1S6LA

Solution structure of merb, the organomercurial lyase involved in the bacterial mercury resistance system
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
192
structure length
192
Chain Sequence
ADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alkylmercury lyase
publication title NMR structural studies reveal a novel protein fold for MerB, the organomercurial lyase involved in the bacterial mercury resistance system.
pubmed doi rcsb
source organism Escherichia coli
total genus 24
structure length 192
sequence length 192
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2004-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1s6lA01
2.40.10.260 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 1s6lA02
1LDKB 2KIUA 3I5UA 4RAZA 3MZHA 4XSZF 4O3MA 1W4MA 5ICCA 1KU3A 3NRVA 1ZHFA 3BP8A 4OIQF 4FX0A 4OMYA 2A68F 4D0PA 2STWA 1B9MA 5ILUA 1LJ9A 3T1BA 3ZMZA 2YPRA 4I01A 4AWXB 4RGSA 1BI3A 3IKVA 1FLIA 3REOA 5LHIA 3BJ6A 3DPLC 5ICFA 2ESHA 4M9XA 1IAWA 4Y13A 2Z9OA 3BY6A 3JAMK 3L00A 3SFZA 2LF8A 2J5PA 3U9GA 3K1NA 5A2QK 2VE8A 4HAMA 2IP2A 4HLXA 5HDGA 5D6EA 2K02A 1IN7A 2IVMA 4RB3C 5CVVA 4MEXF 2OZ6A 1YO5C 1MDMB 4RB0A 1BOAA 2P6SA 3C1DA 4RGXA 3JTGA 1QGPA 1OR7A 2COMA 3F8FA 2VBXA 4M9SA 4A0ZA 4BXUA 5K1YA 1FP2A 3P9IA 4RB1A 4ZYGA 4HX7A 4KA4A 1CF7B 3J80Z 1RI7A 2FQ3A 3B73A 3J81Z 3KCCA 3C7JA 2JSCA 4HF2A 5BMZA 2L4MA 3MCZA 1J9IA 1DDNA 1Y0UA 1T6SA 4M73A 2B0LA 1U78A 4G6DA 1MJBA 1TLHB 3SZTA 2KJCA 3IKTA 4WXCA 1TW3A 4IVNA 4L9NA 1E17A 3EYYA 4XBFA 3ISPA 2EV6A 2H94A 4UV8A 4HYEA 4EGYA 4ON0A 3LSTA 3Q9SA 1BM9A 1Z91A 1QQIA 4ESBA 1ZG1A 4WWCA 4R8HA 3ZPLA 2JRTA 3K1PA 1ON2A 2KKOA 3HTUA 3PFIA 2LDUA 4L5JA 3KLOA 3EUHA 1F9NA 2ZXJA 2ZO4A 2CYYA 4A0XA 3K1MA 3WU1B 2ZJ2A 2FSWA 3F8MA 1W7PD 4MQ9F 1J2XA 3ECHA 2OA4A 1MD0A 1F4KA 1DP7P 5HDKA 1XD7A 1RUNA 2KJBA 1KQ9A 3E97A 3H3UA 4Z2YA 2CW0F 1QZZA 2ISZA 3GFIA 2FNPA 4P96A 1K78A 1BI0A 4L5IA 3WGGA 4ETSA 2O6GE 3V4GA 1OKRA 3E5UA 4ZZDA 2A3SA 4IXAA 3BZ6A 1OPCA 4G9YA 1S8NA 3ZMVA 3HHGA 4AIJA 1ZG3A 5F1RA 1BI2A 3V7CA 3KP2A 2JZYA 4BH9A 4HQMA 3FXRA 1T39A 1SD6A 5FD6A 3NEUA 1HSJA 2ZFWA 3LA2A 2D2WA 2BEOA 1ZRDA 4BAYA 3IRQA 2C6YA 2JT1A 1S29A 4MTDA 2UXNA 1Q1HA 4HZFA 4I09A 4LMYA 3LAJA 3FX3A 2BYVE 2A6HF 4F7ZA 1GXPA 1NHAA 2BE5F 1U6GA 3RPQA 3ELKA 5FB2A 4LG0B 2J5OA 3TQNA 3OV8A 3QU3A 2GIVA 3L9FA 2OQGA 2ZKZA 2FMYA 5EEGA 4EGZA 4OIOF 1IW7F 3COAC 2L54A 1ZLJA 3CUQC 5LLQA 3WTVC 3KP4A 4U88A 4L9JA 1HSTA 3JTHA 1Z7UA 1YW9A 4GO1A 4A0YA 2EK5A 3I58A 3HIFA 3ERED 4I0AA 2ZMEA 5E1XA 1FYKA 3R0JA 5ERIA 2LF7A 1J0RA 3R6SA 3N97A 2EFPA 1UCRA 2L01A 3E3VA 2VOOA 4YFXF 1KU9A 5BPIA 3FWEA 3HTSB 3CUQA 1XB4A 3SHFA 4WXHA 2XAFA 3W6KB 2HZTA 5EEHA 3BWGA 1XSVA 2QBYB 2VC0A 1TQMA 5FFXA 3LQQA 2F5DA 3RJPA 1U2WA 2XHKA 2K27A 1IN5A 2P5LC 5CVUA 2VONA 1LEBA 1WWXA 3D5LA 1J75A 4KICA 1IRFA 3DEUA 3GXOA 3Q9VA 1K7AA 5ILSA 2Q2EA 1XSDA 2VE9A 1LDJA 1D8JA 2EA4A 1R5HA 1S7OA 1P6RA 1B4AA 1DPRA 2STTA 3IC7A 2O3FA 4ENNA 1L0OC 2DU9A 2RDPA 2HQNA 4CDGA 4IRGA 2F5FA 3QRFF 1T0FA 4KIBA 2DO7A 3JAMZ 4G7ZF 1ZYRF 2L4AA 2HDCA 5A2QZ 5F6FA 2UWMA 1HXDA 3F6OA 1Z9CA 5JFRA 3MAJA 5FGMA 3BROA 2HKXA 3KEOA 1HW5A 2DFIA 2NNYA 1EH6A 2UXXA 2EFNA 3RI4A 1B9NA 4HX8A 4UVBA 4HF1A 1R7JA 1HW1A 4EM2A 3WTSC 2Y48A 5LEJA 1HW2A 2ZCWA 1OMIA 3BPVA 2X4HA 1FC3A 4ZYDA 2VBZA 1RZ4A 2VBWA 1U5TC 1HKSA 2MD5A 3DP7A 2ZNYA 4HDVA 2IW5A 1UB9A 4FHTA 1ON1A 5DCMB 5DD4A 1JHFA 3K0LA 1IF1A 3MZYA 1UHMA 3GW2A 4H0EA 3TGNA 2ACJA 3QPHA 4L0ZB 3WTZA 3LA7A 3WGHA 1P4AA 1AOYA 1SD7A 1SMYF 4EJTA 1KU7A 1KU2A 4UVCA 2HS5A 4GXOA 2O03A 1U5TA 5DUIA 3VFZA 5IT9K 3I4PA 3HUGA 1A04A 4MNUA 1ODDA 5DEQA 3F22A 3G3ZA 2P5KA 2XAJA 1O3SA 1FSHA 1SD5A 4UHTA 4CYDA 1WI9A 4L9VA 1S6LA 2KRFA 1XN7A 5D5XB 5K5RA 4FX4A 2VXZA 4EVIA 4CICA 1FPQA 2CWEA 5H6QA 1LQ1A 1L3LA 1TBXA 4IRIA 1GXQA 1P4WA 2P7CB 1TTYA 2Z3YA 5D8LB 5DV5A 2CFXA 2XAQA 2V1DA 2RNJA 3T0YA 2PEXA 1T38A 2M87A 5HS9A 3K9TA 4LFUA 3L2CA 4HX4A 5FLXK 4B8XA 4DNCA 1TNSA 3C18A 2MLGA 3P7NA 3JW4A 1BN5A 2HWVA 2PFBA 3ROUA 3TO9A 2DW4A 2PMUA 4HV5A 5LHHA 1YTYA 3F21A 3BJOA 4O6JA 3G73A 1VTNC 5HOOA 2UZKA 3P9KA 3IWFA 2GZWA 4OU0A 3ZN0A 4HLYA 4RS8A 1MJ9A 2F2EA 4IF4A 3U1DA 3GWZA 2ZBKA 4I7HA 3ZQ7A 1O7FA 1H9GA 2E7XA 1ZN2A 1P4XA 2CSOA 3F23A 5CJ9A 1YW7A 1XDUA 3LFKA 5LEKA 5KK1A 1EH7A 3PQJA 2QQAA 5L3FA 3IRRA 3ABTA 2BBYA 4BHPA 3RKXA 1X3UA 2E1NA 4LLLA 2K4JA 1O3RA 1ZG5A 1OYYA 4G7OF 2OAZA 1XCVA 1T2KA 2PQ8A 1BBYA 2RVCA 3ZMUA 1W5TA 3FM3A 3ZMTA 4XSXF 2K86A 3ABUA 1QNTA 2A07F 1ZRCA 3TDUC 3RKWA 2G7HA 2Q0OA 2YU3A 3QPTA 3GO5A 4LD5A 3HSFA 2EFOA 4KNYA 3GLXA 4Q5SF 4GCVA 4LK0F 4GYIA 2FEZA 4P5OA 5D5VB 2IJLA 3FMQA 4RAYA 3PQKA 4E70A 4LB6B 2P4WA 2HEOA 3LQRA 1K79A 4HV6A 3E5XA 2PLYA 4EV0A 2Z99A 4Q47A 4KMUX 4FT8A 3T5XA 1FYMA 1MJAA 1RUOA 4EJUA 1BC7C 1U8RA 1Z05A 1ZLKA 2H6CA 4I98B 1O7LA 4I02A 3T8TA 1E2XA 5FD5A 2DTRA 4LJZF 3J7AO 4IJAA 3V7RA 4UVAA 4PCQA 2P6TA 1YQAA 5LRRA 2G7UA 2FXAA 2QZ8A 3FMSA 2NRAC 2V9VA 3ZMDA 2WTEA 2QYOA 2A6EF 2R3SA 4Y15A 4NHJA 5BPDA 3I0TA 1TQIA 2RV8A 1R5GA 2QLZA 2XKPA 4G8XA 1J5YA 2FOKA 1TNTA 2ADUA 4PZJA 4KDPA 3CO6C 3KP5A 1FWZA 5H6RA 4CO8A 1G3YA 2FBKA 1R36A 1HBXG 2XVCA 5D4RA 4UUVA 3HSEA 4G6QA 3F72A 3J81K 4PDKA 