1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alkylmercury lyase
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
4WWCA 3K2ZA 3COAC 1SFUA 4LLNA 4RB1A 1G3SA 5D4SA 1TNTA 2Z99A 3N4MA 2AS5F 2KIUA 3KZYA 3E3VA 4ETSA 3CUQA 4RS8A 4HV6A 2RDPA 3GVAA 5CVUA 2DT5A 3KP4A 4BXUA 1T39A 4PGHA 5BMZA 1O3TA 5FB2A 1QZYA 1IRFA 3WGHA 2V1XA 4LGWA 3PFIA 4DQ2A 1IRGA 4YG2F 4EJWA 4XSZF 3RIRA 3R6SA 2D2WA 3IRQA 1TQPA 1XN7A 1KU7A 3WTXC 1QQIA 3H92A 5DDGA 1YIOA 3LAJA 2RV8A 1CF7A 3KLNA 2HWVA 2GQQA 2OZUA 1ZRDA 2IA1A 4HAMA 5FD6A 5L3DA 1UHMA 2Q0OA 2EFPA 1R36A 4JBAA 5ILVA 2YX4A 1ZG3A 3D0SA 3FMQA 4I09A 1BI0A 1K78A 2UZKA 4I01A 3J81Z 1J0RA 4FX4A 1RIOH 1MDMB 3ZMDA 2JTVA 5LGNA 2CW0F 4LB5A 2ZBKA 4LJZF 2EV0A 4E70A 4N0BA 2EFOA 4IHTA 3ROUA 2IT0A 3KE2A 2MLGA 2NNYA 4EGZA 5BOXA 4FHTA 1VTNC 5LGTA 3I71A 2FNPA 4ON0A 4IRIA 1B9NA 4OMYA 1H9GA 2QYOA 4HQMA 1K6OA 1YG2A 2NRAC 4LG0B 4GYGA 1XD7A 2K4JA 2DI3A 4GGGA 3I58A 1K7AA 5K5QA 1EV7A 3DPLC 2ZMEB 1FBUA 2OQGA 2P5LC 4L0ZB 5ERIA 2BGCA 1HQCA 2QQAA 4IVNA 3KLOA 3E6CC 2C6YA 3FM5A 3RTRA 3WGGA 5EEHA 2DQRA 3I0TA 5K1YA 4M6YA 1XSVA 3KCCA 4ENMA 2LKPA 1ZG5A 5ILSA 3FXUA 3N97A 1I1GA 3QPTA 1TQMA 3V7CA 1H0MA 1FNNA 4RB0A 4KYWA 4OMZA 3I4PA 4M72A 1EH6A 1Z9CA 1ON2A 4YFXF 4RGRA 2HKOA 2XAJA 3QAHA 2H6CA 4R8HA 5LHIA 4WCGA 5BS6A 4I0AA 3GFIA 4LB6B 3IHUA 2ZJ2A 3L09A 4BAYA 1BIBA 3VFZA 2QM3A 3LSTA 1LDKB 2UXXA 2EB7A 3J80K 1SMTA 1HSTA 3HYIA 4EVIA 5DYMA 4IRGA 1R00A 3PQJA 1L3LA 2HS5A 4YIFA 5K5RA 2ZXJA 3CTAA 4EGYA 1BI1A 3P9IA 3DKWA 5DV5A 3VODA 4ZYGA 5HDKA 5AIQA 4U88A 4YFKF 1KQ0A 3U2RA 1YW7A 2R7FA 4RB2C 4L18B 4HQEA 1SMYF 2L54A 2HQNA 1E17A 1F5TA 4XBFA 4QWQA 1YYVA 4HX4A 2L4MA 3LQRA 2RN7A 3IL2A 2GWRA 5LGUA 4HYEA 1V4RA 3F3XA 2MH9A 2MLKA 2G9WA 2PJPA 4L9NA 5FLXZ 4HZFA 3R0JA 1WSUA 4OINF 3CUOA 1QNTA 3CUQB 1PUEE 3CO6C 1YQAA 2A6HF 3GXOA 3IKTA 2DW4A 3I53A 1SD5A 2IRFG 2DBBA 5CYVA 5JI6A 3KEOA 5LEKA 2ISZA 4A0ZA 3FF5A 4UVAA 3HUGA 2G7UA 2VBZA 4G6QA 2QWWA 5FFZA 2P7VB 1T2KA 3CJNA 3CDHA 3FHZA 5A2QK 2RNJA 3F8BA 3F8CA 3M8FA 5LLQA 2K27A 4GCVA 3SFZA 1ZAOA 2DPDA 4OU0A 2PLYA 3M8EA 3KP7A 3RYRA 3T0YA 3E5QA 1SFXA 3MZHA 1UHWA 2EFWA 2GA1A 2YPRA 3HRTA 1CF7B 1KU2A 3E6DA 3WTZA 4I0BA 1XGSA 4P9FA 1BC7C 3PQKA 2L4AA 1IN4A 4JK1X 4ENNA 5F1RA 1UCRA 1K78B 2O8XA 3FWEA 2JRTA 4CZZA 4BYYA 2AXLA 3EQLF 3BJ6A 1J2XA 2YR2A 2QQBA 1U8RA 2D1HA 1Z1DA 1WKMA 5CVIA 2ZKZA 2MH2A 5KK1A 3GX4X 1IN8A 2BYVE 1WWXA 3JAMZ 5LRSA 3FM3A 3GEZA 3F6VA 4G7OF 2ETHA 2QBYA 1LEBA 2FSWA 2K86A 3J81K 5BPIA 1U5TB 3K1MA 4KFCA 1XMKA 1IUYA 5D5WB 3JW4A 1JE8A 1EH8A 3TOAA 5IT9Z 3C3WA 4IPAA 3GLXA 1QPMA 4MEYF 2H94A 1BI2A 4Y13A 2P6TA 4U7BA 4AIJA 2MA3A 2KJCA 3HHGA 4HLYA 2XHKA 4WX9A 4ZZDA 1ZRCA 1O7FA 1KYZA 2HZTA 5CVRA 3NEUA 2HOEA 1BN5A 3E5XA 1TLHB 1G4DA 3QRFF 1Z91A 4L9JA 1C0WA 2KJBA 4MTEA 1DUXC 1EH7A 4AD9A 1XDSA 4KIGA 3WTTC 4TV7A 1LDDA 1P4XA 2M5WA 3TDUC 4EJUA 3TQNA 2VBYA 5E1XA 1KA8A 5ICCA 4L0YB 5JR3A 3RKXA 3TO9A 5DCMB 4IXAA 4EQQA 3P9KA 2XV4S 2VOOA 5HS9A 3LA2A 1FBSA 4CICA 4YIIA 1SFEA 4EJTA 2FMLA 4P55A 1ZGJA 3IWFA 1TBXA 4UXNA 4LLGF 5D6EA 3HSRA 4JQFA 1SD4A 4NB5A 2FOKA 3HIFA 3KP6A 3W6KB 4P9UA 1F1ZA 2O03A 2FF4A 1J9IA 1B9MA 5ICFA 5E8IA 1O3QA 1Y0UA 4BHPA 2CO5A 3GF2A 2HQRA 1YW8A 1W7PA 5H20A 2XVCA 3K69A 5F64A 4RAZA 3KZZA 2RGVA 5DUIA 1KGSA 2OA4A 5L3FA 4BH9A 1ZREA 4ESBA 3Q5FA 4M9ZA 2STWA 3MWMA 1ZG1A 5A2QZ 5CVVA 3DFGA 3I59A 1MJBA 1LB2A 4BQAA 2NNNA 2XGXA 1FOKA 3HTUA 1FT9A 4NQWA 1R23A 1STZA 4H0EA 1AWCA 5F6FA 1FP1D 2UWMA 3C18A 3MEXA 4WXCA 1ON1A 5E18F 5E1ZB 3BDDA 3IRRA 3Q9VA 2MBFA 3JTHA 4ESJA 4PCQA 2VBWA 1LVAA 2F5EA 2COMA 3QU3A 5FLXK 3D5LA 4ZZLA 2K7LA 2IA0A 2L3DA 3GWZA 3ZMZA 3JSPA 5FD5A 2P7CB 3HOTA 2CGPA 1I6XA 2O0YA 5CJ9A 3MQ0A 4HF2A 2IP2A 2ESNA 4YFNF 5D8LB 3WGIA 4I98B 3SXYA 4Q5SF 4OIRF 1RZ4A 4OIOF 2HEOA 5DD4A 3F8FA 3ZMUA 3R60A 3GFJA 5E20A 1O7LA 4WF2A 3RPUA 4S04A 1OYIA 5H6RA 1ZN2A 2F5FA 4RB3C 4CO8A 2W85A 1JHHA 4BHCA 2ISYA 4KMFA 1LNWA 4G7HF 2GAUA 4EM0B 4HX7A 5LHHA 2A69F 2RC4A 1R1UA 4HX8A 2QBYB 4CDGA 3FX3A 1W5SA 1D8KA 2PBIA 4G9YA 5L3CA 2RQPA 3LAPA 3ML6A 1ZLKA 2J5PA 1MJ9A 3ZN1A 2HDCA 3V7SA 2ZFWA 3HTSB 4XRFA 1L0OC 2LSOA 2A68F 4EJOA 1KU9A 3JAMK 5IT3A 5K5OA 1YFHA 3LA7A 3WG9A 5L3GA 2VN2A 4I02A 3L9FA 4M9XA 3TO6A 1T38A 1W7PD 2DK5A 3HSFA 1G3WA 2OU2A 2V79A 4LK0F 2VODA 5IT9K 1ZHFA 3HRUA 4BHBA 2XAFA 2FE3A 4M71A 2CYYA 2ELHA 1SAXA 4RGXA 4M9SA 2Z33A 2EA4A 1XGOA 2XKOA 1YS6A 3O2PE 4D0PA 3WTUC 4UV8A 3V4GA 1HSJA 1BBYA 2MC3A 5D5XB 4F7ZA 1B1BA 1HW2A 1ULYA 2PMUA 4IF4A 1FC3A 2A61A 1OYYA 1IN6A 1TW3A 5LBQA 2P5VA 3BJAA 1FP2A 1JXSA 1WQ2A 2J5OA 3F22A 2D1VA 3HRSA 4A2UA 3Q9SA 4S05A 2H6BA 3S2WA 1U3EM 4M74A 2HYFA 4A6DA 5LRRA 4MHGA 2A3SA 2PQ8A 1W7PB 2CWEA 3QU6A 3B73A 2O3FA 2NYXA 4OOIA 3DQVC 2EV5A 4L9TA 1R7JA 3SZTA 2DLLA 2G7HA 2H27A 1DP7P 2P6SA 1O57A 1HKSA 4ZYHA 1DDNA 4NHJA 5ICGA 2LF8A 3DP7A 4MGRA 1RUNA 4R1HA 1KU3A 1KYWA 3RI4A 4Q4ZF 3T8TA 3RKYA 1AOYA 1IXCA 3M7GA 2PEXA 4L5JA 3P9CA 4HF0A 3G73A 1MGTA 3K0LA 1FPQA 1HBXG 1YW9A 2M30A 3GZ5A 3TO7A 1I1SA 1CGPA 3E5UA 3WU0A 3F8MA 3HRMA 3V7RA 2GXGA 3OV8A 2STTA 1ODDA 4P5OA 1J5YA 3SHFA 4IHSA 3GO5A 1Z6RA 2OZ6A 