1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Alkylmercury lyase
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
1K78A 4IHSA 1T6SA 1OMIA 5ICCA 4GGGA 5BS6A 3D0SA 1XSDA 1KQ8A 1YS7A 1SD6A 3E5QA 1UB9A 1G6NA 2DLLA 3C3WA 2P5KA 2ZBKA 1LJ9A 3KE2A 1T0FA 4KT5C 2YU3A 5FO5A 1I1GA 1D8JA 2BGCA 4RAYA 3U1DA 3Q9SA 4A12A 2AS5F 2E1NA 2FQ3A 3DPLC 3FXQA 1P4AA 1R1VA 3F6OA 2M1BA 3PFIA 1YW7A 2HWVA 3BWGA 2C6YA 2EFQA 4RGUA 1HW5A 3TOBA 4H0EA 3WTVC 4ZYEA 2F5EA 4XLPF 1ZG5A 5D6FA 2EFWA 1BBYA 4HV5A 4EJWA 3RYPA 5HOOA 5DEQA 4U88A 3TO7A 3BROA 3MFKA 4MTEA 1LEBA 4Y17A 2M45A 2CSOA 5FGMA 4IF4A 1ZRDA 1ZH5A 1ZLJA 3TDZC 4CZZA 5IT9K 2GIVA 2CYYA 1R1TA 1S7AA 3S2WA 1ZREA 1O3QA 3WTTC 3IWZA 4KN7X 3KLOA 3KEOA 3CUQA 3FXRA 2MC3A 1MDMA 3OOPA 3K0LA 3I71A 1AWCA 2OBPA 4M73A 2XAJA 4AIJA 4OIPF 1R36A 5BPDA 1R58A 4PCQA 4U0YA 2JT1A 3I58A 3TGNA 4YFNF 1R1UA 4ON0A 1D3YA 1USSA 5A2QK 2JZYA 1EH6A 1SFXA 2YX4A 2DQLA 5D4RA 5D5VB 5L3EA 2K86A 4EJOA 5J8FA 3RJPA 2RQPA 4HF2A 4ZZDA 5ERIA 2XV4S 1SD7A 2PQ8A 1D5VA 1K6OA 2FSWA 3BP8A 1FBQA 3QPTA 4HX8A 4A5NA 2FXAA 3ELKA 4LD5A 3HHGA 4RGSA 1U2WA 4YFXF 3G3ZA 4IRGA 2PBIA 2G9WA 5ILVA 4RB2C 1W7PB 1ZN2A 2WC2A 1XD7A 1YQAA 1RUOA 3QU3A 3V8LA 4M9ZA 2ETHA 4YIIA 1REPC 4BXUA 3IRQA 3I5UA 1JHFA 4ZYDA 1LDJA 2GA2A 2QENA 4IHTA 4KIBA 1TNTA 4XLNF 2QM3A 1LQ1A 2M5WA 2EA2A 3ZMSA 2G7UA 4Q48A 2RDPA 4NHJA 4EM0B 2D45A 4KA4A 3VOEA 3CUQC 4LB5A 4A0ZA 1FWZA 3WG9A 3TQNA 1R00A 5DUIA 2ISZA 4R8HA 1TLHB 2YX7A 1QQIA 2HTJA 4BQAA 4EGZA 2Z33A 4M6XA 1MJAA 3F8FA 2F2EA 5CYVA 3ZMZA 2PMHA 3H92A 4PZJA 3EYYA 2ZJ2A 2MLGA 2VOPA 2D1VA 5L3DA 1IXCA 1KU2A 2R7DA 3KP7A 2KIUA 5E1WA 3RKWA 2P5LC 4GYGA 1RUNA 3ZMTA 1FSHA 4M9SA 4HX4A 2P6TA 2F5CA 4MNUA 3RIRA 1QPMA 1HXDA 2XVCA 1P4WA 3ABUA 2CWEA 3O6BB 1IN4A 1S6LA 4IPAA 5CJ9A 1DUXC 1J2XA 5LLQA 1PUEE 4UNOA 1BOAA 5K5QA 4HA8A 1DPUA 2EK5A 4MTDA 2CQKA 5D5WB 3DKWA 4IRHA 3EUHA 2IRFG 1HBXG 2UZKA 1K79A 3QAHA 3ECOA 2CFXA 2DT5A 4HYEA 1G3YA 4YFKF 1H9TA 3FM5A 3HOSA 2E7XA 3FMQA 1BI2A 4ENJA 4LK1F 2EFNA 3ZMDA 2COMA 4EJTA 3K69A 1BJAA 1J75A 2CGPA 3IC7A 2O8XA 2VT2A 1J0RA 1YG2A 4HLXA 1XSVA 4ETSA 4XBFA 2DU9A 3LFKA 3I53A 4LLGF 4HAMA 3I59A 2M87A 2QYOA 4OU0A 3F72A 4Y13A 5J8CA 1MJBA 2OZUA 3LAPA 3IWFA 1O57A 1MGTA 4DNCA 3JSOA 5TJJA 1QBJA 1JHHA 5CVIA 5JR3A 1GXPA 1G3TA 3JW4A 5D4SA 1H9GA 3ABTA 1XN7A 2XUBA 2W57A 2IA1A 3D5LA 2DBBA 4BH9A 3LA7A 2FMLA 3WTXC 2H09A 5JI6A 4OOIA 2L54A 3LSTA 5J6XA 1X3UA 5FLXK 4EM2A 4XSZF 2KKOA 5AONA 3P9KA 4ZZLA 1IZ1A 1HQCA 2IPQX 2XASA 1PDNC 5HLIA 4A6EA 4G8XA 4CXFA 4UVBA 3VB2A 4WK8F 1YYVA 3C7JA 3E6BA 2UXXA 3MCZA 1ON2A 4WF2A 2XAFA 4HW0A 1KQ9A 2GXGA 2DTRA 3HYIA 3R61A 5LRSA 2DFIA 3L7WA 4L9JA 1OR7A 3HSEA 2BEOA 2P7CB 2MA3A 2JSCA 3E97A 3WU1B 5F6FA 4L5JA 1XB4A 5KVRA 1FP2A 4IRIA 3ROUA 4B8XA 1WQ2A 2ACJA 2X4HA 4OIRF 2QBYA 2K27A 4BNCA 4OINF 2D2WA 2Y0MA 4EV0A 1FYMA 3PQKA 1MDMB 5LHGA 1FP1D 1R7JA 1V4RA 3R60A 5D8LB 1B6AA 3GO5A 4MEYF 2ELHA 3ZQ7A 3RI4A 2YSRA 3DQVC 3C1DA 1IXSB 1GVJA 4AIHA 2H27A 2V9VA 3ZMUA 2RVCA 1K7AA 3HTUA 5ICGA 2A6HF 3VFZA 1F1ZA 5CVRA 4OMZA 2LDUA 5CLSA 2ADUA 2WV0A 2VBYA 4KFCA 2XROA 4QLCU 4KNYA 4BHBA 1HW2A 2V6CA 4L0YB 2BE5F 4S04A 4UVAA 5LBQA 1WRJA 1YW9A 2E1CA 4JBAA 1IN6A 2DK5A 3L09A 2PN6A 1HKSA 3R0JA 1HSTA 1Y0UA 5HLHA 2MH2A 1HKQA 2KJCA 1IRFA 2FBKA 2ISYA 4NB5A 1GHCA 4LG0B 2DPUA 1T98A 4G7HF 1U5TB 3FM3A 3ERED 2Y48A 1DP7P 2Z5UA 2QUFA 2VBWA 1SFEA 2WTEA 1OYYA 4LB6B 1ZG1A 1U5TC 3LAJA 2R7FA 3RPUA 2VODA 2XAGA 3DV8A 2W85A 1MD0A 4L5IA 5ED4A 2ZXJA 4WXDA 1VTNC 3FHZA 2VT3A 1QZZA 4A2UA 3HIFA 3BJ6A 4ENKA 2QWWA 2HS5A 3F8BA 1Q1HA 3ECHA 3PQJA 4ZH4F 3CTAA 1OPCA 4NQWA 4U0WA 1SD4A 1OYIA 5E1XA 1F5TA 3B02A 4I2OA 3FMRA 2OU2A 3BDDA 3QU6A 2OZ6A 3GFMA 3V7CA 4L0ZB 3NEUA 5HDKA 1UCRA 3J81K 5HDGA 4M74A 2IW5A 3Q5FA 2M8EA 1BC8C 2RKHA 3V7SA 2HKXA 4LK0F 3R4KA 5IT3A 5H6QA 3ZP5A 5LRRA 5DCFA 3DP7A 3RKXA 1WI9A 3ML6A 3F22A 1BIBA 1E2XA 1R22A 1TW2A 2JPBA 2IA0A 3KP5A 4I01A 1E17A 3HHHA 2XAHA 3V8KA 1I6XA 3LA2A 3T8TA 1QZYA 4FX0A 3CO7C 5A2QZ 3KP2A 3IKVA 4L9VA 1Z1DA 4BYYA 2G7HA 4KIGA 1IN8A 2XRNA 2H6CA 4L18B 2HQRA 3M1EA 4N9IA 2RC4A 3TDUC 5E1ZB 3KFWX 4HDUA 1J9IA 3TO9A 2EV0A 2V1XA 1XCVA 2HOEA 3GFIA 1FBUA 2Z99A 4RB0A 4Y15A 2F5DA 2OA4A 2ZMEB 1U6GA 1K78B 2LKPA 1YFHA 1WWXA 2GA1A 5L3GA 3P9IA 2PFBA 1ZRCA 1LNWA 4JQFA 5F64A 1B4AA 5EEHA 1EH8A 2L4MA 1L0OC 1FT9A 3WODF 3TO6A 5DDGA 2A68F 3RDIA 3E5XA 1O3SA 2HDCA 5HDNA 4K2EA 5FB2A 4GCVA 2VE9A 3K1PA 2EFOA 3L9FA 2EB7A 1ON1A 3F8CA 4EJUA 4AD9A 1O7FA 1W5TA 3WTZA 1BM9A 1Z7UA 3MZHA 4KDPA 2X0LA 3AAFA 1USTA 1F9NA 3CJNA 2Y75A 3LWFA 1MKMA 1T38A 4HX7A 5FD5A 2STWA 1ZARA 4A0XA 2QQAA 1U5TA 4XSXF 3TKYA 2QLZA 2MBFA 3EQLF 1LEAA 3I64A 5D8KB 2DI3A 1ODDA 3BPVA 2VC0A 2ESNA 2RGVA 1FSEA 2LNBA 4KMFA 4U0VA 1XMAA 2WWYA 2K4JA 3BZ6A 2Z3YA 1A04A 4IVNA 4PGHA 1W5SA 3IRRA 3IHUA 3BJOA 1TNSA 2ZCWA 3GUDA 3EETA 4MQ9F 3J7AO 5H6RA 1CF7B 3QPHA 2CO5A 2QBYB 1ZLKA 2PMUA 1ZYRF 4CGZA 3E5UA 4YIFA 2RN7A 2IT0A 3P9CA 3GF2A 1CGPA 3KETA 1KU9A 3U9GA 1T2KA 1B9NA 5JVTA 2FNPA 3Q9VA 4KICA 2VE8A 3DXJF 5HS9A 1FY7A 4HQMA 4P5OA 1ZGAA 2VONA 3HOTA 1J59A 4IXAA 1PP7U 3EYIA 3J80K 5ILSA 