1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
b'ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
5EEGA 2L4AA 3DKWA 4GXOA 5FB2A 4XLNF 4HV5A 1HW5A 3QP6A 1USTA 3K69A 3E97A 1ON1A 2M8EA 3GO5A 4L0ZB 1OR7A 1ZG5A 1S6LA 3CLOA 2HYGD 1TTYA 5DV5A 1YYVA 2PMHA 3TOBA 2VE9A 3FM3A 2CO5A 1R5HA 3KEQA 1HKTA 1Z1DA 3H3ZA 3LQQA 1W5TA 3BJAA 3KCCA 2E7XA 4G8XA 4KIBA 2QENA 1HSTA 5L3FA 3SQNA 3WTVC 2ELHA 4NB5A 1T98A 2RQPA 3M1EA 5F1RA 1O3SA 4MHGA 2NNYA 2MLKA 4IRIA 5H20A 4RB2C 2LKPA 2X0LA 3HHGA 3SZTA 3ULQB 2OAZA 4A6EA 2FE3A 3RYRA 4MQVA 2H94A 5D5UB 4L9TA 2JT1A 5HDNA 3HYIA 2BYVE 2UXNA 4YIFA 1YW9A 2FEZA 1YW7A 4R8HA 5DCMA 1T2KA 3J81Z 2IW5A 5CVUA 3H3UA 1HBXG 1WRJA 1XGNA 1R1VA 2F5DA 4ZZDA 1U8RA 2A07F 3ZMZA 2L54A 3NRVA 2P4WA 2GA2A 3KE2A 1WKMA 3Q9VA 3QRFF 2H27A 1SFEA 3BPVA 5ICCA 1P4XA 1YTYA 2KIMA 2CYYA 2IJLA 1SD7A 1O3QA 2TDXA 4PDKA 2PI0A 1G3SA 2GWRA 2HQRA 4HZFA 2VN2A 4EQQA 3D0SA 1ON2A 3KETA 1SMTA 1FX7A 1Z9CA 2YX7A 4BHBA 5JI6A 3M7GA 2QWWA 1IXCA 4N9HA 3F22A 2LF8A 3GF2A 5AIQA 2P8TA 3TGNA 2W85A 3DPLC 1RUNA 5FLXK 1CGPA 2MLGA 4A5NA 3WE3A 3C7JA 3IHUA 5TJJA 3GEZA 4BAYA 4S05A 2DBBA 2KJCA 1O57A 3DFGA 2JRTA 1SD4A 1AOYA 2CW0F 1XGMA 1QPMA 5IT9Z 1Z05A 1FYLA 3ZP5A 1EH6A 2W84A 4GCVA 5FFXA 5E18F 2ZBKA 1IN8A 3JAMZ 2CG4A 1HSJA 3I5UA 3E5UA 3IC7A 1MJAA 3VOEA 2C6YA 3P7NA 5D5VB 1ZLKA 1VTNC 3WTWC 3MQ0A 4BH9A 3T1BA 5FO5A 1I1GA 3R6SA 4NQWA 3E6BA 5L3DA 3P9IA 2FF4A 3LAPA 3REOA 3JTGA 2D1VA 5ILVA 2Z33A 5HDGA 2DAOA 3BROA 3V8JA 1FP1D 1ZH5A 3N97A 2Q8KA 2MH9A 1ZGAA 1BIAA 1J9IA 2BV6A 4IHTA 2A6EF 2HR3A 3QP5A 3GW2A 3DEUA 3HTSB 1G3WA 3O3KA 2ZKZA 4PCQA 3CTAA 4AIKA 4D0PA 5E8GA 3TOAA 4CGZA 2W25A 3KP6A 2P5KA 2HTJA 5ILUA 1BBYA 1UHWA 4HQMA 2YU3A 3WTUC 3T0YA 1F5TA 2RN7A 3GYHX 3WGIA 3RPQA 4ESJA 2QBYA 2R7DA 1QZZA 3KEOA 4PGHA 1Z91A 1S3JA 5F6FA 3HSFA 2H6BA 3FZVA 1O3TA 1S29A 4RB3C 4RAYA 4M74A 2YPRA 5ICFA 3SHFA 3ERED 1C0WA 1BC8C 1B1BA 2RGVA 3NEUA 4U0WA 5BMZA 5ICGA 2GQQA 1U6GA 5D8LB 1LJ9A 3QU6A 3CUQA 1GHCA 2G7UA 3EQLF 2G7HA 2PBIA 3F8CA 2FBIA 4OIOF 2ETHA 4P9FA 3BPXA 3M9AA 1A04A 5E1ZB 4L9JA 5IT3A 5JR3A 1ZAOA 1ZN2A 3S2WA 2DK5A 5K5OA 2YSRA 3TO9A 2Z5UA 3JSOA 2D1HA 1BIBA 1R23A 2A6HF 4AIHA 1JE8A 2MA3A 1H9GA 1LQ1A 1U5TB 2DK8A 3JTHA 4R79A 3W6KB 3QPTA 4FX4A 1FLIA 5DCFA 2W57A 2UZKA 3V8LA 2FSWA 4A12A 1U5TC 4FHTA 3KLOA 3DPTA 4KN7X 1F1ZA 1P6RA 1KU7A 3ML6A 3CUQB 2FA5A 2F5FA 2Y75A 1SAXA 3Q9SA 4HX8A 3MZHA 4CDGA 3I64A 4IRGA 1ZRCA 2WWYA 3C3WA 1FBQA 1HW1A 5L3EA 1O7FA 4ENMA 4QLCU 1L3LA 2K02A 4QWQA 5HS8A 3CUOA 1S7OA 2EV6A 3ZMUA 2ZFWA 3I53A 2PLYA 5FLXZ 3O6BB 3ECOA 3LAJA 3IWZA 4N0BA 1MD0A 4WCGA 4G7ZF 1QQIA 4M71A 3LA3A 3PFIA 5BPDA 2OU2A 4U7BA 1XCVA 1EH8A 3C1DA 2QM3A 2E7WA 3RDIA 2VC0A 2LF7A 1WI9A 2RDPA 3P9CA 2M5WA 3RI4A 3LA2A 2PMUA 1P4AA 5IT9K 5D5XB 2HZTA 4IF4A 1KU9A 1JHFA 3T5XA 3JAMK 4UV9A 2M45A 1ZARA 2QQBA 2EK5A 4P9UA 2VBWA 4EVIA 3L9FA 4PGGA 4L9VA 3L09A 5D4RA 4KICA 2EA4A 2DW4A 1XSVA 4M9SA 2ESNA 2OQRA 5D6EA 4CHUA 3D5LA 2QUFA 4MGRA 2V79A 1SD6A 4JQFA 4G9YA 3HOTA 2D2WA 1IXSB 4HOBA 1U3EM 4EMSA 4JK1X 4I7HA 3RKXA 3BJOA 4U0VA 3M8EA 4HX7A 3U2RA 1LDKB 2RKHA 4FX0A 4MNUA 5A2QZ 2QZ8A 4GYIA 2Z3YA 4HLXA 2JPBA 3FXUA 3HRTA 4Y15A 3F21A 3AAFA 2VBXA 2NRAC 2OD5A 2ZJ2A 3V7CA 4PZJA 1IN6A 1D3YA 4I0AA 1KU2A 4GGGA 3VB2A 3WU0A 2O61A 2O3FA 1L0OC 3K1PA 1DDNA 4MEYF 4DNCA 3ISPA 2HYFA 5LEJA 2OBPA 1BN5A 4P55A 5BQTA 3QPHA 2GXBA 4ASNA 1R1TA 4RB1A 2D45A 3F6VA 2RC4A 2XHKA 4HBLA 3ABUA 2A68F 3KP2A 4L18B 3GLXA 4M72A 2G9WA 1TLHB 3WTXC 1FYMA 2MH2A 1NHAA 2M30A 5LRRA 2IT0A 2P6SA 2F2EA 1Q1HA 1J5YA 2IVMA 3KFWX 2P6TA 2XASA 3FX3A 2XKPA 2ZXJA 3HSEA 4ZYDA 4MEXF 1O7LA 2VBZA 3FF5A 2UWMA 2EV5A 4CXFA 4OIRF 4L5JA 1DPUA 2FU4A 4Q47A 1MDMA 5EEHA 1R58A 2PFBA 1XN7A 2EFWA 3BP8A 2J5OA 2QLZA 4I01A 1OMIA 4M9XA 2EV0A 4L0YB 4KIGA 2V9VA 3SFZA 3I59A 3QAHA 4I2OA 3ZMTA 4R1HA 2HDCA 2DFIA 2V6CA 1R36A 3HSRA 2QQAA 3E3VA 3BOQA 5JHUA 4UVCA 1B9NA 4YIIA 2HGCA 2HQNA 5DCMB 1TQIA 3T8TA 3MZYA 5CVJA 1RZ4A 1YS6A 5D6FA 3EDPA 2K4BA 1TW3A 4HF1A 4RGRA 3FMRA 2HEOA 4HA8A 1ZG1A 1XCBA 1K79A 4I0BA 4KMFA 4HLYA 2EFNA 2FNAA 2M1BA 2PN6A 3E6DA 4U0YA 2VOPA 4ESBA 4G94A 1K78A 2B0LA 1HKSA 5K1YA 4U7DA 1R22A 2K4JA 2DI3A 2HKOA 4OMZA 2QQ9A 1PP8F 3HRMA 3I59B 3Q5FA 2HS5A 3PQKA 3VFZA 1XGOA 1KYWA 3LWFA 4HYEA 3GZ5A 3ZN1A 4UUVA 5E17F 4IVNA 2XAQA 2HWVA 1FBSA 4AWXB 4I98B 1P92A 1FSHA 4LD5A 1D5VA 2Q2EA 4XRFA 1WWXA 1K6OA 2VXZA 3ZN0A 3RIRA 4H0EA 3RYPA 3FM5A 3GVAA 2UXXA 1R00A 4LLLA 4M6XA 1OYYA 2E1CA 1AWCA 4L9NA 1K78B 2ZCWA 1XD7A 1OYIA 1TNTA 1FP2A 4KT5C 1FWZA 4UVAA 1JHHA 1IW7F 3TKYA 1G4DA 1FT9A 2V1UA 1R7JA 1EV7A 5CJ9A 2AXLA 5A2QK 3W6JB 2E1NA 2EWNA 4P96A 1SFUA 1E2XA 4RGUA 1ONVA 4HQEA 1R5GA 1KYZA 3V4GA 2Y48A 3L00A 5LBQA 3ZMSA 2EFOA 1TQPA 4ZH4F 5FD6A 2O03A 3ECHA 5LRSA 4A0ZA 2ZMEA 4A5MA 2P7CB 2KIFA 5LLQA 2JSCA 1B9MA 4OMYA 3VODA 4Q4ZF 5E1WA 1H0MA 1REPC 1OKRA 4RAZA 3G3ZA 4AVPA 5J8CA 2GIVA 1T39A 1OPCA 3GX4X 4XBFA 4O6JA 3K2ZA 2OQGA 4I09A 4KUMA 3R60A 5DYMA 1D8KA 2OA4A 3GFMA 1BC7C 1PDNC 1KGSA 5E20A 2FMYA 2DO7A 3L2CA 4E70A 4OINF 4IXAA 1XMKA 3WG9A 2IPQX 2ZMEB 1RIOH 2XAFA 2XAHA 4A2UA 2QBYB 4YG2F 4CYDA 