3GFMA 4L5IA 1LEAA 4PGGA 2DPUA 2QZ8A 2V1DA 1LJ9A 3ZMVA 3KP5A 2ZO4A 3BP8A 2YX7A 2EFQA 1IXRC 1UFMA 4KT5C 3HSEA 2M45A 3KP3A 1QO0D 1B4AA 3AAFA 3ZP5A 1IN5A 4P96A 2XIGA 3EDPA 2O6GE 3ZMSA 2DFIA 2OD5A 2L02A 2W57A 2P5KA 3C7JA 2UXNA 3WTVC 3JTGA 2E1CA 5EEGA 2FBHA 1G6NA 1MDMA 4KN7X 2JPBA 3WTWC 1R5HA 2M87A 5HOOA 2NS0A 1Z05A 4G94A 2RVCA 4HV5A 1D8JA 1GVJA 3FXQA 1XSDA 2KIMA 1S6LA 1F4KA 1BI3A 1ZARA 4ENJA 2D45A 3EYYA 5L3EA 2ESHA 2WTEA 3F6OA 1FY7A 3IC7A 5D4RA 4QLCU 3MAJA 1D5VA 2NAZA 1FZPB 4ENKA 1XB4A 2Y75A 4XLNF 2O61A 2VE9A 1REPC 3QP6A 4LFUA 3GZ6A 2BE5F 4HLXA 2WC2A 1USTA 4UHTA 3OOPA 1W4MA 1PDNC 1KQ8A 1E2XA 4GO1A 5HS7A 4A5NA 3EYIA 2PI0A 4KICA 1HW5A 2GIVA 3ZQ7A 2L01A 2HR3A 1XSXA 1ZGAA 1S7OA 4LMYA 6PAXA 2FBKA 3FXRA 4CYDA 2LDUA 1HW1A 4ZYDA 2EA2A 4I7HA 4HOBA 1FX7A 3FMSA 2Y0MA 3QP5A 3T5XA 3HHHA 1W5TA 3LWFA 1IF1A 1TQIA 1TW2A 2FBIA 3H3UA 4U0YA 4UV9A 4AIHA 4UVCA 2V9VA 1ZRFA 1ZYRF 1QZZA 2W84A 4KN4X 3H3ZA 4Y17A 5TJJA 1YTYA 2E7WA 1XDUA 4ZH4F 1YO5C 1FYLA 1YS7A 1HKTA 3V8KA 2KRFA 2XASA 3SZPA 5L3BA 3DV8A 1BM9A 4AWXB 4G6DA 1J75A 2M1BA 2XAHA 4ASNA 3I54A 2LNBA 4LK1F 2JSCA 3DEUA 1ZH5A 1P92A 1B59A 3GFLA 2HFHA 4WXHA 5E1WA 2OAZA 3RYPA 1IZ1A 1MZBA 3F72A 3RDIA 1WRJA 5DUKA 2V6CA 1HXDA 3MFKA 3WTYC 3O3KA 1BIAA 4A12A 1BJAA 1P6RA 2Y48A 2ZNYA 1PP7U 4KA4A 2JPCA 5FGMA 3GUDA 3C1DA 1BC8C 2FA5A 3L00A 2JT1A 5CVJA 4EJVA 5J8FA 2IA2A 4ESFA 5BPDA 1A04A 3FMRA 4O3MA 3NRVA 1GXPA 3ABTA 2DQLA 1JGSA 2Z3YA 1FSEA 1XCVA 1FYKA 3J7AO 2H09A 1TTYA 4M73A 2MD5A 3WU1B 1FWZA 1R22A 2K02A 2W24A 4FX0A 3F21A 3LQQA 4K2EA 1H9TA 3KETA 2W25A 4WXDA 2ADUA 2HKXA 3K9TA 4PDKA 2FXAA 2WWYA 2A5YB 4OIQF 2VONA 5CLSA 1O3RA 2EK5A 1V3FA 2R3SA 5E17F 2CG4A 3ELKA 3V8LA 1J7KA 2OBPA 1T6SA 1IXSB 5D6FA 5DEQA 1O3SA 3F23A 2FNAA 2VE8A 2VBXA 2PG4A 1XGMA 3JSOA 3CO7C 2E1NA 1U5TC 5E8GA 2BV6A 4HF1A 1IAWA 2DAOA 4HDVA 2LF7A 2RKHA 2PFBA 3K1PA 3BWGA 1JHFA 3ISPA 1XCBA 4KDPA 1HKQA 4G8XA 3R0AA 2F5DA 3WE3A 1U5TA 5HDGA 1NHAA 4PZJA 2HYGD 1Z6TA 1B6AA 3EETA 4RGSA 2VT2A 3I5UA 4ZYEA 4RAYA 4B09A 5JHUA 4OIPF 4FT8A 4AVPA 5AONA 4EM2A 4MQVA 5LHGA 3ZPLA 4A6EA 3RPQA 3NQOA 3QPHA 4U7DA 2XROA 3TKYA 3GW2A 2EV6A 3DF8A 2F2EA 3M9AA 3ERED 1R1VA 3U1DA 5D5VB 4DNCA 3BZ6A 3E6BA 2QLZA 2XUBA 3WE2A 1GXQA 4GXOA 1D3YA 3DPTA 3LFKA 1Q1HA 2A07F 3WTSC 3IWZA 1S8NA 2EWNA 3VEPA 1S7AA 3TDZC 1IN7A 2E7XA 2FRHA 3E6MA 2DK8A 1MJAA 3ABUA 1SD6A 1U6GA 1R5GA 2B0LA 1X3UA 5DCMA 3T8RA 2BEOA 1I5ZA 5TRDA 5ICEA 3BJOA 1S29A 4A0XA 4Q47A 1IW7F 4UNOA 3ECOA 2IVMA 4XLPF 2VC0A 5J6XA 3I64A 3TOBA 4KMUX 3U9GA 4HBLA 5LEJA 4MEXF 2X4HA 1RUOA 2VXZA 2P8TA 2Q8KA 2TDXA 5HDNA 3ULQB 2DTRA 3K1NA 4LD5A 2VOPA 2IW5A 3BPXA 4CGZA 5H6QA 3E97A 2ACJA 2DO7A 1OPCA 3I59B 1WI9A 4KNYA 1UB9A 1MKMA 2QQ9A 4CHUA 5J8CA 2EFNA 4KUMA 1OKRA 5D8KB 5HLHA 5DCFA 1BOAA 2XKPA 1FYMA 1OR7A 3F8NA 2YU3A 2K4BA 1DPUA 4U0WA 1ONVA 4IJAA 4A5MA 4XSXF 2XAQA 1MD0A 1XMAA 5AIPA 1U2WA 2M8EA 3L7WA 1P2FA 1QBJA 1KQ9A 1F9NA 2KKOA 3GYHX 3P7NA 4L9VA 5BQTA 2VC1A 2VT3A 1S3JA 1TNSA 3MCZA 3FZVA 4UVBA 5JFRA 1Z7UA 4EV0A 4HDUA 5KVRA 2QENA 4RGUA 2QVOA 2FEZA 2Z9OA 2HGCA 2Z5UA 3O6BB 3BOQA 4Z2YA 3R61A 3IKVA 3MZYA 2Q2EA 3M1EA 4HA8A 1LQ1A 4KIFA 1RI7A 2FMYA 1SD7A 2CSOA 1K79A 1USSA 2YSRA 4MQ9F 2PN6A 1FLIA 2A6EF 4U0VA 2FU4A 1OYWA 3ZN0A 4CXFA 3V8JA 1XGNA 3VB2A 3RJPA 2WV0A 1R58A 2F5CA 2GZWA 5FO5A 3L2CA 5FFXA 3KFWX 3ZMTA 5JVTA 2R7DA 4LG0A 4EMSA 4N9IA 1G3YA 4UUVA 2GA2A 1ZLJA 2IPQX 1GHCA 5HLGA 1RNLA 5HVQC 4Y15A 3T1BA 4R79A 2ZNZA 2ZMEA 3SQNA 2XAGA 3ECHA 2X0LA 1I27A 3G3ZA 1PP8F 2GXBA 4IRHA 2PMHA 4AIKA 1T98A 4N9HA 1LDJA 2HTSA 2CFXA 3B02A 4A0YA 3CLOA 4WK8F 3J80Z 3KEQA 3DXJF 2BBYA 5ILUA 3RKWA 1U78A 5D5UB 3VOEA 1G3TA 3KP2A 4G7ZF 4GYIA 2IJLA 4Q48A 1P4AA 2KIFA 3REOA 2FQ3A 5ED4A 1QGPA 1R1TA 5HS8A 3LA3A 2ZCWA 3R4KA 5DD8A 4O6JA 4I2OA 3HOSA 4B8XA 1DPRA 1T0FA 4HW0A 2P4WA 4O5VA 2V1UA 3BROA 3EUHA 2QUFA 1J59A 1P4WA 4LLLA 1YLFA 5HLIA 3BPVA 3QOPA 3TGNA 2EJRA 2XRNA 2DU9A 2OQRA 4MTDA 1FBQA 3W6JB 4M6XA 4MNUA 4KIBA 4BNCA 1OMIA 3BY6A 1FSHA 3WODF 4EM1A 3CUQC 2HTJA 2JZYA 2CQKA
chains in the Genus database with same CATH superfamily
2OD3B 1AVWA 1BTUA 1T8NA 2VJ4A 2Z99A 2CUFA 4ASHA 2BZAA 3E3VA 4Y7AA 2JIZD 3BG9A 4ETSA 3CUQA 2ZC2A 2BY2A 1RTLA 1IQJA 5F6MA 3GVAA 1LFPA 1EUFA 1YC0A 2DFEA 2DT5A 3OY6U 2G55A 1D6WA 3LSIA 1IQNA 2GTBA 4PGHA 2VQHA 2P8OB 1BITA 2FOBA 3OYMA 2R7ZJ 1IRFA 3MMGA 3BR3A 4EJWA 1YPLH 2VGCC 3C1KA 3VPKA 3MH6A 1UJ8A 4XSZF 1PUFA 3CC4I 4BACA 3H1CA 1TNIA 5JBAS 2YMSD 1O31A 3TGIE 2ESTE 4YO9A 3WTXC 1V2LT 3H92A 1TWFJ 1YIOA 4TYDA 3K7AJ 1ELAA 2RV8A 1LHCH 3LKWA 2OZUA 2IA1A 3K2UA 2CV1A 3G2BA 4HAMA 2G5NA 1R36A 4BKXA 1SG8B 1OS8A 1HPGA 9LPRA 2UZKA 3J81Z 1J0RA 1RIOH 3E0PB 5LGNA 4OS4A 1S6FA 4LJZF 2EV0A 3RC4A 4JYUH 4RN6A 1DM4B 4E70A 1FIZA 2OC6A 5ESTE 1SGNE 2PX9A 4YLUA 1H1BA 2EFOA 2NVTJ 1Z0XA 2NNYA 3S8PA 4WY3A 2ANWA 1XXDA 2FNPA 4ON0A 4B1RA 3ENSB 3ELAH 2GDEH 3ATMA 2QYOA 1YG2A 3MNBA 1TX8A 2A6TA 2DI3A 1K0HA 3LSGA 3MOCA 2EZHA 5DGJA 3ATKA 1GMDG 2PKSC 2FX4A 2ZHWH 3MU0A 1YKTA 1JXPA 2ZMEB 1TT5B 1GCDA 3FBIB 4L0ZB 1AIXH 1RFNA 3TJVA 4AB9A 2J97A 1A5IA 2OP9A 1UO6A 3SV7A 1K6YA 3U28C 4RDUA 