1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Alkylmercury lyase
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
3BPXA 3WTWC 3HUGA 4OOIA 1RZ4A 4EVIA 3VB2A 5D4SA 1OYYA 2LNBA 3QAHA 2F5CA 2DPDA 1ZLJA 2DLLA 4NHJA 3CTAA 4A0ZA 1QO0D 3HSEA 4MHGA 2Z3YA 3SZPA 3WGHA 5F64A 2A68F 2VN2A 3ZMSA 1T0FA 5FLXZ 3ABTA 2ZXJA 4AIJA 2JT1A 2ZKZA 3DF8A 4KN4X 4O5VA 4BNCA 2XAQA 3F6OA 4BYYA 1D5VA 4I0BA 2YX7A 4I0AA 4P9UA 2L54A 2ETHA 3KZYA 1BM9A 1ZH5A 3PFIA 2CFXA 3WU0A 4M72A 4UV9A 3MCZA 2X0LA 2Y48A 1TNSA 1FBQA 2LF8A 5TJJA 4MGRA 3F72A 5J6XA 3L7WA 2NNYA 4LLGF 1IXCA 1TQIA 5E1WA 2VODA 2Q2EA 3M8FA 1HSJA 2PBIA 5E8GA 2E1CA 5A2QK 3KP5A 1MDMA 3VOEA 4M6YA 1U5TA 2V79A 3AAFA 5KK1A 3L09A 4ZYDA 1DDNA 2QLZA 2XKOA 3PQJA 3ZN0A 5E1ZB 4RB1A 1BN5A 1IF1A 1L0OC 1ZRFA 4JK1X 4CHUA 5FLXK 3O2PE 1KQ0A 4L9TA 2D45A 4IPAA 3DKWA 4ZH4F 2DO7A 2M1BA 4UVBA 4Y17A 3D5LA 3KP3A 2L3DA 4A2UA 2LSOA 1RUNA 4A0XA 5HLHA 5LHGA 1PUEE 1YQAA 3ZMTA 1SD6A 1LVAA 4YFKF 1R1UA 3FX3A 3JTHA 2WTEA 3F8BA 3KP4A 1W7PB 3CO6C 1YS7A 5D5XB 3K9TA 2MBFA 3E6MA 4A6DA 2ZBKA 2HZTA 3JW4A 2EFWA 4MTEA 3RDIA 1AWCA 1FZPB 4OINF 2FE3A 3E5XA 5LLQA 4UVCA 4MEXF 1S7AA 2P6TA 1R00A 4GCVA 3T1BA 3HRSA 1OR7A 4L9JA 4HF0A 2D2WA 2CGPA 1XDSA 3QRFF 2O6GE 2XVCA 4L0YB 4LG0A 1ZGJA 4S05A 2R7FA 2Z9OA 2W25A 1IN8A 4YIIA 4M71A 1EV7A 2A6HF 4KIBA 5CVJA 2FA5A 1QQIA 3HTUA 1R5HA 3GYHX 1IUYA 1J9IA 2IA2A 1F4KA 1FSHA 3H3ZA 3RYRA 5CVUA 1SD5A 2EFPA 1FPQA 6PAXA 3GUDA 5FD5A 3KP2A 3WTTC 2IJLA 1GVJA 5LGTA 3BJOA 4EM2A 4EJVA 1JHHA 4BHPA 1B6AA 5DD4A 2RV8A 2WC2A 4ENNA 3FMSA 1V3FA 2HOEA 2O61A 4FX4A 1YS6A 3EYIA 5FGMA 2K02A 2R3SA 4Q47A 2BEOA 2HDCA 2EV0A 1BI0A 4HA8A 1DP7P 1W5TA 5LGNA 2XROA 1SD4A 4I02A 1LDJA 1WWXA 4M9XA 1MGTA 2TDXA 4EGYA 4AD9A 4L9VA 5K5RA 1UHMA 2EB7A 2VONA 4ON0A 4Q4ZF 2M5WA 1ZREA 5HDGA 5LHIA 4I2OA 2OQGA 1OMIA 2H09A 1TTYA 2W85A 2PMUA 3SQNA 2JPCA 5LRSA 2V1XA 3HSRA 3CO7C 3IWFA 4WWCA 3C18A 4G7ZF 3ZN1A 3G3ZA 4CYDA 3WG9A 4CO8A 1I27A 2PI0A 3GO5A 5L3FA 1R23A 4HYEA 1XCVA 1D3YA 5ICGA 2HKOA 2DTRA 3HSFA 4I7HA 1IN5A 2MLKA 4FX0A 3MZYA 2QBYB 1WI9A 3T0YA 2OA4A 3RKXA 3KFWX 4YFXF 5E8IA 5DDGA 3I71A 3WGGA 5DUIA 3O6BB 5H6RA 3GEZA 1WRJA 3I0TA 1YW7A 3T8RA 1FBUA 3JSPA 3L9FA 5LEKA 3SXYA 3CLOA 1T2KA 2KIFA 2PJPA 2VE8A 4BXUA 1V4RA 3EDPA 4KDPA 2RQPA 2ZNZA 2JSCA 5L3EA 4XRFA 2QYOA 3BDDA 4M9SA 4MQVA 2Y0MA 2STWA 2AS5F 4LK1F 2W84A 2ISYA 2BV6A 2GWRA 2OD5A 3WTVC 2R7DA 4GYIA 4G6DA 3HHHA 2JTVA 2LDUA 1FC3A 1BJAA 3FF5A 3BPVA 5IT3A 2OU2A 4HQEA 1SFUA 1IZ1A 2L02A 2VE9A 4ESJA 1E2XA 1B1BA 1YW8A 1B4AA 2RN7A 2EJRA 3RTRA 3WODF 3RPQA 1P92A 3ZP5A 1KU2A 2DPUA 2STTA 1ZG5A 5DUKA 3F21A 5ICEA 1T6SA 2FQ3A 2J5OA 3QU6A 1O3RA 4IJAA 3V7SA 4YG2F 5HS7A 1B59A 1ULYA 2EFNA 1W4MA 3TDUC 1LB2A 4LLLA 2QQ9A 1STZA 1WSUA 2W24A 2NYXA 2F5FA 1MD0A 3GX4X 3I4PA 2L01A 3MZHA 1YTYA 5L3GA 3K1NA 1ON1A 3R60A 3IHUA 4KMUX 3I59B 2G7UA 4HZFA 4MEYF 1JHFA 4TV7A 5BOXA 2DI3A 4NB5A 3LWFA 2XAJA 3GFJA 2QVOA 1MKMA 5D8KB 2ZJ2A 3ZPLA 4HX4A 1KA8A 3L2CA 3CUQC 3K0LA 3E5QA 1USSA 2VT2A 2HYGD 2FRHA 2LF7A 4GO1A 1IAWA 1HQCA 1G4DA 3ML6A 5JFRA 1X3UA 2XAHA 3GFMA 1BC8C 4DNCA 2XAFA 3LA2A 2XIGA 3OV8A 4GYGA 2H6CA 3TDZC 3I54A 3LSTA 4AWXB 4F7ZA 1Z1DA 4I01A 1BC7C 3BY6A 3CUQB 2HTJA 1FYKA 4Z2YA 4GXOA 1HKSA 4IHSA 4M74A 2FNPA 1VTNC 4KICA 3R0AA 1EH7A 2EFOA 3FMQA 3WTYC 3QU3A 1HKQA 3JTGA 2VBZA 3BJ6A 3WTZA 3FXUA 5LEJA 3IL2A 2KJCA 5DEQA 4KIGA 4A12A 3ZMUA 3CUQA 1IRGA 3H92A 3FXRA 3KEQA 4KN7X 1YFHA 2OBPA 5CYVA 4U0WA 4BQAA 1FSEA 1F5TA 2F2EA 3P9CA 2P5LC 2P8TA 3K69A 2WV0A 3BOQA 4R1HA 2UXXA 3BP8A 1D8JA 2DQRA 4ENKA 3TQNA 2NNNA 2ZMEB 1PDNC 3GZ5A 2A3SA 5F6FA 3V8LA 1J2XA 2FBIA 4LGWA 4PGGA 1YG2A 4XSXF 2ADUA 4GGGA 2OZUA 1J5YA 4FHTA 3I59A 1QZYA 2QQAA 4G7HF 4O6JA 1R58A 3KETA 3DPTA 4EMSA 2HFHA 4N9IA 1GXPA 4A0YA 2F5DA 1NHAA 2ESNA 3DXJF 4RGSA 5HDNA 3MQ0A 2QZ8A 1G3YA 5ERIA 1FT9A 3HRUA 1UCRA 1U78A 5H20A 1JE8A 2J5PA 1FX7A 4QLCU 3C7JA 3ISPA 1ZAOA 1KQ9A 4OMZA 1U8RA 2RVCA 2OQRA 2IRFG 4HF2A 2VBWA 4IRHA 2XV4S 3R61A 1LQ1A 4RB2C 1AOYA 1G3TA 3E6DA 2NAZA 2YX4A 4B8XA 3VODA 4CICA 3I53A 4HX7A 2LKPA 2CQKA 3KEOA 4Y15A 3F3XA 1K78A 3KP7A 1GXQA 3FHZA 2EV6A 5E18F 1BBYA 5FD6A 1P6RA 2HQNA 3WGIA 2A61A 2GAUA 1J59A 2CG4A 1LDDA 2EFQA 4U7BA 3F8NA 2XASA 2JZYA 3N4MA 4HX8A 3NQOA 5ILVA 1S7OA 4IF4A 5DD8A 3F23A 2DT5A 3O3KA 5D5VB 2EA2A 2VBXA 3LFKA 4RAYA 2RKHA 1XB4A 3M7GA 2EV5A 2HYFA 2BBYA 5CVRA 1SAXA 2QWWA 1XMAA 4LFUA 3LAJA 3QOPA 4M6XA 2PN6A 2P7CB 1YLFA 1SD7A 2BGCA 1CF7A 4HAMA 1O3SA 1OPCA 5TRDA 1T38A 1HW5A 2GXBA 4ESBA 1QBJA 4OIPF 1HBXG 3KZZA 3ROUA 1JXSA 1IN6A 5K5QA 4JQFA 3TO7A 4IRIA 1FBSA 5ICCA 2FXAA 1XGOA 4PCQA 2A69F 3TKYA 2VXZA 1RIOH 1TBXA 2XHKA 1R22A 3FZVA 5HDKA 2HWVA 3QPHA 5ILSA 2CW0F 1FYLA 1R5GA 4UXNA 2VOOA 3ZMDA 5CLSA 2XKPA 1DPRA 4XSZF 4E70A 3TOAA 4ZYHA 4OU0A 2PEXA 2XGXA 4EJUA 4UNOA 1ON2A 1Z91A 3MFKA 4ENMA 1HXDA 1XSDA 2FF4A 2HKXA 2KIMA 5BMZA 3DQVC 3LA3A 4UV8A 1ODDA 4A6EA 1TQMA 3C3WA 4NQWA 4HBLA 1RNLA 4LB6B 4AVPA 4HW0A 1W5SA 4G6QA 1XGSA 3WU1B 5D8LB 3H3UA 1EH8A 4OIQF 4YIFA 1B9NA 1MJAA 2FOKA 4RB3C 4I09A 2V1DA 2GIVA 2K27A 1QNTA 1WQ2A 1E17A 1CGPA 2P7VB 4KT5C 4OMYA 