1BJAA 2FBHA 5K5QA 2QWWA 4Q48A 3SXYA 4EJOA 1R00A 5D5WB 1PDNC 4ASNA 3M7GA 5D8KB 2XUBA 3GVAA 2MH9A 2PBIA 3TOBA 1XGSA 1FY7A 5JI6A 3LWFA 1S7AA 4XLNF 3KFWX 2EFQA 4LLNA 2CO5A 4EM1A 3DF8A 1YLFA 4U0VA 2HTSA 2EJRA 3ZMSA 2TDXA 4JQFA 4Q4ZF 4P9FA 2M45A 5BOXA 3U2RA 1WKMA 2NYXA 3L7WA 4QWQA 2IA2A 3RTRA 1ZARA 1Z1DA 4GGGA 3V8JA 1LNWA 4ESFA 5IT9Z 2ISYA 3O3KA 4HQEA 3HYIA 3GFMA 1YYVA 5L3BA 3R61A 3EETA 3WODF 2JTVA 1OYWA 3KP6A 3E6MA 2XAHA 3HRSA 4YG2F 2EV5A 3AAFA 3E6CC 4OMZA 4BHCA 3V8KA 1C0WA 2K7LA 1P92A 4MQVA 4WCGA 2IA1A 4YIFA 5DCMA 2AS5F 2DQRA 2D45A 5L3DA 1H9TA 1PP8F 2H6BA 3FMRA 1O3TA 3MFKA 3QOPA 5E1WA 3NQOA 4KYWA 1ZGJA 1WRJA 3M8FA 1JGSA 5LHGA 2WWYA 3FM5A 3I59A 3FZVA 2QUFA 2GQQA 4ZH4F 5HLGA 2HYFA 3M1EA 5FLXZ 2OQRA 1LVAA 1K6OA 2BV6A 3EDPA 4G94A 2XRNA 4MTEA 3M8EA 4NB5A 4RB2C 3L09A 2PI0A 2MA3A 2FU4A 2QM3A 3DFGA 5HVQC 4OOIA 3CDHA 1JXSA 2ZMEB 2F5EA 4HA8A 4EJVA 3I71A 3KE2A 4KT5C 1XGOA 2ELHA 3GF2A 5H20A 4WX9A 3MWMA 3I54A 3ZP5A 1V3FA 3CUQB 2R7FA 3HRMA 2DAOA 2JPCA 4IPAA 5LBQA 4CGZA 1KQ8A 2Y75A 4ENJA 4YFNF 1G4DA 1W5SA 1D5VA 1R58A 4GYGA 3FXUA 1UFMA 1W7PB 1IZ1A 5J8FA 5E18F 2XAGA 2GA2A 1BI1A 1FBQA 2YX7A 4BYYA 1FX7A 4ESJA 1T98A 3F8BA 5L3CA 3D0SA 1Z6TA 1MDMA 2ZNZA 2P7VB 2W84A 3DQVC 2IRFG 1Z6RA 2VBYA 5CVRA 2HYGD 2M1BA 4ZYEA 2KIMA 2ETHA 4AD9A 2PJPA 5CVIA 3IHUA 1ZREA 3KP7A 4KN4X 2LNBA 2L3DA 1CF7A 2QQ9A 4AVPA 3EQLF 3O6BB 3RIRA 3FHZA 5FO5A 2YSRA 2BGCA 4ZYHA 3ECOA 1R1UA 1J7KA 2V6CA 5L3EA 3TKYA 3WGIA 1RNLA 2PG4A 1G3TA 5AIPA 3C3WA 1MGTA 2MBFA 4KN7X 1GVJA 1B1BA 2GXBA 4WF2A 4LB5A 2QQBA 1KYWA 2WV0A 3IWZA 4PGGA 5HS7A 1YS7A 4YIIA 2LSOA 2Z5UA 4IHTA 2FF4A 2H27A 2W25A 1S3JA 3SZPA 3Q5FA 4M71A 4A6EA 2DBBA 3R4KA 1QBJA 1LB2A 2VOPA 4OINF 1XSXA 1KYZA 2W85A 4YFKF 2AXLA 4I0BA 3OOPA 4HW0A 1GHCA 3DXJF 2DI3A 1G6NA 3F3XA 1G3WA 1R1VA 1U5TB 3GZ6A 1J59A 5ED4A 3KZZA 4N9IA 4EJWA 1D8KA 1UHWA 4LLGF 4CZZA 4OIPF 5E8GA 2EV0A 4PGHA 4LK1F 3K69A 4L9TA 2DQLA 1WQ2A 2A69F 1EH8A 1ZRFA 2V79A 5J6XA 4HDUA 4A12A 2JPBA 2M5WA 3CLOA 2MC3A 2A61A 4BHBA 3S2WA 1KGSA 2EWNA 2E1CA 1FBUA 4XRFA 3RKYA 1ZH5A 1R23A 1XMKA 3HHHA 4BQAA 1PUEE 1I1GA 1YW8A 4N9HA 4AIHA 2HGCA 3GX4X 2FRHA 3M9AA 4LGWA 4KIFA 5D5UB 1ONVA 3LAPA 3I53A 4R1HA 1ZAOA 1R1TA 2M30A 1IXRC 1SMTA 1IRGA 3KEQA 4M6YA 2L02A 4A5MA 2EA2A 4P9UA 4DQ2A 5BQTA 4M9ZA 1HKTA 3O2PE 2P5VA 2GA1A 5E17F 2IPQX 2CG4A 1I5ZA 4MEYF 4EQQA 4LG0A 1F1ZA 4IRHA 3KLNA 3BOQA 1BIBA 3FXQA 4L18B 4QLCU 1R22A 2NNNA 3WTTC 5E8IA 2Q8KA 5BS6A 3HOTA 3T8RA 4L0YB 2XKOA 2PN6A 3GZ5A 5LRSA 1SFEA 2E7WA 3QU6A 4S05A 2YX4A 3CJNA 1REPC 2X0LA 4M72A 5L3GA 3E5QA 5ICEA 3WU0A 4CHUA 1XDSA 3WE3A 3KETA 1YFHA 1EV7A 3F8NA 5D4SA 3JSPA 1ZGAA 5HLIA 1FZPB 3QP5A 1RIOH 3K2ZA 2NAZA 1O3QA 1H0MA 3IL2A 2V1UA 5JHUA 3MEXA 3WE2A 2D1VA 3R0AA 1DPUA 1G3SA 4JK1X 4A2UA 2H09A 1XMAA 1P2FA 5AONA 4A6DA 2QBYA 2HR3A 2HQRA 3HOSA 4UNOA 3HSRA 3N4MA 3MQ0A 5DD8A 2VT3A 3WTXC 5DDGA 1D3YA 3BPXA 4I2OA 2XIGA 4RGRA 1WSUA 3J80K 2QENA 3ML6A 1XGNA 4KUMA 5HDNA 3H92A 3DKWA 3WTYC 4JBAA 1FP1D 1YIOA 2WC2A 5ICGA 5E1ZB 5TRDA 2GXGA 3DPTA 1LDDA 3GFLA 4RGUA 1IXCA 3WG9A 4UXNA 5AIQA 2Y0MA 2FA5A 3ZN1A 4R79A 3VB2A 3QP6A 3VODA 2F5CA 4A5NA 1JE8A 3CUOA 1MKMA 4U7BA 5ILVA 5DYMA 3GUDA 2VC1A 4G7HF 4M6XA 1K78B 3H3ZA 3RDIA 2RN7A 1QPMA 1FT9A 4M74A 2DLLA 4HOBA 5F64A 3GYHX 2P8TA 1SFXA 3VEPA 4ENKA 3I64A 5IT3A 3DV8A 2Z33A 5D6FA 5TJJA 5JR3A 4B09A 2A5YB 3KZYA 4Y17A 3P9CA 1IUYA 1MZBA 3BJAA 3RPUA 5JVTA 5CLSA 2XROA 5J8CA 4ENMA 2G9WA 3GEZA 1I6XA 4NQWA 1LEAA 2IA0A 3E6BA 2GWRA 1CGPA 2FBIA 2OZUA 6PAXA 2O8XA 3B02A 3VOEA 2V1XA 1DUXC 1XGMA 5LGTA 1XCBA 5KVRA 2VN2A 2W57A 3R60A 4WXDA 2DT5A 2GAUA 2RGVA 4TV7A 3WTUC 2FNAA 1QO0D 2XGXA 1USTA 2VODA 2RC4A 2RQPA 3RYRA 4CXFA 2FE3A 1USSA 1W7PA 2R7DA 4ZZLA 2OD5A 5DUKA 2DPDA 2OBPA 3GFJA 1IN8A 2FMLA 3TOAA 3W6JB 1PP7U 1KA8A 4O5VA 2LKPA 2CGPA 3TO6A 4HF0A 3SQNA 3CTAA 2ESNA 4MHGA 2OU2A 1FOKA 2EFWA 5CYVA 2NS0A 2DK5A 2O0YA 2MH2A 1BIAA 4BNCA 2DPUA 1STZA 1SFUA 1U3EM 1BC8C 1IN4A 2W24A 1I1SA 4S04A 1AWCA 4U7DA 1I27A 1V4RA 1B6AA 3F8CA 2O61A 3ULQB 3RYPA 4WK8F 3KP3A 2EB7A 1IN6A 5FFZA 2XV4S 2RKHA 3HRTA 1TW2A 3BDDA 4AIKA 3CO7C 1F5TA 5LGUA 2HTJA 1SD4A 4U0WA 1HKQA 2D1HA 2QVOA 4P55A 2K4BA 2VT2A 4EM0B 4KFCA 1KQ0A 3F6VA 2M8EA 5DCFA 4XLPF 5LGNA 3LA3A 1B59A 3TO7A 2YR2A 3TDZC 1FBSA 2PMHA 1JHHA 1FSEA 5K5OA 4MGRA 4HBLA 4U0YA 2HOEA 1YG2A 2KIFA 3HRUA 4N0BA 3E6DA 1IXSB 1HQCA 3JSOA 3QAHA 2IT0A 2HFHA 2HKOA 4IHSA 4K2EA 2MLKA 5E20A 5HLHA 4UV9A 2CQKA 1OYIA 3I59B 1O57A 2XASA 1YS6A 5CVJA 5HS8A 1ULYA 3EYIA 1SAXA 3V7SA 3V8LA 1FYLA 4KMFA 1TQPA 1FNNA 3WTWC 3FF5A 4EMSA 1QZYA 4KIGA 2DK8A 4OIRF
chains in the Genus database with same CATH superfamily