1BRCE 3I0TA 2D26C 2KZGA 3H9QA 1GGDB 3FFGA 1NH3A 4TPIZ 3FXUA 1H0MA 1LPKB 1YP9A 4RB0A 4OMZA 2M3AA 1EH6A 1Z9CA 3L33A 2FP7B 2HKOA 2IGOA 2NU1E 4LK4A 1TPSA 3M35A 5BS6A 4I0AA 4OWRB 3CCQI 2OUMA 2J94A 5HKKD 1SLUB 1O3JA 2BDIA 4MFDA 3KIDU 3LSTA 2UXXA 2MGQA 5E3OA 1GHVH 4BJ6C 4EVIA 1A5HA 3PLPA 4IRGA 3PQJA 1L3LA 2PGBB 3UWIA 1O3KA 1V54H 1C1SA 3P9IA 3BTEE 3VWBA 3DKWA 1T56A 4ZYGA 4DGWB 4FUHA 1KQ0A 3SUFA 1O2JA 3OR1C 2XRLA 1YW7A 4RB2C 4L18B 2HQNA 3HKZA 4XBFA 1YYVA 1GJ9B 2E36A 2HWLB 2WY7Q 5EPYA 2L4MA 1AWFH 2JETB 4BUPA 4HYEA 3SDBA 1V4RA 1YJWI 2MLKA 3T27A 3FKIJ 4C3JJ 2LELA 4UD9H 1GHBF 2MSYA 5FLXZ 2EIMH 4HZFA 3LOCA 3R0JA 4NC7A 5FBEA 5JBTA 2CU7A 4OINF 1RRKA 3CUQB 2X1EA 1YQAA 1RIWC 1TMTH 2DW4A 1TX6A 3RXUA 3I53A 2DBBA 5CYVA 4BE2A 4KELA 2G00A 4XN3A 1UHSA 1UHBA 4K5ZA 2OC1A 2G7UA 3NCLA 2JJ2D 3H9JA 2P7VB 3JCUC 4HTCH 3FHZA 3QZQA 2RNJA 3M8FA 2F3CE 2K27A 1PUFB 1CQTA 1ZAOA 1H4WA 2PLYA 3RYRA 1IQLA 3UNGC 2JJ7A 4AYVB 1DFPA 2JA8J 1O5CB 1LHDH 2ZPRA 3MNSA 3ATLA 3GTOJ 3GY8A 3P8NA 2CQXA 3WTZA 1XGSA 1LVBA 1KXFA 4PFPA 3ZZ8A 3WHCA 3MKZA 4ISHH 2F6CA 5F1RA 1FIPA 2ZC9H 1GDUA 2QKMB 2O8XA 2A2QH 4CZZA 2AXLA 3FN8A 2ZHQH 3VB3A 4BTUB 1J2XA 4YTAA 4I99C 1TALA 1Z1DA 3V7TA 3DEEA 2JWTA 1IQKA 2ZKZA 2MH2A 4ZCNA 3CCVI 2KHMA 5B5EC 2THFB 3SYTA 3JAMZ 3ZZDA 2YMSC 4E7IA 2ETHA 3UOUA 3BEUA 2BZTA 3K65B 3SZEA 1V2JT 1SLVB 2K86A 1UVSH 4AGKA 1UELB 4JZIA 2K9SA 4FETA 5A8YA 3C3WA 3M4OJ 2ZIQH 4IPAA 3M7UA 1NROH 4CH8B 3GCTF 5EQRA 1QPMA 4MEYF 2BY1A 3LNQA 2PLXA 3EAJA 4Y13A 3OYJA 1D3QB 2HVXA 2P6TA 2M8GX 3LGTA 1XXFA 2CHAB 4ZZDA 1ZRCA 7LPRA 1KYZA 1SGFG 2JSPA 4DT7B 5GP9A 1GPZA 3KQEA 3I77A 3E5XA 1O30A 1UVPA 4L9JA 1C0WA 2I6SA 2KJBA 4MTEA 1DUXC 5IP7J 1GJ7B 3M3YJ 3WWFA 3TQNA 2VBYA 1NN6A 1KA8A 1POGA 4DIIH 3GISB 1BIOA 4GHTA 1ZLRA 3S1QJ 5JR3A 3RKXA 3TO9A 3FXKA 5DCMB 2GCTB 4IXAA 4EQQA 3QO6A 2XV4S 5HIYA 3LA2A 2EH3A 5FLVA 4AN7A 1GBTA 5A0BA 2FMLA 1DWCH 1ZGJA 3JREA 2HZDA 4LLGF 5DP3A 1C2HA 2HNTC 1SD4A 1SVOA 2VVVA 3KP6A 3W2WA 3OY9A 2MABA 1TWGJ 4XQFA 2LD5A 2NOJB 1TABE 4BQOA 2F4MB 1CT0E 4NIXA 1VGCB 2TGTA 4A3CJ 2DOEA 2A1DB 2GV6A 3HOZJ 3LSHA 4K69A 4YZUA 2HYJA 2XF7A 1R49A 1AE5A 5L3FA 1FAXA 4UFFH 2GT8A 1ZREA 2AFQB 4ESBA 3Q5FA 3G4SI 2X85A 3W2VA 3I56I 1WJBA 3DFGA 4OGYA 2E60A 1LB2A 9ESTA 1PQ5A 3JRIA 1R23A 5DO4H 4ACAA 1ZTLA 3LH3A 1AWCA 2DT6A 3C18A 2BD8A 1QRWA 1ZKGA 3HGNA 3FANA 2MBFA 1UG0A 2B7EA 2RQQA 1UHBB 3PSIA 4JYVH 2COMA 2L7MP 3DTEA 2QAAA 3HB9A 2ZGJA 2V3OH 5CJ9A 5FCRA 4RT1A 2H5CA 1O3BA 3K4JA 1PYVA 2KDZA 1P09A 1ACBE 4I98B 3OSGA 4FE7A 3DTKA 1RZ4A 1O3IA 3TL4X 2ZDKA 4OIOF 3BIUH 5AFZH 1TOMH 3CCRI 5DD4A 2ECBA 2OTLI 1LPGB 1SOZA 4BXWA 3RPUA 2B9SA 1C9PA 4BDZA 1YYY1 1TE0A 1ZN2A 2F5FA 4CCMA 2CRGA 1SFOJ 1Y6IA 1Y39A 3NAUA 3K70D 3S1MJ 2QSFX 4G7HF 3BG6A 4EM0B 4ZJZA 4GUXA 2A69F 1R1UA 2XCFA 5C5OA 3ZVGA 2QXHA 4B43A 4NC6A 3BG4C 3QLPH 3FX3A 4G9YA 3TEDA 4B71A 2EZIA 2J5PA 5EIYA 1Y56A 3LT3A 3MFJA 2QE7D 1DLEA 1H8ED 4HI3A 2ZFWA 1WQSA 2BXYA 2E19A 3HTSB 1BTPA 2HNHA 3EUAA 4XRFA 5EODA 4BBRJ 2A68F 4EJOA 2H9EH 3VDXA 1A0HB 3LA7A 1VQKI 1SQAA 1OPHB 1K83J 1KXBA 2DK5A 3HSFA 3FKSD 4ABDA 2BXZA 4BHBA 4E6KG 2P3FH 1QBVH 3PO1B 3S16J 2O8TA 2XAFA 2FE3A 4INHA 1VQOI 4RGXA 2OLGA 3A7WA 1ANCA 1Y5AT 2D2DA 2R3UA 4D0PA 4C9YA 1G36A 2MC3A 4UY8I 2FM2A 4DZPA 3M07A 1HW2A 3KIOA 4HNUA 2O8LA 5IP6A 2K8IA 2P0WA 5F04A 1QBOA 4CRFA 2AHME 1TW3A 2LLKA 3K6YA 4A1VA 5LBQA 1QURH 1BTHH 3A7YA 3QODA 2AEIH 4A3GJ 3ZRGA 1H9LB 2PW8H 2D1VA 3HRSA 2OQUA 2B5TB 3S2WA 4M74A 4D76A 3RXCA 1HAXB 1HCGA 3L3TA 2KCOA 5GTIC 4F3QA 1YWUA 2O3FA 5HXFA 1TYNA 3WHBA 4DOZA 1ABIH 3T29A 2YNBA 2ZTZA 2G5VA 2A7CA 1E34B 2YNAA 4L9TA 1LMWB 4A3FJ 1SGYE 1QB1A 4I31A 3VYSB 2VWLA 1O57A 1D4PB 6ESTA 3BR2A 1RRJA 3TNTA 1QGFA 2Z7FE 1NZQH 4A1XA 3H0GJ 3BZKA 1ARCA 5GCHG 3T8TA 3PROA 3RKYA 2HPPH 1TONA 2GT7A 5E0JA 5GXPA 3A0HC 4L5JA 3P9CA 1TPAE 4A5TS 1R6RA 1T7CA 5E2PA 2NOGA 1HBXG 2H6MA 2M30A 1HC8A 3TO7A 1CGPA 3KEEA 3F8MA 3HRMA 3V7RA 1S5SA 1TRYA 1J5YA 1XKBC 5C1YA 1YGCH 5EJZA 1JBUH 1LEAA 1BUIA 1IG7A 1SGPE 2Z9GA 3A83A 2FIRH 2ZGHA 3KP5A 4MTBA 1WVRA 1JMOH 3ZVEA 2M45A 3KP3A 1DQUA 3LC3A 1ZYOA 4ANJA 1GMHF 3M5NA 1DLKB 3JTGA 1O37A 5EEGA 2FBHA 1NC6A 3PO2J 4Y4RA 2M87A 4PSWA 2NS0A 1J14A 4G94A 3PV2A 1NY22 2FTLE 1BW5A 1E0EA 3RU4E 1E3PA 3GZNB 2Z9IA 1UTPA 1TX7A 3H5RA 4ABJA 5D4RA 3F6UH 1JKPC 1OXGA 1KZHA 1XB4A 1VR1H 2ZCLP 4XLNF 4X2XA 3QP6A 1KLTA 4LFUA 2JH0D 3A0BC 2BE5F 4ZYAA 1IQEA 4PJNA 4TSFD 4CUGA 1A2CH 5T1VA 2DFFA 4GO1A 3ZGKA 1SHHB 3DPUA 2GIVA 1XM1A 3TK5A 2HPIA 1MNDA 3CC2I 3P17H 3PMHB 2BVRH 4LMYA 6PAXA 2FBKA 1V2OT 4K2YA 3E6PH 3FXRA 1WYKA 2LDUA 2EEKA 4ZYDA 2KX4A 2W5EA 5FX6A 1J8AA 1FX7A 2EI7A 2WUCA 1PQ7A 4N4OB 3QP5A 3H5AA 1W5TA 3HKJB 1IF1A 2CGAA 3EPZA 3F0CA 2K9NA 3OYAA 4BEHB 1AB9B 4AIHA 1O0DH 3E1XB 3NK8A 3ERMA 4KN4X 1YTYA 3H3ZA 3P5JA 4ZH4F 1B5GH 1FYLA 5ABWA 2WAFA 1BR2A 3GCHC 1TAWA 1WH7A 2L9NA 2ZU2A 1A61H 2KRFA 3CCSI 2J95A 3Q76A 1C5SA 3DV8A 3OMYA 4AWXB 2VQCA 2M1BA 4A3MJ 1G9IE 3Q3XA 1I3AA 3I54A 1ARBA 4AYYB 3DU5A 5IK2D 4F49A 4XRNA 2VKDA 4BU2A 2WAQA 1LHEH 3GFLA 4TWWA 3HC7A 3RYPA 3RKQA 3RDIA 3UWJH 2FXRA 2YUSA 1HXDA 3MFKA 