 4IF4A 3H92A 2V6CA 4MO7A 1O3TA 1FMVA 4FT8A 3MH4A 3CP8A 3Q00A 1RJXB 4GUXA 3D62A 1EFRD 1TGNA 5DP8A 1C2FA 2GKVE 1G36A 2K8IA 2XCFA 1OWHA 1GI2A 4C9YA 3PNYA 1U5TA 2MFZA 3RXFA 2A4QA 4BAHB 1JE8A 1S5LC 1OS8A 5JPMH 2B0LA 4BACA 1ZTKA 5JLXA 2CUFA 1ETXA 1O2SA 1ORKA 4CHAB 4WWCA 3MKWB 1EJNA 1XSDA 2BY2A 2HR3A 1SFKA 5FO5A 1BRBE 2F9UA 1ZARA 2A32A 1F1ZA 3H3UA 1HAGE 3NQOA 4N4NB 2LH9A 5EXLA 3SU1A 1BN5A 3WWBA 1BTUA 2HALA 1C2GA 3VB2A 1ETRH 4BE1A 3PMHB 2OUMA 1TRYA 3A0HC 1VFCA 1OWDA 2X6YA 4XNFA 4I99C 1FPHH 4ACBA 3C18A 2XYAA 2HNTF 1MDMB 3RMLH 2PFEA 1O3HA 3BG5A 3DEUA 3E6PH 1VITF 1C2IA 2QQ9A 1V2RT 4Y4RA 3U8OH 1YTYA 1QB9A 4AB9A 3ISPA 2NYXA 4G12A 1ID5H 3Q0WA 1FY5A 2HQNA 3HOXJ 4WWYA 1BMFD 4E6KG 1EKEA 1MTNB 3CZ6A 2EY4C 1NRPH 1P09A 3URDA 1LE8A 1R5GA 1BUIA 1MMJN 4HX7A 1VCQA 2ZO4A 4BH9A 5JVGF 3UOPA 2ZBKA 2P3FH 1OP2A 4GSOA 4XOPA 3JRFA 2JA5J 2X9DA 4ZKOU 2Y9ZA 1YO5C 3I58A 3N99A 1YJ9I 1RS0A 3HRSA 1LQEA 3V4GA 3HXLA 1AY6H 4Q4LA 2M8GX 4JZFH 2CWEA 3OYNA 3CCSI 5CVRA 4GFBA 1IF1A 5C94A 4RM2A 3GISB 1D3DB 1HFDA 2L02A 2D5VA 1Y8TA 1B8IB 5GAEJ 1MBKA 1X7AC 1O2VA 1FYMA 1O3GA 5CE1A 3M8EA 5ED4A 1DY9A 5DCMB 1G3CA 3KQDA 3CCQI 2BZAA 3N4MA 4GHTA 4OMYA 5BMZA 4XRMA 1MSFC 3BTME 3CC4I 1VQ4I 3QO6A 1G3DA 2L0KA 2AMPA 1NK3P 1YHQI 3TJUA 2GM4A 2OC0A 2FOKA 3STJA 1SG8B 1EZQA 1KLTA 3U8TH 3MKLA 1MMAA 2Y48A 5BOXA 3E1XB 3OY9A 2P59A 3K70C 1AQ7A 2O9LA 1M9UA 1BC8C 4JYVH 4YO9A 1D4PB 2H9EH 1AUJA 1NFXA 3E5QA 3EA8A 2V1NA 1GHCA 2NNNA 3Q9VA 4IN1A 1RNLA 1W0YH 2X85A 1BOAA 4WK8F 3BJ6A 2A05A 5T6FA 3OSGA 1AKHA 5D8LB 2ZEBA 5EW1H 1OJLA 4DIHH 2W3IA 3LSGA 2O8MA 4BAMB 1H8IH 2RNJA 3A7VA 1MBFA 3CLOA 2ZU5A 1DPRA 3ATIA 4LLLA 1S5SA 2DA7A 4WXDA 4I8LA 4Y13A 1SAXA 5F04A 3NAUA 4NC6A 1JIRA 5TISC 1RUNA 3IRRA 3K0LA 1GI1A 4CR5A 2D1VA 3MQKC 1FIWA 2KT0A 2UUZA 2MC4A 2ZFWA 1PP8F 1LHGH 1QRXA 3QWLA 1XGNA 1GHBF 2HTJA 1NROH 4IC5A 3K1MA 5J1YA 4JQFA 1H9TA 3FZVA 1NH3A 3H9GA 2ZMEC 2NNYA 2ZFRH 4EJUA 2HNTC 3MH6A 1L1NA 2KDOA 3QU3A 1KU2A 3ESTA 3QUMP 5AF9H 4FUDA 3LOCA 1RUOA 4RGUA 4EJTA 2YMSB 3OS2A 4JX4A 1E35B 3M7UA 3OS0A 2DJNA 2XRCA 2ODYB 2ZA5A 3OYEA 4EJOA 5EDNA 1RRKA 1E1RD 4WVPE 1DOJA 2KJBA 1B9NA 3RXHA 1SGRE 5GP9A 3QQAA 1NZQH 1YKTA 2R7VA 2UUFB 5EGMA 2BY8X 2NOJB 1QVUA 1OCPA 2CMPA 4FE4A 5KGOA 5GTIC 4EVIA 4J2YB 1C2JA 3SV9A 2XF6A 4AD9A 2FXRA 4AGKA 1GPZA 1GBMA 5GJ4B 3K9TA 4XORA 1C4U2 1HAXB 3M3TA 2EFWA 3DQVC 5FXLA 3KCCA 3JTGA 2KCOA 3H5CB 1HLVA 4FE7A 2AIPA 1VQNI 5EZHA 1AI8H 1JOUB 3CC2I 2OCVB 1XKAC 1S8NA 1CA0B 3T2NA 4D9RA 2WPLS 3M7TA 1HCGA 2A5KA 3HZJA 5DV5A 1MAYA 1W7XH 1G6NA 5HDNA 4ISIH 3VG8A 3PNVA 3GYHX 5D5UB 1EATA 4FUFA 3CS0A 2L7KA 1K4TA 3K4LA 2DN0A 2WC2A 3S1RJ 4BQNA 5E0HA 1KXEA 5DP4A 2ZSHB 1ULYA 3A88A 2KCAA 1NC6A 2VIWA 2IN2A 4IQJA 1B5GH 5DP5A 3DSPA 3WWFA 4FU7A 5FLMJ 3PYHA 2LKPA 1OR7A 2UWOA 1G2LA 4CXFA 2RA3A 2BLVA 1HW5A 1TNHA 5J1RA 4Y8ZA 1MBJA 2CV3A 1NU7B 2ANWA 1SGDE 3I55I 2ACJA 2QBYA 1K9OE 4BAOB 1UVSH 2GCTC 1AWFH 3TK6A 1WH7A 5F0FA 1HKQA 2KIUA 1Y3YA 2Y2ZA 3GMEA 1MTSA 1H8ED 5B3SH 1R4MB 4IZZA 3GTPJ 3I78A 1NM6A 2GZ8A 2F48A 1WQ2A 1NRQH 4HFPB 1EAUA 4XRSG 1VZQH 3A7WA 4KYWA 3ECOA 4A3JJ 1QRWA 3BR0A 3LQRA 