1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Alkylmercury lyase
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
4MEYF 1HKSA 1T98A 4Y13A 2H09A 3E6MA 1UHMA 3IRQA 2NS0A 2RV8A 2G9WA 4N9HA 2EFQA 2L54A 2D45A 1BN5A 1XMAA 2DT5A 3HOTA 4ON0A 2W85A 4BXUA 3U9GA 5KK1A 2MBFA 3GLXA 1MJ9A 3BOQA 3KZZA 3R61A 3QU6A 4PZJA 3PFIA 4S04A 1O3SA 3HIFA 2EJRA 3B02A 5FLXK 1B9NA 5E17F 3J81K 5LHHA 1LJ9A 2RDPA 2KRFA 3HRUA 5BPIA 1BC7C 1R36A 1GXPA 4I7HA 1Z05A 2L3DA 1U6GA 2Z3YA 5IT3A 1W7PD 2IA2A 1MDMB 1FYLA 3R0AA 2XAGA 1TNSA 3ZN0A 1YO5C 5HVQC 3DPLC 4ETSA 1KU9A 1XGSA 2YSRA 1FYMA 3F6OA 3JAMZ 1FOKA 2ESHA 5AONA 3RIRA 3GEZA 2FBHA 2P6SA 3FF5A 3DKWA 3D0SA 3WG9A 5CLSA 1F9NA 2IVMA 2EFNA 4HLXA 4A0XA 2E7XA 1PP7U 1J75A 1LB2A 3KCCA 2A6HF 5JR3A 1R7JA 4ENNA 3WTTC 5ERIA 3M1EA 4KMFA 4HQEA 3TGNA 2YX4A 3F8FA 5DD4A 4UV8A 1BI1A 5HOOA 4OIOF 3I71A 5HLIA 4Z2YA 2IRFG 2UXNA 1B59A 1XGNA 4U7DA 1U5TB 2HOEA 1K78A 2VONA 3BDDA 2RC4A 3EETA 2MH9A 1G3YA 1ZAOA 3V7CA 3KP3A 5J8CA 2XAJA 2MH2A 3I64A 3RPUA 1QNTA 1IN4A 3HRMA 4RGSA 2QBYB 2L02A 2V79A 4WXHA 5EEHA 1OPCA 4KMUX 3V8KA 1RNLA 3E97A 4UHTA 4I02A 3C3WA 2IA0A 3WTWC 2FA5A 3KE2A 1OR7A 2DPDA 2VOOA 4M9ZA 3ZP5A 3J80K 2GA2A 2ZNYA 3DV8A 1ONVA 5F6FA 3R0JA 3HTUA 3V8JA 2DK8A 1BM9A 2EV5A 3RKYA 2EB7A 1EH8A 4KUMA 1QPMA 2GWRA 1HQCA 4IRHA 2PG4A 1P4XA 3EDPA 4HF1A 4UXNA 4OMYA 3R6SA 1ZG5A 4EJOA 1XGOA 5DUIA 4GXOA 5BQTA 2DI3A 3WODF 1R22A 1KU7A 4FHTA 4IF4A 1WKMA 1AWCA 4M6XA 5DD8A 4WWCA 4LFUA 5ICFA 3J7AO 3N97A 1Y0UA 2CG4A 4KN4X 5D6FA 1V3FA 5D6EA 3T5XA 1FZPB 4FX4A 1S7OA 4L5JA 4P9FA 4L9TA 2GXGA 4G6DA 4U0WA 3LWFA 1UCRA 2ZCWA 3FM3A 4Y17A 1ZH5A 3P9KA 5L3CA 4GYGA 4CZZA 2PQ8A 4BAYA 5A2QZ 3ERED 4CGZA 3LSTA 3HTSB 2MLGA 5FGMA 1G6NA 3ISPA 2ACJA 2PMUA 3VB2A 4HV6A 5DEQA 2ZKZA 3SXYA 3RKXA 2P7VB 3BY6A 4KFCA 3WGIA 4ESJA 1R1UA 4KIFA 2O03A 3E5UA 4D0PA 1R5HA 1O3TA 3EYYA 4YIIA 1SMTA 2HTSA 1ON2A 2EFPA 1EH6A 3GYHX 1SD6A 3SFZA 3MEXA 1OKRA 4ENKA 2XRNA 2A61A 2QYOA 2HQNA 1IUYA 3ZQ7A 1D8KA 2Q8KA 3U2RA 2ISZA 2DPUA 2WTEA 5K5QA 3BPVA 4L9NA 1K7AA 4I98B 3COAC 1S6LA 1H0MA 3K69A 5HS8A 3WTXC 6PAXA 4N0BA 2CW0F 3M7GA 4NB5A 3GZ6A 1DUXC 2ZNZA 2OAZA 1FT9A 2TDXA 1ZGJA 1D5VA 4HQMA 1LEAA 4AWXB 2WV0A 1BOAA 4EGZA 4UV9A 3M8FA 2K02A 2L4AA 1S29A 1STZA 5E8IA 3ZMSA 4P9UA 2P6TA 1R1VA 2HYFA 4U7BA 2X0LA 3EQLF 5LBQA 3DF8A 2XGXA 3DEUA 2RN7A 3F8NA 4RGUA 4A2UA 1D8JA 3HUGA 4CYDA 2Q0OA 1Z7UA 1O57A 3QAHA 1SFUA 1IRGA 4RAYA 5TJJA 3RKWA 4B8XA 4YFNF 5D5WB 3O2PE 1RZ4A 3HRTA 2OZUA 2RNJA 1P4WA 2QENA 4ESFA 2HQRA 2HGCA 1LEBA 2XAFA 4M74A 2M45A 2V1UA 2MD5A 1B9MA 4HA8A 3WU0A 1LQ1A 2ZBKA 4R79A 1J5YA 1BIBA 5LEKA 1R23A 2HFHA 5HS7A 1LNWA 1KYZA 5ED4A 1E2XA 1FSHA 2OD5A 2EFWA 1CGPA 5HLHA 3HSRA 5J8FA 1ZREA 2F5DA 1Z1DA 1PDNC 1Z91A 3KEQA 1BC8C 5KVRA 3LAJA 2Y0MA 4LGWA 3GUDA 1FYKA 3ZMUA 1IXSB 3FMRA 1SD5A 2ETHA 3O6BB 3DFGA 4NQWA 5D5XB 3HSEA 5E1XA 1FWZA 2F5EA 3GO5A 1QGPA 3C7JA 4RS8A 3N4MA 1T2KA 4EJTA 4M72A 1ZN2A 1XDSA 2M30A 3DPTA 1NHAA 2VOPA 2CGPA 4IJAA 5D4RA 1K6OA 2OQGA 1BBYA 1KU3A 2OA4A 5CVVA 1XMKA 1RUNA 3CUQA 1JGSA 3MZHA 4F7ZA 3T8TA 2Q2EA 2A68F 2H94A 1W5SA 2Z99A 1J2XA 1ZYRF 3TO9A 4KNYA 1IW7F 3M9AA 3SQNA 1GHCA 3P9IA 2FBIA 1TQPA 3MFKA 3TDUC 3KLOA 1LDJA 2ZO4A 3TKYA 2EA4A 5JVTA 2O6GE 1YYVA 1IRFA 4CICA 4EJWA 2GQQA 3V4GA 1RIOH 3OOPA 1FPQA 2C6YA 3PQKA 1I1SA 4G94A 1QBJA 1TNTA 1REPC 2DW4A 1S7AA 2NRAC 1YQAA 1YFHA 3ZMVA 2DU9A 2YU3A 1GVJA 5L3FA 3BZ6A 5BMZA 4H0EA 4LK1F 4Q48A 2KIFA 3R4KA 2QQBA 1U5TA 4CDGA 2DAOA 3K1PA 3BJOA 3GXOA 4GYIA 2XROA 4LJZF 4OIRF 5D5VB 2QWWA 2IT0A 4UNOA 5FD6A 2HYGD 3HSFA 3IL2A 4S05A 4IHSA 4EM0B 1ZLKA 3IWZA 5AIPA 1TLHB 3KP2A 4EM1A 3T0YA 1HW5A 2G7HA 2O0YA 3WTUC 3S2WA 2D1HA 2PN6A 3KP7A 4LMYA 4TV7A 3I5UA 3LQRA 2K7LA 5J6XA 5DCMA 4LLLA 5F1RA 1XCBA 4OOIA 2O61A 2AS5F 2CFXA 4ZZLA 2GZWA 1ZHFA 2FBKA 1F1ZA 2ZJ2A 3L09A 3K1NA 2PJPA 3SZTA 2Y48A 3K0LA 2JZYA 1ZRDA 2VE8A 1G3TA 1P4AA 3T8RA 4JK1X 2ZMEA 3TQNA 2HS5A 1Z6TA 2KIMA 1OYWA 4WK8F 2MC3A 4LLNA 1T6SA 2V1DA 1L3LA 1G4DA 3GFIA 4I01A 4FX0A 5LRSA 4MQ9F 5DV5A 3IKTA 4GGGA 4M71A 4A5NA 1B1BA 2A3SA 2VODA 4M9SA 2H27A 2V9VA 2BE5F 3FZVA 4BH9A 4KA4A 4KIGA 2JT1A 2JSCA 2QQAA 1BI3A 2RKHA 1R5GA 4Q47A 2ZMEB 4ESBA 2P4WA 3TO7A 1K78B 2BYVE 4EJUA 1P6RA 1TW2A 3CLOA 1B6AA 3I59B 4XLNF 4MTEA 2XKOA 3ML6A 3J80Z 4ZZDA 1T39A 1L0OC 4A6DA 1P2FA 1LVAA 3DXJF 3ZMTA 3LA3A 1UHWA 3ZMDA 4AD9A 1BIAA 2YPRA 5DCMB 4WX9A 4HF2A 3WGHA 4Y15A 1OYYA 1YW7A 2ZFWA 4HBLA 4U0YA 1KQ0A 3FHZA 5L3BA 1HW2A 3W6JB 3WTVC 1EH7A 4EVIA 3F72A 2Y75A 2KJBA 5DUKA 4ZYEA 3QP6A 1HSTA 2K4BA 4EV0A 1BJAA 5E18F 4YFXF 4L18B 3KP5A 5DYMA 2HDCA 1WI9A 3IKVA 5H6QA 5K5RA 4EJVA 1XCVA 4IPAA 5HDGA 4L9JA 4IRIA 4BHCA 2OQRA 3ECOA 4QLCU 4XRFA 1MD0A 2LDUA 1FSEA 5FB2A 4HZFA 3VOEA 5CVRA 3M8EA 2QBYA 1FP1D 2RGVA 5BOXA 1XSDA 3GWZA 2HEOA 1X3UA 3H3ZA 3CJNA 4MQVA 3TOAA 3LAPA 2FEZA 2A07F 3H3UA 1HBXG 2BBYA 2F2EA 2XUBA 5E1ZB 1IN7A 2ESNA 2ELHA 1J7KA 2IP2A 4G8XA 2H6CA 1Z9CA 2EK5A 2FNPA 4LG0A 4B09A 1U78A 1MZBA 3CUQC 5DDGA 2LF8A 1ZRCA 3OV8A 3E6CC 5LGTA 3I58A 4HW0A 3H92A 3C1DA 1JHHA 2XV4S 1SFXA 2G7UA 1RI7A 3TO6A 1TQIA 1G3SA 1V4RA 2EV6A 1DP7P 