1S29A 3I64A 1BIBA 5FB2A 2QM3A 2DK8A 4ZYEA 4U0VA 3M9AA 1LJ9A 4WXDA 1LEAA 4G7OF 2IA1A 1Z6TA 3LQQA 4XLPF 5D4RA 2VOPA 3ERED 5ICFA 5FO5A 3F8CA 2ESHA 4HQMA 3E6CC 4LK0F 2UXNA 3MEXA 4RS8A 2MH9A 4MQ9F 1XDUA 4MTDA 2ZMEA 4PDKA 4BH9A 4QWQA 4PGHA 1WKMA 2G7HA 2MH2A 3U9GA 1Z6RA 1FYMA 4CGZA 3RPUA 4ZZDA 5DCMA 1ZG1A 2Y75A 5HLGA 1SMTA 1OYWA 3LA7A 1IN4A 2EWNA 1H9TA 3WE3A 2K7LA 3LAPA 3GFLA 3U1DA 3B02A 1S3JA 3R4KA 2XUBA 2BE5F 1QPMA 4ETSA 3P7NA 3W6KB 5JI6A 1ZRCA 2PMHA 2L4AA 3S2WA 5HS8A 1UFMA 3R0JA 5JR3A 4K2EA 5HOOA 1S6LA 4H0EA 3JAMK 4D0PA 4P96A 2ZNYA 4EV0A 3EQLF 5LHHA 1BOAA 3KLOA 2E1NA 1IXRC 3HYIA 5CVIA 4CZZA 1U2WA 1FY7A 3V7RA 4RGUA 3D0SA 2ELHA 1O7LA 3ZMVA 2Z33A 3VFZA 1FP2A 2MD5A 2Z99A 2IVMA 1H0MA 1P4WA 4P5OA 1TLHB 1MJBA 1REPC 2IT0A 3CUOA 3RIRA 4EM0B 1D8KA 3FMRA 3GW2A 2KIUA 1A04A 4IXAA 2DK5A 3WTSC 1O7FA 4IHTA 1SFEA 4EJOA 2MC3A 3K1MA 1JGSA 1MDMB 4ZZLA 4XBFA 4IRGA 4LLNA 2C6YA 4P55A 3TO9A 3HOTA 4HV6A 4WXHA 1ZN2A 2F5EA 3HRMA 3ULQB 3MWMA 5F1RA 1Z7UA 1QZZA 2QQBA 5K5OA 3I58A 3JAMZ 2FBKA 1IN7A 5L3CA 2Z5UA 3Q9SA 4KNYA 1XN7A 1LEBA 3RKWA 1P4XA 5AIPA 4A5MA 1TQPA 5EEGA 3DPLC 3GF2A 5BPDA 3E6BA 5D6FA 3IWZA 3JSOA 2Q0OA 2M30A 5DCFA 2M45A 2EA4A 3FXQA 3V8KA 4WX9A 2O0YA 2BYVE 2KJBA 5FFZA 1GHCA 2DAOA 5JVTA 2MLGA 3KE2A 3BROA 1KGSA 2FMYA 2YR2A 4WF2A 3SFZA 1OKRA 1T98A 4UHTA 5EEHA 1P2FA 2RDPA 3OOPA 2NRAC 1UHWA 1LNWA 1HSTA 2FSWA 5HLIA 4LB5A 3GLXA 5D5UB 2V1UA 2ZFWA 1U3EM 4DQ2A 2E7WA 4YFNF 1FOKA 5DYMA 1BI3A 4FT8A 1B9MA 2FEZA 1ZLKA 2IW5A 3ELKA 2XRNA 4MNUA 4AIKA 1YO5C 1Z9CA 3SHFA 1RUOA 1YW9A 2A07F 2V6CA 1ZARA 5KVRA 1ZYRF 1KU9A 2UZKA 4LG0B 1IXSB 1ZGAA 2CO5A 5L3DA 4L5JA 4BAYA 3J80K 3GVAA 2PLYA 3IKVA 2X4HA 4IVNA 3TO6A 4B09A 2DW4A 1BIAA 2L4MA 3IC7A 1DUXC 2P4WA 3HHGA 1Z05A 3F8MA 3KCCA 5E17F 3I5UA 2G9WA 3DFGA 1I1SA 1R36A 4RAZA 2RC4A 2W57A 3REOA 2GZWA 2RGVA 1H9GA 3W6JB 2IA0A 1MZBA 3QPTA 3NEUA 3KLNA 4AIHA 5IT9K 4KFCA 2VBYA 1HW1A 4G94A 2GQQA 2A5YB 2P5KA 3IRRA 1TW3A 5E1XA 2PG4A 1J75A 3R6SA 3MAJA 2HR3A 2H94A 1S8NA 3K2ZA 3IKTA 3GZ6A 4R8HA 3WTUC 5HVQC 3GWZA 2VC0A 1R1TA 4S04A 1CF7B 3QP5A 3G73A 3HTSB 1YIOA 3J80Z 2COMA 5D6EA 1XSXA 2K4BA 3E3VA 3BJAA 4ESFA 3ABUA 4P9FA 3GXOA 5CJ9A 3B73A 2ZCWA 4CDGA 3P9KA 3VEPA 1K79A 5JHUA 1USTA 4HV5A 4BHCA 3V4GA 5CVVA 3TOBA 4EQQA 5LBQA 5LGUA 3CJNA 4WXCA 3Q9VA 2DBBA 1DPUA 3U2RA 5IT9Z 5BQTA 2VT3A 5FFXA 1FLIA 3HRTA 2KKOA 1W7PA 2GXGA 2M87A 4ZYGA 2YSRA 3EETA 4HOBA 1K7AA 4EJTA 1G3SA 1U5TC 1IRFA 1HW2A 2DFIA 4Y13A 2A6EF 5J8CA 4KUMA 1K6OA 2H6BA 3WTXC 2XAGA 2QUFA 4LJZF 1J7KA 2ISZA 3NRVA 4I98B 2IP2A 1BI2A 3N97A 4O3MA 4PZJA 3F22A 3CDHA 2JRTA 5HS9A 3Q5FA 4Q5SF 3PQKA 1SMYF 5BPIA 2HTSA 1F9NA 2D1HA 4R79A 2PFBA 4L9NA 1XSVA 2FBHA 2OAZA 2CYYA 1TW2A 2O03A 3EYYA 1O3QA 3F6VA 3M1EA 4Q48A 1U6GA 5J8FA 1U5TB 1MJ9A 3V8JA 2M8EA 3L00A 4OIOF 4UVAA 2K86A 3HIFA 3J7AO 2V9VA 3V7CA 3J81Z 4RGRA 3FM5A 2VC1A 4N0BA 2ACJA 1Q1HA 2K4JA 2CSOA 3M8EA 1RI7A 1XGNA 1OYIA 1W7PD 4HF1A 2B0LA 2HQRA 4LMYA 1I6XA 2JPBA 3C1DA 3ZQ7A 3SZTA 4HLYA 5H6QA 3LQRA 1G6NA 4KMFA 1R1VA 3F8FA 1PP8F 5L3BA 1PP7U 3EUHA 2GA2A 4WCGA 1F1ZA 1ZRDA 4OIRF 2WWYA 3E97A 3KP6A 2DU9A 5DCMB 1P4AA 4KA4A 5E20A 2RNJA 3DV8A 2P6SA 3TGNA 4EGZA 2UWMA 3T8TA 2Q8KA 2HS5A 3ECHA 1ONVA 1IW7F 2O8XA 1HKTA 2YPRA 3FWEA 2MA3A 4L5IA 4G8XA 1O57A 5LRRA 3J81K 1BI1A 2PQ8A 4RGXA 3GFIA 4KIFA 3ECOA 3RJPA 1SFXA 2FU4A 5A2QZ 3IRQA 3E5UA 2DQLA 3COAC 5ED4A 3ZMZA 3BWGA 1KU3A 5AONA 4G9YA 2O3FA 4EM1A 5BS6A 1XMKA 4UUVA 1XD7A 1L3LA 4HDVA 1XGMA 2FNAA 4EJWA 2QBYA 3WE2A 4N9HA 4U0YA 4HDUA 1EH6A 2CWEA 1T39A 3QP6A 3RKYA 1KU7A 5K1YA 1ZG3A 4WK8F 1FNNA 1ZHFA 3T5XA 1K78B 4M9ZA 1FP1D 2KRFA 4BHBA 5D5WB 3K1PA 1C0WA 1G3WA 4KYWA 2EK5A 2IPQX 5AIQA 1I5ZA 2AXLA 4ENJA 3P9IA 4L0ZB 2HEOA 1KYZA 1J0RA 3RI4A 2NS0A 3DEUA 4U88A 2FMLA 1LDKB 2P5VA 3DP7A 3BZ6A 3RYPA 1KYWA 1R7JA 1I1GA 4HLXA 2GA1A 2YU3A 4CXFA 4M73A 5ILUA 4L18B 4A5NA 2OZ6A 2E7XA 3FM3A 2HGCA 1Y0UA 4LD5A 1KQ8A 5DV5A 1O3TA 1UB9A 2ZO4A 2D1VA 1XCBA 1TNTA 3HOSA 4U7DA 4JBAA 1QGPA 4RB0A 1YYVA 2H27A 4ASNA 1FWZA 2QENA 4XLNF
chains in the Genus database with same CATH superfamily
1XVOA 1SR5C 2XGDA 1LHEH 3BPXA 3CD6I 2GDEH 3SU3A 3WTWC 3HUGA 3TGJE 4OOIA 1O2JA 3SJMA 1RZ4A 3OS0A 4L5EA 4XLFA 1EOLA 2IBDA 2F5CA 1JI8A 5J1YA 4NC6A 2ECCA 1BCUH 3U1KA 5HXFA 2F6CA 4A0ZA 3H7OA 3HSEA 1O3LA 3MH4A 1YPHE 4MHGA 3BR6A 3PO1C 3SZPA 1GCTC 1IQHA 2A68F 1AVXA 2WPDD 1T0FA 2JH6D 2C93B 1HUTH 1S84A 3TITA 3ABTA 1NFXA 4AIJA 2W3KA 2Z7FE 2ODYB 3B8JA 4O5VA 1GHAG 2E60A 4BNCA 1D5VA 2YX7A 3CF2A 2CV0A 1XG1A 2L54A 5DKMA 5J4VA 2CK3D 3F1SB 4QSHA 3PFIA 3WU0A 5C0UA 1T95A 4UV9A 5A8XA 1OWJA 3ZZ6A 2F91A 3AW1A 1TNSA 4Y4RA 1QZ8A 1AKSA 1MKXH 1MQ5A 5E0JA 2NNYA 2J95A 2ESTE 4LLGF 1IXCA 3RZDJ 2VODA 4YLUA 3I4NJ 5F53A 5E8GA 1NU9A 1HAHH 3S1QJ 2OC6A 4NWKA 4I99C 1MDMA 1V2QT 1U9NA 5EXMA 2C8ZB 4BAMB 1HDDC 1GMCG 1IUFA 5EOKA 3A80A 5IOZA 3AAFA 1ZPZA 1E0FD 2QXIA 1C1NA 4F91B 1B0FA 2XKOA 3KZIC 3L2VA 3HPHA 5J1RA 3F0PA 2L74A 4WMEA 1UVTH 5DP7A 1BHXF 1DICA 2A4GA 4JK1X 5J4QA 4NSYA 1G30B 5GAGJ 4XQFA 2D45A 1WJAA 4FUIA 1WAYB 1EA3A 4Y17A 2K0QA 1HDPA 5FKKA 3O8RA 4A2UA 1RTKA 4A0XA 1XMNB 