2HR3A 1JGSA 4Q47A 1TW3A 1OYWA 1C0WA 2V1UA 3HRSA 3JAMK 5LHIA 2HTSA 1GXQA 4EJVA 2DO7A 2HGCA 1XCBA 4WX9A 3OV8A 3N4MA 2B0LA 2FBHA 4CHUA 2EV5A 6PAXA 1FLIA 1JXSA 2VBZA 5BOXA 4HF1A 2Q0OA 4OIOF 5JHUA 4FX4A 2P5VA 2FOKA 2GXBA 4R1HA 2DK8A 5E18F 2R3SA 2ZO4A 2TDXA 3B73A 3RKYA 2NRAC 3WTWC 1BN5A 2NNYA 1U3EM 4AVPA 2P4WA 3WE2A 3KEQA 1SMTA 1P2FA 1R5GA 4EM1A 1IW7F 3I59B 2MD5A 4P9UA 2W24A 3HRUA 4KIFA 1B9MA 5ILUA 3SZTA 2HFHA 4BHPA 4I7HA 5E8IA 3M7GA 2PG4A 3V4GA 2DPDA 3SZPA 3T0YA 4RS8A 3IL2A 1I1SA 3JTHA 1R5HA 1ZG3A 2Q8KA 2VC1A 3IKTA 1IUYA 3VODA 2EJRA 1F4KA 3KZZA 3GXOA 1YIOA 3QRFF 1RZ4A 1CF7A 3R0AA 3RYRA 1G4DA 2ZFWA 3VEPA 2FF4A 2OD5A 3MAJA 4LJZF 1SFUA 5D6EA 1KYZA 3WGIA 3GFLA 1EH7A 3SHFA 4HDVA 3GZ5A 5LGUA 4R79A 2BYVE 5AIPA 3LQQA 1IRGA 2ESHA 4L9NA 2BV6A 4G9YA 1XGMA 1AOYA 4GO1A 3WTSC 3V7RA 2A6EF 5D5UB 2UWMA 3HSFA 2XAQA 1QO0D 1XGNA 3I0TA 2FA5A 4WWCA 1O7LA 1JE8A 2L01A 4ASNA 5HVQC 2H6BA 4I09A 3KLNA 3CUOA 3P7NA 3LQRA 2A61A 3L00A 1BIAA 1SAXA 3KCCA 4ESBA 1LB2A 1SMYF 1RNLA 5HLGA 4HQEA 4RB1A 3KP3A 3K1NA 3NRVA 5E8GA 4I0BA 1IAWA 5BQTA 2W84A 4L9TA 4CO8A 3I54A 3RPQA 4QWQA 1W4MA 4D0PA 4UHTA 3WGHA 3SFZA 5D5XB 3FZVA 1KGSA 2EFPA 1TQPA 4UXNA 4S05A 4G7OF 1YTYA 5E17F 4I02A 2JRTA 3H3UA 3MQ0A 5L3FA 3MEXA 4I98B 4LLLA 1OKRA 5CVJA 3COAC 4AIKA 1QGPA 4HZFA 2Q2EA 3QP5A 2NYXA 1KQ0A 2KIFA 2HKOA 5K1YA 3F6VA 2E7WA 3FXUA 1Z9CA 3E6CC 2DW4A 4WXHA 4O6JA 1IN7A 2GWRA 3REOA 4LMYA 2K4BA 1B1BA 3WU0A 3J81Z 2IP2A 5IT9Z 1XDUA 4RB3C 4G6DA 3QOPA 2JTVA 4U7BA 3F3XA 3C18A 2EA4A 4WCGA 4PGGA 1BC7C 3E6MA 5BMZA 1O3TA 4M71A 4MHGA 1HW1A 1UFMA 4LFUA 4HV6A 4HF0A 5FLXZ 1XGOA 2GAUA 2V1DA 4A6DA 1YO5C 1FZPB 1FX7A 2LSOA 4O3MA 3F8NA 4RGRA 4MEXF 1ZHFA 5TRDA 1ZRFA 5FFXA 3WTYC 2FRHA 2O61A 1LVAA 2NAZA 1O3RA 1YW8A 2IJLA 1FPQA 3ZMVA 1XSXA 5FD6A 1FYLA 1V3FA 1S8NA 1TQMA 2ZNZA 3H3ZA 2A5YB 4ENNA 3ZPLA 3WE3A 3SQNA 4GXOA 2EV6A 2XKOA 3DEUA 3NQOA 2STTA 2DQRA 3GVAA 3O3KA 2HZTA 4ESJA 5LGTA 3GFJA 4G6QA 2VN2A 2O0YA 3F23A 1P92A 3L2CA 2VXZA 2J5PA 3W6KB 1BI0A 4Q4ZF 5L3BA 1I5ZA 3GEZA 4Z2YA 1TQIA 2FEZA 3GW2A 5EEGA 5JFRA 3WTUC 1XMKA 1PP8F 5CVVA 1J7KA 2FMYA 3BPXA 4EMSA 1FNNA 4OIQF 2JPCA 2FE3A 2DAOA 1Z91A 2LF8A 5DCMB 1LDKB 4XRFA 2P8TA 3GX4X 1H0MA 2RNJA 1J5YA 4M9XA 2QZ8A 4WXCA 5LEJA 3T8RA 4RGXA 3T5XA 5DV5A 2KRFA 1U8RA 3M8FA 3JAMZ 1I27A 3FWEA 5KK1A 3ZN0A 3MZYA 4F7ZA 3KZYA 3O2PE 2D1HA 1UHMA 2F5FA 4KN4X 5E20A 1S7OA 2MLKA 3N97A 5HS8A 2L02A 2PJPA 5H20A 5ICEA 4EGYA 4KUMA 2A07F 1L3LA 3HTSB 2BBYA 4TV7A 4LG0A 2IA2A 3KP6A 1UHWA 2KJBA 2L4AA 3R6SA 3CUQB 2ZKZA 2HYGD 4CDGA 2CW0F 2NS0A 2YR2A 2NNNA 1G3SA 3JSPA 3K2ZA 5ICFA 4BHCA 3K9TA 4UV8A 2Z9OA 4KMUX 3CDHA 1BI1A 4N0BA 1MZBA 5CVUA 1DDNA 4KYWA 3DF8A 4I0AA 1RIOH 5LGNA 1DPRA 2XKPA 2V79A 3BY6A 2UXNA 4FHTA 5LEKA 1IF1A 3HRMA 4LLNA 4OMYA 1KU7A 2XIGA 2W25A 1W7PA 2OQRA 2FBIA 2H94A 3RTRA 4A5MA 2HYFA 3EDPA 5HS7A 1IN5A 3J80Z 3WGGA 1BI3A 1EV7A 3MWMA 4ZYGA 4P55A 4EQQA 1Z6RA 2OAZA 2PLYA 4CYDA 1FYKA 4EVIA 3F21A 3ZN1A 2QQBA 2OQGA 1ULYA 4HOBA 3FF5A 3W6JB 2P6SA 4P96A 2MH9A 2GZWA 3BOQA 3SXYA 1WKMA 3T1BA 2A3SA 5DD4A 3DPTA 4ENMA 1ZGJA 1WSUA 2XHKA 3GZ6A 1KA8A 2M30A 3BJAA 2YPRA 4LGWA 2PEXA 2O03A 4G94A 4HLYA 4GYIA 3HSRA 1STZA 2K02A 3M9AA 3LA3A 1TTYA 5AIQA 1P4XA 4PDKA 3FX3A 2VBXA 1T39A 1G3WA 2QQ9A 4ESFA 4U7DA 2XGXA 5L3CA 3TOAA 1LDDA 3E6DA 1XGSA 1S29A 4N9HA 1Z6TA 1R23A 5DYMA 2GQQA 4FT8A 4M6YA 1YLFA 4MGRA 1NHAA 5FFZA 3KP4A 3I4PA 3ULQB 4B09A 3M8EA 2VOOA 1P6RA 4RAZA 1TBXA 5BPIA 2ZMEA 1FOKA 1RI7A 5DCMA 1MJ9A 2EWNA 2K7LA 4Q5SF 2CG4A 3ISPA 3K1MA 1ONVA 1HKTA 5DUKA 4M72A 2LF7A 1S3JA 4E70A 3HUGA 4YG2F 2FNAA 3GYHX 3G73A 1SD5A 3QP6A 3V8JA 4BAYA 1QNTA 5K5RA 1Z05A 2QVOA 2O3FA 5F1RA 1YS6A 4HBLA 4AWXB 4O5VA 4UUVA 3F8MA 3FMSA 2HEOA 2P7VB 1ZAOA 3CLOA 3GWZA 4UVCA 1FBSA 4CICA 2ZNYA 3GLXA 3U2RA 1FC3A 2AXLA 1HSJA 1U78A 2RV8A 5LHHA 2PI0A 1XDSA 5DD8A 3HRTA 4IJAA 4P9FA 1KYWA 2O6GE 4G7ZF 1D8KA 3CO6C 2KIMA 2FU4A 3DFGA 3E3VA 1B59A 2IVMA 4ZYHA 1KU3A 2L3DA 4UV9A 2J5OA 3JTGA 4A0YA 1W7PD 4DQ2A 1IXRC 5K5OA 4MQVA 2HQNA 4JK1X 2A69F
chains in the Genus database with same CATH superfamily
2P94A 1EKBB 1KONA 1MQ5A 3ZVGA 1IQIA 1YS7A 3E5QA 3C3WA 1DX5M 2TIOA 3KE2A 2YMSD 1XPXA 3RUOA 1GCDA 4B4CA 1D8JA 3OYHA 1WJ5A 3U1DA 1GBKA 2UWPA 2AS5F 2FQ3A 3DPLC 2EA3A 4A3BJ 2A7JA 3OU0A 3HEFA 1R1VA 1X58A 3F6OA 1FY4A 1X7AC 1EX3A 1OCCH 1YW7A 4DW2U 1SGEE 3BWGA 1XVOA 3QN7A 3STIA 3DEEA 1YE9A 2FO9A 1NO9H 1HW5A 3WTVC 3MKLA 3HOXJ 1SMFE 2EFWA 5F8ZA 1IQMA 2IEKA 1UZCA 1LHGH 1XUKA 2SGPE 2HOSA 3KQEA 1AKHB 4NSYA 1JBUH 3BROA 3NWTA 3A0BC 1AZ8A 1LEBA 3OS0A 4Y17A 3OYKA 2D5VA 2XYAA 4BQNA 2CSOA 1FXYA 1J9CH 2FOCA 4IF4A 1MMGA 2XCFA 2OQUA 1H9LB 1LE8B 5C4XJ 1NFUA 3ATLA 4KN7X 4X2WA 4IOAF 3KLOA 4A3LJ 1P2QA 3M7QA 3Q76A 2DJIA 1WCZA 1VNDA 1GBTA 5E3OA 3MOCA 2MC3A 1EJMA 2KZ4A 3OOPA 3K0LA 2KIQA 4B2CA 4Q7XA 2XAJA 4OIPF 5BPDA 4XLHA 4U0YA 1XXDA 1Y1WJ 4F49A 2ZCKP 5CQGA 3AL0B 5A2QK 3R0FA 5GP9A 3ZZBA 3S1NJ 1O32A 2GOMA 5KHDA 2YX4A 2XWAA 4J19A 4PSXA 4UB8C 1ZRKA 2JIZD 5L3EA 3URDA 1U9NA 3FKJA 1BA5A 1GMCF 5ESTE 1Z67A 1MH3A 1A61H 4HF2A 1MAXA 5J1UA 3DBRB 3SU2A 1K6OA 2FSWA 1TGCA 5CHAC 