1TWCJ 4DBQA 4IN2A 3RMMH 2XBVA 1P57B 1PP7U 5C94A 4ZC3A 5B1BH 4KA4A 4B6EA 2VB6A 3L2WA 1SGQE 1BC8C 1ETRH 1ENHA 3L00A 1P03A 4KISA 3KYGA 1YHQI 4EJVA 3A2KA 1A04A 4O3MA 2OCEA 2QQ8A 5DSFA 5KCMA 7GCHG 4UFDH 2Z3YA 1JI8A 2MD5A 4A3KJ 4NIVA 5TJXA 1WCZA 1R22A 5JLXA 4FX0A 1OCZH 3VYRB 1JJ8C 2C90B 4K2EA 1H9TA 3KETA 4WXDA 3OWTA 1GVLA 2HKXA 1BB0B 5C67A 2WWYA 3E1SA 2Y31A 2VONA 4XBDA 1O3RA 2A7JA 4B75A 1EKEA 4X1QU 1AFQB 2HGTH 1VQNI 1OWHA 2OTJI 4XSKU 4X1NU 1EX3A 4XE4A 2ZTXA 3M8JA 2WB1N 3VXEH 2NU2E 2M7BA 1RGQA 3FDYA 3VGCB 4ABIA 1XGMA 2VINA 2AMPA 4ZKSU 3SNBA 1E1QD 3VB7A 1L1NA 2ZNKH 3GTGJ 1A3BH 3TGJE 1U5TC 5E8GA 5F53A 1EA3A 5HMAA 3SNAA 1TRMA 2ZDMA 1Z71A 4HDVA 1MBQA 4AGJA 4MPVA 2VVCA 2XW9A 3DEWA 4Q80A 1QHHD 2F5DA 4LITA 5HDGA 3M5MA 1UTJA 3QGJA 4KT6A 2HYGD 3BTME 5DP5A 3I5UA 1NFXA 3BQYA 1A46H 1ETOA 5L2ZH 1P2JA 4CHAC 3GCNA 1RJXB 4EM2A 3OEHD 1L4DA 2LYCA 3LPRA 2EC9H 1K1LA 2EV6A 3D62A 5J4SA 3M3VA 4Y76A 2W6ID 4YELA 2W7UA 1CVWH 4HNTA 1GXQA 1D3YA 2HOBA 4CBOA 5JPMH 5A0AE 1S84A 1GHBG 2LR8A 3UNSA 1LVOA 2WV1A 2JKHA 2QEXI 2FESH 2H5DA 3TH4H 2QSHX 8ESTE 3OYKA 2E7XA 5FCKA 3ABUA 1CSOE 1MH4A 2GMTB 4C3IJ 3I3LA 4D7FA 1OCTC 3ONQA 1SANA 4A0XA 2AGEX 1ZJKA 1X58A 1BHXF 3K4NA 3ECOA 4KMUX 2BY7X 4HBLA 1P7JA 1MQ5A 2XPVA 3S9BA 1C1RA 2X4HA 4E4HA 5FJ8J 3FP7E 3Q0WA 3PNTA 2TDXA 2DTRA 2QYIA 3SJ8A 4LD5A 2GOXB 3SNEA 3BPXA 2HXIA 3F9KA 3E97A 3SOSA 1V55H 5EJLA 4X1EA 3QZRA 1AA7A 4XNFA 4KNYA 1FJLA 4BQNA 2P8OC 1ZTKA 1W0TA 2QQ9A 4J00A 1WAYB 2EFNA 1YY3A 3AG3H 2Y5HA 3P8FA 1YE9A 2IGNA 2AXTC 3PRBA 1YITI 1OR7A 3HOYJ 2VKHA 1DUAA 2FI3E 2YU3A 1HAZB 3RMNH 2EPFA 2K4BA 3P6ZB 1OYTH 4CZCA 3LGYA 4RM2A 5DPAA 2ZPQA 2M8EA 1OWJA 1QBJA 5CDFE 3ZQIA 3S7HB 4O3TA 2R7OA 3PUBA 3ZQQA 4IKFA 2E2HJ 4FUEA 3MCZA 3GCTG 5JFRA 2K9LA 4EV0A 3S2HJ 4HDUA 1CGJE 3RXTA 2QENA 1WCMJ 1PYTC 3R61A 1VQ4I 3WU2C 1ZOMA 4ZKNU 1GI8B 2VI6A 1ZK8A 4YOGA 4ABBA 1K79A 1UTNA 1ITYA 2UWLA 1FLIA 1O3OA 2J98A 4WVPE 2FU4A 1WI3A 1SC7A 3RZDJ 3V8JA 4NNJA 1BJZA 3VB2A 1S0RA 3L2CA 4IGDA 2ULLA 2ELKA 2ZMEC 3GCOA 3SZNA 2XSDC 2BY9X 2IPQX 1XVOA 3IUOA 3HPTB 3NRLA 4CBNA 1RNLA 4BE0A 2BQ7B 4GVUA 1FY5A 3PMBB 2EILH 1JWTA 1IDZA 3SI4H 1GGDC 3GLLA 2DE9A 1O4XA 2ZA5A 1B0EA 1K1MA 1LDJA 2HTSA 3Q0VA 2Y2ZA 3SI3H 2CFXA 1LFUP 2XC0A 1BDAA 2ZGCA 4O97A 3SDGA 3OTJE 4WK8F 4IO9F 3UY9A 3FISA 3UB0A 2BBYA 2IS6A 4FU7A 1FDPA 2NXNB 4GYIA 3SV8A 2IJLA 3HOUJ 1MBFA 5T6DA 1LVKA 4Y8ZA 2KIFA 1QBNA 2FX6A 1NG7A 1MABB 1UTQA 2ZCWA 7ESTE 4WMFA 3QUMP 4DY7B 1GI5A 4XLCA 1VITH 1W11U 4I2OA 1IDYA 1DPRA 3W95A 1XUKA 2P4WA 4ESTE 4I6ZA 1PPGE 1C5LH 2ZQ2A 2K5CA 2ZWLH 2F9NA 1Z77A 3EUHA 4X8UH 2JETC 1Y8TA 1OCRH 1TT0A 5JB9S 3GY2A 1W7XH 5HLIA 3TGNA 1U8BA 1E38B 3N7DA 3R3GB 1UTMA 4GPGA 2F48A 3S1RJ 2E2JJ 3HZJA 2BXTH 1DWBH 1OMIA 1R4MB 1FSHA 3CUQC 2JN6A 2JZYA 4B3AA 3MQKC 1SFUA 1WJCA 1TWXB 2KP6A 4RB1A 3TGKE 1ZR0A 3F68H 1KSNA 2VWNA 4XOJA 4E7LA 5EEAA 2B63J 4RS8A 3ZZ5A 1L1JA 1TA6A 1UK3A 5FKKA 2Q6DA 1BA5A 2WINI 4BXUA 5HM2A 3E7LA 1T39A 3T62A 4AC0A 5BMZA 3ZZ9A 1O3TA 3GYMA 5AF9H 5EU8A 2LKXA 3E0NB 1AO5A 1QR3E 2VQGA 4L5EA 3PFIA 4ABAA 4DQ2A 1IRGA 3Q3YA 4KJZA 3SHCH 2BZ6H 3R6SA 5JB8S 3IRQA 3MU5A 1TQPA 4FUJA 3SGBE 3J7YJ 3PYHA 2BVXH 5KNLA 5C0UA 2HWVA 2GQQA 4K1TA 5FD6A 1UHMA 2Q0OA 3KHVA 4JBAA 2M0CA 2GD4B 2R2WU 3D0SA 1UTLM 1A0JA 1K78A 2CUZA 2ODYB 2W26A 2DA5A 4FX4A 1E35B 4M6VA 1MIJA 4UDWH 4K3JA 1JRSA 1AKHA 1IUFA 5TISC 2ALVA 4XN0A 1VZQH 2J98B 1O5BB 2CUJA 3AL0B 3ROUA 3KE2A 4X6NA 3LGVA 4EGZA 1GG6C 3JRBA 4RT0A 2R0LA 3N7OA 2A45B 3OYFA 1ESTA 2FLRH 1H9GA 4H4FA 1K6OA 1THSH 5TCAA 4JX5A 3ZIAD 1A0LA 1TNJA 2CHAC 2P3TB 3I58A 3JRDA 4XONA 1C1PA 3DPLC 3SUDA 1D0XA 1IHSH 5ERIA 3TJUA 2BGCA 1HQCA 3HPGA 1O3LA 4X8SH 4IVNA 3KLOA 3E6CC 1V2WT 3FM5A 3LIWA 3WGGA 3A8CA 2ZECA 5K1YA 1GVZA 3SFIA 1MU6B 3LONA 4Z6AH 1L2EA 2LKPA 2ECCA 2GCTC 3QPTA 1TQMA 3FXOA 2C8YB 3JRHA 1FOYA 4M72A 1BRAA 3DUXH 4YFXF 4RGRA 5T6FA 1EATA 1V2PT 5LHIA 4WCGA 4LB6B 1O2PA 2O9QA 2ZJ2A 3HOWJ 2D5VA 3L09A 4BAYA 3GY4A 1J16A 1NTPA 2QM3A 3V3MA 5CE1A 1HIAA 3SJIA 1R5ID 2WZQA 1HDTH 3W6VA 1RTFB 3O8GA 4JX4A 1VGCC 4AC9A 1E1RD 3CCYA 4C3HJ 4YIFA 5K5RA 1YI2I 2ZXJA 4BANB 2JMWA 4EGYA 2BD5A 2CQQA 5DV5A 5HDKA 5J3LA 2FUG2 1DXWA 5AIQA 1IQIA 1TGTA 4YFKF 3SHAH 4HQEA 4GSOA 3M36A 1E17A 3MI4A 1O2SA 3RXBA 4J01A 2DCEA 3LQRA 2RN7A 1N8OB 5LGUA 2BX3A 3GOVB 1P2MA 1GHZA 2CW8A 2ZF0H 1AKSA 1K22H 1WSUA 1Z67A 2V7QD 1T8IA 1KTSB 2A2XH 3PV4A 1DT2A 3ZZBA 4AG2A 3QYFA 3EUKL 3S2DJ 4S0HB 3G71I 2Y5GA 1P12E 1ZPCA 3E90B 3KEOA 2ISZA 1MD7A 3HUGA 3FIWA 3TJNA 4G6QA 2VASA 2QWWA 1T2KA 4M3GA 3ABMH 2F4LA 2DPDA 2E1MC 3M8EA 3E5QA 1SFXA 3QPLA 2R93J 3MZHA 3WY8A 3TLOA 1RR7A 3ATIA 1HRTH 1UHWA 1UVTH 1Y8QB 1V3XA 4IC5A 1KU2A 1TIOA 1X3ZB 1MKWK 3PQKA 1DWEH 2BOHB 1K78B 1BTXA 3JRCA 2BDGA 1VITG 5E0HA 2JRTA 2L9RA 1MTNC 2G4TA 1TWHJ 2F9UA 2VIOA 1AKHB 3RXDA 2F9PA 1FY4A 1LHGH 1MZAA 1A6QA 2DDBA 2D1HA 4NIWA 8GCHG 3OSFA 1RD3B 1ELGA 3GX4X 1NTCA 3HKZN 1Y3XA 5IP9J 2I5UA 3FM3A 5EZGA 1CHOG 2WPKS 4G7OF 2NS8A 1INCA 1O2LA 3CZ6A 2HLCA 3DSPA 1TGSZ 1Q1VA 3SEQA 4FUIA 1JE8A 1BMLA 3TOAA 4FUCA 4AFUA 1C5QA 2EBIA 2IOTA 2R5ZA 2DUCA 2LNCA 3GLXA 4R8TB 2H94A 