3A7TA

Crystal structure of trypsin complexed with 4-formylbenzimidamide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7tA02
1BCUH 3F9GA 4WMEA 1G2LA 3SNAA 2QXJA 1G9IE 1PPFE 4RKOB 1C5ZB 3MI4A 6ESTA 1GVLA 1ABIH 3KQDA 2R9PA 3TLOA 1TBRH 2UWOA 1OP8A 3QGJA 4DT7B 2CV3A 4TPYA 2VH0A 4FU7A 4JYVH 2C90B 2J94A 1FY1A 3RC5A 1DVAH 3BG4B 1P57B 3TJNA 2P3UB 2R3YA 3A8BA 3MH5A 2B7DH 3RM2H 4KTSA 5AFZH 1KDQB 3ODDA 3B8JA 1QHRB 2BDCA 4X6NA 5JBTA 4BAOB 1YLDA 3ATWA 3UFAA 3BTDE 1C4Y2 1V2UT 1QJ1B 2GKVE 2O8MA 1FY3A 4ABAA 1HUTH 2C3SA 1XKBC 1NFYA 4AFQA 1SLUB 2FOMB 4INKA 1EAIA 1ZSJA 3LGYA 1UVOA 4IMQA 3UUZA 2Z6BD 1YP9A 3MU8A 4A7IB 2P95A 1INCA 1TNLA 3ZZ4A 4DG4A 4I33A 3ZV9A 1BJVA 1GJAB 2V3HH 2WPJS 3GDVA 3ELAH 4ZXXH 2Z9IA 5J4QA 2DE8A 1JIRA 1H1BA 1GHXH 1SGEE 5FXLA 3A84A 1AVXA 2CMYA 1MZDA 2M5TA 1QR3E 5B6OA 1NZQH 1GI5A 2J2UA 2A0QB 1WAYB 2G55A 3PMBB 1K22H 4R8TB 2BOHB 4JCNA 1YBWA 2PHBA 1O3HA 1Y5BT 3E1XB 1QB6A 2OLGA 1CQQA 3BTQE 1MD8A 1P10A 4UE7H 3S7HB 1C1VH 2WV5A 2VWOA 3MYWA 3NK8A 4UD9H 2H9TH 3SUEA 1YCPM 4MNVA 3AW0A 3H7OA 1C1OA 3OU0A 1LHEH 1GI0A 5BPEA 4IN2A 2G5NA 2OINA 3P17H 1F92A 1OP2A 1GI1A 1YCPH 1A0HB 1DE7H 3VB4A 1SQTA 1C4V2 3KF2A 3RU4E 5TCCA 1O3BA 1C1MA 2C8XB 2GV7A 2OUAA 3SGBE 2Y7ZA 1O3LA 4ZHMU 1NRSH 4JZEH 1EXFA 3H7TA 1S0RA 2SNWA 2GTBA 4D7FA 2OTVA 3A7VA 1P05A 3PLPA 3PTBA 5A8XA 2FMJA 1UVSH 3RXUA 1TLDA 5EOKA 2ZTYA 5EPNA 1GCTC 1TPSA 3SU4A 3ZYEA 3SV6A 3A83A 2SNVA 4KTUA 8GCHG 2Z3DA 1V6DA 1BITA 3I77A 1E0FD 3UWIA 1OWKA 2BYAX 1SOTA 4K1EA 1Z8IB 1BRBE 2BHGA 1C9TA 3TGJE 3K9XB 1N8OB 1C5QA 1S6HA 2B9LA 1O2NA 1FN6A 1PPCE 2FXRA 3F68H 2FX6A 4X1PU 4YT7H 3RP2A 2A2XH 5GIBA 4Z0KA 1O2XA 1WTGH 1QRWA 1VZQH 1JBUH 1YLCA 3RXAA 4KTCA 1KTSB 5GWZA 2XBWA 1DXWA 1MKXH 3PWBA 1O2OA 3TNTA 1EZSC 1C5MD 3RM0H 1AQ7A 2H9EH 1LHDH 3U8OH 3A7ZA 2FI3E 1NU7B 5AF9H 2P94A 1G3BA 1XX9A 3VB3A 1PQ7A 1YF4A 1N6XA 1H9IE 3FZZA 2XBVA 4M7GA 4OS4A 1BUIA 1SB1H 1F0TA 2BQ7B 2HALA 1UVUH 2F83A 4K2YA 4YLQH 5SGAE 1LPKB 1YPEH 1O2VA 2PR3A 3QK1A 4JYUH 3URDA 2W26A 1GI7B 2Z3EA 1P9SA 3L33A 1ETSH 2C93B 1LTOA 1HAIH 3AVZA 1B0FA 1Z6JH 1VJ9U 2ZPRA 1WQVH 1O3NA 8LPRA 2XBYA 1QNJA 3M7TA 1L1NA 5E8EH 4FUGA 1O38A 5HXFA 1GJ5H 2WUCA 1FXYA 1O33A 1ELEE 3GCHC 2A5AA 3QZQA 5FX6A 1Z71A 2FYQA 4WWYA 1TNHA 3UQOA 1Y3WA 4GCHF 2VIOA 1EJNA 1PFXC 3A89A 4LOYH 1W3CA 5T6GA 1GMCG 1Z6EA 3Q00A 1P3CA 3TK6A 1OWJA 2SFAA 1H8IH 1LMWB 1V2VT 2WPIS 2BZAA 4MPXA 4SGAE 1RJXB 1FY5A 1O2WA 1Y3UA 1KXCA 1NFUA 5FPSA 5DP9A 1ZR0A 4NA9H 5L2YH 4MLFB 1SLXB 3OY6U 2FX4A 1QJ6B 4H6TA 1TMUH 2V0BA 3SGQE 2FTMA 3FVFB 3QDZB 3I29A 4Q7XA 4X8TH 5LPEA 4YM9A 2FPZA 4GCHG 1EPTC 1B0EA 1MTSA 1KTTB 3LT3A 2ZGJA 1TB6H 3NXPA 3MU0A 3ZZBA 4VGCC 1O5DH 2Q1JA 3SU3A 3ZVDA 2OD3B 7GCHF 1C5LH 5T6DA 1ZMLA 1FAKH 3HGNA 3NCLA 2VU8E 4JK5A 5AVDA 1K1MA 4Z6AH 4RKJB 1IQHA 1DITH 4DW2U 5EW1H 1UK4A 3LIWA 3PYHA 3TH3H 3PLBA 2A2QH 3TK9A 1PQ8A 2BB4A 2VIQA 4Q80A 1XUHA 1DICA 2W3KA 3A85A 1O2TA 1GCTB 1QJ7B 1A46H 1NN6A 1GPZA 1L1GA 2BDBA 2CGAA 1DY9A 2F3CE 4BXWA 1NTPA 2XXLA 1AO5A 1P09A 2ANWA 2HPQH 4LXBH 5EODA 3Q76A 5F6MA 3GY3A 1AWHB 2QIQA 4O03A 1GI9B 1HIAB 3FFGA 2FOAA 2ANKH 1GI8B 4MVNA 1AVGH 1TNIA 4HGCA 1P8VC 4CRCA 3E16B 2ZECA 1BHXB 4K8BA 3ZZ6A 5EXLA 1GJCB 2FOHA 4CR5A 1P11E 2EI8A 1XMNB 1T7CA 4ABJA 1SQAA 3ZZAA 1O2ZA 1C1PA 1BTXA 2QF0A 3GY4A 2ZZUH 1T32A 4ISIH 1GDUA 1Z8GA 5GCHG 4NZQA 1H8DH 1YPHC 3GDUA 2A7HA 4FUJA 3JZ1B 3OY5U 4K1SA 4NFFA 1OWHA 1E37B 4NGAH 1O3DA 1GBJA 1SOZA 2BX3A 1AY6H 3GDSA 3RMNH 2GP9B 3KQBA 3LGVA 4FVBA 4BAKB 2FOFA 5FBEA 1FI8A 2Y80A 3B9FH 3ZVEA 2BOKA 3KHVA 4MQAA 1ZPBA 2Z7FE 5C1XA 2B0FA 3RXMA 1NO9H 1TRNA 1RTFB 3QO6A 2W7UA 3PB1E 1MQ6A 4DCDA 3RXLA 4ESTE 1C1NA 1J8AA 3SUGA 1JRSA 1TOCB 4ABDA 3TJOA 2XC4A 3ZV8A 3O8BA 4X2YA 1FIWA 5IYTA 1V2MT 4ZKOU 3BEFB 3EQ0H 1Z1JA 4B75A 1UCYK 3SZNA 4TWWA 4KP0A 1V2OT 1SGYE 3BEUA 2D1JA 2GZ9A 4WVPE 5ESTE 2I6QA 1IQFA 3GCHB 2TBSA 1GBEA 1EPTA 4K60A 3ZVFA 3RC6A 5DKMA 2LNCA 3F9EA 1ZJKA 2P16A 1BTUA 3K6ZA 1ZMJA 2ZU1A 4XFQA 5ETXA 3SN8A 3FAOA 4X1RU 1CHOG 3OSYA 4ZXYH 3ENSB 4X1NU 2QCYA 1HAZB 5GPIB 1YPGH 3RXKA 3ZZ9A 1NS3A 3F9HA 4DGJA 4IN1A 1GHAG 4BXSA 3QTOH 2FWWA 2BDHA 3A7WA 1MCVA 1KIGH 4B2CA 3M36A 1O2RA 1S83A 3A7TA 3M5MA 1O5FH 1O3IA 3E0NB 4ZUHA 2YNBA 1EPTB 2ZCLP 2UUKB 2R0LA 1ELCA 4VGCB 4ABEA 1O0DH 4YLUA 4NIWA 4I8GA 1OOKB 5E0JA 4YOGA 2O8TA 1J16A 1JOUB 2PTNA 2ZDKA 3OTJE 1BRAA 1VCPA 3I78A 4AN7A 4MPWA 4MPVA 3SV8A 2XYAA 1NPMA 2ANYA 3P6ZB 1ZTJA 1WTHD 1TGCA 1T8NA 3U9AH 1QL7A 3MU4A 4IMZA 3BTTE 2Y81A 4ASHA 1WOFA 1ZOMA 1HGTH 1Y5UT 1AZ8A 1AB9C 1Q3XA 2QV1A 1GJBB 1O2UA 4E06H 3ZZ8A 1KLTA 1WCZA 5L6NH 4B1TA 2ZKSA 1RTKA 1IQNA 2ZU5A 1AKSA 1AVWA 1O35A 1TQ0B 2W5EA 2BQ6B 2O8LA 1V2TT 1IQEA 3TJUA 3SJOA 2H6MA 3S9BA 4ZKRU 3TITA 1A2CH 4JMYA 3L6PA 1ABJH 4ZAEA 5JYIA 2BD9A 1TYNA 2F9UA 3U1IB 1XUGA 2UUYA 3DT0H 2R3UA 2ZHWH 2BQWB 3NPSA 1CGJE 1ELDE 1F0SA 4OS1A 4AYVB 2QF3A 5DP5A 4O97A 2BDIA 1SGQE 2Y7XA 1UVPA 1BTPA 1GMHG 5C20A 1GMDG 3RMLH 1C1TA 2FIRH 1AKSB 1E35B 1THPB 2FOBA 4Q2KA 2Z3CA 2ZDMA 6GCHF 2ZU3A 3NKKA 1HPGA 1C9PA 1MAYA 2XC0A 1P2OA 1O2KA 5EW2H 3U1JB 5AFYH 3SI4H 1KXAA 3SU0A 2A1DB 3PM3A 1SFQB 3BTKE 1GBIA 