3A7TA

Crystal structure of trypsin complexed with 4-formylbenzimidamide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7tA02
1GGDB 5JBAS 4IS5A 5FBEA 1C2IA 3LGUA 6GCHF 4MVNA 1ZMNA 1B0EA 3BG8A 3FFGA 4NZQA 1XXFA 3RXAA 3UUZA 5C20A 1B7XB 4WF8A 1RRKA 3RXOA 1NRSH 1O5GH 1QQUA 1FNIA 3PMBB 3QUMP 3LOXA 4Y0YE 4NFFA 2O8MA 2XW9A 1GCTC 1A0JA 4BTIB 1K1PA 1C2KA 4X1PU 1C9PA 1E34B 4AB9A 5FCRA 3UNQA 3ESTA 2BOKA 2VIVA 5C5NA 1NFWA 3SU1A 1YPJH 2SGQE 3KCGH 1KYNA 1C4Y2 4YESB 4MLFB 1O32A 1W2KH 2VWMA 1TB6H 2Z3EA 1K1NA 1H1BA 1O2UA 2IJOB 4INLA 4AGKA 3ELAH 3P8OA 2Z9LA 3RXIA 3QN7A 1TGNA 1BRUP 2G52A 5FXLA 4BANB 1O2IA 2G5NA 5FX5A 3RXRA 1O38A 2NU0E 1GBHA 3B9FH 1UTPA 2J38A 3SQEE 1KDQB 2ANWA 2PUQH 3BG4B 3KQDA 1QCPA 1ZYOA 2FOBA 3SNDA 5DP4A 3KQBA 2ALVA 1SFIA 4HFPB 1UCYE 3RUOA 2BB4A 3A81A 1A5HA 1ETRH 2BLQA 2UWOA 5EPNA 2XCFA 4OS2A 5BRRE 1DUAA 1W10U 3TH4H 3C27B 2SGFE 1O2TA 3M5OA 1C5PA 1NFYA 2SGAA 3F68H 2VWNA 4B2CA 2GZ9A 2WPMS 1L4DA 2THFB 1PPBH 3P17H 1KLTA 1KXBA 3HATH 1AD8H 1GMDG 3RMMH 1IHTH 2QXHA 5K7RA 1MZAA 1BJUA 4B76A 3HK6B 1YPHC 4VGCB 1SC8U 1GI8B 3N7OA 4JZ1A 1JIMA 5ESBA 3BTHE 2ALPA 1PPZA 3VFEA 1GHBG 5F03A 1TPAE 2VGCB 4KGAA 1FAKH 1A5IA 3GY3A 3PMJA 3RU4T 1DITH 3SU5A 2FS9A 1PFXC 3A85A 4ZXXH 2FOFA 3RM2H 1FAXA 3LC3A 2ZFPH 1LPGB 1M9UA 4GHQA 1GG6C 4K3JA 1UK2A 1C5LH 1C5MD 4Q7XA 1C5YB 1BT7A 6LPRA 1HGTH 1TGSZ 3DD2H 3ZZCA 3FZDA 1QL9A 4XBBA 1GI4A 2A5AA 2UUYA 4MQAA 2BYAX 3DHKH 1KXEA 3RXQA 2TBSA 3PV4A 2ZU3A 4A1XA 2HPQH 3DFJA 1BRBE 4ZKRU 3CENA 2FYRA 1EB1H 1SB1H 2PWXA 1GDQA 2AGGX 3Q3KA 2PLXA 4CR9A 1YLDA 2EI8A 1D4PB 4TWYA 1YPEH 1SHYA 1PYTC 4HTCH 5T6FA 2PKAA 3NK8A 1IQGA 1O3DA 1NS3A 3E3TA 3QLPH 2BZAA 1XMNB 4AFUA 2I6QA 2FMJA 3STIA 4I31A 2JH6D 1QBVH 1G32B 1GJ5H 2ODQA 4MPUA 1S83A 5T6GA 2BQ7B 3D62A 1UTNA 3U8TH 9ESTA 1GJ7B 1EKBB 1F0RA 3ZVDA 3I77A 5GIBA 2W26A 2YOLA 4O03A 1CSOE 2PHBA 1MTVA 2ZGHA 2AMQA 1OPHB 1UTLM 5LPFA 1UMAH 2AEIH 1C5WB 1IOEA 1N6XA 4JZEH 1DWCH 1O36A 1UJ1A 1HBTH 6CHAC 1C2FA 2GCHF 1CA0B 1AMHA 1K21H 5C3NA 1IQEA 4F4OC 3T5FH 3RXFA 2ZCHP 3URDA 3URCA 1MTUA 2ZU1A 1DLEA 1E37B 3UNRA 1OP2A 4FUBA 1HAZB 4RN6A 