1LDKB 3LNQA 3PTNA 3MZHA 1D6WA 1UK4A 2CQXA 1JI8A 4ZTFA 3TJOA 4NIWA 5ICCA 2ECCA 3IP4B 3NRVA 1E0EA 1ZHFA 1AIXH 1LMWB 4UFGH 1YRNB 1TX7A 4P1WA 2A68F 5ESBA 5HKKD 5ILUA 2QQ8A 2VH6A 3H5CB 4GPGA 1VF9A 2DA5A 2WPLS 4I01A 1NO9H 3OIQA 2MFZA 2Z3DA 1EZXC 3IKVA 3H5NA 3REOA 5HYOA 3DPLC 1O3EA 1JKQC 2FTLE 4FUHA 1DANH 4JX4A 4DGWB 3SFZA 2WINI 3S15J 1GVDA 4ABZA 4M6VA 3ZQGA 5A2QK 4HAMA 1O3KA 5J4QA 5HDGA 5D6EA 1IN7A 5GIBA 4YESB 1JUPA 4MEXF 2W1OA 4RB0A 3T28A 1X1AA 2UUZA 1QGPA 1OR7A 1RTLA 2COMA 2EI7A 8GCHG 1YIJI 5DP5A 3CP7A 3DT0H 5FBIA 2J34A 2VQGA 4ZYGA 3S1RJ 2Z9IA 1KZHA 3BG8A 3SV8A 2LY2A 4HF2A 1JBUH 5BMZA 3E8LA 2CRGA 1GJDB 1P2IA 1NU7B 1U78A 2M0MA 1ETYA 3SO3A 2KJCA 3IKTA 5A8YA 3K7AJ 4L9NA 1SQRA 2EV6A 2JK3A 3EUHC 6GCHF 4UV8A 3EAJA 1WGXA 1G3DA 4ON0A 1NFUA 2JA5J 3QTVH 4FU8A 3RPUD 2CW8A 2JUCA 1AMHA 1IC8A 2L74A 3OY6U 3I56I 3L6PA 6ESTA 2BLQA 1ETOA 4WXVA 4JYVH 1FN6A 2ZJQF 2BD9A 2Y2ZA 2PSYA 2KKOA 1POGA 1FAKH 4RKJB 1UG0A 3SQEE 2BOHB 3MOCA 2M2EA 1F9NA 3LSKA 5FJ8J 2STBE 4O03A 2BY2A 6GCHG 2Z7FE 1TGNA 4MQ9F 3ECHA 3A80A 3OR2C 1DP7P 1TX8A 2E1MB 3OY9A 2KJBA 1OJLA 3SHCH 2E19A 1Q3XA 4I8LA 4ABJA 1H8HD 2TRMA 4XLAA 1NH3A 5CHAB 3A0BC 1EZUC 2CU7A 2FNPA 3G71I 1BI0A 3QGNB 3DU6A 4L5IA 1Y8TA 1C2DA 2O6GE 4RSPA 3V4GA 3E5UA 3DUXH 1R4NB 4DY7B 1INCA 2GXAA 1ZELA 1YF4A 3CJTB 1OPCA 3AFHA 2HVRA 1W5CC 3HHGA 4AIJA 1TAWA 3MU0A 5A8XA 4WMFA 3V7CA 1O5CB 4BAMB 1ZRKA 2CUJA 4BH9A 4B44A 3F3BA 4HQMA 2XCNA 1MMSA 1PQ8A 5FD6A 1RTFB 3OYPA 1VQMI 2BEOA 1TC3C 1BMFD 2JT1A 4MTDA 1PJRA 4INKA 1T8MA 4I09A 4LMYA 1Y39A 1MH3A 1MTNC 2BYVE 3C2HA 3TIUA 2B7EA 4F7ZA 2BE5F 5FB2A 1XC5A 3VG8A 2CV2A 3M8JA 3QU3A 5DPAA 4II2A 2ZKZA 2NVXJ 1MQ5A 2AGGX 4OIOF 1ABJH 3G01A 2Q6FA 3COAC 3HGYA 4ZCNA 1VQPI 1SEUA 5LLQA 1TLDA 5E79C 2A4OA 4H6TA 4UUTA 3HXLA 3PL8A 4D7GA 2ZU2A 4A0YA 4ZAEA 3HEFA 4UONA 2GKVE 1AKSB 1BBRH 4K8YA 2LF7A 3VPRA 2CQQA 2L01A 2VOOA 2AQEA 1KU9A 3FWEA 3HTSB 5LPRA 1GBFA 3P8NA 1DITH 4WXHA 2XAFA 2WHXA 1HFDA 1SGNE 3BWGA 2J95A 1J14A 2DYRH 1FMWA 5GWZA 4ABIA 1XSVA 1TQMA 3PYHA 3LQQA 1CQTA 8LPRA 3RJPA 1IN5A 1O2NA 2PTCE 5CVUA 1LEBA 1O3LA 2JJ1D 3HOXJ 3D5LA 4IX7A 3LH1A 2AFQB 1BQYA 6CHAC 3Q9VA 1GHZA 5ILSA 3M7TA 1LDJA 1D8JA 2EA4A 2FZZA 2QF0A 3W2AA 1OQYA 4YIRX 4WMEA 3OYFA 4PJJA 2RDPA 1FIPA 4VGCB 4IRGA 3H5AA 1BTPA 3TPIZ 1O2PA 2DO7A 1TNHA 2SGFE 1SGIB 1V2LT 1BRCE 4II3A 1MKWK 4I86A 1KXFA 3GCHC 1GJ7B 5J4YA 5B1BH 4CR5A 1WXRA 4K69A 1C5XB 1O2IA 1KLTA 4LITA 3HKJB 1GGDB 1A0JA 1TIOA 2EFNA 5IOZA 1B9NA 4B3AA 4HX8A 2BHYA 2YUSA 1C5QA 4EM2A 3DWLE 5LEJA 2A4GA 1OMIA 1K4TA 2X4HA 2VBZA 2CUEA 1GI2A 4KT6A 2QKMB 2XBWA 3DHKH 4BJ5C 4ABFA 1A46H 1C1SA 5DCMB 4XORA 1NY22 2BOKA 1UG2A 1UHMA 3TGNA 1GBMA 1D3PB 3H9GA 4HSRA 1QBOA 1P4AA 5E3NA 2XSDC 1AOYA 5FX5A 3OEHD 1YBWA 4PROA 1KU2A 3RXFA 3MNSA 1AA7A 3VFZA 5HLTA 3A4CA 4GVUA 3HGNA 5M5YJ 2KAIB 3BIVH 3HC7A 2ZU5A 2DA2A 2QF3A 5AVDA 1F0SA 4CYDA 4L9VA 1HAPH 3VYSB 1GI8B 2KRFA 2ZPSA 3PRDA 1HXFH 1OYTH 1L3LA 4IRIA 4AM3A 1P4WA 3DKYA 3D62A 3CCLI 2J5UA 2GOMA 3NAUA 1B8IA 3RZOJ 2XAQA 3MU5A 5B3SH 3TGJE 1T38A 2M87A 5HS9A 3FXLA 3GTKJ 2ASUB 2K9QA 3K4CA 1OPHB 2WPJS 1IQNA 5E3LA 5EJCA 1TNSA 2KFDA 1DUEA 3DCLA 3JW4A 1BN5A 4HNTA 4A1VA 3TO9A 4MNVA 4HEA2 4K1TA 2DDBA 1YTYA 2L9SA 2H9TH 3F21A 2O9LA 1DP3A 2BVLA 1FQ3A 2UZKA 3P9KA 1Y3YA 1TWXB 3HJEA 4I8JA 2JETB 1GUUA 1FY1A 4FE4A 2E7XA 3LFUA 4NZLA 1PFXC 4NGAH 2GMTC 1AZZA 1V2VT 1QR3E 5K7FA 1YW7A 2WAEA 2VKVA 3JRIA 1LUJB 1GI1A 2SGDE 2XAUA 3PRBA 2BBYA 4BHPA 1X3UA 1QL8A 2K9SA 2K4JA 1LHFH 4XM3A 5L6NH 1O2ZA 1DWDH 2PQ8A 2ME6A 1W5TA 2YS9A 1QNTA 5GTIC 2A07F 3RKWA 4FVBA 4FUIA 2G7HA 1ZLRA 3U28C 4XK4A 2THFB 2YU3A 3QPTA 5J40A 2W5EA 7LPRA 3HSFA 4N4OB 1DXPA 5HXFA 3ZOBA 4ISLA 2FEZA 3EE0B 5DG6A 3Q0VA 4OS4A 3G1MA 5CDFE 3PQKA 2ZFRH 3I4NJ 3BEFB 4X8TH 1O5DH 1K79A 3A7ZA 2LYCA 4FUBA 2OJED 2ZGHA 3HGGA 2ZGBH 3F0CA 7GCHF 2LY9A 1PPEE 4WWYA 1UTOA 4MIMA 1U8RA 1Z05A 1JGGA 3OS2A 1HAOH 4CRAA 1VKYA 3T8TA 5FD5A 2DTRA 3K6YA 5DK1A 3P5JA 3J7AO 4D8NA 4RM2A 3V7RA 1MNEA 3F2HA 2WAQA 4PCQA 1P2MA 4Y4RA 2V26A 2FXAA 2B5TB 3T29A 3K70C 2QYOA 3RXOA 2R3SA 3AK5A 1O4XA 7GCHG 1H9IE 4A3BJ 1TQIA 3PO1B 2RV8A 1GMDF 3BTWE 2W82A 2W26A 1WTHD 4QPQA 2XKPA 4G8XA 1V2QT 1SVLA 2E71A 4OM9A 1CO7E 2LBFB 3FK7A 3DTIA 2J97A 5EF6A 4CO8A 1SOZA 1WQSA 3SQHE 1KIGH 3BTCA 5IYDJ 3Q0UA 5TCAA 2XVCA 4XL9A 5D4RA 3ZZ6A 5B5EC 2W7NA 3CNRA 4G6QA 1TE0A 2DFEA 3ZZ7A 3SXYA 4IN2A 4AGKA 5FRMA 2W7SA 2ZU3A 1A1RA 2A0QB 2XUBA 1GMDG 2BZTA 2FX6A 4E7RG 4AYVB 2MH9A 3DA9B 3K6ZA 3TOBA 3FANA 3N99A 2CJJA 1DY8A 2RNGA 4XD7D 2V3HH 1RGQA 1HJ8A 1ZKGA 4BS9A 1GHAG 1FIAA 4EM1A 1ZR4A 1C4Y2 1R6RA 5EGOB 1ZMJA 2TDXA 1UJ8A 5KCMA 1O2QA 2FYRA 4F49A 1JT6A 3NPSA 3SUFA 3MKWB 2Y30A 2FOEA 2NYXA 3L7WA 1EXFA 1Z1DA 2PKSC 1G30B 1GDQA 3VFEA 4D76A 1LNWA 2BD5A 3GS9A 5IT9Z 4M7GA 2ISYA 1HGTH 1GBCA 2EZIA 1SGEE 2VPLA 2VJIA 3FDYA 3ABKH 5HMAA 4Y52J 1MU6B 4NC6A 5CHBA 3CQZJ 2P16A 2JTVA 4IHXA 1SLXB 4WVPE 1O5GH 3KP6A 3GCNA 4Y8YA 2UUJB 2FOAA 4YG2F 2EV5A 2E2JJ 3KYLA 4PFPA 4C3JJ 4BHCA 1C0WA 2K7LA 4JCNA 4M3EA 3SI4H 3A82A 3KX2A 1DXWA 1P92A 4WCGA 2GM4A 1QU3A 4Y6DA 5DCMA 2AS5F 2DQRA 4IEJA 1SBWA 1C1PA 2LNCA 1IAUA 1PP8F 4KP0A 2LP0A 4NWLA 4V2FA 3HATH 3MFKA 1AFEH 1K1LA 3QOPA 5E1WA 1MBEA 4YLQH 5FPTA 4DT4A 3LSPA 4AG2A 5JBBS 4GDFA 4G12A 3FZVA 5HGGA 1Y3XA 2GQQA 2XC0A 5FLXZ 3ZQIA 4B2CA 2BVXH 1ETWA 2WSSD 3OS0A 2PKAB 1QA0A 4JZEH 2E2IJ 2XRNA 1G36A 3I77A 3A8BA 2PI0A 4MPXA 1LVOA 3S1NJ 4OS7A 4INHA 3SNEA 2QM3A 5HVQC 3O8DA 2W48A 3ATKA 1S6HA 1O38A 3T62A 1XGOA 3CCJI 2R9PA 3GF2A 4WX9A 2XBVA 1HRTH 5T6DA 3I54A 3CUQB 4BQOA 5IOYA 3HRMA 2JPCA 4IPAA 4CGZA 4QSHA 1QVUA 4YM9A 4NIYA 2KLOA 9ANTA 2EZLA 1ZTKA 3S9AA 1OCPA 2OXSA 1GI6A 3I29A 1O34A 5EQSA 1D5VA 1V3XA 1D1BA 3Q76A 3V13A 1UFMA 