4L18B 1QHHD 1HLTH 3RU4T 4X2WA 4M73A 3F3BA 5E79C 1EASA 2FOMB 4ISHH 3KN2A 3FFGA 1CGPA 1P0SH 1BBRE 6GCHF 3ECHA 4PGGA 3GY6A 1KXAA 2PWXA 4JCNA 2XAHA 3SQEE 1ETYA 2DODA 4KTCA 4L5EA 1X1AA 1MU6B 2Y81A 4IMQA 3VB5A 1SQOA 1KXCA 2TGPZ 2E1CA 1PPBH 2AS5F 2XKPA 2K40A 1H8HD 4WF8A 1BB0B 1HRTH 4V19K 2V79A 1OCOH 2IAIA 2IJD1 5K7RA 2X48A 1OR7C 5FCKA 2ZTZA 1GI7B 1UO6A 5B66C 5FLXK 2XNIA 1FTTA 3VOEA 3H0GJ 1EZXC 1CT2E 2FA5A 5KCMA 3ZXSA 5DSFA 4M3EA 4PJNA 1HA8A 3U21A 3RKYA 3BEIB 4TSFD 4N0BA 4HZFA 1HJ8A 1J7KA 3HGPA 4KMUX 4CH7A 3WTTC 1X4OA 3GY2A 3PMJA 3GYMA 3BR1A 3Q0VA 1TMUH 2W3KA 1ON2A 1YOVB 4A3EJ 3C3WA 1EKBB 4HI3A 3CNRA 1CA0C 2H9HA 4RS8A 4RKOB 5C1XA 2CV2A 3TP0A 2FEZA 2A6HF 3FBNB 3A2KA 3M3YJ 3BTHE 1JT6A 4P1WA 1PUFA 3WTSC 2Q6GA 3F9FA 1BBYA 1P2MA 3DBHB 1FI8A 3TDZC 5DP7A 3NZIA 4Z1MD 5JR3A 1OWIA 1NESE 2YPRA 1G30B 3RU4D 5HLIA 1VZ0A 1D8KA 1A36A 2ISZA 2O8WA 2Y0SA 3K7AJ 2QXGA 4RSPA 5FD6A 3AAUA 3AAFA 1ACBE 2W7NA 4IX7A 2XWAA 1EAXA 1TNLA 5LRRA 4UVBA 3HKIB 1W0KD 4YXWD 4NQWB 1XUGA 2D2DA 5GDSH 2GTBA 1SFUA 1VKYA 2FOAA 3TU7H 4NCYA 3LKWA 4XK4A 1OPHB 2QCYA 2UWPA 2QA9E 1O5EH 5EJ1A 3EDXB 4ZTJA 3RXTA 3F6OA 2JVHA 5HNHA 4AU7A 3WODF 2KHMA 1K1NA 2G52A 1FIPA 4PSXA 5HS8A 2FTLE 3W94A 1K61A 1U8BA 2L3DA 2DMNA 1I5ZA 4E05H 2Y30A 4WX9A 5HNFA 8GCHG 3O6BB 3TH2H 1R23A 2HYGD 1PPHE 1BOQA 1ABJH 3SUFA 3CP2A 1O2OA 2FOHA 3V0XA 3OAAD 1ARCA 4NSVA 5CKTA 3LSPA 2CO5A 2O0YA 1ZR0A 1WXRA 1EB1H 2DW4A 1TRNA 2ZU4A 1H88C 1O5GH 2LMDA 4H6SB 1TONA 2STBE 1ZGAA 4OS4A 1KQ0A 2Z7FE 2IS2A 4LITA 4EGYA 3BEFB 2ELJA 1YIOA 3R0FA 3RPUA 4X0WU 3EAJA 1IQNA 5E8IA 5ILSA 3I64A 4MLFB 1CT0E 4II2A 5GPIB 4XKVA 1IXRC 3RTRA 1FSHA 3DTEA 4B75A 3AAVA 1VCWA 2IA2A 1DDNA 1AE5A 1DP7P 1ZJDA 3PM1A 2FX0A 3CD6I 4ASUD 1WV7H 1S6HA 4Y71A 3DPUA 2CQQA 4L0YB 1STZA 2VKEA 3M36A 2KAIA 1WOFA 2RVCA 2EILH 1JHFA 1XUJA 4AIJA 4K2EA 4BUPA 2H9TH 1JRSA 2BLWA 3W2VA 3HSEA 1C2KA 4HDUA 1KU7A 3W2WA 1HIAA 2R7QA 1MNMC 3RXLA 1YYY1 5E3MA 8ESTE 2ZCWA 1I6HJ 3AG4H 2A4GA 4XMYA 1RZ4A 3GOVB 5ICGA 5H20A 1EH8A 1GHYH 1XUFA 2VBXA 2XV4S 3KYDB 1AFQC 3SJOA 4ZTFA 3F8BA 3SV2H 1G2HA 3L3TA 2VH0A 1QY6A 4NIXA 1SD6A 2KZ4A 4KN7X 1ITYA 1XGMA 2MLKA 2P5LC 3WU1B 1F0SA 3SDGA 2C4FH 4MEXF 3TVJB 2Z2SB 5FPSA 3NCLA 1DUEA 5D4SA 4UUSB 5IOYA 1L0ZA 3HK3B 4HV5A 3I4MJ 3H0DA 1BBRK 2FLRH 3LC5A 2ME0A 2W1OA 3NXPA 4AOQA 4X0GA 2JTVA 4E7ZA 3SEQA 3EYIA 1V55H 3RC6A 3JRDA 1IQGA 1E34B 1LMWB 1RTKA 2ALPA 5HXFA 3DCLA 2G55A 2PMZN 5JLWA 2F9PA 2HYJA 4B2BA 2AQEA 3K4MA 5BNGA 1J75A 1MZAA 2HNTE 3NK8A 4KTUA 1C2EA 1G4DA 3URCA 4M3GA 4AN7A 1FBUA 1J5YA 4U30A 3HRTA 1XXFA 3G1MA 3GCHC 4OS5A 3P5JA 1GXPA 4ZUHA 1SLUB 2O9QA 5CPRB 3ZQGA 5FJ8J 4YZUA 4YG2F 5EJLA 2OP9A 2QXJA 3HYIA 1O3BA 1YLDA 3U1IB 1O7LA 1HSJA 1KIGH 2GXAA 1RKTA 4IOAF 4A5NA 1SEUA 1KXDA 3PROA 2EEKA 1KLIH 2CXVA 2W5EA 1XCVA 3E1SA 1EV7A 1IRFA 2SGEE 1A3EH 3ZMSA 1LCYA 2F5EA 1BW5A 1A1RA 1SMYF 1IW7F 1YPHC 4BBRJ 1FBQA 1C9PA 5K5RA 1AKSA 1HAZB 4JYKA 1ORFA 2VB0A 5FD5A 1MW7A 1GJ7B 1RR7A 3A86A 3L2QA 1ETKA 1BIBA 1C9TA 1THRH 2OQGA 3BTKE 3DTIA 5EEHA 1NBME 4A92A 1EPTA 3CMMA 5FFZA 4J1YA 3PLKA 1Z0XA 4UVAA 2RDPA 3SJMA 3LL7A 5EEGA 4CRAA 1C1WH 