4ISHH 8KME2 2BDYA 2XW9A 4NA7A 4BOHA 2STBE 3SU1A 1A61H 5K7RA 5DP6A 5DGJA 2ALVA 1ORFA 4CBNA 1TPOA 3IWMA 3RC4A 1N8OC 4I8HA 4LZ1H 1G36A 4FUHA 1TX7A 2ASUB 1GDQA 3BTME 1K1OA 1ANCA 1CT2E 2GZ8A 1EB2A 5EU8A 1H4WA 1DY8A 2Q6FA 1O2SA 1TABE 3ZYDA 5C3NA 4ABBA 1FAXA 4K3JA 3EGKH 2OXSA 4AYYB 4BNRA 1XKAC 3QGNB 1IQGA 1O34A 1G2MA 2BVRH 1SLWB 1QB9A 4Y0ZE 1EZUC 1NFXA 1V3XA 2WPMS 2V6NA 3LC3A 1LKAA 1S82A 2FI4E 1P2KA 2C8YB 3GY7A 1O3FA 1W11U 1MQ5A 1QQUA 4J1YA 1GJ8B 4UFEH 1LPGB 2A5IA 4AG2A 3TGIE 5C2ZA 1DM4B 2CXVA 2BMGB 1GVKB 2HPPH 3TIUA 5A0BA 1UTLM 4AFSA 1GJ9B 1TMTH 3DFJA 3MNBA 1OSSA 3D49H 1AIXH 4RN6A 1GGDC 4X6MA 2A5KA 5DP7A 1OYTH 3BEIB 2ZEBA 1BBRK 4K5ZA 2QGRA 1OP0A 3SNDA 1EOLA 2P3FH 1D9IA 3HATH 1D3TB 1TGNA 1ESTA 1TPPA 3GCNA 2HWLB 3ZVCA 2FS8A 3KL6A 1AI8H 1O5BB 3BTEE 4XBDA 1V2WT 1BQYA 2BLVA 1FONA 1AGJA 1ZTKA 3C27B 3A7XA 1JXPA 2VWNA 5FPYA 4IS5A 3T28A 1FJSA 2G4UA 1O2QA 4A5TS 3ZVAA 1DSUA 4INLA 3S7KB 3A80A 1MKWK 1AB9B 1ZRKA 1D6RA 1V2RT 3ATKA 3S69A 4DY7B 1O5AB 5HYOA 3HK3B 5E0GA 3MU5A 5CMXH 1DPOA 2BY9X 1IHTH 1SVPA 1TWXB 3IITA 3KQCA 4IC6A 5JBCS 1TNGA 1SGCA 3O8RA 1C2KA 1CO7E 1IQKA 3ITIA 3SU2A 3AASA 3RXEA 2QN5T 3SV9A 3RXVA 2GT8A 2HLCA 3TGKE 5C1YA 3SGAE 2BVXH 2NU2E 2ZA5A 4INHA 1TE0A 4AG1A 1C5YB 3SV2H 1Z7KA 1O5CB 8GCHF 7KMEH 5T6FA 2C8ZB 1XUFA 7ESTE 2FYRA 2VWMA 2GT7A 3RLWH 3RXFA 3ZZCA 1CA8B 2ZFQH 1HJ8A 1F0UA 2AEIH 4JYTA 4FUDA 1BHXF 2OCVB 2VVVA 2AERH 5A0AE 1UK3A 1PQ5A 1ELVA 3V3MA 3A86A 3PTNA 4D7GA 1ELFA 1O2PA 4X6PA 4YO9A 1QA0A 1ELAA 1RGQA 2W3IA 1SLVB 3SNCA 2ODQA 2TGTA 5GJ4B 1Y3XA 1BZXE 2ZDVH 2J38A 4MG3A 2PWXA 1S0QA 3MH4A 1O3KA 1J15A 1C2JA 1YPJH 3STJA 2BLQA 1UTOA 3A8DA 3P70B 3GY5A 1C1QA 1HAOH 2G81E 4Q7ZA 1SPJA 2FI5E 4NFEA 1EQ9A 1AWFH 1DUEA 2AGGX 1HCGA 3VFEA 1MZAA 1SHYA 1JWTA 2OP9A 1DWCH 3TJVA 1AUJA 3ZVGA 4TYDA 3TK5A 3CP7A 3GISB 3EA9A 3E91A 1CBWC 4J2YB 1HV7A 1THSH 2FESH 2ODYB 4O3TA 3RMOH 2IOTA 1O2HA 1GG6B 1YC0A 1ESBA 1O2IA 4UEHH 3UNSA 1G37A 1FQ3A 1EAUA 5HM9A 1HXEH 2FTLE 1EASA 1O3PB 4XBCA 3DA9B 1GHZA 1GBLA 1FPHH 3F9FA 4DJZB 1V2LT 3SO3A 1GVZA 2VWLA 3W95A 1UTNA 1ZLRA 3T29A 4I8LA 3PMJA 3SU5A 1P2MA 4F49A 2ZPSA 2SGQE 1XXFA 2AS9A 3SORA 1N1LA 5I46H 1MAXA 2OBQA 1A4WH 3FP7E 4CBOA 2GVFA 1GGDB 1W13U 2BTCE 2ZQ2A 3SJ8A 4O3UA 1ELBA 1GMCF 1GL1A 1BRUP 1XUJA 2QXIA 2O9QA 3UNQA 2Z9KA 1HAYB 3FP8E 1TGTA 4OS6A 4B2AA 3ATIA 3LGWA 1BMNH 2Y5HA 4ABIA 1TRMA 4FUCA 1ID5H 1KLJH 3VGCC 1MTNC 1F5KU 1UK2A 2OC1A 2TRMA 3VB6A 2ZG0H 3NZIA 1MU6B 4PROA 3RXIA 1QGFA 3R0FA 1WU1A 1P02A 2RG3A 2D8WA 3MH7A 2EI6A 2H2ZA 1MU8B 2PLXA 1IQMA 1WUNH 3Q77A 1O2GH 2ZFPH 3LC5A 2VJ1A 1HB0B 1O3GA 2BXTH 2AH4X 5A0CA 3KNXA 1IQJA 1WQSA 3LGTA 3UREA 3PO1C 3GICB 1GWAA 1XVOA 1ZSKA 4FUBA 3LJJA 4NIVA 3U8TH 1HAVA 1NRNH 2FODA 4WY3A 2ODPA 1GI6A 1B7XB 1NRQH 1XUKA 1CGHA 5DPAA 3K65B 1S85A 1J14A 1GBTA 4B76A 1V2QT 2NU1E 2PGBB 2HNTC 2OQ5A 3MNXA 4JZDH 5AHGH 3E6PH 1JRTA 2ULLA 2IPHA 2VINA 4D9RA 1GI4A 1O37A 1YPHE 3ZZ3A 1EATA 1GBMA 4CRGA 1AUTC 3M3TA 1C1SA 2HOBA 2J95A 1QBOA 5E0HA 4IW4E 4FUEA 2A7JA 3TPIZ 3GCTG 4HZHA 2FO9A 3U69H 2K1QA 5DP4A 4CREA 3Q3KA 1TNKA 3QLPH 2Z9LA 1VITG 4E7NA 5HM2A 1GHWH 4Y79A 1HFDA 1JIMA 2A4QA 2PW8H 2H1UA 4E05H 5ABWA 1V2ST 1EJAA 3AAVA 3QX5H 2H9HA 1QL8A 4GUXA 3T2NA 1S5SA 2GCTC 2BY6X 5GCHF 2QXGA 4WH6A 5FCKA 1QBNA 1MBQA 4A92A 3K2UA 1P9UA 4AGKA 2NWNA 1RFNA 1T8MA 3MMGA 4HFPB 3UY9A 2NU3E 1W14U 1C1RA 4YOJA 1UTKA 3BF6H 1CBWB 3SJKA 2THFB 4X8UH 4B73A 1TGSZ 2XCFA 3PLKA 1C2MA 1TRYA 1BBRH 1EKBB 2TGDA 1DS2E 3M5OA 1A0JA 1A3BH 1RRKA 4X0WU 2GD4B 4BTTB 1PYTD 4TY7A 1LQDB 2YOLA 2WV4A 1OKXA 4CRDA 4H42U 2AIPA 4WH8A 1SGDE 2AGIX 3BIVH 1Y3YA 1UHBA 3HK6B 1BRCE 2B5TB 3A81A 1QA7A 1P03A 1VCWA 3EYDA 3M3VA 1K9OE 3Q3XA 4KELA 4XSKU 5PTPA 1EAXA 3U98H 3LU9B 5JB8S 4GPGA 1P0SH 1TAWA 3SU6A 4NWKA 3DHKH 1LHFH 1CHOF 1W0ZU 3MU1A 5EPYA 4WF8A 2XNIA 3RLYH 1FN8A 4Y8XA 4OGYA 2JKHA 2A4OA 1C4U2 1LDTT 2LPRA 3RXQA 3VGCB 1MTNB 2ZTZA 3BSQA 1GHAF 3MTYA 3QUMP 1GHBG 1FDPA 3MHWU 4X1SU 2JETC 1YPKH 1YCPK 2G8TA 3UOUA 3RU4D 1A0LA 1NM6A 1UHBB 2P59A 1GBAA 1K1PA 1F2SE 3MFJA 1H9LB 2P8OB 2TGPZ 3SUFA 2ZGHA 1HAGE 4UDWH 4I32A 2Q6DA 1LKBA 1FIZA 1C5OH 5H4IB 3LGIA 5EQRA 3PO1B 1TA6A 1MTVA 3RUOA 1C5SA 2F91A 2AMDA 2GMTC 1L1JA 2XTTB 1BT7A 2PTCE 2ZGBH 1ZYOA 2V35A 4OS5A 5EXNA 4Y0YE 1GCDA 1L2EA 3M35A 1XVMA 1C5XB 1ELTA 2A4RA 4JZFH 4X2XA 4CRFA 2JH5D 3RMMH 1VITH 1GHVH 1ANDA 1CE5A 2GDDA 5EG4A 1FY8E 2PUXB 4AZ2B 2JH0D 1SC8U 3D65E 3PWCA 1C1UH 2AIQA 3RXBA 3IG6B 2F9NA 3SQEE 1O2JA 2PGQB 3F1SB 1DOJA 4R0IA 2BD5A 2Y5FA 3P8NA 4ZKSU 1W12U 4OGXA 4A1VA 1UTJA 1Y59T 4CH8B 2ZWLH 1GJDB 3P92A 1AZZA 4FU9A 3LDXH 3RXHA 1TMBH 2VVUA 1QRZA 3RXPA 1O3CA 2ZFRH 3QWCH 1B5GH 3R3GB 3ZZ5A 2ZGCA 1QRXA 4H6SB 1S6FA 3AW1A 1YPLH 5TJXA 2GCTB 1D3PB 3MWIU 1GMHF 2QAAA 2BVSH 1E34B 1GMDF 5FCRA 1O2YA 2BM2A 1D4PB 2FZZA 1O30A 4KGAA 2SGDE 4ZROA 1C5WB 1LHGH 1SGNE 4BANB 1N6YA 1VR1H 3UWJH 3E8LA 1UTPA 1HAHH 1C2DA 5A09A 2GX4A 2QA9E 4IC5A 4AB8A 4NIYA 2C8WB 4ISLA 3A88A 2SGEE 1YPMH 3FANA 9ESTA 4BAMB 2NU4E 4AGJA 2PKAA 1A5IA 3GYMA 1Y5AT 2OC8A 2QYIA 1OXGA 1ZGVA 2AMQA 5L30H 2FP7B 3PMHB 2ZIQH 3KQEA 1C2HA 1NY22 5LH8A 1DWBH 1P2IA 1ZPZA 