3J7AO 2AS5F 2LNBA 3RTRA 4WK8F 4EV0A 2Z99A 3VEPA 5FFZA 1KQ9A 4XSZF 4UNOA 3BZ6A 3V7RA 5LGTA 1LEBA 2QYOA 2FXAA 1TBXA 5LGUA 2ADUA 3GFIA 1P4WA 4G7HF 3LFKA 1ULYA 3TO6A 2BBYA 2IA1A 4WWCA 2R3SA 4HAMA 1BI2A 2FNPA 3WTTC 1UB9A 1DP7P 5J6XA 1Z6RA 3CUQC 4BYYA 3KZYA 3MAJA 2DPUA 2A69F 4KIFA 2ZNZA 2A61A 5DUKA 2VOOA 1IZ1A 4M9ZA 4O3MA 3K0LA 2P5VA 3HIFA 1SD5A 2W24A 1I27A 2FQ3A 1QO0D 2P5LC 4B09A 3I71A 3WGGA 1W7PA 3F8FA 1LDDA 3K1MA 2COMA 5CVVA 4HX4A 4EGZA 3LQRA 1Z7UA 2O0YA 1FC3A 3RPUA 2O6GE 2J5PA 3KP5A 1BI1A 4CZZA 1IN4A 1IN5A 2X4HA 4CICA 4EM2A 3IKTA 4LLNA 3C18A 5JFRA 2VC1A 5HS7A 1MKMA 1I6XA 4UV8A 2STWA 2L02A 4ENNA 4EM1A 1U78A 1JGSA 1GVJA 1XMAA 3RKWA 2JTVA 3IRQA 1YLFA 1XGSA 4YFXF 3FMQA 1LEAA 2FRHA 4LGWA 1MZBA 1PP7U 1KQ8A 4Y13A 3ZMDA 4GO1A 4RGXA 2VONA 2DQRA 3M8FA 5D8KB 5ERIA 3I4PA 4M6YA 1O3RA 2GXGA 1GXQA 1G3TA 5F64A 2HKXA 3ZMVA 5L3BA 3CJNA 2L3DA 5CVIA 5BPIA 1YFHA 5LEKA 4G7OF 5H6QA 4HDVA 3GWZA 4ZYHA 2WV0A 1DPRA 2GA1A 5KK1A 3IWFA 1BI0A 2DLLA 4KDPA 3U9GA 1ZRFA 3OV8A 5JVTA 1W4MA 4ON0A 2RVCA 4P5OA 3E6CC 1BM9A 5E1XA 4MTDA 4UVBA 4HW0A 3F72A 4LJZF 2IA0A 4L5IA 1FSEA 5HLHA 1B59A 2YX4A 1D8JA 2KKOA 4ESFA 4MTEA 1UFMA 3HHHA 1FYKA 2IA2A 3WTYC 3WU1B 3KP3A 3MEXA 5HOOA 4EJVA 2XAGA 1RUOA 1J7KA 2IP2A 2XV4S 5ICEA 1YIOA 5HLGA 1KU3A 5DEQA 1G3YA 2XUBA 1IF1A 4B8XA 1J2XA 4ETSA 1LNWA 2EFPA 2RNJA 4EM0B 1HXDA 2CFXA 2F5CA 2XKOA 4G6QA 1FBUA 3GUDA 3PQJA 1EH7A 1I5ZA 1HQCA 1ZLJA 5AONA 3DV8A 2XIGA 4G6DA 3HTUA 4IRHA 1V3FA 5L3GA 1KQ0A 2ACJA 3FHZA 3O2PE 4ENJA 1UHMA 5HLIA 3MCZA 4ZYGA 2VT3A 4RGSA 2XRNA 1BOAA 2FBHA 1YW8A 5LHHA 2ZNYA 4AIJA 1BI3A 2DT5A 1GXPA 1T38A 2A3SA 3J80Z 2KRFA 5CYVA 3V8KA 1QBJA 5LHGA 3IRRA 2BGCA 5HDKA 2FMLA 1LB2A 3FWEA 5ED4A 3SXYA 2DTRA 1MDMB 5LGNA 3N4MA 2EFQA 3RKYA 1W5SA 4A0YA 3DXJF 4ZYEA 4WXHA 4EJUA 1Z6TA 5BOXA 4A6DA 3NQOA 4F7ZA 3DF8A 1YO5C 1STZA 4KN4X 1T0FA 4LB6B 3H92A 1ZYRF 3F8BA 3EYYA 3MWMA 2RV8A 3QU3A 1JXSA 2EB7A 2CQKA 1B4AA 3TDUC 5E8IA 2ISZA 1TW2A 4OU0A 1J0RA 4CO8A 2QVOA 4KYWA 3FMSA 2Y0MA 1QZYA 3HOSA 5CVRA 5HVQC 2NS0A 2Z9OA 1CF7A 3WTSC 1ODDA 3ELKA 3FXQA 1I1SA 1W7PD 2OZUA 1RI7A 4TV7A 4JBAA 3GFJA 1YG2A 2WC2A 4YFNF 2JZYA 2CSOA 3I0TA 3I58A 4WX9A 1IN7A 2K27A 2KJBA 2FBKA 1G6NA 3F8NA 2H6CA 1ZREA 2NNNA 4OIPF 3EETA 1YQAA 1ZHFA 4A0XA 2VE8A 4HDUA 3BWGA 3R0JA 1B6AA 4S04A 3K1NA 2ZO4A 1BJAA 4Z2YA 4LG0A 3GZ6A 1XSDA 1YS7A 4BHPA 5H6RA 1TNSA 1XB4A 2A5YB 1V4RA 5KVRA 4KFCA 1MGTA 1ZGJA 1CF7B 5DD8A 4KNYA 2DQLA 4LK1F 2PJPA 3FXRA 1K7AA 1WQ2A 2V1XA 3QOPA 4FT8A 1QGPA 3U1DA 5AIPA 1QNTA 4LMYA 4U88A 3E6MA 2VBYA 2K86A 2R7FA 4UHTA 4NHJA 2PEXA 2DU9A 5HS9A 4LLGF 2JPCA 1H9TA 3T8RA 2WTEA 1FNNA 5FD5A 3CO7C 4M73A 2LSOA 4KMUX 2K7LA 2LDUA 4GYGA 5DUIA 4LG0B 3CO6C 5LHIA 1SMYF 3BDDA 3WGHA 1FOKA 3DP7A 4BQAA 4EGYA 3EYIA 4EJTA 2MD5A 3IL2A 1U5TA 3GFLA 1IRGA 4IHSA 5TRDA 4N9IA 4BHCA 3ZPLA 2XROA 4EJWA 2MC3A 3V7SA 1T6SA 1KA8A 4I02A 4MQ9F 1LVAA 4RS8A 3B02A 4WXCA 1IRFA 2EA2A 1ZRDA 3TDZC 1IUYA 2STTA 3HRSA 3SZPA 2GAUA 2HOEA 3F23A 1R1UA 1XSXA 3R0AA 2VODA 3MFKA 5D4SA 4HV6A 3R4KA 4Y17A 5L3CA 3WTZA 3J81K 2HFHA 2IRFG 1X3UA 4HF0A 4RB0A 4YFKF 1F9NA 3TQNA 5DDGA 2OZ6A 1PUEE 2PG4A 4WXDA 3JW4A 3IKVA 2YR2A 1J59A 5D5WB 3K9TA 1MJ9A 2XGXA 2PQ8A 2VT2A 1HW2A 3WODF 2F5EA 5BS6A 3LA7A 3HRUA 4WF2A 2FOKA 4Q48A 2NYXA 3F3XA 1E17A 3J80K 2P7VB 1S7AA 3WE2A 2CWEA 1Y0UA 1P2FA 3BJ6A 1S8NA 3TO7A 1FPQA 1USSA 1UCRA 3DQVC 4XLPF 3E5QA 1IXRC 1HKQA 3ROUA 4KA4A 4IJAA 3KP7A 3COAC 4ENKA 4LFUA 4LK0F 3GXOA 1FZPB 2H09A 3RJPA 3F6OA 2DPDA 3B73A 2BEOA 1F4KA 1OYWA 1TQMA 1XDUA 3OOPA 2NAZA 5ILSA 3LSTA 2GZWA 4XSXF 3G73A 4OIQF 4Q5SF 3R61A 2XVCA 1SFXA 3EUHA 2EJRA 1DUXC 4K2EA 1U2WA 5DD4A 4O5VA 4HF2A 4BNCA 3CDHA 6PAXA 5K5RA 2ISYA 4BXUA 3F8MA 2KIUA 1J75A 1MJBA 4LB5A 4EJOA 3KZZA 1ZG3A 5FGMA 3HUGA 2XAJA 2HTSA 2MBFA 2V1DA 3ZQ7A 4ZZLA 1RNLA 4OOIA 3E5XA 2Q0OA 3BY6A 3KLNA 1LDJA 3I54A 2ESHA 4AD9A 2M87A 3JSPA 2CGPA 2O8XA 1IAWA 3P9KA 4DQ2A 2BE5F 4UXNA 1WSUA 3KP4A 1W7PB 5J8FA 1XDSA 4IPAA 3L7WA 2L01A 5CLSA 3ABTA 1FY7A 5K5QA 2L4MA
chains in the Genus database with same CATH superfamily
2LR8A 3BTLA 3CC4I 2KAIA 2L4AA 2OXSA 3DKWA 5HNHA 5EDNA 2H9TH 3FKSD 3KIDU 1HW5A 2BY3A 3E97A 3QODA 3FXJA 3PWBA 2VJIA 3GO5A 4L0ZB 1S6LA 1GV2A 1W0ZU 1VQNI 1TTYA 4FVDA 4RKJB 2E5ZA 1XS9A 1O4XA 3L2QA 3FM3A 2CO5A 4GHTA 3F2HA 2ZWLH 3OYPA 1QB9A 4L5EA 1S9HA 3O8BA 5TJXA 1GBEA 1O2VA 3GCOA 6GCHF 3LQQA 3H3ZA 4E7SA 5C94A 2VBCA 1JRSA 3SZEA 1HSTA 1B0FA 2A31A 1V6DA 3ABMH 1HLTH 1TALA 1UCYK 2MLKA 2KM0A 4IRIA 5H20A 4DYQA 3H5RA 2LKPA 4IHVA 3A88A 3LJOA 3RQ4A 4UEHH 3VEQB 4FISA 2AGEX 4Z6AH 1WCMJ 2H94A 5D5UB 5HDNA 2ZXIA 2GD4B 1PJRA 2BHGA 4YIFA 1YW9A 2R0KA 3CLQA 1O33A 2XSJC 4XLAA 3KYFA 3PSFA 1MKWH 3ZIAD 5T3HA 2CS3A 3UPEA 1O3CA 3BR6A 2K9NA 2OTLI 2F5DA 2E36A 4D9JA 2ODYB 1GHYH 1Z7LA 3ZMZA 3OY6U 5TCCA 5EQSA 2R7SA 1JWTA 3KE2A 4E7RG 1WKMA 3QRFF 2CV3A 4JCNA 2H27A 4NIWA 5IOYA 2BX3A 1YTYA 3CC2I 1RTKA 2LREA 4FASD 3DTEA 4PROA 2PI0A 2KRHA 2GWRA 5GTHC 5GCHF 7KMEH 1H4WA 2LRDA 5E0JA 1Z8JB 1ON2A 1SMTA 1VZ0A 4Y3OA 3I55I 3RXOA 4Y8YA 2WV1A 4BHBA 4B3AA 1RGQA 5JI6A 2K1QA 2M4GA 2QWWA 1LO6A 1OWDA 