4GCVA 4HF0A 4RGXA 4YIFA 5IT9K 2QQ9A 4RGRA 3T1BA 4BQAA 3ZPLA 4BYYA 1IF1A 1HW1A 1XDUA 3I54A 3F8MA 5LHIA 1W7PB 3WTYC 2V1XA 2O8XA 2BV6A 2VXZA 1SAXA 2CYYA 1YG2A 3FX3A 1MJBA 5JFRA 3P9CA 4PGGA 2JPBA 4E70A 1O3RA 3ECHA 4UUVA 2VBXA 2XAHA 4MTDA 1IN6A 4WXDA 1S3JA 2K4JA 5H6RA 4XSXF 4MNUA 3JSPA 2K86A 4MHGA 2IW5A 1ZG1A 3KLNA 2MA3A 1IZ1A 1T38A 2L01A 2VE9A 4M73A 5CYVA 4UVBA 2Z9OA 5L3DA 3LA7A 4HYEA 1WSUA 4HOBA 3V8LA 4NHJA 2RVCA 3Q9VA 4KYWA 1WQ2A 4OINF 1KU2A 3ZN1A 4Q4ZF 3RI4A 3KP4A 2F5FA 2VC1A 3MAJA 4IRGA 1BI0A 2YX7A 4KICA 3GFLA 3U1DA 3JTGA 1HXDA 4BNCA 3L00A 2Z5UA 1MKMA 4RB0A 5LGNA 1CF7B 1EV7A 3TDZC 1XD7A 3JAMK 4Q5SF 1ON1A 3R60A 2UXXA 1FP2A 4G7HF 2ADUA 3QPTA 4ZYHA 4DQ2A 3VFZA 1HKTA 3AAFA 2JPCA 4CXFA 1E17A 3JTHA 3VEPA 3KETA 1SFEA 2IPQX 2VBZA 1H9GA 1YLFA 3GZ5A 1QZZA 4A0ZA 2GIVA 1W5TA 5L3GA 1P92A 1YS7A 3QRFF 5CVUA 3J81Z 1QQIA 5AIQA 4G6QA 3MQ0A 4HDUA 2QZ8A 2CSOA 1F4KA 1KQ8A 3L2CA 3FMQA 1TBXA 2XASA 4L0YB 5FFXA 4DNCA 3C18A 1UB9A 3BPXA 1T0FA 1ZGAA 5ICCA 1KQ9A 2FXAA 2PBIA 5HDNA 2FQ3A 3WU1B 2PMHA 5ILVA 5BS6A 3MWMA 4RB3C 3ELKA 2FE3A 2XVCA 4L0ZB 4OIQF 4KDPA 2PLYA 2GAUA 3E5QA 1W4MA 3KEOA 3K9TA 5LLQA 3KP6A 2BEOA 5CJ9A 2A6EF 2STTA 1USTA 3KZYA 3I53A 3IC7A 3HHHA 1D3YA 4ZYDA 3JW4A 3NRVA 2LF7A 3HOSA 4G7OF 1FX7A 2ISYA 2F5CA 2STWA 4BHBA 4U88A 4AIJA 2A5YB 1XN7A 1XSVA 4AVPA 3PQJA 4LLGF 1KA8A 3F8CA 2H6BA 2IA1A 1FBUA 2DO7A 4HAMA 1CF7A 2QLZA 2E7WA 4P96A 3HYIA 5TRDA 5E20A 2M1BA 2PI0A 1FBQA 3KFWX 1F5TA 2DQRA 1MJAA 1QO0D 3IRRA 3CO6C 1ZG3A 3K2ZA 5E1WA 3RDIA 4R1HA 2XIGA 2W57A 3Q5FA 3ROUA 2KKOA 1IAWA 2VT3A 3QPHA 2E1NA 4ASNA 3F3XA 5LRRA 5E8GA 3CUOA 3RYRA 3V7RA 2FMLA 4KN7X 4GO1A 4I09A 1KGSA 3I0TA 1A04A 2FMYA 1XGMA 1JHFA 3EUHA 2XAQA 4O3MA 4EMSA 2UZKA 3QP5A 3GX4X 2CO5A 4RAZA 2K27A 1ODDA 3NQOA 1WWXA 3I59A 2A69F 2HWVA 3SZPA 1DDNA 1FNNA 1ULYA 2NNNA 3O3KA 4O5VA 4ENMA 3GF2A 4XSZF 4G9YA 3WTZA 2CWEA 2LSOA 2FRHA 4I2OA 1FY7A 3VODA 2EA2A 3RTRA 5HS9A 2P5KA 3F21A 5ICGA 4HLYA 2R3SA 4LD5A 1UFMA 3G3ZA 5LGUA 5BPDA 1K79A 2VC0A 3F6VA 4WF2A 5FO5A 2DQLA 2FF4A 2KJCA 3LFKA 3I4PA 5ILSA 2W84A 3DP7A 3GFJA 4A6EA 2D2WA 3GVAA 1J9IA 4WXCA 2GXBA 1ZLJA 4ZYGA 1PP8F 4HX8A 3EYIA 5JI6A 1YW8A 3BROA 2OU2A 4G7ZF 1VTNC 1I5ZA 4I0BA 1JXSA 3ULQB 3BJ6A 3WE2A 3FMSA 2HKXA 2KIUA 1LDDA 3E6DA 2E1CA 2XKPA 2R7DA 5CVIA 2HR3A 3HRSA 1DPRA 3E6BA 4A5MA 3JSOA 3IHUA 4YG2F 2EFOA 4YFKF 5K5OA 3E5XA 2NNYA 1FBSA 2W24A 4A12A 1FC3A 2VBWA 4OMZA 1YW9A 2QM3A 5CVJA 2QUFA 4PCQA 2O3FA 1SD7A 3WGGA 1O3QA 3FXQA 3BWGA 2EV0A 2IJLA 3L7WA 5HDKA 1OMIA 3QU3A 3QOPA 2PEXA 3Q9SA 4M6YA 3W6KB 2J5PA 1RUOA 2XHKA 2M87A 1IXCA 4EGYA 4P55A 4IHTA 2L4MA 1R1TA 4QWQA 1PUEE 3E3VA 2EWNA 4JBAA 4EQQA 2LNBA 1G3WA 5D5UB 1LDKB 1JE8A 5D4SA 3FM5A 1MGTA 1WRJA 4UVCA 2GA1A 2DTRA 3FXRA 5FFZA 2M5WA 3CDHA 2R7FA 1ZRFA 2FNAA 2QVOA 4KIBA 4OU0A 5FD5A 3F8BA 1HSJA 2UWMA 1J0RA 3WE3A 2FSWA 1U2WA 5K1YA 2VBYA 1YS6A 3NEUA 3CTAA 2OZ6A 4M9XA 2Z33A 2P5LC 4LK0F 1I27A 4ZH4F 2BGCA 5D8LB 4K2EA 3IWFA 1Z6RA 2M8EA 2PFBA 4XLPF 1OYIA 2FOKA 3CO7C 3LA2A 4KT5C 2V6CA 1O7FA 5EEGA 2MLKA 2RQPA 3GW2A 4IVNA 3RJPA 2JRTA 3CUQB 4IXAA 3RPQA 3TOBA 4R8HA 3BP8A 5DCFA 4RB1A 2AXLA 1SD4A 4LB6B 1KYWA 4L9VA 3K1MA 2DK5A 2FU4A 2DBBA 1I1GA 2P5VA 3GFMA 2NYXA 4I0AA 2HZTA 3FWEA 4MGRA 5A2QK 4JQFA 3P7NA 4LG0B 4HX4A 1O7LA 4U0VA 2NAZA 1R00A 1FLIA 1XB4A 3V7SA 1MDMA 3MCZA 1TTYA 2DFIA 3G73A 5ILUA 4AIHA 2LKPA 4WCGA 1SMYF 4MEXF 1Q1HA 1C0WA 2DLLA 2CQKA 4BHPA 4HX7A 1AOYA 1R58A 2JTVA 1U5TC 2HTJA 3ZMZA 2WWYA 5FLXZ 5HLGA 1U8RA 1IN8A 1S8NA 4XBFA 4HV5A 2VN2A 1BI2A 1IXRC 3F22A 1ZARA 5F64A 5H20A 4HDVA 4N9IA 1XSXA 4AIKA 3MZYA 2J5OA 3REOA 4RB2C 5L3EA 1B4AA 1GXQA 1TW3A 4EM2A 1W7PA 2P7CB 5IT9Z 4UVAA 1YIOA 5D8KB 1DPUA 5JHUA 3ABTA 2HKOA 1USSA 5ICEA 2COMA 3D5LA 5LEJA 3SHFA 1YTYA 4CHUA 2X4HA 3F23A 4LB5A 2W25A 3FXUA 3LQQA 4P5OA 4PDKA 4L5IA 3RYPA 4FT8A 4O6JA 4ENJA 3DQVC 2VT2A 3B73A 2B0LA 1IN5A 2ZXJA 5LHGA 2P8TA 1I6XA 3BJAA 4PGHA 1H9TA 3L9FA 3HHGA 3WTSC 1J59A 4OIPF 2OBPA 4CO8A 2YR2A 4A0YA 3ABUA 2D1VA 1TQMA 1QZYA 1HKQA 2WC2A 1U3EM
chains in the Genus database with same CATH superfamily
2ZEBA 5JBCS 1VZQH 1T98A 2GCHG 3OE7D 1UHMA 3IRQA 2RV8A 1O2OA 5EPYA 2PJRA 4N9HA 2CQ7A 2D45A 4XK4A 2DT5A 1A3BH 2HXIA 2EI6A 2BHZA 4NIXA 1H8DH 2KCOA 3IWMA 3AW0A 4PFPA 4Y4RA 2CH0A 4PJJA 1KXBA 3S3NA 1NM6A 1ELCA 2JK3A 4S04A 1O3SA 3HIFA 2EJRA 1B9NA 2W48A 5LHHA 2PGBB 2K85A 1RR8C 2RDPA 3DBLB 3HRUA 5HIZA 5I25A 1O33A 1O35A 2NS7A 2Z9LA 2Z2SB 3RXLA 2DMQA 2BXTH 1GBDA 2VLAA 1C1NA 4IBLH 3FISA 2CQNA 1J16A 1FYLA 4AFQA 2A5AA 5EXMA 2HVYB 3HPGA 4ESTE 3HKZN 2VQHA 4ISIH 4E7JA 1C2FA 5E79C 1VQ6I 7ESTE 1FYMA 3F6OA 4MG3A 5TJXA 2OCEA 4A3LJ 1LVMA 4OAZA 1TALA 3AG4H 4Y6DA 2GCTB 3RIRA 1UCYE 4NA9H 1E79D 3BTDE 2A6TA 3GEZA 3H9JA 2D1JA 1TPOA 3KQEA 4GDFA 3A7YA 3T25A 3SQEE 4FQGA 1YPKH 1F9NA 2E7XA 2ZXIA 1O2JA 4LG3A 1O3FA 1J75A 1UO6A 2V1NA 4RLQA 1BCUH 3TK5A 1XKAC 5ERIA 2GCTC 4KMFA 4HQEA 1NBMD 3F8FA 5DD4A 2QAAA 3CDLA 2WV9A 4CH7A 4OIOF 2A2QH 3I71A 2BOKA 2CFOA 2IRFG 2BVRH 4U7DA 5M5YJ 3CS0A 3PNTA 2HOEA 3BDDA 3ZZCA 3RU4E 4HPQA 1YCPH 1G3YA 5J8CA 2XAJA 2ASUB 2BD7A 1CU1A 4BE2A 2C8YB 