5A2MH 4WVPE 1NO9H 1N25A 1MTNB 4ZUHA 1SD6A 2CW8A 3K4MA 1DE7H 1GWAA 2NU2E 3VXEH 2BB4A 3HGPA 1DU6A 3HKZN 2WB1N 3F8BA 3MKLA 4B76A 3CO6C 1YS7A 3E6MA 1BR1A 4MNYA 1OCRH 1K22H 2HZTA 1D3QB 1S7EA 4GDFA 5DSFA 2EIKH 5B6LA 2FLRH 1WJCA 3A87A 3LGVA 2FE3A 1V2RT 1F0UA 3E5XA 1EOJA 3T1BA 4XOJA 3BG6A 3ABKH 2V35A 1KLJH 1XUJA 4HF0A 3N05A 1K1MA 1SGPE 2IGMA 3OYBA 1GJDB 5LH8A 3HKJB 2Z9OA 3SJ8A 4YIIA 4QPOA 1Z8IB 3A8CA 5AHGH 1RKTA 1TNKA 4F48B 1QQIA 3K9XB 3KQDA 3GYHX 1CA0B 1EKEA 3BTIA 3OYCA 4ZXXH 4V2GA 1IQJA 3KYLA 1G3EA 2X6YA 2ZF0H 1SD5A 2BD2A 3PNVA 1WTGH 5F1JA 2RQQA 2IAIA 2ZU2A 5FD5A 3BJOA 4THNH 5L2YH 1SGEE 1MNMC 1CU1A 3FMSA 5TCAA 4CHAB 1NFUA 5EJ1A 1YS6A 2WINI 4OAYA 1IG7A 2OF7A 1YCPM 1RS0A 2M7AA 1GV2A 2R3SA 2OCCH 2F4LA 4XORA 4BU2A 1FIZA 2HDCA 2WPKS 2EV0A 1BI0A 2PJRA 3RCOA 1W5TA 1LFPA 2FX0A 5BNGA 2OINA 1LHCH 1T4VH 2SGPE 1O33A 5FPYA 1OCPA 2BX4A 4M9XA 1MGTA 2TDXA 4P00A 1UHMA 1MD7A 5DP4A 3H0GJ 3PM1A 2H9HA 5LHIA 5FX6A 4FUHA 1LKAA 2OQGA 3ZZDA 2H09A 2M0MA 3SN8A 1RETA 2JJ2D 5FAHA 2PMUA 1GUUA 3SQNA 2JPCA 2HGTH 3CO7C 4NQWB 1HPGA 4NZLA 2MFZA 2Q6GA 3CJTB 2KRCA 1MNDA 4CO8A 1V2MT 1LO6A 3MKYB 1I27A 4WMDA 1UG0A 5L3FA 3ATWA 2ZFFH 4XKWA 2AS9A 5DJ7A 5ICGA 3ZZ4A 3FXOA 2DTRA 1V6DA 3A81A 1K6YA 2A7JA 1IN5A 3UNSA 3ZVBA 3AW0A 2QBYB 1YJ9I 3RKXA 2ZTXA 4YFXF 3IV5A 5DTDA 4FU7A 2QGRA 3BG8A 5E8IA 3L2RA 3I71A 3WGGA 4I32A 3T8RA 2CUEA 4M3GA 2Z2SB 5LEKA 3ZRGA 1YWUA 1B8IA 3PFYA 2KIFA 1VCQA 4NIVA 1ETTH 1VJ9U 2EQNA 4FUGA 2EILH 2M34A 1V4RA 1HAGE 1EPTA 5FKMA 2ZNZA 2ILNA 1SVOA 1SQOA 5E8EH 3HM5A 3HEFA 4IO9F 2E1MC 4LK1F 3ODFA 2W84A 3BG7A 2ISYA 1O3GA 1TMBH 2BV6A 2HYJA 3A7TA 2GWRA 3WTVC 3GDUA 2R7DA 2NU3E 4HGCA 2VIXA 1HF0A 5EQRA 2F83A 5IT3A 5J3LA 2L02A 1E2XA 1B4AA 2DOAA 4WH6A 3M5OA 1C5XB 4BDYA 5DUKA 1ELBA 2BDYA 1JOUB 1IQMA 5ICEA 2X1DA 2FQ3A 3F9HA 5FROA 2DFFA 3F6UH 1O3RA 4IJAA 2OBOA 1WH7A 2DA2A 4I8JA 1QPIA 2XPUA 1WSUA 3FANA 4I33A 1UHBA 2QSFX 3PLKA 1ELCA 1BIOA 3GX4X 3ATMA 1O2IA 2L01A 3SNAA 3MZHA 1QA0A 1SAUA 1GI3A 5FRMA 1SC8U 4K1TA 4NA7A 3PRBA 2KCAA 1GVDA 1JHFA 2VKVA 2Z3DA 3HZJA 3F2HA 2YU9J 5C0TA 1GGDB 5BOXA 5EXLA 1U8BA 1FV9A 4NB5A 3GFJA 3CP8A 1VGCB 1MKMA 6LPRA 2ZJ2A 2W5EA 1TB6H 1DITH 3A1YA 1OCTC 1SOZA 1WJEA 2LF7A 1GHZA 3O8HA 1TLDA 2H9EH 1FX0B 5JFRA 3LH1A 2BQ7B 5K7RA 4C2MJ 1AFQC 1C2GA 4GUXA 3MNBA 4DNCA 5TISC 1C1SA 4GYGA 8GCHG 4Y52J 2LK2A 5CDFE 1WTHD 3TDZC 2R0LA 2PV9B 3SV7A 4AWXB 2GCHG 4B2BA 1O3JA 4X0WU 3BY6A 1A5HA 3SO3A 3HGNA 3CUQB 1O2VA 1G2HA 3B23B 1HKSA 5HKKD 3R0AA 1S81A 1GI1A 1ELDE 4Q63A 3KN2A 3OYLA 2BDBA 3GTOJ 4KP0A 4FU8A 5GXPA 5DEQA 3HL2A 4YT6H 3JRHA 4RAFA 1EXFA 1GBEA 3OSGA 1HB0B 3WW7A 3H92A 3ZXSA 3K10A 1O2UA 1SQRA 1NG6A 2WB1A 5CYVA 4BBRJ 4BQAA 3MO3A 1O5CB 4BEHA 3I9V2 1BRAA 2WV0A 1GHAF 1MSEC 2UUZA 4BDZA 1NS3A 3TQNA 2NNNA 2GMTC 3BEUA 1GL0E 3M35A 5HM2A 2Y6TA 2FBIA 3ZQIA 2DXIA 2KX4A 4GGGA 2GX4A 5FLVA 3TNSA 5M5YJ 2VIDA 1QZYA 1V2OT 4DZJA 1RGQA 3ZQLA 3G71I 4EMSA 4MO7A 2VWOA 4N9IA 1GXPA 2LYCA 3DXJF 3MQ0A 3KF2A 1ZR2A 3CC7I 1TGTA 3ASNH 3HRUA 1U78A 2J5PA 1FX7A 3C7JA 3ZQFA 1IGNA 1ETRH 5J4SA 5C3EJ 2XCFA 3PMBB 3E1SA 1K1OA 4IOAF 3S7KB 2BXTH 2IRFG 4HF2A 1ZOMA 4N4NB 5AF9H 3RM0H 1DM4B 3EYDA 2KRHA 1LQ1A 1SOTA 1NRSH 3E6DA 5F0CA 3D5RC 4D76A 5ESTE 1P3EA 1O3DA 2LKPA 2ELJA 2BD9A 3QTOH 3BG5A 3QOEA 2IXSA 3FHZA 5E18F 2LNCA 1GT0C 1LDDA 1NFYA 2YMSC 2JZYA 1X7AC 4IF4A 1F5RA 2PGQB 2DT5A 2O8MA 2EA2A 3LFKA 1ESTA 1Z71A 2AHME 1XB4A 4AYBN 3M7GA 4Y11E 2DDAA 2LMDA 4DIIH 1TRMA 5SGAE 3P70B 4X1EA 1KY9A 1AD8H 4VGCC 4Y0ZE 3LAJA 3I78A 3QN7A 5HGGA 3WG7H 1VQ4I 1SD7A 2BGCA 1CF7A 2E35A 2QF0A 5TRDA 2ZPSA 2GXBA 3RXAA 1QBJA 4Y0YE 5GPCA 2M2EA 3ROUA 1IN6A 5K5QA 4JQFA 2BHYA 1GJ8B 2FXAA 1RC9A 1V3XA 3TU7H 1XGOA 2M2AA 2R7RA 2QAAA 1SLUB 1NY22 1R22A 5HDKA 2CGAA 1FYLA 4YIRX 1GBLA 1UCYE 2XKPA 4K3JA 1DPRA 3BTEE 4E70A 2W6ID 4DJZB 4ZYHA 2XGXA 1ON2A 1HXDA 3QGJA 5H4IB 4FASD 3DQVC 3VB3A 1GDTA 4UV8A 2Z9JA 1TBRH 1TQMA 3C3WA 2ZPQA 2VVCA 3SJOA 2Z16A 3WU1B 1VITF 3FFGA 4H4KC 1B9NA 3BIVH 3MH6A 1ZTRA 1JRTA 2V1DA 2C90B 5HIZA 4MLFB 1WQ2A 1MABB 2P7VB 1GJ6A 3BTDE 4OMYA 2JVGA 3SDBA 3I77A 3OTJE 4X1NU 1GDQA 1HJ8A 3M7TA 1OOKB 1HIAA 2STBE 1J8AA 3ZVFA 1R6RA 1SFKA 4XLCA 3PO3J 2VOPA 1D9IA 1SGCA 3ERED 2JA8J 3HGGA 1S0QA 2ESHA 3E8LA 1SGTA 2VKDA 1FI8A 1AUTC 2C4FH 5IK2D 1HAVB 1OX1A 4AX9H 1D0YA 3FKSD 5EJLA 3V12A 1DQUA 1WKMA 3D65E 4Y7AA 2KMUA 2JA5J 1EPTB 3SHAH 2G7HA 5F8TA 1T56A 3SJ9A 1W0KD 2H5CA 5GADJ 3MNSA 3RPUA 4ZHAA 2XDVA 2XSJC 3RXLA 1P05A 2O8TA 1SMTA 1ZJDA 2EWNA 5DK1A 3ZIAD 1R4NB 3QDZB 3FKIJ 1O3KA 4G12A 2K7LA 3ATKA 2AXTC 1ACIA 4ZKRU 5B1AH 3VG8A 3MU1A 3KQCA 3B02A 2K9SA 3R4KA 3ZCOA 1O3NA 3W6KB 2EZLA 3S2WA 1FMGA 4LZ4B 1W36D 3KPHA 1J09A 3DEWA 1WI3A 4PSXA 2B8OH 1S6LA 2Y5GA 2OBQA 4H0EA 4B2CA 3EQLF 1BOAA 3KLOA 3F68H 4X6PA 1YRNB 1KXEA 2VB6A 2K9QA 1TL8A 1FONA 2NOGA 2Z33A 3DEEA 3ODDA 1LPZB 3VFZA 2UWPA 4UY8I 2MD5A 2EIJH 2Z99A 1H0MA 1P4WA 7GCHG 4X6OA 1UHBB 2WZQA 2FO9A 4EM0B 1C2JA 2BOHB 3GW2A 4ISOA 1D1BA 3T26A 5DS9A 4IXAA 4BAOB 3S9CA 4IHTA 1FN6A 4B43A 3LNQA 2FTMA 3K1MA 3U8TH 1JGSA 1MBJA 4IEJA 4A69C 4IRGA 2C6YA 2TGDA 3TO9A 1TT5B 3C27B 2O9QA 