1YX5A 2NU0E 3GF2A 5AIQA 1GVKB 2VB6A 3K4NA 4CZCA 3TJNA 1L1GA 2R2WU 3AK5A 1HAYB 2G5VA 1V2UT 5TJJA 2IJOB 3DBLB 4PJ0C 2J97A 3GZNB 2HDDA 2JRTA 3SV6A 5DP3A 2PUXB 1Z05A 3A7XA 1EH6A 3DFJA 3ZZ7A 4GCVA 5FFXA 2NVYJ 2ZBKA 3RXPA 1IN8A 3JAMZ 4X1SU 1BR4A 1ARCA 3GDUA 3K4LA 3I5UA 1VFCA 1XUKA 3E5UA 1BRCE 2C93B 2P3TB 3VB3A 4CCLA 1K1JA 3EE0B 1MNEA 4ZHLU 4BH9A 1FPHH 5FAHA 4JOMA 3R6SA 1GBJA 1SQRA 3LKWA 5L3DA 3SV9A 1KXEA 2R3YA 3JTGA 3CZ6A 5ILVA 2HOSA 3BROA 5BPEA 1FP1D 2NU2E 1O5CB 1J9IA 1TOCB 4IHTA 3FKIJ 4D5CA 3ASOH 3RUOA 1RC9A 2SGDE 3SU6A 1DWBH 3GW2A 3HTSB 5AFYH 1FIPA 4DY7B 3IH4A 3MKLA 1GJAB 4ABJA 3S3MA 4ABIA 3BT9A 2KL4A 2AO9A 1HNEE 3N7EA 4HQMA 2YU3A 3OYJA 2J92A 2BD7A 5A8ZA 3OSFA 3OYNA 1NS3A 4NQWB 4CH8B 3HSFA 2ZFTA 4JP0A 2GIZA 2VPRA 3LSMA 2XBWA 1C5WB 2GVFA 5LD2C 3SHFA 1W2KH 2ZNKH 3PV5A 4NBQA 2WV9A 2I6QA 2SGQE 2EY4C 2KZVA 1LJ9A 1X4PA 5DGJA 2C3SA 2VNTA 3SV2H 2G7UA 2G7HA 4A3FJ 2FBIA 4XM3A 2ETHA 3GTMJ 4P9FA 4O97A 1VQ4I 1HAHH 4ISIH 2OC7A 5EJCA 1ZN2A 1Y1WJ 3TL4X 1RJXB 3M35A 2KPMA 4LOYH 5K7ZA 4B1RA 3RU4D 4YIRX 2A6HF 1YF4A 9ANTA 1TZLA 4R79A 3QPTA 1FLIA 4MPXA 3M5LA 2Y31A 2W57A 1SR5C 3SU4A 3PTBA 1U5TC 1MBFA 2OTVA 4FHTA 3F0CA 1P6RA 5M5XJ 3CUQB 2OQ5A 3TJOA 5C3NA 3KN2A 2IGOA 2OP9A 1IQGA 1CVWH 1KY9A 2WWYA 3V0XA 2Y9YA 5L3EA 1O7FA 2ECBA 4QLCU 1WDIA 1QRZA 1W0TA 1AFQC 5FRNA 3B8JA 5HS8A 1NFUA 2EV6A 3ZMUA 2VKEA 1HAPH 4OS4A 3ZV8A 1C5QA 3OYMA 3TVJB 4IC6A 3LAJA 5M5WJ 2PTNA 3OTPA 4G7ZF 1LHCH 2SGFE 2JRMA 4IC5A 3LA3A 5BPDA 4IZZA 2OU2A 2BDCA 1XCVA 5DM6F 2FS9A 2N8GA 4BU2A 1A3EH 1Z6EA 3UNQA 2H1LA 2VC0A 1GMDF 2P81A 2OK5A 3RI4A 1VGCB 1XXFA 3DUXH 1FIZA 2L9NA 1JHFA 2AHME 3QTOH 3JAMK 4UV9A 1DSTA 4EVIA 2IBDA 4L9VA 5EG0B 3A80A 1QZ8A 5F1JA 3Q00A 2OQRA 1RFNA 2QUFA 2O9QA 4X1NU 3DKYA 1TMBH 3BG5A 5DG6A 1YRNB 3SI4H 1U3EM 1P2JA 4JK1X 4U0VA 5C0UA 1MD8A 3UR6A 4NSYA 1LDKB 4GYIA 3HG9A 2ZHDA 3UNGC 3FXUA 1E37B 2JK3A 2KDOA 1T4VH 5CHBA 4PZJA 1HC8A 4I0AA 2HPIA 1GGDB 4CRGA 1TOMH 2XAUA 1V2QT 2D1JA 2HYFA 2VWOA 3VB4A 4P55A 1KDQB 5BQTA 1D9IA 2KAIB 4ASNA 1DGWY 3MH5A 4RB1A 5KAFC 3KYGA 1G3CA 5HM2A 4MO7A 4X6MA 3E6PH 2WPKS 2CUFA 1WSSH 4ZH8A 3GTLJ 4M72A 3RU4T 3WTXC 1YC0A 1OWKA 2M30A 3QLPH 1YCPM 2Y0SA 3K4MA 2IVMA 5GADJ 2XASA 2KZGA 2E1MC 2XKPA 3T5FH 1T32A 1GBBA 2VBZA 1A0JA 1O3AA 4XNFA 1UTKA 3PLKA 2EC9H 2FOWA 1ZLRA 2J4IA 4Q47A 1UTOA 1O3HA 2UUZA 1OPHB 3MFJA 2LD5A 3RDZA 2EFWA 2FP7B 2XSDC 1OMIA 2R7RA 2V9VA 3SFZA 3OYGA 1UJ8A 1HDTH 2DFIA 2V6CA 3MKWB 5IYTA 2M34A 1WFXA 3CF2A 3HSRA 3WG7H 3L6PA 1BIOA 3E3VA 7ESTE 3FAOA 4CR5A 1VJ9U 1O35A 5JHUA 4Q4LA 2JETB 2HQNA 3R3GB 3T8TA 4Y7NJ 1RZ4A 1YJWI 1ZQ3P 4NSVA 1WUNH 1F0TA 1ZG1A 1XCBA 3VSLA 1XUGA 4RSPA 4I0BA 3S2HJ 1FOWA 3E6DA 2QF7A 2BOLA 4CHAB 3CS7A 4ACBA 2LK2A 1WJCA 4WMDA 1R22A 2K4JA 3FDYA 3LONA 2MW8A 3HRMA 3I59B 1GLNA 3Q5FA 5EODA 2Y0SN 3PQKA 1XGOA 1KYWA 1A36A 5GIBA 2CHAC 3GZ5A 1MKXK 3LH1A 5E17F 3VGCC 1FBSA 1SGEE 4I98B 5E2PA 4U32A 1P92A 4LD5A 1D5VA 3PL8A 2Q2EA 3UB0A 2GMTC 1ABJH 4ZKRU 1P9SA 2BM2A 4H0EA 3U8OH 2VIDA 2GLOA 4XLEA 1G2HA 1N8OC 3G1OA 3MMGA 1L2EA 2YNAA 2E1CA 1N25A 5A2MH 3ZQGA 3MKZA 3E3TA 1HUTH 1IRZA 4MNYA 4A7IB 1OYIA 1TNTA 3MU5A 4PSXA 2QIQA 1DY9A 1FP2A 4KT5C 1CQQA 1QL9A 3TKYA 2XPVA 4E7IA 3UTUH 1EV7A 1GDQA 2AGIX 3MH6A 1E2XA 2DDBA 4AYBA 1UVUH 3GCNA 1Z7KA 3V4GA 2Y48A 2ZHWH 5LBQA 1FONA 1MH0A 2W7SA 2D5VA 2ZTZA 3SGAE 4K1TA 1QBNA 2C90B 5FLMJ 1V2NT 3M61U 4ZH4F 6CHAC 4Z6YA 1YCPH 2O03A 3TH2H 3ECHA 2E19A 4CRCA 2JA6J 2NXNB 1DU6A 2LG4A 4IX7A 5TCAA 1ANCA 1LVBA 2ANKH 2WSSD 4Q4ZF 2KCAA 2BZAA 5E1WA 1H0MA 4AM3A 2TCTA 1UAAA 2HNHA 4AVPA 4ACAA 2GIVA 1Y5AT 2Z9GA 5DP6A 1V2WT 1UHBB 1OPCA 2W4SA 4O6JA 4I09A 3U1IB 4BUPA 2V7FA 2OA4A 1O3LA 1T8LA 1BC7C 2BW3A 2W5EA 6ESTA 1FIAA 1S85A 2FMYA 2DO7A 1T33A 2BHYA 3CMMA 3L2CA 2TGPZ 4OINF 2VWMA 2VGCC 1L1NA 2X6WA 1DXPA 2X6XA 4C3IJ 2YS9A 4DBRA 1GDUA 2Z7FE 3SU2A 1FAXA 1O2RA 2X51A 1Q1VA 4INHA 4FETA 4WK8F 1ZKGA 3Q0VA 2Z99A 2ELKA 4RLFA 5J47A 2XRLA 1KQ9A 1QA0A 3ZYDA 4XRNA 2ZGXH 4AYBN 2QCYA 5LGTA 3P8OA 4FE4A 2QYOA 1YIJI 5L2YH 2WY7Q 5E0HA 2HXIA 4C2MJ 1OYQA 3BTCA 4G7HF 3LGIA 3LFKA 4C3HJ 1O36A 2SGAA 3ASNH 2IA1A 1ETQA 3CMEI 1YWUA 1E34B 5ETXA 4B47A 4BYYA 1TABE 1TE0A 3MAJA 2DPUA 2A69F 1O31A 2ZNZA 2A61A 5DUKA 3B6AA 1GBMA 2VOOA 1BB0B 1IZ1A 1QCPA 4M9ZA 1Y0NA 1SD5A 1JKOC 3LSJA 2JUCA 1D0YA 3OFND 4FUEA 3QDZB 2P5LC 2GOXB 2P59A 4XR6A 3HDDA 4ISOA 3UY9A 4C30A 5BNGA 2JJ2D 1LDDA 3K1MA 2BLOA 4HX4A 4EGZA 1Z7UA 1LUJB 2XF5A 2EA3A 4PFPA 5CQGA 2LY2A 1XUFA 4JK6A 1IN4A 3S17J 1TWCJ 3AAVA 1X4OA 4ZXYH 3EGKH 1QJ6B 2PWXA 2RDEA 5JFRA 2VC1A 5HS7A 2G5NA 2ZTYA 3VXEH 8ESTE 1I6XA 4UV8A 3FKJA 3K4JA 5EGOA 4EM1A 3BG6A 5AF9H 1VQPI 3RMMH 4MPVA 2JTVA 2R7VA 3BLYA 2NVQJ 1ENHA 3FMQA 4RT0A 5EPNA 3SNCA 3CQZJ 3SZGA 4Y13A 1MBGA 1UMAH 2VONA 3M8FA 3VG8A 4BJ6C 5D8KB 5ERIA 2W6ID 3E8LA 4NA7A 1TT0A 1AB9C 2OV7A 3EA8A 3HZJA 2ZFSA 2HKXA 4XKCA 3CJNA 3KEEA 1G2MA 2ZHEH 3HGNA 2CF9H 1GMHF 3O8HA 2M0MA 5FKMA 1MU8B 2HNTE 2ANWA 2LOOA 4OAZA 3RXUA 1CBWC 2ZCKP 2FMJA 3TW7A 2XXLA 2TPIZ 2CV0A 2BDYA 5E1XA 1SGIB 2M9HA 4UVBA 1MSEC 1GHAG 4GDFA 3GY4A 2FD5A 3PIOF 4L5IA 1FSEA 2YX4A 2ZPRA 1WBGB 