1MNDA 2EA3A 1PUFB 4KITB 2XAGA 1LPQA 2C8WB 1B72B 1P2KA 4ESJA 1T98A 4CZCA 3SNAA 1MDMA 3DQVC 2HNTE 1QTFA 2GOXB 1Z6RA 5EZGA 2VBYA 3OL3A 4ZYEA 3R0FA 3BG4B 3EA7A 3RKQA 3TJNA 2WY7Q 1ZREA 3PFYA 1EZQA 2LNBA 1MKWH 5T1VA 4AU7A 2L3DA 2ZU1A 3AG4H 1YCPK 1S72I 4AVPA 2D1JA 3DTEA 3UY9A 2VKDA 1Z6JH 2CH0A 5FO5A 2SGAA 3HOZJ 4Y8XA 1R1UA 1C1TA 3ZVCA 5C1YA 1VZ0A 3KL6A 1OP2A 4BL0B 2P81A 3TKYA 2R7RA 1XXDA 1RNLA 1G3TA 3C3WA 2MBFA 3VXFH 1LVMA 2FOCA 4RM3A 2GXBA 1F5LA 1GBDA 3RXDA 4PGGA 4IHTA 2H27A 3WY8A 3UNGC 3LSRA 3SZPA 1NS3A 4ISHH 3R4KA 4P02A 4J1YA 4U32A 3S3NA 1ZK8A 2JDID 3K70D 3OOPA 3MNCA 1WH7A 2XTTB 2CMYA 1CSOE 1VQ8I 5GP9A 5EYRA 3PUFA 3KZZA 4EJWA 3TU7H 4JX6A 4AGJA 1UHWA 3A7VA 2VKEA 2DCEA 3DFLA 5TJXA 1MSEC 4L9TA 1YJNI 4JOMA 3U69H 2W00A 4A12A 5GCHF 2JPBA 2FOBA 2WPIS 2MSYA 2MC3A 1W36C 3QPLA 2GJGA 4AUXA 4BHBA 1SGYE 2ECBA 2EWNA 1FBUA 4INLA 4XRFA 3RKYA 1ETSH 4YOIA 4BY7J 3BZCA 2LR8A 1FTTA 3M07A 1AVGH 5GAHJ 1XMKA 3HHHA 4BQAA 4MNWA 2OF7A 3HG9A 3ZZ3A 2K9MA 4AIHA 3GX4X 2FRHA 2BDHA 2ANMH 1OISA 4TT3D 5D5UB 5B1AH 2IGMA 1QHGA 1NFYA 3I53A 1SVPA 2L02A 4A5MA 4CCJA 2EA2A 4DQ2A 1QZ8A 2ZCHP 4ZKRU 3SUDA 1N75A 1QB9A 3QN7A 2X6OA 3JRAA 1K21H 1NT1A 3OSYA 4FUJA 2F9OA 1N1LA 1TFXA 3SZGA 5E17F 1MZDA 1DGRM 2OLGA 2CG4A 4MEYF 2AMDA 2V1NA 1DVAH 3N05A 2KT0A 1EJAA 4L18B 4M3BA 2Q8KA 2R93J 1WCMJ 5B6OA 3HOTA 1QBVH 3T8RA 4L0YB 2X6XA 1UAAA 2P8OB 3ATWA 5LRSA 2BD3A 4AOQA 1FX0B 3QUMP 4S05A 1T7CA 2YX4A 3CJNA 2C93B 4LIVA 2X0LA 4M72A 2BQ7B 1RESA 3A81A 1ESBA 5K7ZA 1WZ2A 3WE3A 3KETA 2ODYB 1FI8A 1EV7A 3F8NA 3W2VA 3ZVEA 3P8OA 2FESH 3JSPA 1ZGAA 1BRAA 1GMHF 2N8GA 1WYKA 3ZCOA 1FZPB 1JMOH 4A6LA 2BTCE 5C3EJ 1D3QB 3LOXA 3LSJA 1H0MA 3IL2A 1PPGE 1BR1A 3AAVA 2WAQN 4CCMA 3BT9A 4JK1X 3MH7A 2QBYA 1JKRC 3RDZA 3ZYEA 4BJ6C 5GXPA 2OD3B 3WTXC 3BPXA 1AE5A 3K65B 5E3MA 3CESA 4DZJA 1XGNA 3H92A 3JCUC 1WTGH 1GMCF 2WC2A 3EYDA 5E1ZB 2FOFA 1T4VH 3BV9B 1LDDA 2F9NA 1ZMNA 3PM1A 3S17J 2OCCH 4IW4E 3L3TA 4DIQA 2Y0MA 4B3XA 3VB2A 2FYQA 1KXEA 4A5NA 5TCCA 3EDXB 2XNDD 1O3IA 2Y9YA 4U7BA 5ILVA 1WAYB 4DW6A 2VC1A 4G7HF 3SW2B 4M6XA 5J1UA 3RDIA 4HSTA 1EZSC 2JH6D 5F64A 4RMNA 3GYHX 1SFXA 1GPZA 1GHBF 5IT3A 3A84A 1UTNA 4P00A 2DA3A 2GLOA 1E37B 2R7TA 2BQWB 1MMDA 2A5YB 4AYBA 3KZYA 1ANDA 1CBWC 3RPUA 5JVTA 1C5YB 5CLSA 3GEZA 1I6XA 4F48B 3E6BA 3BTTE 5CQGA 1HJAC 2A05A 3VOEA 1VJAU 2XC4A 1XGMA 1SVOA 5E0GA 1IDZA 5LGTA 1XCBA 4J00A 3D5RC 1BA5A 1YC0A 5GNDA 1P2JA 2G5NA 1C5NH 4E7JA 2R5YB 4B48A 3TJVA 2RQPA 1GHBG 1LKAA 2EI6A 4OS2A 1USSA 5DP8A 3OL4A 3GTOJ 1TT0A 1GJ4H 1QRYA 5E0JA 5DUKA 2DPDA 2GCTC 1IN8A 1IQHA 3TOAA 3EQ0H 3A2KA 3IV5A 3W6JB 4O5VA 1J09A 2WV1A 3L33A 3KQDA 3SQNA 1Y1WJ 4DW2U 2OU2A 1TMTH 3QWCH 5GPAA 1N6XA 4YOJA 1STZA 1SFUA 2VU8E 2HPPH 2VWLA 2DE8A 1MTSA 1BC8C 3A8DA 2W24A 1ZSLA 3OYGA 1HA8A 1VQ4I 2GV7A 1JJ8C 4RN6A 1O3MA 1LKBA 2VIDA 4E7HA 1I27A 4XIDA 1V4RA 3FBIB 3PSIA 2NVTJ 3ULQB 3RYPA 2M0CA 3MYWA 2KZVA 1X1BA 2ZDNA 3OYBA 4K60A 1WQVH 2RKHA 3UKGA 1P7IA 3BSQA 3BDDA 4K1SA 3CO7C 1S9HA 1GBIA 5LGUA 1OCTC 1K1OA 2Y7XA 2K4BA 2RQQA 4KFCA 1TQ0B 3F6VA 2WUCA 1O5EH 1ELCA 5LGNA 1KTSB 2YR2A 1SGCA 3Q0WA 2X9DA 5F1JA 1ZJKA 4U0YA 2I5UA 1BRUP 2PSXA 2A5WA 2GTBA 3GYMA 2GIZA 2KIFA 1FJSA 1IXSB 1F92A 3U8OH 2CV1A 3CCEI 4JZ1A 3QAHA 5PTPA 1SFIA 5BPEA 2PMZA 2AMQA 4FOUC 1IJWC 3ERMA 1O57A 1DPOA 1YS6A 4IQ4A 5CVJA 3CS0A 3EYIA 4ACBA 2JA6J 2BM2A 2F43B 1GG6C 3FF5A 1AKHB 1HAYB 1C5VA 1D3DB 4O3TA 4ABGA 1X1PA 1O2GH 1UTJA 4O3MA 3SNBA 4Z0KA 1YLNA 4XOPA 1P04A 2ZKSA 3BP8A 3IG6B 3E7LA 2ZGXH 4OMYA 2STWA 2FOGA 1IQMA 2D5VA 4ZXYH 4O97A 1I39A 2RREA 3VDXA 2M5TA 4BANB 4Y79A 4AWXB 1TWAJ 2PGQB 2G52A 1T08B 3Q00A 2B9LA 3RLYH 5ICFA 1IAWA 3BY6A 3L00A 4DG4A 2J5PA 3U9GA 2UWPA 2VE8A 2BDAA 2IP2A 4Y7AA 4E7NA 4LZ1H 3TH4H 1FPCH 2FI5E 1V2RT 3T5FH 5DKMA 2C3SA 2P6SA 1DOJA 3RXTA 4A3MJ 5DP4A 4CCNA 3F8FA 4RBOA 2X6YA 1RRKA 4BY1J 2SFAA 1TBZH 1ZSJA 1C2JA 3CCVI 1YCPH 3IITA 1MMJN 1M1EB 1FP2A 2DJNA 2R5ZA 3U1IB 3J80Z 1T8IA 2FQ3A 3MQKC 3B73A 3J81Z 4NZQA 1TQ7B 3ZZAA 2B63J 4FUEA 4MNXA 1HB0B 1KXAA 3PNTA 3MCZA 1HAVB 1JTXA 1HBTH 1D1CA 1RC9A 3UQVA 4IVNA 2A45B 4B6FA 4TY6A 5I46H 4XBFA 3UNRA 4DT7B 3LSTA 2DFHA 4LG3A 3E6PH 1EOLA 3OYNA 4BEHA 1FOXA 4ESBA 1ZG1A 4WWCA 1AI8H 5KAFC 3NUMA 1XUFA 1GHYH 3KEYA 3HPGA 1VR1H 3LSGA 2VIQA 1ON2A 3HTUA 2CK3D 5J3LA 5B6LA 2LDUA 4L5JA 2AIQA 3SORA 3EUHA 3AW0A 2UUFB 2ZO4A 1ZTRA 2CYYA 5IK2D 4BJTA 3WU1B 1Q1VA 1AD8H 1W11U 1W7PD 1F5KU 1ZPZA 3MD2A 2ZIQH 1J2XA 4LOYH 1XD7A 3DSGA 1RUNA 3E97A 1ID5H 2OP9A 2CW0F 1QZZA 1T8LA 3H3VK 2ISZA 2OQ5A 4DIHH 4A1TA 1IQFA 2IS4A 1U9OA 4WXIA 3WGGA 2OBQA 3MVPA 4B1TA 1XUHA 1QY6A 2DTZA 4IL6C 4BTTB 5FLVA 4ZZDA 2GMTB 4JZDH 4TY7A 1MH0A 3BZ6A 1R71A 2LRDA 3GISB 3FP6E 1ZG3A 1BI2A 1C5WB 4E4HA 2FS9A 2X48A 1S6FA 4ISOA 3LGVA 3PWCA 5HNHA 1Z21A 2OTLI 4Y0YE 1E1RD 1NFWA 3NEUA 4Y8ZA 2GV6A 2D2WA 1LQDB 4OGXA 1ZRDA 2C6YA 2UXNA 1Q1HA 5EJZA 4HZFA 1V2TT 2V6EA 2BY5X 2R5YA 3M1CA 3FX3A 1ZQ3P 2L2OA 1ANCA 4YOGA 3QYEA 4PK4A 1WJBA 4MDSA 3RPQA 2FEQH 4NSYA 1TZLA 1X58A 2GIVA 3KPHA 2A5AA 4MLFB 3VPKA 1Z8GA 2ZDMA 1VQOI 4XKBA 4Y7NJ 1SQTA 3WTVC 2L6OA 1O2HA 4NIVA 5EEAA 3SJOA 3FXKA 1O31A 3A87A 4TPIZ 2CQNA 3RXHA 2OPTA 5F0CA 1OP0A 3QDZB 1LE8A 1MBMA 4GUXA 4PJMA 