4RGSA 2VPRA 4L5EA 3ZQIA 1LHDH 1O2NA 5HKKD 4KMUX 2PKSC 1JMOH 2ZU3A 1ELFA 2R92J 3DEEA 1OR7A 2VOOA 4OM9A 2IAIA 3ZP5A 2ZNYA 5F6FA 3HL2A 1C5LH 4YT6H 3OX7U 3CESA 3RUOA 3RKYA 4I31A 1KMHB 3DSOA 1X2NA 1I39A 1P4XA 4HF1A 2BQ6B 2NU0E 1IV8A 2VQLA 2RFKC 1XGOA 4GXOA 5B6LA 4KKDA 4XOJA 1R22A 3GISB 1KU7A 3RXVA 1E1QD 4WWCA 1RD3B 4BY7J 5D6FA 1V3FA 5D6EA 5AFZH 3T5XA 3GTLJ 3RXIA 4WF8A 2WPLS 1G37A 4J2YB 2TGPZ 3CMMA 4NCYA 2GMTB 1Z8JB 2VWLA 3LWFA 1UCRA 1A61H 1Y3YA 2Y80A 2FYRA 2VIQA 2HNTE 1DXWA 2VNTA 2ODPA 1NN6A 2IOTA 3ERED 4CGZA 2MLGA 4X8UH 2ACJA 4HV6A 2F9UA 2QF7A 3OSFA 3OTJE 4PFOA 3LH3A 4U30A 2ZKZA 5EGMA 2JIZD 3WGIA 4ESJA 2R2MB 4D0PA 4A3EJ 4YIIA 1R4MB 1GJ5H 1ON2A 3A89A 3GY4A 1SD6A 6GCHG 1AKSA 1OKRA 4ENKA 4FUDA 2HQAA 1MBHA 5C5NA 2QYOA 3TGIE 2HQNA 2KRCA 1OXGA 1DE7H 1N77A 2VJ4A 1FTTA 2VINA 3S0NA 2WTEA 3VB5A 3BPVA 1K7AA 1ZMJA 1P10A 3TEDA 1H0MA 4CA0A 5HS8A 3H0GJ 3WTXC 3BT9A 2CW0F 3GZ6A 1DUXC 2ZPRA 2CV2A 2BY6X 2JA6J 4HQMA 4AWXB 1R49A 4ITVA 1H8HD 4R0IA 5E8IA 1JKRC 1KLTA 2BLWA 5EGOB 1ETTH 5GJ4B 3RXJA 5LBQA 3LONA 1Y1VJ 2L7MP 3NK8A 3F8NA 1EAIA 2K3PA 1D3QB 4BAKB 4B3XA 2K40A 1D8JA 2QSHX 1F92A 4CYDA 4XBDA 2VQCA 1FY1A 3QAHA 1O2XA 3IG6B 5F04A 1K4SA 4B8XA 1MD7A 2F9PA 5FPYA 1GBHA 4XE4A 1Y5AT 2XWAA 1GHWH 4GFBA 2RNJA 2OC8A 3W3CA 5J40A 1FIZA 2HOBA 2PMZN 1JUMA 4M74A 1GBAA 4ZC3A 2V1UA 4A3BJ 3T26A 3WU0A 3VGCC 1J5YA 4R79A 2VQGA 1BIBA 2XBXA 3S16J 1UHBB 2HFHA 5EU8A 2BX4A 1KYZA 3PO3J 1HAVB 1FSHA 1JUPA 2B5TB 5C94A 4FCYA 3PLBA 4IKFA 3PJRA 2F5DA 1JKOC 4CYCB 1CGJE 1QJ7B 5KVRA 3OY9A 3LAJA 2Y0MA 1BOQA 3M1CA 3ZMUA 1C4Y2 4X0GA 5C67A 2FOWA 1SD5A 1JIMA 4NUBA 3U28C 1MIJA 3UWIA 1ZGWA 1K1OA 5IYBJ 2BZ6H 4R8TB 2NS8A 3C7JA 2R7TA 1QR3E 1NY22 1O3PB 4IQ4A 1K6OA 1WH7A 1XUIA 2OQGA 1O3BA 1ANBA 1VGCB 1RUNA 2GP9B 2K8IA 1TX8A 1D9IA 2QXHA 1GJAB 2A68F 1XUFA 4X2VA 4XD7D 5B1AH 2HDDA 1JT0A 1ZMNA 2DFFA 4N4OB 4KNYA 4X6PA 2GIZA 2FBIA 4OS5A 1TL8A 3TDUC 3KLOA 5CQGA 1C4V2 1LDJA 1PUFB 2ZO4A 3A84A 2EA4A 5JVTA 2O6GE 4INLA 1JOUB 3N7DA 1IRFA 4EJWA 1EJAA 2BB4A 3VPKA 1V2MT 1XUGA 1J09A 1I1SA 4KJZA 1Z77A 1JJ6C 5HIYA 3CQZJ 1ELAA 2UUYA 2E36A 2B7DH 2DU9A 2WAQA 3BR1A 4MNWA 2G00A 2Y7XA 1FI8A 4MFDA 1S5LC 2X6XA 2VB6A 5BMZA 3PRDA 3B23B 3A8CA 1AB9B 2KIFA 1BRAA 2QQBA 3W94A 2E2IJ 2R7VA 1RFNA 4CDGA 2DAOA 1WVRA 1X19A 2MD0A 3GXOA 3MMYB 2TBSA 3TJNA 2BOLA 5D5VB 1W0YH 4UNOA 2IT0A 5FD6A 2CW7A 3IL2A 4IHSA 4GVUA 1H1BA 4EM0B 3MNXA 4AYBN 2EQNA 3E8LA 3A01B 1ZLKA 1TLHB 3KP2A 2OBQA 2O0YA 3WTUC 3S2WA 2D1HA 1L1NA 2PN6A 3OYLA 3I5UA 3ATKA 5J6XA 4RKJB 4OOIA 2O61A 3BR3A 2CFXA 2E71A 2H1KA 2JDID 3JRGA 3U69H 1KLIH 2FS9A 2GZWA 3DD2H 2A31A 1ZHFA 1TGNA 3PLPA 1GBFA 1U9NA 3PUBA 1YP9A 4ZXYH 1Y59T 2P16A 2H5DA 2ZJ2A 4Z0KA 2DOFA 3EE7A 4C30A 2Y48A 2VIDA 3SHCH 1AIXH 4CR5A 2P95A 3J7AY 3MO6A 2Q6DA 2FZZA 4AG2A 1Z6TA 1OYWA 1NTCA 3WG7H 2CUZA 2V1DA 1EF4A 1ANDA 4MPWA 3DBHB 4FX0A 2DCEA 4MQ9F 2WUCA 4W1UA 1LHEH 1GI4A 4M9SA 3SO3A 1BA5A 1HLTH 1C5QA 2IPHA 3VSLA 2BE5F 3FZVA 2FO9A 3R3GB 2JT1A 4AU7A 3VXEH 4Q7XA 2FI5E 3K7AJ 1NO9H 2H5CA 1FV9A 2ZMEB 4D8NA 3RXTA 1C2JA 1BTYA 3OS1A 3TO7A 8ESTE 4ABZA 4EJUA 3CLOA 3A7WA 4XSKU 3ML6A 3J80Z 4ZZDA 2M8GX 3VGCB 1K1JA 4F55A 3HOVJ 2O7OA 3DXJF 3ZMTA 3FIWA 1XUHA 5AFYH 3ZMDA 5EZHA 3H7OA 4DOZA 2JH6D 1TPSA 2O5RA 1F0TA 2BD3A 2IS2A 1YW7A 4HBLA 1LVOA 4U0YA 3FHZA 1ACBE 1NRRH 1X4PA 1HW2A 5M3FJ 1NBME 2ZFPH 3CNRA 3WTVC 1MKWH 3VB7A 1LKAA 1EH7A 5E3MA 4EVIA 2Y75A 1ZPBA 3RM2H 2P3UB 4YFXF 2H9EH 1SANA 4JYVH 2HDCA 2QN5T 2TGDA 4RAGA 1XCVA 5IPAA 3CCUI 2OQRA 1C9PA 3K4CA 4LOYH 4XRFA 2Z94A 5ABWA 4DJAA 2EA3A 1MTWA 2LDUA 2V26A 2HPMA 5CVRA 1XG1A 6LPRA 1LPQA 1WJAA 2ZFRH 5E0HA 3H5RA 1FP1D 4BOHA 2RGVA 5BOXA 3SGAE 3GWZA 1SOZA 1X3UA 3CJNA 2A07F 3PIOF 4WH6A 2MGQA 1O2KA 1T8MA 1LUJB 1IQFA 2QY0B 1D3TB 1GI2A 4X6MA 2ESNA 1J7KA 4GUXA 2EK5A 2KT0A 2FESH 4LG0A 1DLEA 1UJ1A 1MZBA 1CVWH 3MNBA 5DDGA 1MBQA 2ELJA 2LF8A 1TOMH 1YKTA 3M36A 2KCYA 3OV8A 1SAUA 1FTZA 5BPEA 3I58A 1JHHA 1QIXB 3KIDU 1VJ9U 1FMVA 1G3SA 2FYQA 1A2CH 2EV6A 4X8SH 4J01A 1DICA 3LGYA 2ZFUA 2HNTF 1Y1WJ 1MBFA 4YELA 1OISA 1QB1A 3OL3A 1QVUA 2BDCA 2J38A 1IF1A 4YIRX 1GPZA 4A5TS 4XORA 1P05A 1SGCA 3R0FA 3I54A 3FBNB 1W7PB 2WV5A 4D7GA 3WTYC 3D65E 1A46H 4Z1MD 2ZC9H 2IS4A 1JWTA 3EA7A 1D1CA 2BV6A 2OXSA 2EQRA 4AG1A 4N4NB 2TRMA 3TIUA 3S9BA 3U8TH 2CF9H 2ANKH 2GOXB 1YG2A 1BQYA 3FX3A 2M0MA 2AHME 1SLWB 5DP7A 1FX0B 1MW7A 2O8UA 5LPFA 1O3RA 4E70A 3ECHA 2R9PA 3GY6A 3GICB 3RZOJ 2I10A 5IP6A 3G1MA 1WZ2A 4MNUA 4WMEA 1A0HB 2YUSA 1W36D 3SJKA 4MHGA 1IZ1A 2DT7B 2K0QA 1T38A 3TBIA 4NIWA 1V2RT 1O2ZA 5L3DA 1WSUA 1FIAA 1W0JD 3ASNH 4I8GA 4C9YA 2RVCA 4NQWB 3LMMA 3AKZA 1C2LA 4OINF 1GBTA 4Q4ZF 1E35B 4CCJA 1ETKA 4H6TA 3MAJA 5JHFA 1ZGIA 3SV6A 4KICA 4J1YA 3GFLA 3ZVAA 1HXDA 2E1MB 4IHWA 3BTLA 2LBFB 1MKMA 2PMZA 3FK6A 1IQLA 3LIWA 4HTCH 1EV7A 2N8GA 2LOOA 4Q5SF 1ON1A 3OYCA 3UREA 2J4IA 5H2FC 3QPTA 4XRMA 5IYDJ 4D9JA 3MFJA 2COBA 4NIYA 3ESTA 1P06A 2V7QD 4AGJA 1FIWA 3JTHA 3GY3A 3KNXA 1SFEA 2AGGX 1AKHA 1MBKA 4A0ZA 4KT6A 5L3GA 2W1OA 3F9GA 1P2MA 4ZROA 3MQ0A 1Z8IB 2PW8H 2CSOA 4K3JA 1PPFE 3K2AA 3S9CA 1CSOE 1KQ8A 1W0TA 4M3GA 5KECA 