3A0BC 3HRMA 3HB9A 3MWMA 1HCRA 3S0NA 1GI9B 1H9HE 2OQ5A 2FJ1A 2FOAA 4RBOA 3FXJA 2Z5UA 3ITIA 4XRSG 1XN7A 3G1LA 1QJ7B 1TQPA 3K2AA 3OYPA 5FKNA 2Y82A 3E3TA 1T32A 1BITA 4E7KA 3FXQA 1O2LA 4WX9A 3BTME 1P3CA 4K2YA 5A09A 5JVTA 2KZGA 3L1PA 2GDDA 1BTWA 1KGSA 2FMYA 2YR2A 5TJXA 1FIPA 5HMAA 1P2FA 1FIWA 1WJ5A 2TBSA 1QNJA 2J97A 3DUXH 4MPWA 3SNCA 3DU6A 4YFNF 1YPJH 4NWLA 2HPIA 1HAYB 1ZLKA 1IQLA 2L9NA 1SGFG 4Z6YA 2NVYJ 2XAUA 1D6RA 1A61H 1IDZA 1YO5C 2B9LA 2ZA5A 1RUOA 1N6YA 2GBYA 2A07F 1HJAC 1ZARA 1C2HA 1HC8A 2UZKA 3HKIB 2SGDE 2G8TA 1ZGAA 4X2VA 2VUMJ 3S2HJ 2FIRH 1CGJE 3QPLA 2G4TA 1LHDH 2VBCA 3RQ4A 1X2MA 1HFDA 3UFAA 4IVNA 1LMWB 3EDXB 2R93J 5CHBA 3IC7A 6GCHG 3LC5A 4DIHH 3ZZCA 2WPJS 3L33A 1K83J 4F55A 1Z8JB 2P4WA 3HHGA 4XOTA 3HPTB 5DP9A 3I5UA 5GTHC 2G9WA 1HLTH 4KTCA 1S82A 2RC4A 2V7FA 1DWCH 4C9YA 1FN8A 3CF5F 1V54H 4HTCH 2AO9A 2FTLE 2IA0A 1TWFJ 3BTJA 1YCPK 1ZTKA 1CHGA 2AGGX 1AU7A 2WV9A 4KFCA 4ISIH 1TX7A 4G94A 1V2UT 2GQQA 2QXHA 2OD3B 1P12E 1TW3A 5E1XA 2PG4A 1O5AB 2ME0A 3R6SA 3MAJA 1S8NA 3VB6A 3FHNA 4ZDLA 3HKZA 2MGQA 3WTUC 2SGFE 2VC0A 4NFFA 1R1TA 3QP5A 2COMA 1MAYA 5CHAC 2K4BA 5J40A 1ETSH 5FCKA 3HOYJ 3BT9A 3DWLE 3GXOA 1ARCA 2D1JA 2ZCWA 1YPLH 5JHUA 3URCA 1NM6A 1USTA 4D9JA 2MSYA 3S17J 3V4GA 3Q3SA 5CVVA 1DP3A 3LL7A 5DN6D 2LREA 2GOXB 4BQNA 1QL9A 2KAIB 2EPFA 2F5VA 3FBIB 3TGIE 1W36C 4WXCA 4VGCB 4I8LA 1IQKA 1DPUA 2DJNA 1F0RA 2BDIA 3DCFA 1AVWA 3KYFA 5BQTA 1P2JA 1T8LA 5GWZA 4B71A 4GAWA 4JX6A 1W7PA 2GXGA 4E7ZA 3NWUA 3PNTA 5C44J 5BPEA 1I50J 1K7AA 1UTNA 1QBVH 1MBKA 2KAIA 2A6EF 3BTCA 1E34B 2H6BA 3BQYA 2K3PA 2KFDA 2XAGA 2QUFA 1EX3A 1TWGJ 1ITYA 1ETYA 1BI2A 1XXFA 4PZJA 1YHQI 1VR1H 1D3TB 1G9IE 3PQKA 1AE8H 2QV1A 2HTSA 1KTTB 2PFBA 2J5UA 3W3CA 4B74A 2CYYA 1TW2A 3A4CA 2O03A 5HNHA 3EYYA 4BE1A 3LOXA 3KYDB 3F6VA 4H42U 1OCZH 5J8FA 2Z9LA 3SJKA 4ABEA 3QQAA 3FP6E 1IQGA 3JCUC 4RGRA 3FM5A 2XRLA 2VC1A 5F0HA 1NK2P 1TYNA 1BMAA 5FKLA 3SGBE 2M3AA 2B0LA 2HQRA 4LMYA 2JA6J 3ZQ7A 2JDID 3DLAA 3FVFB 5H6QA 1A35A 1UTLM 1PP8F 5L3BA 2JUCA 1PP7U 1L4ZA 1W8BH 4CCLA 1TPSA 2GA2A 2K9LA 1ZRDA 3EUKL 3ZZAA 2HQAA 4KA4A 2QEXI 3EA7A 1YY3A 5E20A 2XB5A 2YMSD 4XRNA 1P2QA 5CHAB 1HJ9A 2XB0X 4BAKB 1UZCA 2UWMA 4GCHF 3LH3A 5K7HA 2HS5A 4B75A 3ECHA 1GVLA 1IW7F 2O8XA 1YJWI 1HKTA 1C2LA 1Y5BT 1LE8A 2GLOA 2ZGXH 3PJRA 2MYSA 1NTCA 1LHGH 2BY5X 2WSSD 3IAS2 3HK6B 2GZ9A 1SFXA 1C2DA 5A2QZ 4JX5A 2WPIS 2DQLA 4CRAA 5ED4A 2KPMA 3GCHB 3ZMZA 1S85A 3GLLA 1AN1E 3MWIU 2ID6A 1A46H 4UD9H 1SLWB 3TH2H 2TGAA 4B3AA 4HFPB 2A7CA 4ZKSU 2V4JC 1MH0A 2ME6A 3JREA 4UUVA 2J98B 2R9PA 1DUAA 1ZRBA 2ZI2H 3HXLA 4I6ZA 4OS4A 2FNAA 2G51A 1H8ED 4DCDA 4U0YA 4BQOA 5C5OA 1EH6A 3SEQA 4ZTFA 5FBEA 1IHSH 3CDLA 2D26C 1WDIA 3SYTA 4WK8F 1FNNA 5T6DA 1ZHFA 1S72I 1K78B 4M9ZA 1GJ5H 1FP1D 2HNTC 2HXOA 2EINH 3ZVGA 1C0WA 2EK5A 1EJ9A 2IPQX 2JETB 2AXLA 4D7MA 4ENJA 3P9IA 1G32B 1YJNI 2TGPZ 1SEUA 1HLVA 2BOKA 2R5YB 2FMLA 1P2NA 1IQNA 3SV9A 2ZC9H 2VJ5A 1TFXA 3RXGA 1K1PA 1F43A 1KXFA 1R7JA 1I1GA 4HLXA 2G00A 1R5ID 4A5NA 4WXVA 4A3CJ 1FQ3A 2BHZA 1D0ZA 3SW2B 2DMTA 3OAAD 2ZO4A 1YCPH 2D1VA 1PQ8A 2P93A 4BEHB 4RB0A 2LBFA 4F93B 1LVMA 4ASNA 1OP0A 4ABJA 1Y1VJ 1GDNA 1HXFH 1O3EA 1Z1JA 4ABFA 1LPKB 4INKA 1SGQE 1C2KA 2HWLB 3VB2A 1MKWH 2HOTA 3DT0H 1MIJA 3U98H 3H5AA 4NDLA 2DPDA 1ZLJA 2WA0A 4IGDA 4NHJA 1AE5A 3TK6A 4X1PU 1C9TA 1JKOC 3ZV8A 2Z3YA 1TA2A 5H2FC 4YZUA 1VF9A 1UMAH 2VN2A 3ZMSA 1NROH 3GCMA 2LRDA 2J9NA 5FLXZ 2FOBA 1NZQH 2J2UA 5T6GA 3H7TA 2VKEA 2BD3A 2XNDD 4PJNA 2A2XH 4I0BA 1ACBE 4I0AA 1P7IA 4P9UA 3P8NA 3PV5A 3PNYA 2IOTA 1XM1A 3ATLA 1ZH5A 3RM2H 3RXKA 2AIPA 1NU7B 1QR3E 1C5YB 3AL0C 3S32A 4AG2A 1CQQA 1GMCF 3SUDA 5DGJA 3F72A 2XBXA 1DLKB 5B66C 4UDWH 2Q2EA 1IAUA 2E1CA 2ZFUA 2HOAA 3KP5A 2OCVB 3BTHE 2PUXB 4NC7A 3SORA 1F0SA 3SJIA 1FY3A 1RXPA 3DTIA 1BW6A 4ZYDA 4BOHA 1B0EA 3W94A 1MBHA 2VVUA 2WUBA 1OWEA 4CH2B 1S9HA 9ESTA 3PQJA 1Y3XA 3OTPA 3ZN0A 3F2FA 1BN5A 1IF1A 1ZRFA 4DYCA 1C1TA 5FLXK 4WH8A 2IS4A 1ZGVA 2OK5A 1ZMJA 2JKHA 3LSKA 4IPAA 2WYJA 2M1BA 1TX8A 2VQCA 3M5NA 4UVBA 1BTZA 1O2XA 3RXTA 3D5LA 5GIBA 2HLCA 3FXKA 1AU8A 1N6XA 7KMEH 1RUNA 1OLTA 3JRAA 5HLHA 1EASA 5LHGA 4Y3OA 1YQAA 3CMAI 3ZMTA 5GNDA 1CO7E 3KEYA 1L1JA 1NRPH 4YFKF 3TMOA 4DBRA 2R2WU 3MTYA 1SGNE 4GVUA 3BTWE 2WTEA 1OCOH 4A3BJ 3PIOF 4E7JA 2J98A 4UUSA 1BMNH 5EODA 3VB4A 1LE8B 4A6DA 2ZBKA 1JT0A 4V19K 2FOEA 1CA0C 3LSGA 1U6QA 3I29A 1FTTA 3ZQQA 1AWCA 1FZPB 2ELKA 4OINF 4R0IA 4BANB 2G5VA 3H09A 4Y79A 4UVCA 1EFRD 1AIXH 4GCVA 2P16A 4JZIA 4HI3A 3LPRA 4P02A 2O6GE 8LPRA 2XVCA 2LY2A 4GCHG 1MD8A 1ZGJA 1O5EH 2R7FA 2WUCA 2W25A 3JZ1B 1IN8A 1O5DH 2OCEA 1N8OC 2I8DA 4KIBA 4PJMA 4MTBA 2AERH 4ZDPA 1FY4A 1R5HA 1J9IA 1F4KA 4IS5A 2K8IA 4HNVA 2QGUA 3ZVCA 3K6GA 4JX4A 2W7UA 2EFPA 3GUDA 1Z8GA 1GVZA 5EG0A 1K9OE 2V3OH 3OS1A 2IJLA 3DTEA 5LGTA 1SQAA 1AGJA 4CRGA 1JHHA 1O3IA 4YTAA 3F0CA 1NK3P 2RV8A 3IH3A 2O61A 5JB9S 4FX4A 3CDIA 4Y7NJ 2FI3E 2YNAA 5C3NA 3QK1A 2H1LA 5EG0B 4HA8A 4C3HJ 5A8ZA 1LQEA 2XROA 1TMTH 2TGTA 3TJUA 2A05A 4I02A 4KISA 1LDJA 3PV2A 1WWXA 1VQMI 2OC8A 1MSFC 1BOBA 2VGCC 2EB7A 3S2DJ 4ON0A 1ETXA 7GCHF 4NIYA 1ZREA 5HDGA 3OEHD 1ESAA 4I2OA 5DM7F 