2K3FA 3BR6A 4BAHB 2ZMEA 4BU2A 3TITA 3DBRB 3BQZA 3R0JA 5BRRE 5ERIA 1GJ8B 4IC6A 2LY1A 3N97A 1G3CA 1DS2E 2IS2A 1JIRA 3E3VA 3OIPA 3SHFA 3E0NB 1I3AA 2DA1A 4Y10E 4BNRA 5EG0A 3RUOA 2VC0A 2WAFA 2F5DA 4AYBN 3KYFA 1KYNA 1YITI 3CJRB 1SLWB 4YO9A 3RLWH 3TGKE 2K27A 2BXYA 2VONA 2M4GA 4XNFA 2JSPA 3S9CA 1O5BB 1O5FH 2EZHA 1YP9A 4IOCF 3DEUA 3QLPH 2HXIA 3W94A 3M4OJ 1CE5A 2VE9A 3UIRA 4U87A 2YNBA 1PQAA 1R5HA 1S7OA 1FXYA 4AX9H 2XBXA 4MPUA 1HOMA 2WB1A 4UUSB 1DPRA 1LVBA 2STTA 3IC7A 3SI3H 1TNLA 3M61U 3ZQQA 1C5ZB 2HQNA 4CDGA 3HL2A 1HPGA 2G81E 4IKFA 2BZAA 4Y11E 2HNTC 1XTAA 3LKWA 5CKTA 1ZYRF 2LELA 1HXDA 3F6OA 1IV8A 1LCYA 5JFRA 3SU5A 4BXFA 2MG4A 2E5ZA 2XGCA 4UY8I 3SUGA 4XLHA 1SC7A 1SC8U 2WPDD 3LT3A 2DFIA 1V5FA 2L9RA 2DT7B 1A4WH 3RI4A 2H9HA 4HF1A 1HW1A 4FUGA 3P95A 2ZCWA 5KHDA 2QY0B 4NC8A 1UZCA 1CHOF 2EEKA 2VJ4A 3BPVA 1ARBA 1FC3A 1IDYA 3R3GB 3H7TA 4ZYDA 1RZ4A 2VBWA 2HQ5A 3GOVB 1U5TC 4AZ2B 3FOAA 1HKSA 2R0KA 3RXBA 4OS6A 4FHTA 2EIKH 5DD4A 3S3MA 1C5MD 2PP6A 3K0LA 2KCPA 1IF1A 4H0EA 1C1MA 1DU0A 3QPHA 3VSLA 2CUZA 2OC6A 2WV4A 2F9UA 3ZZBA 5J4SA 2F3CE 3BTIA 1KU7A 4UVCA 2O03A 5IT9K 4D7FA 3I4PA 1CHOG 2L7FP 3HUGA 2HPMA 4MNUA 1ODDA 3URCA 3TBIA 3ZVGA 3GTPJ 2XAJA 4B71A 4IMQA 3ZZ8A 1ELEE 3S16J 4XSKU 1SD5A 1Z67A 4UHTA 2PMZN 1NRPH 2P3FH 2ZHWH 3CCQI 3KQEA 4HNUA 3CD6I 3TJUA 2VXZA 2O7OA 4CICA 5EQRA 1H9LB 2P7CB 1B7XB 1QNJA 1YHQI 3HOWJ 4AFZA 1HAVA 1P2NA 3I55I 5D8LB 2F5VA 1DDJA 2I6SA 3DBLB 2FMJA 4OAYA 2CXVA 2QCYA 1V2MT 4Q7XA 1XMXA 3HOVJ 2M9HA 1DWBH 1WU1A 1G32B 4LFUA 5FLXK 1V2KT 3KEEA 2O8UA 2DDAA 1OP8A 1DY9A 3ZV9A 2MLGA 3PSFA 2PFBA 1M9UA 3FKJA 3AG1H 3A01A 1ELTA 3G73A 1V54H 3MO9A 3IWFA 3ZN0A 4F3QA 3X2QH 1MJ9A 5L2YH 2F2EA 4IF4A 3GWZA 3ZXSA 2ZBKA 3H0GJ 3K10A 1H8IH 1XS9A 2HVXA 2AH4X 1C2MA 1O7FA 2WYGA 1ZN2A 2BY9X 1O2TA 2H5DA 3WHBA 2ILNA 1OCRH 1SMFE 1Q31A 2L7MP 2VIXA 1QRXA 3LFKA 4XDEA 3I78A 2A5KA 3SBKA 2V7QD 5L3FA 2A1DB 2PJRA 3ABTA 3RKXA 3P17H 2QYIA 1OHHD 3ZQHA 2Q1ZB 1UTKA 1C1OA 1YY3A 1O3RA 1ZG5A 4O9VA 4ESTE 3HBLA 2Y0SA 1XCVA 1LVKA 1G37A 1TA6A 2WA0A 3ZMTA 2K86A 2ZF0H 3QPSA 4U2WA 5HIYA 1MMGA 4ANJA 1ZRCA 4CRCA 4U30A 3CENA 1UW7A 3P8GA 3RMLH 3GO5A 2HLDD 4XRMA 3KHVA 2QA4I 4GCVA 1W14U 2ZEBA 2SNVA 3A1YA 4ZUHA 4P5OA 1TYNA 3S1MJ 3TNSA 3SGQE 4RAYA 2R0QC 3VGCC 2HEOA 3FVFB 2AQFA 2PLYA 4X1PU 2Z99A 2R3UA 3JRHA 4KMUX 2LC2A 4CBNA 1S81A 1F43A 1UO6A 2BY6X 4FXGH 1UK2A 2RCEA 1DUAA 1Z8IB 3RZDJ 1O2KA 1FAXA 2R7OA 1I6HJ 1BC7C 5EW1H 4CSWA 4I02A 4XR6A 3F0OA 1E2XA 1Y3UA 4B4CA 1GI5A 3OFND 4LJZF 4TWYA 4IJAA 4A3CJ 3SV9A 1ANBA 4ABBA 5LRRA 5LGOA 1GV2A 1U9NA 3PNVA 3PUBA 5EIYA 5C0TA 2ZZUH 2QN5T 2WTEA 1EAUA 1EAWA 3UWJH 2JVHA 4Y15A 4C2MJ 3I0TA 2CHAB 2ZWLH 1O3HA 1R5GA 2BD2A 1BBRK 1OCZH 2DN0A 5F0FA 4Y71A 1V6DA 1RR7A 2ADUA 3EA9A 3KP5A 3PIOF 5H6RA 4DIIH 4B73A 3PROA 2XRLA 1N8OB 2HXOA 1O3FA 3CZ6A 3F72A 2KP6A 4XBCA 2V4JC 5GTHC 5C1UA 3LC3A 5HM9A 4ASNA 2K9NA 4MFEA 1YPHE 3OYDA 1MW7A 1CA0B 1TP4A 1EQ9A 1CA8B 4X2VA 4UUSA 1X4PA 2JA7J 1S5SA 4WMDA 1D9IA 3LWFA 1QURH 2RDLA 3BQYA 2PX9A 4YRVA 2WUBA 2EFQA 4XONA 2GVFA 2LOOA 2R2WU 1OLTA 1K9OE 4U0VA 2HTSA 3ZMSA 3BG9A 2VINA 2NS8A 2M45A 3RSNA 3U2RA 5JVGF 1WKMA 4QWQA 2IS6A 1DX5M 2EY4C 3UR9A 1UHBA 2A7CA 3E0JB 2C90B 3S1QJ 3V8JA 1A61H 3O3KA 4HQEA 1L1NA 1PPBH 3PLKA 3HYIA 3Q3SA 1YYVA 1XKAC 3SEQA 1K1JA 1SHHB 2ODQA 3SV6A 3E6MA 4NCYA 2Z9KA 2E5NA 3V8KA 3B6CA 3HKZA 4WH6A 3KGPA 2DOAA 4MQVA 2DOEA 1K1PA 1H9TA 3ONQA 3FMRA 3RXEA 1O3BA 1BTYA 1JGSA 2CF8H 1FEXA 2WWYA 1WH5A 1H8AC 3I59A 2X51A 2NVQJ 2XF7A 4ZH4F 2DMQA 1YLCA 1MABB 2Y82A 1TGTA 1F0UA 5GAEJ 2OQRA 2ALPA 1UCYK 3EDPA 4G94A 1J8AA 1C4U2 1C1UH 2OC1A 4D9JA 2WB1N 2VVVA 3OYLA 3CDLA 1KXCA 5KECA 5M3MJ 1THSH 1JXSA 1YPLH 4EJVA 4HA8A 4AVZA 1W0KD 4HRIA 5H20A 2XDVA 2X1DA 2WZQA 4NFEA 1V3FA 2R7FA 1W0YH 5IP6A 4NIXA 4X6PA 4BBRJ 3SUEA 2VIVA 3ODDA 8ESTE 1GBJA 1C1WH 1G4DA 1TA2A 2VH0A 2Y9ZA 2VPRA 4GYGA 1CQQA 1CBWB 3ZVFA 1D1AA 1SGTA 2P3TB 3FXUA 1W7PB 2OV7A 2R0LA 1IZ1A 1SLVB 2GA2A 1BI1A 3H9JA 3OY5U 3GY4A 2JUGA 3ZRGA 3D0SA 1Z6TA 4X1QU 2XRCA 1C5RA 2W84A 1DE7H 2LTPA 1A35A 2JQ7A 2ZDAH 5EODA 3FXMA 3GTMJ 3KP7A 5EXMA 3B23B 5A8ZA 4RT0A 2BW3A 3TW7A 1EPTA 1CF7A 2CF9H 2M8GX 2EPFA 5TISC 2YSRA 2BGCA 4BAOB 1SGPE 3JRDA 1SFOJ 1V2OT 1O2YA 2F91A 3SJ9A 3ECOA 3S14J 2V6CA 1KXDA 3WGIA 5F0HA 1T31A 5AIPA 1L2EA 4UE7H 4WF2A 2QQBA 2FOMB 5HS7A 1X2NA 1YS7A 1NBMD 1S83A 1A3EH 1BITA 4FUDA 8GCHF 2FF4A 1Y6IA 1XUJA 1ZMLA 4A3FJ 2W25A 4CUGA 2M7AA 2NXNB 1S3JA 4BE1A 2Z3CA 1BIOA 1GJCB 2XCFA 2P93A 5F8ZA 1ZYOA 1L0ZA 2G00A 3S7KB 1Z3YA 4M71A 4XOTA 3S69A 2JN6A 2QXIA 1QBJA 4XBBA 2WADA 1JKPC 2DJIA 2X1EA 4CRBA 1XSXA 2W85A 3MTYA 3MWIU 3D49H 2TGPZ 4HW0A 1U0JA 5L30H 1NROH 1R1VA 3BN9A 3MH4A 2EQRA 3ELAH 5FKLA 3MU4A 5JLWA 1J59A 3HKIB 2KIQA 5ED4A 5C44J 1BHXF 1K61A 2AO9A 4JMYA 1Z1JA 4LLGF 4CH7A 4PGHA 3FHNA 2JA8J 1WQ2A 2A69F 5M5WJ 2ZECA 1QB1A 1Y56A 1V2NT 5J6XA 4QPOA 4AG1A 1MBJA 2M5WA 2A61A 2H9EH 4B76A 2STAE 3L1PA 2Z9JA 7ESTE 4F52A 3MZ8A 2ZTXA 1OCOH 1B8IB 1WJEA 1HDTH 1C5LH 2QC2A 3GDSA 3M9AA 1VJ9U 2PGBB 3UOUA 4I33A 1TWHJ 1SG8B 4XE4A 4D7NA 3PTBA 1DT2A 3AG2H 3BR1A 3KEQA 2R92J 2G51A 2NU3E 3GBGA 5BQTA 3ZVBA 5DTDA 3RC5A 2HGTH 3DPUA 1QB6A 3GDVA 2ZU4A 4M9ZA 1HKTA 2HVYB 4RAGA 