1NRNH 5IYTA 3L2CA 3E3TA 1GDNA 2EIMH 3ONQA 1A6QA 3BG5A 2K1QA 1O3NA 5GTIC 1MZDA 1T0FA 1ZGAA 3M3TA 5ICCA 3OSYA 1KQ9A 3WU1B 3GDVA 5BS6A 2CHAB 1H8ED 1P02A 3OS2A 2CU7A 4RB3C 3AAVA 3PMAB 4CHAB 1VQLI 3TITA 5DP4A 5C20A 1W4MA 4QTRA 1VCWA 1R4NB 3SNEA 2BEOA 1B0FA 2TGAA 1HAOH 4AGKA 4LK4A 3K4MA 3EE0B 3NWUA 2BZAA 1VQ8I 3UNSA 1USTA 3D23A 3IC7A 1MD8A 4BDZA 2GD4B 4ZYDA 1GBCA 2PSXA 3ERMA 1C2EA 1O2SA 2O9QA 3NRVA 3ATIA 1F43A 2W26A 4G7OF 2R5ZB 2Y81A 4AVPA 1F5LA 1QPIA 4LLGF 1SPJA 2WAQN 1MZAA 3TGJE 3UB0A 1F5RA 3QPLA 1BMMH 5M5XJ 4IC6A 2J97A 4GPGA 1MBEA 4XBCA 5TRDA 3P6ZB 3L33A 1FBQA 2AIQA 3I4NJ 2LP6A 2LY2A 4FVBA 2E60A 3KX2A 1FIPA 1J8AA 2FOFA 3K2ZA 1EZQA 4BKXA 4R1HA 4UFFH 2W57A 2AQFA 2G0EA 3ROUA 3Q5FA 1TGBA 1FOWA 4RN6A 4ASNA 4IW4E 1O31A 3KQ5A 2LK2A 2F4OB 4KN7X 1GBJA 4I09A 2VH6A 5LD2C 1A04A 2CUEA 1Z8GA 1B8IB 3AVZA 3DSGA 1H4WA 1C2KA 2B9LA 1ETOA 4AOQA 3VFEA 2A0QB 3E0NB 2UZKA 1K83J 1HV7A 2AXTC 1UMAH 1OYQA 2B7EA 1G59A 2A69F 4K8YA 3SZPA 4D5CA 3O3KA 1W36C 4ZCNA 2ZTZA 3GF2A 3WTZA 3EGKH 2X6WA 2QSFX 5I46H 3HOZJ 2F5VA 2XDVA 2HPPH 3LKWA 3K70D 3RTRA 1BRCE 4XKBA 4X6AJ 3F21A 1O3DA 2VC0A 3CCMI 2NU1E 2LC2A 1SVOA 4GCHF 4BAQB 2A7CA 4BQOA 5JB9S 3QWLA 2HOSA 1F0RA 2WB1N 4HX8A 3CS7A 2OU2A 1KTSB 2CGAA 4E7RG 1VTNC 2VU8E 1E3HA 1I5ZA 2I6QA 3I29A 3ULQB 1QBOA 2KIUA 1QRZA 1DWDH 5B3SH 2F6CA 2DMUA 3FO8D 1DPRA 1DGWY 3E6BA 1P2JA 3BR6A 3BTME 2FX0A 4XRSA 4I8HA 2ZQ2A 1PVEA 3E5XA 2NNYA 3BTTE 1O3GA 3GYLB 2VBWA 4OMZA 1EAWA 3S14J 2QM3A 2XBVA 1DU0A 2VKEA 2QUFA 5CVJA 4PCQA 2O3FA 4Q7YA 2LKSA 1KY9A 3FXQA 1Z0XA 3MNCA 3QU3A 3RXBA 1U6QA 4M6YA 1W0UA 3P8GA 1OWIA 1ZZZA 1VQ9I 1RUOA 2XHKA 4WMFA 2GV6A 4QWQA 3ZGKA 2LFBA 3K2UA 5FX6A 2GLOA 2W7SA 2LNBA 2E19A 2JVHA 4QPOA 3FXMA 2DA1A 1IGNA 1EOJA 2XOKD 5D4SA 1ETXA 1QL9A 2M5WA 4BJ5C 2DODA 2XRLA 1XTAA 1NC6A 1QQUA 4ACBA 5FD5A 1NPMA 4JX5A 3F8BA 3ZVFA 3KEEA 2ZJRF 2J98A 1M1EB 2XWBI 1S6FA 2BY0A 2X6OA 1CT0E 4JCNA 3H3VK 2L5QA 2DA2A 3NEUA 1QA7A 3BTGE 3STIA 3MI4A 2RA0A 3ZCOA 1C1MA 3U98H 1AD8H 2Z33A 4LK0F 4K69A 3STJA 1YE9A 1Z6RA 2M8EA 4XLPF 3OR1C 2X51A 1IQNA 1GJ6A 1Q1VA 2MLKA 3OR2C 3ZZ8A 4IVNA 3DTKA 3GCHC 1QA6A 3RPQA 2XSDC 3TOBA 3TNTA 1SBWA 1A6IA 1J17T 1LPGB 4R8HA 2BMGB 3BP8A 5DCFA 1IQEA 1OP2A 1ITYA 4II3A 1EFRD 1A5IA 1G2LA 4XKCA 1HIAA 3FWEA 3BLYA 2DA3A 4Y33A 2BD4A 1O7LA 2ZXWH 3ZVEA 3BR0A 2NAZA 1H9HE 5A8XA 3BTQE 1FLIA 3F9KA 2Z3DA 3MCZA 3V42A 1TTYA 3ZYEA 4OAYA 5GAEJ 4X8VH 3DA9B 1SQRA 1G9IE 3F0OA 1O2QA 3H09A 1AWFH 3MU0A 1VQMI 1N8OB 4A93J 5ETXA 2XAUA 2WWYA 3BG9A 2VJ5A 5HLGA 1ZHMA 1YF4A 3EQ0H 1IXRC 1MMAA 4B47A 5H20A 4YESB 4AIKA 3MZYA 4CCOA 2BDIA 2J5OA 1QU3A 3KEYA 1N8OC 1D5YA 3BTHE 2P7CB 1MKWK 5D8KB 1MBJA 3FVFB 1MU8B 5GP9A 4KTUA 3D5LA 3ZR8X 5DP5A 2KMUA 3MU1A 2X4HA 2SGAA 3TW7A 4FT8A 4O6JA 1TBRH 3RXAA 4JOMA 3VB4A 2VT2A 1AHTH 3GTMJ 5FXLA 5LHGA 2P8OB 1IOEA 2BVXH 3PTNA 4Y52J 2SNVA 3WTSC 2L6OA 4F48B 1AU8A 4CO8A 2YR2A 1C5ZB 3HPTB 1ESAA 5CQEA 4IX7A 5DN6D 1A5JA 2C8WB 1SHHB 5E0JA 3OYDA 1K21H 1UTLM 5F08A 1TPPA 1H9LB 1MTNB 7GCHF 3E6MA 3UR6A 1ELGA 3HPHA 3SN8A 2R4GA 3SORA 2EFQA 4XLCA 2O8KA 2L54A 1BMFD 4Q63A 4HSRA 3HOTA 3LC3A 4ON0A 1UTMA 4B74A 3HB9A 2OTJI 2VJ1A 2AQEA 3U9GA 5KK1A 2QF4A 4YLQH 2SFAA 4QPQA 3L2RA 5C0UA 1UAAA 2AHQA 3FHNA 3KZZA 2A05A 1JTYA 3LSRA 3RXKA 3W2WA 1VGCC 3CJQB 1AN1E 5EQRA 2WAEA 4HEA2 1TONA 2CJIA 2WHXA 1BHXF 7GCHG 5KAFC 4XM3A 4I7HA 4X1RU 2W5EA 5JBAS 1SR5C 2Z3YA 1V5FA 2KHMA 4Q7ZA 3I3LA 1MDMB 9ESTA 4LZ4B 5G4BA 1GVDA 1LPZB 1PYTD 3DPLC 4ETSA 3CC7I 2YSRA 3HOYJ 4I32A 1WI3A 4CRAA 3F9FA 1JIRA 1W2KH 1QZ8A 1S84A 5AONA 1O5FH 2DMPA 5K7RA 4AUXA 1IQMA 2ZC2A 1HJAB 4BL0B 5CLSA 2IVMA 4LIVA 2OLGA 4A0XA 4NFEA 2WPIS 5JR3A 1R7JA 2HNHA 3HXLA 2VJJA 1EATA 3M1EA 1Y3VA 4LZ1H 9LPRA 3GLLA 4UV8A 4BXXJ 5HOOA 1GBBA 5E3LA 1XVOA 3QZRA 1DQUA 3IITA 1AB9C 4DG4A 2Y31A 5L2ZH 1K78A 4KELA 2MH9A 5EOKA 3S2DJ 2BM2A 4OS4A 2WYGA 5HM2A 3RXHA 1DSTA 1IN4A 1X1BA 4K8BA 2L02A 2IGOA 3ATMA 5EXLA 5EEHA 1DS2E 1ERDA 2Z9GA 3EYDA 1OPCA 3V8KA 1RNLA 3SZNA 4I02A 3M5NA 1SL3A 3WTWC 4ABAA 3KE2A 3PV4A 5F8TA 4B76A 4AFSA 1B7XB 3DV8A 5CMXH 1NT1A 1L2EA 1W1WE 2W6ID 3UUZA 3V8JA 2BW3B 1YOVB 2DK8A 2BYAX 1BM9A 1S85A 4KUMA 2OV7A 3CC2I 1QPMA 1HQCA 4IRHA 3EDPA 5C2ZA 3MD2A 4ZKRU 4OMYA 3G1LA 4EJOA 5DUIA 1GHYH 4OS6A 3RXPA 4RMNA 1D3DB 3WODF 2KX4A 4IF4A 1WKMA 1BMAA 1AWCA 1AHDP 1GBLA 4LFUA 4A3DJ 2KPMA 3J7AO 2BTCE 1SQAA 2Y5FA 2PP6A 3F2GA 1YBWA 3OEHD 1O5DH 4FE7A 4IEJA 1P0SH 1S7OA 3TH4H 1GBMA 4L9TA 3S1QJ 3FM3A 1X4OA 3P9KA 5L3CA 4CCLA 2JVGA 2RQQA 4CZZA 1O2MA 4HGCA 2LREA 1IHTH 1JJ8C 3A86A 5J4YA 2OC0A 3LSTA 1IG7A 1YITI 1K28D 2Y9ZA 1Q31A 3VB2A 2M7BA 5CPRB 2ODYB 5DEQA 2ILNA 1SQOA 1BBRH 1BIOA 1TB6H 2P7VB 3BY6A 3ZV8A 4KIFA 2OJED 1ZMLA 1GV2A 2XCFA 1R5HA 3EYYA 2ODQA 2UUJB 1SMTA 5HNHA 4E7KA 1EH6A 4B2CA 3GYHX 3VWBA 4XLEA 2J98B 4UY8I 3O8GA 2QKMB 1C1WH 1PJRA 2AFQB 3MO9A 2BY9X 1GVKB 1D8KA 1H9IE 1L0ZA 5JBBS 1X2MA 1ENHA 1RR7A 3BEUA 2DPUA 5K5QA 1ARBA 4ABEA 2RA3A 1DGRM 4BTIB 2Z9KA 3SGQE 3M7GA 5FBIA 4BQNA 1YGCH 2ZNZA 1ZGJA 3HM5A 1IV6A 2ZDMA 4ZMAH 1S29A 3AFHA 3JREA 4HG2A 2ZCLP 2QA4I 4U7BA 3BG6A 2X0LA 2TPIZ 3K4JA 3DF8A 2K9MA 2RN7A 