2F9VA 1GI3A 4UFGH 4YZUA 1QFKH 1SGIB 2XC5A 3T26A 3S9CA 3M61U 5JB9S 1MMJN 2ZNKH 3TVJB 3BTGE 4CH2B 1EZXC 1KXDA 2P93A 4ZKNU 1SL3A 5C5NA 2J34A 1ETRH 1FY4A 3ESTA 1KSNA 2FOEA 1BTYA 2J92A 1CA0C 1W7GH 5EXMA 2AYWA 4LK4A 4K1TA 1CT0E 4AB9A 1OPHB 1F7ZA 2UUFB 1C5RA 5C1UA 3D23A 4AORA 2Z9JA 1Y3VA 1C2EA 2I6SA 4H4FA 2CF9H 4YTAA 1V2NT 3SNEA 1HNEE 1ZSLA 1W10U 1P01A 5EGMA 3ZZDA 1SSXA 1P2JA 1CVWH 4E7RG 1CT4E 2JETB 1TBZH 4HTCH 1PPBH 1ZHMA 1DWEH 2PV9B 2ZDAH 4TPIZ 1C2LA 1WYKA 3RXOA 1C5PA 1GG6C 1ARBA 1KDQA 2ZFTA 1DX5M 1TX6A 5F8ZA 1TFXA 1KY9A 1O3AA 5F8XA 2F9PA 5FPTA 4GAWA 1C5TA 1H9HE 3P8FA 3BIUH 2BLWA 3U8RH 2GMTB 1FLEE 2WYJA 3SUDA 1KXFA 1OWDA 1YYY1 1K28D 2QC2A 1DDJA 3RXGA 1OWEA 2ZDNA 1O3OA 1EP6A 2ZI2H 2J9NA 1K1JA 2UWPA 3LH1A 2RDLA 2ESTE 5C67A 5E2OA 1SBWA 3SJ9A 2EC9H 4D76A 3RXJA 3RXRA 4GVUA 1D3QB 1GBFA 2ZC9H 3BTFE 5F8TA 5EQSA 3STIA 1T8OA 3VB7A 3SW2B 5JBAS 2KAIA 5JBBS 4B74A 1LVOA 1ZPCA 1SI5H 1D6WA 3B23B 4B71A 1HYLA 1ANEA 2R2MB 5LGOA 4Y76A 3MOCA 1W7XH 1EP5A 2VVCA 1HXFH 3MO3A 1HJAC 3HGPA 3LJOA 1AD8H 5L2ZH 2ZHDA 1SGTA 2UWLA 2AFQB 4I31A 1MH0A 2EI7A 4MPUA 3E90B 1E38B 3CS7A 4A1TA 1L0ZA 2QY0B 4X8VH 1RD3B 3GYLB 1AFEH 1C2FA 4RSPA 4GHTA 1HAPH 4ZHLU 1AFQC 3RXTA 1C5UA 3LOXA 4WMDA 3O8DA 4DIIH 3BTHE 4BAQB 1TQ7B 2WPHS 3LH3A 8ESTE 2TGAA 2KAIB 4K69A 3UIRA 5J4SA 5FX5A 1HAXB 1YGCH 1G3CA 3SHAH 3EE0B 2W7SA 1GHYH 4Y8ZA 5DP8A 1BMAA 1OX1A 1UJ1A 4U01A 3S0NA 3VEQB 1G30B 1T8LA 1UCYH 2ZO3H 1WBGB 3UPEA 2WYGA 5A8ZA 1TOMH 1X7AC 1C2GA 2DE9A 1BBRE 3TH2H 2HVXA 2ZF0H 3LKWA 1BTWA 2ZP0H 1CA0B 5EQQA 4ABFA 2H5DA 3P95A 4GHQA 3N7OA 3S9AA 1EUFA 1K1NA 1MCTA 2STAE 3MNSA 1U6QA 1P06A 1QQ4A 1PYTC 3C1KA 3Q3YA 2PFEA 1T4VH 1UMAH 2BY7X 2A32A 2AGEX 2RCEA 5IDKA 1TA2A 5LPRA 1LPZB 4WMFA 2QXHA 1XM1A 1K2I1 2TPIZ 2Y6TA 1NU9A 1SFIA 1TNJA 1IQIA 4Q7YA 2BD2A 1BMLA 2FLBH 2ZU4A 3TNSA 1CSOE 1A1RA 4YOIA 1ZHRA 5BRRE 1KYNA 1DSTA 3HPTB 1AHTH 1PPHE 4IBLH 1W2KH 2F9OA 1ELGA 2XRCA 2Z9GA 4XBBA 4ZMAH 2ZFSA 4NSYA 5TCAA 1LQEA 1K1IA 1GDNA 1Z8JB 1FZZA 1L4DA 1Z1IA 2HNTE 2A4GA 5DP3A 1O3JA 2CF8H 5HMAA 6CHAC 4XOJA 2FLRH 1DFPA 4FVDA 1TPAE 2PKSC 2OC7A 3HKIB 1C5NH 4AFUA 1O32A 1PPGE 2R2WU 1M9UA 2GCHF 2Z94A 1T31A 1BTHH 1P12E 1UTQA 2BX4A 3RDZA 1ESAA 4CHAC 1QURH 3KCGH 2J4IA 1GBCA 3KEEA 1LVBA 3OX7U 2ZCHP 3VXEH 4OS7A 1GJ7B 1MUEB 1IAUA 4YESB 4CR9A 2B8OH 2HNTF 4U32A 1SGFG 3RXSA 5JDUB 1ZGIA 1QIXB 1SGRE 3E0PB 1D3DB 2P8OC 2ZHEH 1F5RA 4HI3A 3ATMA 2G52A 5CHAC 1ZHPA 4I8KA 1SR5C 2F9BH 2FDAA 1HJAB 3A82A 1BMMH 4QT8C 2R0KA 1TIOA 5DG6A 3MH6A 2OC0A 1EX3A 1PJPA 2GCHG 1PQAA 2IJOB 2ILNA 1GBKA 3D62A 2ZGXH 3GCTF 1OWIA 1BB0B 3UR9A 3FP6E 2BD8A 1WV7H 1AFQB 1NROH 3ATLA 2GZ7A 1TONA 5LPFA 2CHAC 1VITF 6LPRA 2BDAA 1ARCA 1SGPE 2FOCA 1XXDA 2A45B 2ALPA 1MTWA 4WXVA 1RIWC 1S81A 4XE4A 4CRBA 4MDSA 3BG8A 2ZCKP 4I7YH 1LVMA 1DLKB 3OYPA 4U30A 3RXDA 5ESBA 1BA8B 1DANH 1VCQA 1AN1E 3PMAB 3VXFH 2GGVB 3WY8A 1UTMA 2HRVA 2WPLS 1A5GH 3K6YA 3SV7A 1PPZA 3MO6A 3DD2H 4D8NA 2O8WA 1NC6A 3QZRA 2FS9A 1RTLA 1HAVB 3M5NA 2ZPQA 2A31A 2ZFFH 4JZIA 1MTUA 1HLTH 1V2KT 4A1XA 3JZ2B 5FHTA 4D9QA 1HIAA 2V3OH 1C5VA 5HGGA 2VGCC 2BXUH 1VGCC 1C2IA 3EAJA 1ZZZA 1O3EA 2RA3A 2ZHQH 3UQVA 2YNAA 3KIDU 5CE1A 3LGUA 5GXPA 2PSYA 3M7QA 4ISNA 3GOVB 1GI2A 3UTUH 2G51A 1CGIE 2PUQH 1A5HA 1KXEA 5DO4H 2BD3A 3SHCH 5F03A 1KXBA 2IN2A 2VB0A 2WUBA 5FBIA 1AU8A 4Y10E 4DIHH 2VIVA 7GCHG 2H5CA 3O8CA 1NESE 3AAUA 1AE5A 3UR6A 1L4ZA 1O2LA 3DUXH 2D26C 1CU1A 1F5LA 1FMGA 1BOQA 2PSXA 1GBBA 4MTBA 1TBQH 4ZHAA 1BDAA 2XBXA 3SI3H 4NZLA 1LCYA 2GV6A 4MNWA 4FXGH 2P3TB 1GHBF 1O5GH 4K8YA 3A8CA 1J17T 1ZJDA 3A87A 1QBVH 2BZ6H 1TALA 2XCNA 3M3SA 2WINI 1SGFA 2ANMH 4AX9H 3ZZ7A 1MKWH 3H5CB 2NU0E 1G3DA 1O5EH 6CHAB 3KGPA 3BN9A 2O8UA 3SBKA 1GL0E 1O2MA 1LO6A 1QTFA 2PKSB 1HDTH 3ZVBA 3VPKA 5A8YA 3A8AA 4GSOA 1BIOA 4NG9H 1UVTH 2AMPA 1IHSH 1AE8H 4Y8YA 3PV4A 1NRRH 3TH4H 3FZDA 4CHAB 1ZMNA 2Y5GA 1Y8TA 3DFLA 4Y7AA 4NIXA 3EA7A 2VIWA 1PPEE 4TY6A 5DK1A 1EJMA 3MO9A 4FU8A 3PROA 4MNYA 5CHAB 3BV9B 9LPRA 3SQHE 1V2PT 3W94A 1C1WH 2DUCA 1FUJA 1P2NA 3SNBA 1RS0A 2SGPE 3UOPA 1QCPA 1ANBA 1J9CH 1SQOA 1YKTA 4DOQA 2G5VA 4DVAU 2BY5X 4UONA 1CHGA 4ABHA 2CHAB 1P2QA 1Q2WA 1FNIA 2ZDLA 4UFDH 1RIWB 1ACBE 3BG4C 3P8OA 1G32B 3P8GA 4WXIA 1V2JT 4DURA 4Y7BA 1HRTH 2SGFE 2OQUA 4NCYA 1O31A 4SGBE 4O9VA 4F4OC 2XWBI 4U2WA 2EEKA 5A2MH 2G00A 2EA3A 3NUMA 4NA8A 5T3HA 1GBDA 4GLYA 1DLEA 2WPKS 4Y6DA 1EOJA 5FAHA 1HJ9A 3V12A 3URCA 1W0YH 1SG8B 1ZTLA 2UUJB 5C5OA 3LPRA 5I25A 1MKXK 2VGCB 1SMFE 1A3EH 2D2DA 1VGCB 3L3TA 2SGAA 1XUIA 2BD4A 2TIOA 4BAHB 4OS2A 4FUIA 1OYQA 1BJUA 3NWUA 4I8JA 2BY8X 2ZU2A 2VH6A 4UFFH 1UCYE 1DUAA 2A7CA 3QTVH 3A7YA 5JPMH 4B2BA 3MNCA 3T62A 2JH6D 1W8BH 4TWYA 2CJIA 1S84A 4FUFA 1DXPA 4NWLA 1FPCH 1ZRBA 1P04A 1O39A 2FEQH 1O3MA 2VIDA 3CENA 4BTIB 3GY6A 1KLIH 3SJIA 2FM2A 3EA8A 3UNRA 4LZ4B 4JK6A 3GY2A 4WJG2 1QB1A 3TU7H 3RU4T 5DJ7A 4X1QU 2C4FH 3F6UH 4ABGA 7LPRA 1NRPH 1GJ4H 1TX8A 1MD7A 1DT2A 1Q31A 2VIPA 3M7UA 2Y82A 2ZQ1A 3M37A 3G01A 4X8SH 1QL9A 3V0XA 3T27A 3QN7A 4ZH8A 3ODFA 3RXCA 4CRAA 4MNXA 1E36B 1EZQA 1ETTH 2OBOA 2BDGA 3CS0A 4AFZA 1BTZA 4Y11E 3T5FH 1THRH 1SHHB 2HGTH 4BTUB 1FV9A 1NFWA 1RXPA 2XWAA 1GBHA 3KN2A 4ISOA 3M5LA 1OS8A 3T25A 1IQLA 1JMOH 1LHCH 5G4BA 4YT6H 2FOGA 2BD7A 1QY6A 2PKAB 1UO6A 2BLOA 4IGDA 1EB1H 2VNTA 1WSSH 4X6OA 3LONA 1YM0A 2ZTXA 2GDEH 1VJAU 4XDEA 3SOSA 3HKJB 1IOEA 4X2VA 4AOQA 1K1LA 1HBTH 1TGBA 1LVYA 3E3TA 4Y71A 3VB5A 4A6LA 1DWDH 2G4TA 5K0HA 2CN0H 1A7SA 4THNH 1Z8RA 1F0RA 1G3EA 1NT1A 1EAWA 4NSVA 3GY8A 5E2PA 3V7TA 5GDSH 3EDXB 1GJ6A 1K21H 2Q6GA 4X2WA 1T4UH 1O36A 3GCOA 2ZHFH 3BTWE 6GCHG 4KKDA 1MBMA 3V13A 4JZ1A 2RA0A 1AMHA 1P3EA
