1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
4HDUA 1L0OC 3R60A 3VODA 2ZNZA 3J81K 4CGZA 1XSXA 3ZMSA 1R58A 1S8NA 1XGMA 4S04A 1FP1D 3BJ6A 3DPLC 3LWFA 3IL2A 2L4MA 3KEOA 1R1UA 3EUHA 5IT9K 1LVAA 1Z91A 3HTUA 4KFCA 1QNTA 2R7FA 3TOBA 3O6BB 3CUQC 2PLYA 3S2WA 3G3ZA 1K78A 1W5SA 4L9TA 5BMZA 2E7XA 4HV6A 4I7HA 1Y0UA 3EQLF 5FD5A 2ZMEA 1FZPB 2YR2A 3J7AO 4G94A 1KU2A 5CVUA 1ZH5A 1J59A 5FGMA 3IRQA 1GXPA 1B4AA 2XAQA 3DPTA 3Q9SA 3WE3A 3LQRA 1T38A 4EV0A 3WTYC 5L3BA 4ZZLA 4LLLA 3CJNA 5HS7A 1MDMB 2DPDA 5D4SA 4ASNA 4XBFA 4QWQA 2F5EA 2OBPA 2CYYA 5AIPA 2H6BA 1XSVA 3GLXA 4GXOA 4L0ZB 3FX3A 5LGTA 3E6CC 2Z9OA 3NRVA 2VODA 3F3XA 1J0RA 2F5FA 2XROA 5DEQA 4HX8A 3D5LA 2MH2A 2JRTA 2Z99A 1TQPA 1MZBA 2O03A 1ZG3A 2DK8A 5E8GA 4GGGA 1LEAA 5D5UB 2A61A 3QU6A 4EM1A 2LF8A 2AS5F 3SZTA 1X3UA 4P5OA 3CDHA 4LD5A 2PMUA 2DFIA 1MJ9A 2RNJA 2A3SA 3KZYA 2XGXA 4LGWA 5L3DA 2FA5A 4I09A 1I1GA 4KIGA 2VE8A 1C0WA 1FOKA 5LRSA 4WK8F 2VE9A 2X4HA 1L3LA 3TKYA 3VFZA 4FX0A 5LEKA 4CO8A 3R4KA 2P5VA 5DD4A 4I2OA 2FBKA 2XVCA 3RTRA 3KP2A 1Z6TA 2A6EF 1QO0D 4HOBA 2YSRA 3HYIA 4OIRF 2QYOA 3RYRA 3SQNA 2FMLA 2PEXA 3HTSB 1BOAA 3TDZC 1YIOA 1UHMA 1ZREA 3SHFA 2DPUA 3RI4A 3ZN0A 4EJUA 4HYEA 3BOQA 3M1EA 2ESHA 2Q8KA 1WKMA 4CICA 3FZVA 3RKWA 1J75A 2XAGA 2DI3A 3L9FA 1LDJA 3JAMK 1IXRC 5JFRA 2IW5A 2GIVA 1TNSA 2OZ6A 2L54A 2DLLA 2K02A 5L3CA 3TGNA 2L02A 1RUOA 3P9IA 5IT3A 5HDGA 3TO7A 1SD5A 4A12A 5BQTA 3ISPA 1P2FA 1EH6A 4HX7A 2HR3A 5ILUA 2P6TA 2XAHA 4WWCA 1R00A 3HRMA 5LHHA 1G3YA 2HEOA 3GEZA 4P96A 1LDKB 1SAXA 2FNPA 1IUYA 4BHPA 3COAC 3ZMUA 3HHHA 5FLXZ 3WTXC 2QBYB 4RGXA 4XSZF 2VOPA 5E17F 2CWEA 1UCRA 4AIKA 1BI2A 3FMRA 3V7SA 3RIRA 2Q2EA 3E3VA 4HAMA 3O3KA 3WG9A 2VBYA 4H0EA 3L7WA 3LSTA 1IN7A 4UVCA 3F23A 1J7KA 1XDUA 2A68F 3FXUA 1IW7F 3FMSA 4ENJA 2VT2A 2OAZA 5DUKA 3WU1B 4BHCA 1FY7A 4I0BA 1V4RA 1JHFA 5K5OA 2DAOA 4RAZA 4G6QA 3BJAA 5E1XA 2VONA 2HTJA 2BBYA 4G7OF 1G3SA 3J80Z 1ZRFA 2OU2A 1R5GA 4KIFA 1I5ZA 4Y17A 2OQGA 2DT5A 2OA4A 1FBUA 5CVRA 3DKWA 4N0BA 3DV8A 3KP5A 4FT8A 3KZZA 1I27A 3QOPA 1FYMA 3EYYA 5L3EA 1O7LA 1W5TA 2BYVE 3FXRA 5L3FA 3KFWX 4U0VA 3QPHA 2KJBA 4EJWA 2QUFA 1IAWA 5D4RA 3F22A 2XKPA 1ZG1A 4NB5A 1IN6A 3ZN1A 3KEQA 1O57A 4G8XA 3RDIA 4ETSA 2FRHA 2K7LA 1YQAA 4L5JA 2R3SA 2WC2A 2NNNA 3FM3A 4IRHA 3BJOA 2W57A 4YIFA 4BHBA 4HBLA 1TQMA 4UNOA 2FF4A 3CUQB 2EJRA 2QBYA 2ADUA 4A5NA 1TBXA 4AD9A 3T8RA 3ZPLA 3NQOA 2D1VA 4D0PA 4R79A 1HXDA 4NHJA 2W85A 2FE3A 3SXYA 3I71A 3IKVA 5CYVA 2K86A 5BPIA 2FQ3A 5FD6A 1Z6RA 3QAHA 1MGTA 1R7JA 3I0TA 3SFZA 1E17A 4M6XA 4ENMA 1EH7A 4UVAA 1OYYA 1YTYA 4N9IA 1TTYA 3E6MA 4M6YA 2HOEA 4A6DA 2H27A 1YO5C 4RAYA 2EFPA 4O6JA 4L18B 3N4MA 2HFHA 4FHTA 2PG4A 1IXSB 5FFZA 1OKRA 1G3TA 3F6VA 3ZMZA 2XIGA 3LAJA 1R22A 2NYXA 1XSDA 5ILSA 2Y75A 1XD7A 3WTZA 4RB2C 5KK1A 1MKMA 4RS8A 3C7JA 2ELHA 2DBBA 4S05A 2UXNA 3DQVC 5D6FA 3F8NA 4XSXF 2E7WA 2HKOA 2FSWA 2OD5A 3J81Z 5HS8A 5LHGA 3VEPA 3EDPA 4CHUA 2BE5F 4PDKA 4BAYA 2H94A 1YLFA 2DU9A 1FNNA 2DO7A 4M71A 3RKYA 1K7AA 3CUQA 3CLOA 4EJTA 5IT9Z 3CTAA 1KYWA 3HOTA 4CDGA 1MJBA 3REOA 3ZQ7A 2QZ8A 3FWEA 1ZRDA 1LJ9A 4ZZDA 1TNTA 4Q5SF 4RGRA 3GUDA 2TDXA 4HF0A 3K9TA 4P9FA 1DP7P 2ZKZA 5J8CA 4ON0A 1XGSA 2FXAA 1FP2A 2DK5A 3V8KA 1R36A 2MA3A 3MQ0A 2LF7A 3MAJA 4DNCA 4LLGF 3E5UA 1ZYRF 4U7DA 3LQQA 5E20A 1BIAA 5DCFA 4KNYA 4RGUA 1ZGAA 5ED4A 2F5DA 3WGHA 1FWZA 1S7OA 4KMUX 2IJLA 2MC3A 4G7HF 4RB3C 3V7RA 4YFNF 5J6XA 1JXSA 5E18F 2RN7A 5A2QK 3WTSC 2W25A 4U7BA 5D8LB 4LB6B 1T2KA 4WF2A 1FSHA 4ZH4F 1ULYA 4MQVA 1W7PD 3M7GA 2RV8A 2UXXA 3E97A 3FHZA 4L0YB 5ICCA 1FBSA 2IA2A 1DPRA 4EGYA 5F1RA 4RB1A 3R6SA 4XRFA 1H9GA 4JK1X 4M9SA 5JR3A 1YS7A 4P55A 4U88A 3GVAA 4ESBA 2STTA 5FFXA 4ZYGA 4G6DA 3FM5A 3JTHA 4WXCA 2BGCA 3QU3A 4L9NA 1BJAA 3DXJF 3FXQA 1OPCA 1HSTA 4EM2A 1E2XA 4N9HA 3G73A 3BY6A 5DUIA 2CGPA 3WODF 3C18A 2JZYA 3N97A 3CO6C 5ERIA 4B8XA 1FPQA 2IT0A 3EYIA 2NS0A 4HV5A 2QM3A 3E5XA 1U3EM 1AWCA 1AOYA 2GA2A 2YU3A 1G4DA 1BC7C 3ELKA 2VXZA 1EH8A 1P4AA 3JAMZ 3IKTA 3I54A 1BI1A 3KP7A 5F6FA 4KDPA 5ICEA 2FU4A 1XMAA 2HYFA 1FLIA 1I6XA 3L00A 1XDSA 4MEYF 3CUOA 2EFNA 3PQJA 2UZKA 3HRUA 1LDDA 1KA8A 5D5WB 1GVJA 3MZHA 3WTWC 1MDMA 4GYGA 5DDGA 3RKXA 2MLGA 2CSOA 1QGPA 4FX4A 2GZWA 2PQ8A 3GFIA 3T5XA 1XCVA 5LEJA 4UV9A 3HHGA 2HGCA 5DD8A 4YIIA 1XGOA 1F9NA 4LFUA 1Z1DA 4G7ZF 3E6BA 2JPCA 3WGGA 2VN2A 2V1DA 3HIFA 1TLHB 1TQIA 4ZYDA 2O3FA 1HKTA 2YX4A 1DPUA 1V3FA 4L9VA 3W6JB 2LKPA 1ZGJA 1RZ4A 2NRAC 4IF4A 4MQ9F 2EV5A 2Z33A 1FYKA 4OIOF 1JE8A 2L4AA 1IRGA 3V4GA 4EQQA 3KCCA 3I58A 2RVCA 2HDCA 2ISYA 1IRFA 1K79A 3BP8A 3JSPA 4BXUA 4IHTA 1QBJA 3I53A 1WSUA 1SFXA 5L3GA 1G3WA 4HW0A 3WTUC 2G7HA 2KKOA 3MFKA 2VBXA 2B0LA 2K4JA 2RDPA 5DCMB 2PFBA 4LG0B 3F8BA 5HVQC 1Q1HA 3GX4X 1WQ2A 1BI0A 3ZMDA 3Q5FA 3K1PA 4OU0A 2ACJA 4G9YA 4I01A 3MZYA 3F6OA 3TO9A 2ZCWA 3BWGA 3NEUA 2P7VB 4UHTA 3AAFA 3T1BA 4OINF 1O3TA 1CGPA 3H92A 1ODDA 3QRFF 1WI9A 4TV7A 2VBWA 4M73A 1UHWA 2EB7A 1FBQA 3OOPA 1SD6A 4KN7X 1GXQA 1PP8F 4KT5C 2ESNA 4KMFA 4U0YA 4EGZA 5D6EA 2P7CB 4Y13A 1OYWA 1W4MA 2HWVA 4I0AA 3GFLA 4BH9A 4M9ZA 1U5TC 3GZ6A 1JHHA 5HDNA 3K1MA 4R1HA 2CW0F 1QQIA 5TJJA 