4I8KA 1SLUB 4WY3A 2D2DA 3P8GA 2ZHDA 1WQSA 4IC6A 1QBOA 3MNSA 1FN8A 4E05H 2A32A 1TOCB 2F3CE 2QN5T 5DP8A 1DWDH 1EX3A 1P3EA 1QY6A 1CHOG 4OS7A 1K1LA 2PKSB 1G2MA 3T27A 4GCHF 1SPJA 4CRDA 5GXPA 1HJ8A 2VVUA 1YYY1 5HXFA 1TRYA 3K2UA 3TIUA 3KIDU 1GBBA 1C4V2 1P2NA 5EQSA 3F6UH 1LPZB 3P6ZB 3QX5H 1ZPZA 1W7GH 5L2ZH 2QF3A 1SQTA 3VPKA 1NRQH 1QURH 2CF9H 2GCTC 2H9HA 5JPMH 1P11E 3PMHB 1YLCA 4CRCA 2HRVA 1P10A 1EPTC 3DT0H 1LHGH 3BTDE 3U1IB 1C1PA 2B7DH 2RG3A 4FUHA 3MH5A 3TITA 1RXPA 3V13A 1QL7A 3GCNA 5DG6A 1P09A 2F83A 1G30B 5EW2H 1T8NA 4ZROA 1TQ7B 4A7IB 3TJVA 3MNXA 4TPIZ 1A5GH 2VINA 3ZYEA 1WU1A 5FPTA 1EJNA 1T8LA 4A1VA 4KTUA 2IPHA 2NU1E 2CXVA 3LIWA 4FUGA 2CN0H 3SNAA 4NIVA 2G51A 3UQOA 2Q6FA 2BY6X 4GHTA 4UFEH 1GI7B 1O2KA 2J9NA 3E0PB 4K5ZA 1DY8A 1O35A 4K1EA 3MOCA 2GKVE 1EZXC 2QXGA 7LPRA 1GI2A 1PPEE 3QZRA 2HNTF 3V7TA 3PLBA 1O5AB 2D1JA 5E2OA 1GHZA 2NU2E 5DP5A 3RLWH 4BAMB 2J4IA 3KF2A 1TGTA 5DJ7A 1JXPA 1P9SA 1ZGIA 1ZHRA 1LVMA 3UWIA 3A83A 5T6DA 4B74A 1HNEE 3SU6A 1HYLA 2HGTH 4H42U 1TABE 4I8LA 2SGDE 3A89A 3ITIA 1NPMA 1ZJDA 1O3KA 3TH3H 1DFPA 1TONA 2ASUB 4THNH 3ZZ9A 6CHAB 2ZC9H 4BTTB 2GVFA 4TWWA 1EZQA 3M35A 1GBEA 2UUFB 1ZZZA 3G01A 4B2AA 3FVFB 1BUIA 2RDLA 4DJZB 3EYDA 1EAXA 3MO9A 1T4UH 3ZV8A 1BMMH 2A5IA 2GP9B 1NTPA 4GAWA 3SGBE 2GTBA 1GHBF 1A0LA 2FZZA 2QC2A 3RXBA 3LGTA 1O5DH 2FP7B 1RS0A 3KGPA 3O8BA 2VH0A 4BAQB 1KXAA 1RJXB 1TBZH 3IITA 1QNJA 5E0GA 3RMNH 3ZZBA 4X8TH 3M3SA 4IN1A 4DIIH 3KQEA 3ZZ8A 1GI0A 2ZGXH 2F9BH 4KTCA 3M3TA 3V12A 4B2BA 1V2WT 3W95A 2BD5A 4IN2A 3L3TA 1NROH 3BTME 1KDQA 1OP0A 1ZRBA 1MH0A 1SMFE 4D7FA 1NN6A 2AYWA 2VVVA 2HNTC 2AMDA 3L6PA 2ZFQH 1P02A 3ZVFA 1H4WA 3RXDA 1Z1JA 2AGEX 2RA3A 2A4QA 4K2YA 1EPTB 3NWUA 1TX8A 1TNIA 4Y71A 1FONA 1Y59T 3D49H 2ZZUH 5DP7A 1GI1A 3LGIA 5LGOA 2TGDA 2KAIA 1JMOH 2XBVA 1OSSA 4O9VA 1GMHF 2J95A 2G55A 2ZFSA 1MTNB 2W3KA 3MI4A 4NIYA 4BAHB 4H6TA 1Y8TA 2ANKH 1BBRK 3A80A 5K0HA 1XUJA 2AS9A 4O3UA 1GGDC 5ESTE 2F9PA 1QR3E 2CHAC 2ZHWH 4SGAE 1A1RA 1D3TB 1LVYA 2WPHS 1DANH 3H7OA 1SLXB 1V2QT 3TNSA 1QRWA 4I8HA 1Y3VA 2FOCA 5A8ZA 1DSTA 3K9XB 3TK6A 1FMGA 4JZIA 4DVAU 3HGPA 1O30A 3UREA 