1BHXB 3WU2C 2PR3A 3ZQHA 4FVBA 2R5ZB 1S6LA 2H5CA 1UK3A 2A6TA 2F4MB 1IQFA 2NXNB 5DUIA 1H0MA 3EE7A 2QWWA 1O2RA 1H9GA 4OS7A 1DQUA 4M6YA 2CGPA 1FMGA 3T28A 1P4XA 4NC8A 3S3OA 1HJ9A 3ZR8X 3QP6A 3T5XA 5FKMA 2Z3YA 2ESTE 1O2JA 1SKYE 1V54H 5LGNA 1UK4A 3Q3KA 3QYFA 3RMNH 3FMSA 1U2WA 4M6VA 3LSRA 4CUGA 5DYMA 3SOSA 5GXPA 1D8JA 2RV8A 2Z16A 4I2OA 3R4KA 1KU9A 2VJJA 1DWEH 3NRLA 1LDDA 1HUTH 2FNPA 1GJBB 3FP6E 2VL8A 4INHA 4XFQA 4AX9H 3KL6A 1ZMNA 1DSUA 3PL8A 2PKSB 5HM2A 1H89C 1Z91A 1IXSB 3WW7A 1VF9A 5BRRE 1VQ8I 5AHGH 1OMIA 4DZJA 3SJIA 1P9UA 2LBFB 3RLYH 1BJUA 1JUPA 2NS7A 2XSDC 4FCYA 3W1EA 5T1VA 3ZPLA 3HJEA 4ZYDA 3ZZ8A 1KTTB 5J4QA 2VIOA 3JCUC 2UWMA 1R71A 2CK3D 1KQ9A 4SGBE 3FVFB 1ZGWA 3AW0A 4F48B 1AVXA 3BG8A 1O0DH 1V2LT 2PKAA 3G71I 2AHME 3KIDU 5K5OA 1I50J 4RT0A 1WJEA 3BPVA 5FRMA 3R0JA 2XB0X 3Q5FA 2QUFA 1DANH 1EB2A 4N9IA 2HVSA 1ZMJA 2E19A 1TAWA 4OM9A 2Y82A 2HWVA 2G0EA 4KUMA 1DT2A 2IJOB 2J92A 5BS6A 3QYBA 2VASA 5IK2D 3ZZ4A 2EJRA 5JBBS 2H5DA 3BR3A 3GY3A 1FDPA 2C93B 5HVQC 3VEQB 3J7YJ 2D26C 2XPWA 5A2MH 3A8AA 4NZQA 3SNBA 1WHUA 3I0TA 3P17H 3JR9A 2E71A 1QQ4A 2A3SA 1A0LA 4YT6H 7GCHF 5K7ZA 2QC2A 1ESBA 1HW2A 1TGSZ 2OC8A 3L2CA 2L7MP 3K2UA 3GFJA 4Z2YA 2HPPH 1W14U 3A03A 5M5XJ 3BG4C 4X8TH 1LE8B 3M8FA 5FKLA 4B6EA 1MKWK 1ACIA 2E2HJ 4BY1J 3OR1C 1HXEH 3RKWA 4YLUA 4XBFA 1UHMA 4MFEA 4PSWA 2FMJA 2R93J 4XBDA 1KXFA 1BJZA 2BLQA 3MO6A 3UNRA 3QYEA 4ZCNA 3GDSA 3E6BA 3GFLA 3P9CA 5KAFC 4ZAEA 2C90B 1B59A 2BEOA 3F23A 4KISA 5M5YJ 4CH2B 3EYDA 3HK6B 1WJBA 3OYLA 3REOA 2JETB 1FZZA 4PGHA 3F68H 2ZPSA 2HDWA 1K1MA 1PQ7A 1VQ9I 1BA5A 2F91A 1QBNA 3BZCA 2VGCB 1C4Y2 3E97A 1C4V2 4HX8A 4KFCA 5F03A 2MABA 2BDIA 4I8JA 1FYKA 3UKGA 1WZ2A 5HDGA 2HQRA 2B8OH 2O8KA 2L9SA 3MEXA 3KLOA 3MZYA 1IAUA 2ZKZA 2DMQA 2Y0SN 5ICCA 4FU9A 1EP6A 3A83A 3SU0A 1GBIA 2QKLB 1TBQH 1BR4A 4R1HA 3W6JB 1B4AA 1OX1A 5AIPA 3D0SA 3RCOA 2ZQ2A 4NFFA 3DSGA 4MG3A 3GX4X 1HAYB 4BQOA 2CHAB 3SEZA 2IA0A 1O2TA 2DQLA 4CHAC 1IHSH 4BTTB 3SUDA 4YOIA 1UG0A 3F3XA 3EE0B 1O5CB 3V8JA 3A7ZA 4EJWA 4DOQA 2I5UA 4HEA2 2TIOA 1PQ8A 4D0PA 3GVAA 3VSLA 4CCNA 1QL8A 1T8NA 1ZTRA 4K1SA 1J14A 3GBGA 1C5VA 1F5TA 2VKVA 2FMYA 1IQKA 1GHBG 2YX4A 1UHBA 1GGDB 3F0PA 3F22A 3SGQE 2ZMEA 4G9YA 1GHXH 2R4GA 2DPDA 3UAIC 4FUEA 3RZDJ 4CA0A 2YUSA 4DGWB 5LD2C 4AIKA 1C2DA 2XF5A 4XN0A 3GDVA 3E91A 3T8TA 4NZLA 5FKNA 1ZHFA 1BRAA 4YTAA 2LY1A 1ZR4A 1HB0B 5IDKA 1QJ7B 1GG6B 1MZDA 5ABWA 3NWUA 2HI3A 4NB5A 3RXKA 5BQTA 2WUCA 3K65B 3JAMK 1K0HA 5DG6A 1P9SA 1TWGJ 5B6LA 2ADUA 4TV7A 3EUHC 4PUSA 2FI5E 3KQEA 1ZSLA 1U78A 1V2ST 1Y56A 3DWLE 1INCA 1UVTH 1DGWY 4YFKF 1BM9A 2ESNA 1IUYA 1YITI 1A61H 3HGNA 1O3AA 2JWTA 1YG2A 2DOEA 1Z9CA 2OC6A 1EH7A 2FMLA 4H0EA 2AHQA 2E7WA 1F4KA 1R00A 2XTTB 1OYTH 4UFGH 2PV9B 1WRJA 2EV0A 1NN6A 5F1JA 5H2FC 2P7CB 1ZH5A 2HLCA 3RLWH 1EP5A 1OP0A 2GGVB 2HTSA 2R2WU 2Q8KA 1J9CH 2ZFQH 4AORA 2JSCA 2GP9B 4IMZA 3DKWA 2FZZA 1T33A 2Y5GA 3MMGA 3HM5A 4N4OB 3IWFA 3VFEA 2V9VA 2OINA 4G94A 1YF4A 2Y7XA 2F6CA 3KP7A 2TGAA 4IBLH 4U0WA 4ASNA 1L4DA 2RCEA 2G9WA 4CGZA 1JIMA 3CC7I 3TDUC 1GJ5H 1VI0A 3OIPA 2BY0A 1LVMA 3U9GA 2P6SA 3ATMA 3OYAA 3RXMA 3ZZAA 2WPJS 1Z8GA 1MJAA 