4PCQA 1SMYF 1Z9CA 2OZUA 5DV5A 3RYPA 2XAFA 2QQAA 2PBIA 3JSOA 5HLHA 1ZG5A 1P4XA 2GAUA 4LK0F 2MD5A 4ESFA 5CVJA 5K5RA 2VC0A 3TQNA 1RIOH 4EJOA 2PMHA 4HDVA 2Y48A 4O5VA 3KLOA 4IJAA 1T6SA 1T98A 1RI7A 1YFHA 1B6AA 1CF7B 1ZHFA 4OOIA 2BEOA 2HKXA 1U78A 2G9WA 5ICGA 2D45A 1HW2A 3ECHA 4HQMA 1D3YA 5DCMA 4LG0A 3ROUA 4EJVA 2RQPA 2GXBA 2F2EA 3M9AA 2V9VA 5HLGA 2XASA 2IA0A 5HLIA 2ZXJA 1LQ1A 2A5YB 4MHGA 2X0LA 1BC8C 5H6QA 1KQ9A 2HYGD 1H9TA 3P9KA 5LGNA 2ZBKA 3V7CA 3HUGA 1F4KA 2IA1A 4KICA 2PJPA 1O3RA 1SFEA 2VBZA 1KYZA 2DW4A 4M9XA 2EFOA 3JW4A 1QZYA 5H20A 4NQWA 2FOKA 3ABTA 4M72A 2JT1A 4K2EA 4JBAA 5E8IA 3BROA 2J5OA 4PGGA 4Z2YA 1BI3A 4WXHA 3WGIA 1P6RA 4XLNF 6PAXA 4ESJA 1QPMA 4ZYHA 2XV4S 2EFQA 1XGNA 2Y0MA 1HBXG 2FBHA 1T39A 5J8FA 3KP4A 3WTVC 1KU7A 1U6GA 5JHUA 1KU3A 2XKOA 3TDUC 1R23A 3U1DA 1B59A 3LAPA 3O2PE 1B1BA 4PZJA 4L5IA 2D2WA 3H3UA 3WE2A 3KETA 4A0YA 2KIMA 1WRJA 2QWWA 5D5VB 2KJCA 1D8KA 3W6KB 1CF7A 3LA3A 1HW5A 5KVRA 3TO6A 3ZMVA 4HX4A 3ZP5A 2STWA 5DYMA 1LEBA 2YPRA 4XLPF 2GA1A 3V8JA 3K1NA 1PUEE 3T0YA 2M1BA 3ZMTA 2HZTA 1ON1A 3F8MA 5AIQA 3E5QA 4IXAA 1IN4A 4A6EA 5BS6A 1ZARA 3EETA 5JVTA 2LSOA 1F1ZA 3TOAA 1T0FA 2GQQA 5A2QZ 1Z05A 2WTEA 2DTRA 2EA2A 5BPDA 2NAZA 5CJ9A 3PFIA 2P5KA 2IRFG 2UWMA 2M87A 2H6CA 3WTTC 4EMSA 2G7UA 3ECOA 3F72A 5LLQA 1J5YA 2E1CA 1ZRCA 3VOEA 5FO5A 3U2RA 2K27A 1B9NA 1FX7A 4ZYEA 5LBQA 5HDKA 4UUVA 1U2WA 3PQKA 2JTVA 1MJAA 5HOOA 4IRIA 5JI6A 3KLNA 2FEZA 2O6GE 3F8CA 3IRRA 1K6OA 3OV8A 1H0MA 2A6HF 4F7ZA 1KQ8A 4HQEA 4B09A 2Z3YA 2QVOA 2XAJA 4UV8A 4HLYA 1O3SA 2P4WA 4O3MA 1IXCA 1SD7A 4OMYA 2EV6A 3HSRA 4DQ2A 4MNUA 1R1TA 2JPBA 4Q48A 1YS6A 5AONA 2A69F 1FYLA 1W7PB 2FNAA 4A2UA 1B9MA 2K4BA 1HKSA 2M8EA 1BN5A 4P9UA 1EV7A 3BDDA 4AIHA 3B73A 2C6YA 2ISZA 2VT3A 3RPQA 4MTEA 3ERED 2L3DA 1BBYA 2FBIA 5ICFA 3DEUA 1S6LA 2GWRA 2ZNYA 3ML6A 4CZZA 2Z5UA 3HSFA 2HTSA 4HA8A 1D5VA 2WV0A 2PI0A 1SMTA 1J2XA 4UXNA 3M8EA 5LRRA 2KRFA 1STZA 3H3ZA 4HF2A 2MLKA 2EWNA 1HKQA 1U5TB 3GF2A 4OIQF 2VC1A 3ABUA 1VTNC 3FMQA 2F5CA 1S7AA 3HRTA 3KE2A 2QQBA 1IZ1A 4QLCU 3GZ5A 5TRDA 3BZ6A 3I5UA 2QQ9A 3GWZA 2DQRA 2ZO4A 1GHCA 4AIJA 1ZAOA 5CVIA 4WXDA 1P4WA 4R8HA 1ZLJA 2JSCA 2J5PA 4OIPF 1IN8A 2HQNA 3MCZA 2WWYA 4I98B 3WU0A 3P9CA 4Q47A 3GFMA 4AVPA 1RNLA 3LA7A 1FT9A 1WWXA 4IVNA 1LB2A 5LGUA 2RKHA 4L9JA 3BPXA 3R0JA 5LHIA 4WX9A 5EEGA 4BNCA 3IC7A 4A0XA 1S3JA 2QLZA 4Y15A 4GO1A 2COMA 3F21A 2IP2A 1RUNA 4ENNA 3K0LA 3RJPA 2P6SA 3QP6A 1OMIA 1KU9A 1R5HA 4LLNA 2R7DA 2YX7A 4E70A 3DF8A 4Q4ZF 4M74A 1ONVA 2AXLA 4I02A 3Q9VA 1YW8A 1DDNA 3M8FA 4YFKF 4AWXB 2NNYA 2P5LC 3B02A 4YG2F 2VOOA 1HSJA 3V8LA 1W7PA 1D8JA 3DFGA 1USSA 3L2CA 2HS5A 4KN4X 1IN5A 1USTA 3ULQB 2P8TA 2EFWA 2O8XA 5BOXA 1YW7A 5FLXK 5D8KB 4KUMA 3GXOA 2KIUA 1TW2A 1FC3A 3QP5A 2CQKA 4UVBA 2ETHA 2CFXA 1G6NA 2OQRA 4KA4A 2EA4A 1U5TA 4PGHA 1BIBA 4KIBA 2O61A 4KYWA 5D5XB 2V1XA 3SZPA 2W24A 1UFMA 1ZN2A 2IPQX 1YG2A 1HQCA 3FF5A 3KP3A 2V79A 1XB4A 3P7NA 1HW1A 2H09A 3D0SA 4EM0B 3LA2A 4YFXF 3K2ZA 2ZFWA 1P92A 3I59B 4U0WA 2M5WA 5E1ZB 2CO5A 2HQRA 1J9IA 1XCBA 2Q0OA 3HRSA 3J80K 3I4PA 4GYIA 2W84A 1KGSA 1MD0A 3KP6A 3LFKA 1XMKA 1ON2A 2M45A 4HF1A 1YYVA 4ENKA 4GCVA 4BYYA 1NHAA 1KQ0A 3QPTA 4HLXA 3HOSA 5K5QA 2LNBA 1OR7A 3HSEA 4MEXF 5E1WA 2CG4A 2LDUA 2D1HA 5EEHA 1YW9A 2MH9A 3GFJA 3MEXA 4IHSA 5FB2A 5F64A 2KIFA 4LMYA 3IWFA 2GXGA 3IHUA 1UB9A 1IF1A 1O3QA 2EK5A 1TW3A 1OYIA 2O0YA 3DP7A 3GW2A 4A5MA 1Z7UA 2RC4A 3L09A 1REPC 3JTGA 2IVMA 3IWZA 1O7FA 2XUBA 5CLSA 3CO7C 4EVIA 4RB0A 2RGVA 2PN6A 1F5TA 2DQLA 1PP7U 1DUXC 2V1UA 4RGSA 2BV6A 1SFUA 1XN7A 2XRNA 1I1SA 1K78B 2M30A 1LNWA 4WCGA 1PDNC 4JQFA 4CXFA 2L01A 4A0ZA 2ZMEB 1QZZA 2XHKA 1FSEA 1S29A 4LK1F 3C1DA 3K69A 2E1NA 5ILVA 3GYHX 4LJZF 4IPAA 1U8RA 4HZFA 5K1YA 1ZLKA 1A04A 1SD4A 4OMZA 2MBFA 3BPVA 3MWMA 1R1VA 3I59A 2FMYA 4BQAA 5HS9A 4CYDA 3R0AA 4MTDA 2ZJ2A 3RPUA 3R61A 4LB5A 3I64A 4IRGA 2V6CA 3C3WA 3F8FA 3E6DA 5H6RA 3T8TA 3U9GA 2A07F 3GO5A 1BM9A 5CVVA 3VB2A 1JGSA 2QENA 4MGRA 2EV0A
chains in the Genus database with same CATH superfamily
4HDUA 4A3BJ 1W0KD 5JBTA 2ZPRA 5GDSH 5GPAA 1R58A 1ZR2A 1X2NA 3P8FA 3M3SA 3SI3H 1IRZA 3RXOA 2XRLA 4FUFA 3PNYA 4KTCA 2KAIA 3A8BA 2L4MA 3B6AA 3RC6A 1A61H 4IOAF 3A01A 3K70D 1U8BA 1GBDA 1UTOA 1G36A 3HTUA 2BOKA 3W2VA 3TOBA 5DP7A 2PLYA 3S2WA 5CHAC 4L9TA 2PKSC 1JJ6C 3LT3A 3EQLF 2ZMEA 1FZPB 1ZH5A 2QQ8A 1V2LT 3IRQA 2L6OA 3VYUB 1DOJA 5FKKA 3O8DA 3EQ0H 2VPRA 3RXRA 2JMWA 5L3BA 4B43A 1K1IA 3CJNA 5D4SA 4QWQA 3LGYA 3D5SC 2VIQA 4LOCA 3GLXA 4NA9H 4RDUA 3DPUA 4RMNA 2AHQA 4FOUC 1TP4A 2Z9OA 2VODA 2ZKSA 4DYCA 5GWZA 2DOAA 2JA7J 2HVRA 2O8TA 5DEQA 1DDJA 2JRTA 2I5UA 1JT6A 4MO7A 4DW2U 1O37A 3DU5A 2KCOA 3U28C 4E7KA 2E2JJ 3BTFE 5A8XA 2WZQA 3C2HA 2A61A 3BSQA 3NCLA 2LF8A 4LD5A 5LPEA 2WSSD 2A3SA 2XGXA 1W12U 1SGIB 4FU8A 3BTTE 1J17T 1ELFA 1I1GA 1SOZA 2BXZA 4KIGA 4NWKA 2VE8A 3BG5A 2VJ1A 3SJ8A 3K2AA 3WG7H 3OS1A 1KXFA 1MZAA 1P7IA 3H5RA 3VFZA 4B73A 1O2RA 5LEKA 1Y5UT 4CO8A 2RREA 2PKAA 4UD9H 2FBKA 3PM1A 3KP2A 2A6EF 1QQUA 4PK4A 3TH2H 2QYOA 2J34A 5EYRA 3KQBA 1O5BB 2GKVE 3HTSB 1O5FH 1ZREA 1UHMA 1ITYA 5GJ4B 2ZG0H 1QU3A 1P3CA 1OHHD 