2IPQX 3BR3A 3OEED 3EGKH 2AEIH 3LGTA 4Z6AH 2VL8A 4LG0A 1SAUA 2KZ4A 2EC9H 4GLYA 3UTUH 3BOQA 1NK3P 1JJ6C 1R22A 3VWBA 3WTTC 4NNJA 2L0KA 2HPQH 3KYGA 1V2PT 2XC5A 3BIUH 2DA7A 2XKOA 5HODA 2FPZA 2Q6DA 2E7WA 1REPC 2MW8A 1TBRH 2UUYA 5L3GA 1BR4A 1MMAA 1NK2P 1GJ6A 1VQ5I 2KQRA 4CHUA 3LDXH 2SGPE 1YFHA 1SFQB 1GBAA 2I6QA 4XBDA 1EJMA 2EIJH 2XB0X 4KELA 4Q7YA 1AO5A 3VYUB 1QL7A 3QP5A 1YJ9I 1RIOH 2HPIA 2NAZA 1ACBE 1O3QA 2KL4A 3OMYA 3CCUI 2VB6A 4XLCA 3PV5A 4CBOA 4A2UA 3K2AA 1XMAA 3E1SA 2HR3A 2HQRA 3WHCA 4YEJA 1RFNA 3HSRA 3S32A 1ZTJA 5DD8A 1W2KH 4VGCC 1D3YA 4FASD 2DT6A 1O36A 1G2HA 1PPZA 1WSUA 3J80K 1O0DH 3ML6A 2A5IA 5C4XJ 2O8WA 4KUMA 5GJ4B 1VGCB 1F5RA 2JA2A 2BMGB 4JBAA 2FX0A 2F4MB 4ZMAH 1FP1D 1GVKB 1ETRH 4ASHA 3DPTA 4KTCA 4HG2A 4RGUA 3WG9A 4UXNA 4LIUA 5C20A 4X6OA 2FO9A 1JE8A 2I10A 1GGDC 1EUFA 2ZMEC 1RKTA 2O8MA 5CE1A 5DYMA 4HFPB 2C8ZB 1SGQE 1P09A 2RN7A 3V12A 4HNVA 1IOEA 1SPJA 5EW2H 1O3NA 5JPMH 4E7SA 4IHVA 3D23A 1LFPA 1NPMA 1S84A 3VB6A 3DV8A 3FAOA 1UVPA 3VB4A 4BBSJ 5CMXH 1WV7H 2YMSB 1AWHB 4MQAA 1IUYA 3BJAA 2HU9A 1OFCX 2XROA 5J8CA 2OK5A 2G9WA 4NQWA 1LEAA 2EINH 2GWRA 2MD0A 2OZUA 2O8XA 4DZPA 1BB0B 1GHWH 4DJAA 3P8FA 5A0CA 3LJOA 4TSFD 2ZI2H 2W57A 1J15A 2QSFX 3R60A 4WXDA 2DT5A 2RGVA 4BQQA 2UUKB 4JYKA 2FNAA 1GBBA 1QO0D 2Z6BD 1USTA 2P0WA 3JREA 2VODA 2RC4A 2MC4A 3RYRA 2V9KA 4A5TS 4CXFA 3D1NI 4E6KG 1W7PA 2VI6A 1TPSA 3ZYDA 3W3CA 3HKZN 2Y5GA 2VVCA 1BL0A 1PP7U 2LKPA 3BLYA 3TO6A 1AUJA 2V3OH 2ESNA 1TRMA 4MHGA 2HLCA 2EFWA 2NS0A 2DK5A 3QOEA 4CRDA 2TGTA 4A3IJ 1ELGA 5KNLA 2DPUA 1Z7KA 1UVOA 2MYSA 1R5ID 2PFEA 4SGBE 1I1SA 1BW6A 1X3ZB 4ISNA 3U1JB 3F8CA 4OAZA 4WK8F 3KP3A 1XX9A 3RC4A 4JK5A 1AUTC 4X0GA 5C67A 1IN6A 4ABAA 1E3HA 1WJ5A 2XV4S 3HRTA 3PNYA 3RP2A 4AIKA 3GYLB 1SD4A 1HKQA 3J7AY 5DGJA 1N77A 3H1CA 4C9YA 3TDZC 1FBSA 2PMHA 5FLMJ 2R3YA 1QJ7B 3CF2A 1NTCA 3E3TA 1TOMH 1C1VH 2ZDKA 5EOKA 2IGOA 1BOQA 3HRUA 1HIAA 3KYCB 2VGCB 1FDPA 3M3TA 2IT0A 1EF4A 3A03A 4IHSA 5HLHA 1OYIA 4ASUD 5DJ7A 2TRTA 2GX4A 1UCYH 1SAXA 3V7SA 1FYLA 1TQPA 3K4LA 1FNNA 1A6QA 3WTWC 5DM7F 1QRZA 2HRVA 1P57B 4K3JA 3F9EA 1QZYA 2DK8A 1BCUH 4XSZF 4BXWA 2ELJA 1VQNI 2IXSA 1RD3B 1KU3A 2R7SA 3GY3A 1YWUA 4OIQF 4FX0A 3PWBA 4CHAC 2FIRH 1TNIA 2F9VA 3MKZA 1B9MA 1AB9B 3A88A 3E91A 1LJ9A 4QTRA 3T1BA 2J98A 1Y1VJ 2FDAA 2A7HA 3JRGA 1D3TB 1SR5C 1FLIA 1TMBH 3MNXA 5LHIA 2V7FA 3BJ6A 4NSVA 2ESHA 3MFJA 2F4IA 2LF8A 3K1NA 2HNHA 4NDLA 1HAHH 5GPIB 5SGAE 2CGAA 4RB3C 1A0HB 3BR5A 5CVVA 2H6MA 1YO5C 1MDMB 4CCKA 5F8XA 3C1DA 2ZCLP 2Q1JA 2OUMA 3QGJA 2KMUA 5C1XA 3RXAA 2F6CA 2F48A 4BQNA 2FI3E 2XYAA 2ELKA 4W97A 4A0ZA 3FO8D 2VJ1A 5K1YA 1VCPA 3QTOH 4XLFA 2ALVA 4RB1A 4HX7A 3ATLA 3HZJA 3ZIAD 3NCLA 4LXBH 1L1GA 2WBMA 3LPRA 2GDEH 1CT2E 2L7ZA 2L4MA 1J9IA 1GHVH 1BBRE 1Y0UA 1LHCH 4M73A 3V42A 5EJ1A 1TLHB 1QJ1B 4WXCA 2M7BA 3EYYA 4B74A 2ZPRA 2I8DA 2H94A 2LD5A 2KM0A 1JT0A 4HYEA 4I8KA 5A09A 3ZQFA 3Q9SA 1ZGIA 1F0TA 3K4KA 2BHGA 4ACAA 4BE0A 1GVZA 1NG7A 1QQIA 4A93J 3KZIC 3GDUA 3ZPLA 5M3FJ 2JRTA 3K1PA 3PFIA 3BTFE 1X1DA 5DP6A 1YJWI 2VQHA 2VJJA 2VIOA 2ZXJA 4B1RA 2Y6TA 2HVQA 4A0XA 3M5MA 3K1MA 3CLQA 3J7ZI 1GI9B 4BTIB 5AF9H 2FSWA 3F8MA 1P7JA 4F55A 2WPKS 2B9SA 1LPKB 4DYQA 2OA4A 2CW7A 1F4KA 1O32A 1DSTA 2XOKD 4Z2YA 4ZDPA 1UTMA 2JVGA 3GFIA 4P96A 2FXRA 1MBFA 3G2BA 4RKOB 4ETSA 4PJ0C 2BLOA 4X8VH 1QPIA 2ZFQH 5EGMA 4IXAA 1MQ6A 4FISA 4ZJZA 2M4KA 2FQ4A 4G9YA 1B0FA 1S8NA 4X6NA 4X8UH 1SGFA 1ZHPA 5F1RA 2ZJPF 3KP2A 4ZHLU 1KONA 1ELVA 1P06A 3RQ4A 3CCYA 2EILH 3TP0A 3ZZ5A 4X8SH 1T39A 1BMLA 5F53A 3SNDA 1T33A 1SSXA 1HSJA 1MH4A 1QQ4A 1SI5H 3LA2A 3N7DA 3IRQA 2HALA 3PV2A 1GHAF 1E79D 3L2QA 1E3OC 4BKXA 1C9PA 5C3NA 2A6HF 4MVNA 2JJ7A 1U6GA 3RU4E 4X1RU 3FISA 4IHWA 1UCYE 4PSXA 4RT1A 1CU1A 3CC4I 3OV8A 3L9FA 2OQGA 2QAAA 3Q3KA 5EEGA 4EGZA 4A3GJ 5J4VA 2K85A 1P0SH 2L54A 1ZLJA 2AYWA 1IQGA 3OWTA 3CUQC 3D65E 3PO3J 2P95A 3FZDA 3KP4A 3ABLH 4L9JA 1HSTA 1SB1H 4GO1A 3PB1E 2IN2A 3HIFA 3UPEA 5GPCA 1FYKA 2OUAA 5EQQA 1J0RA 3R6SA 1QFKH 2EFPA 1GJBB 1I50J 1OX1A 1AWFH 1L4ZA 1TRNA 4YFXF 3BG7A 4D5CA 1O2SA 1TNKA 2MGQA 2HZTA 4S0HB 2QBYB 1GBHA 3MNBA 3E16B 1BOBA 3S3OA 1AGJA 3BG4C 1U2WA 3K4JA 2O8KA 1VFCA 2P5LC 5HM2A 1QBNA 2GP9B 2ZFSA 3ZZCA 1YPGH 1P2QA 1H88C 2ZCKP 1T0FC 3GY8A 1BJVA 4KICA 1C9TA 5DP9A 1IRFA 1IHSH 3GXOA 4G6TB 3FKSD 1K7AA 4NUBA 2Q2EA 5C5OA 5JB9S 4D9RA 4RA2A 1LFUP 1P6RA 1G3BA 2NU1E 4N4NB 3LSHA 1BTWA 1Z8RA 2DU9A 1O2RA 1C2KA 1C2IA 2W3KA 3QRFF 2ZHEH 3JAMZ 3OYAA 4I32A 1X4OA 1MNMC 4FU9A 2L4AA 3SDGA 2W4SA 2HDCA 2QE7D 2NU2E 2UWMA 1P8VC 3DEEA 1BMMH 4TWWA 2OBOA 3BR0A 1ANEA 1IO2A 5FGMA 3BROA 3AAUA 3KEOA 2X6WA 1HW5A 1UHSA 2VKHA 2NNYA 3SYJA 2UXXA 1NG6A 4UVBA 4UB8C 3WTSC 1HW2A 2LKXA 4ABDA 1DLEA 5FCKA 2H1KA 1PPFE 4MNYA 2MD5A 4HDVA 1UB9A 1ON1A 1K1MA 1XX5A 2DODA 3CJQB 3MZYA 3GCMA 3RXUA 1MTVA 1FONA 1FIWA 1TALA 1XPXA 4YXWD 3LOCA 1O37A 4L0ZB 3WTZA 1TPPA 3WGHA 2Z94A 5G4BA 1XMNB 1EPTC 5GAGJ 1OWJA 1AU8A 1SMYF 1S85A 4EJTA 3S0NA 2HS5A 3OYMA 4GXOA 1U5TA 3SGBE 1GI4A 1C2HA 1A04A 4DYRA 5DEQA 2E60A 3QO6A 3F22A 3G3ZA 1O3SA 1FSHA 4Y7BA 2VWMA 1WI9A 3CF5F 3LONA 3NKKA 5JYIA 1XN7A 1XUGA 4FX4A 4EVIA 2CWEA 1TBXA 1UTLM 2C8YB 5F6MA 4ZTJA 2GZ8A 2W7UA 3OTPA 4JK6A 2W6ID 3PLBA 4ZKOU 2RNJA 