3LH3A 2HYFA 5AIQA 4BXXJ 3PUBA 2M8EA 3GY7A 1DXWA 3M07A 5DK1A 4EM2A 4X8SH 1R5ID 3BTCA 4XRNA 4TYDA 3WGHA 2VJ5A 2A7HA 2VQCA 2VIPA 1SHHB 4DJZB 2WPKS 3KYFA 4BJ6C 3O8GA 2G00A 2XXLA 1FTZA 2A1DB 2IS1A 4KELA 3EUKL 2Z9JA 3LJJA 1GI5A 2CMYA 4WH8A 2Z9KA 2SGDE 4HNVA 3I53A 2V9PA 4FQGA 5HYOA 1RTLA 3H9JA 2ECBA 2XASA 4ABHA 3HUGA 3PJRA 1IV8A 4Q4ZF 1FYLA 3K1NA 2XNDD 2J97A 3O3KA 3I9V2 3TJVA 1TC3C 2QLZA 1FONA 3DD2H 1GV2A 2JA8J 2JRMA 4BAQB 3M5OA 3H1CA 4IQ4A 1O5AB 1G3TA 2FWWA 3LGUA 2BBYA 3IG6B 1YPHE 2KJCA 1O37A 3OEHD 1ELGA 3LA7A 3PM3A 4FUCA 2DI3A 1QA0A 2DOFA 1TRMA 3LT3A 1Y5AT 2VN2A 2G5VA 1YJNI 4DBQA 3V7TA 3CQZJ 2DTRA 1P2FA 3GCHB 2BVMA 5A8XA 1TPAE 1ONVA 1S7OA 1TNKA 4INLA 2A0QB 3FK6A 4B2AA 3WTWC 2YOLA 4ZJZA 2VLAA 3LFKA 5K7FA 3BTJA 4II3A 1AKHB 2CV0A 2NOGA 1UTLM 1PYTD 4RB3C 1IQIA 1MTWA 3SNAA 3DA9B 2Z9LA 3QP5A 1ZELA 2EV5A 3PIPF 1VCPA 1S9HA 1LO6A 1OFCX 4BGDA 1W4MA 4GYIA 3GCNA 4HDVA 4L9TA 4BEHB 4JZDH 1F0UA 1MBQA 1VQLI 1RKWA 3OYHA 4VGCB 1GBJA 4UUTA 3ZZ3A 1QZ8A 3OL4A 1UAAA 2BDAA 1BCUH 3GF2A 1WI9A 1YX3A 1UMAH 2JSPA 3ZVDA 2W24A 1F36A 1W0ZU 1C5YB 4K3JA 4U88A 2CFXA 3ZQLA 4WCGA 4ASHA 2J4IA 4OGXA 2EFNA 4FHTA 1QZZA 4A2UA 2KDZA 4I0AA 4XLNF 2BD5A 5F08A 1B0FA 2XRLA 5CHAB 2WADA 3BG6A 1R36A 3MQ0A 5JB8S 4XLFA 1OSSA 2DMTA 1CGJE 1SMTA 2GMTC 1CE5A 4Q5SF 2R5YB 2Q2EA 1VJ9U 2QZ8A 1MGTA 4NSYA 1O3CA 2AO9A 2K4JA 1GBBA 2MBFA 4JX5A 5K7HA 1H4WA 4ZYGA 2EIKH 5C5NA 4M9XA 1TT5B 3OYDA 2NU0E 1RC9A 1ZPCA 3U28C 5IYTA 2BVRH 4ABIA 2HOSA 3Q3YA 2VXZA 1CHOF 3WGIA 1VQ5I 1JTYA 2I10A 3OYJA 4A3CJ 5E18F 2W48A 1SC7A 1O33A 2CUJA 2DT7B 2ZNZA 2XBYA 3CTAA 2VGCC 1OP8A 2RA0A 2OZ6A 5ERIA 4B43A 3IH3A 1XD7A 2A5AA 4JP0A 1RXPA 2ZFPH 2ZXHA 2MA3A 2X1EA 4UVCA 3OTPA 2BXTH 5TJXA 2ZGXH 1UK2A 4UXNA 3HB9A 3O8RA 2CUZA 4BAYA 1OWJA 5J8FA 3B6AA 1YCPK 4UNOA 2X6OA 4HLYA 3E0JB 2ZDKA 4CRCA 2IGNA 4UUVA 3G6EI 4M71A 1GCTB 5CQGA 1PFXC 2ZHWH 4XONA 3WE3A 1LVOA 1ZTLA 5C1YA 5HKKD 1T39A 3W6VA 2ZU2A 1O2HA 1AOYA 1T8LA 4C2MJ 1T4VH 5E2PA 3F9EA 1GMHF 3BG4B 2HVYB 1GDTA 1LPGB 4DVAU 1GHZA 2BDGA 3A84A 1O7FA 1XTAA 1JUMA 5LPEA 1V2MT 5GAGJ 3K4KA 2Q6DA 5TGTA 5D8KB 3LSKA 5GCHG 1W0JD 2NVXJ 1LHCH 4XOTA 4K1TA 3KGPA 3PWCA 3QDZB 1ZRKA 4BS9A 1SD4A 1WJCA 2LDUA 3E5UA 1Z1DA 1BJVA 4FUJA 4LJZF 1T2KA 2BY7X 5DM7F 3SU2A 4TY6A 1BMMH 1MMNA 3AW1A 3ZMVA 5GNDA 4A5TS 4GAWA 1D0YA 2JPBA 2FP7B 3M37A 1S3JA 4ZYAA 2HPIA 2OPTA 5IOZA 2M0CA 1NK2P 3S9CA 5E2OA 1IDZA 3K10A 5HDKA 2VIXA 1FWZA 1OQYA 3HBLA 1GHAG 3QLPH 2UV1A 4FU8A 3V8KA 2AS9A 1GBHA 3OYMA 1YRNB 1P8VC 2VXDA 3K6YA 1WQSA 1BTYA 2VVVA 3MAJA 5ICFA 3NARA 3S3NA 3HPGA 1MMDA 1ZSJA 4OOIA 2A2XH 2VC1A 4DCDA 2JIZD 2FOEA 3SI4H 2DQRA 3DLLF 2K5CA 1W2KH 1Z1JA 2QXIA 3EETA 3DEEA 3BN9A 4PJLA 2GV6A 2JN6A 2ZCHP 1TTYA 4WH6A 2VUMJ 2R2MB 3WHCA 2RDEA 2F5DA 3JRAA 3IRQA 2RC4A 4WXHA 1SVOA 3KEEA 3OIOA 5EZGA 1CT4E 4HV6A 1F5KU 2EZHA 3K2ZA 2Y69H 3A87A 1C5SA 4LG0A 4XSKU 3SGBE 3FOAA 5J4YA 3EQ0H 4WXCA 3IV5A 2QF4A 4Y10E 1CBWB 3H5NA 1GL1A 3P8FA 1T8OA 5FBIA 1J59A 2HKXA 3M9AA 1V2VT 2GMTB 3PNTA 1SGYE 3VXFH 3VGCC 5I46H 3ZP5A 2XSJC 3CDHA 4OMZA 2Y5FA 5DKMA 3LSMA 5D5VB 1P7JA 2AH4X 1R7JA 1QR3E 3MI4A 3ZZBA 2WB1N 