chains in the Genus database with same CATH superfamily
1BCUH 3F9GA 4WMEA 2PP6A 1G2LA 3SNAA 2QXJA 1G9IE 1PPFE 4RKOB 4TSFD 1C5ZB 3MI4A 6ESTA 1GVLA 1ABIH 3KQDA 2R9PA 3TLOA 1TBRH 2UWOA 1OP8A 3QGJA 4DT7B 2CV3A 4TPYA 2VH0A 4FU7A 4JYVH 2C90B 2J94A 1FY1A 3RC5A 1DVAH 3BG4B 1P57B 3TJNA 2P3UB 2R3YA 3A8BA 3MH5A 2B7DH 3RM2H 4KTSA 5AFZH 1KDQB 3ODDA 3B8JA 1QHRB 2BDCA 4X6NA 5JBTA 4BAOB 1YLDA 3ATWA 3UFAA 3BTDE 1C4Y2 1V2UT 1QJ1B 2GKVE 2O8MA 1FY3A 4ABAA 1HUTH 2C3SA 1XKBC 1NFYA 4AFQA 1SLUB 2FOMB 4INKA 1EAIA 1ZSJA 3LGYA 1UVOA 4IMQA 3UUZA 2Z6BD 1YP9A 3MU8A 2KX4A 4A7IB 2P95A 1INCA 1TNLA 3ZZ4A 4DG4A 4I33A 3ZV9A 1BJVA 3DSOA 1GJAB 2V3HH 2WPJS 3GDVA 3ELAH 4ZXXH 2Z9IA 5J4QA 4F55A 2DE8A 1JIRA 1H1BA 1GHXH 1SGEE 5FXLA 3A84A 1AVXA 2CMYA 1MZDA 2M5TA 1QR3E 5B6OA 3N7EA 1NZQH 1GI5A 2J2UA 2A0QB 1WAYB 2G55A 3PMBB 1K22H 4R8TB 2BOHB 4JCNA 1YBWA 2PHBA 1O3HA 1Y5BT 3E1XB 1QB6A 2OLGA 1CQQA 3BTQE 1MD8A 1P10A 4UE7H 3S7HB 1C1VH 2WV5A 2VWOA 3MYWA 3NK8A 4UD9H 2H9TH 3SUEA 1YCPM 4MNVA 3AW0A 3H7OA 1C1OA 3OU0A 1LHEH 1GI0A 5BPEA 4IN2A 2G5NA 2OINA 3P17H 1F92A 1OP2A 1GI1A 1YCPH 1A0HB 1DE7H 3VB4A 1SQTA 1C4V2 3KF2A 3RU4E 5TCCA 1O3BA 1C1MA 2C8XB 2GV7A 2OUAA 3SGBE 2Y7ZA 1O3LA 4ZHMU 1NRSH 4JZEH 1EXFA 3H7TA 1S0RA 2SNWA 2GTBA 4D7FA 2OTVA 3A7VA 1P05A 3PLPA 3PTBA 5A8XA 2FMJA 1UVSH 5EJZA 3RXUA 1TLDA 5EOKA 2ZTYA 5EPNA 1GCTC 1TPSA 3SU4A 3ZYEA 3SV6A 3A83A 2SNVA 4KTUA 2JJ1D 8GCHG 2Z3DA 1V6DA 1BITA 3I77A 1E0FD 3UWIA 1OWKA 2BYAX 2EQNA 2HLDD 1SOTA 4K1EA 1Z8IB 1BRBE 2BHGA 1C9TA 3TGJE 3K9XB 1N8OB 1C5QA 1S6HA 2B9LA 1O2NA 1FN6A 1PPCE 2FXRA 3F68H 2FX6A 4X1PU 4YT7H 3RP2A 2A2XH 5GIBA 3UAIC 4Z0KA 1O2XA 5T1VA 1WTGH 1QRWA 1VZQH 1JBUH 1YLCA 3RXAA 4KTCA 1KTSB 2WV9A 5GWZA 2XBWA 1DXWA 1MKXH 3PWBA 1O2OA 3TNTA 1EZSC 1C5MD 3RM0H 1AQ7A 2H9EH 1LHDH 3U8OH 3A7ZA 2FI3E 1NU7B 5AF9H 3WWFA 2P94A 1G3BA 1XX9A 3VB3A 1PQ7A 1YF4A 1N6XA 1H9IE 3FZZA 2XBVA 4M7GA 4OS4A 1BUIA 1SB1H 1F0TA 2BQ7B 2HALA 1UVUH 2F83A 4K2YA 4YLQH 5SGAE 1LPKB 1YPEH 1O2VA 2PR3A 3QK1A 4JYUH 3URDA 4ACAA 2W26A 1GI7B 2Z3EA 1P9SA 3L33A 1ETSH 2C93B 1LTOA 1HAIH 3AVZA 1B0FA 1Z6JH 1VJ9U 2ZPRA 1WQVH 1O3NA 8LPRA 2XBYA 1QNJA 3M7TA 1L1NA 5E8EH 4FUGA 1O38A 5HXFA 2J98B 1GJ5H 2WUCA 1FXYA 1O33A 1ELEE 3GCHC 2A5AA 3QZQA 5FX6A 1Z71A 2FYQA 4WWYA 3OEED 1TNHA 3UQOA 1Y3WA 4GCHF 2VIOA 1EJNA 1PFXC 3DSPA 3A89A 4LOYH 1W3CA 5T6GA 1GMCG 5KECA 1Z6EA 3Q00A 1P3CA 3TK6A 1OWJA 2SFAA 1H8IH 1LMWB 1V2VT 2WPIS 2BZAA 4HG6A 4MPXA 2V3MA 4SGAE 1RJXB 1FY5A 1O2WA 1Y3UA 1KXCA 1NFUA 5FPSA 5DP9A 1ZR0A 4NA9H 1NBMD 5L2YH 4MLFB 1SLXB 3OY6U 2FX4A 1QJ6B 4H6TA 1TMUH 2V0BA 3SGQE 2FTMA 2L74A 3FVFB 3QDZB 3I29A 4Q7XA 4X8TH 5LPEA 4YM9A 2FPZA 4GCHG 1EPTC 1B0EA 1MTSA 1KTTB 3LT3A 2ZGJA 3VG8A 1TB6H 3NXPA 3MU0A 3ZZBA 4VGCC 1O5DH 2Q1JA 3SU3A 3ZVDA 2OD3B 7GCHF 1C5LH 5T6DA 1ZMLA 1FAKH 3HGNA 3NCLA 2VU8E 4JK5A 5AVDA 1K1MA 3PRDA 4Z6AH 4RKJB 1IQHA 1DITH 4DW2U 5EW1H 1UK4A 3LIWA 3PYHA 3TH3H 3PLBA 2A2QH 3TK9A 1PQ8A 2BB4A 2VIQA 4Q80A 1XUHA 1DICA 2W3KA 3A85A 1O2TA 1GCTB 1QJ7B 1A46H 1NN6A 4AC9A 1GPZA 1L1GA 2BDBA 2CGAA 1DY9A 2F3CE 4BXWA 1NTPA 2XXLA 1AO5A 1P09A 2ANWA 2HPQH 4LXBH 5EODA 3Q76A 5F6MA 3GY3A 1AWHB 2QIQA 4O03A 1GI9B 1HIAB 3FFGA 2FOAA 2ANKH 1GI8B 4MVNA 1AVGH 1TNIA 4HGCA 1P8VC 4CRCA 3E16B 2ZECA 1BHXB 4K8BA 3ZZ6A 5EXLA 1GJCB 2FOHA 4CR5A 1P11E 2EI8A 1XMNB 1T7CA 2XOKD 4ABJA 1SQAA 3ZZAA 1O2ZA 1C1PA 1BTXA 2QF0A 3GY4A 2ZZUH 1T32A 4ISIH 1GDUA 1Z8GA 5GCHG 2WZQA 4NZQA 1H8DH 1YPHC 3GDUA 2A7HA 4FUJA 3JZ1B 3OY5U 4K1SA 4NFFA 1OWHA 1E37B 4NGAH 1O3DA 1GBJA 1SOZA 2BX3A 1AY6H 3GDSA 3RMNH 2GP9B 3KQBA 3LGVA 4FVBA 4BAKB 2FOFA 5FBEA 1FI8A 2Y80A 3B9FH 3ZVEA 2BOKA 3KHVA 4MQAA 1ZPBA 2Z7FE 5C1XA 2B0FA 3RXMA 1NO9H 1TRNA 1RTFB 3QO6A 1COWD 2W7UA 1MQ6A 3PB1E 4DCDA 3RXLA 4ESTE 1C1NA 1J8AA 3SUGA 1JRSA 1TOCB 4ABDA 3TJOA 2XC4A 3ZV8A 3O8BA 4X2YA 1FIWA 5IYTA 1V2MT 4ZKOU 3BEFB 3EQ0H 3PRBA 1Z1JA 4B75A 1UCYK 3SZNA 4TWWA 4KP0A 1V2OT 1SGYE 3BEUA 2D1JA 2GZ9A 4WVPE 5ESTE 2I6QA 1IQFA 3GCHB 2TBSA 1GBEA 1EPTA 4K60A 3ZVFA 3RC6A 5DKMA 2LNCA 3F9EA 1ZJKA 2P16A 1BTUA 3K6ZA 1ZMJA 2ZU1A 4XFQA 5ETXA 2OK5A 3SN8A 3FAOA 3FKSD 4X1RU 1CHOG 3OSYA 4ZXYH 3ENSB 4XRNA 4X1NU 2QCYA 2JIZD 1HAZB 5GPIB 1YPGH 3RXKA 3ZZ9A 1NS3A 3F9HA 3GS9A 4DGJA 4IN1A 1GHAG 4BXSA 3QTOH 2FWWA 2BDHA 3A7WA 5EIYA 1MCVA 1KIGH 4B2CA 3M36A 1O2RA 1S83A 3A7TA 3M5MA 1O5FH 3WWBA 1O3IA 3E0NB 4ZUHA 2YNBA 1EPTB 2ZCLP 2UUKB 2R0LA 3KYFA 1ELCA 4VGCB 4ABEA 1O0DH 4YLUA 4NIWA 4I8GA 1OOKB 5E0JA 4YOGA 2O8TA 1J16A 1JOUB 2PTNA 2ZDKA 3OTJE 1BRAA 1VCPA 3I78A 4AN7A 4MPWA 4MPVA 3SV8A 2XYAA 1NPMA 2ANYA 3P6ZB 1ZTJA 1WTHD 5KGOA 1TGCA 1T8NA 3U9AH 