1VQMI 1Z8IB 4AIJA 4WXIA 4CRCA 2XHKA 2LVSA 3P92A 5IOYA 1VI0A 5CVRA 2HALA 2CQ7A 1QCPA 3WWBA 3BTGE 4NCYA 1MSFC 1TLHB 1Z91A 1MMJN 4AD9A 1XDSA 1YPKH 4WMEA 3WTTC 3QX5H 1TMBH 2ZGXH 3TDUC 1LKBA 4PROA 5E79C 1H9HE 4Y6DA 2R7UA 1P0SH 1Z3XA 4L0YB 1UG2A 4LIUA 4IHXA 1QU3A 4CICA 4EJTA 1HIAB 5HM9A 4P55A 3IWFA 3K4KA 4UXNA 5D6EA 1NRNH 1O2NA 1GJAB 1MTVA 3LDXH 3HSRA 3NXPA 2FOKA 3QTOH 2WB1A 3QOEA 1MD8A 1F1ZA 1B9MA 1W3CA 1NT1A 1GBMA 3RMOH 3GF2A 1YW8A 4ABFA 1B8IB 3KCGH 3KZZA 4DYRA 5DUIA 1TPOA 2W00A 5HODA 3PFYA 5A2QZ 5CVVA 2RCEA 1AKSB 4BQAA 2JJ1D 2XGXA 4NUBA 1PPFE 3A80A 2V3HH 1FT9A 4NQWA 4B4CA 5C1UA 5F6FA 2UWMA 3MEXA 5EGMA 1BQYA 2GV7A 1TC3C 2SNWA 5FXLA 1LVAA 3HUGB 1YCPM 4JYTA 3ZMZA 5FD5A 5L30H 2PWXA 2R2MB 4ITVA 1AGJA 5AFYH 1I6XA 2O0YA 3SO3A 2BOKA 1SB1H 1HJ8A 3IH2A 2ESNA 4YFNF 2FZZA 5FKOA 3WGIA 3O8RA 2FDAA 2WUBA 1LFBA 1KLIH 1FY1A 4OIRF 2M4GA 3BR1A 4FASD 1VCQA 2FLBH 3OR2C 1L0ZA 1BA8B 3GY6A 2GIZA 3RXJA 4GRIA 2GCHG 1L1GA 2SGAA 1OYIA 1ELCA 2F9OA 1UCYH 3OYCA 3TH2H 1MAYA 3E8LA 4RB3C 2TGAA 3CP8A 4AX9H 1JHHA 1QTFA 4UUTA 2CV3A 1ELDE 2VQLA 1IOEA 4JZDH 5DN6D 2DJNA 2KFDA 2R7QA 4HX8A 3KN2A 3M5OA 2PSXA 1GHWH 3TP0A 1W5SA 3OFND 2PBIA 4AB8A 3LAPA 1ZGIA 3ML6A 1MJ9A 1XUGA 2WAEA 2PKAA 2DA1A 4Y3OA 2R5ZB 2HDCA 4E7RG 1Z6JH 4NWLA 2HNTF 4CCKA 2ODPA 2A4OA 3CJQB 4DIHH 3WG9A 1I3QJ 1DXPA 2VN2A 3L9FA 4ISLA 1MBJA 1OWDA 1E0FD 3L2RA 3SORA 2FMJA 3TO6A 3N05A 3F3BA 3BCAA 4I86A 2GBYA 1W36C 2V79A 5IT9K 2AGIX 5FHTA 2DT7B 1AB9C 1MKXH 1QRYA 2CYYA 2ELHA 1Z1JA 4M9SA 3KF2A 1D0ZA 2JK3A 4XLEA 3O2PE 1F92A 2CMPA 1RS0A 1TMUH 3A4CA 5D5XB 2FWWA 1B1BA 1O2HA 1FC3A 4FTHA 3SUEA 1YLNA 2IXSA 2A61A 1IN6A 1TNGA 2O5RA 2L7KA 4WH6A 2P5VA 3BJAA 1FP2A 5C4XJ 4A6LA 2ZXWH 4ZHLU 3F2GA 1GI1A 4A2UA 3Q9SA 1EP6A 4D8NA 3K4MA 2L2OA 5J4QA 2H6BA 1C5OH 2HYFA 2EA3A 1C2LA 2M9HA 2PQ8A 2BW3A 2CWEA 2LBFB 1NRPH 1YOVB 3B73A 3FP8E 2WPJS 1WGXA 2KZVA 3QPSA 3CQZJ 2EV5A 3MH5A 3SZTA 2DLLA 2G7HA 1DP7P 2P6SA 2X51A 1HKSA 1CU1A 1WJFA 3AAUA 4MGRA 3S1NJ 4R1HA 1Y1WJ 1SGTA 1KU3A 3RI4A 3SQEE 1GV5A 4Q4ZF 5JVGF 2ZEBA 1NRQH 4FCYA 3G01A 4RBOA 1XX5A 3G73A 2C8WB 1FPQA 1YPJH 3C27B 4I76A 1NFUA 2FI4E 1NG6A 3D1NI 2JA2A 4P5OA 1I50J 4A3LJ 2W4SA 4X8VH 4IHSA 3GO5A 1FX0B 3AW1A 2OZ6A 3H5CB 2HPQH 4CR5A 4PGGA 2QZ8A 3AVZA 2VGCB 1FLEE 2ZO4A 4ZTFA 1P9SA 2YX7A 3J7ZI 1IXRC 4KT5C 1QO0D 3Q77A 1P2KA 3ZQCA 2F83A 4V2GA 2IN2A 5CHBA 2XIGA 3PSFA 2FOAA 5DP7A 5T6GA 4OAZA 2P5KA 4XKVA 2UXNA 3WTVC 2E1CA 2FD5A 1SVLA 2JPBA 3WTWC 1XUIA 4NG9H 5HOOA 3SJOA 1P11E 4F55A 4HV5A 1P8VC 4B1TA 4ZROA 2KIMA 1S6LA 3H5NA 1ZARA 2D45A 2XGCA 1KONA 2C3SA 1FY7A 2BHZA 4V2FA 1FZPB 4ENKA 1UVOA 2Y75A 4CRAA 5DP4A 3UAIC 3BEFB 2NVUB 3GZ6A 1A4WH 1TPPA 2IEKA 3ODDA 2PKAB 1HFDA 4E7KA 4KTCA 1DY8A 4O3UA 1OYQA 3OOPA 4YLQH 1W4MA 5F08A 1KQ8A 1E2XA 5HS7A 4KICA 2GM4A 4D5CA 3SU3A 1KDQA 1FOWA 3RXMA 4BBSJ 5FKLA 2MG4A 2NS7A 4JX6A 1S7OA 2G51A 2XOKD 2CS3A 1PVEA 1LVMA 4BE1A 4DJZB 2GMTC 1DVAH 2WY8Q 3OU0A 4D1QA 1MZDA 4NA8A 1TW2A 2FBIA 2F4IA 3ZXSA 1EZUC 3RXQA 3GTPJ 3SBKA 4UVCA 1ZYRF 1HGTH 3A8AA 2XGDA 5K7FA 1O2YA 3FAOA 1YO5C 4IW4E 1N25A 4MLFB 3CS7A 1KMHB 3RXOA 4XLAA 3RXPA 1HKTA 5DKMA 3ZZ4A 5FKNA 1XUFA 2VBCA 2FOEA 3NWUA 1BM9A 1J75A 2XAHA 4BDYA 4ASNA 3T2NA 2LNBA 5JYIA 4LK1F 1IHTH 3CENA 1P02A 2LREA 1C2GA 2BW3B 5B6OA 5E1WA 1IZ1A 3JZ1B 4YT7H 3M7TA 3DWLE 3BR5A 3GTJJ 4A12A 3AKZA 2FOMB 4X2VA 1BJAA 3FP6E 3CNRA 1F43A 4WF8A 3UIRA 5FGMA 1CA8B 4YOJA 4E7HA 4B6FA 5GAHJ 4X1PU 1X1AA 2JT1A 3EA7A 4B74A 1GXPA 3RP2A 2DQLA 4Y0YE 1J9CH 3J7AO 4H6SB 1FYKA 2LTPA 4M73A 3WU1B 1O5EH 1QZ8A 2DA3A 1FWZA 2K02A 1C9TA 2W24A 4M3EA 4UE7H 3F21A 2XPWA 4I8KA 2PJRB 2UUKB 2LH9A 5HLTA 3FOAA 4YXWD 1ZPZA 3IAM2 3DHKH 1HOMA 1WV7H 2LRDA 1MMAA 3X2QH 4BXXJ 1W14U 1V3FA 2W6JD 1YPHE 4VGCB 2R3SA 2HQ5A 1OOKB 3PLBA 3UKGA 2CG4A 3V8LA 1D5YA 4IS5A 2MFZA 1J7KA 2WBMA 4LZ4B 4INKA 5DEQA 4CCLA 5M3MJ 4JK6A 3BLYA 3ESTA 2VNTA 5FKMA 2VBXA 1K9OE 3VFEA 2KZ4A 2LPRA 2E1NA 1QL8A 1QJ6B 5C2ZA 4SGAE 1O2KA 1EASA 1G8XA 2DAOA 2DMNA 2M2EA 3U1KA 3URCA 2LF7A 2RKHA 2WAQN 1EF4A 3BWGA 1BW6A 4A7IB 3CJTB 3R0AA 1A6IA 2ZFSA 1NHAA 2YMSB 1Z6TA 1B6AA 2ZFRH 2OF7A 2VT2A 1O3PB 1N78A 2F9VA 2FOFA 1ZGVA 1O2UA 4RAYA 4FT8A 2XF6A 1IQMA 2EIJH 1THPB 3GY5A 4MQVA 3UQVA 3OL4A 3TJOA 2QGUA 1AVGH 1GMCF 4DG4A 1ELFA 3RDZA 3QPHA 2GZ9A 2R9PA 2Y9YA 1KDQB 3MU1A 2F2EA 1U0JA 3U1DA 4DNCA 3RLYH 3BZ6A 4ABZA 2B9LA 3PNVA 3LFKA 1Q1HA 1WPKA 3WTSC 2R0QC 3LMMA 2EWNA 3OYIA 4CH2B 3F0OA 2BM2A 2NU4E 1NU7B 2ZJQF 3TDZC 3EE7A 2HRVA 3SJKA 2DK8A 1MJAA 1SD6A 4BJTA 1U6GA 5DCMA 2BEOA 3CCEI 1I5ZA 2QA4I 5ICEA 2V6NA 2KAIA 3BJOA 3K2AA 3A02A 2JUCA 4YT6H 2KRHA 4XLPF 2VC0A 1AUJA 3TOBA 5LEJA 4U2WA 4MEXF 3F2FA 4XBCA 5M5XJ 1RUOA 2VXZA 5AVDA 2BDHA 2ZGBH 2DJIA 3K1NA 3CDLA 2VOPA 5H4IB 2CXVA 2XCNA 1FAKH 2WPLS 1GUUA 2W3IA 3GTQJ 2DMUA 1IAUA 1ORFA 2ZJRF 2HDDA 2ACJA 3A03A 1K4TA 3E16B 1V2TT 1AFEH 1OPCA 3GDSA 3I59B 1OR7C 1TQ0B 1JUSA 4OM9A 1L4ZA 4KUMA 1S0QA 1T4VH 4J2YB 4DOQA 5HLHA 2W7NA 2J92A 2XDVA 1SGRE 2BY3A 2GVFA 3VYUB 2HI3A 1ONVA 4XSXF 2BQWB 4AU7A 1QZEA 1GBEA 4UUSA 5AIPA 1U2WA 2FOWA 3CMMA 1P2FA 1F9NA 2KKOA 3P7NA 2LK2A 1BCUH 1ZGWA 1YJNI 