1OMIA 1F2SE 1QVUA 1TABE 3RXQA 1KMHB 3KYCB 2JQ7A 2O8KA 4GHTA 3ZGKA 2V1XA 3HSRA 2JJ1D 3LOCA 2BD4A 5LPFA 3C18A 1V2JT 3HOXJ 3ZN1A 5L6NH 4CYDA 2PTNA 3H1CA 1ETQA 1DGWY 2CUFA 2K85A 3L2UA 2PI0A 3GO5A 1EAIA 6CHAB 1C5OH 3SU4A 3RXHA 2HKOA 1VQOI 4A1TA 1C5TA 2IS6A 5CPRB 2MLKA 5IYBJ 3MZYA 3LT3A 1NN6A 3T0YA 3SOSA 3SV6A 1KXDA 3KFWX 1UELB 3S9AA 3LSMA 3RXIA 3O6BB 2NU1E 3JR9A 1YW7A 4MFDA 2BVSH 1QRYA 2M4GA 3MO6A 2XPVA 3L9FA 3CLOA 2PJPA 1BMLA 1XX9A 3CQZJ 4BXFA 1SPJA 2VH0A 3OY9A 1Y3WA 1SI5H 5LPEA 2J4IA 4M9SA 4IBLH 4B6FA 1W7GH 4CA0A 1IV6A 4WJG2 4GSOA 2A5KA 2A5AA 1PVEA 1N1LA 3D23A 5E2PA 2W48A 4G6DA 1TOMH 3HHHA 4BACA 3VYRB 3QYFA 1TGCA 2VH6A 5C1YA 3BPVA 3VFEA 1SFUA 4XBDA 2KP6A 1IZ1A 2ZC2A 4BXWA 5TGTA 4ESJA 1B1BA 4S0HB 1YW8A 4LITA 3RTRA 2CFOA 3ZP5A 1KU2A 2DPUA 5E79C 3BTKE 3PB1E 1BJVA 3HC7A 4DYRA 4D5FA 1AHTH 3UOUA 4X8SH 1WQVH 3PWCA 3QU6A 3V7SA 2EFNA 1LB2A 3Q76A 3GCTG 4LLLA 2QQ9A 4CCOA 1OYQA 4I8GA 2NYXA 1MD0A 2Z9KA 5E0GA 1YTYA 5L3GA 3R60A 4AB9A 2CRGA 2P0WA 4NUBA 5JLWA 2WAFA 2DMQA 4MEYF 3NZIA 1C5PA 4CBOA 1KZHA 3CCQI 3MD2A 1EZUC 3VB7A 3GMEA 5FPSA 3SGQE 2XAJA 3OE7D 2Q2EB 4HX4A 1QL8A 2WY8Q 1KA8A 2Y30A 3BN9A 1IO2A 3LSJA 3QZQA 2VT2A 2HYGD 1G8XA 2FRHA 1TGNA 3VWBA 5JLXA 1HQCA 1X1DA 1BBRE 2VVVA 4MDSA 3KEEA 1G4DA 3ML6A 5EPYA 3NXPA 1ELFA 1M9UA 2Q6FA 2HVSA 5DP5A 1LFBA 1XXDA 2GV7A 1XUGA 4JYTA 3LA2A 1E38B 2XIGA 3CMEI 3OV8A 5CMXH 4Q4LA 1GBJA 3I54A 3W1EA 1E1QD 2ZFRH 1X1AA 4F7ZA 1Z1DA 3P8FA 5F0FA 4BJTA 1VQLI 4QT8C 4XICA 1T4UH 2LY1A 4GXOA 4IHSA 4M74A 2FNPA 4KICA 4XBCA 1OJLA 1BA5A 3FMQA 1AQ7A 3A03A 4D7NA 3T27A 1IV8A 3VPRA 2VBZA 3BJ6A 4LOYH 3FXUA 4Y76A 1E3HA 1JT6A 4KIGA 3BTFE 3NCLA 5GAHJ 1MBGA 3ZMUA 3SZEA 2ZCHP 3KEQA 4WF8A 1YFHA 2OBPA 1SL3A 1YYY1 4BTTB 1Q31A 1ZPCA 1FSEA 2F2EA 2A2QH 1JKQC 2W82A 2UXXA 3BP8A 4XR6A 2DQRA 4ENKA 1QZEA 2JETC 3C2HA 5F6FA 2FYRA 2WV4A 1J2XA 4LGWA 3PV4A 1XX5A 2H8RA 3A82A 1YOVB 1PPEE 3M5MA 3CCEI 2OZUA 4FHTA 3ZR8X 2QQAA 4HSRA 2NXNB 3DPTA 4AB8A 3ASOH 2G52A 2F5DA 2ESNA 2FYQA 3T5FH 4RGSA 3SV8A 2QZ8A 1G3YA 5ERIA 1FT9A 4A3KJ 2BY8X 2GTBA 2X6WA 5JPMH 2JK3A 1KQ9A 4OMZA 1KIGH 4ZROA 1U8RA 2OUAA 2D5VA 1ZQ3P 4IRHA 2XV4S 1G37A 3L3TA 1AOYA 3RC5A 1G3TA 2NAZA 2YX4A 4IL6C 4CRCA 5KHDA 3A7YA 3A2KA 1DX5M 3I53A 4HX7A 1EATA 1RFNA 2QF4A 4XMYA 2XF5A 3F3XA 3OYEA 1K78A 2EV6A 1BBYA 5FD6A 1P6RA 2NWNA 1J59A 4Q80A 1BTPA 2CG4A 2ZDNA 1DGRM 3OSYA 3K4LA 3N4MA 4F92B 1S7OA 1DWBH 3PO1B 1C5RA 2B7EA 1MBEA 5F04A 1ELAA 1GHBG 1DOJA 5C5NA 2IGOA 2HYFA 2E5ZA 3ABMH 4JYVH 3E90B 2BBYA 3UKGA 2R7TA 3U1JB 3EUHC 1VZQH 3QOPA 4M6XA 2P7CB 1YLFA 2P3TB 4HAMA 1WOFA 4D9QA 1X2NA 3O8DA 3LGIA 2R7VA 2A31A 5C67A 1GV5A 2IJD1 1FBSA 3TW6A 4I8HA 3ZZ7A 1C5VA 2XHKA 4E05H 1EP5A 3FZVA 2HWVA 5ILSA 2VOOA 3HOUJ 2XXLA 3TNTA 3H0DA 5EF6A 2BY2A 4OU0A 5FL7D 2PEXA 2CMPA 1SC7A 2R7QA 4UNOA 2ZFPH 2P81A 1XSDA 2FF4A 5C4XJ 1UMQA 1AA7A 2EBIA 2QF5A 3CC2I 4IMQA 1I3AA 4DW6A 1CHOF 5DP3A 1RNLA 4AVPA 1W5SA 2CQNA 2DMUA 5EZHA 4OIQF 1A0JA 1ABIH 3EE7A 2E1MB 1Z7KA 1O2HA 1VQNI 3E0PB 4IHXA 3UUZA 4K1SA 3K70D 4KT5C 4UB6C 4JZFH 4JK6A 4JOMA 2ZU5A 2TPIZ 2QM3A 4ZYEA 4U0VA 4D5CA 5EW1H 2ZGHA 3RXCA 2XC0A 2W6JD 4R8TB 3SGAE 2IA1A 2ZGJA 2RCEA 5D4RA 2FI4E 5ICFA 5FO5A 4HQMA 4ISLA 2F9NA 1ZK8A 3E6CC 2UXNA 1MTWA 1JIRA 2FWWA 3ABLH 4Y7BA 1SLVB 1XDUA 4MTDA 2ZMEA 4QWQA 2CV3A 2DUCA 2WADA 2BY3A 2JJ7A 2FOCA 2E2HJ 1BA8B 5B3SH 1LVYA 4CGZA 3LGTA 3DLLF 4ZZDA 5HLGA 1QRWA 1IN4A 4FUJA 2ZXHA 2BYAX 1YLDA 2WY7Q 2XBWA 2XBYA 3LAPA 5EQQA 3GFLA 4IHYA 2LKSA 2IGNA 4DG4A 4X2YA 5E3NA 5IPAA 2BE5F 3P7NA 2OTJI 2PX9A 2FOMB 4ZDOA 1IDYA 2L4AA 1PQ5A 3KL6A 4K2EA 5F8XA 1ETVA 2PMZN 1R49A 4TPYA 1VGCC 4NIWA 4D0PA 4UUSB 2Y69H 4EV0A 3V3MA 3BG4B 5ETXA 3CCRI 1QBOA 2E1NA 3HYIA 5CVIA 1S83A 1BTUA 5KECA 3IAM2 1O7LA 1WZ2A 3ZMVA 3W2VA 1ZLRA 4D9RA 2GZ7A 1FP2A 3BR1A 4MFEA 4P5OA 1S0RA 4JYKA 1MJBA 1ORFA 1V2KT 2ZDLA 3FMRA 2KCPA 2IS2A 1YPEH 1H8AC 2KISA 3MYWA 1GHXH 3IH4A 3BR2A 2XC4A 5HODA 2XNIA 1SKYE 1A2CH 1SFEA 4EJOA 5B6OA 3KQ5A 3EUAA 1W0ZU 3TBIA 3WWBA 2RFKC 4ZZLA 1BBRH 1P02A 4P55A 1ZYOA 4HV6A 1FDPA 2X1CA 3OYGA 3ULQB 2PP6A 1LKBA 3I58A 3MMGA 2HOSA 3DFJA 1LEBA 4A5MA 1VITH 3VSKA 4LIUA 3DPLC 5BPDA 1GI4A 3E6BA 2LKXA 3G2BA 5FRNA 1ANDA 4XFQA 3UTUH 1O3BA 5DCFA 2HLDD 3PSIA 3V8KA 5M5XJ 2ECBA 2HXIA 2BYVE 2KJBA 3GTLJ 2A6TA 3OYMA 1DWDH 2DYRH 3OYFA 3KE2A 2H1KA 3DKXA 3SFZA 3CC4I 3OYDA 1OKRA 4INLA 2AMQA 2YOLA 2V6EA 4X8VH 3EPZA 2L7FP 4A3FJ 1UHWA 1LNWA 5HLIA 4LB5A 3GLXA 2VQHA 1J14A 2ZFWA 4DQ2A 5LD2C 1BR2A 3PROA 4ESTE 1UTKA 5DYMA 1BI3A 1O36A 2CQ7A 5IYCJ 1W0UA 4BAQB 3HUGB 3OIOA 2FEZA 2OXSA 4MNUA 1D1AA 1QVTA 1YW9A 4QTRA 1B7XB 2I10A 4ANJA 3ZZ5A 2VPLA 4ZJZA 4JP0A 2XF7A 1IXSB 3AVZA 2BVMA 1NC6A 2ZJQF 1UAAA 2X6OA 4A3DJ 4BAYA 3U21A 4ACAA 2PLYA 4XOPA 2ZNKH 3GY7A 1Y5AT 3TO6A 1IJWC 4B09A 1G36A 1F5KU 2I5UA 1DUXC 1O3OA 2TCTA 3D5SC 4FOUC 4X0GA 3SYJA 1Z05A 1G2LA 4NNJA 1I1SA 1R36A 3VGCB 3H5NA 1P57B 4XLHA 1OISA 4FU9A 4NA9H 2GZWA 2O9LA 1A5JA 5I46H 4XNFA 3W6JB 2FX4A 1SBWA 1KTSB 2R4GA 3NEUA 3KLNA 2OTLI 1SFOJ 1O2GH 5JB8S 3A83A 3M3SA 3IRRA 1ZR0A 1XUKA 1Y39A 1MW7A 1AB9C 3S69A 5A0CA 3K2ZA 3UOPA 1NRQH 2RDLA 5HVQC 