4RGUA 3P70B 5E8EH 3UR9A 2PTCE 1HJ8A 5J1YA 2ZPSA 2Q0OA 4NZLA 1W11U 1SFUA 4I76A 4RAYA 3IV5A 1JT6A 2FOGA 4YFNF 3T2NA 4AB9A 2R0LA 3HRTA 1Y3WA 5IP9J 4GCHG 1FN6A 4CRBA 5DSFA 2NU2E 2XAFA 2W7UA 3ZZ3A 2ZTXA 3GTKJ 1E38B 5LEKA 5HS7A 4CHAC 3M35A 2OD5A 2V35A 3LGVA 2BDGA 3UNRA 1ZREA 3K6GA 3K6ZA 1PQAA 2PFEA 1PDNC 2D8WA 1BC8C 4LGWA 3H5AA 2HLCA 2ZNKH 3GUDA 2ECCA 3TW6A 1WQSA 4BTUB 4PUSA 3GY5A 3BR2A 3O6BB 5FCKA 3CCSI 4NQWA 1MABB 3QDZB 1X1DA 1E37B 2HVXA 2QC2A 4BXSA 4KGAA 1NFXA 3OSGA 1QGPA 3N4MA 1T2KA 4M72A 4H6SB 2A4QA 1ZN2A 3SU5A 1XDSA 2KCAA 1NHAA 2VOPA 7KMEH 3Q3YA 2ME0A 1C1QA 4C3JJ 2FOHA 3DKYA 1BBYA 2WPMS 1KU3A 2OA4A 4PJNA 1XMKA 1X7AC 1JGSA 3RC6A 1HA8A 2FDAA 4X6NA 2FD5A 3MO3A 1UCYK 1ZTKA 1X58A 4FUBA 2V3HH 2H94A 4RKOB 2WPDD 2NOGA 3TO9A 3OYHA 1DY9A 3M9AA 3HATH 2GV7A 3P9IA 1TQPA 1TWFJ 1BMNH 1CT2E 5IOYA 4E7IA 5M5WJ 1ZYOA 3S1MJ 4GSOA 1OR7C 4DGJA 2X85A 4E06H 3OOPA 2C6YA 2E2JJ 4EEFG 5KAIC 2CN0H 1R71A 4G94A 3RKQA 2W3IA 1QBJA 3NWSA 2XGEA 3H5NA 1YPHE 2M4KA 2WINI 3ZMVA 1D6WA 2CF8H 3ATLA 3LSMA 3BZ6A 1UHBA 2VWMA 5EXNA 4Q48A 1TMBH 3MH6A 4Q80A 2XXLA 2MYSA 3UAIC 4GYIA 3A0HC 4WVPE 3JRIA 5T1VA 1NK2P 4LJZF 4OIRF 1UTNA 5A0CA 2HYGD 3NWTA 1S0RA 1C1VH 3IWZA 2CQXA 4EM1A 1HW5A 1VFCA 1KXFA 4IL6C 1IC8A 1IQKA 3RXOA 1R6RA 5KCMA 1EJMA 4ABJA 4THNH 4RSPA 2RDEA 3ZZBA 2HGTH 2K7LA 3VEQB 4LLLA 3KF2A 2XB0X 1W5CC 2HU9A 1NFUA 5T6FA 2FBKA 3A01A 2VGCC 3RXEA 1HDDC 3PROA 4BDYA 5HGGA 2PJPA 1Q2WA 2NVQJ 3CP2A 1NFWA 3SZTA 4F52A 5GIBA 3OYBA 2ZP0H 1ZRDA 2LY1A 1UK2A 1PFXC 4IO9F 1AFEH 1P4AA 2BVMA 3T8RA 3U9AH 4XL9A 3GTGJ 1P57B 2MC3A 4LLNA 1WQVH 1T6SA 3S32A 2Y5GA 4AX9H 5EIYA 3DHKH 2BHYA 5LRSA 3SJMA 2ZO3H 2BD9A 1A5HA 5DV5A 5FPSA 4GGGA 1B1BA 3BG8A 1ORKA 2QGUA 2OBOA 3A0BC 1TPAE 4E7LA 2JSCA 1X3WB 2QQAA 2R7XA 1HBTH 1MMJN 1BI3A 3A8DA 1R5GA 3H36A 1T33A 4XONA 1OSSA 1DXPA 1BRUP 3CZ6A 1SC7A 3WHBA 2BYVE 1KXDA 3A87A 2F3CE 3ABLH 1BA8B 2A4OA 1O2IA 3I59B 3CMEI 4XLNF 1LMWB 5IP7J 5EJZA 3QGJA 2XNIA 3HKJB 4A6DA 1P2FA 2CV0A 4HFPB 5EZGA 3LA3A 1UHWA 4AD9A 3ZZ6A 1V2QT 2H8WA 4WX9A 1Z6JH 4HF2A 3MU4A 3WGHA 3TP0A 2CK3D 1Z3YA 1Y5UT 2WPJS 2QF3A 3SBKA 1UHSA 2PUXB 2PX9A 2QGRA 5TGTA 5DUKA 3MH5A 1NG6A 1HSTA 4A7IB 3F2FA 1K0HA 1NFYA 3LOXA 1T08B 1AWHB 1BR1A 1WI9A 1WJDA 3UNGC 1WH5A 4EJVA 1BTHH 2CUFA 5HDGA 4QLCU 1O34A 2L9RA 3CCRI 3RM0H 2BQWB 1SG8B 3DU5A 2MG4A 2EZLA 2UWPA 3CLQA 4QIWN 1K9OE 4X2XA 3SOSA 2K9QA 4NWLA 3LAPA 1SGDE 3H3UA 1HBXG 2RCEA 4HZHA 2JJ2D 4DIIH 2VB0A 4ZAEA 3SZGA 1YLDA 3KGPA 2IP2A 4G8XA 1PYTC 2FNPA 1XM1A 4B09A 4YEJA 3F9EA 3D1NI 1HYLA 3A2KA 3KYCB 1MMDA 1O0DH 5LGTA 1UJ8A 2XV4S 3TO6A 1GI6A 5F0FA 4JZDH 3SJOA 1O5EH 1AFQB 3BN9A 6CHAC 4MO7A 1T8IA 4O97A 5DP3A 4YRVA 1LCYA 4RGRA 3OU0A 2ULLA 1TAWA 3P17H 1LFBA 1XDUA 5HNFA 4FUGA 3LGIA 3VYRB 2BLQA 5DJ7A 2W82A 1I3AA 1AO5A 2ZU1A 2YOLA 2ZSHB 5J1RA 1UG0A 1SAXA 2ZQ1A 2CYYA 2VIXA 2WZQA 3EUKL 1C5PA 2G5NA 2GOMA 3KN2A 1WFXA 1MTSA 3LGTA 1C4U2 5JFRA 3AL0C 3V3MA 1OWDA 2ZIQH 1O3CA 4PGGA 1GCTC 3Q3XA 4A3IJ 3MU5A 3AAUA 5C5OA 2HI3A 2VBXA 4MTDA 1IN6A 1S3JA 1EKBB 2PWXA 1QBVH 3KYLA 1APLC 4XSXF 1V5GA 4U2WA 4YLUA 1S82A 2K86A 2AEIH 1ZG1A 1UTKA 1ETSH 3TLOA 1WU1A 3SYJA 4JYUH 1OFCX 3DT0H 1C5VA 3D62A 4M73A 1TMTH 2QXJA 4UVBA 3V12A 3UQVA 3RXDA 3LA7A 4CRDA 3V8LA 1VITH 3S9AA 3T5FH 2UV1A 4KYWA 1LFUP 3OY5U 3Q0VA 4BY1J 1ZGVA 1PYVA 1BJZA 2ZJPF 1NZQH 4DT4A 4NZQA 4D76A 2EC9H 4ZH8A 5JDUB 1MQ5A 2KR7A 1TRMA 2ZXHA 3U1DA 3JTGA 1YRNB 2R3YA 1SLXB 4RB0A 1C5RA 1EOLA 5GPCA 1OS8A 1R5ID 1N6XA 1EAXA 4YZUA 2XGDA 1XD7A 3JAMK 3R60A 1TC3C 1O5GH 1MCVA 4A92A 3D5SC 4DQ2A 1ELVA 3E16B 3JRAA 2CV1A 3RLYH 2IPQX 1QY6A 1A4WH 1EXFA 3ZZ7A 3S17J 1QZZA 1HC8A 2JQ7A 2AIPA 3GOVB 1W5TA 4G6TB 2X1EA 3FXOA 1P92A 1FAXA 4HDUA 2QZ8A 3HJEA 4DW2U 1F4KA 1CHGA 1O3LA 2OCVB 1EB1H 5FFXA 2D5VA 1O3MA 3BPXA 4KITB 8LPRA 4K60A 2GMTC 2TRTA 2R7WA 2ZHWH 2R7QA 2PMHA 5ILVA 3C27B 2WB1A 3H9QA 3ZZ5A 3BZCA 5EW2H 2KIQA 5FPTA 3BEIB 1V2TT 3ZRGA 2ZU2A 2TGTA 2PLYA 2OTVA 3E5QA 3KEOA 2XCNA 2HWLB 2ZGCA 3OAAD 3WY8A 1Y8RB 3N7OA 2STTA 3SV7A 2BD5A 3G01A 4Y8ZA 1UZCA 2PGQB 2WV1A 3I53A 3CCEI 3CCLI 1T8OA 1D3YA 3LGUA 3WHCA 4FVDA 4BU2A 2LF7A 3HOSA 1DFPA 3SUDA 4M3EA 2STWA 4XLHA 3FOAA 4BHBA 4U88A 4ABDA 1QNJA 1E3OC 4B73A 1CT4E 1OCTC 4AB8A 3PQJA 1P01A 3F8CA 1TMUH 3JCUC 2IA1A 4Y8YA 2AGIX 2GDDA 1FBUA 2CW8A 4BEHA 1CF7A 2QLZA 2GDEH 4P96A 1LE8B 1TRYA 1QL8A 4Y10E 3KFWX 1F5TA 3CCJI 4D9QA 3BTFE 3UR3C 4E6KG 2ZFSA 3IRRA 3CO6C 1ZG3A 1ANCA 1E1RD 2GVFA 2XPWA 3ZXSA 3RDIA 2VPLA 1BW5A 1N78A 3QPHA 2E1NA 4Y11E 3U21A 5LPEA 3RXSA 5LRRA 2I5UA 5E8GA 1E3PA 3KL6A 1IDZA 2Z1DA 1SVLA 5HODA 3SNDA 1T56A 3TH3H 2FMLA 1GI0A 1X1PA 5EQSA 4I7YH 1MMSA 3I0TA 2CRGA 2FMYA 1XGMA 3K4BA 2XF5A 2XC0A 2MSYA 4AC9A 1LHCH 4EMSA 2NU4E 3MKLA 2CO5A 3ZZ4A 4RAZA 3QQAA 1AVXA 1WWXA 2IS6A 2L9VA 3I59A 1OCCH 4X1NU 1GWAA 2NNNA 1MSEC 3UY9A 1SLUB 4AC0A 1ANEA 3PWBA 2FRHA 7LPRA 4UONA 4NC6A 1GI7B 1KLJH 3DFLA 5DG6A 1WBGB 5HS9A 2P5KA 2J5UA 2FLRH 1UFMA 5LGUA 3A80A 2EIJH 2LBFA 2XBWA 5FO5A 2F9OA 1LHFH 3ZZDA 2DQLA 2FM2A 1FDPA 3GFJA 1CE5A 3SQHE 4A6EA 3DU6A 2D2WA 3GVAA 2ZF0H 4GAWA 4WXCA 2GXBA 1ZLJA 3JRDA 4ZYGA 1PP8F 2ZI2H 