3BP8A 2M0MA 1O2UA 5GADJ 3V0XA 1E0EA 3QPSA 3BQYA 4HX8A 5F27A 2FXAA 3ELKA 4YFXF 1NTPA 1NG6A 3W2WA 2OTJI 5EZHA 2V9KA 1ZN2A 1L4DA 1S5LC 4XSKU 1INCA 1XD7A 3Q0VA 1RUOA 3S3OA 4YT6H 2ETHA 1Z1IA 1RRJA 1UVUH 1WU1A 3GTOJ 2J98B 2GA2A 2QENA 1SFKA 4INKA 2B7DH 1I50J 2R5ZB 2QM3A 1QVTA 1TGSZ 1LQ1A 1C2HA 2VQGA 2DOAA 2KFDA 2G7UA 2FP7B 4NHJA 4F48B 1UTKA 2EC9H 2D45A 4YOGA 1DXWA 3VOEA 3UUZA 3ZIAD 2V7QD 2O8WA 2AGIX 1ZR0A 3WG9A 2FYQA 4GLYA 2FXRA 1GHYH 1X4OA 2CV0A 1VR1H 2YX7A 1Z6EA 2CQNA 1OOKB 2HI3A 3EE0B 3GCNA 2ZKSA 3F8FA 4CHAB 1BBRE 1EJNA 1E35B 1BRCE 5GAHJ 4PZJA 2DFHA 4RM3A 3I77A 2ZPQA 5B6LA 1CT2E 2ZJ2A 3OAAD 1NH3A 2VOPA 2E1MC 2ZGJA 3SNDA 1IXCA 2KIUA 3H7OA 1AB9B 4A69C 4KTSA 1P10A 5BPEA 2XAUA 4Y76A 4MTBA 1FAXA 4ISHH 2UV1A 4M9SA 2HLCA 1OCOH 4WF8A 1HLVA 2CMYA 1LCYA 3CCUI 1HXDA 2XVCA 2CWEA 3O6BB 1NM6A 1QHHD 3P6ZB 3ABMH 3EE7A 1ZKGA 1UG0A 5CJ9A 2XF7A 3OS2A 1SAUA 2O7OA 1EOLA 1J2XA 5LLQA 4BY7J 2VKDA 3WU2C 1TGBA 4ASHA 4B6EA 2VKVA 1DPUA 2L9VA 1ZTJA 1DY9A 1O3MA 5D5WB 1YLCA 4IRHA 3TNTA 3SNAA 1HBXG 1G2LA 1FIWA 1JJ8C 2CFXA 2DT5A 1AWHB 1Z1JA 5GTHC 9ESTA 2E7XA 1L1GA 1XX9A 2BMGB 4ENJA 1K1LA 3TITA 5HXFA 3OYDA 3ATKA 2FYRA 4DBRA 5IPAA 2GM4A 2DU9A 3I53A 4LLGF 1C4Y2 3I59A 2M87A 2QYOA 3SNEA 4B3XA 3F72A 4I31A 1DITH 2E19A 5EZGA 5DP5A 2QSGX 1ZGWA 5CDFE 3GY8A 3JSOA 5A8XA 1JT0A 3OL4A 1MTVA 5C2ZA 3S9AA 5EW1H 1PPFE 3EPZA 5E0JA 1H9GA 1XN7A 2H1LA 1Y3VA 3D5LA 1HAOH 3ZQGA 3JRIA 4AIDA 1C1PA 3BTFE 5TCCA 5DK1A 1UCYE 5FLXK 1TPOA 4JYTA 2FTLE 1TALA 2Z2SB 5GPCA 4ZDOA 4K1SA 3HGPA 2XASA 3DBHB 1PDNC 1IQGA 2GZ8A 5HLIA 3UR9A 4FU9A 1Y5AT 4WK8F 4UDWH 4M7GA 1DUEA 1OWJA 1YPKH 1ON2A 4Y11E 3A7TA 1APLC 1MW7A 1KQ9A 1OWHA 2DTRA 3FP7E 3L7WA 3BTGE 2FI3E 1JMOH 4HI3A 2XB0X 2JSCA 1MCVA 2BD2A 5LGOA 4FETA 4FU7A 1BJUA 1FMGA 4OIRF 2CUZA 1TRNA 2K27A 4OINF 1KMHB 1ANEA 3MHWU 3S7KB 5FJ8J 5KECA 3OTPA 5LHGA 1O2LA 3CC2I 1A31A 5D8LB 2BQ7B 2ELHA 2F4LA 3DSGA 1R4MB 3PRDA 5J3LA 4J00A 4ABDA 3NK8A 3SUEA 7GCHG 5K7HA 5EQSA 4AIHA 2XBXA 2DTZA 3PMBB 1OISA 5ICGA 1FY5A 2OC8A 2AERH 3OSFA 2EINH 1YI2I 1F1ZA 1DGWY 5CVRA 5CLSA 2ADUA 1OP2A 2VBYA 1YM0A 2V6CA 2ZPRA 2EI6A 1ESAA 1ABIH 5LBQA 1WRJA 2OC1A 2E1CA 2RNGA 4O03A 3JCUC 3RU4D 1IN6A 2DK5A 2XC4A 3L09A 3MQKC 1HSTA 1Y0UA 5HLHA 2M5TA 3DD2H 2MH2A 2KJCA 4BE1A 2FBKA 1MNDA 1U9OA 3TL4X 2LPRA 4NB5A 1QZEA 1GHCA 2X1CA 3KYGA 5GPIB 3CCMI 3OY6U 1VQ4I 1SGIB 1ETYA 1F7ZA 1OS8A 3FM3A 2OCEA 1W0YH 3RSNA 4NA8A 5E3NA 1O2SA 2QUFA 2BY7X 2DN0A 2VBWA 1OYYA 1RIWC 2OC7A 3LGIA 3W95A 1F0UA 1VQLI 1V2MT 1ANBA 3URCA 3DLAA 3OYFA 3ZZ5A 2DFFA 2ZXJA 2GMTC 2VT3A 1BTHH 2IGNA 3GOVB 1WJBA 3KIOA 3HIFA 3BJ6A 2QWWA 4E7KA 2DYSH 2XW9A 3TJVA 4JK5A 3OEED 3ECHA 3PQJA 3VYSB 5A09A 4BNRA 2PHBA 4XN0A 1SD4A 1OYIA 5E1XA 2B63J 2LH9A 4I2OA 4ABJA 3BDDA 3U1KA 3RZOJ 1OQYA 3AG4H 2ZGCA 1Y8RB 1BW5A 3HGNA 2ZCLP 3PSIA 3V7SA 2HKXA 1SL3A 4HNTA 2IJOB 3M3YJ 3SU5A 5H6QA 5DP7A 1DU6A 5LRRA 1O3LA 3BN9A 1EP6A 3M5MA 4SGAE 3KEYA 1BTUA 4ABIA 2JPBA 3HPHA 1UVOA 2EI7A 1X3ZB 2BY5X 1W12U 2BVRH 4FX0A 2QEXI 3CO7C 1V2OT 3TK5A 1AFEH 2HPPH 1NRQH 4L9VA 1Z1DA 3NZIA 1TAWA 1WHUA 4ZAEA 1IN8A 2JJ2D 1XS9A 1C2IA 1GBIA 1DWEH 1J9IA 3M5LA 1GJ4H 1XCVA 3OYCA 3GFIA 3Q0UA 2Z99A 2E2IJ 3GTKJ 4Y15A 2JVGA 1YJ9I 4PJNA 1BTXA 2SNVA 2R7RA 5L30H 4ISLA 3BR6A 3A02A 3P9IA 3DEWA 1SVPA 7LPRA 2OCCH 4C3IJ 1NN6A 4UUSB 2BY6X 2W7UA 1FT9A 3WODF 2QCYA 1CU1A 3E5XA 2OTLI 4XLFA 4B6FA 3P8OA 3BTKE 4UFGH 4B47A 1AD8H 2ZF0H 2CU7A 5CKTA 3M5OA 5JHFA 4DGWB 5HDNA 5DP8A 5A0BA 3TMOA 5FB2A 1EAIA 1BQYA 4AC0A 3OS1A 2BW3B 2EFOA 1GJDB 3RXPA 1A6IA 1TPAE 1XMNB 2Y7ZA 1GBLA 1GMDG 4ZMAH 1ZQ3P 3ZV9A 1Z7UA 2C4FH 3JRDA 2PP6A 4GFBA 2XNDD 2Y75A 3LWFA 1MKMA 1E3PA 1MTNC 1TT5B 1HDTH 4X6AJ 2RDLA 1S7EA 4QSHA 2O8TA 1TBRH 1LEAA 3STJA 2O8KA 5D8KB 3BPVA 2KFWA 4IN2A 4CCJA 3CC7I 2ESNA 2RGVA 2XXLA 1FSEA 2R7SA 1XMAA 3UWIA 1YIJI 2I10A 2WWYA 4ZTJA 2KHMA 1SKYE 3IHUA 1V2RT 3GUDA 3EETA 1CF7B 3AW1A 3QPHA 3MNCA 2QBYB 1ZLKA 4NA7A 3U98H 4CGZA 3E5UA 2VASA 1QZ8A 4YIFA 3MU0A 3P9CA 1A5GH 7KMEH 1WV7H 4NIYA 2FNPA 1GMCG 1MTWA 1MU6B 1FY7A 4AUXA 2ZFTA 3HBLA 2VONA 3ATWA 2EBIA 5E0HA 2HR3A 3BG9A 3ZVDA 1FAKH 5EEAA 3RXHA 1AIXH 3JAMK 5LHIA 2WAFA 1YRNB 2QIQA 3OV8A 2B0LA 2FBHA 3A85A 2R7ZJ 4IOCF 2LVSA 1ETVA 5BOXA 1FY1A 1B72A 5FPYA 1JKQC 4RBOA 2ZHWH 3O8RA 4OIOF 2P5VA 2GXBA 2F9BH 4KJZA 5KNLA 3DTKA 2Y7XA 1T8LA 1ETRH 1VGCB 2J38A 4FUBA 1WFXA 3DA9B 1BN5A 1H88C 4D7GA 4FTHA 3DBLB 3WE2A 2M9HA 1Z3YA 1MSEC 1R5GA 3E1SA 5DP3A 2NOGA 3A03A 3SI4H 1IW7F 2MD5A 4P9UA 3U8OH 3GCHB 1KLTA 5ILUA 2IGOA 5HYOA 4BHPA 1NRPH 2A1DB 1QPIA 2R5YB 1TIOA 3PMJA 3SZPA 4YOIA 2BOHB 2BDGA 2SNWA 1F0TA 4CRAA 3A1YA 3LOXA 1GDTA 3JTHA 1O5AB 3RXQA 1LVKA 1SGPE 1Z8JB 3A80A 4MLOA 1VJAU 4MO7A 3ZZ8A 1POGA 3WHCA 1YIOA 2ZECA 4XQFA 1S6FA 2PX9A 3S0NA 1RZ4A 1MBEA 5DO4H 4XR6A 1G4DA 2ZFWA 5EW2H 3VEPA 2P8OC 2VVVA 2OD5A 3K4MA 3MAJA 1SFUA 1VCWA 2Y80A 1GT0C 3GCHC 1KYZA 2XF5A 3GFLA 3SHFA 4HDVA 2GDEH 3EA8A 4AM3A 1FX0B 4BUPA 1YBWA 3E0JB 2BV6A 1QGFA 4ZXYH 3SV6A 3LSPA 2H9TH 3V7RA 2UWMA 2WPDD 2R5ZA 1P3CA 1QO0D 5K7RA 3I0TA 2FA5A 2W4SA 4FUFA 3KQ5A 2ZJQF 1MTNB 1JE8A 5B1BH 2OUAA 3OTJE 2G00A 