4JZEH 3G73A 1XKAC 3E3VA 3M3TA 4BJ5C 2QN5T 3BR3A 2KR7A 3RXBA 4P9FA 5CJ9A 2SGEE 4XIDA 3DFLA 4XKCA 4CDGA 3MHWU 1K79A 3RZOJ 4MNWA 4ASHA 1BMFD 4OS2A 4BHCA 1AKHA 3B6AA 3S1RJ 3D1NI 3G1OA 1YLNA 3M7UA 2L0KA 4ABIA 2QSHX 4EQQA 1C5WB 1WPKA 1X19A 5AFYH 2DBBA 4X2WA 4GHQA 2ZFTA 2CJJA 5IP7J 5JBCS 3HRTA 2AH4X 4TWWA 2E2JJ 3RXJA 3URDA 3JRCA 2KKOA 5FXLA 3RU4T 1H1BA 2M87A 2X48A 4ZYGA 5K0HA 1O3AA 1SVLA 2WYGA 1PPFE 2UWLA 1U5TC 2XYAA 1HW2A 2DFIA 1QHGA 4E7NA 1K6OA 1JTXA 1X3WB 1WCMJ 1QY6A 2BVRH 3OSFA 2E1OA 1J7KA 2ISZA 3NRVA 1O2KA 3H9QA 1ANBA 4PJLA 1BMMH 5EDNA 2JRTA 4K8YA 5BPIA 4TSFD 2BM2A 3UQVA 2W7NA 1SHHB 4IC5A 2OAZA 1S5LC 2A45B 2LELA 1O3QA 1O3PB 3M1EA 2EZKA 1U6GA 1X1BA 2F4IA 5C4JJ 3V8JA 4M3FA 3H9GA 2K86A 1U9OA 4B47A 2V9VA 3MH5A 3E0NB 2TRMA 1MQ6A 3FXMA 2DA5A 2ACJA 2Z94A 5HNFA 1Q1HA 1Z77A 4O3TA 3M8EA 1G2MA 1RI7A 4FETA 3BF6H 1WSSH 2PHBA 2C8WB 1TGBA 2XSDC 3A8BA 3ENSB 1MZAA 5KAIC 1EAXA 2KCYA 2HOBA 2PTCE 2QKLB 2LP0A 1F1ZA 4B3XA 5A0AE 3E97A 3KP6A 4E4HA 2LC2A 2A4QA 2RNJA 3DV8A 1HBTH 3T8TA 2FOFA 3OYKA 2DA7A 3RMOH 4AC0A 4NGAH 3RXDA 2MW8A 2Q1JA 1C1RA 4KITB 1W0TA 2LLKA 2OV7A 2VQLA 1LPGB 4UFDH 5LRRA 3RQIA 3U9AH 2PQ8A 2VIQA 3BV9B 4KIFA 4JZ1A 3ECOA 3G1MA 2EA3A 2DA1A 3RJPA 4AFSA 2YNBA 3GISB 1ETOA 1W14U 4CRFA 2LG4A 3RXOA 4DJAA 2ZGBH 1SANA 1BHXB 3COAC 3K7AJ 4UUTA 1GCDA 2X1EA 5EG4A 5GAEJ 4HRIA 1KU3A 3ZVAA 5F6MA 3F3BA 3DTKA 4EM1A 2DT7B 1XD7A 3NAUA 1L3LA 1UTQA 4HDVA 1PFXC 3MU8A 4EJWA 5M5WJ 1TIOA 4RDUA 4HDUA 2CWEA 1BL0A 2XTTB 2DA4A 1E37B 1YGCH 2CV1A 1QCPA 2LH9A 4ITVA 3NWTA 1NG7A 1UK4A 3UNQA 2B5TB 2QF3A 3RC6A 1AKSB 3IWMA 5D5WB 1XMXA 1F0TA 1G3WA 1JUPA 4KYWA 1P03A 1UVPA 5BRRE 2CXVA 3PWBA 1TOCB 4CZCA 1KYZA 1GBMA 1V5FA 2R2MB 2NS0A 4N4OB 3RXFA 1LKXA 3VSLA 5EPNA 1LDKB 4J2YB 1QIXB 4IX7A 2XWAA 1H88C 3ZYDA 3DP7A 2XC5A 4ABZA 3HG9A 3WWFA 5FHTA 3C2BA 2L5QA 4HPQA 2L7MP 3FM3A 4E7IA 1XKBC 3QLPH 5DV5A 2R7SA 1TNGA 4CSWA 1XCBA 3HOSA 2O8UA 3UB0A 1C2EA 1GI0A 4BGDA 4U7DA 3RU4E 3K6ZA 1GI8B 1YF4A 4Q7ZA 3A88A 2BW3A 2QENA 1SQTA 1B5GH 5EGMA 4RN6A 1BQYA 1VJAU 1FY5A 5KCMA 3MI4A 4EVIA 4AUXA 4XSKU 1OYYA 3BQZA 2L2OA 3QAHA 3G6EI 2WBMA 2JH0D 1TX6A 3QTVH 1UK2A 2DLLA 3CTAA 3QPSA 1V5GA 2L9VA 3LGYA 1QO0D 1EUFA 1MH3A 1TZLA 5T1VA 1Z7LA 1IQEA 3WGHA 5F64A 2J34A 1H4WA 4KN4X 4TWYA 2E36A 2QQ8A 3HOZJ 2XAQA 3F6OA 2V9PA 3KZYA 3A8DA 1GBBA 3M37A 3SU5A 4DOZA 1CGIE 3UQOA 4EATA 3MCZA 3LU9B 3FP8E 3SUEA 1TAWA 2LF8A 5TJJA 5J6XA 1BB0B 1TQIA 4A3IJ 3DSPA 1MMNA 4B73A 2PBIA 1FOWA 4PUSA 5FLMJ 4XM3A 3VOEA 3AAUA 4BJ6C 1B72A 2RG3A 4M6YA 2V79A 4ZKNU 1KDQB 1Y8TA 4K8BA 4E7LA 3LGUA 3BSQA 2CF8H 3RC4A 5E1ZB 4RB1A 8KME2 4YXWD 1L0OC 4UFEH 3ZZ8A 4CHUA 3R0FA 1E36B 1ZMLA 1KQ0A 4L9TA 1AMHA 4AGJA 3DKWA 3AAVA 4ZH4F 9ANTA 1A5GH 3KP3A 2L3DA 1BJZA 3JRBA 2GVFA 2BXUH 3TH3H 2EQRA 2DA6A 4INHA 4F49A 4DYQA 2Z9GA 1LVAA 1DANH 1IC8A 3FX3A 1TNIA 3JTHA 1O35A 4ZYAA 5FX5A 3KP4A 5PTPA 3PMHB 1YM0A 2GT8A 3TK5A 1FZZA 5D5XB 3K9TA 2KZVA 1COWD 3D49H 2ICWG 1TNHA 1HDTH 3EA9A 1NTPA 2EFWA 3SEZA 4Y10E 2UV1A 1Q1VA 3OR1C 1HNEE 4ABGA 1C5SA 3ZQHA 4XD7D 4MEXF 1AKHB 2EEKA 2GXAA 5DPAA 4NBQA 1P9SA 1K4SA 3Q00A 1OR7A 2CGPA 1XDSA 3QRFF 1C1VH 4OM9A 3CJQB 3UPEA 4L0YB 1ABJH 4CRDA 4FE4A 2DFHA 1L4DA 4RA2A 1GJCB 1QHRB 3OX7U 3BTLA 1KXCA 1ZKGA 4M71A 1EV7A 2Y7ZA 2A6HF 2ZTYA 3I55I 1BDAA 1PQAA 4DGWB 2BY7X 1HAPH 1O2WA 2R3YA 2XW9A 3HTUA 1FSHA 2FESH 4MNVA 1GJBB 4BS9A 3RYRA 5CVUA 3K2UA 1C1QA 4LIVA 3MU0A 2JSPA 4MG3A 1K21H 5GTIC 1ANCA 3BLYA 2OUMA 4WWYA 3WTTC 3LKWA 1P11E 2IEKA 3M5LA 4EM2A 1WU1A 5EGOA 2L7KA 1O34A 2J92A 4E7SA 5J1UA 1V3FA 2HOEA 1A3BH 1K1LA 1JJ6C 2M9HA 3EYIA 6CHAC 2K02A 1KLTA 1ZSJA 3CZ6A 1AY6H 2ZEBA 5B1BH 3A89A 3UR9A 3MFJA 3U28C 1SD4A 4ZCNA 3CNRA 2VKHA 4L9VA 5K5RA 3K6YA 3OYJA 2VONA 4Q4ZF 3A7VA 3ONQA 3S1MJ 1TTYA 4Z6AH 4X2XA 4MLOA 1AB9B 3EE0B 5LRSA 1O32A 1XC5A 5HYOA 2CV2A 1EB1H 3BG9A 2V3HH 1O38A 3SHCH 4G7ZF 3FBNB 3G3ZA 3WG9A 2WAQN 3UIRA 4BE2A 2DYSH 2GV6A 1XCVA 1J15A 2K9NA 1D3YA 2JUGA 2NS8A 4I7HA 1B8IB 3RKQA 2UWOA 1WI9A 1HCGA 5KAFC 2PMZA 1OYTH 2FPZA 2ID3A 1SGRE 1VQ7I 5DDGA 2BTCE 1UVUH 1OQYA 5H6RA 3GEZA 1RRJA 1FY8E 1DXWA 1GBKA 1TWAJ 2ZO3H 3RPUD 2LFBA 2VE8A 4BXUA 2NVQJ 1D6WA 3EDPA 3OS2A 3MKWB 2P59A 2RQPA 2JSCA 4XRFA 3BDDA 2BXZA 2DA3A 1P04A 2Y0MA 2E2IJ 1RD3B 3TPIZ 3ZYEA 4B6EA 4W1UA 4E06H 3DPUA 5M3FJ 1MU8B 2JTVA 2Y9YA 1K0HA 3OL4A 2LDUA 1FC3A 3AG3H 2KQRA 4C2TA 2OU2A 1A36A 4HQEA 2Y5HA 2H6MA 2YS9A 1DSTA 3DCLA 2IGKA 1PPBH 2RN7A 3WODF 1PYTC 3RPQA 1V2VT 1HJAB 1RKWA 2STTA 2BQ6B 2ZXWH 1L1NA 1QB9A 1C1WH 1L2EA 3GTKJ 2J5OA 1C9PA 6ESTA 2NVUB 3J7ZI 2J94A 1GVKB 3V42A 1QJ1B 3PSFA 1JMOH 2EI7A 4ISHH 2GIZA 1STZA 1SSXA 3L6PA 5DM6F 4X8TH 1A6IA 4FVBA 2P94A 1QRZA 2W24A 1KYNA 2A1DB 3CMYA 2F5FA 2ANKH 2KDZA 2RA0A 3DBRB 2NVTJ 4DVAU 3STJA 2GCHF 1C5NH 1WBGB 4C30A 2W7SA 1O3HA 1ON1A 2ZCKP 3I59B 2G7UA 3M07A 1QRXA 2F9PA 2HI3A 1V2PT 4H4FA 5IYDJ 3OIQA 3UWIA 4FTHA 3LWFA 4A3MJ 2QVOA 3ZPLA 2Y7XA 2EZHA 3L2CA 4Y6DA 2CH0A 2GMTB 1Y3VA 1USSA 3SNBA 2SGQE 1RTFB 1P9UA 3GY3A 1GBDA 5IP9J 1X3UA 3WU2C 3GFMA 3VYUB 1BC8C 2VJ4A 2AQFA 3E0JB 4YM9A 2BLQA 2XAFA 2VLAA 3MU5A 3PIPF 2H6CA 1O2OA 5C2ZA 