3CP7A 4DW2U 1XN7A 2X0LA 3Q0UA 3A0BC 4YEJA 4YIFA 2A5YB 3E3TA 1QTFA 2Q1ZB 2PFBA 1XKBC 3FP8E 3L6PA 3ZQ7A 1UJ1A 1NFYA 4XR6A 1MQ5A 1MBHA 2CU7A 2HOAA 2Z1DA 1BMNH 1TA2A 1PP7U 4PJ0C 2M4KA 1ELAA 3TGIE 3FWEA 3TO9A 2A4OA 4ZROA 3GCTG 1TBXA 2VVUA 4HF1A 1Q3XA 1IRGA 3PO1B 3F2GA 3Q3SA 3L09A 4MNUA 4YIIA 5FB2A 4C2UA 1ZMLA 4ABAA 2OBOA 1SGIB 2H6MA 4CCJA 1TX7A 2L4AA 5HIZA 2NU2E 1MBMA 1T32A 3CDIA 2OQRA 3RC5A 3SDBA 5JBAS 5AFZH 1TPPA 4HPQA 2PLYA 4FUIA 1QL9A 3KP4A 2AGIX 3P92A 3HKJB 1E3OC 2ID3A 3FXOA 1E38B 3HC7A 3CCYA 4G6DA 1IHTH 1TE0A 2ESHA 4G8XA 5E1XA 1NTPA 1YQAA 3BJOA 3HRMA 4CYCA 1N6XA 2BQ6B 2ULLA 1WQVH 1W1WE 3HSRA 2HGCA 3G1LA 4ZDLA 2I6QA 2HXIA 1XX5A 1E17A 2LKXA 5BPIA 2GOXB 1O3RA 8KME2 1KGSA 4EQQA 4ZZDA 1ELTA 1N6YA 3PV2A 1LKXA 3DTKA 3SFIA 3I71A 2QSGX 3OU0A 4HQEA 1O34A 3TITA 4B3AA 1Y39A 1O38A 4EJVA 6ESTA 1TQ7B 5CVJA 4Q7XA 1TIOA 3ODDA 2M45A 1XVMA 2HPQH 8LPRA 4QPOA 4MPVA 1YPJH 3GWZA 2AXTC 3TL4X 1Q1HA 2ICWG 1HSTA 1GDNA 1TNGA 1GUUA 1F0RA 3J81Z 1E36B 4NGAH 1IRXA 2DT6A 1UW7A 2R7UA 2RFKC 3DHKH 4DJAA 4UFDH 2R5YA 3RXVA 1GVLA 4IPAA 2M1BA 2AMQA 4D5FA 3VYSB 1AFQB 1GWAA 2M30A 1ZREA 1FLIA 4X6NA 5E8GA 1LDKB 2CQ7A 2LTPA 2X51A 4F91B 1V2WT 3PO1C 2FXAA 5D5WB 1RIWB 3P8OA 4X6OA 3LJOA 1ETQA 1ZQ3P 1NU9A 1D1AA 2J5OA 1BR2A 2V6EA 1LVYA 2PUQH 3ABLH 3OSYA 3E90B 2WAQA 3BV9B 2W85A 2GIVA 4H6TA 2GIZA 4I01A 3FM3A 5LRSA 2BD8A 1V2QT 2WV0A 4IOCF 1KTSB 2H2ZA 1IQLA 4ZHMU 5HS9A 2A69F 1Q1VA 1TWAJ 4W97A 2LELA 2FOFA 4AUXA 1WFXA 2DA5A 1QNTA 5EGOA 2WPIS 2KQRA 2GDDA 3T0YA 2TRTA 1QPIA 3N05A 4LZ1H 4H4FA 1UTNA 4E06H 4CSWA 1AO5A 2F9VA 5A8ZA 3VWBA 1KDQA 1DU6A 3BTEE 1Y3WA 2IPQX 4KMFA 2ZGJA 5AVDA 2VBWA 2WAFA 1CQTA 2COBA 3CS7A 3BG7A 1OWKA 4YFXF 1QBOA 4PCQA 3OE7D 4J19A 3IAM2 1OKXA 2EPFA 1KZHA 5SGAE 3H35A 2HEOA 1J17T 2K3PA 1U6GA 4D7MA 4RMNA 2GA2A 2HVRA 2BGCA 3WG9A 1FOXA 2QE7D 1OYIA 1M1EB 1HV7A 1T6SA 4FX0A 7GCHG 5B5EC 2QN5T 3HHGA 3Q76A 1W3CA 2BY3A 4IHVA 4UFEH 3A89A 1TQIA 3U1DA 1NY22 1ZG5A 1GBEA 2ALVA 1DWBH 1SGFG 4MHGA 2ZU1A 5DUKA 5C3EJ 3WGGA 4LIVA 3HOVJ 1DM4B 2KIFA 4A0ZA 3DBRB 5DO4H 1GT0C 4GYGA 1FY7A 2PTNA 1MUEB 4A6EA 3K2AA 4WXIA 2R0QC 3F9HA 2V3OH 3RIRA 1L0OC 1K7AA 1RFNA 2KCYA 2EI7A 4E7SA 3H3VK 2EWNA 2FTMA 2V0BA 2XC0A 3GEZA 4C3HJ 4DIIH 3BZ6A 2VI6A 2GWRA 2EI8A 1TMBH 1CGIE 2B7DH 5LGUA 1GHWH 2TPIZ 2GVFA 3BQYA 1SQAA 5C4XJ 1D9IA 1TNIA 4LFUA 3S0NA 4ZDPA 4GCVA 4OU0A 2P4WA 1O3JA 3ZIAD 1FOWA 5FPYA 1GJ4H 4R0IA 3RXBA 1HYLA 2RGVA 2ZU3A 3TO6A 3CCUI 1JKQC 2RNGA 3GTOJ 1R58A 5J1UA 4KICA 1ZRBA 2CSOA 5DPAA 4I98B 2KRFA 2FYRA 2JJ1D 1LEBA 2OTJI 4UV8A 4HF0A 4HNTA 5CVIA 2WV1A 4OS6A 5T6GA 4Y11E 2M2AA 4M74A 1X1DA 4FISA 4HTCH 1D3YA 4BDYA 4FX4A 4IRIA 2P3TB 2VT2A 2J38A 1GI6A 4B47A 1EQ9A 4RBOA 3VODA 4Y76A 3KQCA 4EM1A 1A6QA 3KQ5A 2PX9A 1S7EA 3UTUH 2WHXA 3RXRA 1U5TB 2DFHA 5HS7A 1C5NH 3JZ1B 4B6FA 1ETSH 4DT7B 2XGDA 2R9PA 2DE9A 4Y0ZE 1N77A 1YWUA 5JYIA 1P04A 3SW2B 4L9VA 2FOCA 3QZQA 3L2VA 1YPLH 4X1PU 4NC7A 2VB6A 3A85A 1IQEA 1SGNE 3A8BA 1BRCE 1HC8A 1GBFA 2VOPA 1GLNA 3MFJA 3AFHA 2MSYA 3GCOA 2E5NA 1O3OA 2FOWA 1KYWA 1MD0A 1C5PA 1UG2A 2TCTA 4P96A 1P12E 1YW8A 4AM3A 2WZQA 1WJDA 4E7NA 1EUFA 