1CO7E 2WPLS 2OLGA 2WADA 1K1LA 3FZVA 1J75A 2XAGA 1W0TA 2ZP0H 2GIVA 2QF3A 1EKBB 1ZHMA 1MTNC 3F9HA 3P9IA 2HYJA 4ZCNA 5HDGA 1MD8A 3ISPA 1P2FA 1TA6A 1TMUH 5DM6F 3K2UA 2M9HA 2CRGA 1Q3XA 1G3YA 1BMMH 3LFUA 2XF5A 1SLUB 1IJWC 3BR2A 2LBFB 1SAXA 3LU9B 3KEEA 2VIXA 1GV5A 1BR4A 3CP2A 4K5ZA 4BXSA 4RGXA 4MDSA 1MD7A 2EZKA 1UCRA 2WAEA 1BI2A 3VYTB 1DQUA 1CGHA 4E7IA 1AD8H 4HAMA 2MG4A 1AB9B 1TWAJ 2K5CA 4JCNA 5AHGH 2Z9KA 2JSPA 1J7KA 1I3AA 3EYDA 2QEXI 2NS8A 1UK3A 1Z1IA 3N7OA 1A31A 1JXPA 1XMNB 1MBHA 5DUKA 3E1XB 4BHCA 1FY7A 2L9VA 1V4RA 3TU7H 4M3BA 2BZ6H 4G6QA 3U8RH 1ETSH 2HTJA 1Z6EA 2BBYA 1SANA 1BHXB 4JK5A 2DFHA 2JA8J 4B75A 2XPVA 1QBOA 1R5GA 1B72A 4KIFA 7GCHF 3FDYA 1FMGA 5CVRA 1S9HA 1YRNA 4GPGA 2BDYA 4ZYAA 1PFXC 1I27A 3QOPA 3MO3A 2TRMA 5ESTE 4H6SB 1PPBH 2FI4E 2ZU4A 4CUGA 3BG9A 2KT0A 3QPHA 5CKTA 4EJWA 1JRTA 2XWAA 5D4RA 1I39A 4AUXA 3P8GA 1ZG1A 3HOXJ 3P17H 4BTTB 1C1OA 2BQWB 5LH8A 1YIJI 1O57A 5FAHA 4G8XA 2J9NA 3A8DA 1DGWY 4ETSA 2FRHA 2IGKA 1YQAA 1O2VA 4L5JA 2WC2A 2NNNA 4IRHA 3BJOA 4DYRA 1TNKA 1RESA 4JX6A 1D4PB 4A5NA 1IQJA 2F9OA 2D1VA 4D0PA 2W3IA 4NHJA 2THFB 1WHUA 4Q7XA 5HODA 1GI6A 1NT1A 3IKVA 5B5EC 3A7YA 2FQ3A 1WBGB 3E0JB 1UHSA 2VKHA 5TJXA 2BD4A 2YUSA 2WY8Q 2DDAA 4UEHH 4UVAA 4Y8ZA 3NZIA 1C1SA 1YO5C 5IK2D 2EFPA 3SU2A 2Z3EA 4GUXA 3PMHB 2OC8A 4O6JA 3MTYA 4L18B 2PGQB 4XN3A 3BTHE 5FFZA 1FOWA 1MNDA 1HLVA 1G3TA 4A92A 3ZMZA 1AE5A 4NIWA 1VGCC 1SC7A 3F0CA 5IY5H 2W6JD 1KTSB 3CC4I 5EF6A 3VB4A 4JYVH 4X2WA 3VYRB 3GY6A 4F91B 4XRNA 2VU8E 3ZZ5A 2ELHA 2UXNA 3DQVC 2OUMA 4XSXF 4YXWD 3SO3A 4F55A 1FNIA 2I6SA 1V2QT 1TFXA 5EDNA 3H9JA 4E7ZA 1W13U 5J47A 1RR7A 3Q77A 5LHGA 2BE5F 3V3MA 1GBBA 1VQ4I 4PDKA 4BAYA 2H94A 1YLFA 2VASA 2HNHA 1ZPBA 5DSFA 1BZXE 2VIVA 5DP9A 1GJAB 5F04A 4CDGA 3GCHB 2W6ID 2H1LA 1DFPA 3FOAA 1SC8U 2QZ8A 1V6DA 1LJ9A 4ZZDA 3FXMA 4ABAA 1ETXA 3S1QJ 2JIZD 4Q5SF 2I10A 4A3CJ 3GUDA 2TDXA 4M9FA 5HIZA 1OCPA 3E6PH 4P9FA 5J8CA 4ON0A 4RT1A 3V8KA 1R36A 2MA3A 5F6MA 3MQ0A 2LF7A 1W7XH 1P9QC 4DNCA 3GTJJ 1IO2A 3E5UA 1LE8B 1ZYRF 3LQQA 5E20A 1BIAA 3T26A 3SGAE 5DCFA 1ESBA 1WJDA 2EA3A 1FWZA 4GAWA 2H6MA 1IC8A 1GI8B 3V7RA 3GS9A 3JRBA 3PV2A 4II2A 5ABWA 2GV7A 5A2QK 2L7MP 3Q3KA 1WDIA 5C4XJ 4NUBA 1P2OA 2JUCA 4U7BA 1O33A 3LOXA 4CHAB 5DTDA 5JYIA 1TWGJ 2GV6A 1G3BA 1QURH 1EX3A 4HGCA 1FAXA 4LZ1H 4HI3A 2IA2A 4YELA 1K2I1 4DT7B 3R6SA 2GD4B 1UVUH 1OWJA 3AAVA 1H9GA 1PUFA 4M9SA 1C2LA 1DWEH 3F68H 3SNCA 1SGFA 4ZYGA 4G6DA 4XBCA 1F0TA 3FM5A 3Q00A 2R7VA 3TJUA 3H9GA 4HNUA 1PPFE 2LNCA 2A32A 1W36C 2GGVB 4OAZA 2A7CA 1OPCA 5L2ZH 3PLPA 1C1TA 3U8OH 5B1BH 4IHVA 3BY6A 5DUIA 3WHBA 3WODF 1OCTC 2Q6GA 3C18A 1UK4A 3N97A 1TWHJ 3SUDA 4HV5A 3T27A 1QCPA 2QM3A 3E5XA 3DKXA 1U3EM 4FVDA 1AWCA 1BC7C 2MYSA 1S72I 2MFZA 3OYKA 3ZZ9A 4X1RU 3DHKH 2BX3A 3LSJA 1HAXB 2C4FH 1BI1A 2J38A 4HG6A 1P2IA 5IYCJ 5ICEA 1YPMH 4FU9A 1DUEA 2HRVA 1Z8RA 2A2XH 1KDQB 1TAWA 1O3NA 2UZKA 2WPJS 1N8OB 2F4IA 2ZGHA 1A2CH 4GYGA 4B4CA 1H9HE 5EG4A 4Y8XA 3P5JA 4I7YH 2GZWA 3SGBE 1MZDA 5LEJA 2A1DB 2HGCA 2TGPZ 4IMZA 4E06H 3SFIA 5M5YJ 4QIWN 4CBNA 1E3PA 1Y1WJ 1Z1DA 4JK6A 3H09A 4FE7A 1K22H 3WGGA 3STIA 5E3NA 5HMAA 1TQIA 1HKTA 1CHOG 4GHQA 2YX4A 1TGTA 1DPUA 1V3FA 4L9VA 3W6JB 1O2GH 5GAHJ 2HZDA 1FTZA 2LRDA 1WAYB 4BDZA 2ID6A 1GMDF 3A0BC 1O0DH 4OIOF 4AM3A 1JE8A 1Z8IB 3V4GA 1LPGB 2RVCA 2HDCA 3H5NA 1E1RD 2VH0A 2ZQ2A 5HNFA 1IDZA 1FPCH 3VDXA 3BF6H 3I53A 2FDAA 1RRKA 3RDZA 1G3WA 2OQUA 3A86A 4ZDOA 1O2QA 1MCTA 2ZTXA 2K4JA 3ZOBA 1Y5AT 3UOPA 1F0RA 1O34A 3F8BA 2E1MB 1DSTA 1YLCA 3Q3SA 5C2ZA 2SGDE 3Q5FA 4OU0A 4G9YA 3CCSI 3MZYA 3F6OA 4CR5A 3LGIA 2V3HH 3TO9A 3RMNH 4XFQA 1O2SA 2ZCWA 4ISIH 1BTHH 1AUJA 1JUMA 1ZHPA 3LDXH 3W6VA 1O3TA 3FAOA 3H92A 1ODDA 1OYQA 4TV7A 2VBWA 1MKWK 1BBRK 3OOPA 1V5FA 4AVZA 1MBQA 4KN7X 1GXQA 4THNH 1J9CH 4KMFA 3D5RC 3OEED 1MBEA 3OYDA 2BD5A 1DWBH 5J1UA 3A7WA 1ORKA 2K9LA 2GZ7A 2DT6A 1U0JA 2FWWA 1OXGA 5HDNA 3K1MA 3CESA 4R1HA 5TJJA 2GMTB 1SMYF 4C2MJ 3MO6A 2R5ZB 1YWUA 3OX7U 4ISNA 1CA0C 4FTHA 5J3LA 4B2AA 3JSOA 4M6VA 5HLHA 2HPMA 3CC2I 3M5MA 2GAUA 2MD5A 2B5TB 2FOAA 3MNCA 4TWYA 2AIQA 2JK3A 5K5RA 2H8WA 4C30A 5C1YA 4OS6A 1Y8TA 3T25A 4NCYA 4EJOA 2H8RA 2Y48A 4O5VA 2PP6A 1EUFA 4NA7A 2DMQA 1YFHA 1BL0A 3DU6A 2ZA5A 2QXJA 1ZHFA 1E35B 2BEOA 1OCZH 2HKXA 1U78A 2G9WA 5C4JJ 3BIVH 1HW2A 5JB9S 2PJRA 1LQDB 2IEKA 1GMHF 2X6XA 1D3YA 1NG6A 1PQAA 3M9AA 2XASA 1XUIA 1N75A 1A35A 3CC7I 1GT0C 4MHGA 3QQAA 4BEHB 4BY1J 2ZXHA 4H6TA 1ETVA 4NIYA 5H6QA 1FV9A 1H9TA 4UB6C 2WINI 1RC9A 3MI4A 1X4PA 4CCKA 3ZIAD 2J4IA 1F4KA 1AB9C 1O3RA 1GG6C 2FESH 5FX6A 4NQWA 3T29A 5EW1H 1IG7A 2JT1A 2XB0X 4JBAA 3DTKA 3VB6A 4TPYA 1P6RA 3RMMH 8KME2 2EFQA 2GDEH 3G1OA 2FJ1A 1HCRA 5J8FA 2CS3A 5K7RA 3CMMA 1WJAA 2WY7Q 2ZJQF 3MU5A 5FROA 3BTCA 4IHWA 3U1DA 2K40A 1BRCE 2XC4A 1PJRA 4Y6DA 4I6ZA 4J1YA 4ESTE 1EAUA 2D2WA 3EA9A 2XBVA 1NBMD 3H3UA 4CRGA 4IHXA 4MFEA 2WBMA 2KIMA 1GBFA 1F0UA 1MBFA 1D8KA 2CV3A 4E05H 1QB6A 3LA3A 3AK5A 1HW5A 1ELDE 4HX4A 3KQDA 1MW7A 1GJ5H 2DYSH 2ANMH 1PUEE 1TQ7B 1QBNA 2EH3A 1Z8JB 4KELA 2HZTA 3Q3YA 2IGOA 1HBTH 3SDBA 4DGWB 3F8MA 5AIQA 1SFOJ 5E2PA 5BS6A 1ZARA 3SEQA 3RXBA 3A89A 