1QL7A 3MU4A 4IMZA 3BTTE 2Y81A 4ASHA 1WOFA 1ZOMA 1HGTH 1Y5UT 1AZ8A 1AB9C 1Q3XA 2QV1A 1GJBB 1O2UA 4E06H 3ZZ8A 1KLTA 1WCZA 5EJLA 5L6NH 4B1TA 2ZKSA 1RTKA 1IQNA 2ZU5A 1AKSA 1AVWA 1O35A 1TQ0B 2W5EA 2BQ6B 3DSGA 2O8LA 1V2TT 1IQEA 3TJUA 3SJOA 2H6MA 3S9BA 4ZKRU 3TITA 1A2CH 4JMYA 3L6PA 4M9FA 1ABJH 4ZAEA 5JYIA 2BD9A 1TYNA 2F9UA 3U1IB 1XUGA 2UUYA 3DT0H 2R3UA 2ZHWH 2XNDD 2BQWB 3NPSA 1CGJE 1ELDE 1F0SA 2RDEA 4OS1A 4AYVB 2QF3A 5DP5A 4O97A 2BDIA 1SGQE 2Y7XA 1UVPA 1BTPA 1GMHG 5C20A 1GMDG 3RMLH 1C1TA 2FIRH 1AKSB 1E35B 1THPB 2FOBA 4Q2KA 2Z3CA 2ZDMA 6GCHF 2ZU3A 3NKKA 1HPGA 1C9PA 1MAYA 2XC0A 1P2OA 3NRLA 1O2KA 5EW2H 3U1JB 4ZCNA 5AFYH 3SI4H 1KXAA 3SU0A 2A1DB 2M2AA 3PM3A 1SFQB 3BTKE 1GBIA 4ISHH 8KME2 2BDYA 2XW9A 4NA7A 4BOHA 2STBE 3SU1A 1A61H 5K7RA 5DP6A 5DGJA 2ALVA 1ORFA 4CBNA 1TPOA 3IWMA 3RC4A 1N8OC 4I8HA 4LZ1H 1G36A 4FUHA 1TX7A 2ASUB 2K8IA 1GDQA 3BTME 1K1OA 1ANCA 1CT2E 2KCOA 2GZ8A 4FOUC 1EB2A 5EU8A 1H4WA 1DY8A 2Q6FA 1O2SA 1TABE 3ZYDA 5C3NA 3N99A 4ABBA 1FAXA 4K3JA 3EGKH 2OXSA 4AYYB 4BNRA 1XKAC 3QGNB 1IQGA 1O34A 1G2MA 2BVRH 1SLWB 1QB9A 4Y0ZE 1EZUC 1NFXA 1V3XA 2WPMS 3OE7D 2V6NA 3LC3A 1LKAA 1S82A 2FI4E 1P2KA 2C8YB 3GY7A 2YMSD 1O3FA 1W11U 1MQ5A 1WXRA 1QQUA 4J1YA 1GJ8B 4UFEH 1LPGB 2A5IA 4AG2A 3TGIE 5C2ZA 1DM4B 2CXVA 2BMGB 1GVKB 2HPPH 3TIUA 5A0BA 1UTLM 4AFSA 1GJ9B 1TMTH 3DFJA 3MNBA 1OSSA 3D49H 1AIXH 4RN6A 1GGDC 4X6MA 2A5KA 5DP7A 1OYTH 3BEIB 2ZEBA 1BBRK 4K5ZA 2QGRA 1OP0A 3SNDA 1EOLA 2P3FH 1D9IA 3HATH 1D3TB 1TGNA 1ESTA 1TPPA 3GCNA 2HWLB 3ZVCA 2FS8A 3KL6A 1AI8H 1O5BB 3BTEE 4XBDA 1V2WT 1BQYA 2BLVA 1FONA 1AGJA 1ZTKA 3C27B 3A7XA 1JXPA 2VWNA 5FPYA 4IS5A 3T28A 1FJSA 2G4UA 1O2QA 4A5TS 3ZVAA 1DSUA 5CHBA 4INLA 3S7KB 1SQRA 3A80A 1MKWK 1AB9B 1ZRKA 1D6RA 1V2RT 3ATKA 3S69A 5DSFA 4DY7B 1O5AB 5HYOA 3HK3B 5E0GA 3MU5A 5CMXH 1DPOA 2BY9X 1IHTH 1SVPA 1TWXB 3IITA 3KQCA 4IC6A 5JBCS 1TNGA 1SGCA 3O8RA 1C2KA 1CO7E 1IQKA 3ITIA 3SU2A 3AASA 3RXEA 2LP6A 2QN5T 3SV9A 3RXVA 2GT8A 2HLCA 3TGKE 5C1YA 3SGAE 2BVXH 2NU2E 2ZA5A 4INHA 1TE0A 4AG1A 1C5YB 3SV2H 1Z7KA 2CK3D 1O5CB 8GCHF 7KMEH 5T6FA 2C8ZB 1XUFA 7ESTE 2FYRA 2VWMA 2GT7A 2QF4A 3RLWH 3RXFA 3ZZCA 1CA8B 2ZFQH 1HJ8A 1F0UA 2AEIH 4JYTA 4FUDA 1BHXF 2OCVB 2VVVA 2AERH 5A0AE 4OM9A 1UK3A 2K0QA 1PQ5A 1ELVA 3V3MA 3A86A 3PTNA 4D7GA 1ELFA 3KQ5A 1O2PA 4X6PA 2KCAA 4YO9A 1QA0A 1ELAA 1RGQA 2W3IA 1SLVB 3SNCA 2ODQA 2TGTA 5GJ4B 1Y3XA 1BZXE 2ZDVH 2J38A 4MG3A 2PWXA 1S0QA 3MH4A 1O3KA 5B6LA 1J15A 3FO8D 1C2JA 1YPJH 3STJA 2BLQA 1UTOA 3A8DA 3P70B 3GY5A 1C1QA 1HAOH 2G81E 4Q7ZA 1SPJA 2FI5E 2J97A 4NFEA 1EQ9A 1AWFH 1DUEA 2AGGX 5CDFE 1HCGA 3VFEA 1MZAA 1SHYA 1JWTA 2OP9A 1DWCH 3TJVA 2J5UA 1AUJA 3ZVGA 4TYDA 3TK5A 3CP7A 3GISB 3EA9A 3E91A 1CBWC 4J2YB 1HV7A 1THSH 2FESH 2ODYB 4O3TA 3RMOH 2IOTA 1O2HA 1GG6B 1YC0A 1ESBA 1O2IA 4UEHH 3UNSA 1G37A 1FQ3A 1EAUA 5HM9A 1HXEH 2FTLE 1EASA 1O3PB 4XBCA 3DA9B 1GHZA 1GBLA 1FPHH 3F9FA 4DJZB 1V2LT 3SO3A 1GVZA 2VWLA 3W95A 1UTNA 1ZLRA 1W0JD 3T29A 4I8LA 3PMJA 3SU5A 1P2MA 4F49A 2ZPSA 2SGQE 1XXFA 2AS9A 3SORA 1N1LA 5I46H 4Q63A 1MAXA 2OBQA 1A4WH 3FP7E 4CBOA 2GVFA 4FETA 1GGDB 1W13U 2BTCE 2ZQ2A 3SJ8A 4O3UA 1ELBA 4YXWD 1GMCF 1GL1A 1BRUP 1XUJA 2QXIA 2O9QA 3UNQA 2Z9KA 1HAYB 3FP8E 1TGTA 4OS6A 4B2AA 2KFWA 3ATIA 3LGWA 1BMNH 2Y5HA 4ABIA 1TRMA 4FUCA 1ID5H 1KLJH 3VGCC 1MTNC 1F5KU 1UK2A 2OC1A 2TRMA 3VB6A 2GJGA 2ZG0H 3NZIA 1MU6B 4PROA 3RXIA 1QGFA 3R0FA 1WU1A 1P02A 2RG3A 2D8WA 3MH7A 2EI6A 2H2ZA 1MU8B 2PLXA 1IQMA 1WUNH 3Q77A 1O2GH 2KZ4A 2ZFPH 3LC5A 2VJ1A 1HB0B 1O3GA 2BXTH 2AH4X 5A0CA 3KNXA 1IQJA 1WQSA 3LGTA 3UREA 3PO1C 3GICB 1GWAA 1XVOA 1ZSKA 4FUBA 3LJJA 4NIVA 3U8TH 1HAVA 1NRNH 2FODA 4WY3A 2ODPA 1GI6A 1B7XB 1NRQH 1XUKA 1CGHA 5DPAA 3K65B 5IK2D 1QZ8A 1S85A 1J14A 1GBTA 4B76A 1V2QT 2NU1E 2PGBB 5EJ1A 2HNTC 2OQ5A 3MNXA 4JZDH 5AHGH 3E6PH 1JRTA 2ULLA 2IPHA 2VINA 4D9RA 1GI4A 1O37A 1YPHE 3ZZ3A 1EATA 1GBMA 4CRGA 1AUTC 3M3TA 1C1SA 2HOBA 2J95A 1QBOA 5E0HA 4IW4E 4FUEA 2A7JA 3TPIZ 3GCTG 4HZHA 2FO9A 3U69H 2K1QA 5DP4A 4CREA 3Q3KA 1TNKA 3QLPH 2Z9LA 1VITG 4E7NA 5HM2A 1GHWH 4Y79A 1HFDA 1JIMA 1EFRD 2A4QA 2PW8H 2H1UA 4E05H 5ABWA 1V2ST 1EJAA 3AAVA 3QX5H 2H9HA 3PV5A 1QL8A 4GUXA 3T2NA 1S5SA 2GCTC 2BY6X 5GCHF 2QXGA 4WH6A 5FCKA 1QBNA 1MBQA 3FOAA 4A92A 3K2UA 1P9UA 4AGKA 2NWNA 1RFNA 1T8MA 3MMGA 4HFPB 3UY9A 2NU3E 1W14U 1C1RA 4YOJA 1UTKA 3BF6H 1CBWB 3SJKA 2THFB 4X8UH 4B73A 1TGSZ 2XCFA 3PLKA 1C2MA 1TRYA 1BBRH 1EKBB 2TGDA 1DS2E 3M5OA 1A0JA 1A3BH 1RRKA 4X0WU 2GD4B 4BTTB 2W6JD 1PYTD 4TY7A 1LQDB 2QE7D 2YOLA 2WV4A 3AK5A 1OKXA 4CRDA 4H42U 2AIPA 4WH8A 4RT1A 1SGDE 2AGIX 3BIVH 1Y3YA 1UHBA 3HK6B 1BRCE 2B5TB 3A81A 1QA7A 1P03A 1VCWA 3EYDA 3M3VA 1K9OE 3Q3XA 4KELA 4XSKU 3WW7A 5PTPA 1EAXA 3U98H 3LU9B 5JB8S 4GPGA 1P0SH 1TAWA 1SKYE 3SU6A 4NWKA 3DHKH 1UW7A 1LHFH 1CHOF 3F0PA 5HIZA 1W0ZU 3MU1A 5EPYA 4WF8A 2XNIA 3RLYH 1FN8A 4Y8XA 4OGYA 2JKHA 3H09A 2A4OA 1C4U2 1LDTT 2LPRA 3RXQA 3VGCB 1H8ED 1MTNB 2ZTZA 3BSQA 1GHAF 3CNRA 3MTYA 3QUMP 1GHBG 1FDPA 2LELA 3MHWU 4X1SU 2JETC 1YPKH 1YCPK 2G8TA 2YMSC 3UOUA 3RU4D 1A0LA 1NM6A 1UHBB 2P59A 1GBAA 1K1PA 1F2SE 3MFJA 1H9LB 2P8OB 2TGPZ 3SUFA 2ZGHA 