3KLNA 2OPTA 1B8IB 2R93J 2R4GA 1SAXA 3KCCA 1YX5A 4V2GA 3OYEA 5HLGA 4TY7A 4KKDA 2FOMB 4RB1A 3MD2A 3K1NA 3NRVA 2AIPA 2GT8A 2DUCA 4RI0A 5F8TA 4EEFG 4JZ1A 3ZQCA 2W84A 4CO8A 3RPQA 4BAOB 3S3NA 4QWQA 1TX8A 1GCTC 2X6OA 3WGHA 1WXRA 3FZVA 2JK3A 1THRH 1KGSA 1X2NA 2ZJPF 3K2AA 1YTYA 2FOEA 2WINI 3GBGA 5J4SA 5DN6D 7ESTE 4PFOA 4LLLA 4DW6A 3RXBA 3LSJA 4OS5A 1ELGA 1GI1A 4AIKA 1IQHA 4HZFA 2GZ9A 2Q2EA 3QP5A 2NYXA 5FPSA 3F6VA 1EZSC 4MPUA 4BEHA 3MTYA 4LMYA 1S6HA 1AFQB 3RXRA 4X6OA 3AK5A 1YWUA 1LKXA 2JTVA 3TK6A 4M3BA 4HG6A 4X2YA 1X1DA 2EA4A 3CCJI 3E6MA 5BMZA 5FAHA 1S85A 2IS6A 1DT2A 3MMYB 2VQHA 5C3NA 1SOTA 2L7ZA 1QL7A 3A8DA 2QF4A 2SGDE 1B0EA 1YO5C 3PNVA 1FZPB 2EI8A 3RMMH 3F8NA 5TRDA 5FFXA 5FLMJ 3A81A 4F93B 3N05A 4LITA 2NAZA 1JXPA 6GCHG 1FPQA 2CQQA 5J1RA 5FD6A 1S8NA 2ZNZA 2Y82A 3F2GA 1DP3A 5KGOA 2GDDA 4IX7A 5C1YA 4ENNA 3ZPLA 2N8GA 4RAFA 3SQNA 2GCHF 2XKOA 4I8JA 3NQOA 2COBA 3BT9A 1FMWA 5EPNA 2ZFPH 2DQRA 4ESJA 4G6QA 3PLPA 3I56I 3CESA 1NROH 3QZQA 4B43A 1YPEH 2R2WU 4CYCB 4ZKSU 4Q4ZF 2QA4I 3LSIA 5L3BA 4I8LA 3GEZA 3C27B 4Z2YA 3S15J 4AFZA 3DWLE 1Y5BT 5JFRA 1PP8F 1AI8H 5CVVA 1J7KA 3ZZAA 2DYRH 3CDIA 4YXWD 3I55I 2HQAA 2L74A 1Q1VA 4R0IA 4X8UH 3RXVA 2HOTA 4BGDA 2B0FA 5DCMB 4D9JA 2P8TA 2AQEA 1HV7A 4UEHH 2BZAA 2RNJA 2BZTA 3B8JA 2QZ8A 3MVPA 4WXCA 3T8RA 1QVUA 1O3BA 5DV5A 4GUXA 4A1XA 5FBEA 1U8RA 3M7TA 1K4TA 3M8FA 3JAMZ 3GICB 1V2ST 2D1HA 3VB6A 2ICWG 4IEJA 1FMVA 1YKTA 1UJ8A 2CUJA 5JBCS 1V55H 4II2A 1S7OA 2L02A 1XXFA 1ANCA 3FK7A 1AQ7A 2QYIA 2F6CA 2EPFA 2BBYA 1IG7A 1Z7LA 2JH0D 4ZH8A 4DIHH 2ZXHA 2ZKZA 3MH4A 5IY5H 1O3DA 2JRMA 4CDGA 2CW0F 4GRIA 1BHXF 5EF6A 4J2YB 3VFEA 4Z6AH 4N0BA 1H8ED 4Y0YE 2GD4B 2F4OB 3H5CB 1SGTA 1DPRA 2XKPA 3GTGJ 4LZ4B 5T6FA 4FHTA 4B48A 3FXOA 4TWWA 1HC8A 2SGEE 4IC6A 2NVUB 2J92A 4NC6A 4RN6A 2FI5E 3NARA 4PSWA 1TT0A 2W82A 4HG2A 3MKYB 2Z16A 2OQRA 2FBIA 2H94A 3VG8A 1TWHJ 5GTIC 2ZFRH 1GBBA 2QN5T 3M07A 3SNCA 1D3QB 1BI3A 5F1JA 3W1EA 4NBQA 1IQKA 2HNTF 4CYDA 2NWNA 4MNXA 3ZN1A 2AO9A 2QQBA 3CLQA 3BG4C 2IXSA 3LOCA 2KZGA 1WBGB 4NCYA 1G8XA 1SB1H 2MH9A 1IJWC 2GZWA 1O37A 2A3SA 3DPTA 4ENMA 1DVAH 1ZGJA 5IDKA 3BG7A 2ANWA 1SVOA 3GMEA 1VFCA 2Q1JA 2YPRA 1ZR4A 1T08B 1C1VH 4GYIA 3F68H 1K1PA 3UOPA 3LA3A 1RXPA 5F6MA 4DYRA 6LPRA 2VBXA 1HJ8A 4AZ2B 1C4U2 2LRDA 3HOZJ 2W00A 4K5ZA 4ESFA 3OL3A 2FDAA 2AMDA 3TOAA 1TB6H 1GBMA 1XGSA 1S29A 2BB4A 2Y5GA 1MIJA 1E34B 1O2RA 2FD5A 2CK3D 5C1UA 1RJXB 2LC2A 1Y3YA 3VEQB 2FOWA 3PIOF 1NHAA 2GOXB 1CHOF 4PJ0C 4CZCA 4YLQH 1D0ZA 1SLXB 3VSKA 4CYCA 2FIRH 2AEIH 3NWUA 1BT7A 2LP0A 1GJCB 1FOKA 2ZB9A 2HXIA 1EZXC 3GDUA 2EWNA 3MWIU 3ISPA 4AVZA 2ZHEH 3V3MA 1HKTA 1L2EA 1S3JA 3M37A 1M1EB 1C5XB 2BW3A 1SD5A 1O0DH 4Y33A 2EH3A 4Y7NJ 1CSOE 1QNTA 2BQWB 1P9UA 3LGWA 2PJRA 4I76A 4AWXB 1QNJA 4MPVA 3F8MA 2HEOA 2P7VB 3CLOA 3FFGA 7GCHF 2QSHX 2VL8A 2K9QA 2AQFA 3P8FA 3GLXA 3M5NA 1FC3A 2BLOA 2O5RA 2AXLA 3PO3J 1U78A 2RV8A 2J9NA 3VB7A 4F55A 5DD8A 1CA0B 3A8CA 3TEDA 4OM9A 4BQQA 3UR6A 1D8KA 5EGOA 3EQ0H 2KM0A 1XM1A 3RXGA 4FUGA 2OCVB 4ZYHA 1HRTH 4ZKRU 4AC9A 2VJIA 2EILH 1W7PD 4JYVH 5IP9J 3UAIC 2BD9A 2HQNA 2QF0A 4A3FJ 4JK1X 2JJ7A 2Y0SA 3OEHD 4NZQA 1IRXA 1OMIA 4GGGA 3J7YJ 3NPSA 3LSKA 1XSDA 3VXEH 2PV9B 2NS7A 1G6NA 1HDPA 1X4PA 4MFEA 2FX6A 3A7YA 5FO5A 3UWJH 4A12A 3B6AA 3HK3B 3FXQA 2B9SA 1P4AA 1C5VA 2C6YA 3W3CA 3OYPA 3RXSA 2ODQA 4RGUA 3KPHA 3OY9A 4C2TA 1Z77A 4ZYEA 3F9EA 1JTYA 1ZG5A 3T5FH 4MPXA 4IL6C 5HOOA 4U88A 4FASD 3TO7A 3A7ZA 4NZLA 3MFKA 1V5EA 1HLTH 1RD3B 4FE4A 2X9DA 4MTEA 1XUGA 3KCGH 1YJWI 3L6PA 1MD8A 1JKPC 4YM9A 5FGMA 1ZLJA 3TDZC 1GBJA 2CYYA 3GTPJ 1QHRB 3PV2A 1TLDA 1O3QA 3WTTC 2M8GX 1VGCC 3PMAB 5DP6A 2XCNA 1YCPK 2ZNKH 5EG4A 2I8DA 3TH3H 5C5OA 3FXRA 1ELCA 1MDMA 1MKWH 1DXPA 1WYKA 2ECBA 3LGYA 1WZ2A 1JJ6C 5L2ZH 2VWOA 5KAFC 3SU1A 5ABWA 1QJ6B 1TWFJ 2CHAC 4ON0A 1PJRA 4UD9H 2A5AA 2JZYA 1C2LA 3U28C 4FUJA 2NVQJ 2VIQA 5M3FJ 3FXKA 3LT3A 5J40A 1TMBH 1QBNA 1C1NA 2W6JD 4ASUD 1LPGB 4EJOA 3O8HA 5J8FA 4A3JJ 2RQPA 1EB1H 1O3IA 2XV4S 4CRFA 4BTTB 3SZEA 3K4BA 3HHGA 2K8IA 1D1AA 3BTLA 4IRGA 3JRFA 2G9WA 1GJBB 3KYLA 1GJ8B 3V8LA 3SW2B 4YIIA 3MU5A 4E7RG 4WVPE 1JHFA 3OIQA 1Q3XA 3TGJE 1LDJA 1MBGA 3S7HB 1P2NA 1ZZZA 4HPQA 4KIBA 1TNTA 2V7FA 2RREA 2VIVA 3BTJA 3QOEA 4LXBH 3A7XA 4DBQA 2EA2A 1TNHA 4Q48A 3TGIE 4AGKA 3TJNA 2P3FH 1ABJH 1CGIE 4OGXA 4KA4A 4M3EA 2R5YA 1GMDF 4LOYH 1ARBA 3CUQC 4LB5A 4YELA 3WG7H 3S17J 1K21H 3SQHE 5DUIA 2QQ8A 4R8HA 1AKSB 1P12E 2LYCA 4BAHB 3EUKL 2R7VA 2HTJA 4BQAA 1A5IA 2A7CA 3PUFA 1SLWB 1MJAA 2JSPA 2F2EA 1P3EA 2VNTA 1GDNA 2PMHA 3H92A 3V42A 3EYYA 3MI4A 4A1VA 2D1VA 3SEQA 2Z1DA 4PFPA 5E1WA 1RPWA 2YOLA 1A2CH 1VKYA 4GYGA 1WJFA 3OR2C 3ZMTA 1FSHA 3DCFA 4MNUA 5K0HA 3ABUA 3L33A 4IPAA 1AKHA 1LVMA 4BKXA 4FUIA 2YMSB 1RKTA 4G12A 3OE7D 4I6ZA 4HA8A 1NC6A 4D1QA 1K1NA 1C5WB 3BTWE 3UPEA 1B8IA 2UUZA 2IRFG 2W7SA 2UZKA 4FUHA 1WCMJ 3QAHA 1H8DH 2OD3B 1ZELA 3ATIA 1C4V2 4YRVA 2FM2A 2OJED 3U9AH 3FM5A 3HOSA 2FOAA 2F48A 2QKMB 3G4SI 2K3FA 4JX6A 2X6WA 4DCDA 1BJAA 3ZZ4A 5J47A 1TPSA 3E7LA 2VT2A 1VZQH 3PB1E 3H36A 2W6ID 1HBTH 4HLXA 2RDEA 2ZU4A 4ETSA 1RRKA 2QCOA 5IK2D 2ZDKA 3LFKA 4HAMA 1YJNI 2KMUA 