1Y3UA 4RGSA 2NVTJ 1KY9A 5L2YH 3BTLA 2GZ9A 3PMAB 3PMBB 1FBSA 2ZGHA 2LFBA 4RA2A 4NDLA 4XLAA 3QPSA 1SVLA 5T3HA 5TCAA 3H5RA 2PJRA 1E0EA 1WVRA 4AIDA 4DG4A 1UB9A 2VC0A 2QYIA 2PHBA 2JZYA 4MEYF 1VQMI 1ANEA 3IHUA 2M87A 5DEQA 3LSHA 2ANYA 1TX8A 2UXXA 1FOYA 1SFIA 2LK2A 2A6EF 4RDUA 1N1LA 2K27A 3ENSB 4NUBA 1F9NA 1ZLRA 1ZYRF 3GW2A 4FXGH 2DBBA 3WU0A 3CO6C 1O3DA 1W11U 4MTDA 3CMYA 1MIJA 1KDQB 3F1SB 2GV7A 1GGDC 3ODFA 2PJPA 1QGPA 2ZDMA 3FP7E 2BYAX 3L00A 1PYTC 1I27A 1C1PA 1A0HB 3S93A 2C8YB 3LGYA 2DT5A 4IEJA 2LC2A 1WJFA 5LHIA 3GY5A 3I4PA 2XVCA 2SGPE 1X2NA 3OYFA 2WV4A 1MNDA 3PB1E 1EZSC 4X1EA 5TRDA 3GTGJ 4KITB 4MQ9F 2O03A 3S3MA 4K1EA 2WV5A 3RC4A 1UTJA 1T98A 1OWEA 1G9IE 3HGGA 1Y0UA 1B72B 3A01A 3FM5A 3FKJA 2K9LA 1L4ZA 3FDYA 3W2AA 4WMFA 1X1BA 3BTDE 2ZIQH 3ZZ7A 3VDXA 1BW6A 1G2MA 5DP6A 4F52A 2ZXIA 4Y52J 4IHWA 1LTOA 3ELAH 3TIUA 1TZLA 5L3BA 1C1MA 1WJ5A 3LWFA 2CRGA 5KHDA 2JH0D 3A7XA 3DFLA 2IVMA 4ANJA 5HOOA 2VQHA 3BWGA 2FLBH 2W25A 3BDDA 2HDCA 1GVZA 3OX7U 3QODA 1QRYA 1Z21A 1Z7LA 1YE9A 1PJPA 2XAGA 4EATA 5B6OA 2PLXA 2ZMEB 1SQRA 3G1OA 1E0FD 5L3FA 2R7OA 3TGKE 3WG7H 3A01B 3SQNA 2OC7A 1TQ0B 3STIA 4NHJA 1THPB 3WHBA 1RD3B 1ABIH 3ZN1A 1NO9H 1O3KA 1GCDA 3WTVC 2JQ7A 1D0XA 5EF6A 1SLWB 2A68F 2XC4A 2YR2A 2K3FA 1XDSA 2L2OA 3V7RA 2BOHB 2QF0A 4F55A 3KX2A 2DK8A 3LGTA 3PO3J 2EZKA 3BTQE 3VB4A 1WUNH 2XAUA 2J95A 2PN6A 2WTEA 3LIWA 3IH2A 3LNQA 2A5WA 4CZZA 1DSTA 3PSFA 3PLPA 1V2JT 2E1NA 3RMMH 2O3FA 4U2WA 2BX3A 2KFDA 2XC7A 3F72A 4BHPA 1FZPB 4KT6A 1SGCA 4F3QA 2RAEA 1SLVB 4A3KJ 1UCRA 3OS1A 4B71A 2J5UA 4AFZA 1AVGH 1GMCG 4MPUA 1W36D 4HQMA 4AC9A 1Y8QB 4WMDA 3SBKA 3GLLA 4BJTA 4Y7AA 1FC3A 3F9KA 4B44A 2VE8A 3CJRB 5C0UA 1A46H 3TW6A 2M9HA 2VQLA 3S7HB 2J94A 4HRIA 1C1NA 3S1NJ 2XPUA 3TBIA 3BCAA 4CBOA 3ITIA 1K1IA 4LB6B 2ZO3H 5IY5H 2V35A 2MLGA 5FPTA 3GY4A 2BD3A 4D9QA 5DP3A 4LOCA 2R92J 2VBYA 2H09A 1EX3A 1XMNB 4L5JA 1YFHA 2NS8A 1CGHA 2L7ZA 2KFWA 2FE3A 1JUSA 9ANTA 4LK0F 1IQJA 3CJTB 2BM2A 4DGJA 4LLGF 5C1UA 4XSZF 2IS6A 1K4SA 1XDUA 1X3ZB 1VTNC 1O2IA 2GXBA 3T5FH 2FESH 1U6QA 1H9IE 2CQKA 2E36A 1O30A 5LH8A 1WDIA 3JW4A 3BTGE 1W5CC 2IS4A 1QB6A 3S2DJ 4DYRA 1Y1VJ 3RPQA 3L7WA 1OYYA 3UFAA 4BDZA 1BI1A 4KP0A 1ZHRA 1UHSA 2P16A 1TBZH 1REPC 4I76A 2OA4A 1EA3A 1YX5A 4Q2KA 3V13A 1BMLA 3HOUJ 3DSOA 3W95A 3DFJA 2L6OA 4KTSA 3D1NI 3MOCA 1SFOJ 1YPKH 5C2ZA 2O7OA 4SGAE 3KP3A 1YW9A 1LHFH 1W7PD 2I8DA 5L6NH 3RXSA 3U8RH 1VQKI 4IHYA 1KYZA 4MPXA 2V7FA 4C30A 3MMYB 4AYBA 1J0RA 1JWTA 3S17J 3JRBA 1H9HE 2VPLA 2XGCA 3PTBA 2GBYA 2WB1A 1HKTA 4S05A 3EPZA 3HPHA 1IV6A 1HQCA 1O31A 3UWIA 3HPTB 2FI3E 1XC5A 1GDQA 3DPLC 3BR6A 5B1AH 2OK5A 2ZHQH 2FIRH 1TLHB 5E20A 4MTBA 4MQAA 2QQ8A 3VXEH 1I6XA 4BTIB 1FXYA 2VNTA 1XMXA 2WPMS 1BDAA 3T25A 1BTZA 2OBQA 2W57A 1C5RA 5I25A 4L9JA 3AL0B 3I3LA 1D3QB 4A3FJ 2I6SA 2UWLA 1GI9B 1QQIA 4YOGA 4PFOA 2HZTA 3MZ8A 4KN4X 1VQ7I 3A81A 3RJPA 2CHAC 1P2JA 4K2YA 2ISYA 3C1KA 1H8AC 2GDEH 2LR8A 5GTHC 3TH4H 2O8TA 4XKCA 4V2GA 5FKKA 1NRNH 2F9NA 1ZRFA 4MPWA 4THNH 5DP9A 2IGMA 1AU7A 4GRIA 5HIYA 5LPRA 2KISA 1O2PA 2HKOA 4A1XA 2QF3A 2OQUA 1YS6A 3E7LA 2JA7J 5DS9A 3HIFA 2W7SA 1PVEA 5KECA 2F5FA 