4L9VA 2QIQA 5BQTA 1SFQB 2VT3A 1S3JA 2VJJA 3UUZA 3F9FA 2VPLA 4IQJA 5JBCS 5KVRA 3RXGA 4Y33A 4RGUA 2QVOA 2Z9OA 4BL0B 2Z5UA 1K1JA 3O6BB 3MZYA 5IPAA 2Q2EA 4JZFH 5A8ZA 2STBE 1JT0A 4HA8A 4KIFA 1OP0A 1APLC 1RI7A 3W1EA 2L7FP 2FMYA 1SD7A 3SUGA 1O39A 1EZQA 2RFKC 4XRMA 3SYJA 1LDTT 1USSA 1NFYA 4FUFA 1LUJB 2PN6A 4U0VA 3QK1A 1GJBB 1SLWB 1C5NH 1OYWA 2KISA 3RLWH 2ALPA 1ZMJA 1JOUB 2UWOA 3DBRB 4FU8A 3RJPA 1TZLA 2WV0A 3PM1A 1GBFA 5C3NA 5CHAB 3KFWX 9ANTA 3MU8A 2R7DA 1GT0C 1TOCB 1G3YA 4UUVA 2BX4A 3KQCA 5HLGA 1T31A 5HVQC 4R79A 1C5YB 1TWAJ 3SQNA 2XAGA 4Y11E 3ECHA 2X0LA 3BR6A 3Q3SA 2EZKA 1PP8F 1IJWC 2JH6D 1QA0A 5EXMA 2PMHA 2WHXA 1T98A 1OKXA 4N9HA 5IDKA 4XMYA 5CPRB 2MW8A 3DKXA 4OS2A 1XUJA 2EINH 4B3XA 3HXLA 3KEQA 1C4V2 5D5UB 3VOEA 4E06H 3RCOA 1G3TA 4G7ZF 5LPRA 2P94A 5DS9A 1P4AA 3S0NA 4ZH8A 5ED4A 2XC4A 1PJRA 3HGPA 1HXEH 2DA4A 1VQ8I 4IOAF 3TK9A 1P9QC 2KAIB 3RSNA 1T0FA 1P2OA 1BTYA 4IN1A 5FLMJ 1IC8A 2V1UA 3BROA 2P81A 1V2UT 2QUFA 1J59A 1N8OC 2I8DA 1P4WA 3RU4D 3M3SA 1W7GH 1XS9A 4IZZA 3SV9A 2BHYA 3QWLA 1QJ7B 2O8KA 2GDDA 1XPXA 3SNDA 5F8TA 1FBQA 4MNUA 3C2GA 1ZJDA 4Y7NJ 4CYCA 4AOQA 4BNCA 3BY6A 3K4LA 5J1RA 4EM1A 3W94A 1NRRH 4D5FA 3A88A 4WWCA 3MNXA 4F52A 1AU7A 3ODFA 4LLNA 1GWAA 3URDA 3MN2A 1TNTA 3VB4A 5EXNA 3HDDA 1C5TA 2AS5F 3VSKA 2MC4A 3BG8A 2WPMS 1EAIA 3NPSA 3OS0A 2LMDA 4IHYA 4CR9A 2FYQA 3CS0A 3DSGA 5DP6A 3KP4A 1EAUA 3S17J 3ZV9A 4XKBA 2HOAA 2XWBI 3BTKE 5FB2A 3C2BA 1QZYA 3TVJB 2FPZA 5I25A 2ZXHA 2V1XA 1TBQH 1AUTC 1GDQA 4YG2F 1O5AB 3RXSA 4UUSB 4HG6A 2P59A 2X48A 4YIRX 4MG3A 3RIRA 3RMLH 2D2WA 1G3CA 4BQQA 4A3DJ 1XN7A 4DBRA 1QQIA 3TH3H 5DDGA 3MMYB 3LC5A 3P8GA 2RA0A 4MO7A 1ZRDA 3LSKA 1C1NA 1Z8GA 5L3DA 2YX4A 4CCNA 1W0ZU 3FMQA 2HXOA 4I09A 1BI0A 2Q2EB 1JGGA 4I01A 1GLNA 2VWMA 1MDMB 3ZMDA 2JTVA 3DLAA 2CW0F 4LB5A 1WJ5A 4R0IA 3O8BA 4SGBE 5C17A 5A2MH 3RZOJ 1ETSH 1F2SE 1UZCA 3I71A 4IRIA 2DA7A 2ME0A 2WSSD 1ZTRA 1DUEA 1E37B 2GLOA 4HQMA 1BRBE 1ZRBA 3O8DA 4NWKA 2KPMA 4GYGA 1XD7A 4GGGA 3I29A 3UNQA 5K5QA 4W97A 2EQNA 4E7SA 3ABLH 1KYNA 1MBMA 3EGKH 2P5LC 2VIWA 1ZELA 8LPRA 5CQEA 3CCMI 1O35A 3SGQE 4Q4LA 2Z1DA 4YESB 1SFKA 2JA5J 3KYLA 2BD9A 1W12U 1IQHA 4M6YA 5FRMA 4HEA2 1ZG5A 1T08B 5HNHA 5ILSA 3MWIU 3UFAA 3V7CA 1D3PB 3FHNA 1YCPK 4I8GA 2EIKH 4KYWA 2X1DA 3S7KB 1ON2A 4CRBA 2QA9E 2XAJA 2ZFUA 2H6CA 4R8HA 3GFIA 4CSWA 3IHUA 1BIBA 2BMGB 1C2KA 4IQ4A 1RXPA 1VKYA 2V9KA 3J80K 3FBNB 4BEHA 1GHYH 5E2OA 1SMTA 3HYIA 1AU8A 1FOXA 1CBWB 4AG1A 1AZZA 2ID3A 1R00A 4AFZA 2HS5A 3U8RH 3CTAA 2K40A 4DT4A 1JKOC 3RXLA 4RSPA 3MYWA 3U2RA 2OCVB 3GCHB 3U9AH 5FBIA 5LPEA 2R7FA 1ZR4A 4HX4A 4NDLA 1ZRKA 2A5AA 1FMVA 4CYCB 2K1QA 4FUBA 2GWRA 3IL2A 4DIQA 3OYEA 3F3XA 1C5MD 3FO8D 1BMAA 4HSTA 2QXJA 5C0TA 1ETVA 3CUOA 3OYNA 1PUEE 1ZZZA 3CO6C 1FEXA 3FZDA 3CMEI 3GTLJ 3P95A 3LOXA 1SD5A 2IRFG 1G2MA 4PJLA 1GVKB 3OY5U 3DCLA 1DS2E 1SVPA 5LEKA 1ABJH 4M9FA 5FFZA 3CDHA 3NUMA 5A2QK 3F1SB 3F8BA 5LLQA 3PMAB 3SFZA 1U9NA 3OS2A 3SQHE 4OU0A 4B2AA 3T0YA 1QIXB 2BVSH 1C5UA 2ID6A 3D5SC 1D6RA 3CCJI 1S72I 1EPTC 1GBAA 3E6DA 4I0BA 1UJ1A 2DMTA 1BC7C 2KFWA 2Z94A 4UB6C 4ENNA 2ZFPH 4M3DA 1UCRA 2WV5A 1LCYA 2R7XA 1WOFA 2BLVA 4BGDA 1E3HA 2ZFQH 1LPQA 3EQLF 3SV2H 5C4JJ 4MNVA 3CMAI 3UTUH 3B6CA 3BJ6A 4ISIH 2ODQA 2ZXIA 3ZR8X 2QQBA 1U8RA 1WKMA 5CVIA 5J47A 5KK1A 1CE5A 2DA6A 2AERH 5LRSA 4PJMA 3F6VA 1A3EH 1X19A 3CP7A 4WMDA 3VXFH 5DJ7A 1LEBA 2FSWA 2QY0B 2R3YA 1U5TB 3K1MA 4FOUC 1Z7LA 5D5WB 3JW4A 1F0TA 1TA2A 1EH8A 2W7SA 2B7DH 5IT9Z 4OAYA 1A36A 3PLKA 1T32A 1O33A 1GJ6A 4DCDA 1QY6A 4U7BA 3VB6A 4LZ1H 4A3EJ 2O9LA 1SGDE 2Q1JA 4K8BA 3NEUA 4CHAB 1ZSJA 2WV9A 1MMDA 3AFHA 4JZ1A 3QRFF 3RQIA 1K1PA 2BD7A 3A01A 1O2QA 1FTZA 1EH7A 1XKAC 4TV7A 2H2ZA 1P4XA 2M5WA 4Q7XA 2ZU5A 1LO6A 5E1XA 1E3OC 5GAGJ 1N6XA 1IQGA 5GWZA 2XB5A 5ICCA 1GBDA 3JZ2B 2VOOA 1JTYA 4ZDPA 4AYBA 1GBKA 1WBGB 3ATWA 2VJ5A 4WXVA 2FJ1A 2QV1A 1AI8H 4JQFA 2A05A 3HIFA 4PSXA 1HDPA 4P9UA 1GBJA 1C5ZB 2FF4A 1SGCA 1O3QA 5IYTA 2M4KA 3OTPA 1Y0UA 2CO5A 3SGAE 2HQRA 1W7PA 5H20A 1O2RA 2XVCA 1R9TJ 1GCTB 3MZ8A 1JUPA 1OWKA 4IMZA 2RGVA 3RXHA 2AYWA 4JMYA 1KGSA 2OA4A 4G6TB 1ELBA 5A09A 1SC8U 1UK4A 4M9ZA 2STWA 4A93J 1JIMA 1O3GA 3DKYA 3PJRA 1LE8A 1ZG1A 3UREA 2Q1ZB 4TPYA 1O5GH 3U1JB 4NIYA 4NFEA 2JVGA 2FOHA 3IG6B 1SEUA 2DXIA 2LFBA 1HJAB 1P2IA 1E36B 2HVSA 1MAXA 1TGNA 1PYTD 2MYSA 4WXCA 3EYDA 3PV5A 3ZZ3A 1HAOH 5J40A 3D49H 3IRRA 3Q9VA 4IEJA 3JTHA 1GJ5H 1MW7A 1O34A 2VBWA 2BB4A 1QRXA 2ZHDA 1EZSC 4ISOA 2VKEA 1C2JA 3QU3A 4DYQA 2C93B 1VJ9U 1OCPA 2VIXA 2IA0A 5J1YA 1WSSH 2J5UA 3GWZA 1TBZH 1X2NA 4P02A 1GV2A 1MTUA 2CGPA 3MQ0A 2OBOA 4AVZA 8KME2 5D8LB 2EI8A 3PB1E 4BTIB 2CJIA 4OS7A 3AG1H 1W10U 4Q5SF 1GMCG 3BZCA 2ME6A 3AK5A 3F8FA 1A5GH 3ZMUA 2A5KA 3R60A 3EE0B 5EYRA 1O7LA 4WF2A 1GHXH 1HF0A 3DLLF 2G81E 4S04A 4HPQA 3DBLB 4A3IJ 1VQ9I 1EOLA 4E7NA 4AUXA 3KYFA 2LY1A 2OC8A 2D8WA 2ISYA 2ANMH 4KMFA 1N1LA 7GCHF 1LNWA 2KR7A 4X6OA 3OIPA 5LHHA 1O36A 2RC4A 1GHAF 4XLFA 1MUEB 4CDGA 1WU1A 3GDVA 1D8KA 2RQPA 2ZCHP 2G0EA 4U01A 1X2MA 1HJ9A 3MKWB 3ZN1A 3OIOA 1VQ7I 1EAWA 3BV9B 3TITA 3V7SA 2KQRA 3PWCA 1ELEE 2LSOA 1C1MA 1KU9A 3HATH 5E3MA 5IT3A 5K5OA 