2J9NA 2IXSA 4HNTA 3EYIA 3FN8A 5JI6A 3BROA 3LJOA 4G7ZF 3UIRA 1JXSA 1CA8B 3BJ6A 1M9UA 1P04A 2GXAA 3S2HJ 3BTJA 3QUMP 1GMDF 3JSOA 1C5MD 2EFOA 1NESE 1VKYA 4AFZA 2F4LA 1HCGA 5K5OA 1FBSA 1O4XA 1FC3A 1P3EA 1O2RA 1NU9A 5E3OA 3LSGA 5C1XA 2JA8J 3S3OA 3F2HA 4DY7B 2GJGA 1SD7A 2BY1A 2CUJA 4UUSA 2B9SA 1IO2A 3AG3H 3GDUA 5K7FA 3O8RA 1OMIA 2FMJA 3VPRA 1TP4A 2OCCH 3W6KB 5ESBA 1LE8A 3ASOH 1BT7A 4CH2B 4EGYA 1DUEA 4XOPA 3FKJA 3BZKA 1PUEE 1P2KA 2Y9YA 1TQ7B 4VGCC 2X9DA 5EJLA 1G3WA 4UB8C 2THFB 2Z16A 4AFUA 1JE8A 2JA7J 1UMQA 3SYTA 6GCHF 1MGTA 1WRJA 2GA1A 2IGNA 3L3TA 1ZRFA 4DVAU 4OS2A 3RMMH 2BZTA 4B4CA 2V6EA 3F3BA 1FMGA 1GJCB 1J0RA 4NIVA 1FQ3A 5DPAA 1T32A 2FSWA 1O3AA 1U2WA 5K1YA 2GKVE 1Q3XA 2X1CA 5CE1A 2FXRA 1ZTJA 1EB2A 3DUXH 5JLXA 3BG3A 3TMOA 2P5LC 4MPVA 4CH8B 2L9SA 2VVUA 1WCZA 4ZH4F 5D8LB 4K2EA 1DU6A 3FFGA 3A8AA 2FJ1A 2VL8A 2FOKA 1Y39A 1CGIE 1EAUA 3CO7C 4KT5C 1O7FA 2W6JD 3RJPA 3SJIA 1RRKA 4RB1A 1HAHH 5J3LA 4LB6B 2ZFTA 1NH3A 4L9VA 2QQ8A 3K1MA 2FU4A 3RPUD 1I1GA 3BTWE 3GFMA 2Y5HA 2HZTA 1MNDA 2FS8A 3GCOA 1JXPA 3KYFA 3F6UH 4JQFA 1AQ7A 2LRDA 2AERH 1WUNH 4B1TA 4HX4A 1HB0B 1B5GH 1MUEB 4YOGA 1Z8RA 3V7SA 3VB3A 3QYEA 2JKHA 2FWWA 1TLDA 3JRBA 1SFKA 2HQ5A 3F1SB 1BJUA 2VIVA 3FZZA 4MEXF 1FY4A 1LVBA 1TNHA 2ZCKP 4HX7A 2FUG2 2ZGJA 2DA7A 5GPAA 1U5TC 1P7JA 3AG1H 3FP7E 4IMZA 1U8RA 1DANH 1S8NA 4XBFA 3E90B 2STBE 1AE8H 3DTIA 3BV9B 1BI2A 2OPTA 5E2OA 3F22A 1ZARA 1THSH 5F64A 1OWEA 1QBNA 4ZTJA 1RTFB 3S15J 1XXFA 1B4AA 2ZCHP 4NFFA 1TW3A 1LHGH 3ABTA 4ZKSU 1USSA 1QRXA 1C9TA 1L4DA 2OUMA 3FXUA 3LQQA 1B72A 1GDUA 2NXNB 2AH4X 1C5SA 1L4ZA 1THRH 3MZ8A 3S3MA 2B0LA 3LSJA 3B9FH 4A3MJ 4Y0ZE 3HHGA 2Y7ZA 1O2GH 1J59A 2GZ9A 1TBZH 2C8XB 2OBPA 1CA0B 3RXRA 8KME2 4A0YA 4Z6YA 3SI4H 2D1VA 5LGOA 2J34A 4XKWA 3VYUB 1QZYA 4D1QA 2WC2A 3OYIA 3BCAA 1YPLH 1O32A 1UVSH 1HKSA 3MN2A 2VBCA 2NS0A 5T3HA 1FPHH 4HI3A 3CDIA 1BN5A 1XMAA 3SV8A 1BTZA 1UVPA 3V0XA 4BXUA 4B48A 4SGBE 1JTXA 2HXOA 1NROH 3M8JA 1C5XB 5IDKA 2MBFA 3BOQA 1SGEE 2QKLB 2OD3B 4PZJA 3PFIA 4FUJA 1D4PB 5E17F 3J81K 1YYY1 2ELKA 1HGTH 1LJ9A 3UNQA 2KRFA 4IHXA 1BC7C 1R36A 2G51A 1GXPA 2WY8Q 2GCHF 5EEAA 2ZHEH 5B6OA 3OIOA 1Z05A 1O2VA 1SB1H 3CENA 5IT3A 1C5YB 2IA2A 3R0AA 2DFHA 4D5FA 2XAGA 1ESBA 5LPRA 1YO5C 5HVQC 1KU9A 1MTVA 1O2YA 1XGSA 1O3IA 4CBOA 2GBYA 2G52A 5GPIB 2ESHA 1T0FC 2L2OA 2M4GA 4FISA 2G81E 2FBHA 2DMNA 1OWHA 2C90B 3SEZA 3WU2C 2LH9A 1HUTH 1OQYA 3FF5A 3TK9A 1HFDA 1O2LA 1PPZA 1PQ7A 3SU2A 1PP7U 2A6HF 4ENNA 3WTTC 4QSHA 5FRNA 1BBRK 1SSXA 2YX4A 1BI1A 1O30A 3MHWU 4TYDA 2CQQA 3BC8A 2XSJC 1B59A 1YCPK 4O03A 2VIWA 4ZHMU 2NVUB 2L7FP 1ZAOA 3KP3A 4ACAA 4B2BA 2MH2A 3I64A 3RPUA 1QNTA 2QBYB 2V79A 2VVVA 3A8BA 3TVJB 2CJJA 4JZEH 3N05A 1EA3A 5F27A 1PPHE 1OCRH 4UHTA 3C3WA 1JBUH 3FP6E 2PV9B 3HK6B 2O8WA 4FUFA 1ONVA 1WTHD 2GT7A 2LYCA 1WJBA 3HTUA 1YJWI 1FMWA 2O9LA 3K6YA 2E2HJ 3QK1A 2EV5A 1EH8A 2E1MC 1BMLA 3ODDA 3KQDA 1RIWB 1HIAB 2GWRA 1Z7LA 1ZG5A 1NG7A 3G2BA 5BQTA 1C5UA 2FI3E 2P3TB 1VITG 3TJUA 5GNDA 1A31A 3A88A 3KQBA 1ZQ3P 3T27A 3N97A 2K5CA 4ISHH 4KN4X 1IHSH 3J7ZI 2SGFE 4ISOA 2FP7B 4ABBA 1FZPB 4FX4A 3NARA 4GHQA 3JRHA 3MU8A 5C4XJ 1GJ4H 4P9FA 4IN1A 2MC4A 4Y17A 4X2YA 4ZJZA 1VF9A 1Z3XA 1U8BA 3OIPA 2FI4E 3W2AA 1OJLA 4BAYA 2VIPA 5A2QZ 1TT5B 1ZJDA 1G6NA 3ISPA 2PMUA 1H89C 4Y0YE 3HGNA 1F0UA 2BLVA 3SXYA 1TT0A 4YO9A 3G71I 1BL0A 1D6RA 3A81A 3OYKA 1ZR4A 2LELA 1O3TA 1ABJH 3DTEA 1P2NA 3HBLA 4CSWA 3DWLE 1YPMH 2H6MA 3W95A 4BAHB 1VQOI 4YOIA 3MEXA 2PKAA 1W0KD 3PMHB 1FY8E 2A61A 1IUYA 2AGEX 3ZQ7A 2Q8KA 2E1OA 2ISZA 1A35A 4L9NA 1PJPA 1YY3A 5DM7F 3COAC 1S6LA 3EA8A 1ZK8A 6PAXA 4N0BA 4FETA 3LL7A 3UKGA 3D5RC 1GV5A 3OWTA 1A1RA 1FT9A 2ZHDA 1NU7B 1W8BH 1D5VA 3S93A 3A7XA 1WJEA 1I3QJ 1LEAA 4I99C 4EGZA 2JH0D 2WPHS 1W7GH 2L4AA 1STZA 2KLOA 1MQ6A 4G12A 4P9UA 1ZTLA 4Y7BA 1R1VA 2HYFA 3BG4B 4IQJA 3HUGB 1GI1A 2E5NA 1C1SA 1PQ5A 2NU3E 3PMBB 2ZU5A 2ESTE 4CCMA 2ZKSA 4V19K 1BDAA 1O57A 3BR5A 1IRGA 3UWJH 2A5KA 2ZECA 4F91B 1A7SA 3O2PE 2R0QC 1Z67A 1AE5A 5HXFA 4ESFA 2VASA 2Q6FA 1LEBA 3C2BA 4MLFB 2M45A 2KZVA 2MD5A 2BDAA 4HA8A 3BTIA 2ZBKA 2ZHQH 1V2NT 2LVSA 1SOTA 4Y71A 4J00A 3E6PH 5HLHA 3OIQA 1GT0C 5J8FA 2J92A 4LXBH 1HNEE 1UCYH 1FNIA 5GCHF 1Z1DA 1Z91A 3KEQA 2O8LA 2GM4A 2X48A 1LVYA 2PJRB 2OUAA 1HDPA 2KQRA 1GDTA 1IXSB 3FMRA 3NRLA 3E0JB 1ZSKA 1DY8A 3HSEA 3GO5A 1G8XA 2QEXI 4NG9H 2YMSD 4H42U 4RS8A 1V2OT 2ZFFH 2M30A 3DPTA 1XVMA 4IJAA 2VUMJ 5D4RA 3PMJA 5C1UA 4PROA 1S9HA 1IQJA 2OQUA 3SW2B 1IQGA 2P0WA 5CVVA 3OS0A 1FOYA 3CUQA 3MZHA 4UDWH 1S0QA 1HOMA 3T8TA 2Q2EA 6CHAB 5EG0A 2Z99A 1QB6A 1J2XA 3RMLH 3GS9A 2XF6A 1RIWC 1QFKH 3SQNA 1KXEA 1MBGA 4RA2A 4X6OA 1T4VH 2DOEA 1SI5H 5FHTA 1ACIA 3CMYA 3V4GA 1F36A 2Y69H 4CR9A 1T8LA 2B63J 4UE7H 1GHAG 3A83A 1TNTA 1HXEH 1REPC 2BDBA 2DW4A 1DM4B 2F9BH 2R7OA 1HRTH 4CUGA 1S7AA 1YFHA 1ZPCA 4ABGA 2K9SA 5C3EJ 3S8PA 5L3FA 3AL0B 4LK1F 2K9NA 1BITA 1RTKA 4ZDPA 3R4KA 2O8MA 3K4KA 3IH4A 3K1PA 3MKWB 4OGYA 3BJOA 3G1OA 2EIKH 2XROA 4B6FA 4II2A 3SU3A 2X6YA 2QWWA 2BY5X 3HSFA 2ZDAH 4A1VA 1MAXA 2M9HA 4WMDA 3EDXB 1LDTT 2DOAA 3GTOJ 4K1SA 5AIPA 1IRXA 5EG0B 4XFQA 1UK4A 5DKMA 4ZKNU 3PO1B 