3K4NA 3S1QJ 2HNHA 2XWBI 1R6RA 1ELBA 3S1MJ 3TMOA 2NWNA 4Q47A 2R7DA 1TA6A 2K9MA 1BHXF 3RQ4A 3D5SC 2MYSA 2QA4I 1GG6C 1ANDA 3DF8A 1EPTB 4KIFA 1BIOA 3N7DA 1CVWH 2M7AA 2L9VA 2JJ2D 2ILNA 1HBTH 3ZVAA 1Y6IA 1MMSA 2EH3A 3K1PA 5KAIC 4XKWA 1WAYB 2FO9A 4QSHA 2WY8Q 4LLNA 1E37B 4EGZA 2VWNA 1C1QA 3S16J 4IKFA 4HGCA 2FNAA 5E8EH 1S0RA 1PPZA 5JI6A 3E6CC 4JYTA 3L1PA 3AVZA 1LQ1A 1XCBA 1GXQA 3CCVI 2F83A 4PDKA 1W0TA 2K86A 1WU1A 1P2NA 3EA9A 1F0TA 1B8IA 3S8PA 1TW2A 2X6XA 4DQ2A 2OLGA 4PFPA 1QBJA 4AVPA 4OS1A 2W6JD 3C2GA 3NEUA 1ARBA 1A31A 2YMSD 5C3NA 1SFEA 1QIXB 2FEQH 4RLFA 2CW7A 3MU5A 3M4OJ 4AYVB 3BCBA 1QCPA 3OV8A 4BBSJ 1SFQB 2WYGA 4IHTA 1XSVA 2ZNYA 2UZKA 5A2QZ 4PJJA 3SZTA 5EPNA 4A7IB 3F6UH 1IQMA 1AE8H 2NU1E 1BTPA 2KMUA 1ELFA 3V7CA 1O3QA 4IJAA 3L2RA 4AGJA 3CUOA 5A0CA 2KKOA 2W00A 3TOBA 1GMDG 3HL2A 4NIVA 2FRHA 3MKZA 1CA8B 3LGWA 1PYVA 2J2UA 2M34A 1VGCB 1ZG1A 5FROA 2STWA 3QOPA 3LA2A 2TDXA 1ZTJA 2HXOA 3KEQA 3FIWA 5A8YA 3S9AA 3ATLA 3OY6U 2BDYA 3CUQA 4JOMA 2WBMA 3COAC 2ZFFH 4ON0A 2M7BA 2GJGA 4NWLA 2DA4A 5A2QK 1LPKB 3HOWJ 1AU8A 2LP0A 1JT0A 3HKZN 1SOTA 2Q2EB 1TGBA 1G32B 1JXPA 2D1JA 1HDTH 1D5VA 3NWTA 4NA8A 1YI2I 3OMYA 4BXSA 1GBKA 3BZKA 2DMPA 4ABFA 2OJED 1UTMA 3ONQA 2Y80A 1CSOE 4M72A 1XUIA 4JZEH 4BY7J 4XOJA 1ETVA 1Z77A 3QWCH 4MNXA 1O36A 3VB6A 5E17F 5EG4A 1IUFA 3CJQB 1DE7H 1F5RA 3S32A 2A31A 1ON1A 1DUXC 1DPUA 1WYKA 3VFZA 3DV8A 2KZVA 1EJMA 2AFQB 3ZGKA 1U5TC 2EQRA 3ERED 2LF8A 5FLVA 4MQVA 3RXOA 2DCEA 1GI3A 5CMXH 4ENNA 3SN8A 3OWTA 2R3YA 5F27A 3HOZJ 1D0ZA 2VQGA 5HGGA 2DK5A 3ZMDA 1T8MA 1JGGA 1D1CA 2H1KA 1QA6A 2AGGX 2FS9A 2ZPQA 1OCZH 1Q2WA 3JSPA 3C27B 3ATWA 2LBFA 3PTNA 3H7OA 5KNLA 1Z6RA 2JUGA 4I86A 2MC3A 3EQLF 3UOUA 3G73A 2LKSA 2O6GE 3K4JA 4MGRA 3EUHA 5HM9A 1PJRA 3SU4A 2K1QA 4RAGA 3MTYA 4B74A 1XGOA 3OOPA 2BDCA 1XG1A 1LFBA 3OR2C 2EBIA 4A93J 4P00A 2W82A 3A8DA 2M3AA 2HQ5A 4DZPA 4BU2A 5A0AE 4TT3D 3LA3A 4P9FA 3WY8A 2NVUB 2H27A 3DU5A 1W13U 5EYRA 4GXOA 1FMWA 1ZR2A 5JDUB 4HF2A 2M0MA 4GO1A 1MH0A 4WJG2 4CCLA 2XC5A 4RGRA 3GICB 2VIQA 4XRFA 1DS2E 3F0CA 4E7IA 1RPWA 4O03A 2JETC 1SQTA 3ROUA 1R4NB 1LVAA 2ZGCA 2ECCA 3SU3A 4RM3A 5EJCA 3A1YA 3K69A 1H9LB 1P03A 5JHFA 1O5FH 1VGCC 3F2HA 2VJ1A 3BIUH 1ZYOA 1AZ8A 1P3CA 1A6IA 1KONA 3MO3A 1ELCA 3QN7A 2V3HH 3BR2A 1FIAA 1LDTT 3FHZA 1UHWA 1QU3A 1HAVB 4CCKA 4M9SA 1A5HA 1A0JA 1R49A 5DCFA 3EUAA 1GBTA 3IC7A 3LQQA 4F7ZA 2AXLA 1WSSH 5DJ7A 4I31A 4ZKRU 1TQMA 4L5IA 2CGAA 2YNBA 3OYCA 1GJDB 4Y17A 3BIVH 1S84A 1TWFJ 4X8VH 2PEXA 2VIVA 2C6YA 1TYNA 2DMUA 2Q6FA 3B8JA 3UQVA 1K22H 5EIYA 5EXMA 4ZHLU 3RQIA 2LYCA 1QBVH 2VT3A 2AQFA 1QHGA 5J8CA 3A02A 4AYBN 4IN2A 3S15J 4Y15A 3SZPA 3MU4A 1P10A 2AMDA 5DN6D 4PROA 2EV6A 1DVAH 1U8RA 3OTJE 1SMFE 1A5GH 2LF7A 2DUCA 2IW5A 4VGCC 2K9NA 4FUHA 1R1UA 3HOTA 3G2BA 5M3FJ 4DBRA 3IWZA 1VQ6I 3CUQB 3ZQQA 5LHHA 5HLGA 1FY8E 3D49H 1HNEE 5CHAC 2NVYJ 2BLOA 3GFMA 4PK4A 1FN8A 3HTSB 2VJIA 1MD8A 4ISNA 4JBAA 3MKYB 3BEUA 2LNBA 2C8WB 4Q48A 1S83A 1WCZA 1DFPA 5ICEA 1P2OA 1DUAA 2L9RA 1SGEE 3RSNA 1QL7A 2AYWA 4K8YA 2F9BH 1O5BB 1U9OA 3ZQCA 1Y0NA 1C5TA 1E1QD 4I8HA 2PSYA 4RLQA 4E7HA 4M3BA 1ZG3A 3AL0C 4GVUA 1QQUA 1GVJA 