5C0TA 1HAGE 4UDWH 4I32A 2Q6DA 1LKBA 1FIZA 1C5OH 5H4IB 3LGIA 5EQRA 3PO1B 1TA6A 1MTVA 3RUOA 1C5SA 2F91A 2AMDA 2GMTC 1L1JA 2XTTB 1BT7A 2PTCE 2ZGBH 1ZYOA 2V35A 4OS5A 5EXNA 4Y0YE 1GCDA 1L2EA 3M35A 1XVMA 1C5XB 1ELTA 2A4RA 2IJD1 4JZFH 4X2XA 4CRFA 2JH5D 3RMMH 1VITH 1GHVH 1ANDA 1CE5A 2GDDA 5EG4A 1FY8E 2PUXB 4AZ2B 2JH0D 5C0UA 1SC8U 3D65E 3PWCA 1C1UH 2AIQA 3RXBA 3IG6B 2F9NA 3SQEE 4RI0A 1O2JA 2PGQB 3F1SB 1DOJA 4R0IA 2BD5A 2Y5FA 3P8NA 4ZKSU 1W12U 4OGXA 4A1VA 1UTJA 1Y59T 4CH8B 2ZWLH 1GJDB 3P92A 1AZZA 4FU9A 3LDXH 3RXHA 1TMBH 4F48B 2VVUA 1QRZA 1YWUA 3RXPA 1O3CA 2ZFRH 3QWCH 1B5GH 3R3GB 3ZZ5A 2ZGCA 1QRXA 4H6SB 1S6FA 3AW1A 1YPLH 5TJXA 2GCTB 1D3PB 3MWIU 1GMHF 2QAAA 2BVSH 1E34B 1GMDF 5FCRA 1O2YA 2BM2A 1D4PB 2FZZA 1O30A 5C17A 4KGAA 2SGDE 4ZROA 1C5WB 1LHGH 1SGNE 4BANB 1N6YA 1VR1H 3UWJH 3E8LA 1UTPA 1HAHH 1C2DA 5A09A 2GX4A 2QA9E 4IC5A 4AB8A 4NIYA 2C8WB 4ISLA 3A88A 2SGEE 1YPMH 3FANA 9ESTA 4BAMB 2NU4E 4AGJA 2PKAA 1A5IA 3GYMA 1Y5AT 2OC8A 2QYIA 1OXGA 1ZGVA 2AMQA 5L30H 2FP7B 3PMHB 2ZIQH 3KQEA 1C2HA 1NY22 5LH8A 1DWBH 1P2IA 1ZPZA 2F9VA 1GI3A 4UFGH 4YZUA 1QFKH 1SGIB 2XC5A 3T26A 5DN6D 3S9CA 3M61U 5JB9S 1MMJN 2ZNKH 3TVJB 3BTGE 4CH2B 1EZXC 1KXDA 2P93A 4ZKNU 1SL3A 3W1EA 5C5NA 2J34A 1ETRH 1FY4A 3ESTA 1KSNA 2FOEA 1BTYA 2J92A 1CA0C 1W7GH 5EXMA 2AYWA 4LK4A 4K1TA 1CT0E 4AB9A 1OPHB 1F7ZA 2UUFB 1C5RA 5C1UA 3D23A 4AORA 2Z9JA 1Y3VA 1C2EA 2I6SA 4H4FA 2CF9H 4YTAA 1V2NT 3SNEA 1HNEE 1ZSLA 1W10U 1P01A 5EGMA 3ZZDA 1SSXA 1P2JA 1CVWH 4E7RG 1CT4E 2IPQX 2JETB 1TBZH 2YMSB 4HTCH 1PPBH 1ZHMA 1DWEH 2PV9B 2ZDAH 4TPIZ 1NBME 1C2LA 1WYKA 3RXOA 5KEDA 1C5PA 1GG6C 1ARBA 1KDQA 2ZFTA 1DX5M 1FX0B 1TX6A 2WPDD 5F8ZA 1TFXA 1KY9A 1O3AA 3MQKC 5F8XA 1H8HD 2F9PA 5FPTA 4GAWA 1C5TA 1H9HE 3P8FA 3BIUH 2BLWA 3U8RH 2GMTB 1FLEE 2WYJA 3SUDA 1KXFA 1OWDA 1YYY1 1K28D 2QC2A 1DDJA 3RXGA 1OWEA 5GNDA 2ZDNA 1O3OA 1EP6A 2ZI2H 2J9NA 1K1JA 2UWPA 3LH1A 2RDLA 2ESTE 5C67A 5E2OA 1SBWA 3SJ9A 2EC9H 4D76A 3RXJA 3RXRA 4GVUA 4ASUD 1BMFD 1D3QB 1GBFA 2ZC9H 3BTFE 5F8TA 3OAAD 5EQSA 3STIA 1T8OA 3VB7A 3SW2B 1KMHB 5JBAS 2KAIA 5JBBS 3N7DA 4B74A 1LVOA 1ZPCA 1SI5H 1D6WA 3B23B 4B71A 1HYLA 1ANEA 3F2GA 2W6ID 2R2MB 5LGOA 4Y76A 3MOCA 1W7XH 1EP5A 2VVCA 1HXFH 3MO3A 1HJAC 3HGPA 3LJOA 1AD8H 4DT4A 5L2ZH 4B6EA 2ZHDA 1SGTA 2UWLA 2AFQB 4I31A 2QF5A 1MH0A 3ZIAD 2EI7A 4MPUA 3E90B 1E38B 3CS7A 4A1TA 1L0ZA 2QY0B 4X8VH 1RD3B 3GYLB 1AFEH 1C2FA 4RSPA 4GHTA 1HAPH 4ZHLU 1AFQC 3RXTA 1C5UA 3LOXA 4WMDA 3O8DA 4DIIH 3BTHE 4BAQB 1TQ7B 2WPHS 3LH3A 8ESTE 2TGAA 2KAIB 4K69A 1E79D 3UIRA 5J4SA 5FX5A 1HAXB 1YGCH 1G3CA 3SHAH 3EE0B 2W7SA 3OFND 1GHYH 4Y8ZA 5DP8A 1BMAA 1OX1A 1UJ1A 4U01A 3S0NA 3OTPA 3VEQB 1G30B 1T8LA 1UCYH 2ZO3H 1WBGB 3UPEA 2WYGA 4I86A 5A8ZA 1TOMH 1X7AC 1C2GA 2DE9A 1BBRE 3TH2H 2HVXA 2ZF0H 3LKWA 1BTWA 2ZP0H 1CA0B 5EQQA 4ABFA 3F3BA 2H5DA 3P95A 4GHQA 3N7OA 3S9AA 1EUFA 1K1NA 1MCTA 2STAE 3MNSA 1U6QA 1P06A 2JDID 1QQ4A 1PYTC 3C1KA 3Q3YA 2PFEA 1T4VH 1UMAH 2BY7X 2A32A 2AGEX 2RCEA 5IDKA 1TA2A 5LPRA 1LPZB 4WMFA 2QXHA 1XM1A 1K2I1 2TPIZ 2Y6TA 1NU9A 3SYJA 1SFIA 1TNJA 1IQIA 4Q7YA 2BD2A 1BMLA 2FLBH 2ZU4A 3TNSA 1CSOE 1A1RA 2VBCA 4YOIA 1ZHRA 5BRRE 1KYNA 1DSTA 3HPTB 1AHTH 1OHHD 1PPHE 4IBLH 1W2KH 2F9OA 1ELGA 2XRCA 2Z9GA 4XBBA 4ZMAH 2L6OA 2ZFSA 4NSYA 5TCAA 1LQEA 1K1IA 1GDNA 1Z8JB 1FZZA 1L4DA 1Z1IA 2HNTE 2A4GA 5DP3A 1O3JA 2CF8H 5HMAA 6CHAC 4XOJA 5C94A 5HKKD 2FLRH 1DFPA 4FVDA 1TPAE 2J98A 2PKSC 2OC7A 3HKIB 3KYGA 1C5NH 4AFUA 1O32A 1PPGE 2WSSD 2R2WU 1M9UA 2GCHF 2Z94A 1T31A 1BTHH 3PV2A 1P12E 1UTQA 2BX4A 3RDZA 1ESAA 4CHAC 1QURH 3KCGH 2J4IA 1GBCA 3KEEA 1LVBA 3OX7U 2ZCHP 3VXEH 4OS7A 1GJ7B 1MUEB 1IAUA 4YESB 4CR9A 2B8OH 2HNTF 4U32A 1SGFG 3RXSA 5JDUB 2HVYB 5F53A 1ZGIA 1QIXB 1SGRE 3E0PB 1D3DB 2P8OC 2ZHEH 1F5RA 4HI3A 3ATMA 2G52A 5CHAC 1ZHPA 4I8KA 1SR5C 2F9BH 2FDAA 1HJAB 3A82A 1BMMH 4QT8C 2R0KA 1TIOA 5DG6A 3MH6A 2OC0A 1EX3A 1PJPA 2GCHG 1PQAA 2IJOB 2ILNA 1GBKA 3D62A 2ZGXH 3GCTF 1OWIA 1BB0B 3UR9A 3FP6E 2BD8A 2EY4C 1WV7H 1AFQB 1NROH 3ATLA 2GZ7A 1TONA 5LPFA 2CHAC 1VITF 6LPRA 2BDAA 1ARCA 1SGPE 2FOCA 1XXDA 2A45B 2ALPA 1MTWA 4WXVA 1RIWC 1S81A 4XE4A 4CRBA 4MDSA 3BG8A 2ZCKP 4I7YH 1LVMA 1DLKB 3OYPA 4U30A 3RXDA 5ESBA 1BA8B 1DANH 1VCQA 1AN1E 3PMAB 3VXFH 3FN8A 2GGVB 3WY8A 1UTMA 2HRVA 2WPLS 1A5GH 3K6YA 3SV7A 1PPZA 3MO6A 3DD2H 1E1QD 4D8NA 2O8WA 1NC6A 3QZRA 2FS9A 1RTLA 1HAVB 3M5NA 2ZPQA 2A31A 2ZFFH 4JZIA 1MTUA 1HLTH 1V2KT 4A1XA 3JZ2B 5FHTA 4D9QA 1HIAA 2V3OH 1C5VA 5HGGA 2VGCC 2BXUH 1VGCC 1K0HA 1C2IA 3EAJA 1ZZZA 1O3EA 2RA3A 2ZHQH 3UQVA 2YNAA 3KIDU 5CE1A 3LGUA 5GXPA 2PSYA 3M7QA 4ISNA 3GOVB 1GI2A 3UTUH 4Q4LA 2G51A 1CGIE 2PUQH 1A5HA 1KXEA 5DO4H 2BD3A 3SHCH 2RFKC 5F03A 1KXBA 2KCYA 2IN2A 2VB0A 2WUBA 4XD7D 5FBIA 1AU8A 4Y10E 4DIHH 2VIVA 7GCHG 2H5CA 3O8CA 1NESE 3AAUA 1AE5A 3UR6A 1L4ZA 1O2LA 3DUXH 2D26C 1CU1A 1FMGA 1F5LA 1BOQA 2PSXA 1GBBA 4MTBA 1TBQH 4ZHAA 1BDAA 2XBXA 3SI3H 4NZLA 1LCYA 2GV6A 1MABB 4MNWA 4FXGH 2P3TB 1GHBF 1O5GH 4K8YA 3A8CA 1J17T 1ZJDA 3A87A 1QBVH 2BZ6H 1TALA 2XCNA 3M3SA 2WINI 1SGFA 2ANMH 4Z1MD 4AX9H 3ZZ7A 1MKWH 3H5CB 2NU0E 1G3DA 1O5EH 6CHAB 3KGPA 3BN9A 2O8UA 3SBKA 1GL0E 