4ESFA 3DSGA 1W36D 1NU9A 2F4OB 1P04A 4EJVA 4RAGA 1DQUA 1ZTRA 2XAGA 2WPHS 3I4NJ 1J7KA 1RRKA 1AU7A 3HXLA 5EEAA 3CCSI 1SOTA 2EFPA 4EM0B 1TGSZ 2CFXA 3N7OA 4I6ZA 1FNIA 2F5CA 2FDAA 4J19A 3ZQLA 4AFUA 3BSQA 4NIYA 1WPKA 2Q6FA 1SL3A 1LHGH 1HF0A 3P92A 3F9FA 3VPKA 1HQCA 3MI4A 1ZLJA 1H9HE 1Y5BT 4ISNA 1FXYA 2ACJA 4Y6DA 4HSRA 5HLIA 1YLCA 2VT3A 2ZXHA 2G4UA 1BOAA 2FBHA 3TH4H 3SGQE 1K22H 1RS0A 2VASA 1EKEA 1GXPA 2LBFA 3W2VA 3DLLF 5ESTE 1X1PA 3BR2A 3PUFA 3S0NA 2PKAB 2BGCA 1C5VA 3DBRB 3QOEA 3DU6A 3G2BA 3MO9A 2FX4A 2Y9ZA 2WHXA 1YHQI 1BRBE 3N4MA 2EFQA 4DJAA 1W5SA 2P95A 1K1LA 2D26C 1FJLA 1P3EA 3DXJF 1DGRM 3SORA 3PB1E 3GMEA 3NQOA 5F0HA 1YO5C 1AVGH 1STZA 4BDZA 2A4OA 4X6OA 1NFXA 3H92A 1ZYRF 3KYCB 2J9NA 2ZDMA 4OGXA 3RXSA 3CMYA 3RXDA 4UONA 1B5GH 3MU1A 1O2JA 3ATMA 4NZQA 2Y69H 2Y0MA 2NS0A 2GBYA 1ODDA 3ZQCA 3ELKA 2PGQB 2IS6A 1SFQB 4DGWB 3TITA 1W7PD 2ELJA 3GFJA 3K6GA 1YG2A 4B73A 5GAGJ 4A93J 4RN6A 2NS8A 3KZIC 2QSGX 4F55A 2K27A 1FTZA 2V0BA 3MNSA 3RXJA 1IV8A 1THPB 1E0FD 3Q77A 1IQLA 1O37A 1XX5A 2BD5A 3F8NA 4XN0A 2H6CA 1PPFE 4JZ1A 3QYBA 4B43A 2ZU3A 1PYTD 1ZREA 3T29A 4OIPF 1OWIA 4A0XA 4WMFA 4HDUA 1XUHA 1GG6B 1D6WA 1GJ6A 1MAXA 3B23B 4XL9A 7GCHG 2ZO4A 1A0LA 4NFEA 4JYUH 3LC3A 4BHPA 5H6RA 4ABAA 1D3TB 5PTPA 1Y5UT 1SC7A 1Z21A 3KF2A 2V1XA 3QOPA 2R5YA 4FT8A 2WV4A 1X19A 2AQEA 2DA2A 1ELTA 1O3IA 1JGGA 3I4MJ 2JA2A 4LMYA 4Z1MD 3RM2H 1KLTA 4NA8A 3TP0A 1O2TA 2VBYA 4B1TA 4Y76A 4YRVA 5FBEA 4X2XA 1W10U 5JB9S 4CCKA 1H9TA 2YMSD 4M73A 4KMUX 1W0JD 1T31A 5E2OA 2K7LA 5DUIA 3AL0B 4AN7A 1SMYF 3DPUA 2M5TA 3BQZA 1FOKA 3RZOJ 4FU8A 1D6RA 4X2YA 4Y71A 3QGNB 4EGYA 1TNJA 3SBKA 1DY8A 2MABA 3IL2A 1U5TA 3GFLA 1BZXE 5TRDA 3S3OA 4N9IA 3PTNA 3V7SA 1Z8RA 4MQ9F 1O34A 4BTUB 3G4SI 1C2JA 3HRSA 2HOEA 3VXFH 2ANYA 1WU1A 4HV6A 2ZHQH 3DKXA 2M3AA 3SJOA 4Z0KA 4TSFD 5C20A 1X3UA 1T8NA 3LC5A 1D5YA 2OZ6A 1PUEE 1NRSH 2QF5A 1MJ9A 2BW3B 2KLOA 5BS6A 2HVYB 1HAVA 5FKOA 1E17A 2KCYA 1SHHB 1AFEH 2EQNA 2AIQA 2IEKA 1QVTA 2Z2SB 3OS0A 3E0JB 3TO7A 1FPQA 1COWD 3DQVC 5AHGH 3PROA 1HKQA 3KP7A 2OD3B 1S84A 1D3PB 4LFUA 2R4GA 1O2XA 2H09A 2B9SA 3WY8A 4Q2KA 2BEOA 3S9AA 2CV1A 2BY5X 2ZGJA 2C8XB 1TQMA 3STJA 4B6EA 1GMCG 5J1YA 2GKVE 3R61A 2H2ZA 1V2RT 1GVZA 4K2EA 1E3HA 1IRXA 1W7XH 1U2WA 4HF2A 1BR2A 1OCCH 6PAXA 2ISYA 2WB1A 4D7NA 3PNVA 1J75A 1SGFA 1MJBA 4EJOA 3KZZA 1ZG3A 4XIDA 1FN8A 2HTSA 4B44A 2V1DA 3ZQ7A 4OOIA 4CA0A 1IV6A 5HIZA 3KLNA 2ESHA 2AYWA 3JSPA 5FXLA 2Y5FA 2CGPA 3TMOA 2V7QD 1MNMC 1S72I 2O8XA 1IAWA 1UTMA 1FOYA 3KP4A 1VI0A 1XDSA 4IPAA 2QF3A 1DITH 2L01A 3A01A 5L2ZH 2L4MA 3Q3SA 5B5EC 5EEGA 4GXOA 3S1MJ 4XLNF 3ZZ8A 2KCPA 3QP6A 2HI3A 3BCBA 2A0QB 3PYHA 1BOBA 5GAHJ 4YOGA 4BANB 1ZG5A 5IP7J 3HUGB 1C1NA 5E3NA 1Z77A 4UFGH 1CT2E 5E0GA 1R5HA 2J34A 3QUMP 3W95A 3ZOBA 1P7JA 3AG4H 1W5TA 3KCCA 3U9AH 2E7XA 2IXSA 4G8XA 3U28C 2QENA 2WAQA 5L3FA 2OINA 3H0GJ 3WTVC 5J3LA 4F91B 1PUFB 3M1EA 5F1RA 1OSSA 1YPHE 1P01A 1O5FH 2WB1N 2ZSHB 2Y5HA 1O3SA 4BQQA 1A6IA 3MMYB 2NNYA 1C5YB 1LVOA 3LIWA 4RB2C 2C8YB 2BD3A 4I33A 3SZTA 3HHGA 3FIWA 2A5IA 3FXLA 3J7YJ 4UB6C 3MH7A 3RYRA 4X6AJ 3PNYA 3IWMA 4ZKOU 1GV5A 2J98B 2BY1A 3NK8A 2VIVA 1AKHA 2JT1A 2F4LA 2BYVE 5B1BH 3L2UA 2UUKB 3I77A 2E2HJ 4R8HA 1AHDP 3RSNA 1VR1H 2PTCE 2CH0A 2IW5A 1O2ZA 5A0BA 3H5NA 1HIAA 1ELDE 2LTPA 1R1VA 4JZFH 1D3DB 1AMHA 3NRVA 1HCRA 3IH2A 2P4WA 3LGVA 2BY2A 3VYSB 3TK9A 2PFEA 1GUUA 1SFEA 3NKKA 5ICCA 1LCYA 2IJLA 1O3QA 3N05A 1IDZA 2YNBA 2PKSB 2VH6A 2MYSA 3D0SA 1U0JA 1DT2A 2VVVA 2QQ8A 3V3MA 2WAQN 1FX7A 1Z9CA 2L7ZA 4JX6A 1FV9A 3FP8E 4BXSA 1JKRC 1TX8A 3OY5U 1XMXA 1Y59T 1NO9H 3F22A 1A46H 2LF8A 5M3MJ 1ZRBA 4FOUC 1UK3A 1BMAA 2XTTB 3TGNA 4PSWA 3S15J 1EZQA 3D62A 2W85A 3IITA 3A4CA 1RUNA 5FLXK 1ZR0A 3PJRA 2GOMA 2LBFB 3SQEE 1HB0B 1HRTH 1Y3WA 1UJ1A 3UREA 3HKJB 4BAYA 4OS6A 2GCTC 1GJ9B 3Q3XA 4RKOB 3NPSA 5JBAS 1EXFA 5T6DA 1OFCX 3DFGA 1GVDA 1SD4A 5E8EH 2CW0F 1XGMA 1P12E 1QPMA 3ZP5A 4A3MJ 2W84A 2P93A 4BS9A 5E18F 5LPRA 1O2PA 1MJAA 1CHGA 3GTKJ 4WVPE 3P7NA 1K83J 4S0HB 4FVBA 1I1GA 1SFKA 3E6BA 1BL0A 2ZJRF 2FF4A 2ZFRH 1YY3A 4ZJZA 2BTCE 3H7OA 5HDGA 2DAOA 3OEED 1K4SA 1ZH5A 1KXCA 4E7NA 2ZFPH 1BIAA 1FEXA 1O3GA 2BV6A 3TK5A 4FUGA 4AZ2B 4B48A 1CHOG 4DOZA 4DIIH 2ZKZA 2QGRA 4PCQA 1CA8B 2F9PA 4D0PA 1N6XA 3EUAA 4F49A 1IG7A 3P8FA 2LFBA 1NRQH 3ATIA 3W2WA 4X6PA 4ZUHA 1GHBF 1TQ7B 5IP9J 1QJ1B 1B72A 3WTUC 2QA4I 2RCEA 2AMDA 1YGCH 2DTZA 3RLYH 4FU9A 3RPQA 3CESA 3S3NA 2HALA 1QZZA 1IHSH 3KEOA 1OCTC 1Z91A 3FO8D 5EU8A 3RQIA 2H6BA 1O3TA 4RB3C 4A3KJ 4NFFA 1OWJA 1C2MA 1O39A 4X1QU 1X3WB 2QXGA 1N1LA 6GCHG 4J1YA 3ERED 3B6CA 2Z9JA 3EPZA 4H6TA 2RGVA 2DJIA 2C8WB 4U0WA 2AERH 3IV5A 5BMZA 5D8LB 1AO5A 4RLQA 4Y10E 4X2VA 3F1SB 1ORFA 1GHCA 2GTBA 1PPZA 4JYVH 5GP9A 1O2NA 1EZXC 2M2AA 3BPXA 3M9AA 4FUCA 1J17T 3CENA 4Y8ZA 5E1ZB 1LE8B 4ASHA 3RKQA 5JR3A 1DICA 1EKBB 3S2WA 3E1XB 1SGDE 2A4GA 2Z5UA 3N7DA 3HOVJ 2MA3A 4J2YB 4BQNA 2OQUA 2A2QH 1U5TB 3UNSA 5J40A 2HPMA 5DCFA 5KECA 4M7GA 3VDXA 3V8LA 1NK3P 1UCYH 3KLOA 3DPTA 3HOUJ 1F1ZA 1SGCA 2WAFA 1C1VH 3BEUA 4FUDA 1KU7A 3ML6A 3RP2A 1MZAA 1O2IA 1ABIH 2Y75A 1K6YA 1XC5A 2KIQA 2IJD1 2NOJB 4HX8A 2AIPA 1AFQB 