2M2EA 3GLLA 4K60A 5FKKA 4DOQA 1W7XH 2E35A 3T62A 3BR3A 3GZNB 1CT0E 3PRBA 3ZQQA 2PKAB 4DNCA 3DLLF 2TGDA 5TJJA 3FK6A 4XRMA 2BLQA 5CVIA 1G3TA 3BV9B 1GHAF 5D4SA 1NU9A 2F4IA 4CBNA 2A5KA 3N7DA 5HNHA 5HIZA 1RC9A 3LA7A 4BXFA 3GCTF 2DA2A 4AB8A 2B5TB 4OOIA 3RXEA 3LSTA 5J6XA 1X3UA 2DT7B 1MUEB 2ZGHA 5AONA 2ZFUA 4X1SU 3A0HC 3UB0A 2M4KA 1NS3A 3H9QA 1HQCA 1DOJA 4A6EA 4CXFA 4BJTA 1L1JA 3VB2A 2BVMA 2QAAA 1XTAA 2ZGBH 1G3EA 3K4KA 2PUXB 1QQ4A 2UXXA 3MCZA 5GPAA 2O8MA 4FU8A 2XAFA 5A2MH 3UIRA 2GXGA 3AVZA 4Z1MD 1YCPM 3HYIA 4AGJA 5LRSA 4RT1A 1T8IA 4L9JA 1A6QA 1X1CA 1OR7A 1SFOJ 1YGCH 3P92A 4ZROA 3WU1B 5F6FA 5EJ1A 1EAUA 1HAVB 1PUFA 4PJJA 1P0SH 3BLYA 1A5JA 4K3JA 3ROUA 1WQ2A 2CUEA 2X4HA 1LTOA 4BNCA 5IYBJ 3HB9A 2QC2A 2R7OA 3TP3A 2HPQH 3CMMA 4EV0A 1N1LA 1O3HA 1MDMB 1R7JA 2XSDC 1B6AA 2IS2A 3ZZDA 3K2UA 3RU4T 3M7UA 3D5RC 1FIAA 1R9TJ 1QB1A 4UB6C 2JJ1D 3S3MA 5C17A 2H27A 2V9VA 3KX2A 1HGTH 2RVCA 3VPKA 2XPWA 3HTUA 2CV3A 2VVUA 5DP9A 1YPJH 1QL9A 2WV0A 4KFCA 2Y0SN 2XROA 4KNYA 4BHBA 2K40A 1HW2A 5GWZA 2HQ5A 4ACBA 4H6TA 4A3CJ 3EA7A 4OGYA 5HM9A 1VQ9I 5C67A 2PN6A 5HODA 1DLEA 1BMMH 2MD0A 2ISYA 1GVLA 4BJ5C 4LG0B 3MU8A 1T98A 1P9QC 1C5UA 4G7HF 2HVQA 3UNSA 3DSOA 3T27A 3BTHE 3SV7A 1K1OA 2Y48A 1ELEE 2Z5UA 2CUFA 4Q4LA 1SFEA 2VGCB 1JUSA 1YHQI 1ZG1A 2NVYJ 1CBWC 2L7KA 1U5TC 2KPMA 3LAJA 2R7FA 3P5JA 1UAAA 1VITH 4ZDPA 2PSXA 5ED4A 4WXDA 1GVDA 4D5CA 3FHZA 1ETWA 4CRGA 3E0NB 1GL0E 1VQPI 1KDQA 2AGGX 3F8BA 1Q1HA 2KRHA 3HDDA 2G4TA 4VGCB 2L6OA 1Y8TA 3O8BA 5H4IB 3S2HJ 3KYDB 1F5KU 3BCBA 3FMRA 5GIBA 2A5WA 3QU6A 2X6YA 4MIMA 1C5MD 2OZ6A 1UW7A 3GFMA 4YT7H 2JN6A 1UCRA 5HDGA 2F83A 5KAIC 2IW5A 1UK2A 3OYIA 2GBYA 1ETXA 4ZKOU 2KRCA 1TC3C 3UKGA 1G3BA 1IV8A 3DP7A 3AW0A 3RKXA 1DU0A 4I86A 2Z94A 1BIBA 4JZFH 1E2XA 1R22A 1TW2A 3A7VA 2IA0A 4I01A 2Q6GA 3ZYDA 3V8KA 3LA2A 1QZYA 2E1OA 4RLFA 1JI8A 2RQQA 4LK4A 3KP2A 3SORA 3OSGA 1TFXA 2L9SA 1S81A 1RR7A 4Q80A 1R6RA 3UQOA 3RPUD 2XRNA 1BDAA 3TJOA 2H6CA 4YOJA 4L18B 2IGMA 3BTQE 2RC4A 3CJTB 3KFWX 2VKEA 3ERMA 1WSSH 4B71A 3TO9A 2HOEA 1T8NA 4B73A 1WQVH 3PTNA 3QGNB 1FBUA 1OWKA 2F5DA 2TCTA 2OA4A 3F1SB 1AO5A 4A5TS 1YFHA 3BTME 3OOUA 1P02A 5L3GA 1ZRCA 1LNWA 1RS0A 4B74A 1A1RA 4BBSJ 1EATA 2L4MA 1GCTB 3T26A 4M9FA 3TO6A 4DIQA 2A68F 1HAYB 2W1OA 1GVZA 2YS9A 2HDCA 2OINA 1SR5C 1E1QD 1J15A 5M5WJ 2FOFA 2VBCA 2JA6J 1MZAA 3L2RA 1MNMC 1QL8A 3F2HA 2OF7A 4EJUA 3CC4I 4AD9A 1K6YA 4QIWN 5JDUB 5FXLA 1X1BA 1BZXE 2KZVA 4A1TA 2M7BA 1Q2WA 2JWTA 2JH5D 2X0LA 3BTDE 3OWTA 1LFBA 1EF4A 1USTA 3BEFB 3LKWA 2A4OA 3CJNA 1T38A 1Z3XA 4AYVB 4K8YA 3FN8A 1U5TA 1DQUA 4DT4A 2QLZA 4JYUH 1F5RA 4UFFH 2WYGA 3SJ8A 4BE2A 2LK2A 2HPMA 2R9PA 2PTNA 4X8VH 1OPHB 1AN1E 2K4JA 1HJAC 2CF8H 4ANJA 1MD7A 2Z3YA 2V26A 3E16B 4IVNA 3IRRA 3DPUA 1NZQH 1BUIA 3HK6B 5GCHG 4BXWA 4GPGA 3BJOA 1TNSA 5JBBS 4MQ9F 3GY2A 1C9TA 2CO5A 2PMUA 4C2UA 1D4PB 5TJXA 1V2TT 4G6TB 2R0LA 1EPTB 1TGTA 2IT0A 2EEKA 3KETA 1KU9A 1YPMH 1HIAA 3MO3A 1ZTRA 4O97A 1COWD 3Q9VA 4XKVA 2QGUA 3DT0H 1XC5A 3PLKA 4ZCNA 2OLGA 5HS9A 1ZGAA 1ZJDA 1G9IE 2VVCA 1NG7A 3AG1H 4TPIZ 1JGSA 1TW3A 3ENSB 3NXPA 4GCHF 4BDZA 1K0HA 1TX7A 4MQAA 1GXQA 4EJVA 1E0FD 2ZEBA 1XCBA 4XLCA 4WX9A 4CHUA 2O8UA 1JXSA 1TA2A 2KT0A 5JHUA 5EG0A 3BF6H 1E37B 4TT3D 2XRLA 4R1HA 3G1MA 4CSWA 2MYSA 2OTVA 3MH7A 3SEZA 1JRSA 1TNJA 2NNYA 1O2JA 3DFJA 1IV6A 2P4WA 4J01A 1UTJA 1SHYA 2ZI2H 3KEQA 1SMTA 3LGVA 4EM1A 3ZCOA 1AFQC 3JRHA 3A8AA 3HRUA 4KIFA 4NDLA 3SZTA 1W0UA 2HFHA 3GTMJ 5E8IA 3LSGA 4FCYA 3M7GA 2GT7A 4MVNA 2DA5A 1PFXC 1H9IE 3T0YA 2PKAA 3IL2A 3OYAA 4BEHB 1R5HA 2KCAA 4C30A 4HTCH 1NFWA 1IUYA 1ZGVA 3Q0WA 2MC4A 6CHAC 1C5QA 1ERDA 2VH6A 2J94A 1CF7A 2C8ZB 1UHBA 4ABBA 3R0AA 2DA6A 3RYRA 3ZQIA 3IAS2 1X1AA 2FF4A 3RXFA 2G4UA 1HDDC 4LJZF 4ESTE 5D6EA 5LH8A 1OP8A 4IS5A 1NRNH 4R79A 1P9SA 1E3OC 2BYVE 1KDQB 3LQQA 1HAHH 2ESHA 4E7SA 3JRGA 1E38B 3D1NI 2ZSHB 2THFB 1XGMA 2K9LA 1MMJN 4IQ4A 3RU4E 3DHKH 1OR7C 2A6EF 2OXSA 1H1BA 2XAQA 3H5NA 4HNVA 2DXIA 3PO1B 4Y8YA 1MBJA 1MBFA 1O5CB 4ASNA 1W0JD 1GGDB 3PFYA 3L00A 4B76A 2LY1A 1SMYF 4KISA 2ZCHP 3W94A 4ABEA 3EA9A 1ZOMA 1SC8U 4I0BA 2WAEA 5BQTA 4L9TA 3I54A 2F9NA 1O3KA 1EASA 5HKKD 1F2SE 1SGQE 2QXIA 1W4MA 4UHTA 3VB4A 5FCKA 1D3TB 4DJZB 1TQPA 3U1JB 2X85A 2VU8E 5GJ4B 2TRMA 2V3MA 1MMAA 5E17F 3KQBA 3MQ0A 5L3FA 1HIAB 3MEXA 1ACBE 2ZDMA 2CV1A 4I98B 4Y8ZA 3G6EI 1CE5A 5CVJA 3COAC 2AH4X 2FTMA 1QGPA 2ZQ1A 1OFCX 4GDFA 2CJJA 1KQ0A 5K1YA 2E34A 4AFUA 1O3OA 2BY0A 3E6CC 1AHDP 2H9HA 4O6JA 1IN7A 1HXFH 1W1WE 5A0AE 3NCLA 4FOUC 3TH4H 3SUFA 4IC5A 2K3PA 2P3UB 4R8TB 2IP2A 3FO8D 4VGCC 1ZK8A 4U7BA 4AORA 3MO9A 4WCGA 2H6MA 2L7FP 4M71A 2LREA 1UFMA 3N7OA 3LJOA 4HV6A 4IHYA 4E7HA 3SDBA 2VB6A 2PR3A 1XGOA 3WWBA 2V1NA 2V1DA 4A6DA 3ZZ7A 3LH3A 1RR8C 2KLOA 1FX7A 1ELDE 3LGUA 4A3KJ 2BD7A 1C5RA 4K1TA 3HXLA 1ZHFA 3RXIA 1GJ7B 2FRHA 2O61A 2BOLA 3F9KA 4IQJA 3TLOA 4RSPA 1FTTA 1MTSA 3AKZA 1YW8A 1GBHA 1XSXA 1Y8QB 4BTIB 3LPRA 1FYLA 1LVYA 3H3ZA 1WGXA 1EXFA 3H5RA 5JLWA 2R7XA 1UHBB 2UWOA 3ZQHA 2LD5A 2STTA 1SGNE 3OMYA 1I3QJ 1ELVA 1LQDB 2VN2A 2O0YA 1QJ7B 2WV4A 4FVDA 1D5YA 3W6KB 1DFPA 3HL2A 2DT6A 4MLFB 3D49H 5EEGA 2DMTA 3CMAI 2AGEX 