5JVTA 2VWMA 4AFSA 1EZUC 4E6KG 4IC5A 5BPDA 5F0FA 2ZWLH 2H5DA 3GY5A 4IHYA 2IRFG 1IV8A 1SVOA 2DA7A 3TITA 2J94A 3WTTC 1NK2P 2ODPA 5EGOA 3OS2A 3ECOA 3DTIA 1QA0A 5JLXA 1EZQA 2R7ZJ 3U2RA 2XRCA 5EW2H 5HDKA 4YT6H 3QZRA 1RS0A 3OYCA 2FYRA 5JI6A 1KLIH 3U98H 4WWYA 2FEZA 2JH0D 3E0NB 2VKVA 3K65B 3QZQA 3OV8A 1YYY1 3PYHA 4B09A 1C5UA 1Y6IA 2QVOA 1O30A 2P4WA 4O3MA 3FP6E 3S7KB 3BCBA 5CPRB 2GDDA 3SI4H 1IGNA 3P6ZB 2GX4A 5EJLA 2HPQH 3A82A 2EQRA 2JN6A 4PSWA 1YPEH 4ZXXH 2DMNA 3TLOA 1GI0A 1HIAB 4A2UA 1Z3YA 4KISA 1NROH 2M8EA 5CQGA 4AIHA 1UMAH 2PFEA 3RPQA 4MTEA 2MW8A 3HK6B 5GTHC 4XRMA 1DX5M 4I8KA 3ML6A 1P2QA 1J14A 1GJ6A 4CZZA 5M3FJ 1D5VA 2WV0A 1NFYA 1J2XA 2G51A 4UXNA 4BY7J 2XSJC 4AORA 3H3ZA 1LHCH 1HKQA 3VFEA 1WCMJ 1U5TB 1K21H 3HRTA 2Q6FA 1BITA 4ABHA 1QJ7B 1QTFA 2QQBA 1A5HA 3I5UA 2AO9A 2VB6A 2QQ9A 1N25A 1BW6A 4FXGH 4AYVB 1C1MA 2ZO4A 3MYWA 3SV7A 3GMEA 3H3VK 2FOCA 4AIJA 4DZJA 2BZTA 2UUYA 1C1NA 5EJCA 1C5OH 2FX6A 3GBGA 4PJ0C 4C2TA 2JSCA 1O38A 2J98A 5KCMA 1YPHC 1IN8A 2HQNA 3RLWH 4I98B 1CGJE 4INLA 2KDZA 3TIUA 1GJ9B 1H89C 2QGRA 2Y7ZA 4JMYA 1RNLA 3OS0A 1ABJH 3LIWA 1HGTH 2QSFX 2RKHA 2CW7A 3BPXA 5LHIA 2DA5A 3DFJA 1SVPA 3GCNA 1BHXF 1S3JA 1O3GA 4X6PA 2IP2A 3MU0A 3RJPA 1TZLA 2YX7A 1MTVA 2I6QA 4Q4ZF 1ONVA 2LELA 3JRAA 3MH7A 3M8FA 3GICB 4LIVA 4XICA 1TL8A 3HKIB 4ASHA 1Y0NA 4YG2F 4AG1A 1SQAA 3M5LA 1SGCA 3SU5A 1W0UA 2K0QA 2Q1JA 3OSFA 2BMGB 1S6FA 1Z71A 1KY9A 1AKHB 1IN5A 3M35A 1Y3WA 1R5ID 1QJ6B 1WI3A 1DVAH 4FUHA 2A0QB 4NWLA 4XLEA 2VI6A 1Y3UA 4RKOB 2KL4A 1AGJA 4TPIZ 1C2IA 5EOKA 3LMMA 2ETHA 5T1VA 3DSGA 5FPYA 3FIWA 1HJAC 2ZCHP 1S0RA 3URDA 2V1XA 3HPTB 1XUHA 3QWLA 4A1XA 1AHDP 1SG8B 3ONQA 1RPWA 3FF5A 2V79A 2ZB9A 5J4SA 3BQYA 1HW1A 2H09A 3D0SA 1FY1A 4AB8A 4EM0B 5FL7D 3UTUH 1EB1H 1SGTA 3K2ZA 1DLKB 4BQQA 3I59B 1L4ZA 2BW3B 5FBEA 2CO5A 1C4V2 4YEJA 1TGSZ 4BJ5C 2V3OH 1P7JA 2PSYA 5DP3A 1LVYA 3J80K 1NBME 2ZHEH 2W84A 3ELAH 3P8OA 5IOYA 3KP6A 3F2GA 1WV7H 2AH4X 3LFKA 1XMKA 1HLTH 2M2EA 4ENKA 3TGIE 2Z9LA 1RTFB 1NHAA 1GHZA 4O03A 3QPTA 4HLXA 1DLEA 1HAGE 4XM3A 2ID3A 2ZIQH 2WB1N 3RXJA 2ZU3A 3H0DA 1HFDA 1D3PB 3MH4A 2CG4A 3ZQGA 3RXDA 1EOLA 1YW9A 2MH9A 2CH0A 3MEXA 5JBAS 2VQHA 4PJNA 5FB2A 5F64A 1GGDB 3IHUA 1F7ZA 2IOTA 4NIVA 4F52A 3DP7A 5KGOA 4IGDA 3JTGA 2VVUA 1A0HB 3PV4A 1O7FA 6CHAC 5CLSA 3TK5A 2K9QA 1ELCA 4ABIA 5G4BA 1LHGH 4F4OC 4CCNA 3KHVA 2RGVA 5LPRA 3IV5A 1TGCA 4RGSA 4BAMB 4X2YA 4CH8B 4KITB 1OX1A 1G9IE 2CK3D 2M30A 4Y3OA 3KX2A 3WW7A 4P00A 4CXFA 2L01A 3A7VA 3OY9A 4JX4A 3DBHB 4RAFA 2IS1A 2FS9A 3S15J 1G3DA 3ATWA 4DOQA 2P3FH 3GYHX 4HZFA 4AC9A 3RC4A 3S69A 3BPVA 2K3PA 1R1VA 1AZZA 2M2AA 2FMYA 2EEKA 3E1SA 1XPXA 2HLDD 4UFDH 4BQAA 1NRQH 3A7ZA 4KTUA 2L7KA 1T8LA 3RXVA 1BT7A 3S3OA 1ELTA 2YU9J 1Y39A 4XR6A 2A31A 5CDFE 1WJBA 4QSHA 3U9GA 3PTBA 3GO5A 2CQQA 1NU7B 3VWBA 2QENA 3I9V2 1MTSA 2L74A 4MGRA 3R60A 1A5IA 3VODA 1L1NA 4INKA 1IHSH 2ZNZA 1YC0A 1ZMNA 3M7TA 2A5AA 2G4UA 1QRZA 3Q3XA 1YGCH 1JKPC 1GDTA 3P95A 2X85A 3N7EA 4IBLH 3LNQA 4WH8A 2QF4A 1UCYH 1FP1D 3BJ6A 3LWFA 1C1UH 2ZDAH 1UTNA 4PFPA 2IS4A 4WMFA 2AERH 4C9YA 3OYGA 3ESTA 2V35A 1Z91A 4WY3A 2QKMB 1QNTA 1POGA 2R7FA 3CUQC 4NIXA 4ZUHA 4D1QA 2CGAA 5DJ7A 3D62A 2LP6A 3V42A 2E7XA 4HV6A 3LC3A 1O2YA 5FD5A 1DM4B 1C5LH 1GBLA 1EPTA 2FD5A 3JRIA 3JCUC 1LHFH 3Q9SA 1X4OA 1FDPA 3RZOJ 4CCLA 2BZAA 1ANDA 3WTYC 2BXUH 4ZZLA 2A7JA 3GTQJ 2KISA 3SJIA 2DPDA 2F5EA 1DE7H 2OBPA 4J01A 2Z3CA 2YMSC 4GXOA 3D65E 1CBWB 2GT7A 4ISLA 2MABA 5EXLA 3MNSA 2OP9A 3F3XA 2NOGA 3NXPA 5FPSA 1GDUA 1OJLA 2MH2A 4XOPA 2NU3E 2Z99A 1QZEA 1TQPA 7ESTE 4A3IJ 2DK8A 2H1UA 3RXGA 3OSYA 3VB3A 4GGGA 4BBRJ 3GOVB 4EM1A 1QJ1B 3PO1B 1X3UA 2ZJRF 3CDHA 2VJ5A 1C1VH 1F2SE 2IAIA 1O2PA 3L2QA 1AVWA 1L2EA 2SGEE 4LGWA 1LO6A 2FA5A 1Z77A 2V0BA 2P3TB 2BDIA 4BBSJ 2Q2EB 4E7LA 2L7FP 1K1OA 2HGTH 5C44J 2IGMA 5DP6A 1FOKA 1WU1A 3MD2A 2VWOA 4FX0A 4I31A 2Y69H 3G1LA 4I2OA 5J4VA 2XVCA 3RTRA 1Z6TA 1AUTC 1XVMA 4LITA 4HOBA 3HYIA 4DG4A 2ESTE 4OIRF 3F6UH 4NZLA 4HNTA 1V2OT 2PEXA 1K4TA 1N1LA 2DPUA 4X8TH 3RI4A 2ZCKP 1TOCB 4EJUA 4HYEA 5GCHG 3BOQA 4F48B 1HC8A 4DJAA 5F8XA 3SU3A 2R0LA 3RKWA 3AW1A 4X8VH 3G6EI 1FIWA 3L9FA 1GV2A 2F5VA 1LDJA 1RTLA 3A02A 1WQVH 5JFRA 3MH5A 2FP7B 4ITVA 3TJNA 1YF4A 4D5FA 3TGNA 4Z1MD 3I77A 4YT7H 1H9IE 2A4QA 5IT3A 4A69C 4A12A 4YOIA 4B1TA 3QX5H 2P6TA 2XAHA 4Y0ZE 5LHHA 1EAXA 1V2UT 2HEOA 3ZXSA 4BANB 3PL8A 3MFJA 3NK8A 3FHNA 1AFEH 2F6CA 1IUYA 2E19A 3K6ZA 3RXIA 2QBYB 2BXYA 3GTPJ 3HOZJ 3FBIB 4I32A 2SNWA 5E17F 5J1RA 3RXKA 1BJZA 1SBWA 3BG8A 4CYCB 5A0AE 3E3VA 4XLFA 4CCMA 2SGFE 3STJA 3WG9A 2J95A 2DA6A 1V2PT 3L7WA 4UVCA 4UDWH 3K10A 1K83J 5E79C 2V4JC 2PJRB 2A68F 3S1RJ 3DA9B 2VUMJ 4IL6C 4ENJA 5DGJA 5BPEA 2ZPSA 4WXIA 4JYUH 1YKTA 1MBGA 4B6EA 1QY6A 2IS2A 2LD5A 4RAZA 3BJAA 5E1XA 1G3SA 5H2FC 1Z21A 3W2WA 3DTEA 4OAYA 5A2MH 5E8EH 2QF5A 2VPLA 1F92A 2EPFA 1PPGE 2OQGA 1JWTA 2AQFA 1VQ7I 3DKWA 3PIOF 1GBMA 3QPSA 1ETQA 1UELB 1O7LA 4ISHH 2M8GX 2BYVE 4NQWB 2HXIA 5L3FA 3GTKJ 3RLYH 4XL9A 2P81A 3QUMP 2NXNB 1VQKI 1KXEA 1IAWA 3U9AH 2OTLI 1GI1A 1T8IA 1QB9A 3Q0WA 5F8TA 5FPTA 4QT8C 4Y76A 4BXFA 3H35A 3SNDA 4CZCA 2DOEA 2FEQH 