1O2MA 1LO6A 1QTFA 2PKSB 1HDTH 3ZVBA 3VPKA 5A8YA 3A8AA 4GSOA 1BIOA 4NG9H 1UVTH 2AMPA 2AHME 1IHSH 1AE8H 2WHXA 4Y8YA 3PV4A 1NRRH 3TH4H 2KCPA 3FZDA 4CHAB 1ZMNA 2Y5GA 1Y8TA 3DFLA 4Y7AA 4NIXA 3EA7A 2VIWA 3F2HA 1PPEE 4TY6A 5DK1A 1EJMA 3MO9A 4FU8A 3PROA 4MNYA 5CHAB 3BV9B 9LPRA 3SQHE 1V2PT 3W94A 1C1WH 2DUCA 1FUJA 1P2NA 3SNBA 3SZEA 1RS0A 2SGPE 3UOPA 1QCPA 1ANBA 1J9CH 2KR7A 1SQOA 1YKTA 4DOQA 3F2FA 2G5VA 4DVAU 2BY5X 4UONA 1CHGA 4ABHA 2CHAB 1P2QA 1Q2WA 1FNIA 2ZDLA 1VKYA 4UFDH 1S6LA 1RIWB 1ACBE 3BG4C 3P8OA 1G32B 3P8GA 3U28C 4WXIA 1V2JT 4DURA 4TT3D 4Y7BA 1HRTH 2SGFE 2OQUA 4NCYA 4P02A 1O31A 4SGBE 1E1RD 4O9VA 4F4OC 2XWBI 4U2WA 2EEKA 5A2MH 2G00A 1YY3A 2EA3A 3NUMA 4NA8A 3EE7A 1GBDA 4GLYA 5T3HA 4P00A 1DLEA 2WPKS 4Y6DA 1EOJA 5FAHA 1HJ9A 3V12A 3URCA 1W0YH 1SG8B 1ZTLA 2UUJB 5C5OA 3LPRA 5I25A 1MKXK 2VGCB 1SMFE 1A3EH 2D2DA 1VGCB 3L3TA 2SGAA 1XUIA 2BD4A 2TIOA 4BAHB 4OS2A 4FUIA 1OYQA 1BJUA 3NWUA 4I8JA 2BY8X 2ZU2A 2VH6A 2V7QD 4UFFH 1UCYE 1DUAA 2A7CA 3QTVH 3A7YA 5JPMH 1W0KD 4B2BA 3MNCA 3T62A 2JH6D 1W8BH 4TWYA 2CJIA 1S84A 4FUFA 1DXPA 4NWLA 1FPCH 1ZRBA 1P04A 1O39A 2FEQH 1O3MA 2VIDA 3CENA 4BTIB 3GY6A 1KLIH 3SJIA 2FM2A 3EA8A 3UNRA 4LZ4B 4JK6A 3GY2A 4WJG2 1QB1A 3TU7H 4ACBA 3RU4T 5DJ7A 4X1QU 2C4FH 2JJ2D 3F6UH 4ABGA 7LPRA 1NRPH 3DCLA 1GJ4H 1TX8A 1MD7A 1DT2A 1Q31A 2VIPA 3M7UA 2Y82A 2ZQ1A 3UB0A 3M37A 3G01A 4X8SH 5FL7D 1QL9A 3V0XA 2F4LA 3T27A 3OEHD 3QN7A 4ZH8A 3ODFA 5HIYA 3RXCA 4CRAA 4MNXA 1E36B 1EZQA 1ETTH 2OBOA 2BDGA 3CS0A 4AFZA 1BTZA 4Y11E 3T5FH 1THRH 1SHHB 2HGTH 4BTUB 1FV9A 1NFWA 1RXPA 2XWAA 1GBHA 3KN2A 4ISOA 3M5LA 1OS8A 3T25A 1IQLA 1JMOH 1LHCH 5G4BA 4YT6H 2FOGA 2BD7A 1QY6A 2PKAB 1UO6A 2BLOA 4IGDA 1EB1H 2VNTA 1WSSH 4X6OA 3LONA 1YM0A 2ZTXA 2GDEH 1VJAU 4XDEA 3SOSA 3HKJB 1IOEA 4X2VA 4AOQA 1K1LA 1HBTH 1TGBA 1LVYA 3E3TA 4B6FA 4Y71A 3VB5A 4A6LA 1DWDH 2G4TA 1WDIA 5K0HA 2CN0H 1A7SA 4THNH 1Z8RA 1F0RA 1G3EA 1YLNA 4RT0A 1NT1A 3F0OA 1EAWA 4NSVA 3GY8A 5E2PA 3V7TA 5GDSH 3EDXB 1GJ6A 2F43B 1K21H 2Q6GA 4X2WA 1T4UH 1O36A 3GCOA 2ZHFH 3BTWE 6GCHG 4KKDA 1MBMA 3V13A 2KM0A 4JZ1A 2RA0A 1AMHA 1P3EA
chains in the Genus database with same CATH topology
1BCUH 3F9GA 4WMEA 1G2LA 3SNAA 2QXJA 1G9IE 1PPFE 4RKOB 1C5ZB 3MI4A 6ESTA 1GVLA 1ABIH 3KQDA 2R9PA 3TLOA 1TBRH 2UWOA 1OP8A 3QGJA 4DT7B 2CV3A 4TPYA 2VH0A 4FU7A 4JYVH 2C90B 2J94A 1FY1A 3RC5A 1DVAH 3BG4B 1P57B 3TJNA 2P3UB 2R3YA 3A8BA 3MH5A 2B7DH 3RM2H 4KTSA 5AFZH 1KDQB 3ODDA 3B8JA 1QHRB 2BDCA 4X6NA 5JBTA 4BAOB 1YLDA 3ATWA 3UFAA 3BTDE 1C4Y2 1V2UT 1QJ1B 2GKVE 2O8MA 1FY3A 4ABAA 1HUTH 2C3SA 1XKBC 1NFYA 4AFQA 1SLUB 2FOMB 4INKA 1EAIA 1ZSJA 3LGYA 1UVOA 4IMQA 3UUZA 2Z6BD 1YP9A 3MU8A 4A7IB 2P95A 1INCA 1TNLA 3ZZ4A 4DG4A 4I33A 3ZV9A 1BJVA 1GJAB 2V3HH 2WPJS 3GDVA 3ELAH 4ZXXH 2Z9IA 5J4QA 2DE8A 1JIRA 1H1BA 1GHXH 1SGEE 5FXLA 3A84A 1AVXA 2CMYA 1MZDA 2M5TA 1QR3E 5B6OA 1NZQH 1GI5A 2J2UA 2A0QB 1WAYB 2G55A 3PMBB 1K22H 4R8TB 2BOHB 4JCNA 1YBWA 2PHBA 1O3HA 1Y5BT 3E1XB 1QB6A 2OLGA 1CQQA 3BTQE 1MD8A 1P10A 4UE7H 3S7HB 1C1VH 2WV5A 2VWOA 3MYWA 3NK8A 4UD9H 2H9TH 3SUEA 1YCPM 4MNVA 3AW0A 3H7OA 1C1OA 3OU0A 1LHEH 1GI0A 5BPEA 4IN2A 2G5NA 2OINA 3P17H 1F92A 1OP2A 1GI1A 1YCPH 1A0HB 1DE7H 3VB4A 1SQTA 1C4V2 3KF2A 3RU4E 5TCCA 1O3BA 1C1MA 2C8XB 2GV7A 2OUAA 3SGBE 2Y7ZA 1O3LA 4ZHMU 1NRSH 4JZEH 1EXFA 3H7TA 1S0RA 2SNWA 2GTBA 4D7FA 2OTVA 3A7VA 1P05A 3PLPA 3PTBA 5A8XA 2FMJA 1UVSH 3RXUA 1TLDA 5EOKA 2ZTYA 5EPNA 1GCTC 1TPSA 3SU4A 3ZYEA 3SV6A 3A83A 2SNVA 4KTUA 8GCHG 2Z3DA 1V6DA 1BITA 3I77A 1E0FD 3UWIA 1OWKA 2BYAX 1SOTA 4K1EA 1Z8IB 1BRBE 2BHGA 1C9TA 3TGJE 3K9XB 1N8OB 1C5QA 1S6HA 2B9LA 1O2NA 1FN6A 1PPCE 2FXRA 3F68H 2FX6A 4X1PU 4YT7H 3RP2A 2A2XH 5GIBA 4Z0KA 1O2XA 1WTGH 1QRWA 1VZQH 1JBUH 1YLCA 3RXAA 4KTCA 1KTSB 5GWZA 2XBWA 1DXWA 1MKXH 3PWBA 1O2OA 3TNTA 1EZSC 1C5MD 3RM0H 1AQ7A 2H9EH 1LHDH 3U8OH 3A7ZA 2FI3E 1NU7B 5AF9H 2P94A 1G3BA 1XX9A 3VB3A 1PQ7A 1YF4A 1N6XA 1H9IE 3FZZA 2XBVA 4M7GA 4OS4A 1BUIA 1SB1H 1F0TA 2BQ7B 2HALA 1UVUH 2F83A 4K2YA 4YLQH 5SGAE 1LPKB 1YPEH 1O2VA 2PR3A 3QK1A 4JYUH 3URDA 2W26A 1GI7B 2Z3EA 1P9SA 3L33A 1ETSH 2C93B 1LTOA 1HAIH 3AVZA 1B0FA 1Z6JH 1VJ9U 2ZPRA 1WQVH 1O3NA 8LPRA 2XBYA 1QNJA 3M7TA 1L1NA 5E8EH 4FUGA 1O38A 5HXFA 1GJ5H 2WUCA 1FXYA 1O33A 1ELEE 3GCHC 2A5AA 3QZQA 5FX6A 1Z71A 2FYQA 4WWYA 1TNHA 3UQOA 1Y3WA 4GCHF 2VIOA 1EJNA 1PFXC 3A89A 4LOYH 1W3CA 5T6GA 1GMCG 1Z6EA 3Q00A 1P3CA 3TK6A 1OWJA 2SFAA 1H8IH 1LMWB 1V2VT 2WPIS 2BZAA 4MPXA 4SGAE 1RJXB 1FY5A 1O2WA 1Y3UA 1KXCA 1NFUA 5FPSA 5DP9A 1ZR0A 4NA9H 5L2YH 4MLFB 1SLXB 3OY6U 2FX4A 1QJ6B 4H6TA 1TMUH 2V0BA 3SGQE 2FTMA 3FVFB 3QDZB 3I29A 4Q7XA 4X8TH 5LPEA 4YM9A 2FPZA 4GCHG 1EPTC 1B0EA 1MTSA 1KTTB 3LT3A 2ZGJA 1TB6H 3NXPA 3MU0A 3ZZBA 4VGCC 1O5DH 2Q1JA 3SU3A 3ZVDA 2OD3B 7GCHF 1C5LH 5T6DA 1ZMLA 1FAKH 3HGNA 3NCLA 2VU8E 4JK5A 5AVDA 1K1MA 4Z6AH 4RKJB 1IQHA 1DITH 4DW2U 5EW1H 1UK4A 3LIWA 3PYHA 3TH3H 3PLBA 2A2QH 3TK9A 1PQ8A 2BB4A 2VIQA 4Q80A 1XUHA 1DICA 2W3KA 3A85A 1O2TA 1GCTB 1QJ7B 1A46H 1NN6A 1GPZA 1L1GA 2BDBA 2CGAA 1DY9A 2F3CE 4BXWA 1NTPA 2XXLA 1AO5A 1P09A 2ANWA 2HPQH 4LXBH 5EODA 3Q76A 5F6MA 3GY3A 1AWHB 2QIQA 