5GPAA 2EZIA 3H7TA 1IO2A 2DYRH 2XAFA 4Z6AH 4A69C 1O2ZA 2BTCE 4BQQA 2ANKH 2VKDA 3KEOA 2F9OA 2WA0A 2Q1JA 3LOXA 4ABEA 3JRHA 2VOOA 1V2KT 4JK1X 2ZHDA 4IHXA 3LSIA 4WF2A 3LSTA 1NRSH 1BA8B 2D2WA 4ETSA 3SQHE 1V2NT 5LEKA 4FVDA 1NFUA 3T27A 3ZV9A 4LMYA 4F92B 3B23B 5M3MJ 2BYVE 3RXQA 4CICA 2A7JA 5FGMA 1JMOH 4BE0A 3M5LA 1O3EA 3KF2A 3TGJE 4G7OF 4UB8C 2MG4A 4LK1F 4IL6C 1TGCA 2E1OA 1YCPM 1UHBB 3UQOA 2EC9H 3SZEA 2L4MA 1FSEA 2W4SA 3QX5H 4AWXB 1GL0E 4RAZA 4OINF 2A5IA 2O8LA 4D5CA 3DFGA 2F4IA 3NWSA 4ZC3A 2BB4A 1MU8B 1SD5A 2KIQA 4A12A 1JTXA 2ZSIB 1AN1E 2BHGA 2CH0A 2Z33A 1A5JA 1Z1IA 3VGCB 2OCEA 2L7FP 3W6KB 1ELEE 1OPCA 4ZZLA 3LFUA 1YPEH 2IT0A 1O2NA 3UNQA 2H6CA 1CF7A 2P7VB 5LHGA 2FOGA 5CVUA 2B5TB 3AASA 2PW8H 1V3FA 2FUG2 1DICA 2K0QA 1MTVA 4JK5A 3A8CA 4NG9H 3TNSA 1OYQA 1P02A 3K70D 1GBLA 1P7IA 1Y8RB 2OV7A 4YRVA 3BJAA 1DP3A 5JBTA 2QGUA 4ENJA 2PJRB 1C1OA 2QSFX 1SHYA 3TO7A 1LB2A 1PPCE 1MJBA 2E1MC 1TW3A 2NU3E 1MCVA 4A5MA 1DGRM 4I32A 4BKXA 2W26A 4HA8A 3BLYA 1J2XA 2GT7A 1SR5C 3AK5A 2RREA 1GI4A 4KT5C 1POGA 2K9SA 2PKSC 1TT0A 3EDPA 1MD7A 2J5PA 3SJKA 3MU8A 2PGQB 3OYKA 2L54A 1NTCA 4U7DA 5JVTA 1ZGVA 4AVZA 3OL3A 4TWWA 1B1BA 3E0PB 4ESBA 1V6DA 3KZZA 4LD5A 4B3XA 1GMDF 1LFUP 2MGQA 4I02A 1BRUP 4MVNA 3FXQA 3IKTA 3RP2A 3BF6H 3P8GA 3GXOA 4JZIA 3F9GA 1Z8RA 4A6DA 3BP8A 2PUXB 4UD9H 1D3PB 4QIWN 3ZZ6A 1C5UA 5LBQA 3GUDA 1O2KA 2PSXA 3BSQA 3MCZA 2ZTXA 2STTA 2DA6A 4KDPA 1UCYE 3RM2H 4QWQA 2IGOA 4BNRA 3LC3A 2EIJH 3IKVA 2B7EA 4X8UH 4RN6A 4E70A 3KYGA 2WSSD 2LNCA 5IYBJ 2A7CA 5E3OA 1NFWA 1PPGE 3O8DA 1HBXG 2HDDA 1L3LA 1MABB 2IA1A 1Y3XA 4UFFH 3RXJA 4U87A 1SLXB 2BXYA 2O8UA 2QGRA 1V4RA 2DXIA 2TBSA 1TBRH 3KLNA 2DAOA 4B48A 3KZIC 1AHDP 1ERDA 4M6XA 4XKBA 3BC8A 2WPHS 2ZKSA 2F2EA 3GZ5A 1TWXB 2G4UA 2GOMA 2Z94A 2VWOA 1TNTA 2MD5A 2G7UA 1AFEH 2PMHA 3S69A 1YW7A 2E7XA 4AB8A 4ABJA 4ZH4F 3V7SA 5A09A 4X1QU 2K85A 1IC8A 1IN5A 4AFUA 2TGDA 4X6AJ 2ZDVH 1A3BH 4O6JA 1S81A 4S0HB 1KQ8A 4HNUA 2J98B 2SFAA 4FUGA 4QLCU 1QZEA 1IN7A 1FEXA 4GLYA 3VYRB 1P2IA 1WBGB 4MTEA 4O3UA 3IAS2 3J80Z 2IXSA 1JKRC 5DCMA 4HOBA 1YY3A 2NAZA 4JMYA 2HPMA 2EZLA 1PQAA 3FHNA 1ANCA 3DUXH 3PQJA 1W7PA 2LY2A 3ZVFA 3A4CA 1Q31A 3ZZ9A 3LDXH 5AFYH 1K21H 1W7GH 2BY9X 3PSIA 3ZMUA 3EYYA 1FY4A 2HVQA 3AG2H 4CDGA 1PUEE 1HAOH 2QKMB 1K6OA 1O2QA 3G4SI 3UY9A 3SGAE 4UV9A 3M5MA 3GTJJ 3J80K 5JBCS 3RKXA 2G5NA 2XKOA 4HG2A 1S72I 2VIDA 1C5XB 4CRDA 2EQNA 5ILVA 1GHAF 3FXLA 4XSXF 2XPVA 2CV1A 2Z9IA 2C8XB 3TNTA 2PG4A 1MDMA 2DPUA 2J9NA 1T56A 4B73A 4X6MA 3GO5A 5F6FA 3KCGH 2FPZA 1K1PA 1D6RA 5EQRA 4GCHF 1ZKGA 1AB9C 1U0JA 1T31A 1SOZA 5FX5A 2CJIA 3ABUA 2PBIA 4ISOA 1WCMJ 3LPRA 4ZKNU 2V3MA 3IITA 4P55A 3TK9A 4YESB 3DBLB 1K1JA 1NG6A 2MH2A 3SI3H 2FD5A 4O3MA 4LXBH 5E1WA 2D1HA 2JMWA 3ATKA 3HSFA 1YJWI 2P3UB 1K78A 3K6GA 1VITG 5C67A 2ID6A 3LAJA 7KMEH 2VE9A 1Z8IB 2Y5HA 2JRTA 3FKSD 3E6MA 1R9TJ 1BT7A 5HMAA 4LIUA 2KZGA 2HFHA 3TOAA 2P95A 3AG1H 1V2TT 1K83J 2DLLA 2IEKA 1QFKH 1UTOA 2GA1A 2JK3A 2P6TA 6PAXA 3M61U 5H6RA 1J09A 3K4CA 3MYWA 3H5AA 1ZGIA 2ODPA 3E5XA 1W0UA 4Y0YE 4KA4A 3WTXC 5L3DA 1XMAA 1SFXA 3TJOA 1C1TA 1W36C 4BQAA 1RGQA 2OU2A 5T6DA 4IW4E