3RMNH 2PGQB 3GS9A 1BRUP 3FZZA 3SQEE 4EMSA 4OIQF 2IGKA 2JPCA 2CGAA 2FE3A 4BXXJ 3HGYA 3K65B 4XRFA 4F3QA 3ZVEA 4I7YH 1MAYA 1H0MA 4BS9A 4M9XA 1BTZA 4N4NB 3OSYA 4X8TH 3T5XA 1SHHB 1A0LA 3ZVBA 1K4SA 1I27A 3FWEA 3ZN0A 1EKEA 4F7ZA 3BG4B 1GVKB 1ZPCA 1ARCA 1UHMA 2RA0A 1H89C 2DOEA 2HNTC 4M3GA 1C9PA 3VDXA 1WJDA 3N97A 1YC0A 3CP7A 1BOBA 4EGYA 3MU1A 1T8OA 2FX0A 2EY4C 1LUJB 3HTSB 4DYCA 1Y3UA 4WH6A 2WPKS 2ZTYA 3F9GA 5E8EH 2EIJH 3KP6A 3RKQA 1H9HE 1EB2A 1SQTA 3IAM2 1UHWA 3MKWB 4GCHG 1H4WA 3ABLH 4XORA 1QA6A 2HYGD 2NS0A 1EAWA 2NNNA 2A4QA 3K2ZA 4BHCA 3K9TA 4UV8A 4A3IJ 1BL0A 2BZ6H 3CDHA 1DDNA 5CVUA 1OYTH 3P8GA 2UXNA 3TW6A 2VIWA 1YY3A 2BQ6B 5DGJA 2ELKA 2XBVA 3OIOA 4LLNA 2LR8A 1S83A 2ZU3A 2ZG0H 4D8NA 3W2AA 3ITIA 4NWKA 1ETQA 2W25A 1E36B 4JZIA 3FVFB 1W7PA 2ZIQH 3OYNA 4A5MA 4OAYA 3NKKA 3FIWA 5IOYA 3EDPA 1FPHH 3OY5U 1BTYA 4EVIA 1V2NT 4DVAU 2A5IA 3SJIA 2E71A 3FF5A 3W6JB 2P6SA 2VI6A 1HAPH 2E1MB 2DE8A 4P96A 2PMZN 3BOQA 3TP0A 3CZ6A 1D3PB 3T1BA 3M36A 2CMPA 1YF4A 3GZ6A 5LPEA 2M30A 3BTEE 2PEXA 2O03A 3S32A 4HLYA 1P2KA 1LMWB 1MKXK 3HSRA 3EDXB 3K70C 1KXCA 1TTYA 3HPTB 5AIQA 3FX3A 4BBRJ 1T39A 1IDYA 3RLYH 3P70B 3K6YA 4U7DA 2XGXA 5F03A 1LE8A 1W5CC 1GBFA 2M0CA 3E6DA 1O2IA 2DCEA 2FS9A 3QODA 1K9OE 5DYMA 4FT8A 1YLFA 4K2YA 4P1WA 1OCZH 2NU1E 1TMTH 2EQNA 3RQIA 5JLXA 3K4JA 3Q77A 3I4PA 1T95A 4B09A 5ETXA 2HRVA 2BM2A 2MSYA 1V2QT 2BTCE 1TBXA 1THPB 5BPIA 2J97A 3DCLA 3EGKH 2WAQN 2ZMEA 3NAUA 3Q00A 4Y71A 1O30A 2K7LA 2Z9KA 4GHTA 3IWMA 3K1MA 5DUKA 2M3AA 2O9LA 2LF7A 1O2OA 3KN2A 3DTEA 3PTBA 3QP6A 3V8JA 1AU7A 4BAYA 1Z05A 2ILNA 5F1RA 3G71I 3CJQB 3E90B 2I6QA 1IQLA 2G0EA 1V3XA 4O5VA 3PSFA 4UUVA 1FOXA 8ESTE 1SPJA 1ZAOA 1YPHE 4CICA 3RDZA 3E3TA 3U2RA 3ESTA 1ZPBA 1MU8B 3F3BA 1HSJA 3RM2H 2XOKD 4Y79A 1TWGJ 3BG3A 2GCTB 2VIPA 2PI0A 3B6CA 2FLBH 3RC5A 4KT6A 2XC0A 4G7ZF 1IQEA 3DFGA 2WUBA 1RGQA 2C8XB 4BDYA 1F0RA 3ZGKA 1VQMI 1ZRBA 1IXRC 2NS8A 5K5OA 2UUJB 2WV9A 2A69F 3A88A 1RESA 2C3SA 4WH8A 2ZZUH 3M3SA 2FLRH 5BS6A 2GCTC 3JRBA 2ALPA 1KQ8A 3LMMA 4X1RU 2OP9A 1SD6A 1UB9A 2DLLA 2P5KA 3V13A 2ZBKA 1LJ9A 3G2BA 1KTSB 1P2IA 1HF0A 2JH6D 4KT5C 1ZMNA 2A2QH 4JYKA 1I1GA 2BY8X 4RAYA 3Q9SA 4PK4A 2E1NA 3FAOA 1IQJA 5AHGH 1A35A 1SVLA 3H09A 4TYDA 2BD4A 1EA3A 2HWVA 3K9XB 1BTPA 4X6NA 1Y39A 2X1DA 2AYWA 2F5EA 1C2MA 2JETB 4AB9A 5D6FA 4FUDA 1BBYA 4XNFA 4HV5A 4EJWA 2JMWA 2E2JJ 1GL1A 1ETKA 1G30B 5DEQA 3BR5A 1L1NA 4BAMB 5JBAS 1O2YA 1LPZB 4XLEA 3SYTA 1PQAA 1W8BH 4YO9A 4DYQA 3HKJB 3GYLB 2GX4A 3VPRA 2CV2A 1ZPZA 1ZRDA 4CZZA 4ABAA 2KCPA 1B72B 2GIVA 4A3EJ 1SGCA 1R1TA 1S7AA 3S2WA 3KEEA 1N25A 1NTCA 1ZREA 1O3CA 3A89A 1JKRC 3IWZA 3KYCB 5F04A 3RXUA 3PO2J 4H4KC 4I32A 3KEOA 2WYJA 1C1TA 1Z71A 3LNQA 3J7AY 4EATA 2FS8A 3CUQA 1ZTLA 1XX5A 1QA0A 2FX4A 1AWCA 1O5BB 3LIWA 4U2WA 1NESE 4PCQA 4D76A 1YOVB 1AVXA 1FI8A 3I58A 3TGNA 4YFNF 1R1UA 3CMEI 1QBOA 1IQFA 1SFXA 3DU5A 4Q7ZA 4L5EA 2DQLA 3BR2A 2K86A 1I39A 3E1XB 3QTOH 2XSJC 3RJPA 3MH6A 1LKBA 4Y3OA 5ERIA 1SD7A 2PQ8A 1TRMA 2ZDVH 1FBQA 3HOYJ 4A5NA 4LD5A 1T7CA 5JB8S 1P04A 5ILVA 4RB2C 1W7PB 1GI0A 1OXGA 2Z7FE 1YQAA 1REPC 4FISA 1WQSA 3IRQA 3UOUA 3G1LA 1HJ9A 2AFQB 4N4OB 1Y5UT 4IHTA 4XLNF 4NFEA 1THSH 2FJ1A 1PVEA 2L9NA 3ZMSA 3SYJA 4XKCA 3A8BA 3ASOH 1O5EH 2VGCC 1N8OC 4MFDA 4EM0B 5J4YA 5JYIA 1O4XA 4IO9F 1Z8RA 3A86A 3U69H 1FWZA 1C1RA 1P03A 3TQNA 2BXTH 1R00A 2ISZA 2WB1A 4XN3A 1FPCH 5E2PA 1TLHB 1IHSH 1UTPA 3G01A 3RC4A 3JREA 2Z33A 2A0QB 4M6XA 4J1YA 2VIDA 4S0HB 5CYVA 3ZMZA 2UUKB 3M61U 3TW7A 5GXPA 3CMYA 2MLGA 2OUMA 2RCEA 4UFEH 1DUAA 2R7DA 3KP7A 3I9V2 1GHBF 4CHAC 3RKWA 3C2HA 1NRSH 2P5LC 2K9NA 1RUNA 1NRRH 4Y7AA 2J95A 1QHGA 3SHCH 1OWIA 1S6LA 1DUXC 4UFDH 1UMQA 4YTAA 3DKXA 2P8OB 3VYUB 1XMXA 5DS9A 1BOAA 4JMYA 3K4CA 3BZCA 2EK5A 2CQKA 2VKHA 3MKZA 1SQAA 4ABZA 1K1MA 3OR1C 3BEUA 3DKWA 1V2VT 3NRLA 1P8VC 3EUHA 3ECOA 1TNLA 1UG2A 1OJLA 2E5NA 4LIVA 1H9TA 3C1KA 3ZMDA 5IP7J 2COMA 3K69A 2CGPA 4GSOA 3CJRB 2VWNA 4DG4A 4HGCA 3IC7A 2YNBA 3ZYEA 1WPKA 2EQRA 2CRGA 1O2VA 1ZYOA 1YG2A 1CQTA 2Q2EB 4XBFA 2L0KA 1GPZA 2IAIA 3HJEA 3A83A 4Y13A 1MH4A 5J8CA 1TONA 1W13U 4A6LA 1TPPA 3IWFA 2ZMEC 3RXAA 3BTCA 1MGTA 2ZO3H 3BZKA 1LPKB 4YESB 4PJLA 1NY22 1QBJA 1JHHA 2LP6A 4A3GJ 1DWBH 1O39A 1GXPA 2KAIB 3BG6A 3OYLA 2TGPZ 5A8ZA 2XUBA 1QB9A 3TU7H 4Y10E 2IA1A 5DPAA 1S9HA 4BH9A 2SGQE 3T2NA 3CF5F 3TVJB 2ZHFH 3GY4A 1F43A 2XPUA 2FEQH 1FTZA 4XSZF 2KKOA 4Y4RA 1X1PA 1U6QA 2P81A 3FBIB 3RXOA 2IPQX 3BIUH 2GV6A 2V6NA 1C1UH 3QWLA 4G8XA 2BX4A 1U0JA 3FP6E 4UVBA 5E3LA 3C7JA 3E6BA 4WF2A 3FISA 2D8WA 3TH2H 1GHAG 4HW0A 5EXNA 3F2FA 2WY7Q 3R61A 2DFIA 2VUMJ 1HJAB 5FBIA 3ESWB 3I29A 3LONA 3HSEA 2BEOA 2P7CB 2MA3A 3HZJA 3E97A 2XC7A 2FOGA 1PPBH 3N7EA 4M6VA 3LC5A 2C93B 5KVRA 2A32A 4IRIA 1JKOC 2X51A 4B8XA 2ZJRF 2ACJA 3RZDJ 1P2MA 3MFJA 1SGYE 2D2WA 1P57B 1GBAA 5E0GA 3GO5A 4MEYF 2CN0H 2XTTB 1VQ6I 3RI4A 2ULLA 3DQVC 3UFAA 1VQNI 1IXSB 1GVJA 3SFIA 3ZMUA 1FY3A 1K7AA 2K0QA 2GKVE 3FZDA 4JX4A 4HNUA 2PGBB 2ZDNA 4B2AA 2LDUA 4ZHMU 2JVHA 2ANKH 2HYJA 3MH5A 2ME0A 2OQ5A 2NU0E 4Z6YA 1FJSA 4L0YB 3HPGA 1OCRH 3M3VA 1RTFB 1LHCH 1YLNA 3RXDA 4UVAA 1DE7H 1CHOG 1Z8GA 1GI5A 1YW9A 