2F4OB 5K7HA 1YFHA 5L3GA 1QQ4A 2Y81A 3RXAA 5GPAA 1W7PD 5F8ZA 3A01B 1ZHFA 4Q7ZA 3HRUA 4MLOA 3PMJA 1AQ7A 3IWMA 2E2IJ 2B0FA 4M71A 2Y0SA 1UAAA 2Z33A 2EA4A 1XGOA 3H3VK 6GCHF 1N77A 1W0KD 4RAGA 2XNIA 4B2CA 5EG0A 3WTUC 1EB2A 2BLWA 3V4GA 4ZDLA 1PPHE 4D7MA 4F7ZA 4BNRA 4GHQA 1ULYA 2PMUA 3NARA 1BRUP 4Y7BA 1TNLA 1IV8A 1OYYA 2YS9A 4UONA 1EOJA 2TGDA 4QTRA 3BTLA 5C20A 1AHDP 1JXSA 4MPWA 4IMQA 1WQ2A 2J5OA 3F22A 1Y3VA 4ZXXH 2QF3A 5EJ1A 4MIMA 5SGAE 2IGKA 4S05A 3U8TH 4RLFA 2TIOA 1O3MA 1O2VA 2FS8A 5LRRA 1WJAA 3JRGA 1XG1A 1YPEH 2GP9B 4MHGA 1OWEA 1ID5H 3HGGA 1W7PB 4XFQA 1GBCA 2X6YA 1A31A 3ABKH 1VFCA 4OOIA 1G3DA 2XXLA 4U32A 3DQVC 3I4MJ 4FUDA 1DWDH 2H27A 5LPFA 1LE8B 2JDID 1DDNA 5DP8A 4NHJA 1C2MA 4HRIA 3DP7A 2L9SA 2YU9J 3OE7D 1CT4E 5AHGH 2TRTA 6LPRA 4ZKRU 2KT0A 4M3BA 2RDLA 2DYSH 3QWCH 1KYWA 4RLQA 2Z3CA 4HZHA 1QRZA 3QYBA 3FK6A 2HPMA 2PMZA 5E3LA 2KCPA 1IXCA 5F8XA 3CLQA 1OJLA 1MGTA 1NS3A 4KTUA 4XM3A 3FKJA 1QJ1B 3FK7A 1YW9A 4F93B 1G3BA 1I1SA 1DP3A 1NK2P 3WU0A 3RUOA 1MMNA 4VGCC 1O3AA 2STTA 2AHQA 2R7TA 3M61U 3M5LA 1O2XA 1FY3A 3GFMA 1G3EA 1VQPI 2IBDA 2DPUA 2LY2A 1LJ9A 3ZMVA 2Z6BD 2V4JC 4GDFA 3HSEA 1V2ST 3KYDB 1X4PA 2VIPA 2RDEA 2EI6A 1GBLA 2FYRA 2DFIA 2OD5A 3KPHA 2DA2A 1QL7A 1W0YH 1VJAU 1G6NA 3K4CA 1R5HA 1TRNA 4C2UA 1ANEA 4B2BA 1K1IA 1GVJA 3FXQA 1F4KA 1PFXC 4ENJA 3I78A 1Y3YA 4AZ2B 2SGQE 3EYYA 2CV0A 3T26A 4BXSA 2ESHA 2WTEA 2XGEA 3F6OA 1VCWA 3LSPA 4XK4A 5M5YJ 2ANYA 2K85A 2NAZA 5HYOA 5EF6A 3SJ9A 2IS1A 1NRSH 2ZPSA 4W1UA 1GG6B 1REPC 3E91A 1D3DB 4C2MJ 3MD2A 4HLXA 4ABHA 3SNCA 1K1OA 2ZKSA 1USTA 4UHTA 1G59A 3PO3J 5EDNA 1TP4A 2PI0A 2GGVB 5EQSA 1XMNB 1HW5A 3U21A 2J38A 1GDNA 1GI2A 3ZCOA 1Y59T 2H1KA 2ZDVH 3ZQ7A 3BCBA 2HR3A 1XSXA 4BOHA 1ZGAA 3LU9B 2Z2SB 3LSJA 4KTSA 3S93A 4X8TH 2TRMA 4RKOB 3KZIC 1PJPA 1BJVA 1YLCA 1H8HD 2ZO3H 5G4BA 4I7HA 1F0SA 1MBEA 3DTIA 1G2LA 2Y0MA 2FS9A 2ZB9A 4KKDA 4X0GA 4DYCA 4O03A 3LWFA 2UUFB 3GMEA 2KCYA 5EG0B 4X6PA 3H3UA 4FE4A 5KAIC 3OX7U 5TJJA 3B9FH 1XDUA 4ABGA 1O2MA 1K1NA 3OS1A 1M1EB 4JYKA 1O2ZA 1YS7A 1T95A 3ZVCA 1AN1E 3KEYA 2XASA 1OLTA 1C5VA 1Y3WA 5L3BA 2H9TH 2QXGA 2Y7XA 3BN9A 3A85A 1GI0A 2O8MA 1Y8RB 2JSCA 1LPZB 3LH1A 2DODA 4K1SA 2B8OH 3DEUA 1D1BA 1ZH5A 1P92A 5F0FA 4WWYA 2XB0X 3AG4H 4JZEH 1MZBA 4U87A 3F72A 1WRJA 1MBGA 5HGGA 2O8UA 2OJED 1SR5C 4F92B 2QF5A 1YM0A 3WTYC 2BQ6B 3GYLB 1BIAA 2SNVA 1SGIB 1P6RA 1UMAH 2ILNA 1DICA 3L2QA 2JPCA 3TW6A 1SMFE 4YEJA 2J34A 3C1DA 4B47A 2XRCA 3GDUA 2VH6A 4DW6A 5CVJA 5J8FA 5CQGA 3UNRA 1BTWA 5BPDA 3VB5A 4BY1J 4CREA 3PRDA 3ABTA 2AQEA 2HNTE 1C2EA 1MTSA 5JBBS 1JGSA 5PTPA 3PWBA 1MQ6A 1FSEA 1Z21A 1GJDB 3ZVFA 2H09A 1TTYA 1SQTA 2LKSA 1OCCH 1ZSKA 3A7TA 3MU4A 2BD2A 4RI0A 4NSVA 3LQQA 2E5ZA 2W25A 3M3TA 3TIUA 2ADUA 2WYJA 1CO7E 4PDKA 2A5YB 1CQQA 1B0FA 2EK5A 1Z1IA 5K0HA 2E1MB 5E17F 3S32A 2OBPA 4CCOA 1IXSB 5D6FA 1COWD 1LTOA 1O3SA 2AMDA 3TP3A 2FNAA 1YBWA 4BAOB 3VG8A 5M5WJ 5CHAC 4D7GA 2OC7A 2PG4A 3KX2A 2IS4A 3CO7C 1W0UA 3O8HA 4UFGH 2CMYA 4RM3A 1MTNB 4HF1A 4BJ5C 1N75A 5EQQA 2EQRA 1O2WA 4FVBA 2PFBA 2BY5X 1SGEE 5GNDA 1JHFA 1X1PA 2VU8E 5KEDA 3RC6A 4G8XA 3KYCB 1TNHA 3SU6A 3G1MA 5J1UA 3HG9A 1EKBB 2HVRA 3CF5F 4ZYEA 2PUQH 1C5WB 5JHUA 1HDDC 1MBHA 1GL1A 4Q7YA 5AONA 1DY9A 4Y8YA 1KXCA 4XOPA 5F03A 3RPQA 3NQOA 4U7DA 1OX1A 3GW2A 1GBIA 2BYAX 3M9AA 3S9CA 3ERED 1JKQC 3E6BA 2ZP0H 3PL8A 2RG3A 3L1PA 2VIVA 3DPTA 3LSRA 5FX5A 5ETXA 2A07F 1WH5A 3IWZA 1EJNA 1S8NA 2HDWA 2R4GA 3SEZA 2COBA 2L74A 3BIVH 2FRHA 3E6MA 1MNMC 1Z8JB 1HAIH 2Q6FA 1X3UA 1AD8H 5LH8A 3V12A 3I4NJ 5JDUB 5TRDA 4PUSA 1F7ZA 1YF4A 1S29A 3GBGA 1H89C 1OP8A 2IVMA 3RXFA 1OSSA 3FXLA 2BY0A 1TBRH 1GI6A 1W1WE 2P8TA 2Q8KA 2OQ5A 2VL8A 5HDNA 2X6WA 1T8OA 2IW5A 2AS9A 4BY7J 4DW2U 1C4U2 3D65E 2ASUB 1B8IA 2TBSA 1UK2A 5EW2H 1C1QA 2CK3D 1ANBA 3FXMA 1ETXA 2C8ZB 1S6HA 1YPGH 2E35A 4DGJA 3ZQFA 1GMHG 2WYGA 1MKMA 5IOZA 3S3MA 2ZDAH 3RPUD 1OKRA 3S15J 1MBKA 4MNWA 4TY6A 5D8KB 4J1YA 1PQ8A 4LOCA 5A8XA 3V42A 3F9HA 2VJ1A 5DCFA 1BOAA 1FYMA 4A92A 1CA0B 1WZ2A 2XC7A 3CCLI 2P95A 2ANKH 1TQ7B 1DPUA 2KIQA 1FZZA 4U0WA 2BLOA 4A5MA 1WUNH 2RNGA 5EW1H 1R4NB 3B6AA 2K9MA 4NA9H 1LHFH 3MO9A 1BHXB 1KQ9A 3BT9A 3GYHX 3TW7A 1SFIA 1IQFA 5GIBA 3S9AA 4FQGA 4ZAEA 1P06A 5FPYA 1Z7UA 5FROA 2VIQA 4UEHH 5I46H 4LG3A 2FEZA 1GDTA 2HGCA 2ZZUH 5IYDJ 3IKVA 3RQ4A 2IJOB 3V13A 3MO3A 5B3SH 3I55I 2CSOA 2YSRA 2OTVA 2A31A 4MVNA 1PQAA 1GBHA 2A6EF 1Y5BT 1SBWA 4P00A 1WFXA 3S3OA 3ZN0A 4IOCF 1S81A 1XGNA 2SGPE 4XL9A 3V0XA 1GJCB 2R0KA 3BR0A 1NESE 2PHBA 2Y30A 4GFBA 3DA9B 2GZWA 5FO5A 1NBMD 5FFXA 1W36D 1ERDA 3ZMTA 1FPHH 2I6QA 5JVTA 4LG0A 1XC5A 2PV9B 6CHAB 3CC7I 1QNJA 1FMGA 1TGBA 1GHCA 2NU3E 1LVYA 1P05A 1HV7A 1PPZA 1GI7B 2UWPA 1GL0E 1Y3UA 4A69C 2ZFTA 1I27A 2OC0A 2EZLA 3J7AY 2GXBA 2M34A 4IRHA 2DFHA 2H8RA 3EDXB 1U9OA 1KXEA 3K10A 1OP2A 3I9V2 1ETTH 2R7RA 4QPQA 1K4SA 3OYLA 4A0YA 3K70C 4AORA 1VITF 3HOVJ 3PO1C 3CLOA 3J80Z 4MNXA 2PGQB 3DXJF 1XMXA 4N4NB 5ILUA 2VLAA 3RKWA 1TGCA 2TGPZ 2SGEE 3KP2A 4TY7A 8GCHF 4Q48A 1FQ3A 1CBWC 1TFXA 1CHOF 1T0FC 1UCYE 1NM6A 1R1TA 5HS8A 2V26A 2DTZA 2GKVE 4RKJB 2OPTA 2AO9A 1MKWH 3R4KA 1QPIA 5DD8A 4O6JA 1BR1A 3HOSA 3BTWE 