2BVSH 1OWEA 1FZZA 1L4ZA 4B71A 4ISLA 2R3UA 3MTYA 1FBQA 1HW1A 5FRMA 3Q3YA 5L6NH 4ENMA 4RI0A 3JZ1B 2IOTA 5GCHG 1S7OA 4UY8I 5J4SA 2QKLB 1LPZB 3I53A 2PLYA 2HOBA 3CCUI 1X3ZB 2LY9A 3O6BB 3ECOA 2F83A 3IWZA 2HRVA 4WCGA 1HAVB 2H9EH 2R9PA 3ERMA 1P9UA 4AFZA 2EI7A 3BZCA 2E7WA 1ORKA 2WPIS 1HJAB 1P2QA 2EZHA 1SGQE 1GI4A 4KKDA 2M5WA 2E35A 2PMUA 1P4AA 2PW8H 2ZB9A 3ENSB 2BVRH 1BBRK 1YE9A 1ZARA 2QQBA 1RKTA 1THRH 2VBWA 3BZKA 2DE8A 3OYFA 1JUPA 3L09A 2EI8A 4KICA 1VITF 1XSVA 4M9SA 1VQOI 2XC5A 5D6EA 2FTMA 2DOAA 4MGRA 3A83A 4DJZB 1KYNA 1GBHA 4I99C 5E3MA 3CP7A 4JQFA 4G9YA 1IXSB 2JH6D 4IQJA 1TWHJ 4PJLA 4E7KA 1NC6A 3CNRA 4I7HA 4CR9A 1Z3YA 1Z1IA 3M8EA 3U2RA 1VF9A 4FX0A 5A2QZ 1EZSC 1AWFH 3NUMA 1SANA 4CYCA 1GJ4H 1E38B 3HRTA 2GM4A 5E3OA 2OD5A 1AZZA 1ELAA 1D1BA 1SGNE 2M2EA 4GGGA 1TAWA 3IAS2 3VB2A 4DURA 1Z67A 2O3FA 1Z8GA 4MEYF 1GCTB 3ISPA 1DXWA 1ANBA 1R9TJ 5LEJA 2ULLA 3A01B 3M3SA 3OY9A 1BN5A 4GSOA 3RMLH 3QPHA 3TNTA 1J9CH 2D45A 3H9JA 2A68F 4IHYA 2UUFB 1KLIH 4XRSA 4BEHA 4L18B 1WQSA 2AMQA 3UFAA 1P8VC 3VYTB 2WPLS 1M1EB 4FUHA 3NXPA 4XBBA 2DFHA 1TLHB 4D5FA 1H89C 8GCHF 4UB8C 5LRRA 2E1MB 1OR7C 3W3CA 2A2XH 4BACA 1Q1HA 1J5YA 3RC4A 3SHCH 1UVPA 2AQFA 3FX3A 3MWIU 1F0SA 3GY8A 1YI2I 1LHFH 4OIRF 1MCTA 1SFIA 4A3JJ 2QN5T 4NG9H 4BL0B 1R58A 1SGFG 3K70C 1HAIH 2AFQB 3QTVH 1XN7A 2HGTH 2QLZA 4I01A 5EW2H 4INKA 2V6EA 3QAHA 4GLYA 4I2OA 3RXTA 3ZMTA 3GDSA 2E1OA 4R1HA 3LT3A 3RU4E 3S9CA 1FQ3A 1TC3C 3BG9A 1AKHB 3I56I 2V6NA 4UVCA 1OS8A 1PPEE 2HGCA 4BAHB 2K8IA 4RM3A 1HOMA 1OJLA 3NCLA 1TQ0B 2VQCA 1GJ7B 3CCEI 2K4BA 1O5GH 1HIAB 4AC0A 1OCOH 3LGWA 2P16A 1TWAJ 4Y33A 4KMFA 2EFNA 3OS2A 2M1BA 2PN6A 4UFFH 3NAUA 4U0YA 5DP4A 4ESBA 1K78A 3ZZ3A 3G01A 2B0LA 1I39A 2RA0A 4M3EA 1D1AA 3JRCA 3TK6A 2DI3A 2HKOA 4RAFA 2ZCLP 2HS5A 1GBTA 3VGCB 2HOTA 4HYEA 1TRMA 2JMWA 4IVNA 2HWVA 1TPOA 5EGMA 4AWXB 2XBXA 2V3MA 3SI3H 4C2TA 1FSHA 8KME2 1N8OB 1WJBA 4XRFA 2ZU5A 1OCPA 2VXZA 5J4QA 3SDBA 1YPJH 1NK2P 4X1EA 1R00A 1F5KU 3BR1A 4M6XA 1OYYA 4HPQA 1AWCA 1GMDG 3CP2A 3U21A 2ZCWA 1AZ8A 1XD7A 5K7HA 3ZVBA 1JHHA 1IW7F 2QKMB 4MDSA 1SC8U 4ZTJA 2V1UA 5C0TA 1YPEH 5DP9A 2AXLA 5A2QK 3VB5A 2EWNA 3PSIA 4P96A 4K5ZA 1BTXA 4HQEA 6CHAB 1PYVA 2F4MB 3JRFA 4HRIA 4BKXA 1TQPA 1C5XB 3TP3A 1U9OA 5FD6A 3F2GA 1KTTB 1WV7H 1ZSKA 3W1EA 2ZZUH 3T28A 2BOHB 3OWTA 2VIXA 4TT3D 2WPDD 3RZDJ 1T56A 2X1CA 4OMYA 1T4UH 2W6JD 4HG2A 2ZDKA 2ZFQH 1KXAA 1HYLA 2QV1A 5J8CA 2JH5D 2V26A 1T39A 4UD9H 3SUGA 3ATKA 2OF7A 1JKPC 2G55A 2VJJA 4IO9F 5DYMA 3LJJA 2LH9A 5DK1A 1NG7A 3GFMA 4HGCA 1GCDA 1W5CC 1DFPA 4H4FA 1KGSA 2VGCB 5E20A 4FU7A 1UTQA 1E3PA 2Z9IA 4E70A 3EE7A 3NZIA 4IXAA 1XMKA 3WG9A 3QYFA 3E0NB 2ZMEB 1RIOH 2XAHA 1KSNA 3K4CA 2KR7A 2AS5F 3CCVI 1O3BA 4D7MA 3W2AA 2RNGA 3IAM2 3D5RC 5GPIB 4EV0A 1P7IA 3VEPA 1JIRA 5F8TA 3PFYA 1CE5A 2B5TB 4YLQH 2A5KA 3K6ZA 2SNVA 3UNRA 3H1CA 1A5HA 1LEBA 1C2IA 3GCTF 1DP3A 4AG2A 2FXAA 1TBXA 1SEUA 4X0WU 3QWLA 5SGAE 5EXNA 1ULYA 1ANEA 3KYLA 1BTUA 2R3SA 2I10A 3OYLA 3WTTC 1W3CA 3ZVFA 4YXWD 3CUQC 4DYRA 5GTIC 1I6HJ 1O5BB 5KGOA 5FPYA 2KP6A 3P95A 3RM0H 3K0LA 1I27A 1QFKH 1BRAA 2VVCA 1UTJA 4B09A 1T95A 3KEYA 2HOAA 2QY0B 1W7PA 2FOAA 1CQTA 5CVVA 4IQ4A 3LQRA 3GY3A 2K9MA 1OCZH 1C5ZB 4O3UA 1QZEA 3RPUA 2O6GE 2HQAA 1BI1A 2EIMH 4EM2A 3C18A 4KISA 1UVOA 4ISHH 2ME0A 2JA8J 1E79D 2GDDA 1VGCC 1JGSA 1GVJA 1X2MA 3RKWA 3IRQA 1YLFA 3WHCA 2XF7A 3L2VA 3E90B 2FRHA 3ABKH 1FPCH 3KGPA 1MZBA 3OYAA 1KQ8A 2JJ1D 2DQRA 1WCZA 4N4NB 1ETYA 1BMLA 3MU4A 1X1BA 3SDGA 2AEIH 3CCYA 3M7QA 1ZK8A 5F64A 1OLTA 2L7MP 5L3BA 2L3DA 3RXMA 4I8HA 1QU3A 2ZG0H 2E71A 1YFHA 2DCEA 4MTBA 2XRCA 4NIVA 2VKDA 4G7OF 3GCHB 4ZYHA 5A8YA 4JZDH 3GOVB 1C5PA 4F3QA 5KK1A 1UELB 1MKXH 3KIOA 4GPGA 1AU8A 1EFRD 1FTTA 4XICA 3TJUA 3TLOA 1GGDC 4ZYAA 1TIOA 4P5OA 3E6CC 4HZHA 2ZJQF 1FIWA 1P09A 4LJZF 4FCYA 1MBEA 1L0ZA 4ZMAH 1JIMA 4CH7A 4FXGH 2EZLA 1RIWB 1B8IA 4MTEA 3P8NA 3HHHA 2XBVA 3PMAB 2IA2A 1Y8TA 5EQQA 1WAYB 3OR2C 3E1SA 3MEXA 2L6OA 1VQ8I 3ITIA 4XE4A 3UIRA 5C2ZA 3ESTA 4HSTA 1RUOA 2IP2A 2L9SA 1AI8H 2XV4S 1GBAA 2FYRA 5DEQA 1IF1A 1P3CA 4ABGA 4FUFA 4I7YH 2AXTC 4ZAEA 2EZIA 2B7EA 3LNQA 1EATA 1AIXH 5A09A 5IYDJ 1FBUA 4HEA2 1K61A 1C5SA 3HB9A 4XOJA 1BR1A 1UVTH 3FFGA 1NG6A 2ZA5A 5AONA 4G6DA 4CRDA 3NWSA 1XVMA 4IRHA 5L3GA 1KQ0A 1NN6A 3O2PE 1A61H 1WJEA 3GYMA 2HVRA 1EJNA 3BTHE 3IP4B 1PFXC 2KFDA 3K6YA 3ZVDA 2H8RA 5LHHA 2ZNYA 1BI3A 2M7BA 2XYAA 1DSUA 2DT5A 5J1RA 4G12A 3PO1C 1GJ5H 3CCJI 1T8OA 2KRFA 1ZGIA 3MN2A 1ZELA 3V8KA 1O3OA 2XBYA 2GCHF 4XLCA 5HDKA 2FMLA 1O3PB 3KQ5A 9LPRA 1A5JA 3SXYA 3SN8A 5LGNA 1ELBA 4YOIA 1C2HA 3H7TA 1NBME 4WXHA 3U8RH 5BOXA 1ZMLA 5KNLA 1LFBA 2O8UA 2RDLA 2ESTE 3DF8A 2E34A 2BXTH 1MBHA 1GI0A 3QO6A 2C8ZB 1MH3A 3F8BA 3MWMA 2J94A 2EB7A 1VNDA 4INLA 1HV7A 4MLOA 2HQ5A 2ISZA 5EYRA 3FMSA 1V2JT 1HAXB 5CVRA 1SVLA 3WTSC 3FXQA 1TX6A 3TGIE 2OZUA 2ODPA 4TV7A 4JBAA 4K2YA 4XRSG 4QTRA 2B63J 2H6MA 2JZYA 1AUTC 3MNCA 2P8OB 2C4FH 2GGVB 2KJBA 1UHSA 2FBKA 2ZEBA 1AVXA 2ZQ2A 1KXBA 2NNNA 4LK4A 3DTKA 1EOLA 2RA3A 1ZHFA 1V2ST 1DLKB 1EP6A 1RR7A 3BWGA 1F5LA 1B6AA 4BTTB 1ZTJA 2BQ6B 4M3DA 3A84A 5HM9A 1QL8A 1YS7A 1XKBC 1O38A 2B0FA 1XXDA 