5IOZA 2ZCLP 2K7LA 3FM3A 2KDOA 4HBLA 1TQMA 3ABMH 1SVMA 4MPWA 2FF4A 2IS6A 1YBWA 1ZLRA 2EJRA 1AHTH 4AD9A 3ZPLA 1GWAA 5CHAB 5F03A 3NQOA 2PKSB 5AFYH 3QGJA 2HVYB 4ZMAH 2W85A 4V2FA 2WV4A 3SXYA 1GBCA 2YS9A 4IN1A 4KJZA 3LSIA 3I71A 5CYVA 4D7NA 3UY9A 5BPIA 2R7UA 2DUCA 1O3BA 1E0FD 3HL2A 1E17A 1SKYE 1EKEA 1YPKH 2R5YA 4ENMA 3DCFA 1OYYA 3K4KA 1HUTH 1KXAA 5B6OA 1YTYA 2BYAX 1TTYA 2D26C 1D1CA 5FCRA 5DN6D 3B23B 1W2KH 2LVSA 4RAYA 1FIZA 3RKQA 4S0HB 3N4MA 2HFHA 1O2XA 1MCVA 2NVXJ 2VINA 4E7SA 2Z7FE 1W36D 2LY2A 3GTOJ 2JA2A 3W94A 1HAOH 3PMAB 3WTZA 1DY8A 4RS8A 3ZRGA 2BD2A 2QA4I 2ZFTA 6LPRA 4X0GA 5D6FA 4OS4A 3F8NA 3PUFA 3OMYA 2OJED 1QFKH 5GAEJ 1ZHRA 4WMDA 2OD5A 3J81Z 2QAAA 4J00A 2BVRH 1WH5A 1JTYA 5IDKA 1RKWA 4YO9A 1ZTJA 4Q80A 2QE7D 2CJJA 1OKXA 3TMOA 3TNSA 2WUBA 2DU9A 1FNNA 2R4GA 2NVQJ 4M71A 3RKYA 1K7AA 3CLOA 4Q2KA 5IT9Z 2R7TA 1SQOA 3HOTA 1L1JA 1E34B 3RXPA 1MJBA 2F3CE 1INCA 1UW7A 1V2RT 2Z94A 3REOA 3ZQ7A 2FOEA 1H4WA 3EUAA 2CUFA 2QYIA 3PO3J 4B71A 2TPIZ 3Q76A 1RRJA 3H7OA 5FKNA 4BS9A 1Y5BT 3SJ9A 5HGGA 3JZ2B 2F9UA 2QN5T 2W7SA 3ZQCA 3MAJA 2M0MA 1OCOH 4JOMA 3UAIC 1MTNB 1YJNI 2Y30A 4D7GA 1ZGAA 1W10U 2O8WA 5ED4A 2F5DA 4YLQH 4MPXA 2WV5A 1P9SA 1UTQA 1O3KA 4G7HF 4RB3C 3UREA 5J6XA 1EXFA 5E18F 1H1BA 3PV5A 3WTSC 2W25A 2J2UA 4HPQA 1ENHA 2E36A 4ZH8A 2X6OA 2J98B 4LB6B 4CCOA 1R4NB 1T2KA 4AC0A 1P57B 1FSHA 1ULYA 3OIPA 1W7PD 3M7GA 2K9NA 6ESTA 4I76A 1H88C 1TNHA 3BEFB 2Z16A 2LOOA 1HA8A 1V5GA 1O3FA 1DPRA 3QWCH 2B7DH 2NOJB 2FTMA 2OCVB 4JK1X 5JR3A 3W1EA 4ESBA 2STTA 3HKJB 2R7QA 1VQPI 3S1MJ 1KSNA 3DEWA 1BJAA 2B63J 4N9HA 4Z6AH 2LY9A 1PPHE 4BQNA 1FUJA 2RNGA 2ZGBH 1FIAA 2JZYA 2Y5HA 3M5NA 3CO6C 4B8XA 2CF8H 3EYIA 3ZZ8A 1RIWC 2UUFB 1ABIH 4M3GA 4B6FA 4ZKNU 1MH4A 3ELKA 4YIRX 3DWLE 2BHGA 1WZ2A 2VXZA 3JAMZ 4A93J 3I4MJ 2V6EA 3I54A 1JKQC 1LE8A 3MKLA 3KP7A 2TGAA 4KDPA 1HF0A 3K4CA 1A6IA 3F0PA 3WHCA 1XMAA 1M1EB 2P0WA 3UPEA 2E1OA 3L00A 3RQIA 4MEYF 5JBBS 2EFNA 3HRUA 1HPGA 3V12A 1LDDA 1C5PA 5D5WB 1GVJA 3WTWC 1YLNA 3M36A 5EZGA 1XTAA 3UKGA 5DDGA 3RKXA 2L7ZA 2ECCA 4XD7D 1HDPA 3FBNB 2CUZA 2CSOA 3QO6A 4NDLA 2PQ8A 3GFIA 3BTKE 3KZIC 2VGCC 4UV9A 2BQ6B 2W48A 3GY3A 2CFOA 4YIIA 1XGOA 1CU1A 1EAIA 1F9NA 2CHAC 1ELBA 4E7NA 1HAZB 5FBIA 3A88A 3OR1C 2V1DA 1GVKB 1OP0A 1ZGVA 3U1JB 3OL4A 1VQ6I 4NA8A 2LH9A 3FN8A 3M1CA 1QHRB 3SV8A 1XS9A 3RSNA 4IF4A 4MQ9F 3PMBB 1FY8E 2Z33A 3CZ6A 3G71I 1KXBA 2L2OA 4RAGA 3KCCA 1CQQA 1G2MA 2ISYA 2P93A 1SVLA 3BP8A 4Y7BA 3TJVA 2XTTB 3CD6I 1QBJA 5L3GA 1IV6A 2B7EA 3KYGA 3OE7D 2G7HA 2I8DA 3BTEE 5IYTA 1VGCB 3MFKA 2GZ9A 1P2KA 1QL7A 1YY3A 2PFBA 1LHEH 8LPRA 4LIUA 5I46H 8ESTE 1H8HD 3IH4A 3GX4X 1GVDA 5C5NA 3RXLA 1O31A 1BI0A 1O3MA 1GLNA 3K6GA 5E3OA 1O2JA 2ZZUH 2P7VB 3H5AA 1VQ9I 2FXRA 1J09A 4OINF 3KYCB 4JYKA 1CGPA 1WI9A 4M73A 3AAUA 3FXKA 1UHWA 1EASA 1KDQA 3EA7A 2EB7A 1E36B 2Y80A 4XBDA 3CDIA 1HXEH 3EGKH 2GCHG 1S85A 4HG2A 1GHXH 1HAYB 3HBLA 2P7CB 4KT6A 8GCHG 3GFLA 3N99A 1ARCA 3BTIA 1EOJA 5F1JA 3GZ6A 2FI5E 3M61U 1QQIA 3OOUA 4AYBN 1L0ZA 1LMWB 2ZEBA 2AIPA 1FLEE 3QLPH 1GI3A 2OZUA 4NSYA 5DV5A 3RYPA 1NESE 3RMOH 3K4MA 1QRXA 2VIWA 2ULLA 3UR3C 1ZG5A 2KLOA 4MQAA 4ESFA 2Y5FA 1QQ4A 4ISOA 3DBRB 5FLVA 4X2XA 1ZZZA 1MMDA 3KLOA 3ITIA 1T6SA 1T98A 3BG4C 4D5CA 1C5TA 1TB6H 5J1YA 4A7IB 1C2JA 3K7AJ 2P3UB 4XBBA 3PJRA 2D45A 1GPZA 1TLDA 4INHA 2VWNA 1EB2A 1E37B 4VGCC 1OR7C 1M9UA 2ELKA 1ELGA 2GXBA 4RN6A 4V19K 2R0KA 5ETXA 2V9VA 5HLGA 5DK1A 4XKVA 2IA0A 1GCTC 3ZZ7A 2BY7X 5DP8A 2AHME 2OC6A 2A5YB 1KXDA 1A3EH 1KQ9A 1VITF 3P9KA 5LGNA 2QIQA 2QA9E 3V7CA 5E3LA 1AA7A 3CCUI 3DLAA 2PJPA 1ZTLA 2FX4A 1KYNA 1T7CA 2VBZA 2PSXA 1AE8H 2DW4A 2ECBA 1K9OE 5H20A 1NRSH 1F5RA 3NPSA 1VQOI 3ABTA 3E7LA 3DLLF 1G32B 5C20A 2GZ8A 4K2EA 2O8MA 2PMZN 3HK3B 1P03A 4WJG2 4H4KC 2OCEA 4WXHA 2IJD1 6PAXA 4ESJA 2QY0B 4ZYHA 4Z0KA 1XGNA 4XSKU 4ABBA 2R5ZA 1T39A 1LVKA 1A5JA 1PYTD 2AFQB 2EI6A 3KPHA 3UB0A 1JUSA 2PGBB 1LPQA 1QHHD 2KPMA 2KIQA 1YPLH 2UV1A 3WE2A 3KETA 1F43A 4JZ1A 3ZQFA 2QWWA 5D5VB 1DGRM 2ALVA 2DYRH 1NN6A 2CUEA 1V2JT 1C5ZB 2OV7A 3ZP5A 3I55I 3ATKA 1V55H 1EP6A 4PFOA 2STWA 4ZKSU 4XRSA 1ZPZA 4FUEA 5CMXH 4BNRA 3A87A 2GA1A 3V8JA 3K1NA 2M1BA 1O5EH 4JX5A 3RU4T 1C4U2 1WUNH 1VJAU 2TGTA 4ASUD 3MQKC 3E5QA 4IXAA 1IN4A 2WB1A 3EETA 4BEHA 2LSOA 1T08B 1VI0A 3TOAA 2CN0H 4UFGH 1Z05A 3AL0C 3T62A 1X58A 5ESBA 4RA2A 2WPDD 2Y81A 1J16A 4EATA 3RQ4A 3PFIA 2P5KA 2AGEX 1OQYA 3IG6B 2UWMA 3L3TA 5E2OA 1F5LA 5T3HA 4G6TB 2BY5X 2H6CA 2E60A 1ETWA 3F72A 4CH7A 1GVZA 1ZRCA 2HPIA 3FP8E 1QA6A 2VQLA 2CV1A 1FX7A 1MU6B 4AG2A 4BOHA 1OWDA 1YP9A 1U2WA 3I4NJ 3PQKA 2JTVA 3KLNA 1R4MB 1P11E 2ZMEC 1K6OA 1BRUP 2A6HF 3A8AA 4UE7H 2W7NA 3TK6A 3NRLA 4HQEA 2Z3YA 1MSEC 4HLYA 1O3SA 1GUUA 4A3LJ 1IXCA 5KNLA 4D9QA 1KLTA 3ZVEA 5F08A 1MH3A 5IP6A 3OYEA 4A3FJ 2JPBA 4M3DA 2A69F 2H9TH 1YX5A 4RM2A 1W7PB 2ZHFH 3HOYJ 3S9BA 3S1NJ 1HJ8A 1WFXA 4FISA 4BACA 4P9UA 3EE0B 4U01A 3BDDA 3B73A 2C6YA 1TNLA 2Z6BD 2DJIA 2PUXB 1BBYA 2FBIA 1AN1E 1S6LA 2GWRA 1HB0B 5T6DA 2BDGA 4UUSB 2K9MA 2MGQA 2A4GA 2TGDA 2Z5UA 3HSFA 4DW6A 4HA8A 1MMNA 1FI8A 1MBKA 3M8EA 5KECA 2LMDA 1STZA 3NUMA 2HI3A 4JZFH 2ZGXH 1G3EA 