1KXDA 1P3CA 4HW0A 2ELJA 3F2HA 3MH4A 1BBRE 3Q00A 5K7ZA 1DITH 4M7GA 2UV1A 2A7HA 4B73A 2HVYB 4F4OC 3DCFA 3QOPA 2XC5A 1OQYA 3HPHA 1UW7A 3HK6B 1X3WB 1IO2A 4OS5A 2DU9A 1YIJI 1XVMA 1K2I1 2QCOA 1YRNA 2LBFA 4D9QA 3WODF 3OYPA 2HTJA 3K2ZA 3KNXA 2GZ8A 3COAC 2PSYA 1G3SA 5D4SA 1WHUA 3N4MA 2KIUA 3KZYA 3CD6I 2BDAA 1JIRA 3R0FA 3A86A 2J2UA 2LG4A 4HV6A 3T5FH 4EEFG 2RDPA 1BR4A 2YOLA 5CVUA 4BAQB 2G8TA 3M7QA 1Z6EA 2HLDD 2X6OA 2XPUA 4XRSA 1WXRA 1GHAG 3WGHA 4LGWA 1FNIA 2BD4A 1P3EA 4JOMA 1GJ4H 1Y0NA 1XUHA 1SPJA 3OAAD 2XAUA 3EA8A 4PJJA 3VYTB 4YOIA 1ZMNA 1KXAA 1H8IH 4K1EA 4Y8XA 1KU7A 2GZ7A 4ZXYH 2DMQA 1BZXE 3LAJA 3BG7A 4IHVA 2X1CA 1CF7A 3KLNA 4O9VA 2JH5D 2O7OA 2A4RA 3GY7A 2EFPA 5ILVA 3NZIA 2JQ7A 1ZG3A 1SLXB 2VB0A 3A82A 4XKWA 2BD3A 2L6OA 3LJJA 4JP0A 4H42U 2BVLA 2ICWG 2ZBKA 2M2AA 4I32A 2Y80A 3KL6A 2TPIZ 1SSXA 1VCPA 4N0BA 2VKVA 3ZQLA 2Q6GA 4IHTA 2V35A 2IT0A 4FU9A 3K9XB 2MLGA 1C5XB 3IH3A 6GCHG 1I39A 1BMNH 7KMEH 3DD2H 5BOXA 5GPIB 4FHTA 3IH4A 1VTNC 5LGTA 4I33A 3ZQGA 4WJG2 3ZOBA 5L6NH 1B72A 1B9NA 2Z3DA 1WTGH 4OMYA 4FISA 1JJ6C 1ESAA 1BJUA 3CESA 2BY6X 2DOFA 2NRAC 4LG0B 5DK1A 2WPHS 3SU4A 2K4JA 4X6MA 2ZTYA 4I8HA 1VF9A 3DT0H 2M0MA 3CDIA 1K7AA 1C1VH 1C4Y2 4E7ZA 2H1UA 1EV7A 1SHYA 3NKKA 1FBUA 2OQGA 2A4QA 2WPDD 2BLQA 5HIZA 2GOMA 1X7AC 1HUTH 2QQAA 1SI5H 4UFEH 2C6YA 3RTRA 5EEHA 1O2IA 2DQRA 2GCHF 3E3TA 1XSVA 1UMQA 3KCCA 2IPHA 4ENMA 5F27A 4NZQA 2V7FA 3N97A 1I1GA 1FPCH 2DDAA 1ZHRA 1FNNA 2VVUA 3P8OA 1A5JA 3I4PA 3D23A 1AE8H 1SQRA 2ZHFH 1AVXA 3QAHA 4XDEA 2XBXA 2GJGA 1BMMH 2OCCH 4QPOA 3VFZA 3UPEA 1E79D 3AG2H 1LDKB 1DE7H 2EB7A 1ETKA 2UUZA 1EB1H 4THNH 3ZYEA 1EP5A 2L0KA 1HSTA 2XWAA 2GXAA 5DYMA 2DN0A 1GCTC 2R7VA 4ZKOU 1BI1A 5GJ4B 4YRVA 2CFOA 4E05H 3VODA 2AIPA 1F0RA 4U88A 3OEED 2JUGA 3S14J 1DANH 1QA6A 1SMYF 2KMUA 2L54A 3IITA 1F5TA 5IY5H 4QWQA 5IYBJ 1FJSA 4ZMAH 3JRAA 3HEFA 2G4UA 2K3FA 3QQAA 3QYEA 1YRNB 3Q3KA 3G1LA 4GLYA 1HJAC 2MH9A 4ZDOA 4X0WU 2LOOA 2WV4A 5C5NA 2G9WA 4TT3D 2D1JA 2PJPA 3UR9A 1NU9A 5F0CA 2XTTB 4L9NA 5F0HA 1CT2E 2GX4A 3CCUI 2FOCA 1QNTA 1RC9A 4Y52J 3UQOA 3BF6H 2A6HF 3GXOA 3IKTA 2Y7ZA 3MHWU 4A3JJ 4B76A 5JI6A 4X6AJ 2CF9H 2XBYA 4A0ZA 3FF5A 4UVAA 2QKLB 1LQDB 2VBZA 1NO9H 3B8JA 1RKWA 3CJNA 1HNEE 3F9GA 3F8CA 3AAVA 4GCVA 1AFQC 3KP7A 2PJRA 2BHGA 4ISNA 1W13U 2EFWA 2GA1A 1VQLI 3BTJA 2YPRA 3HRTA 1CF7B 4P9FA 2Z9LA 4LXBH 4BXFA 1A1RA 2H1LA 2XBWA 3VGCC 2L4AA 1IN4A 2HU9A 4JK1X 1CGIE 4RMNA 1A7SA 3QGNB 2XSJC 3ZVAA 2XYAA 4NSYA 3BG5A 3FWEA 2P16A 4BYYA 3F9EA 1BL0A 1IRXA 2DMPA 3PNYA 2BDBA 2RREA 5L2YH 5J4YA 2YR2A 4AFSA 3LL7A 1C5RA 1K61A 1X4OA 2QF4A 1YJ9I 1IN8A 2BYVE 1WWXA 2H8WA 1O38A 2Y9ZA 3ZZ6A 3GEZA 2RAEA 2PFEA 3DFLA 2NVQJ 2LY9A 1BMFD 1B72B 2QBYA 1ACIA 3J81K 1UVUH 5BPIA 4XICA 4ASUD 4KFCA 1C2FA 4B48A 2J4IA 1VNDA 1XMKA 1WQVH 1IUYA 1T8MA 4I8LA 2H9HA 4CRDA 5EPNA 1FMWA 5B66C 4IX7A 5FRNA 2VPRA 5E0GA 3ZZCA 1FV9A 4Y79A 4IBLH 1BI2A 3A7VA 3AASA 3EQ0H 1J09A 2MA3A 1FN6A 5M3FJ 3Q0UA 2KJCA 3HHGA 4HLYA 4WX9A 1O7FA 2HZTA 1O3NA 5GPCA 3BTQE 2Y6TA 2PKSB 1FUJA 2HOEA 1QA7A 1A35A 1EFRD 1V2VT 1JKRC 1BN5A 1G4DA 1ZTJA 1QFKH 1P04A 4MQAA 2UUJB 4KIGA 1GI3A 1RKTA 1O5DH 1LDDA 4JCNA 1KTTB 4EJUA 1THRH 4PK4A 5KHDA 2X6XA 1S83A 5DP9A 3CJRB 1HAVA 4NGAH 1O3DA 3A89A 3P9KA 1SKYE 1Y5UT 5HS9A 1NK3P 1FBSA 4YIIA 1SFEA 2E5NA 2W3KA 1TBXA 2OK5A 1MH3A 3DBHB 3HM5A 4NB5A 2WADA 3W6KB 2EY4C 2LP6A 1X1BA 2O03A 2KRCA 1J9IA 5ICFA 5E8IA 1V2RT 1EJ9A 2ZU3A 4BHPA 3N99A 1F0UA 2BY8X 3K69A 1JRTA 3ZVBA 5F64A 4RAZA 3A8DA 4F91B 4Z0KA 4BH9A 3GCMA 1YPHC 3KQBA 1BOQA 1EXFA 3O8CA 1J17T 3MWMA 1BOBA 4Y10E 2NU0E 3I59A 1MJBA 3DU6A 2NNNA 1D3TB 3SJMA 3OIQA 1FOKA 3HTUA 1EJMA 3CP2A 4FVDA 2SGDE 1KIGH 1STZA 4H0EA 3QN7A 2ZSIB 2PTNA 1FP1D 1G2HA 1ON1A 2Z16A 5E18F 4OS6A 5E1ZB 3BDDA 2CJJA 4CCJA 4ESJA 1Z7KA 4PCQA 3W3CA 3A7ZA 2ZDNA 3DSOA 1O32A 2F5EA 4HSRA 1MCTA 5FLXK 1RIWB 3D5LA 4ZZLA 2K7LA 1V2NT 1AZ8A 2L3DA 4G12A 3JSPA 2P7CB 3FVFB 3HOTA 2FODA 3ASOH 4HF2A 2IP2A 1X1DA 5C3EJ 2A5WA 2V0BA 1FI8A 3RXVA 4IL6C 1MU8B 1HAHH 3SXYA 3S3NA 2HOSA 5LGOA 4GCHF 3A8BA 1P2NA 1XTAA 2HEOA 1O5FH 2JRMA 4AYBN 4FXGH 4QT8C 5F1JA 3GFJA 2NWNA 5E20A 3OSYA 4DZJA 4DVAU 1ZPBA 1AMHA 5FPSA 3GTMJ 1Q3XA 1T8LA 1AY6H 3OYHA 3GTKJ 5H6RA 4X2WA 3H0DA 2ZU4A 1BTZA 4CO8A 2W85A 1V2QT 2L9VA 4BHCA 1H9IE 4DURA 1SAUA 2WA0A 2GAUA 1P9UA 4HX7A 3IP4B 1KLJH 5TCCA 1HAYB 2IJD1 1KY9A 2QBYB 4K60A 5B1AH 1FONA 1W5CC 5L3CA 4XRSG 1ZLKA 3K4BA 5H2FC 3ASNH 4NZLA 4ACBA 1T33A 3HOXJ 1L0OC 5ESBA 3JAMK 2Y82A 5IYCJ 2E34A 1LKAA 3LGWA 3JRFA 4LOYH 5GAEJ 2ZJPF 2PUXB 4I02A 4M9XA 1T38A 3UR6A 3LFUA 1V5GA 1G3WA 2OU2A 5BRRE 4LK0F 4Y0ZE 2VODA 4F48B 2XNDD 4AFQA 3SV6A 4U30A 3G6EI 1SAXA 1O2GH 1FIAA 1DPOA 2ZU1A 5E8EH 5EG4A 2XKOA 4C2TA 1M9UA 1YS6A 1S85A 1HCRA 4UV8A 2V3MA 1FTTA 1HSJA 1BBYA 2BDYA 2ZCKP 1HAVB 3MTYA 1ANDA 1ETYA 1HAPH 1ETQA 1YX3A 4IF4A 3U69H 2E71A 4Q2KA 4KGAA 2M5TA 1GMDF 1QHRB 1W0JD 1DOJA 3KQ5A 2FTMA 3PIOF 1U3EM 1NFWA 4A6DA 2A3SA 4M3FA 3OL3A 1OFCX 3QU6A 4BAMB 1MMSA 2NYXA 1H8DH 1QB6A 2TCTA 1R7JA 3ZZ7A 3E0JB 3BTHE 1K28D 1P2QA 2A4GA 1QQUA 4ZYHA 5ICGA 2LF8A 2FI5E 1RUNA 2Z9JA 3MKYB 3SZGA 4X2YA 1OISA 3LGUA