4O03A 1GI9B 1HIAB 3FFGA 2FOAA 2ANKH 1GI8B 4MVNA 1AVGH 1TNIA 4HGCA 1P8VC 4CRCA 3E16B 2ZECA 1BHXB 4K8BA 3ZZ6A 5EXLA 1GJCB 2FOHA 4CR5A 1P11E 2EI8A 1XMNB 1T7CA 4ABJA 1SQAA 3ZZAA 1O2ZA 1C1PA 1BTXA 2QF0A 3GY4A 2ZZUH 1T32A 4ISIH 1GDUA 1Z8GA 5GCHG 4NZQA 1H8DH 1YPHC 3GDUA 2A7HA 4FUJA 3JZ1B 3OY5U 4K1SA 4NFFA 1OWHA 1E37B 4NGAH 1O3DA 1GBJA 1SOZA 2BX3A 1AY6H 3GDSA 3RMNH 2GP9B 3KQBA 3LGVA 4FVBA 4BAKB 2FOFA 5FBEA 1FI8A 2Y80A 3B9FH 3ZVEA 2BOKA 3KHVA 4MQAA 1ZPBA 2Z7FE 5C1XA 2B0FA 3RXMA 1NO9H 1TRNA 1RTFB 3QO6A 2W7UA 3PB1E 1MQ6A 4DCDA 3RXLA 4ESTE 1C1NA 1J8AA 3SUGA 1JRSA 1TOCB 4ABDA 3TJOA 2XC4A 3ZV8A 3O8BA 4X2YA 1FIWA 5IYTA 1V2MT 4ZKOU 3BEFB 3EQ0H 1Z1JA 4B75A 1UCYK 3SZNA 4TWWA 4KP0A 1V2OT 1SGYE 3BEUA 2D1JA 2GZ9A 4WVPE 5ESTE 2I6QA 1IQFA 3GCHB 2TBSA 1GBEA 1EPTA 4K60A 3ZVFA 3RC6A 5DKMA 2LNCA 3F9EA 1ZJKA 2P16A 1BTUA 3K6ZA 1ZMJA 2ZU1A 4XFQA 5ETXA 3SN8A 3FAOA 4X1RU 1CHOG 3OSYA 4ZXYH 3ENSB 4X1NU 2QCYA 1HAZB 5GPIB 1YPGH 3RXKA 3ZZ9A 1NS3A 3F9HA 4DGJA 4IN1A 1GHAG 4BXSA 3QTOH 2FWWA 2BDHA 3A7WA 1MCVA 1KIGH 4B2CA 3M36A 1O2RA 1S83A 3A7TA 3M5MA 1O5FH 1O3IA 3E0NB 4ZUHA 2YNBA 1EPTB 2ZCLP 2UUKB 2R0LA 1ELCA 4VGCB 4ABEA 1O0DH 4YLUA 4NIWA 4I8GA 1OOKB 5E0JA 4YOGA 2O8TA 1J16A 1JOUB 2PTNA 2ZDKA 3OTJE 1BRAA 1VCPA 3I78A 4AN7A 4MPWA 4MPVA 3SV8A 2XYAA 1NPMA 2ANYA 3P6ZB 1ZTJA 1WTHD 1TGCA 1T8NA 3U9AH 1QL7A 3MU4A 4IMZA 3BTTE 2Y81A 4ASHA 1WOFA 1ZOMA 1HGTH 1Y5UT 1AZ8A 1AB9C 1Q3XA 2QV1A 1GJBB 1O2UA 4E06H 3ZZ8A 1KLTA 1WCZA 5L6NH 4B1TA 2ZKSA 1RTKA 1IQNA 2ZU5A 1AKSA 1AVWA 1O35A 1TQ0B 2W5EA 2BQ6B 2O8LA 1V2TT 1IQEA 3TJUA 3SJOA 2H6MA 3S9BA 4ZKRU 3TITA 1A2CH 4JMYA 3L6PA 1ABJH 4ZAEA 5JYIA 2BD9A 1TYNA 2F9UA 3U1IB 1XUGA 2UUYA 3DT0H 2R3UA 2ZHWH 2BQWB 3NPSA 1CGJE 1ELDE 1F0SA 4OS1A 4AYVB 2QF3A 5DP5A 4O97A 2BDIA 1SGQE 2Y7XA 1UVPA 1BTPA 1GMHG 5C20A 1GMDG 3RMLH 1C1TA 2FIRH 1AKSB 1E35B 1THPB 2FOBA 4Q2KA 2Z3CA 2ZDMA 6GCHF 2ZU3A 3NKKA 1HPGA 1C9PA 1MAYA 2XC0A 1P2OA 1O2KA 5EW2H 3U1JB 5AFYH 3SI4H 1KXAA 3SU0A 2A1DB 3PM3A 1SFQB 3BTKE 1GBIA 4ISHH 8KME2 2BDYA 2XW9A 4NA7A 4BOHA 2STBE 3SU1A 1A61H 5K7RA 5DP6A 5DGJA 2ALVA 1ORFA 4CBNA 1TPOA 3IWMA 3RC4A 1N8OC 4I8HA 4LZ1H 1G36A 4FUHA 1TX7A 2ASUB 1GDQA 3BTME 1K1OA 1ANCA 1CT2E 2GZ8A 1EB2A 5EU8A 1H4WA 1DY8A 2Q6FA 1O2SA 1TABE 3ZYDA 5C3NA 4ABBA 1FAXA 4K3JA 3EGKH 2OXSA 4AYYB 4BNRA 1XKAC 3QGNB 1IQGA 1O34A 1G2MA 2BVRH 1SLWB 1QB9A 4Y0ZE 1EZUC 1NFXA 1V3XA 2WPMS 2V6NA 3LC3A 1LKAA 1S82A 2FI4E 1P2KA 2C8YB 3GY7A 1O3FA 1W11U 1MQ5A 1QQUA 4J1YA 1GJ8B 4UFEH 1LPGB 2A5IA 4AG2A 3TGIE 5C2ZA 1DM4B 2CXVA 2BMGB 1GVKB 2HPPH 3TIUA 5A0BA 1UTLM 4AFSA 1GJ9B 1TMTH 3DFJA 3MNBA 1OSSA 3D49H 1AIXH 4RN6A 1GGDC 4X6MA 2A5KA 5DP7A 1OYTH 3BEIB 2ZEBA 1BBRK 4K5ZA 2QGRA 1OP0A 3SNDA 1EOLA 2P3FH 1D9IA 3HATH 1D3TB 1TGNA 1ESTA 1TPPA 3GCNA 2HWLB 3ZVCA 2FS8A 3KL6A 1AI8H 1O5BB 3BTEE 4XBDA 1V2WT 1BQYA 2BLVA 1FONA 1AGJA 1ZTKA 3C27B 3A7XA 1JXPA 2VWNA 5FPYA 4IS5A 3T28A 1FJSA 2G4UA 1O2QA 4A5TS 3ZVAA 1DSUA 4INLA 3S7KB 3A80A 1MKWK 1AB9B 1ZRKA 1D6RA 1V2RT 3ATKA 3S69A 4DY7B 1O5AB 5HYOA 3HK3B 5E0GA 3MU5A 5CMXH 1DPOA 2BY9X 1IHTH 1SVPA 1TWXB 3IITA 3KQCA 4IC6A 5JBCS 1TNGA 1SGCA 3O8RA 1C2KA 1CO7E 1IQKA 3ITIA 3SU2A 3AASA 3RXEA 2QN5T 3SV9A 3RXVA 2GT8A 2HLCA 3TGKE 5C1YA 3SGAE 2BVXH 2NU2E 2ZA5A 4INHA 1TE0A 4AG1A 1C5YB 3SV2H 1Z7KA 1O5CB 8GCHF 7KMEH 5T6FA 2C8ZB 1XUFA 7ESTE 2FYRA 2VWMA 2GT7A 3RLWH 3RXFA 3ZZCA 1CA8B 2ZFQH 1HJ8A 1F0UA 2AEIH 4JYTA 4FUDA 1BHXF 2OCVB 2VVVA 2AERH 5A0AE 1UK3A 1PQ5A 1ELVA 3V3MA 3A86A 3PTNA 4D7GA 1ELFA 1O2PA 4X6PA 4YO9A 1QA0A 1ELAA 1RGQA 2W3IA 1SLVB 3SNCA 2ODQA 2TGTA 5GJ4B 1Y3XA 1BZXE 2ZDVH 2J38A 4MG3A 2PWXA 1S0QA 3MH4A 1O3KA 1J15A 1C2JA 1YPJH 3STJA 2BLQA 1UTOA 3A8DA 3P70B 3GY5A 1C1QA 1HAOH 2G81E 4Q7ZA 1SPJA 2FI5E 4NFEA 1EQ9A 1AWFH 1DUEA 2AGGX 1HCGA 3VFEA 1MZAA 1SHYA 1JWTA 2OP9A 1DWCH 3TJVA 1AUJA 3ZVGA 4TYDA 3TK5A 3CP7A 3GISB 3EA9A 3E91A 1CBWC 4J2YB 1HV7A 1THSH 2FESH 2ODYB 4O3TA 3RMOH 2IOTA 1O2HA 1GG6B 1YC0A 1ESBA 1O2IA 4UEHH 3UNSA 1G37A 1FQ3A 1EAUA 5HM9A 1HXEH 2FTLE 1EASA 1O3PB 4XBCA 3DA9B 1GHZA 1GBLA 1FPHH 3F9FA 4DJZB 1V2LT 3SO3A 1GVZA 2VWLA 3W95A 1UTNA 1ZLRA 3T29A 4I8LA 3PMJA 3SU5A 1P2MA 4F49A 2ZPSA 2SGQE 1XXFA 2AS9A 3SORA 1N1LA 5I46H 1MAXA 2OBQA 1A4WH 3FP7E 4CBOA 2GVFA 1GGDB 1W13U 2BTCE 2ZQ2A 3SJ8A 4O3UA 1ELBA 1GMCF 1GL1A 1BRUP 1XUJA 2QXIA 2O9QA 3UNQA 2Z9KA 1HAYB 3FP8E 1TGTA 4OS6A 4B2AA 3ATIA 3LGWA 1BMNH 2Y5HA 4ABIA 1TRMA 4FUCA 1ID5H 1KLJH 3VGCC 1MTNC 1F5KU 1UK2A 2OC1A 2TRMA 3VB6A 2ZG0H 3NZIA 1MU6B 4PROA 3RXIA 1QGFA 3R0FA 1WU1A 1P02A 2RG3A 2D8WA 3MH7A 2EI6A 2H2ZA 1MU8B 2PLXA 1IQMA 1WUNH 3Q77A 1O2GH 2ZFPH 3LC5A 2VJ1A 1HB0B 1O3GA 2BXTH 2AH4X 5A0CA 3KNXA 1IQJA 1WQSA 3LGTA 3UREA 3PO1C 3GICB 1GWAA 1XVOA 1ZSKA 4FUBA 3LJJA 4NIVA 3U8TH 1HAVA 1NRNH 2FODA 4WY3A 2ODPA 1GI6A 1B7XB 1NRQH 1XUKA 1CGHA 5DPAA 3K65B 1S85A 1J14A 1GBTA 4B76A 1V2QT 2NU1E 2PGBB 2HNTC 2OQ5A 3MNXA 4JZDH 5AHGH 3E6PH 1JRTA 2ULLA 2IPHA 2VINA 4D9RA 1GI4A 1O37A 1YPHE 3ZZ3A 1EATA 1GBMA 4CRGA 1AUTC 3M3TA 1C1SA 2HOBA 2J95A 1QBOA 5E0HA 4IW4E 4FUEA 2A7JA 3TPIZ 3GCTG 4HZHA 2FO9A 3U69H 2K1QA 5DP4A 4CREA 3Q3KA 1TNKA