2P8OC 1VTNC 2QF7A 2F5CA 4MG3A 3RU4D 1S7EA 1VR1H 3Q0VA 2OPTA 1JKRC 2LFBA 4RM3A 2BLQA 3NAUA 4UB8C 1CA0B 1GHCA 3PNTA 2XBYA 3D1NI 3IAS2 1TOMH 3AFHA 4Y11E 2VJJA 2MSYA 4WXDA 4R8HA 1NS3A 2CF9H 2WWYA 1NO9H 3GFMA 1R6RA 4AVPA 1YPGH 1C2MA 5LGUA 4L9JA 3R0JA 2NWNA 2NU0E 2F9NA 2ZFQH 2QLZA 3OYBA 2COMA 1ETKA 1EZSC 3K0LA 2P6SA 3QP6A 4Y0YE 1OMIA 4LLNA 2R7DA 4E70A 1LPKB 4FUCA 4M74A 1YCPH 4ZKRU 2AXLA 2C8YB 2CJIA 4I02A 3OYIA 4X1SU 1DDNA 1WJCA 1P05A 5B1AH 4AWXB 1O3CA 4K1EA 1FQ3A 3J7ZI 2VOOA 1HSJA 3V8LA 2Z2SB 1D1AA 1HIAA 1XXDA 1UTPA 3M3TA 2HNTC 1UHBB 2HS5A 2FI3E 2DA4A 2QKLB 1BOBA 3ULQB 1USTA 3M3VA 3DBLB 1DU6A 1JIRA 5TGTA 3AG2H 1GG6B 5D8KB 4KUMA 3GXOA 5JLWA 2F43B 1DSUA 2CUJA 2FX0A 2KIUA 3ZQQA 3RXCA 4F92B 3QP5A 4UVBA 3C1KA 2R5YB 2KR7A 3T5FH 3S7HB 1G6NA 4M3EA 2OQRA 1O2NA 1K4SA 1U5TA 4Q7ZA 1COWD 2O61A 2ZU1A 3CMYA 4KYWA 3HEFA 1O2MA 2ZFFH 5D5XB 3SZPA 2W24A 3OY5U 2J92A 4B2CA 2IPQX 3SJOA 1YG2A 3ZZBA 3GCTF 4L5EA 1E1QD 4BXWA 3RXFA 1P3EA 4CRDA 5E0GA 2ZPQA 1G8XA 1Y3XA 2OC1A 1P92A 1S5LC 5HIYA 1R49A 2XYAA 2M5WA 4FASD 5E1ZB 1VQ8I 3BEIB 3R0FA 1SGPE 1XCBA 1TNGA 5EJ1A 1YPJH 4OS7A 2SGPE 3A03A 4C3HJ 4IQJA 4GYIA 2X1DA 3VPRA 2Y5GA 1MD0A 2UUKB 1JUPA 5C0UA 2UWOA 4AGJA 1MU8B 1ON2A 2RAEA 7LPRA 1YPHE 1HJ9A 4BTIB 4GCVA 4BYYA 3M07A 2ANYA 5K5QA 3L2VA 6GCHF 3S9AA 2ZC9H 4IS5A 3AG3H 3SU1A 3ZVGA 5EEHA 2C93B 1BJUA 3L33A 2DE8A 2WUCA 3V13A 1FPHH 3IWFA 3ZQIA 1IF1A 1V2VT 2VH6A 3A7TA 3CS7A 1OYIA 3GW2A 1TONA 1BTZA 2YMSD 1U9NA 1GHAG 3BZCA 4CREA 1DWDH 4P1WA 1AKHA 4P02A 1SLVB 1KMHB 3H1CA 3BCAA 1F5TA 1ZK8A 2JH5D 1O2IA 2BV6A 1FEXA 2XRNA 4GLYA 2GXAA 4DZPA 4UY8I 2SNVA 1K78B 3W2AA 4CRFA 4WCGA 2M0CA 1Q2WA 2FMJA 3FXOA 5C67A 3VGCC 1VQ5I 1VCPA 1QZZA 2XHKA 3LSRA 1MBJA 1FSEA 1APLC 3C1DA 5ILVA 1CE5A 1W0YH 2VIOA 3TW7A 4X1EA 2ZFRH 5F0CA 3J7YJ 1SD4A 2C8XB 4YOJA 3ZYDA 3CCLI 4OMZA 2MBFA 3ZR8X 3I59A 1TQ0B 2BW3A 1O2HA 3S16J 3OIOA 3SU0A 2V1NA 2PWXA 3TNTA 1IUFA 3SBKA 2PV9B 2O7OA 1RETA 7KMEH 4MTDA 2XC7A 3P70B 4XLHA 2W7UA 3R61A 3ODFA 2XSDC 1B0FA 5EPNA 5GXPA 2NU4E 3F8FA 3E6DA 4A3DJ 1YI2I 1LPZB 4A3EJ 5H6RA 4HFPB 5AVDA 4RT0A 3SQHE 3HPHA 5J40A 1BQYA 4Y52J 5EPYA 2GT8A 3SYJA 1BM9A 1N6XA 3A0HC 1K1JA 3VB2A 4NGAH 2FOFA 1O3LA 1ETTH 2XPWA 5T6FA 4ZDPA 1XG1A 3FZDA 4CGZA 1XSXA 1UCYE 1S8NA 3O8RA 1BDAA 4KP0A 3RU4E 3GLLA 3RXAA 3LH1A 4S04A 2BY0A 3DPLC 3IL2A 3KEOA 4U30A 1PQ8A 3P8NA 1CGIE 1LKXA 5F0HA 1NTPA 4GCHG 1LVAA 3MO9A 1GMCG 2C8WB 5M3MJ 1FIPA 2GIZA 1P09A 4E7RG 1T4UH 5F27A 5JVGF 3PB1E 1TGNA 5BMZA 1W1WE 3N05A 1ZMJA 4HTCH 4I7HA 3HGPA 3UQVA 1Y0UA 4MNXA 1J59A 5FGMA 3A81A 4K8BA 1MMJN 1B4AA 3DPTA 1ZYOA 3RXSA 3S14J 3MU4A 3LQRA 2WPMS 1C5XB 3VPKA 3F3BA 2C3SA 2UWPA 4LLLA 4BE0A 1VQLI 3HOVJ 5HS7A 4ASNA 3KGPA 1YCPM 2CYYA 1XSVA 4L0ZB 3ABKH 1YLDA 3NRVA 1N77A 1T0FC 2Y82A 3M8JA 1GI4A 4CRCA 5EQSA 1IOEA 1PPZA 3ASOH 4ABZA 2F5FA 3BQZA 2XROA 1JKOC 2CMYA 4HX8A 1Y59T 1V2NT 1BMFD 3D5LA 3U69H 2O03A 5E8GA 2F4MB 3CCQI 2DE9A 1LEAA 3G4SI 1VNDA 5D5UB 3QU6A 2QSGX 1O2OA 4NZQA 2ANKH 4P5OA 3L2RA 4I8JA 4UONA 3OTPA 1TBZH 2DFIA 3ZZ3A 2UUJB 2A2QH 1J8AA 5L3DA 1HJAB 3F9EA 2EZLA 4DCDA 1IQKA 4YM9A 4J19A 3E0PB 4MLOA 2ODYB 5KAFC 1GHYH 2E5NA 3KF2A 5LRSA 2VE9A 1L3LA 3TKYA 5GADJ 5IP7J 1CA8B 5FCKA 3CCMI 2JA6J 5L2YH 1GJCB 2P5VA 3K9XB 5DD4A 4IKFA 1NK3P 1MH0A 3L1PA 3SHCH 1QO0D 4AIDA 1T33A 3SQNA 1T95A 1YIOA 3SHFA 1MNMC 1BTXA 3GY2A 1BRAA 1SGYE 1D3QB 2Q8KA 3ZV8A 1WCZA 2QC2A 2WV9A 1WKMA 4CICA 1JRSA 1U6QA 2TIOA 3HG9A 4I8LA 2DI3A 1X2MA 5FX5A 3A80A 1O3OA 1TNSA 5TCAA 5AF9H 2K02A 5L3CA 4AU7A 2L02A 1RUOA 1X1PA 4PJLA 1PPCE 3TO7A 4WVPE 4XONA 3JRCA 2JKHA 1EH6A 1O32A 2HR3A 1IQIA 1P04A 4DIQA 4WWCA 4FU7A 6CHAB 1R00A 3M7QA 1C2HA 3GEZA 4ABDA 3SV9A 1V2TT 3IP4B 1LDKB 2E2HJ 5J4YA 2VB0A 5FJ8J 2A7HA 3SZNA 1HXFH 4BHPA 3COAC 4SGBE 3P92A 1GHBG 2BD9A 2STBE 5FLXZ 3ZZ6A 1MKXK 4Y79A 1NRPH 4XSZF 3PMJA 2VOPA 1TA2A 2CWEA 3ZZDA 4XKBA 1DU0A 2LKXA 4AIKA 2XGDA 2G5VA 3RIRA 2Q2EA 3O3KA 3EA8A 2VBYA 2XCFA 4H0EA 3V0XA 2OINA 2G8TA 1XDUA 1LTOA 1H8ED 2B9SA 3FXUA 1IW7F 3GTGJ 2OAZA 1OWIA 2BOHB 4YRVA 4JP0A 2BVSH 5CE1A 2HVXA 3WU1B 4CA0A 2GCTC 5BRRE 1JHFA 5K5OA 2KZVA 1K6YA 4UFFH 2DAOA 1ZJKA 3BTDE 2VONA 5CHBA 5A0CA 3PFYA 4RI0A 5C17A 2X1CA 2UWLA 1C1RA 1CT2E 2IBDA 4Q7YA 2DXIA 1SQRA 1VITH 2DT5A 2OA4A 3BIUH 3DV8A 3KP5A 3O8GA 3LSKA 1A7SA 1FMWA 1C4Y2 4TWWA 1FYMA 3EYYA 5L3EA 1EFRD 2BLWA 1W5TA 1SGDE 4Y7AA 3FXRA 1QL9A 1AZ8A 4U0VA 3FK7A 3UQOA 2QUFA 4XN0A 1D3DB 4ABJA 3F22A 3BEUA 1F5KU 1ZPCA 2AGIX 3CJTB 3ZN1A 3KEQA 3HPGA 1SMFE 2WAFA 3RDIA 2JJ7A 7GCHG 2W57A 3MN2A 1OP2A 1ARBA 2VQCA 4UNOA 1SEUA 1AO5A 5EEAA 3CUQB 2JJ1D 3MNBA 3ABLH 3A84A 2QBYA 1P06A 3T8RA 3IWMA 1FY4A 1V2ST 4R79A 1HXDA 2QV1A 4CYCA 4K1TA 3U1KA 1QBVH 1QB1A 2Y6TA 4OWRB 2FE3A 3A83A 2EBIA 1GBIA 3NKKA 3ZQLA 3E8LA 4FCYA 4BXXJ 5FRMA 3QAHA 4X1PU 1R7JA 1UJ1A 2DJNA 3I0TA 3SFZA 1JTXA 1ZGIA 1EH7A 3ZCOA 3CP7A 2ZNKH 1MKXH 4J2YB 4N9IA 1HAIH 2YMSB 4N4OB 2HOEA 4A6DA 2H27A 2ZSIB 1YM0A 3JZ1B 2ZDVH 2C8ZB 4FHTA 5HNHA 1HDDC 2PG4A 3JREA 4GDFA 1IXSB 1SFIA 2OCCH 1OKRA 1UO6A 1T56A 2QXHA 2XIGA 3GISB 3LAJA 2OBOA 2Y2ZA 1W14U 2NVYJ 2NYXA 1HNEE 1XSDA 