2F9VA 3BQZA 4JBAA 3GCTG 1OKXA 1HKSA 3R0JA 5BNGA 1HKQA 1DSTA 1AY6H 5DTDA 1GHWH 5AFYH 1GJ6A 2DPUA 1DS2E 4NIXA 1KSNA 1QRWA 1HFDA 4BQOA 2BDIA 1NFYA 2LBFA 5GAEJ 3ZZ3A 4DT7B 1DP7P 2TGTA 3B23B 3QGJA 4C2MJ 2WTEA 4LB6B 1WVRA 2BLVA 3D62A 2V3HH 5AF9H 3RPUA 2R2MB 3OYMA 4B2BA 3DV8A 1BCUH 1KZHA 1GG6B 1VTNC 1MBMA 1QZZA 4MNYA 4HEA2 4A2UA 1SBWA 4ENKA 2GMTB 2HS5A 4Y8XA 2ZTZA 4ZH4F 2AIQA 1AE8H 3CTAA 4NQWA 4U0WA 2FUG2 3H35A 1IHTH 1G3DA 3B02A 3RXJA 1C2EA 2OU2A 4M3DA 2B7EA 2O8LA 5CHAB 1ESTA 3V7CA 4AFSA 4L0ZB 5HDKA 1TNIA 4XOJA 1ESBA 3VYRB 3J81K 1ID5H 3GY7A 2VB0A 1O2KA 3Q5FA 1ZR2A 2M8EA 1I6HJ 4CR9A 1VI0A 5EQQA 2RKHA 4JX5A 1VITG 3R4KA 1ZTKA 1VQOI 3CQZJ 1PQ5A 1U8BA 4HFPB 5LPFA 5DCFA 4DGJA 3SZGA 1WI9A 2WADA 2NXNB 2V6EA 4Y52J 4XICA 3VB5A 2DE9A 2XAHA 1I6XA 3L2WA 4HSRA 5TGTA 1QR3E 1O38A 1D9IA 3A84A 5A2QZ 2ALVA 3IKVA 1OCTC 2F91A 4BYYA 4X0GA 2G7HA 2Y31A 1YPGH 1UO6A 2HQRA 5E1ZB 1N8OB 4HDUA 1KXAA 4BACA 4IGDA 2EV0A 2EZHA 1A4WH 2HGTH 4ZYAA 2ZU5A 4RB0A 1U6GA 2BVLA 3EYDA 4RKJB 5J1YA 3RXLA 4BAQB 2A6TA 4U32A 1WWXA 2GA1A 1MNEA 2BVXH 2DMNA 5JB9S 4JQFA 2R7QA 1JWTA 1EH8A 1L0OC 5C94A 5C20A 4NA9H 5DDGA 2CW8A 1D1CA 5E3MA 3EAJA 2WY8Q 1O3SA 2ZPSA 2IS1A 4HSTA 5GDSH 1QJ1B 4K2EA 2KAIA 4BXSA 3TPIZ 1SLVB 2VWMA 3JZ1B 3LFUA 3DFLA 1BMAA 4E7ZA 1FQ3A 1ON1A 4BE0A 1GBDA 1LFUP 1JTXA 1TYNA 2ZDLA 1O7FA 1UCYH 3WTZA 1BM9A 3S9BA 5FKMA 3SU0A 5PTPA 4KDPA 3M8JA 4E4HA 3AAFA 4D7NA 1PPEE 1S0QA 2R3UA 2TGAA 3LGTA 4BTUB 3MNSA 5FD5A 1A0HB 2DOFA 2ZC9H 4AOQA 3UY9A 4XSXF 1UVSH 2MBFA 1BITA 3I64A 1TQ0B 3N99A 1UCYK 1TOCB 1GBEA 1MBQA 1TE0A 2QXHA 1YYY1 1DANH 2CQ7A 1S5SA 1AVWA 1V2KT 1SQOA 4KMFA 4D5FA 4U0VA 4XKWA 4XOPA 5C1XA 3BZ6A 4AU7A 4CRBA 1H8AC 3U1IB 6ESTA 2XDVA 3KIDU 1C2KA 1W5SA 1W14U 1G32B 1PUFB 1W2KH 1VF9A 1D3DB 2CFOA 2ZCWA 3J7AO 2F9PA 2XGDA 3A01B 4PJMA 3AAUA 3MO6A 1ZYRF 3AL0C 5DP4A 2RN7A 4UE7H 2LELA 5B5EC 1Y59T 2A31A 2JDID 1C1MA 4ZDLA 1T2KA 3RXTA 1B9NA 5JVTA 3ZVCA 4KICA 1GMHF 3DXJF 2ZSIB 2HNTE 2KCYA 1FJLA 3H3VK 2R7UA 5T6GA 3PYHA 2FOBA 4HQMA 4P5OA 1GDQA 3FXMA 2ZC2A 3HOTA 1G2MA 2Z3CA 4FUEA 4AN7A 1PP7U 4ZHLU 3J80K 5ILSA 4Q47A 1OYWA 4WMDA 2V1UA 4CH8B 2Y6TA 3CS0A 1FIPA 3LSHA 3X2QH 4JZDH 2NU2E 2DO7A 2HGCA 3BSQA 4NFFA 4P00A 3N4MA 2PUQH 3QPLA 3ATMA 2EV5A 1FLIA 3FDYA 2VBZA 3SU6A 2ZWLH 5F0HA 4MNWA 1WJCA 4LIUA 2IN2A 4NC7A 2DA4A 1E79D 2DK8A 4CR5A 2ZO4A 2F5VA 2TDXA 3B73A 4RA2A 3RKYA 2NRAC 5ESBA 1WUNH 4CCMA 4FE7A 4NGAH 1P11E 4DJAA 2AHME 1P2FA 2M2AA 4Q7YA 2ZGXH 1C5TA 1ETTH 3BG8A 3ASNH 5EDNA 2ZFFH 2W24A 2Y5FA 2ZHQH 4I7HA 3SV8A 1W36C 3RXMA 4RS8A 2VJ4A 3IG6B 2IBDA 2A4RA 2Q8KA 4XRSA 3IKTA 3CNRA 5FROA 2QXGA 3UNRA 1O2QA 3ODFA 3VODA 2EJRA 1F4KA 1FN8A 3MN2A 3VB3A 1ETSH 1C2JA 1CBWB 1XG1A 2UUFB 1GGDC 4D9QA 3I4MJ 1TP4A 1AHTH 3H5AA 2L5QA 1BB0B 1FLEE 2QV1A 1ZSJA 3ZZCA 2ZTXA 2ME6A 5LGUA 4Q2KA 3KZIC 1WH5A 5AIPA 3BIVH 3OFND 1AOYA 1Y0NA 4GO1A 4QT8C 3WTSC 3KL6A 5D5UB 2ZQ2A 1RIWB 1R49A 1XGNA 2XPVA 1NBME 2LMDA 1K2I1 5HVQC 1W3CA 2IS4A 3FBNB 4I09A 1BJVA 3P7NA 2IJD1 1ZJKA 3LQRA 4W97A 1KXDA 4CRCA 3A82A 1C5SA 1BIAA 3JRCA 2W3KA 2J34A 1QCPA 2EIKH 1RNLA 4HQEA 3KP3A 5E8GA 1WJAA 1GI4A 2ZFQH 3PJRA 2KQRA 5FX5A 2DMPA 3F0CA 2WPIS 1CA0C 2BOKA 4D0PA 1ACIA 1GHBG 1QU3A 1CQQA 1TWCJ 3SFZA 5D5XB 3OYBA 2C8WB 3NWSA 3PM3A 4OWRB 3RC6A 2EFPA 4UXNA 5EYRA 2JUCA 3H7TA 1QRXA 2DODA 2JA7J 4I02A 3H3UA 2V0BA 1W0KD 3PL8A 1PJPA 2FMJA 1T33A 4ZHAA 1OKRA 2F9UA 4X6PA 1T0FC 2M7AA 5FL7D 2KIFA 1UTMA 2HOAA 1AA7A 2E7WA 5FRMA 1ZHMA 2HVXA 1C5OH 1HOMA 4WXHA 3LU9B 1JUPA 2GWRA 1ENHA 1T31A 5LD2C 2K4BA 1BMFD 1OP0A 3WU0A 3OIPA 4FUCA 5IT9Z 4G6DA 1CHGA 3QOPA 2W7NA 4F52A 3TIUA 1HAGE 1PYTD 4PGGA 1BC7C 1E1RD 2TPIZ 4MHGA 3K70D 1AU8A 4CREA 1PPHE 4E7LA 4HF0A 1LVBA 4JK6A 3L2QA 2J2UA 1TOMH 1D0YA 2CXVA 3FXLA 3MNBA 1ANDA 2LSOA 5DSFA 2LFBA 3VSLA 1BR4A 4RGRA 2B9LA 4IKFA 1IQNA 1ZRFA 3WTYC 1MZDA 4NWLA 3O8CA 4NUBA 1O3RA 5KCMA 2IJLA 2DDBA 2P93A 1MBHA 9ANTA 4RM2A 5HIYA 3UQVA 4CH2B 1EZQA 1V3FA 4V2FA 2A5YB 2RA3A 1C1OA 4DOZA 2E2HJ 2V3OH 3WE3A 2EV6A 4FVBA 2CH0A 3DEUA 2PKSB 3DUXH 5IYCJ 4RAGA 4BY1J 3HOUJ 2BY1A 2PTCE 2YNAA 5T3HA 5LGTA 3GFJA 4XRSG 5LFAA 3QYEA 3FOAA 2VXZA 1N77A 3CP8A 5C5NA 5CMXH 2L9RA 3VGCB 2XBYA 1IAUA 1FOWA 3I78A 1C1SA 1BI0A 2OC6A 1KTTB 1I5ZA 1G36A 2FEZA 4Y0ZE 3JZ2B 1XMKA 3SBKA 1IO2A 1GV2A 1PQ7A 2FMYA 1WOFA 3BPXA 3L2UA 1FNNA 1FDPA 3HUGB 2MFZA 1JUMA 4XFQA 1T8MA 3SGAE 1HCGA 3PNYA 2DAOA 1Z91A 2XC5A 3SOSA 2LF8A 5CE1A 1ELBA 1L0ZA 1LDKB 1MH0A 3AFHA 1YX3A 1J14A 5LEJA 2WPHS 1ORKA 4X2XA 1F92A 1N6YA 4XKBA 1N6XA 3WW7A 5FCRA 2KRFA 1V54H 2VPLA 1EP5A 5KK1A 3O2PE 5DKMA 3PMHB 1TBQH 4NIVA 2F5FA 4IMZA 4KN4X 5E20A 5HS8A 1X19A 5ICEA 1RETA 1L3LA 4LG0A 5A0CA 5FKNA 4C3JJ 2L4AA 3R6SA 1AUJA 1D0XA 1XKAC 3CUQB 3GY6A 1UMAH 5DG6A 4JZEH 1G3SA 3JSPA 2LLKA 4KMUX 1BI1A 1IRZA 1MZBA 1O3AA 1HNEE 5EU8A 2HXOA 1UTQA 2VH0A 3DF8A 5DM6F 4OS2A 5LGNA 1CVWH 1GJ5H 1O2NA 5LEKA 1IF1A 1C5LH 4AYBN 4OMYA 4TSFD 1A3EH 5EJZA 3OYGA 1KU7A 1TL8A 2XIGA 3K10A 2JUGA 1LHFH 2BDYA 4CBOA 1BR1A 1BHXB 1T56A 4Y7BA 2HYFA 3A4CA 3MWMA 2B8OH 4P55A 2RAEA 4EQQA 2VQCA 1Z6RA 1O2GH 1C2GA 1OWEA 1FYKA 3F21A 1AZZA 1YLDA 2OQGA 