3LSTA 2KDOA 1UK3A 3M61U 1LQDB 2VWMA 3OEED 4Z2YA 1J17T 1BT7A 1VTNC 2VGCB 3QUMP 5KNLA 1HKQA 2FXRA 3WTZA 1HIAB 3IL2A 2ZDKA 3V0XA 2KJCA 2BHGA 3OY6U 3H35A 1MKWK 3CUQA 1JGGA 3UNRA 1V2WT 4KN7X 2ZHQH 2UUJB 1Q2WA 1C2MA 3SI4H 5F8ZA 2EC9H 4HNUA 1GI5A 2ZFQH 3EA8A 2AYWA 1NH3A 2P5LC 1O5BB 1E0EA 4M6VA 2A4RA 2LOOA 4CCJA 2QKMB 1PDNC 3GZ5A 3W6VA 2A3SA 2PSYA 2ODPA 1QFKH 2AQEA 3GTGJ 8GCHF 1YG2A 4XSXF 2ADUA 1J16A 1C2IA 1EAWA 2R7ZJ 1J5YA 4OGYA 3O8CA 4OS6A 2BX3A 3DA9B 3I59A 1FPHH 4O6JA 2P3FH 2GGVB 2BLVA 4IOCF 1Z3XA 4OAZA 4A0YA 5HDNA 3CCMI 4F3QA 1W1WE 2HNHA 4CUGA 3AASA 4TY7A 2BDGA 4QLCU 4XDEA 1WVRA 3RXSA 1BR4A 1GMHF 2EIMH 2PKAB 5M3MJ 3BTQE 2ZIQH 1HAOH 3FO8D 2OC0A 1O3FA 3HOWJ 3JRGA 3G01A 4C3IJ 4CICA 2DE8A 4PFOA 1TNLA 1Z21A 1K2I1 2VJ1A 2CQKA 1JXPA 3KEOA 3TP0A 2CW7A 1GXQA 3A84A 1POGA 2HQNA 3WGIA 2ZDMA 1FIAA 1ZGWA 4U7BA 2XASA 3RXEA 5ILVA 3NQOA 5DD8A 1P9QC 2KCOA 1MZDA 1ENHA 3V7TA 4ASUD 2RKHA 2LBFB 3SBKA 5DG6A 3SI3H 2BOLA 1UCYH 4KTUA 2EV5A 4X6MA 4IQJA 1NRNH 2D8WA 2R5ZA 5CVRA 2PKSC 4FE7A 4I76A 2DMNA 3JRIA 3AG1H 2FM2A 2XBVA 1OPCA 1T38A 1CT0E 2J38A 3S16J 4UE7H 1Z3YA 4OIPF 2QYIA 5L2ZH 1Q3XA 1JXSA 2ZDAH 5ICCA 4GPGA 2HZDA 1XS9A 3N99A 2QA9E 4PCQA 1QHHD 1KXBA 2VXZA 3K4BA 1TBXA 4BY7J 1I39A 4CR5A 4AVZA 1HAZB 2ZCLP 2Y81A 4ISNA 4UXNA 2FD5A 2HVXA 5CLSA 3ZQCA 4D8NA 1YX3A 3TOAA 4XRMA 1ARBA 3LSHA 1T08B 2VPRA 4EJUA 2KHMA 1Z91A 2THFB 3MFKA 4YOJA 2KIMA 5BMZA 2QY0B 1ODDA 4A6EA 2JVHA 4NQWA 1UW7A 4LB6B 1K1NA 4HW0A 1FXYA 3JRFA 4G6QA 1XGSA 1FJLA 1K1JA 1FTZA 1MJAA 2FOKA 4RB3C 2BLWA 2GIVA 1O39A 1E17A 3BCAA 3S3MA 4IMZA 1S29A 1BIBA 5FB2A 2ZJPF 2EZIA 1MNEA 3IG6B 3MMYB 2L9SA 4BY1J 4DBQA 1LPQA 1VNDA 3M9AA 1LJ9A 1LEAA 4G7OF 3SQHE 4AGKA 2ZXIA 3D62A 1Z6TA 2Z1DA 3LQQA 4IKFA 1FNIA 3F8CA 3RU4D 1ZMNA 2CS3A 4LK0F 3L2WA 5CQEA 3MEXA 2PSXA 2DCEA 2HNTE 3OMYA 1AO5A 4PGHA 1BTYA 4JK5A 1Z6RA 1FYMA 1Y3UA 3A01A 2B7DH 1UO6A 2Y75A 3IH2A 5T3HA 4RT1A 2BW3B 3LA7A 5EQSA 4LK4A 4AFQA 1YI2I 5IP6A 4XONA 2DTZA 3K4NA 1QJ6B 2PW8H 2BZ6H 4BQQA 2XUBA 3SU6A 1E79D 5G4BA 1QPMA 1ZRCA 5LPRA 1UFMA 2G81E 1AHDP 3K70C 1WCZA 3ERMA 4WMFA 5JR3A 3TIUA 4A3LJ 2R3UA 4WY3A 4RKOB 2V6NA 3ZZ9A 2ZNYA 3CCVI 1A5IA 1O2MA 1SMFE 4CZZA 3TEDA 1U2WA 3V7RA 4CREA 2WPHS 2ELHA 1GBCA 2VASA 2DJIA 4X1QU 3UWJH 4MNXA 2IVMA 4NFEA 1TLHB 1GG6B 2IT0A 4CCMA 3CUOA 3RIRA 3E7LA 1D8KA 3CCSI 3HPGA 1PQ7A 2KIUA 1Y5UT 3LSRA 2MC3A 2O8WA 4IZZA 1BBRK 2R7WA 4M7GA 5L30H 4XBFA 5AFZH 2F43B 3HOTA 2VIWA 1L0ZA 1ZN2A 2F5EA 5J4YA 1Z7UA 1W10U 3BZCA 5E3OA 2QQBA 1NBME 3GTMJ 1MKXK 2Z3EA 2FBKA 3A86A 3GYMA 3FIWA 3M4OJ 4H6SB 1OXGA 3K65B 1P4XA 1W2KH 3A7WA 5JBBS 1RR8C 4RM3A 1TQ7B 3AKZA 4FXGH 4RAGA 4K1EA 3U8RH 5D6FA 1O2QA 2I6QA 5EJZA 3IWZA 3JSOA 4NA8A 2M30A 5EGOB 3GTJJ 2RDEA 2M45A 1C5UA 3CS0A 1K61A 2KLOA 2QXJA 2O0YA 5J47A 4AM3A 2DAOA 4ABBA 1M1EB 2MLGA 4SGBE 4RMNA 3SU0A 3BROA 4WF2A 2QCYA 4Z0KA 3GDVA 1MMDA 3K4JA 1QGFA 3F2GA 4HZHA 3OOPA 1UVSH 2NRAC 3ZV9A 2FX6A 1JBUH 1C1OA 3M3VA 5D5UB 2V1UA 2E7WA 1TWXB 4ZC3A 3VPKA 5EIYA 3RMNH 4B1TA 2H9TH 1W7XH 2TIOA 3PUFA 4O3UA 2HPMA 5EEAA 1B9MA 1LVKA 1C4V2 1O3CA 1TBQH 3ELKA 1EZXC 4AIKA 1DUEA 3N7DA 3SHFA 2HVRA 1MCVA 2QIQA 2V6CA 4PJJA 1SGIB 2KM0A 1V2ST 3SNEA 2VJJA 3AL0B 1R71A 4LG0B 3ESWB 1WJFA 3VEQB 1N77A 3E16B 2CO5A 1IOEA 4ABHA 3HK3B 2R7OA 4L5JA 4RI0A 4YO9A 2F4MB 2R92J 1C5LH 7LPRA 4M9FA 1YIJI 3KQBA 3IKVA 2X4HA 4CRBA 4YELA 4LXBH 1SGYE 1A1RA 4CCKA 4ABDA 2FEQH 3KCCA 5E17F 1RESA 2HALA 3DFGA 1MBQA 1JRSA 1UHSA 2ZECA 4IHWA 2W57A 3REOA 2Y31A 2RGVA 3S7HB 4UB8C 5GCHG 4AIDA 3O8BA 1MCTA 1MZBA 3N7OA 2A0QB 5C17A 1O3MA 3H9JA 1IQIA 1G3BA 4FUFA 4X1SU 2B63J 4LG3A 4OS5A 2OC7A 2QXGA 1HW1A 2A5YB 2P5KA 4LZ1H 1O2TA 1FOXA 2H94A 1ERDA 3NPSA 1EJNA 4NCYA 4YLQH 1LHFH 1DXPA 4S04A 1CF7B 4X6NA 4F4OC 1F5LA 1FMWA 2B0FA 1YIOA 1XSXA 3GDSA 2VINA 2ZHEH 2JWTA 3BJAA 5FPTA 4ESFA 1V55H 1QA7A 2CQXA 1DS2E 1A0HB 3P9KA 3VEPA 3DSOA 4I7YH 1D5YA 3S3OA 4W97A 3SZGA 2DDBA 6GCHF 1TBZH 3LSPA 4JYUH 2WV1A 1O4XA 5EJCA 3MNXA 2LTPA 3Q9VA 1YKTA 2GD4B 3NK8A 3U2RA 4CBNA 1E35B 2F9OA 1TNJA 2VT3A 1FLIA 1VQ5I 4ZHLU 1H89C 2BD8A 1HA8A 1TP4A 2VJIA 1GCTB 4HOBA 2DMPA 2V3MA 2VL8A 1T0FC 2XOKD 1G3SA 1IRFA 4Y13A 5J8CA 4KUMA 2OTVA 2WPMS 2LPRA 2GM4A 3E1XB 1BTHH 4I98B 2IP2A 5FKOA 3N97A 1YRNA 3F22A 1YPMH 2X9DA 5HS9A 4Q5SF 1IRZA 1SMYF 1YLCA 2GCTB 4Q7YA 1F9NA 2D1HA 4YOIA 3TW7A 4L9NA 1TC3C 1XSVA 2FBHA 2F3CE 2PFEA 4UEHH 3I4MJ 1ZSKA 4GLYA 1GMHG 1MTSA 2ZFSA 1VQ6I 1C1UH 3C1KA 3M3YJ 3ZVDA 1FAKH 1IQFA 1U5TB 1MJ9A 2MABA 2M8EA 3EGKH 3L00A 4KELA 4OIOF 4UVAA 4H6TA 2L6OA 3HIFA 3J7AO 3V7CA 3SU2A 2BVXH 2XPWA 3WHCA 3ELAH 4UFGH 1Z67A 1LTOA 1BRCE 2CSOA 2CQQA 1GPZA 4JCNA 2GCTC 5K7FA 1W7PD 4HF1A 2H1UA 1BUIA 2XGEA 1I6XA 2OP9A 3BG3A 2O8LA 2BQWB 1G6NA 3PUBA 4KMFA 3CESA 3HBLA 1GHWH 4G6TB 3TL4X 2HDDA 2QE7D 5KGOA 2DU9A 1OWIA 4FUDA 2VQGA 1O2NA 1GBFA 1MMGA 4EGZA 2QCOA 5FJ8J 3G4SI 4BAHB 2E5NA 3T25A 3HOVJ 3MVPA 4K69A 1ONVA 3C2GA 4A6LA 2YPRA 2JRMA 2H8WA 2MA3A 5E3MA 1P09A 5GPIB 2B9SA 3BZKA 4X6AJ 3KNXA 1QQ4A 2LD5A 1CT2E 1BI1A 5HM9A 3BEFB 3GTQJ 4Z1MD 2W3IA 5CKTA 3TLOA 3PLBA 2ZSHB 3RP2A 1VITG 2MG4A 3IRQA 3RXVA 3E5UA 2ZQ1A 