3OR1C 5DS9A 1BDAA 2HOAA 4IOAF 3ZQLA 1OXGA 3UB0A 3L2CA 1KTTB 4B8XA 1KLIH 3PMAB 5KAIC 3C18A 3TK9A 3DD2H 1JTYA 4C2UA 3P7NA 3BTKE 2P8OC 4GSOA 3F9KA 5K7HA 3VB5A 2J92A 1WDIA 2PMUA 2RDEA 5LHHA 1EP6A 2BXTH 3BJOA 2AS9A 4O6JA 1VTNC 2E36A 2GZWA 4OU0A 3BTGE 3PV4A 4HLYA 4RS8A 4X2YA 3U1DA 3H5RA 4I7HA 3ZQ7A 1QIXB 1P4XA 2AMPA 2ZXHA 1U8BA 3F23A 5CJ9A 1GDUA 1Z77A 2CN0H 1ZJDA 1VQ7I 5LEKA 3NK8A 5KK1A 1EH7A 1RIWC 2FS8A 3RXGA 3B6AA 3K2UA 1FTZA 4AIDA 3IRRA 2DMTA 4FU7A 1U6QA 1NTPA 5EJLA 1DU6A 2E1NA 1EAIA 4LLLA 3SJMA 1E36B 4R0IA 3JRFA 1TBQH 4C2TA 4G7OF 2OAZA 2GCHF 2ZSHB 1T2KA 2RVCA 2TIOA 2FWWA 4XSXF 2Z3EA 3ABUA 1ELAA 1H8ED 1FPHH 1O2JA 3A7YA 2X85A 2H8WA 1P02A 4LD5A 1O3OA 4IS5A 2HZDA 1GJAB 4Q5SF 4LK0F 1JWTA 5IDKA 1Q2WA 3EPZA 4M3GA 3OTJE 2DA4A 1EB1H 4WF8A 5D5VB 3NWTA 4GRIA 2BLVA 2IJLA 3FMQA 3LSMA 3UUZA 1TRYA 5M5XJ 4X1NU 4E70A 4LB6B 1RPWA 2ZDLA 3E5XA 2EQNA 4EV0A 3SJKA 1YPJH 1FV9A 1UK3A 2GCHG 1JXPA 1SANA 5L2ZH 1FLEE 2BY0A 4ISIH 1HLTH 3BG6A 1Z1IA 4XRNA 2E1OA 5TGTA 1RUOA 1SL3A 2EI8A 3FK6A 5GADJ 2VB0A 5FKKA 4EJUA 5EZHA 1EB2A 1O7LA 2KDZA 5FX6A 1WPKA 1E34B 1IV6A 1DSUA 5FROA 2Y81A 2KCYA 3I4MJ 3LJJA 3DEWA 2R5ZB 4E06H 4NA8A 2IS1A 3H0DA 4UVAA 2H1UA 3STIA 2P6TA 1YQAA 2XSJC 1R9TJ 2XWAA 4NG9H 2F9BH 2V9VA 5AHGH 2Y69H 2A6EF 1YOVB 1NRNH 1V2JT 4NHJA 5F8TA 5KEDA 5BPDA 1EASA 2QXJA 3TH3H 2QGRA 2QLZA 1FY3A 4KTSA 1ETVA 1W0UA 5ABWA 2HOBA 4BEHB 1TNTA 2QV1A 1PPHE 3CO6C 3HPHA 3S8PA 3U21A 1G3YA 1JIMA 2FBKA 1HAZB 4OWRB 1N25A 1GI3A 4UUVA 1WJCA 1ZTLA 2DMUA 3JRBA 2R2MB 2FBHA 3GY5A 4EJOA 1F7ZA 5D5WB 1PDNC 3CS7A 4B6EA 1AVXA 3M7GA 5D8KB 3W95A 5J1RA 3GVAA 3U8RH 5K7RA 2PBIA 1QJ6B 4K8BA 1XGSA 1FY7A 5E8EH 4I8GA 2G5VA 3GY2A 1S7AA 4XLNF 3AKZA 3KFWX 4XOJA 1RRJA 3GCTF 1ETTH 2RFKC 3DF8A 4QT8C 2ZG0H 3SU4A 1P9QC 3OSFA 1W3CA 4Q4ZF 2P59A 5BOXA 3W6VA 1HV7A 2HWLB 3RXMA 2IA2A 3RTRA 2JKHA 1KY9A 1XVMA 1A31A 4ESFA 3M7QA 5DO4H 1A5GH 1LO6A 4NFFA 3T2NA 1W0ZU 3GFMA 1K22H 3RMMH 5L3BA 1ELBA 3UNQA 1T8OA 2V0BA 4I8HA 1ACIA 1RKWA 1NRQH 3WODF 2XPWA 3F9GA 3CMEI 3W1EA 2XAHA 3ASOH 2NOGA 3NWSA 4OMZA 3KQBA 2OC8A 3GCTG 4CYCA 1JOUB 4B43A 4YIFA 1OWHA 1GVLA 3G1LA 1N6YA 4A69C 1WCZA 4FVDA 2H6BA 1O3TA 4KYWA 1DWEH 1UVTH 1WRJA 3M8FA 5LHGA 2O8TA 3FM5A 1Y0NA 5J47A 5HLGA 3M1EA 4THNH 2EIMH 2RG3A 4GFBA 1W0TA 2FUG2 1LVAA 2BV6A 1OWKA 1A7SA 4ZC3A 3OYCA 1DWCH 4AN7A 1QHHD 1MTNB 3HK3B 2XGDA 4NB5A 2K3PA 2IGNA 1O2VA 1QL9A 2A32A 2ZQ1A 5FCRA 1DICA 2MA3A 1XKBC 1BHXB 2FU4A 1LE8B 3C1KA 4MG3A 3KQ5A 4A92A 2ZMEB 3KYDB 4DJZB 2HVSA 3I71A 3KE2A 3A7WA 4AYYB 1GHXH 2ELHA 1YRNA 4ABHA 1GL0E 3M35A 1KQ8A 2F9PA 1LTOA 3UREA 5EG0B 4ZYAA 3P70B 4YFNF 1OWIA 1ZHRA 1SKYE 4M3FA 1R49A 5FKNA 1W5SA 1R58A 1TABE 3FZZA 2QKLB 3G4SI 2AHQA 2A6TA 3VYRB 5J8FA 1NRSH 1FBQA 2FD5A 4YLUA 2YX7A 4BYYA 3LGWA 3F8BA 1W36D 5L3CA 3KNXA 4W1UA 2ZNZA 2P7VB 2B7DH 2IJOB 1D0ZA 2IRFG 3H35A 1TWCJ 3RXPA 3OX7U 2KIMA 5FPYA 2ETHA 2PJPA 5CVIA 5LPEA 3OU0A 3IUOA 4XKCA 1LKXA 1IG7A 3H9QA 1S82A 3MKYB 6CHAB 4UEHH 2NU4E 3A86A 1SOTA 3EQLF 4ZKNU 7KMEH 3TVJB 3RIRA 3FHZA 1YPKH 3QK1A 2PLXA 2HDWA 1HAXB 2DYSH 2HOTA 3WW7A 3BTEE 2CV3A 3HGPA 3FP8E 1QA6A 3KF2A 2PG4A 1C2LA 1KMHB 4Q80A 1LHGH 4BXXJ 5E0HA 4KN7X 1GVJA 3H09A 3M7UA 4LB5A 1V55H 1KYWA 1EFRD 2ID6A 5A2MH 1CGJE 3UAIC 3VXEH 2Z5UA 3BEUA 3GCHB 1E1QD 2A2XH 4J19A 1PYVA 1ZHMA 3WWBA 4BDZA 3AASA 4CRGA 1AY6H 2GGVB 1SGFG 1TOCB 1C5UA 3RXSA 4B47A 3Q5FA 5C4JJ 4A6EA 3IH3A 4WY3A 1LB2A 4Y0ZE 3VB7A 2YOLA 4OINF 1KYZA 4YFKF 1BRBE 1ZOMA 4BAKB 3DXJF 1YX5A 3GLLA 1G3WA 1A36A 2VWOA 3HUGB 5E3OA 3DSOA 1GDNA 4OIPF 3A0HC 3L2RA 3GTLJ 5E8GA 2EV0A 2DQLA 1HCRA 1EH8A 1OWEA 1ZRFA 2ZA5A 2V79A 3WG7H 4DVAU 3HPTB 1GJ5H 1Y8QB 1VCWA 3O8BA 3A7TA 2Q6GA 3BG3A 3ASNH 2QSHX 1ZH5A 2ULLA 4FETA 1PUEE 3VSKA 1I1GA 3ZVDA 1Z7LA 5EU8A 2A7JA 1BW5A 4KIFA 4B2AA 4X1EA 3EE7A 1P03A 3OS1A 1SGDE 2TPIZ 1ZAOA 1R1TA 2BDGA 1SMTA 1IRGA 4P9UA 2SNWA 4CHAB 4GCHF 3DU5A 1GBLA 1YCPM 4C30A 4I76A 3O2PE 5E2OA 2P5VA 1EKBB 2FOHA 2GA1A 3A01B 3QQAA 4CCLA 3RXQA 4UFEH 1C2EA 4EQQA 4CR9A 2BDYA 1F1ZA 4IRHA 3AL0C 3CDIA 3FXQA 1KDQB 2NNNA 5E8IA 1VITH 5BS6A 1VQ9I 4AC0A 2DOFA 4QIWN 2XGEA 3PM3A 2PN6A 4YT7H 3GZ5A 2FP7B 2E34A 1SFEA 1QHRB 2NU0E 4E7IA 4JP0A 4XN3A 3Q3YA 2PJRB 2AGIX 5ICEA 4GCHG 3WU0A 3LU9B 3TGIE 4M3DA 1FUJA 4D1QA 4XKVA 2HNTF 1F36A 1VITF 5D4SA 2QGUA 1AKSA 1KXBA 1N78A 1LVYA 4I99C 5HLIA 5F08A 2ZHFH 3K2ZA 2XPVA 3MEXA 3WE2A 4EEFG 2D1VA 3R0AA 5EPYA 1V2WT 1G3SA 2KRHA 2RA3A 3ODFA 3JZ2B 2H09A 1OWDA 3DKXA 3HOSA 1G2MA 4BGDA 3MMGA 2WYJA 3OYIA 2M34A 5DDGA 3OYJA 4I2OA 2XIGA 2CJIA 1HLVA 2AIPA 3F9FA 3DKWA 1VITG 1O2MA 3HOYJ 3LH3A 2COBA 3ESWB 4BACA 1ERDA 1GCDA 5ICGA 4KGAA 3WWFA 5TRDA 1APLC 2P94A 4XLEA 3K4BA 3HDDA 5AIQA 1A2CH 1H1BA 1OKXA 3A7XA 1WHUA 4A3DJ 2FA5A 4R79A 4IHYA 3QP6A 3NARA 3VODA 2F5CA 3T26A 4Q4LA 3CUOA 1HXEH 1MKMA 1K28D 3S9BA 3BTHE 2BVRH 4HI3A 3GUDA 1K78B 1ETXA 4PUSA 3H3ZA 1CT0E 1FT9A 1AHTH 4J01A 4M74A 3BF6H 3L2VA 2DLLA 3FXJA 1UELB 1W7XH 2P8TA 1O3PB 1MUEB 1ELDE 3VEPA 3I64A 5IPAA 4H42U 5EXLA 2Z33A 3NXPA 1W10U 5D6FA 5JR3A 2UWOA 1Y3WA 4Y17A 3P9CA 4EATA 2BD8A 3RXIA 4A3EJ 4HGCA 4H6SB 1FJLA 1CGPA 2FBIA 1MBHA 2X1CA 1NRRH 2C8XB 2V1XA 1FIZA 2PWXA 2PR3A 4Q2KA 4O3UA 3L2WA 1MD8A 5KVRA 