1GHXH 1IC8A 1ULYA 2BY3A 2BXZA 3H0DA 6CHAB 2D2DA 1ZHRA 2VJJA 4BANB 1Z0XA 1WSUA 4DZPA 1F5LA 3ZVFA 2G5NA 3S1MJ 3MU4A 4LGWA 4WXIA 5FX6A 3BTIA 1CGHA 1STZA 3M9AA 1GDUA 1DLKB 3KYFA 1G3WA 2BX3A 2Q6FA 2W3IA 1KIGH 1F36A 5L3CA 5C4JJ 2H1UA 1O31A 3KQDA 3V7TA 4UONA 1Z6TA 5A8YA 5EJCA 4M6YA 1H8IH 2M4GA 4SGBE 1WDIA 5EJLA 3ZQLA 3KP4A 2JKHA 1FOYA 2A7HA 1BTWA 3F0PA 3ULQB 2QF7A 3S8PA 1P6RA 4IHWA 2XBWA 2CF9H 2VQLA 1DPOA 3TJUA 3K7AJ 4TWYA 3JR9A 3HKIB 1MJ9A 4YEJA 3ZZ6A 2PWXA 4Q5SF 2BLWA 4Q63A 3P17H 3RP2A 4M72A 4E7IA 1JRTA 3SJOA 3GY3A 4E70A 4YG2F 1M9UA 1YS6A 1IDZA 4HBLA 3KNXA 1EUFA 2UUYA 3JRAA 1VCQA 4A93J 4I8KA 1J17T 4UVCA 2ODYB 1Z8IB 2ZNYA 4XOTA 4INLA 3DSPA 5SGAE 1XDSA 1O35A 4IJAA 1T4UH 4P9FA 2O6GE 3AAVA 1W10U 3S93A 4IBLH 2BD3A 2KIMA 3E3VA 1B59A 1NU7B 3IH2A 2L3DA 5EOKA 4OS4A 1O3NA 4QPOA 3NUMA 1V6DA 5JPMH 3ZZ9A 1K78A 4IHSA 1T6SA 3SO3A 2PMZA 5ICCA 3AASA 3DKYA 3D0SA 1QFKH 2ANYA 3LH1A 3IUOA 1V5GA 3T25A 5EXMA 1T0FA 2UWLA 1TNGA 3S9CA 2YU3A 2BGCA 1SGFG 2MW8A 1YPLH 1ORFA 1P7JA 1J09A 1GJ9B 3BG5A 2M1BA 3PFIA 1CO7E 5C0TA 2EFQA 3M1CA 2GJGA 3TOBA 4H0EA 4XK4A 3CCQI 4MG3A 2ZA5A 2JQ7A 1RFNA 2WB1N 2BVSH 3EUAA 4XLPF 2R3YA 2FPZA 3CS7A 4O9VA 8GCHG 3RYPA 4KGAA 1MMDA 4FXGH 4ABGA 5CQEA 3SJKA 1SGDE 1K22H 1A36A 4V19K 4ITVA 3D65E 2HALA 3UNGC 2M45A 1KXFA 1ZH5A 5IT9K 1NFXA 1GUUA 4K69A 5EG0B 3PM1A 2ID6A 1KY9A 1GI9B 4HRIA 3VXFH 2QY0B 4XL9A 2ESTE 1TQ7B 2STAE 2VIXA 4MPWA 1GBCA 1NK3P 1O5FH 3HG9A 3M35A 5FRNA 1ELFA 4XBBA 3I71A 2OBPA 4M73A 4AIJA 1MTUA 1R36A 3KGPA 2XB5A 3R3GB 4X8SH 2JETC 1R58A 2JT1A 1BW6A 1D3YA 1USSA 2BYAX 1Q31A 2NOJB 1EH6A 3MMGA 2EIMH 1MMSA 5D4RA 5D5VB 1CT4E 2GP9B 3HM5A 2H5DA 4RKOB 1HA8A 4ZZDA 1D5VA 3FHNA 4CCOA 3QPTA 2ZHDA 4RGSA 1ZHPA 2AHQA 1U2WA 2A05A 2W5EA 3G3ZA 2Z9JA 2PBIA 2VPRA 2LG4A 2WC2A 2VWLA 2LBFB 2QXJA 3QU3A 4M9ZA 2E5ZA 5IYTA 3S16J 4BXUA 1PPZA 3I5UA 4ZYDA 4I8HA 1KXBA 3Q3KA 4U01A 5DM7F 1T32A 3V12A 1P09A 3T28A 1P05A 2F3CE 2VINA 2M5WA 2RDPA 4PUSA 3S14J 3OX7U 4X0WU 1FONA 1G59A 2H5CA 4AG1A 2BDBA 1IUFA 5F0FA 4A0ZA 1P01A 2XRCA 3W2VA 5JVGF 9LPRA 3BEIB 1TX6A 2TBSA 1XKBC 5G4BA 2A4GA 1QQIA 5E79C 4EGZA 2GCHG 3ZR8X 3PWBA 1LQEA 1D1BA 2BD5A 2HDWA 5L3DA 5HNFA 3IV5A 1KU2A 4KTUA 1SGFA 2Z3EA 4C3HJ 3SV9A 4HX4A 2P6TA 2F5CA 3RIRA 1QPMA 1P4WA 2L2OA 3FXJA 1IN4A 3WHBA 1FN6A 2DDAA 5I46H 2CJIA 4JCNA 2HLDD 1PUEE 4UNOA 1DSUA 3H9GA 3ZQFA 5K5QA 1ZGIA 2E36A 1GLNA 2P95A 1OYQA 1OX1A 4MTDA 1YITI 2G81E 2YUSA 2ID3A 1FY8E 3PO1C 3OYJA 4B44A 4AYYB 1GMHG 4QPQA 1K79A 1LVOA 1Z6JH 1K1IA 4X1EA 4HYEA 1O2WA 1O34A 1G3YA 3E6PH 2P16A 3Q3SA 3VYTB 4YFKF 4E7NA 1EOJA 5HMAA 3FMQA 3J7ZI 1MQ6A 1BI2A 4LK1F 3PUBA 2EFNA 3MNXA 4CRDA 1LFPA 3SJ9A 3DTIA 4EJTA 1J75A 3LSRA 1SQRA 2O8XA 1J0RA 2NU3E 1XSVA 2J5UA 1UK4A 4OU0A 1AB9C 4HZHA 1DDJA 1DICA 2HWLB 1MJBA 1C5PA 2OZUA 3LAPA 1C2DA 2AS9A 1O57A 1UVTH 3CD6I 2PLXA 2Y69H 1C5ZB 1C5YB 3VWBA 2FZZA 3HGGA 1DWCH 5AVDA 2HVYB 1BIOA 3QUMP 4XBCA 5JR3A 3DU6A 3JW4A 2WPMS 2HVSA 1MABB 3ABTA 2MG4A 2W57A 3WY8A 2WZQA 2E60A 3GY5A 2DBBA 4ZJZA 2X1EA 2FMLA 3WTXC 2H09A 5JI6A 1TMUH 1V2LT 5B3SH 1A0JA 1QBVH 1OCPA 2L54A 1OLTA 3UNQA 5EPYA 4EM2A 1PPGE 1P2OA 2FQ4A 3P9KA 4ZZLA 2QA9E 1IZ1A 4OS1A 1QQUA 2C8YB 2ASUB 1T4VH 1BMLA 1HB0B 3ZOBA 5C0UA 2GTBA 1ELAA 3LL7A 4E05H 2H8RA 1YYVA 1SOZA 1J16A 1EAXA 3QYFA 3Q3YA 3O8GA 2RG3A 4Z0KA 8LPRA 3GTJJ 1XUIA 4ZUHA 2FWWA 3SUDA 2F9OA 1Y56A 4O3TA 3A01A 1TBZH 1W7GH 1V5FA 4C9YA 4L5JA 5TISC 1D6WA 1XB4A 1FP2A 1OHHD 2R7TA 4XLAA 2QBYA 2QSFX 2RFKC 2CW7A 2K9SA 2Y0MA 1LKAA 1OWDA 1FYMA 3PQKA 8KME2 1G37A 1FP1D 4X1NU 4ZTFA 2IOTA 1V4RA 3R60A 2VJ5A 4CCKA 2LY2A 2HPIA 3ZQ7A 4B1TA 1QY6A 4RT0A 2QF3A 2YSRA 1ETOA 3C1DA 5C3EJ 1O5DH 2ZP0H 3FP8E 3ZV8A 1JIRA 5F08A 3C2BA 2A6HF 3VFZA 4OMZA 1O3GA 1UTNA 4A3MJ 2HZDA 4QLCU 4CCLA 1O2HA 2AMPA 1SFIA 1C2FA 2BE5F 4U30A 4BL0B 4S04A 4A92A 2LOOA 1GI6A 4GAWA 3PROA 1N75A 2WPLS 1OSSA 1EQ9A 3RXCA 5T6DA 1IRFA 3SU4A 4TY6A 1GG6C 1SG8B 4D7MA 4A3DJ 1R5ID 3QYBA 1MKWK 2BHYA 2R92J 4WMEA 5HM2A 1GI3A 1U5TB 1GWAA 3ERED 2GIZA 2DFEA 2ELJA 1MSFC 4ABFA 2F4MB 4X2VA 3CP2A 3U8RH 3QZRA 2VODA 1TGNA 2XAGA 1SVMA 2W85A 1MD0A 2LKXA 4L5IA 1AUTC 2DJNA 1W0TA 1HAVA 1O5GH 2CHAB 3QO6A 3QK1A 1JOUB 1S72I 3ELAH 2AXTC 1D6RA 3Q3XA 2NVXJ 4AG2A 1OPCA 1VZ0A 5FKLA 3LJJA 1F5TA 1G3CA 1GI8B 2KP6A 3NEUA 5F53A 1O2ZA 2P0WA 4DURA 4M74A 1C1QA 1DY8A 1UK3A 1BC8C 1BBRH 2G5VA 1XUHA 1X3WB 4LK0F 1NK2P 2QE7D 1UTLM 3RMOH 2SGFE 5IT3A 3ZP5A 5FPTA 1TRYA 1LHDH 3ML6A 3F22A 3PV5A 3RXKA 3F9FA 1EPTC 3KP5A 1E17A 3HHHA 1O33A 2TRTA 3FKIJ 3TK9A 3T8TA 1KLIH 4WMFA 4PROA 1GV5A 2J4IA 2BY2A 4NNJA 2KDZA 1KXEA 3E0PB 1TZLA 2SGAA 4KIGA 1AMHA 2KCOA 4DZJA 1O2XA 2R7WA 3PWCA 1Z21A 1B0FA 3CCRI 5IOZA 4MNVA 4F91B 3M1EA 4N9IA 3TDUC 1O3FA 1QRZA 5GNDA 2OBOA 2V1XA 1F0SA 1R4NB 3IH3A 4IHVA 1WAYB 5B6OA 4BAKB 4B75A 2BHZA 1WTGH 2ZMEB 1K78B 2LKPA 4RMNA 4RDUA 2PFBA 2BD8A 2Y9YA 1VITF 2JA8J 2JA5J 5F64A 1K83J 1ZMJA 3O8DA 3SNBA 1B4AA 3ABKH 5EEHA 2WV5A 1HPGA 1O3PB 2FODA 3RQ4A 5M3MJ 3RDIA 3CCLI 3TNSA 5J4VA 5FLVA 3ZXSA 2D26C 4GCVA 4U87A 2VE9A 4H6SB 3K1PA 2H1KA 4I8GA 3L9FA 3UR3C 2V35A 1UVPA 2EB7A 4YIRX 4YZUA 2G52A 3F8CA