2A5YB 4A3LJ 3CCLI 1V4RA 1K2I1 1MGTA 1CF7B 4KNYA 2DQLA 4LK1F 3FXRA 2DODA 1K7AA 1EJ9A 3EQ0H 1DANH 2CV2A 1FUJA 1V2OT 4AFSA 1LHDH 3M36A 2BY6X 2DA4A 1J14A 4NCYA 1FY8E 1TMUH 3SJIA 3G71I 1SOZA 4UHTA 4NHJA 1MMNA 2PEXA 1K1IA 1GMHG 2XF6A 1O5DH 3O8DA 2WTEA 1FNNA 5FD5A 4K69A 5FPTA 1AA7A 1OKXA 4LG0B 4D8NA 2CU7A 3CO6C 3WGHA 4EJTA 3LMMA 5F8ZA 3LOCA 3ZPLA 2XROA 3S8PA 3KQCA 4EJWA 1T6SA 1KA8A 3FK6A 4RS8A 1OP2A 3B02A 3BR5A 4WXCA 4CCNA 3WWBA 2STTA 2FPZA 3H09A 2VODA 1S6HA 3UQOA 2HNTF 3R4KA 1JUMA 3WTZA 1SSXA 4UUSA 1DWCH 2MG4A 2DA5A 2O8LA 5B6LA 2BDBA 3SUDA 4B6FA 1O3JA 2FEQH 4F93B 2NVXJ 3I78A 1ELFA 2YR2A 2QEXI 3DCLA 5D5WB 2P94A 3DCFA 4BQOA 1S5SA 3WODF 2CXVA 2F5EA 5DKMA 3LA7A 3HRUA 3I29A 4DGJA 3BG8A 3URDA 2HLDD 1ZR2A 4M3BA 1GHXH 1TLDA 1TX7A 3WE2A 1MU6B 1A7SA 3MD2A 1MTNC 3PV2A 3AFHA 1UG0A 2VIPA 1UCRA 4I8LA 4XLPF 4MFEA 2A32A 3HM5A 1IXRC 3MKYB 3C1KA 3ZVEA 2XC7A 3OYBA 3ZYEA 3GXOA 3F6UH 3KYDB 2LVSA 2QE7D 3KQDA 2W3KA 3RJPA 3M8JA 2DPDA 2H5DA 1F4KA 4LIUA 1XDUA 2R7OA 3OOPA 5ILSA 4HI3A 1F0RA 2NWNA 4X2WA 6LPRA 1YPLH 1SFXA 1CA0C 2H5CA 3UR3C 2EJRA 1DUXC 4PJMA 5IDKA 2FYQA 1QY6A 1G8XA 4H42U 3F0OA 2ZGCA 3QWCH 2IS4A 1MMGA 4BXUA 2XC4A 3OTJE 4TPYA 3U69H 3F8MA 1ZGWA 4X8VH 4LB5A 3GY2A 2XGDA 1C1SA 4IOCF 2XAJA 3P6ZB 1RNLA 2DA6A 3E5XA 5J1UA 3AW0A 1SLWB 3BY6A 1LDJA 5DJ7A 4AD9A 2ZFFH 3MHWU 2V35A 3LGUA 5F0FA 4TWWA 2BE5F 4Y52J 2B8OH 2R7XA 1LVMA 1YM0A 1W7PB 1DM4B 1E0EA 4EEFG 1VQKI 3ABTA 2G51A 3K10A 1AD8H 1F43A 5JBTA 4LXBH 1K21H 3M1CA 3KQBA 4HV5A 3SEQA 1EB2A 2J38A 2BQ7B 1A1RA 2FJ1A 1USTA 3K69A 3RMOH 1XUJA 1ARBA 1OR7A 3CLOA 2HYGD 2MSYA 4CCOA 1JMOH 1YYVA 1F7ZA 2BD9A 2R5ZB 4P02A 1AWHB 1AY6H 4TY6A 2JIZD 1JI8A 3OYHA 3KEQA 2R7UA 1HKTA 2CMPA 2HNTC 3FP7E 2L7FP 5KCMA 5I46H 3M07A 4KIBA 2YU9J 5C17A 5FHTA 3T27A 4UFEH 5CMXH 9ESTA 3SQNA 1SLVB 4LG3A 4NB5A 1T98A 2RQPA 4MLFB 3S7KB 2OCCH 3OU0A 3HKZA 3BV9B 1N75A 3PRDA 3DTIA 2RREA 4TWYA 4U2WA 2X0LA 4ZKSU 3ONQA 1BMNH 1K28D 3DFLA 2FE3A 4MQVA 4ABDA 2OJED 5F08A 2YMSB 4SGBE 1FY5A 2UXNA 5GDSH 2A7HA 2GV6A 4NWKA 1TYNA 3VWBA 3MOCA 2Z94A 4YT7H 3J81Z 3STIA 3H3UA 1XGNA 1OX1A 1RTFB 2EZKA 2A07F 4YO9A 4Q7XA 1LDTT 3Q9VA 5F8XA 2ZGHA 2Z3DA 2VL8A 4ANJA 2FXRA 1P2OA 3BPVA 2KIMA 2VQGA 1BTHH 1AN1E 2TDXA 1LTOA 4XKBA 2HQRA 4IMQA 3JRHA 1G2LA 4HZFA 2VN2A 4EQQA 2G0EA 5T1VA 1QIXB 2BD4A 4Q63A 3A8DA 3KETA 1V5EA 2STAE 3MNXA 4VGCB 2YX7A 1WI3A 4FUBA 1NROH 4R0IA 1EASA 2O8TA 2XPWA 1MW7A 1AUJA 3HKZN 3GTJJ 3EA7A 4DT4A 1TA6A 2CMYA 1CO7E 1TL8A 5GPCA 4N9HA 4K60A 3JRBA 2O8MA 1R49A 3WWFA 1V2KT 1S81A 1V5GA 2VWNA 1CGPA 2ZXWH 2QYIA 2MLGA 2E2IJ 1H8HD 1QHGA 1I50J 3WE3A 4ZHAA 3IHUA 3JRGA 1FY4A 2RQQA 1IQMA 4JMYA 5HYOA 1X1AA 5HGGA 1AOYA 1UK4A 1F5RA 3PLBA 3K4KA 5IT9Z 1FYLA 4DZJA 1ZGVA 3MZ8A 1QQ4A 3KPHA 1KZHA 4ZCNA 1S6FA 1FI8A 3VOEA 5FKKA 3LSPA 4HTCH 1WZ2A 2NVTJ 1ZLKA 3TPIZ 3WTWC 1J8AA 4BAQB 3T1BA 5FO5A 4NQWA 1ZRKA 1JKQC 1PQ7A 3P9IA 5KEDA 2KT0A 3HOXJ 1UW7A 1T08B 1OCRH 2ZU2A 3EYDA 3TBIA 2MH9A 3VYUB 2GDEH 2BLVA 2W7UA 2HR3A 3BEIB 3QP5A 3P70B 2HDWA 1N78A 1DS2E 2W82A 3SU1A 2ZTXA 3O3KA 2JJ7A 1A5IA 2BDGA 3DA9B 4K3JA 1GWAA 1TGNA 3CTAA 5DTDA 4OAYA 4AIKA 5FKNA 3HKIB 3TOAA 4CGZA 5B6OA 1SVPA 3KP6A 2HTJA 5ILUA 1BBYA 2O7OA 1UHWA 3T0YA 2ECCA 1F5TA 2RN7A 3GYHX 4ESJA 2R7DA 1S3JA 3OIQA 5A0AE 4BDYA 3UQVA 4IBLH 5GNDA 4HNTA 1O2WA 2KISA 1ETVA 3FZVA 3F9GA 2K40A 1O2GH 4RAYA 3PIPF 1ZTLA 5JBCS 3AKZA 2YPRA 2PJRA 3AL0C 3V7TA 3RXGA 3S1NJ 3MU0A 3BTEE 1DX5M 5ABWA 1BC8C 3GCMA 5ICGA 3HATH 2GQQA 1U6GA 3QU6A 3A7VA 1FY3A 3IG6B 3CUQA 5JPMH 4OM9A 3EQLF 2PBIA 4AIDA 3F8CA 4YELA 4OIOF 4YT6H 3V12A 4ZC3A 4YOJA 2FI4E 2FOBA 1A04A 4L9JA 3OSGA 2B7DH 1ZAOA 1BJZA 2DFFA 1M9UA 2XWAA 5H2FC 1HA8A 1G36A 2FOFA 1PQAA 5K5OA 2AMPA 4JYTA 1LPQA 1WOFA 3JSOA 2D1HA 2GJGA 1BIBA 2L9RA 3R0FA 4AIHA 1C1WH 1JE8A 5EQRA 1H9GA 3MO6A 1LQ1A 2DK8A 1IQNA 3JTHA 3FVFB 3GTGJ 2CQQA 1Q2WA 2DT7B 4D1QA 1RD3B 2BZ6H 2UZKA 2ZC2A 4PJNA 4KN7X 4A5TS 3RXQA 2FUG2 2EIKH 2FA5A 3HPGA 1SAXA 2SNWA 3MZHA 1LKBA 3SJ9A 1LPKB 3I64A 4B3XA 1N6YA 3SO3A 4IRGA 3C3WA 4BE1A 3GTPJ 2M0CA 1L3LA 1J15A 2K02A 2Z1DA 4CCJA 4QWQA 5EG0A 3OYEA 3A87A 1EJMA 2OUAA 2ZFWA 4C2UA 2BY7X 4U01A 3FZDA 4IN2A 4E7HA 2I8DA 4AFQA 4YLUA 1QQIA 3SYTA 1O32A 3PFIA 2HVXA 3K2AA 1WI9A 3P9CA 2VPLA 2Y6TA 3LA2A 4Y7AA 5IT9K 5D5XB 4XBDA 1KU9A 3I9V2 5B1AH 3T5XA 3PO2J 4E4HA 2M45A 2GZ7A 1PPCE 1E3OC 2R2MB 1EP5A 4RMNA 3L9FA 2MGQA 2F4IA 1EZUC 2ILNA 5FROA 2L2OA 3BEFB 4B76A 1C2FA 5FJ8J 4CHUA 3D5LA 3NWTA 2X1EA 2AS9A 2V79A 3DU5A 2X6OA 1SD6A 2QA9E 3DT0H 4BTIB 2D2WA 1H88C 2Z3EA 2F5VA 4OS5A 4MVNA 4HOBA 3QN7A 3E7LA 1C2EA 3RKXA 1T8MA 4NGAH 1G3BA 3BJOA 3EUHC 2OTJI 4HX7A 3H9GA 1MBJA 3LSIA 1UTNA 2VJ5A 1R6RA 3P5JA 2ME6A 3DEWA 1GBFA 2Z3YA 2MFZA 1L1JA 1ZMNA 3D1NI 2JPBA 4UDWH 4BAOB 4Y15A 2VJ1A 3AAFA 2VBXA 2NRAC 1EAXA 1THSH 2ZJ2A 1TRNA 2K3PA 3BTKE 1CSOE 3CP8A 1IN6A 1WJAA 5IYBJ 2TGDA 1JRTA 2O61A 3U8TH 1O0DH 1L0OC 2BLQA 4DNCA 2L5QA 1HDPA 3GYLB 2GXBA 3F68H 1TBZH 5EXMA 3F6VA 1LKXA 4HBLA 3ABUA 1WH7A 1GHBG 2A4QA 3KP2A 3WW7A 2G9WA 2BVXH 2PP6A 2MH2A 2ZPQA 2W3IA 4MPUA 1YPHC 3FANA 3A85A 1V2LT 1IOEA 2R7QA 1NT1A 4K8BA 1G37A 