2A1DB 1ZKGA 1P8VC 1TQ0B 4ASHA 3U8OH 1XCBA 2AS5F 1VNDA 2IS1A 4ZZLA 2DN0A 2KISA 1KTTB 4EATA 2EZKA 3I9V2 1BBRE 3L09A 3U1JB 1LKBA 3BF6H 2JZYA 1O3HA 3M7UA 1XUJA 2BX3A 3HGPA 2JUCA 2ZMEA 3RCOA 3GCHB 3TQNA 5EJ1A 3E7LA 3DBRB 1G4DA 2KL4A 3GFIA 5B5EC 2V6NA 5T6GA 1VZ0A 3FXJA 3M07A 2G4UA 4M71A 1FPCH 4HRIA 2NVYJ 2VODA 4CYCA 2H27A 3DLLF 1GL1A 2V9VA 3TU7H 2FEQH 3H0DA 4KIGA 2M5TA 1OKXA 1KONA 3MKZA 2RKHA 2BXUH 1V2ST 4AYBA 4BGDA 3PNYA 3C1KA 4ESBA 1K78B 5FLVA 3MQKC 3GY8A 4HNVA 4ZHLU 1TW2A 3OYAA 2GZ7A 2OC6A 1K1IA 3PNVA 1J15A 3OTPA 4MTEA 5DK1A 2XKOA 1FJSA 1T39A 4AORA 3RU4T 1MMGA 4IOCF 1LVAA 2CMPA 1VCQA 1TWGJ 1C1OA 1I50J 1BIAA 3A1YA 2YPRA 4Y15A 3K4NA 1OYYA 1HLVA 2QA9E 4WWYA 4WY3A 3BTKE 3SJ9A 3MMGA 2R3UA 3T28A 3CCQI 3RXMA 3W6JB 3VYTB 4AYYB 4E7HA 1SGPE 3F72A 3LSHA 2KJBA 2Q1ZB 2K4BA 4EV0A 3KCGH 1BJAA 2BW3A 5E18F 2LMDA 2A5WA 4L18B 3NPSA 3KP5A 2HALA 5H6QA 4BANB 2H9HA 5K5RA 2F91A 4KTCA 5FRMA 1HPGA 4L9JA 3VSKA 1GHZA 1DX5M 4IRIA 4BHCA 4B44A 3PM1A 3ECOA 1TRNA 4F93B 4W97A 1MD0A 1FSEA 5KEDA 3F0PA 5FB2A 3ZVGA 4HZFA 3QN7A 3RXUA 2J2UA 2GX4A 1C1TA 4B75A 5CKTA 1QQ4A 3RC5A 3RQIA 2IGKA 2QBYA 1Y8TA 2P59A 1IQHA 3ZQLA 4MQVA 3UOUA 2O8TA 2DJIA 3MTYA 3T29A 4DCDA 2BBYA 2XUBA 2OINA 5CHAC 3BG7A 1A0LA 1Z1IA 3W2VA 3RXQA 2L74A 1Z9CA 1MBMA 2I6SA 4E7SA 2DUCA 1MH0A 1U78A 2P8OC 3CUQC 3WWFA 1ZRCA 2K9LA 3KPHA 3E6CC 1TFXA 4C3HJ 1THPB 4HW0A 1BTUA 1RI7A 3P8OA 1TQIA 3T62A 3SUGA 2M0CA 1P3CA 1ID5H 2QV1A 1DP7P 4GCVA 1EJNA 4HF0A 4RGXA 4YIFA 5IT9K 4E7ZA 4A6LA 2LY9A 1GI3A 4PSWA 3P95A 4XMYA 1HAIH 4BQAA 3N7EA 1R9TJ 2LNCA 1ZRKA 3RMOH 1AUJA 4B6EA 5F0CA 1EKEA 1P9UA 2VIOA 1FONA 2AS9A 3FAOA 2HVSA 3HG9A 5E3NA 3FXLA 2SGPE 5GAGJ 3FKIJ 3PV5A 2VXZA 2YMSB 1DWBH 4DURA 3PLKA 5E0GA 4TPYA 2JH5D 3X2QH 1TBQH 2ZFQH 2C4FH 3SDBA 1TWXB 3GMEA 4KISA 1MJBA 2Y30A 1TIOA 3P9CA 5DTDA 3L2WA 2WBMA 4YXWD 4TT3D 1YPJH 2JPBA 4UUVA 1C2DA 3O8BA 4DYRA 1EUFA 3SEQA 3OEED 2PTNA 4CRCA 4XOTA 2XPVA 4TY7A 4M3BA 1JGGA 3MWIU 1OCPA 2DT6A 3PV2A 3DPUA 1S83A 2PHBA 2L01A 3U8RH 2VJIA 4FOUC 1OLTA 5CYVA 3FANA 2Z9OA 1B72B 4HOBA 2FLBH 4NHJA 1YJ9I 2PKSB 3Q9VA 1WQ2A 3BQYA 2P81A 1INCA 4I86A 2F48A 1YIJI 2BQ7B 2CHAC 3ZN1A 3RI4A 3KP4A 2KDZA 1ELTA 2F5FA 2VC1A 1TGCA 1BI0A 3IAM2 1HJ9A 3IAS2 5F0HA 2QXIA 4BNCA 1TABE 5LGNA 4BEHB 1CF7B 2P94A 2A7JA 5FBEA 1J14A 4PSXA 2BY2A 2XBYA 3TDZC 2UXXA 2R5YA 4G7HF 2ZHFH 2ADUA 4PJLA 1ELBA 2ALPA 1CHOG 4BXWA 3VFZA 1SFIA 4VGCB 1NS3A 3TH2H 2JPCA 2VVCA 4CRGA 1X1AA 3MH7A 2FOBA 5JPMH 1WCMJ 1Y0NA 4Y8XA 1YLFA 3GZ5A 1N25A 2HDWA 2GIVA 1YS7A 3QRFF 3EUHC 2PR3A 4RI0A 3J81Z 1QQIA 5AIQA 3AASA 5IYCJ 4D9RA 3GTPJ 4AN7A 2XB5A 3IUOA 1RC9A 3QODA 2HOAA 5CHBA 3PSIA 1NK3P 1QHHD 5F03A 4ABHA 1TBXA 2XASA 4IGDA 1E34B 3OYMA 5LFAA 4TWYA 3C18A 1QRYA 3IP4B 2JRMA 3E1SA 1SFQB 5HDNA 1Z7KA 1Z21A 3MWMA 5L2YH 1FXYA 1AU7A 2HOTA 5A2MH 2XNDD 1TZLA 4LITA 1WYKA 4ASUD 3H35A 3ELKA 2Z9IA 2FE3A 3RSNA 2ZDNA 4OIQF 1T95A 1V5EA 1T8NA 1GI8B 4OWRB 4KDPA 2GAUA 5PTPA 5GWZA 3K9TA 5HYOA 5LLQA 5CHAB 1ZRBA 2FOMB 5CJ9A 2ZGBH 2EEKA 5B1BH 2A6EF 1T31A 2ME6A 3M7QA 5J47A 1GGDB 3HHHA 5F53A 1CQQA 5F1JA 2HLDD 4B43A 2FPZA 3SGBE 5J4QA 2DYSH 3JW4A 3RDZA 3P8FA 3FP8E 1ZHRA 3IH3A 1SKYE 1FX7A 1GCDA 3SHAH 2F5CA 2J95A 3LU9B 1XN7A 1H8IH 4XN3A 5J4SA 3HZJA 2BD2A 1KA8A 1YHQI 3JRCA 2H6BA 1CA0C 4YM9A 1JI8A 1XMXA 1PUFA 3PUFA 4P02A 1GVZA 2LD5A 2PI0A 2RDLA 3FDYA 2DQRA 2R7SA 2SNWA 4D7NA 5F8XA 1C1UH 2JN6A 1Z6EA 2FX4A 5E1WA 2XIGA 2KKOA 4DZJA 1IAWA 1IAUA 2VT3A 4UUSB 2WSSD 2FQ4A 3F3XA 2IEKA 2Y0SN 3CUOA 5FJ8J 1SQTA 3V7RA 1AGJA 1ORFA 6ESTA 4JZIA 1W14U 4GO1A 2A2XH 1V2UT 3Q3KA 4GRIA 1JHFA 4DYQA 5K7ZA 2XAQA 3QP5A 1XXDA 3GX4X 1XX5A 3SUEA 4BBRJ 2BDHA 3KIOA 1DDNA 4O5VA 3E91A 4ENMA 2ZSIB 4XSZF 4G9YA 1FEXA 1DITH 1TX6A 5JVGF 2MABA 1WGXA 1TA2A 3AG2H 2LPRA 1ETQA 3ZIAD 3M5LA 3N99A 3VODA 2R5ZA 1MKXH 1O3EA 2ICWG 1LKXA 2ZJQF 4JYTA 3GZNB 5ICGA 4HLYA 2R3SA 3G3ZA 1K79A 4U01A 3F6VA 1O2HA 2PKAB 4WF2A 1LVKA 4XBBA 2FF4A 2KJCA 3K10A 3LFKA 5JB8S 1UVTH 3DP7A 1O39A 2QYIA 3VDXA 3RXCA 1TOCB 1G3BA 1IQIA 1Y3XA 4Y76A 1UVOA 3OMYA 4C2TA 4DJZB 1SLVB 3WE2A 2KAIA 2HKXA 2A32A 2RREA 1LDDA 2E1CA 2R7DA 5CVIA 3HRSA 4A5MA 4YG2F 4TPIZ 3I77A 3RXGA 5EODA 3NXPA 4A12A 3CC4I 1YPGH 1SFOJ 2BVSH 2RG3A 1GMCF 8GCHG 3WWBA 1DOJA 3WGGA 3CCVI 3L7WA 4A3CJ 2W3KA 3AK5A 1SGIB 2PEXA 2V3OH 1P9SA 4YTAA 1A5GH 4I33A 1OOKB 3OYEA 1BHXB 1IXCA 2Y0SA 4XICA 4FUEA 2EWNA 2UUZA 4Z6AH 1LDKB 4P1WA 1KYNA 3NUMA 1GHBG 3C2GA 4A3JJ 3ENSB 3CCYA 1BTPA 1DDJA 2DTZA 5FFZA 2KZGA 1MNEA 4MPXA 2R7FA 1YPHC 2FNAA 4F49A 1XX9A 2QVOA 4BACA 4OU0A 2Y6TA 1ZR0A 3L6PA 1HSJA 3I4MJ 1GBEA 1BTWA 5L6NH 2HPIA 3BTCA 3WE3A 3RZDJ 4DIQA 1ETWA 2QIQA 1TE0A 3HKZA 5C17A 2YS9A 1BTXA 2EH3A 3L2UA 1VJAU 3CTAA 4IN2A 2OZ6A 4XIDA 4RAFA 3DLAA 4PJMA 4UD9H 1DUAA 3IWFA 3TP3A 1OYIA 4UUTA 2ZDVH 4F4OC 1X1CA 1MH3A 2IBDA 2V6CA 5EEGA 3GW2A 2BD8A 1RGQA 2JRTA 3CUQB 4IXAA 1MCTA 4O3UA 4DBRA 5GTHC 1O38A 1TNGA 1RXPA 3VG8A 2AXLA 2DFEA 1AY6H 2DK5A 1SHYA 1RKTA 2LG4A 2P5VA 4YT7H 2R7UA 2NYXA 2RNGA 2TIOA 3I78A 3PB1E 5GXPA 1CGHA 3P7NA 3PWCA 2Z9JA 2QF5A 2WAFA 4RM2A 1MDMA 4ABIA 2DFIA 3CD6I 5ILUA 2ID6A 4WCGA 3M5MA 