1PUFA 1Z6EA 2PKSB 3BWGA 2DOFA 3IITA 4G9YA 3J7YJ 3H5CB 2PR3A 2XWBI 4MPVA 3I3LA 4BNRA 1XGMA 1MBMA 2JA2A 3WE2A 4N9HA 1ZJKA 2CF9H 2NS7A 1T39A 1ZG3A 1FAXA 4RLQA 3T5XA 3T29A 2R5YA 4BHBA 1D0XA 4HG2A 3FP7E 1RIWC 3ZVEA 4C3JJ 2I6SA 1THPB 2MC4A 5AIQA 1E1RD 3HDDA 1QB6A 3Q0WA 4AORA 1YC0A 1B72B 1J0RA 5JBTA 2V1NA 3KHVA 3DEUA 2ODQA 3BR0A 3BR5A 4U88A 5EZGA 1G3CA 3GOVB 2LY9A 4BXSA 2P5VA 2BD5A 3RMMH 1GGDC 4FUBA 2ANWA 1UTOA 2A4OA 3BZ6A 3RYPA 3J7AY 4AZ2B 4YEJA 4K60A 2YU3A 4M73A 3W2AA 2BY9X 4DGJA 3MH7A 1O2YA 2E7XA 2HGCA 1S6HA 4I31A 3DD2H 4ACBA 1O3TA 3LSIA 3KIDU 5DP6A 2F9VA 1X1CA 1TNTA 1Y8QB 4F52A 1X1PA 2BXYA 3Q0UA 4JBAA 1ZELA 1YYVA 1P2IA 3S9BA 2H27A 1FWZA 4C2UA 3PMJA 4B4CA 4PJ0C 3BTTE 1TPOA 3HATH 3BEIB 5E0HA 1P10A 3S15J 1ELEE 1ZZZA 1SG8B 5D4SA 3RXRA 2LNBA 2M7BA 1YITI 2CUJA 4A5TS 4KKDA 1OWHA 1VZ0A 1LDTT 2GT7A 1BJUA 1OFCX 1EJAA 1P2KA 1TE0A 4X1RU 1PPGE 2Z9IA 1N75A 4BL0B 3LMMA 4FVDA 3E6PH 1A4WH 2ZXJA 2AHQA 4RKJB 2JT1A 2ZKZA 1GG6C 3DF8A 1GL1A 3OWTA 3PO2J 4BYYA 1UTPA 2RNGA 2ZSIB 2ETHA 2AGIX 1BM9A 2CFXA 2K40A 1P8VC 4M72A 3TGKE 1C5MD 2ZP0H 3TP3A 2X0LA 2Y48A 5EXNA 1FBQA 3MO9A 3VYTB 5T6FA 4MGRA 3L7WA 5E1WA 3M8FA 1HSJA 1Z0XA 5A2QK 2MD0A 2SGAA 3RXPA 2DE9A 1HAVA 1YE9A 4E7HA 1GMDF 1U5TA 2NU0E 5KK1A 1XTAA 3L09A 1DDNA 3BCBA 2QLZA 5B5EC 1ELTA 1MBFA 1DY9A 2ZHWH 2L7ZA 2VI6A 2A32A 2LVSA 1MU6B 3P6ZB 3OL3A 2P8OC 3O2PE 1YBWA 2HVQA 1ZR4A 1DPOA 2DO7A 2K9MA 5TCCA 2R0KA 4HNTA 1P2OA 2G55A 2PJRB 3RXMA 2E34A 2E19A 2M5TA 1OSSA 2LSOA 5E2OA 1PUEE 4Y8ZA 4XN3A 4IW4E 2VNTA 3QODA 4EEFG 1RIWB 1UTJA 2ALPA 1SFQB 1ELVA 3PL8A 4Y8YA 2H2ZA 1R1UA 3WY8A 1BOQA 1I6HJ 2LP6A 1CGHA 1W7PB 4QPQA 1V2NT 2MBFA 4KTSA 2RA3A 1P01A 3N7EA 3JW4A 2EH3A 2IJOB 1AZZA 4B48A 2FI5E 1TPPA 4MTEA 3RDIA 1O37A 1TONA 1GI7B 4ZHMU 5LLQA 1S7AA 2P6TA 1R00A 2X85A 3HRSA 5E3LA 3PTBA 1SGFA 4L9JA 2X51A 2M4KA 1W11U 3QZRA 2D2WA 1JTYA 1MUEB 4LG0A 1GHYH 4S05A 2V7QD 5GP9A 1VFCA 2EI6A 3FDYA 1SLXB 4XBBA 4CHAC 2FQ4A 1CBWC 3GCNA 3P5JA 3R3GB 5CVJA 2FA5A 1CT4E 1OPHB 1IUYA 2SNVA 2HPPH 3B9FH 2IA2A 2VWLA 4IN1A 3H3ZA 2QC2A 5GPAA 1KDQA 3LJOA 1FPQA 1ESBA 6PAXA 1C5QA 3KP2A 1GVJA 3VXFH 1UTMA 3M1CA 3TK9A 4EJVA 1I3QJ 3GY6A 3M36A 4AN7A 3GTPJ 4BHPA 1Y56A 4Y71A 1B6AA 1Y59T 3LONA 5DD4A 2WC2A 3ZOBA 4ENNA 1PJRA 2X6XA 2AGEX 2QA4I 2BY0A 2HDWA 1QA6A 4XN0A 1TWCJ 1GI2A 5FGMA 1WYKA 1OWDA 2AMPA 2QSGX 1KONA 2ZPRA 1NPMA 4Q47A 2BEOA 2ZWLH 4LOCA 2BLOA 1IHTH 3MZ8A 3A8AA 1DP7P 4A3GJ 2SFAA 5LGNA 5EW2H 4PROA 1GJ9B 1ETWA 1A31A 4CH8B 3CS7A 4EGYA 4AD9A 4XLEA 2KFWA 2NOJB 4TT3D 3FKJA 2M5WA 1PPZA 2L9RA 4XK4A 3QO6A 3H36A 2DOEA 4PFPA 1WH5A 2W85A 1BRUP 3CCLI 3IWFA 1F7ZA 4CCNA 4WWCA 1EP6A 4KT6A 3JRDA 3U1IB 1LFUP 2WAEA 1CQTA 1BW5A 1JKRC 1R23A 4HYEA 1SGDE 1T8IA 3HSFA 2F9BH 1K28D 3OYIA 2HU9A 3I56I 4MQAA 5C1XA 1T33A 4FX0A 3SV2H 5C94A 1W5CC 1AWHB 1C1MA 2IPHA 2OA4A 3FOAA 1C2FA 5CQGA 1XVMA 1UJ1A 5DUIA 4B2AA 1WRJA 3I0TA 2ZB9A 3GICB 1YPGH 1FBUA 3JSPA 1OS8A 1AWFH 1X4OA 1N8OB 5GJ4B 1APLC 3SXYA 1T2KA 3FK6A 2GKVE 4OS1A 3KYGA 5JDUB 2ZG0H 4KDPA 3QGNB 4ZH8A 1P0SH 5L3EA 3LGWA 4Q7XA 2QYOA 1VQPI 3JZ2B 4MQVA 2STWA 1ZTLA 3BIUH 2VWNA 2AS5F 1T8MA 4CYCA 2OD5A 1Y6IA 2WAQA 4GYIA 1YPKH 3VDXA 2NU4E 1BJAA 3FF5A 5DP8A 4E6KG 2BZAA 1HXEH 4ZTJA 1FY1A 2VE9A 3MKZA 3TJOA 2EJRA 2Q6DA 2W26A 1P92A 3KX2A 1ZG5A 3AG4H 3F21A 4TPIZ 1VCWA 4NIXA 2GJGA 4KJZA 2P8OB 1XUFA 2AMDA 1T6SA 5C1UA 2HQ5A 1QL7A 5JYIA 2JA7J 2ANYA 3DSGA 2BVLA 2OJED 1HRTH 4YG2F 5HS7A 1B59A 1ULYA 2ZJRF 1W4MA 3TDUC 4J1YA 1RJXB 4J01A 4DT7B 1FLEE 3GCHC 3I4PA 3A02A 4JZDH 1QURH 3K1NA 1EQ9A 4DIQA 2FODA 3IHUA 4KMUX 1ZRKA 4D7FA 1G59A 4HZFA 4TV7A 2CMYA 5GDSH 2EI8A 4WXIA 4AYYB 2DODA 2RREA 4YT7H 2PLXA 2DI3A 2Y80A 3OOUA 2WV5A 5D8KB 4ZAEA 1GBHA 3F9GA 4AFUA 2UUFB 3EQ0H 4IQ4A 3CUQC 2ZMEC 3K0LA 4ZMAH 3E5QA 2FZZA 1UG2A 3PM3A 4DT4A 4GO1A 2Z6BD 1IAWA 3AFHA 3CJRB 1XUIA 4MPUA 2JH5D 2K3FA 2PKAA 3K4KA 2XAHA 1A0LA 1Y0NA 4SGAE 4OGXA 3IP4B 3SQEE 1BTXA 4XE4A 1ANEA 4B1RA 2VIOA 4CYCB 1HOMA 4I01A 4O97A 1BC7C 3UR6A 3Q3XA 5JVGF 2HTJA 4MIMA 1FYKA 1TPAE 1EZQA 4A7IB 3A85A 2VIVA 2XCNA 1W0YH 1MTVA 1ZSLA 1EH7A 2EFOA 5F08A 3NKKA 2OLGA 3WTYC 3QU3A 2ASUB 3MQKC 1ETKA 3JTGA 5LEJA 4D1QA 1J9CH 3S14J 1MTNC 2R5ZB 3RSNA 4A12A 4M3DA 1VQKI 1SFIA 5A8YA 3VB5A 1IRGA 1HV7A 3FXRA 2HVYB 1H8IH 1D1CA 4U0WA 1F5TA 1D4PB 3MN2A 3P9CA 2P8TA 3K69A 5ABWA 2KIQA 3BOQA 2ALVA 4R1HA 1D8JA 3ZZ3A 4BTUB 2ZMEB 1VI0A 3V8LA 5C20A 3RLYH 1PYTD 4PGGA 1DLEA 2AIQA 1JUMA 1S5SA 1WJDA 3FZDA 5F27A 3ESTA 4G7HF 2BY1A 1R58A 4DOQA 1O0DH 3GY5A 3KETA 2HFHA 4XL9A 4O9VA 1NHAA 1QB1A 1PUFB 2A7HA 1GHVH 2FLBH 5ESBA 3FZZA 1UCRA 5H20A 1JE8A 4BUPA 3ISPA 4YRVA 1ZAOA 3WHBA 2EY4C 1VKYA 3ZZBA 2ZHFH 1X58A 2ULLA 2RVCA 2OQRA 2VIPA 3B6CA 4J00A 2H5DA 2VBWA 1O2ZA 3R61A 4RB2C 3CENA 2TRTA 1O2PA 4B8XA 5IYTA 1FMVA 3VODA 1NT1A 3GYLB 1AUJA 2F4OB 3KQEA 2XC7A 2Y5FA 1V2TT 1GMDG 4RT0A 3QWLA 1W3CA 4Y15A 1QTFA 3CCJI 3KP7A 1TQ0B 2A61A 2GAUA 1C4U2 3E91A 3P95A 4IHVA 2EFQA 3F8NA 5KEDA 2E71A 4HX8A 1YP9A 2HRVA 3NARA 1MMSA 3W95A 4RM2A 3F23A 3UR3C 2IN2A 3O3KA 5D5VB 2VBXA 2Y2ZA 4RAYA 1UCYK 4UFFH 2V26A 1Y8RB 2JMWA 1OR7C 1SAXA 1N78A 2QWWA