3P17H 2BMGB 1BJUA 2P6SA 5TGTA 2F2EA 1C1QA 1EA3A 4E06H 2JVGA 5EJLA 2P6TA 1MCVA 3SW2B 2ZPSA 2ZXJA 3HSEA 4ZYDA 1O7LA 1R71A 3FF5A 2UWMA 1PPHE 2A4RA 5F53A 4Y11E 5AFZH 1C1MA 2BD2A 4L5JA 1DPUA 1MDMA 3ELAH 2FIRH 5HNFA 2COBA 3HK6B 2DA7A 3TJVA 1E35B 4BAKB 1K1MA 2J5OA 2R7TA 4M9XA 2ZO3H 4L0YB 3Q3KA 2HYJA 3I59A 3SUFA 5EPYA 2LY1A 4NIXA 2HDCA 1D3QB 4DYCA 4THNH 1UCYE 4JYKA 4K1EA 4PK4A 2QQAA 1VQ7I 4E7ZA 5DPAA 4YIIA 4NDLA 2PKSC 4MQAA 4W1UA 3M3YJ 1P02A 3MZYA 2CW8A 2BQWB 5C4JJ 2NU3E 3NWUA 1TW3A 3A81A 2QXHA 1BMFD 1SG8B 2SGPE 3P8GA 1Y6IA 1RPWA 2FNAA 1VCWA 3G1LA 1X2NA 2EEKA 1K9OE 3OL4A 2CJJA 2VOPA 1O2YA 1O3KA 4G94A 3GBGA 4U7DA 1P2MA 3GTOJ 3F0PA 4OMZA 2BZTA 1CU1A 2KRCA 2GP9B 2ZCHP 3F3BA 4CRBA 3LWFA 4Y8XA 3BR3A 3ZN1A 5DM7F 2A05A 2XGCA 4UUVA 3TW6A 1RETA 2XAQA 5FCRA 3TGJE 2QF4A 1ESAA 3ODFA 2WZQA 2O8KA 5GJ4B 4RA2A 2G81E 4ZHMU 1V3XA 3FM5A 2UXXA 3VB6A 2CUJA 4LLLA 5K7FA 1SGTA 3RPUD 2G00A 2XCFA 3QPSA 4I8JA 5EOKA 4BXWA 4XDEA 3M7UA 1JUSA 2FOGA 2XCNA 1FWZA 4YM9A 4BJ5C 4WY3A 1G4DA 1FT9A 1FLEE 3UKGA 1R7JA 3BN9A 2L74A 1EPTC 1GI5A 4BOHA 1UHBA 1EUFA 1VITG 4RGUA 1ONVA 5JYIA 1BA8B 1R5GA 1LMWB 4Y0ZE 2Q2EB 1H8IH 3ZMSA 2EFOA 1QRYA 5CHAC 2Q1ZB 1NRPH 3KHVA 5LRSA 3OE7D 4A0ZA 1A3BH 3S9BA 4WF8A 4A5MA 2W00A 4FE7A 2P7CB 3LPRA 5LLQA 2JSCA 1B9MA 2BD8A 1BBRH 1XMNB 1CGIE 1KIGH 1Y3YA 2ALVA 1REPC 1GI9B 2WBMA 1OKRA 4SGAE 3Q76A 2L0KA 3G3ZA 1ZJDA 1XX9A 5T6FA 1QB6A 4E7JA 2FI5E 4Q80A 1C5LH 1O5EH 3PWCA 4KUMA 3R60A 3KQEA 2ZKSA 2EPFA 4A6LA 2JDID 4IS5A 3O8RA 3C2BA 2FOEA 1W0KD 2DA1A 7LPRA 2IPQX 4A2UA 4HNUA 2FS8A 3NRLA 4YZUA 4CYDA 2ALPA 8GCHG 3A82A 3HC7A 3K2UA 3RTRA 3ZZDA 5FFZA 1O5AB 4XSZF 3EDXB 2FI3E 1S5LC 1C2LA 2BVLA 1KLJH 4A3CJ 3BZ6A 2PJRB 3V7RA 1Y3UA 1FN6A 1UO6A 3KNXA 4DOQA 2FZZA 2Q6DA 3GFIA 1KXDA 1Z1JA 4M9FA 5G4BA 2VQLA 3TO6A 2DE9A 1OQYA 3CD6I 2A5WA 4WWCA 2VIOA 3DD2H 3RXRA 1P0SH 1WH5A 2FNPA 1Z6RA 2PX9A 1WYKA 4ABEA 3HOZJ 5TISC 3D23A 2CFOA 3FBIB 5FKLA 4KIFA 5KHDA 2FWWA 2J5UA 3M5NA 3TIUA 2HWLB 4O3MA 2P5VA 1Y39A 2ID3A 3FOAA 5JDUB 3RXKA 2FQ3A 1QO0D 3S2DJ 1R5ID 2FTLE 3SJMA 3WGGA 4MNXA 5F6MA 1ACIA 3F8FA 1GI2A 2COMA 2VU8E 5DO4H 4AX9H 2O0YA 2X48A 2VLAA 1FC3A 5CQEA 2ZJPF 4ABFA 2V9PA 3KP5A 2R0LA 5DSFA 2X4HA 3DEEA 4CICA 3IKTA 3BTIA 1P2IA 4LLNA 1C4Y2 4XBCA 3RXFA 1HJAC 3J7AY 2ZC9H 1UMQA 1TONA 2L02A 1ETKA 4ENNA 1U78A 5IP6A 2TRMA 1XMAA 3A7ZA 3PV4A 1DLEA 1YP9A 1XGSA 1QQUA 3ATLA 4KTSA 3A2KA 1PP7U 3ZMDA 1SBWA 3BG4B 2DMPA 4GO1A 2K9SA 4RGXA 4B2AA 4XORA 4B75A 2UUYA 3ESWB 1IUFA 4CBOA 1GJDB 3I4PA 4M6YA 4A92A 4XOTA 1GXQA 1G3TA 4B2BA 4A1TA 3M3VA 1O3DA 4A1VA 1N77A 4AYYB 5CPRB 1HCGA 1GHZA 1NFYA 4BY1J 4Q7YA 2RG3A 2LC2A 5LEKA 1GI1A 4W97A 4HDVA 3GWZA 2W48A 1TRYA 1ETOA 2SFAA 5EF6A 5EGOB 1VQ5I 3CCRI 3ZCOA 1YJ9I 2DLLA 4KDPA 3U9GA 1ZRFA 2ZECA 5JVTA 1SGPE 3A7WA 4ON0A 3Q0UA 1BM9A 2IGNA 1P10A 4RBOA 5H4IB 4MNWA 1GCTC 1D8JA 2KKOA 1HLVA 3QZRA 1C1RA 5GAEJ 1FYKA 1FMVA 4GRIA 4PJJA 3WTYC 3ZQIA 3WU1B 2LLKA 2FLBH 3GY7A 3KP3A 4GCHF 2H1UA 5HOOA 1QHRB 1R4NB 1LQDB 1ITYA 1YIOA 4XQFA 4MFDA 1MNDA 1KU3A 4G6TB 5GXPA 2XUBA 1GI7B 2I6SA 3FXOA 4AGJA 4A3DJ 4ETSA 1LNWA 2RNJA 1HXDA 3F9EA 2X1DA 4UUTA 4AOQA 2XKOA 2PKAA 4TY7A 1V2TT 4JX4A 1XG1A 3GUDA 1IHTH 3PQJA 1U9NA 1IQHA 1MQ6A 3L1PA 1SMFE 3S1RJ 1BTYA 3DV8A 1QA7A 3PM3A 3HTUA 4I76A 1XKAC 1V3FA 2NS7A 3FHZA 2A7JA 4QPQA 3MCZA 4IL6C 1SGYE 4IW4E 4C9YA 2KHMA 2Z16A 4QT8C 1GJ8B 3PO1B 1G3DA 5ESBA 4Y0YE 1ZR4A 4AIJA 2NOGA 5B3SH 1T38A 2A3SA 3J80Z 1K0HA 2BOKA 3M3TA 2ZFUA 3L33A 4ZKNU 5JVGF 5LHGA 1OHHD 1NFWA 1A35A 2PUQH 3GCTG 1LB2A 3FWEA 1AHTH 3LGYA 5ED4A 2DTRA 3S69A 2YUSA 2X6YA 1MDMB 4AYVB 3RKYA 5JHFA 2DMNA 1APLC 3BIUH 2EILH 3LSRA 2IS1A 4FUJA 4A6DA 4F7ZA 2M7AA 3LL7A 3BR0A 1PVEA 1GPZA 1GVLA 2H1KA 4JZIA 4LB6B 3SFIA 2BLWA 3EYYA 4IMZA 2RV8A 1JXSA 3RCOA 1B4AA 1NM6A 4TPIZ 1C5NH 1TW2A 4CO8A 1TNKA 3A03A 3QYEA 4TYDA 5GWZA 1YLDA 5BRRE 1T7CA 2WPJS 5HVQC 2Z9OA 1MUEB 2FOMB 1HAGE 1WTHD 3T2NA 4NC8A 1UZCA 1WJFA 1RRJA 4ABHA 1I3QJ 3ZR8X 4YFNF 1UK2A 1BW6A 3I0TA 1HGTH 4WX9A 1W8BH 1ANDA 3PNTA 2R0QC 3GY6A 1TNGA 1INCA 2ZU4A 3C27B 3UWJH 2VUMJ 3BTQE 1OOKB 1QL7A 3EETA 1YQAA 1GDTA 2VE8A 3R0JA 3RXEA 2KQRA 1O2QA 5HKKD 5I25A 1BJAA 4Z2YA 5EW1H 1XSDA 2BXZA 1XB4A 3HJEA 1C1OA 4O9VA 4KFCA 1ETRH 4M3GA 2PJPA 3GLLA 1WQ2A 1MKWK 3OYCA 2GV7A 1UG2A 1QPIA 1EX3A 2QCOA 4XSKU 4NC6A 1QGPA 3GTQJ 3G1MA 1BHXF 1VCQA 1FJSA 3OL3A 4X8TH 1QNTA 2K9LA 3LFUA 4U88A 3A8AA 2AGGX 3PMBB 3BTWE 2A6TA 4WH6A 4KTCA 2R7FA 3X2QH 4LLGF 1O3EA 1TWFJ 3RXBA 2DMTA 2MD0A 2OC8A 4DCDA 5DS9A 4UFDH 1GHWH 1K1NA 4I86A 3LSGA 3L2WA 1BA5A 3SOSA 2P3FH 2LDUA 4OS2A 5LHIA 4E6KG 2JH0D 3BDDA 1ZHPA 3CF5F 1ELEE 5FX6A 4BQAA 3EYIA 2Z3CA 5JLWA 2MD5A 1EAWA 2ICWG 4IHSA 3JREA 4BNRA 4BHCA 5EZHA 3LU9B 3K70D 1C5MD 2MC3A 1DDJA 2R5YB 4I02A 1PPBH 4ESTE 1TGTA 2R92J 3N99A 3HL2A 1IUYA 1LVYA 1V2VT 3SZPA 2E5NA 2WINI 4H4KC 1R1UA 2Y7XA 2ZMEC 3MFKA 4I8KA 4BE0A 4P1WA 3ZVGA 5L3CA 4IOAF 3AASA 5JB8S 1QNJA 4U87A 5DP7A 3IH3A 1MTSA 4DT7B 2Z9LA 1F9NA 3TQNA 1P06A 5DDGA 1HBTH 1IQKA 4WXDA 3JW4A 2D2DA 3IKVA 1S0QA 3A0HC 2XGXA 4WF2A 2FOKA 1MTNB 1JJ6C 1SI5H 2NYXA 3J80K 1BITA 2P7VB 2PV9B 