4Q2KA 1Q1HA 1C0WA 2FIRH 1EZSC 5GADJ 3OYGA 1AOYA 2F43B 2C8ZB 1R58A 1ZHPA 1GMHF 4C2MJ 2R93J 1G3CA 2M3AA 3HEFA 2VN2A 3ZQQA 1AZ8A 4HG6A 3REOA 4RB2C 5L3EA 1K61A 4EM2A 5IT9Z 1DPUA 5JHUA 2BY8X 4C2UA 1F5KU 1U9OA 3IH2A 1V54H 1N6YA 1UVUH 5LEJA 3SHFA 1SGQE 4CHUA 3G6EI 2ANWA 3QPSA 3MKYB 4LB5A 5A8ZA 3RYPA 1EX3A 2VH0A 3ELAH 5TISC 3ZZ9A 5C0TA 1LPKB 2JUGA 3DEWA 3GYMA 3KHVA 3FZDA 1IN5A 1X3ZB 1I6XA 2NVXJ 1E0EA 1V2VT 5C3NA 4PGHA 1RETA 1H9TA 3L9FA 1LQEA 2VWOA 2VWNA 1GVLA 1QHRB 1HF0A 2DDAA 5EJCA 3A03A 1ETYA 2ANYA 3ABUA 2XC5A 1YX5A 3GCTG 1HKQA 1ETVA 4DGWB 4BAOB 3P92A 1U3EM 4K2YA 1YM0A 3PSFA 4MEYF 3QTOH 4Y13A 2H09A 3MYWA 3BIVH 3J7YJ 1OYTH 5EG4A 2G9WA 1D0XA 1KDQA 1EQ9A 3SI3H 2W85A 1QB9A 2EI7A 3S7HB 3QLPH 3GLXA 3SU1A 2L7KA 3O8HA 1MJ9A 3R61A 3QU6A 3Q0WA 1JRTA 4FUHA 1C1PA 3ATWA 1K1PA 3B02A 1V2LT 5C4JJ 3ZV9A 5FLXK 4XN0A 3K65B 3URCA 4BAMB 5BPIA 3RQ4A 5LH8A 2STAE 1EZXC 2W4SA 2M2EA 2WY7Q 2L3DA 1U6GA 3EUAA 2QCOA 1O5AB 1W7PD 3GCTF 3S69A 4X1EA 3HOXJ 4BJ6C 1TNSA 3ZN0A 4MNXA 3CMAI 1C2IA 1MMNA 3NKKA 3KYDB 3JAMZ 1FOKA 3CP7A 2DE8A 3SU4A 1ZOMA 2ZTYA 3OYJA 1E36B 4XRSG 2C3SA 3BCBA 3QGNB 3M5OA 1VR1H 1OP8A 2E34A 2P6SA 3DKWA 3D0SA 3WG9A 2EFNA 4HLXA 1JKPC 1LB2A 3KCCA 3LT3A 5FROA 1O5BB 1OWJA 2PSYA 4NWKA 3QTVH 1ZSJA 3TGNA 1P2IA 2XTTB 3F9HA 5EDNA 4K5ZA 4E4HA 3SDGA 1NRPH 3EAJA 1SGYE 1GJ7B 5HLIA 4Z2YA 4BJTA 2EILH 2UXNA 1XGNA 2ZA5A 2G55A 3BEFB 3UTUH 1U5TB 2VONA 5FL7D 2RC4A 3EETA 3V7CA 4NNJA 3E1XB 3HRMA 5JLWA 4FUCA 2ID3A 2J94A 3MOCA 2BHGA 1GMHG 4WXHA 2R5YB 4O9VA 2AO9A 3E97A 2EPFA 1HAVA 1W10U 2IA0A 2FA5A 1A36A 2DPDA 4XR6A 5KGOA 1AKSB 3H9GA 4M9ZA 3J80K 4NA7A 2GA2A 2VKHA 1H88C 3R0JA 1MTNC 1WJ5A 5FAHA 1V2PT 2EB7A 1KDQB 1N1LA 1K6YA 4AVZA 3TNSA 5FKNA 2PG4A 4UXNA 2JJ1D 3R6SA 1DT2A 1P2OA 2YMSC 2DI3A 1MU6B 3PO1C 4I8LA 4FHTA 1GJ8B 5L30H 3OYNA 4M6XA 5DD8A 1TNLA 5ICFA 2E5ZA 1Y0UA 1G2HA 2CG4A 1EPTA 3Q0UA 2H8RA 4KTSA 3B8JA 1EP5A 4L5JA 4JMYA 3TL4X 3U1IB 2GXGA 5EGOA 4G6DA 1SGNE 4U0WA 4MNVA 2AYWA 2ZCWA 2P93A 1ZH5A 3WW7A 2HRVA 3MNSA 4GYGA 2PQ8A 3FXKA 1C5WB 4MFEA 2E35A 3HTSB 5FGMA 1O2TA 1VQNI 5DO4H 1TA6A 1AI8H 1GJBB 1QVTA 3RKXA 3GCMA 4KFCA 3K70C 1R1UA 2O03A 3E5UA 3HGGA 1HCRA 4Y7AA 1G36A 2HTSA 3V7TA 3UFAA 3QYBA 2EFPA 2JMWA 2LKXA 3SFZA 4DZPA 1FZZA 1GHBF 4F92B 1KXAA 2XRNA 3TGKE 3S1RJ 4M6VA 1RS0A 4O3TA 4RDUA 1GG6C 2SGDE 4AM3A 1AA7A 3U2RA 3ESWB 1Y5BT 4I98B 4NDLA 3F68H 2QE7D 3K69A 4I8KA 2JWTA 3KYGA 2OF7A 4FASD 3FKSD 4NB5A 5A0AE 2OAZA 2KRHA 2TDXA 4NSYA 4A3GJ 4LOCA 4S0HB 3HDDA 2WV0A 1Y3UA 1BOAA 1GMCG 8GCHF 1D1AA 4UV9A 3M8FA 2K02A 1YI2I 1BZXE 3W1EA 1T7CA 3ZMSA 2P6TA 3LNQA 1O2WA 2GGVB 2VKVA 3EQLF 3DKXA 2XGXA 3DEUA 1EPTB 3LSPA 1XMNB 3ZOBA 4A2UA 2YNBA 1K2I1 3D49H 2ANMH 2C93B 2P3FH 1P03A 3HUGA 2XC7A 4A1TA 4ISNA 1Z7UA 4MVNA 3LSKA 3V13A 1W12U 5TJJA 3RKWA 4CBNA 5D5WB 1EZUC 2ECBA 2H1LA 1RZ4A 4NA8A 2OZUA 1P4WA 1EP6A 2D2DA 2QENA 1BJVA 2HQRA 2HGCA 2JETC 4ZDOA 3BQZA 3QX5H 1WDIA 1B9MA 1LQ1A 1R23A 1AFQC 3Q00A 1QJ6B 1LNWA 2DMTA 1TNJA 5ED4A 1E2XA 2EFWA 1CGPA 1P11E 3HSRA 3P8NA 4UB6C 4CCNA 3SZEA 2IJD1 1V6DA 1FYKA 2H1UA 2ETHA 3DFGA 5D5XB 3UQOA 5E1XA 4B1RA 1FWZA 3GBGA 2F5EA 2ZMEC 2G8TA 4EJTA 4FUIA 4H4KC 1YC0A 3RP2A 2CGPA 4XDEA 4I6ZA 1DVAH 2RAEA 4XRNA 1F0SA 1GBIA 4MQAA 2H9TH 4QT8C 1NRQH 1FUJA 1AVWA 2AMPA 1KZHA 1V2JT 4F7ZA 4GHTA 5AF9H 4IS5A 1W5SA 2DYRH 2HNTC 2DXIA 3RC4A 1ZYRF 4FTHA 5FX5A 1IW7F 1GHCA 3O8DA 3MFKA 4RT0A 1F7ZA 1QRWA 3TKYA 3G4SI 1TGSZ 4YOJA 4PJ0C 4BS9A 1JRSA 1UK3A 1YYVA 4CICA 2GQQA 4XQFA 1RIOH 2BOHB 1FPQA 2GTBA 3PQKA 3PM3A 1RRJA 1VI0A 3DFJA 1O3KA 2A4GA 1H8AC 4NGAH 1C1RA 2SGQE 4JP0A 1WPKA 2NRAC 1YQAA 1L1JA 4JZ1A 2YU3A 1GVJA 3Q77A 1S6HA 1SGTA 1ZSLA 1IRZA 4IOAF 2JA5J 3DCLA 5J4VA 4H0EA 1VCPA 3VXFH 1U5TA 1QL7A 1G3DA 1CO7E 1MSFC 1AUTC 1Z1JA 2Q1JA 4ZTFA 1DLKB 4S05A 1CBWC 3M61U 2EZIA 3SV9A 1GI5A 1TX7A 4SGAE 3T0YA 2G7HA 2XW9A 3MVPA 2UUFB 2M7AA 3KP7A 5KNLA 1GJDB 1VQPI 4LMYA 1CBWB 4TV7A 3LQRA 1O3JA 5DCMA 5F1RA 1N75A 5A0BA 1QCPA 4BBSJ 3QOEA 3RU4D 1AZZA 1F1ZA 1MKXK 4M3FA 3EPZA 3K1NA 2UWOA 2ZB9A 1QA0A 2AMQA 1PQ8A 1XPXA 3K0LA 4B71A 2QF0A 2VE8A 1G3TA 4RT1A 4PK4A 4JK1X 2HS5A 3A02A 2KIMA 4M3DA 1HAYB 4WK8F 2KFWA 1V3XA 1CHOF 2BDYA 1L3LA 1PPGE 2D26C 4J19A 4I01A 3FK7A 1FOXA 3IKTA 4INHA 2HVRA 4A5NA 2A3SA 1RJXB 2BLOA 4DOQA 2V3MA 4BH9A 3LOCA 4KA4A 1S81A 4Q47A 4X1SU 3JRFA 2P4WA 3HK3B 3L1PA 3RXFA 4IC5A 1P6RA 1PPEE 4Y7NJ 1B6AA 2F4IA 4NC8A 3P5JA 2SGEE 4BUPA 1L0OC 5KHDA 1V2WT 2X1DA 1ABIH 2AMDA 2VGCB 2WV4A 3E0PB 5DCMB 2ZZUH 5K0HA 2BXYA 2ZFWA 1ZPZA 2FTLE 1KQ0A 4BTTB 5L3BA 2ALVA 4ABFA 1S72I 1XKBC 1HAPH 2A45B 2YNAA 2KAIB 4ZYEA 1TWAJ 3QP6A 3H5CB 3SUFA 1TNKA 1GMDG 1S7EA 5AVDA 1GCTB 5DYMA 5M3MJ 2HVQA 2XC4A 3IKVA 1RTLA 3ABKH 4LIUA 1WOFA 3HGYA 4IPAA 4Y3OA 2ZWLH 3Q76A 2ZGHA 4X8TH 4A1XA 2XF7A 1SEUA 2UUKB 1TWCJ 2LP0A 3VOEA 5C1YA 1SVMA 1FJLA 2EZHA 4H4FA 5H4IB 4UFGH 1V2KT 1XS9A 3M8EA 2UWLA 1OX1A 4XLAA 3K4LA 4UEHH 1XSDA 2HEOA 3HOUJ 1YRNA 3H3ZA 4Q4LA 1IDYA 3TOAA 1SGFA 2FEZA 1ETRH 4ZUHA 2LLKA 1W0ZU 2F2EA 5EPNA 5BRRE 5E1ZB 4ISLA 1EASA 1B0EA 1IN7A 5F8ZA 2IN2A 2ELHA 2KP6A 2BVLA 2H6CA 3VB6A 1DWEH 2KM0A 3DCFA 3PTBA