3ZVAA 2N8GA 1C1WH 4KTSA 5KK1A 3HDDA 2V7QD 4O3TA 2DMTA 2E7WA 2HKOA 1IQLA 2FSWA 1FZZA 4GCHF 1A46H 3CNRA 4I99C 2LREA 1C2FA 1ZQ3P 2G00A 3VEPA 3EDPA 1MIJA 2BDBA 1G37A 1IQFA 3BR1A 1DITH 4BGDA 2DO7A 2GOMA 4EJTA 2D1JA 3CTAA 1KYWA 3CLQA 1H8AC 1YX3A 2R3UA 3BR6A 3CS0A 2KQRA 3ENSB 1DS2E 1ZRDA 4AYBA 3E90B 3DCLA 2M4GA 1D9IA 4DURA 3LGUA 4RGRA 1BUIA 4HF0A 1TRNA 1O2WA 3WWFA 2ZKZA 1JJ8C 1XGSA 2FXAA 1FP2A 4YTAA 2ME0A 4CBOA 1PPEE 1S6HA 1GJ4H 1Q1VA 1B8IB 2A5IA 1GI7B 3KQ5A 3IH3A 1TPPA 5HKKD 3OSGA 3VXFH 2VIPA 1NH3A 2F83A 1ZTRA 4ZKOU 4FETA 2PW8H 2IJLA 2MC3A 1TRMA 5EIYA 1FN8A 2VQGA 2RN7A 1AFQC 1A3BH 3EUHC 1THPB 2GVFA 1TMBH 5EJZA 2NVTJ 1E38B 1GL1A 1BJVA 2OC7A 3LGVA 1GJDB 4RLFA 4WF2A 1V2KT 4HNVA 4G12A 3E16B 3GCOA 4XKWA 3A8CA 2RV8A 2UXXA 3E97A 2ZDNA 4L0YB 1IQHA 1GBTA 5ICCA 3I29A 1FBSA 3CF2A 1V2MT 4H4FA 4ZC3A 4FUGA 2BDHA 3OYPA 1OFCX 2VIDA 3SOSA 4D9JA 1XVOA 1P12E 4DBQA 4XLAA 1TX8A 4WXCA 3MMGA 4XQFA 2XDVA 3QU3A 2PMZA 3DXJF 3OL3A 3S2HJ 2RG3A 4IEJA 1E2XA 1BTUA 4X8UH 2LP0A 1XX9A 3PIPF 5SGAE 2OQ5A 1E79D 1ZR0A 3MMYB 4NFFA 2IT0A 2NS0A 2HOSA 3WWBA 1YITI 3FO8D 1ELVA 1G4DA 3G01A 2QXIA 2HQAA 2HPPH 4ZDLA 2XW9A 3TW6A 3IKTA 3JRFA 3PWBA 5I25A 1PYTC 5F6FA 3H5CB 3SUEA 2FU4A 2HYFA 1FLIA 1CHOF 4TT3D 3OYFA 1XDSA 3PROA 2AGGX 1GHBF 5L30H 3CUOA 1LFUP 4AGKA 3PQJA 1PQ5A 3QTVH 1C2KA 1MDMA 3AASA 1XXFA 3LSMA 2MLGA 1QGPA 4B3AA 2OTVA 3ESWB 1W11U 4MPVA 2IXSA 1XCVA 1C1PA 5K7ZA 3CP8A 3HHGA 5DD8A 3VB5A 1FOYA 4O3UA 4LFUA 4D76A 3T2NA 1TBRH 2M7AA 2JPCA 2VN2A 2O3FA 2YNAA 2KMUA 1VF9A 4A1TA 3GY8A 4K69A 2LKPA 1ZGJA 2K3FA 2NRAC 4NSVA 1C2GA 2CV0A 3VSLA 2EV5A 1FYKA 1VZ0A 1OP8A 3SDGA 2L4AA 1IRGA 3I58A 1N6YA 3JSPA 4BXUA 1AQ7A 2ZFPH 2ZSHB 1SFXA 1HAVB 2OK5A 3WTUC 1Z3XA 4B47A 1EAWA 3S3MA 4ZROA 5DCMB 4LG0B 5HVQC 1WQ2A 3HGGA 2ZDMA 3SEZA 4ZAEA 1FAKH 2ZECA 3BWGA 4K60A 3OWTA 2JETC 2V3MA 3RXUA 1VZQH 1P9UA 3AAFA 3T1BA 1GMDG 1I3QJ 4IX7A 1QNJA 2ZTZA 4NC7A 1DY9A 1O2UA 1SHHB 1HV7A 3BTWE 3W3CA 3RPUD 3OYMA 1N78A 1FBQA 2ZO3H 1Z1JA 4XE4A 1W0ZU 3KN2A 1PP8F 2F9PA 5D6EA 4I8HA 2O5RA 2CV2A 4BKXA 2KRHA 4Y13A 1OYWA 1UVTH 2HWVA 1A0JA 3HZJA 1AIXH 4U87A 3RMLH 2K85A 4M9ZA 1TGBA 1R9TJ 4OS2A 2ZFUA 1JHHA 4XOJA 5E3MA 2DA3A 1DP3A 2XC0A 1PJPA 3VSKA 1Z9CA 2OC0A 2H2ZA 3WY8A 2O8LA 1GBHA 2ZC2A 3T28A 1BA5A 5CQEA 1P4XA 4BJTA 4LK0F 2BDCA 1UCYK 5TCCA 4W97A 1SR5C 5CVJA 1D3TB 3TQNA 4WF8A 1RIOH 4IO9F 4HDVA 4KGAA 5JHFA 2HVQA 3FISA 2BDAA 2P94A 2HDDA 3S17J 1S83A 1RI7A 9LPRA 1B6AA 3FP7E 1CF7B 3ZZCA 2L9NA 3B6CA 2ZJPF 1C5SA 2ZDKA 3CDLA 5ICGA 1CHGA 3ECHA 3ZZAA 4HQMA 5JB8S 1W0JD 1G2LA 2XGCA 2KP6A 1C1QA 4B48A 1MAXA 2ZXJA 3AG4H 1LQ1A 5DG6A 4A5TS 4IW4E 2X0LA 3N7DA 1BC8C 4BQOA 4RBOA 4A6LA 2RFKC 2HWLB 4YLUA 2Z9GA 5KHDA 3HUGA 1BTPA 5JPMH 4DVAU 5C1XA 3U1IB 3HB9A 3AVZA 3DEEA 2FTLE 1KYZA 4A3MJ 3RM0H 5KAIC 1GMHG 5E8IA 3AKZA 5EODA 2J5OA 4PGGA 4Z2YA 4XKCA 1BI3A 3TP0A 3WGIA 1JGGA 1ETOA 4X8SH 2Y0MA 3HOUJ 2FBHA 5DS9A 3KP4A 1O2LA 3WTVC 1C9PA 1U6GA 3U21A 3QYEA 4C3IJ 5JHUA 1VCWA 3TDUC 2EINH 3LAPA 3OY6U 2XNDD 3KL6A 5FXLA 1RIWB 1SGRE 1DXPA 1L1GA 1WRJA 1ESAA 2RQQA 1TC3C 3L2WA 2KJCA 3S93A 1GBKA 2EIJH 3W6KB 3UNRA 1NC6A 3MZ8A 4QTRA 3TO6A 1O2ZA 2LTPA 3ZMVA 4RSPA 2YPRA 1HCGA 1IQMA 4XLPF 1Z0XA 2KCAA 1ETYA 2NU1E 2AMPA 1JMOH 2JJ2D 2H1KA 1ON1A 2VKEA 3A7XA 4X6AJ 2IJOB 3JRGA 1T0FA 5A2QZ 4YOGA 2KCYA 4MVNA 2WTEA 4BE1A 2DTRA 3BV9B 5CJ9A 5EZHA 2VGCB 1DPOA 2LK2A 3JR9A 3PSFA 2M87A 2ICWG 5DP5A 2M7BA 2CHAB 1P01A 1Y56A 2XBWA 3H0GJ 4EMSA 2TBSA 2G7UA 5LLQA 4X1NU 2R92J 2E1CA 3VOEA 5FO5A 1XC5A 2K27A 4ZYEA 2PLXA 1ID5H 4UUVA 5HOOA 4IRIA 2B9LA 4E4HA 3F8CA 3IRRA 1H0MA 2M34A 1O36A 1EPTC 4JZDH 2XAJA 1P0SH 2FQ4A 3B9FH 5EG0A 3VG8A 1D6WA 4ABGA 3URCA 4XORA 4Q48A 1YS6A 1ZSKA 1GHVH 3LGWA 4MLFB 1WVRA 3HJEA 1BR2A 2O8UA 3ATIA 4NFEA 1FYLA 2K4BA 1HKSA 1Y1VJ 1K1PA 1WJ5A 1JBUH 1BN5A 1G30B 5K7FA 1K28D 1T8OA 3U8TH 2ISZA 3KQCA 1ESTA 4BAKB 2L3DA 3ZVDA 5ICFA 3DEUA 3MKWB 4E7HA 1PYVA 1Y8RB 1BR1A 2ELJA 2F9BH 3NWTA 3ATMA 1FXYA 1SMTA 2FOHA 5LRRA 4HF2A 3KIDU 2MLKA 2EWNA 3GF2A 2AMQA 4OIQF 5EGMA 2VC1A 4OGYA 3QPLA 3FMQA 1QL8A 1SFKA 5FHTA 4QLCU 4OM9A 3GZ5A 1TPOA 3QODA 2BX4A 3GWZA 2B8OH 2DQRA 2M5TA 1OPHB 4RLQA 4UUTA 1DT2A 3TP3A 2G4TA 2V26A 1ZLJA 2J5PA 4OIPF 5AFZH 3H9QA 4Q47A 1V54H 3BG4B 5HM9A 3LA7A 1FT9A 1WWXA 4IVNA 1LB2A 3MU1A 2JUGA 4IOCF 4WX9A 5EEGA 3IC7A 1UG2A 4A0XA 1BRBE 3SHAH 2GBYA 4GO1A 1OOKB 1RUNA 4F3QA 3GZNB 4FVBA 2XPUA 1YHQI 2F4LA 1R5HA 4BU2A 1RJXB 4NBQA 4VGCB 2F48A 2AS9A 4HEA2 5GNDA 1MNEA 4YFKF 3BLYA 5KEDA 2G55A 2NNYA 1GCTB 5DPAA 4ABFA 2P5LC 3G1MA 3C27B 3Q0UA 1D0XA 1W7PA 2XB5A 1ELEE 3ZZ4A 3S3NA 3ZQHA 3ATLA 3BZKA 2FLBH 2FYQA 4DYQA 2O8KA 1Q31A 3L2CA 2EZIA 5IYBJ 1Y8QB 1HDTH 2P8TA 2GJGA 2LPRA 1EJ9A 4UUSA 5BOXA 1YW7A 2DT7B 1KZHA 1RXPA 2R7SA 2CQKA 1IQEA 1T32A 5GPCA 3F9KA 4HRIA 4PGHA 4AFZA 4KIBA 3BG7A 3RUOA 3RZDJ 2Y9YA 3L6PA 5JDUB 4RKJB 5L6NH 4X6NA 1AKSB 1HQCA 2A4RA 4BAQB 2D5VA 1C5NH 1EJNA 1X1BA 2ZFWA 2WYGA 4U0WA 3SV6A 3BTJA 1GI2A 1RTKA 1MBMA 4I33A 2KM0A 1LVMA 2WV1A 4B76A 4WXVA 2M45A 1UAAA 2RCEA 2G52A 2K8IA 3HOSA 3GCMA 3K4NA 4AB9A 1J15A 2LNBA 1GBJA 3L2UA 3PLBA 3HSEA 3VYSB 