2VN2A 2GAUA 4B2BA 4TV7A 2BX3A 3PMBB 3QWLA 4NA7A 3F9HA 1C1RA 2NVYJ 2XGXA 2ANYA 1CHGA 1NU9A 5JHFA 2FE3A 1IRZA 4NA9H 2R7DA 1B5GH 4KISA 2OD5A 2OBPA 3GFJA 4YTAA 2XNIA 1YE9A 2BQ6B 1GCTC 2KAIA 2LKSA 2DMPA 2MH2A 1BIAA 5JBAS 4BNCA 4B75A 1U3EM 1FZZA 2HQAA 3JRCA 1G3EA 4S04A 1L1JA 1GBEA 4Q7ZA 4D9QA 1PVEA 2ZB9A 2ZP0H 1OYQA 2O61A 1SFKA 1UHBB 1HAGE 2EB7A 3RU4T 1TW2A 3MU8A 2XW9A 3M37A 1F5TA 3ATMA 4U0WA 1EJNA 4EM0B 4NBQA 5DCFA 3TK6A 1E3PA 3LA3A 1B59A 4C3HJ 1GI7B 1JHHA 3TMOA 1LFBA 5K5OA 2PKSB 3HB9A 2XBYA 3LMMA 2ZTYA 4N0BA 3E6DA 5AFYH 3CCSI 2VBCA 2KPMA 3F2GA 3JSOA 3FKIJ 1YGCH 2HKOA 4FTHA 3DFJA 2MLKA 4UV9A 3I59B 2XASA 5KGOA 4F93B 1IQEA 2E35A 5IYTA 1P05A 3UOPA 3PO2J 1V2UT 1ORKA 3H7OA 3MKLA 2ODPA 1H4WA 5FXLA 4EMSA 2J4IA 4KIGA 4OIRF 2KIUA 3I5UA 4RAZA 2V3MA 1O3CA 2KRCA 1FNIA 1GL1A 1EJ9A 1W4MA 2AGEX 2K0QA 1VQLI 4AB9A 2VVUA 3MHWU 4D0PA 2Y5FA 4IBLH 3ZMZA 2YPRA 4X0WU 4A3JJ 1KSNA 3RU4D 4RGSA 1BI3A 3W2WA 3ZR8X 2DUCA 1OR7C 1IQLA 2FODA 1K4SA 4M9XA 2B0FA 4Y13A 2Z9OA 1A5JA 3JAMK 2OINA 1ABIH 5FBEA 1KLJH 2FX4A 3S2DJ 4HLXA 4RAFA 3MMYB 2K02A 2IVMA 4X2XA 2GD4B 3ESTA 1BZXE 1ZGWA 2OZ6A 1JRTA 3F68H 1BOAA 4C3IJ 4KJZA 4RGXA 4CA0A 1BT7A 4M9FA 1Y8RB 3JTGA 3GICB 2VBXA 4M9SA 1MTWA 3K9XB 1KDQA 1EAXA 1TGBA 4YELA 4JYUH 2CHAC 1YI2I 4BXUA 1TGSZ 1O3DA 2R4GA 3P9IA 2BW3B 3OAAD 4KA4A 1EPTB 1CF7B 3FIWA 1RI7A 2BY3A 1XM1A 3KCCA 5JBTA 3C7JA 2G0EA 2JSCA 4OS5A 5F04A 1DDNA 1T6SA 2B0LA 2GZ7A 4G6DA 1MJBA 3SZTA 1MKXK 1TW3A 1QCPA 3QX5H 1E17A 1N8OC 1CT4E 1MCVA 1MBKA 2XF5A 3ISPA 1AU7A 2M2AA 3UWIA 3RC6A 2A4RA 4EGYA 2G55A 1BM9A 1MCTA 1JUMA 1Z71A 1Z91A 2LMDA 1CA0C 2FI4E 4AC9A 2XPUA 3BG5A 2LBFA 3RXRA 2EBIA 5IYCJ 3DTKA 5GCHG 4SGAE 4R8HA 3DCFA 1TPOA 1G9IE 3FP7E 2EZKA 4V2GA 2ANWA 2HYJA 2ZXWH 1TMUH 1NESE 3KLOA 2OCEA 3CP8A 2ESTE 1QGFA 2QSGX 2ZJ2A 2SGQE 3AVZA 4IMZA 3JZ1B 3SU0A 4JZFH 1MD0A 1LQEA 1FY5A 5HDKA 2VLAA 1KQ9A 2ZFFH 3H3UA 2BY1A 2F83A 2E2HJ 3CP2A 3RM0H 2FLBH 1OCCH 1K78A 2NS7A 4F91B 1WJAA 2TGDA 5EGOA 2KCAA 5A0BA 1OKRA 5LD2C 2CUFA 3V0XA 2A3SA 2R7XA 2BXUH 2H2ZA 1MMNA 3ZZ9A 2L9VA 2BD4A 1GLNA 1P11E 3TK5A 1IRXA 1RIWB 3ZMVA 1TT5B 2JZYA 3RXCA 3FXRA 3ZQCA 3B9FH 2BOLA 2EH3A 3M36A 1SD6A 4K2YA 3AG3H 3CMMA 5LFAA 3ZZDA 2ZFWA 1THPB 3UFAA 3MO6A 4BAYA 2UV1A 1S29A 1OSSA 4IGDA 4E05H 1TWGJ 3LAJA 4XMYA 3OSGA 4GHTA 3VB3A 4DBQA 1GMHG 1NBME 3SU6A 5IY5H 1GXPA 1NHAA 1PYTC 3ELKA 4LG0B 3O8RA 2J5OA 4CH2B 3QZQA 2F4OB 3TQNA 1O3GA 3BTME 1THRH 1NZQH 3FXOA 1AZ8A 2FMYA 2BXZA 1TNJA 1IW7F 4FUCA 1ARCA 5I25A 2PKAA 1WJFA 1NM6A 4U88A 1UTQA 4UD9H 3JTHA 1Z7UA 1ORFA 4AFUA 1YW9A 1GMCG 3C2BA 5JLXA 3Q77A 4RLFA 4MFDA 5EDNA 2ZJRF 2JH0D 2EK5A 3SHAH 3I58A 3ERED 4I0AA 2ZDVH 5E1XA 1DM4B 3NZIA 3BTJA 4H4FA 1IQKA 2K1QA 3BR2A 2R7WA 1UCRA 5BPIA 5HNFA 3CUQA 1VI0A 1XB4A 1AFQC 1BMAA 1TX6A 3W6KB 4IZZA 5EEHA 1ETKA 3QYBA 1RS0A 2KCOA 1DLKB 5FFXA 2PHBA 4FUFA 1FY4A 2XHKA 4AORA 4Z1MD 1BTUA 3GZNB 1B0EA 1F2SE 4F92B 1WWXA 1X1CA 1LPGB 1AQ7A 1PUFA 1PQ5A 3GY6A 1J75A 2JRMA 1RXPA 2XC7A 5FRNA 1B72A 1MIJA 2VASA 3NRLA 3BTDE 1XSDA 3P92A 5DP3A 3HOUJ 2ICWG 1IQJA 1B4AA 3SOSA 1A3BH 2O3FA 3O8HA 4JZIA 3OOUA 2IOTA 4ENNA 3OYHA 1L0OC 2LG4A 4ZDLA 1YKTA 3LGUA 4A7IB 2F5FA 3S2HJ 1T0FA 4KIBA 2PW8H 4G7ZF 5DSFA 4WH8A 4YT6H 2MABA 1G59A 5A2QZ 5F6FA 3RQIA 1Z9CA 2QF5A 4Y33A 3MAJA 2HKXA 4BE2A 1GDTA 1DGWY 3UR6A 1EH6A 1HYLA 2NOJB 5E2PA 1S7EA 1R7JA 1QQUA 4NQWB 3J7YJ 2Y48A 3O8GA 1ETQA 2IAIA 2PV9B 4BDYA 1O2OA 4J2YB 2Y80A 1QRWA 3MH6A 4BOHA 1HUTH 1Z3XA 3DP7A 2ZNYA 4XQFA 2IW5A 2L9NA 1JHFA 3Q3XA 4HTCH 3U9AH 2ZXIA 3GW2A 2HDDA 1L4DA 2ACJA 3SZEA 2ZSIB 4L5EA 2WY8Q 1C1NA 3LA7A 5DM6F 1HJAB 1SD7A 1H89C 1NN6A 1EP5A 5DUIA 1ESAA 3NWUA 2IPHA 2BYAX 1YYY1 4XRSA 1QA7A 3BTQE 1GWAA 2OCVB 1YPMH 2P5KA 4A3LJ 2BVMA 2L7KA 5FKMA 2QEXI 1C4V2 3I3LA 1OS8A 3KQCA 3E1XB 3KN2A 4BXSA 1S6LA 4D5FA 3TP3A 4I6ZA 3H36A 2ME0A 2GCTB 5D5XB 5K5RA 1FPQA 5H6QA 3CMAI 2RAEA 1LQ1A 1MTUA 2BDBA 1HDDC 1GXQA 1TTYA 2Z3YA 2R7VA 1O33A 5DV5A 4MPVA 2ZFPH 5JDUB 1SLUB 1CGHA 2CFXA 3GTGJ 1O2LA 2VUMJ 2V1DA 2UWLA 3T0YA 2ZGCA 2PEXA 5FL7D 3K9TA 3V3MA 4HX4A 2DFFA 3ABMH 4DNCA 3IH4A 1WSSH 2HWVA 2O9QA 2PUQH 3ROUA 2E1MC 3S93A 1YLDA 2J38A 3LIWA 2DW4A 4FE7A 4HV5A 3S7HB 3OYEA 3U1KA 2ZPQA 4A3KJ 1GBKA 1HIAB 2VJ5A 5BNGA 3PMJA 5HOOA 1SHYA 5CHAC 2J2UA 3SN8A 5LH8A 1BJUA 1C1QA 1RJXB 5T6FA 4V19K 3M3YJ 1H9GA 3BC8A 4PJNA 1MSFC 2CSOA 2VXDA 3VYTB 4DYCA 1IGNA 2KZGA 1XDUA 3E90B 1O35A 3B8JA 2B8OH 4DBRA 2GT7A 3PQJA 2QQAA 2V6NA 3F1SB 1QVTA 2O8LA 2OTVA 2ZC2A 1YX3A 1OYYA 3UNSA 4K1EA 1ZZZA 5H2FC 1J16A 2K9LA 3M5OA 1RTKA 1PYTD 1XUIA 1YPEH 1BBYA 3UQOA 3ZMUA 3FM3A 1VGCC 3ITIA 3PMHB 1GG6B 1VZQH 3TDUC 2J98B 2Z2SB 2Q0OA 9ESTA 2H5CA 3STJA 2IJD1 3LSIA 2EFOA 4KNYA 4HPQA 3GLXA 2Y0SN 3O8CA 3RCOA 4GYIA 2LFBA 2M3AA 1C5SA 4CRFA 2P4WA 3LQRA 4HV6A 1C5TA 4ZROA 1JKOC 4Q47A 1D0YA 3A85A 1K83J 3SGAE 1O5AB 4FT8A 3T5XA 1FYMA 1MJAA 2LP6A 2YMSC 1K1NA 4XKWA 4UDWH 4FQGA 3SJIA 1ZLKA 2H6CA 4I98B 3ZVAA 1EX3A 1EATA 3SZNA 2KISA 4ZHMU 1T4UH 3FFGA 4XN0A 2VNTA 4JYTA 1ELFA 2HOSA 1FN8A 4PSWA 1K0HA 2G7UA 2QZ8A 1PJPA 1MKXH 5FKOA 5EPNA 3FMSA 2NRAC 1O2UA 3ZMDA 3LC5A 1HJ9A 2BZ6H 2WV5A 2CMPA 5CPRB 5CQEA 2QXHA 8KME2 4LZ4B 3SNCA 4CH8B 2Z9LA 1JUSA 4R8TB 1J5YA 2FOKA