2JKHA 2O5RA 4MG3A 1S7AA 1EQ9A 1Y0UA 3M4OJ 1NBMD 2A1DB 1ZTKA 3BJ6A 1USSA 1ETTH 5F27A 3CDLA 3E5QA 1W12U 4KA4A 4IJAA 1VITH 4II3A 3COAC 2WA0A 4RDUA 4LK0F 3BTFE 1SB1H 1FZPB 4IHWA 3B73A 5LFAA 4KELA 3OYKA 2K9QA 3VPRA 3BTDE 1C5TA 2GCHG 1CA0B 4AG1A 1LFUP 3LSTA 4NA9H 3G73A 3SU0A 3LDXH 2M8GX 2J2UA 4OIQF 4Q5SF 1BQYA 1PQ5A 1TT5B 2XVCA 1W1WE 3EUHA 3EAJA 1K1OA 1Z71A 4H6SB 1C5UA 1C2KA 3BG7A 3ZQHA 1P2KA 2K85A 4DIHH 1BMMH 3A1YA 1HDDC 2DN0A 2OBOA 1VQLI 1A6QA 1SLXB 2UWPA 4A3EJ 2OCVB 4LIVA 4NNJA 2VXDA 1HFDA 1DWDH 3OIOA 5FGMA 3HUGA 2YOLA 1OISA 4CBNA 4CCMA 3CJRB 1IJWC 4IEJA 1D1CA 4ZZLA 5DN6D 2R7ZJ 2OC1A 3GICB 4V2GA 4LITA 2M87A 1GDNA 1PJPA 2IS2A 5HLTA 4X8SH 2F9VA 3P9KA 1H1BA 4UXNA 1WSUA 1FOXA 5J8FA 5A0CA 3QK1A 2OBQA 5CLSA 1XPXA 1CT0E 3AAUA 3RXCA 3FN8A 1PUFA 4E05H 1PQ8A 1YLNA 5LPEA 2RAEA 5FB2A 2TGTA 2DFEA 3HGPA 2HVQA 3BTGE 2DMUA 2EBIA 1ON1A 2M8EA 1C1UH 1SGRE 1A0HB 2FO9A 3GCHC 5F03A 5DV5A 1IQJA 2J98A 2PMHA 4WMEA 3TOBA 2VE9A 1HXEH 4JK5A 4O3TA 4ABZA 3WU2C 1IQIA 2Y2ZA 2TRTA 3OIPA 1Z1DA 1CGJE 1DE7H 3BJAA 1IO2A 4ZTFA 4ZDPA 2ELHA 4Y7BA 1RIWC 1XVOA 4MHGA 1IQEA 3QPLA 5FBIA 1ZOMA 4FQGA 1EB1H 2PHBA 2Y7ZA 3ULQB 2OAZA 3W6VA 4A6EA 2Y82A 5HMAA 1VKYA 2VINA 4L9TA 1Y3XA 3HYIA 1LQEA 3RC5A 4B2CA 2FEZA 1YW7A 1JTXA 5DCMA 4WJG2 4Y79A 4HNVA 1T2KA 2F9UA 3CS0A 1QR3E 5CVUA 3H3VK 1MD7A 1HBXG 1KMHB 1WRJA 2VKVA 1ZSLA 3SZNA 4ZZDA 1U8RA 1RKWA 2L54A 2WADA 1O2MA 2GA2A 2ZF0H 2XB5A 1BCUH 2JSPA 3UOUA 4II2A 1V55H 1P4XA 1TBQH 2CYYA 1U8BA 1TNIA 1SD7A 4MPWA 4PDKA 2Y80A 1ETXA 1G3SA 4ASUD 3AG3H 2ZSIB 2FESH 1FY1A 2CQXA 1C4U2 5F0CA 2ZQ1A 1UVSH 1IAUA 3M7GA 1V2PT 1KXFA 3K9XB 1ZPBA 1Y8RB 2WUCA 3SJKA 4ZXXH 1Q3XA 1IXCA 1X1DA 1AKSA 4M6VA 3TNSA 3OR1C 2P8TA 1BUIA 2JUGA 1XUIA 3VYRB 3SGBE 4HFPB 2KX4A 3DPLC 1QHHD 1BT7A 5F04A 2CHAB 4A5NA 1EPTA 1QRXA 2CN0H 1P11E 3C7JA 1O2SA 3GEZA 2ID6A 4S05A 2DBBA 2VIWA 2KJCA 3EUKL 1O57A 3S7HB 2HXOA 3PO3J 2XNIA 1NESE 2GMTB 1ELVA 2HPPH 1QB1A 1EJAA 3T62A 4LZ4B 2CG4A 1HSJA 3IC7A 3ZGKA 5J4YA 1GBCA 2EI6A 3MQKC 2C6YA 2P8OC 4XD7D 5D5VB 1MMSA 2ZDVH 1VTNC 3MQ0A 3HPTB 1ACBE 4XOPA 2AHQA 3H5CB 2ZI2H 1T0FC 1IQFA 3LAPA 3BCAA 3REOA 2D1VA 2Z33A 3V8JA 3SU5A 1O2HA 4AVZA 1XM1A 3N97A 2Q8KA 1ZGAA 3BG3A 3M7TA 1X58A 2A6EF 2WPMS 5C1YA 1NTCA 1JT6A 3DEUA 1G3WA 2GX4A 1B7XB 2FQ4A 1QJ7B 5E8GA 3G6EI 3RC6A 2W25A 4QPOA 2FM2A 2P5KA 3T25A 1W14U 4WH8A 4NZLA 2TGAA 4OWRB 1DU0A 1A4WH 3WGIA 2QBYA 1TP4A 2J95A 3PUBA 1LE8A 4PGHA 3RMNH 5F6FA 3OYDA 1GL1A 2LYCA 1G30B 1S29A 4M74A 1GBDA 3OS1A 4BGDA 4RM2A 5ICFA 1J09A 2JA5J 5CE1A 1C0WA 3BTME 5FCKA 2TBSA 4U30A 2A5AA 1B1BA 2SGEE 4OS7A 3MU8A 5JBBS 2EQRA 3NEUA 2Q1JA 2VI6A 5E3LA 1W36C 4NC7A 1K1PA 1G32B 1B72B 4IN1A 3SU3A 1DUEA 1KONA 3JCUC 1SPJA 1ELCA 1D0XA 5IT3A 1G3EA 2DK5A 2PGBB 1SQTA 5C1UA 3ZVAA 2CQNA 2YSRA 3TO9A 1R23A 4ITVA 4CSWA 3CMAI 1F36A 2O9LA 1KTSB 5FL7D 2JWTA 8LPRA 1GHVH 3ZV9A 1MQ5A 3W6KB 4CRFA 4A3BJ 1S82A 2UWOA 2FOCA 4FX4A 3K7AJ 2FSWA 1MBMA 4A12A 4XFQA 1FMGA 3ZXSA 2ZP0H 3RXAA 2F5FA 1VQ9I 3Q9SA 1BW5A 3LSHA 1SVMA 4CDGA 1EAIA 1ZRCA 4RT1A 2NU4E 2XW9A 2HVSA 2BX4A 2THFB 3CUOA 4XK4A 1ZPZA 1TFXA 3C2GA 4DIQA 5IY5H 1C9PA 1ZSJA 5FLXZ 4OS1A 2G52A 4N0BA 1MD0A 2ZIQH 4M71A 4F92B 4U7BA 1EH8A 3KCGH 3C1DA 3C2HA 1Y3VA 3F2FA 2GT7A 2QM3A 2VJ4A 3EA9A 3RDIA 2LF7A 1YCPK 5FX5A 1AE5A 2RDPA 5CDFE 3V42A 2HZTA 4IF4A 3M37A 1YITI 1YJNI 5LGOA 2QAAA 4BY7J 2NVUB 1ID5H 2EK5A 1YYY1 3VFEA 3SJ8A 4P9UA 3RXIA 4PGGA 3MO3A 5D4RA 2EA4A 2DW4A 4BJTA 2ESNA 4BBSJ 1ZYOA 1SLUB 1C5OH 3SHAH 1BRUP 3PRBA 2WYJA 1AB9B 3HOTA 3TGKE 2TIOA 1JBUH 4EMSA 4ZDOA 3JRAA 3D5SC 3URCA 2V4JC 2RKHA 4MNUA 1NRNH 2QZ8A 4HLXA 3NARA 1JJ8C 2V9KA 1WXRA 1QGFA 3E91A 3F21A 1PYTC 3RXLA 3QQAA 3V7CA 2X85A 3ZQFA 2K0QA 1H9IE 1D3YA 3JRDA 1CBWB 1KU2A 4DG4A 1ELGA 4ZROA 3WU0A 2CGAA 1DDNA 3K1PA 4X8UH 5T6GA 1LHEH 2XC0A 2RFKC 3T26A 3OMYA 1LFPA 3BC8A 1QTFA 2OBPA 4DW2U 2DDAA 1MABB 1R1TA 2LNCA 2RC4A 2XHKA 2G8TA 3HBLA 3LGTA 5EXLA 4C3JJ 1ESBA 1SVOA 3UOPA 3GLXA 1V2MT 4CYCB 1FYMA 1NHAA 2QGUA 5EJZA 3SNDA 4D76A 3JR9A 5EIYA 2IT0A 1K4TA 3OAAD 4F4OC 2QSFX 1R4MB 2YMSC 1DWEH 3KFWX 4E7LA 2EH3A 2DOEA 4MEXF 3PMHB 4ZDLA 2EV5A 5CKTA 4CXFA 1TMTH 2FU4A 4KJZA 5EEHA 2ANMH 2PFBA 2WAEA 3BP8A 3FXMA 1P9QC 2WV5A 1JOUB 2EV0A 4KIGA 1F2SE 2GT8A 2W1OA 4BEHB 1HXFH 3L3TA 2XDVA 1SQAA 2IPHA 2BXUH 2WUBA 1R36A 3ZRGA 2FLRH 1VCPA 1PPGE 2BDHA 4YEJA 2E60A 2M4KA 3BOQA 4KGAA 4PFOA 1B9NA 4AORA 3TH3H 1BTZA 5DCMB 2VVUA 1TQIA 1GJBB 3I3LA 5CVJA 1MTVA 2CK3D 3ZZ9A 1YS6A 2L9VA 5D6FA 4X1RU 3EDPA 4DVAU 2JETC 4BXFA 4HF1A 4RGRA 3FMRA 4VGCC 2HEOA 4HA8A 4WXVA 1A5GH 1K79A 3QX5H 2GXAA 3ZZAA 1VQMI 4HLYA 2NU1E 3M5OA 5IPAA 4LOCA 2ZDNA 1T8IA 3FHNA 4ABBA 4UE7H 1HKSA 5K1YA 2HPQH 1MMJN 5HXFA 1IGNA 2WYGA 5HIYA 1BTPA 4CHAC 1PP8F 3DBHB 2QQ9A 1ZJKA 3V13A 1Y8QB 2HZDA 2JA7J 1FX0B 4GVUA 3ZZ6A 3VFZA 2PR3A 2OPTA 2QF0A 4AU7A 4B74A 1U6QA 2LP0A 3GS9A 4AC9A 1DVAH 1BOQA 1V5FA 3CDIA 4IGDA 2L7KA 3D65E 1CGHA 2DA3A 4BE2A 1WWXA 1K6OA 3ATWA 3ZN0A 4HG6A 1H8DH 2DXIA 3RIRA 1NU7B 5AVDA 3RYPA 4JZEH 3GVAA 1D0ZA 3FP6E 1YKTA 1AKSB 3UR9A 3E16B 2EINH 1TB6H 4L9NA 1K78B 2BY8X 2G4TA 1VQ6I 4IKFA 2LP6A 1X1CA