1CVWH 1UVSH 3S0NA 3RXHA 4D7FA 3F2HA 4MEXF 5E1WA 4IN2A 2LDUA 1GI9B 2STAE 5E0HA 2D1HA 2XF7A 1LDTT 4IZZA 3GFJA 2ZF0H 1KIGH 1MAYA 2KIFA 2GXGA 1EJMA 3AL0B 2E71A 2EK5A 5M5WJ 1TW3A 2O0YA 1Z7UA 4TYDA 1UHBA 2RC4A 1REPC 2IVMA 4XLCA 1MMSA 1SOTA 1B5GH 1OLTA 1FY3A 1QR3E 3CO7C 5C94A 5J4QA 1EF4A 4EVIA 2G5NA 2KAIB 4RB0A 2PN6A 3FFGA 2OTJI 2HNTE 3A01B 1O5DH 3LL7A 2A6TA 5EXMA 4LK4A 3HGYA 4X6MA 1MSFC 1D0ZA 2VLAA 2FOBA 3HGNA 3TGJE 4Y8YA 1NG7A 3OYLA 1Y3VA 4JQFA 3HKZN 2ZMEB 2XBXA 1AI8H 3K69A 1NTCA 1B7XB 4IPAA 2M3AA 1A04A 1ZLKA 2BD3A 2XXLA 3GTMJ 3MKZA 4MNVA 1WTGH 2EC9H 1P2NA 5A8YA 3RXTA 3R0AA 2BD7A 3O8BA 2R7RA 3A85A 2G0EA 1R71A 4X1QU 3BTGE 2HOBA 1MKWH 3BG3A 1BBRH 2FIRH 2V6CA 5DP4A 1KLJH 3TPIZ 2VJ4A 3IITA 4ACAA 3E91A 4ZTJA 4B3XA 3BTQE 1V3XA 2AEIH 1P8VC 5CVVA 2H5CA 4Z6YA 1UG0A 3TH3H 2ZHQH 1L0OC 3TVJB 4ZHAA 3J81K 5A8ZA 4MFDA 2VL8A 3ZMSA 2P8OB 2BOLA 1MTUA 4ZHLU 2VVCA 4QPQA 4ZJZA 1XGMA 2VWLA 4K8YA 3KNXA 3KEYA 2UUZA 1R1UA 1OSSA 3OEHD 3EUHA 1C2EA 1QRYA 1VKYA 5IT9K 3MHWU 2D8WA 3C2GA 4KFCA 1Z6JH 2PKAB 3O6BB 2XCNA 3ODDA 1IQNA 5EXNA 2BLVA 4X0WU 4XDEA 3G3ZA 1K78A 1W5SA 4Y33A 3DSPA 3RC5A 1TE0A 3J7AO 2YR2A 4G94A 2KX4A 1KU2A 5CVUA 2Y7XA 3GY4A 2WHXA 3UR9A 1GXPA 4YZUA 2XAQA 5GP9A 5C1UA 3PTNA 2K9SA 3QOEA 3WE3A 4LG3A 2DOFA 1T38A 2L9RA 4EV0A 1RR8C 3GYMA 2XAUA 1PVEA 3X2QH 3UNSA 1MDMB 1SLXB 1MTWA 5DO4H 4XBFA 5AIPA 2H6BA 1JIMA 1T31A 3FX3A 2WAQN 3NWSA 3FKJA 5LGTA 2DTZA 3E6CC 2Y0SA 4Y7NJ 4K3JA 1AU7A 3M7UA 1BMLA 1J0RA 2CXVA 1BB0B 1MZBA 1ZG3A 3PRBA 2FPZA 5HLTA 1RD3B 2L0KA 2Z1DA 3M4OJ 2BM2A 3SUGA 2AS5F 3SZTA 1CQTA 2PMUA 1MJ9A 1SLWB 3SGQE 2RNJA 3KZYA 5GCHF 2GOXB 5A0BA 4I09A 5FLMJ 2BHZA 2KFWA 1KXCA 5EU8A 1C0WA 2JA5J 2J5UA 3OR2C 4WK8F 2X4HA 5K0HA 3CCVI 2W5EA 2E34A 5FKMA 2KZ4A 3R4KA 1E3OC 3DD2H 3ZV9A 3TK9A 2ZGJA 2YSRA 3CCJI 3RYRA 3GCHC 2R7XA 2FMLA 1BOAA 4SGAE 3TDZC 3O8CA 1BA8B 2P16A 2A5WA 1IRXA 2HU9A 3ZN0A 2J97A 2X48A 1UTMA 2GTBA 3M1EA 2LC2A 1B72B 1VJ9U 2ESHA 1OWEA 2HQ5A 3GYLB 4BAOB 3C2BA 3UFAA 2HALA 1YRNB 1ACBE 2PTNA 2O9LA 1FX0B 1FTTA 4MTBA 3DKYA 4JZIA 3ZYEA 4MNWA 3M3YJ 3JAMK 4WH6A 4WMEA 1K0HA 1IXRC 4A3GJ 1ETRH 2IW5A 2BY8X 5FRNA 2OZ6A 2L54A 2DLLA 4U32A 2O9QA 1SD5A 5BQTA 1NZQH 4HX7A 3PO2J 5ILUA 4FE4A 3K70C 3HRMA 4P96A 1GI5A 2EIKH 1LFBA 3LSHA 3KQEA 1X7AC 2FNPA 2A5KA 3ZMUA 1FN6A 3HHHA 3AW0A 3LSPA 3WTXC 1DICA 4Q4LA 4CHAC 3VGCB 1ANEA 2B0FA 1A36A 3FMRA 1SHYA 3V7SA 3QGNB 1GJBB 3LSTA 1S5SA 1IN7A 2VJIA 2DMPA 3F23A 1O2TA 2TRTA 1NFWA 3FMSA 1W7GH 2VT2A 2H9HA 4DBRA 5C3EJ 1W8BH 4I0BA 4LXBH 5BNGA 1LHDH 1GL0E 3BTLA 1JT0A 3UIRA 1RKTA 4G7OF 2OBQA 2BB4A 1WJEA 3J80Z 1ZRFA 2YOLA 2OU2A 2QXGA 1QVTA 4LOYH 1I5ZA 4Y17A 2DODA 1HOMA 1FBUA 2A4OA 3HUGB 3OYJA 3DSOA 3J7AY 4N0BA 4FT8A 4PSXA 4C2UA 1OCCH 3KZZA 2QF0A 3BC8A 1TMTH 1TBQH 1OS8A 3KFWX 1GBAA 2KHMA 4ACBA 5M5XJ 1TYNA 2KJBA 2VKDA 3K4BA 1ANBA 1F0SA 2XKPA 4NB5A 1IN6A 2XOKD 2D2DA 3BTME 2BQ7B 2JRMA 1EATA 2ASUB 4U2WA 1UZCA 1XX5A 4AYYB 1FOXA 1P10A 3IUOA 2R3SA 2SFAA 2FO9A 5JBCS 1N8OC 1HAPH 4YIFA 2ZXIA 2X51A 1O5CB 2ALPA 4BHBA 3FK6A 2R2MB 2CQ7A 1CSOE 2LLKA 2BVXH 4XRSG 2ADUA 1OWKA 1TBXA 3K4LA 1QA7A 3PWCA 2C90B 1C5YB 3F1SB 3UOUA 4O97A 1T4VH 3BR0A 3S9CA 1IHTH 3TEDA 1WYKA 1K61A 2WA0A 5IYDJ 2K86A 4HSTA 1S82A 3H7TA 5FD6A 5DKMA 4HZHA 4QPOA 1GHWH 1Z6RA 2OXSA 3V7TA 1MGTA 2MC4A 5E0JA 4M6XA 4X2VA 4F93B 1P2MA 1K1MA 1VQNI 3AG1H 1ACIA 3E6MA 3EAJA 4M6YA 1X1DA 2IN2A 2YNBA 2DN0A 3MOCA 3SZEA 1C5WB 2VNTA 1EZXC 1KTTB 3FXJA 3F6VA 3BR3A 1AWHB 1O39A 1R22A 1THSH 4GRIA 2HOTA 4LZ4B 1UVOA 5ILSA 1O3HA 2QCYA 4K1SA 2Y75A 2E1MC 2WYJA 1XD7A 4RB2C 1EA3A 1MKMA 3C7JA 1QGFA 2DBBA 3A1YA 1SL3A 1GDNA 4S05A 3WU2C 5FKOA 4B44A 1TWCJ 3BT9A 1WTHD 2XNIA 2R9PA 2GLOA 4H42U 5HS8A 2X1EA 4XMYA 2RDEA 4CHUA 2R2WU 4CSWA 2HOAA 4PJJA 1LKAA 5EG0B 2VVVA 4I86A 1PUFB 1P02A 2Z3DA 1S81A 3CUQA 3UWIA 2NS7A 1LVBA 4E7JA 1ZJDA 2GMTC 3BG6A 1JI8A 1VCQA 3CJRB 2ZDLA 2JH6D 3SJMA 4ABEA 4EEFG 3FWEA 2VXDA 3SUFA 1TNTA 2QGUA 5LFAA 4CR9A 1KONA 4ANJA 1C2DA 3K9TA 1G3CA 2GP9B 1DP7P 1D6RA 2P59A 2DK5A 2E35A 1Y3YA 2L5QA 2FOWA 1G59A 1WGXA 1X3ZB 2BY2A 4LLGF 3HM5A 3CF5F 4U7DA 4CH2B 1YJ9I 4KNYA 4RGUA 1A6QA 3WGHA 1NU9A 3F0OA 1O4XA 1S7OA 4KMUX 2LY1A 3KCGH 1MMGA 1BMNH 3GY7A 4YFNF 1JXSA 1IDYA 1A1RA 1YCPK 3RCOA 5D8LB 1Z8GA 1GJ8B 3F9GA 1TT5B 1FONA 4ZH4F 1XUJA 4MQVA 2Q6DA 4AZ2B 1WH7A 2NU2E 1ZELA 1X19A 2LYCA 2MD0A 3FHZA 1D0YA 2JDID 4D8NA 4F49A 3LGTA 2DA2A 4OGXA 4EGYA 5F1RA 1DUAA 4RB1A 1I6HJ 1C5QA 4XRFA 2EILH 1GJ7B 1YS7A 4R0IA 1FY5A 3CQZJ 4P55A 4U88A 1XUGA 3GVAA 4JZEH 5FFXA 2W3KA 1TABE 4II3A 3JTHA 1HRTH 2EQNA 2GCTB 1LUJB 2BGCA 5GPIB 4L9NA 4B1RA 1LKBA 1AVGH 3MH6A 2F91A 3FXQA 1HSTA 1GVLA 4XOTA 4EM2A 1A0LA 2KZGA 3MWIU 3G73A 2DCEA 1QPIA 4AFQA 1Z7LA 2CGPA 1LVOA 1NFXA 5EQQA 1ZSJA 2W26A 3BN9A 2JVGA 5F53A 5ERIA 1MQ6A 1MUEB 1FPQA 5A09A 1RGQA 1QIXB 4W1UA 1AOYA 3FZZA 2XF6A 3S8PA 2GA2A 2YU3A 2AQEA 2CW8A 4DOZA 1ZOMA 4I8GA 4M3FA 1EH8A 1P4AA 3CMEI 4YESB 3S32A 1B8IA 2BLOA 1I6XA 2F4OB 2FZZA 4XIDA 3OU0A 1O3JA 4IMQA 1T8MA 1KA8A 3MZHA 2XWBI 2GM4A 1O5GH 1QZ8A 2V7FA 1C5VA 1AY6H 3SZGA 5GIBA 1O3IA 3SN8A 1SAUA 3GDVA 1WPKA