1FI8A 1SOTA 2ZDAH 4AFQA 1SOZA 1MU6B 3ATIA 3SN8A 4INKA 4A92A 3VEQB 1MD7A 3SGQE 4YM9A 2V3HH 1AIXH 2P3FH 5C2ZA 1HXFH 3SI4H 3T62A 1LQEA 3S7HB 4K1SA 1ESBA 1AWHB 1TNGA 5CE1A 2EEKA 2FDAA 3KHVA 1OKXA 2CF8H 2FODA 3Q3XA 2VIDA 1CT0E 4YTAA 3DA9B 3UTUH 3SV2H 1O2VA 1YF4A 1GBCA 2C8WB 1TMBH 1O5EH 1WOFA 3BEIB 4ISLA 4AORA 4BXWA 3VB6A 1S0QA 4UFFH 1BHXF 1YCPM 3F1SB 2HOBA 3E6PH 1YP9A 2FYQA 4H4FA 5LH8A 4X2YA 1YPHE 1GVZA 3PB1E 1SR5C 3U98H 3MU1A 2FOEA 1QJ7B 4BAOB 1CA8B 1EUFA 1NRRH 1QB1A 3MTYA 1LHDH 1QFKH 1ESTA 3SU0A 3UPEA 3SHCH 2ULLA 1TMTH 1W7XH 2FOAA 1BITA 1FIZA 1O37A 1HAPH 1DWBH 1WUNH 2R0LA 2GMTC 1BBRE 1XX9A 2BXUH 3VB5A 3SUDA 1EP5A 2PUXB 4FVBA 1ZSLA 4VGCC 3NCLA 3M3VA 1PQ5A 2D8WA 1NT1A 3KNXA 3S9BA 3GISB 2BMGB 2QXIA 2P94A 4D7GA 2HLCA 4X1NU 3LGVA 1W12U 1C2HA 1SFQB 4FU8A 2BD7A 2W7UA 1THSH 2FX4A 3BTTE 4MNVA 1AVGH 1ZMJA 2FWWA 4DY7B 1BTYA 5EQQA 1UTMA 3SZNA 3HGNA 4UFGH 3AW0A 1THPB 1KXDA 5F8TA 1GJ9B 4ABGA 5C1UA 4GCHG 4Y6DA 1BTZA 3UY9A 3QDZB 5LPEA 3M7TA 1BMNH 3SOSA 1BTXA 2AGIX 2EI7A 3EE0B 1SGYE 1LHFH 2ZDNA 1PPCE 2V0BA 1DDJA 1MQ6A 1IAUA 1OWDA 1BOQA 3SU2A 2VVCA 1GHAF 1AFQB 3BIUH 1Y3XA 2VJ1A 1ZHPA 8GCHG 1HAHH 1C5NH 1D3PB 1AWFH 3BTQE 3GY6A 4K8BA 2CHAB 1EAIA 4JK5A 1DY9A 1F5KU 2BX3A 2FOMB 1TNLA 1OWKA 2Z3CA 7KMEH 4DIHH 4IC5A 5JBTA 1AZ8A 2Z94A 4CRBA 3A7ZA 2WPKS 1K1JA 5I46H 3ODFA 3RXSA 4GVUA 1XXDA 4FVDA 1OWJA 1P0SH 5L2YH 3T26A 5HMAA 1O3MA 1A3EH 4X6OA 2OP9A 2ZGBH 1NFUA 3T2NA 1CT4E 2OD3B 1EXFA 4D9RA 1O3FA 1C5RA 2IN2A 1SG8B 1S81A 3ATMA 1NRNH 4TY7A 1A7SA 5DK1A 3SJKA 2ZECA 2TRMA 1CT2E 1CA0C 5FPYA 3RM0H 5J4SA 2ZKSA 4KELA 2Z6BD 4HI3A 1HB0B 2M5TA 1AFEH 4JK6A 3PWBA 1C1TA 3LGYA 1AQ7A 3SQHE 4AB8A 4WXIA 4NCYA 1O2QA 1QHRB 1SSXA 2ZCKP 1O2HA 4J2YB 2XC4A 1E0FD 2DE8A 4UD9H 1BB0B 2YNAA 1O3LA 1BZXE 1NO9H 2FIRH 4ISIH 1C1WH 1BQYA 2BDBA 3E90B 3U8RH 1A61H 2PKSC 1QRZA 4CBOA 2V3OH 2GMTB 2H1UA 5JB9S 1KSNA 1AUTC 2ZDMA 1ZJKA 1DUEA 1Y5UT 1EAUA 2Q1JA 1HAVB 1PQ8A 1KLIH 4RSPA 3KEEA 3ZV9A 2BDIA 4R8TB 2H9TH 1S5SA 5GCHF 2GD4B 4LK4A 1O3IA 1Y3UA 5JDUB 3LU9B 1EQ9A 3R3GB 3MYWA 3ZZAA 1DXWA 1SGQE 1OWEA 3P95A 3RP2A 4Y76A 1YCPK 1GL1A 1G37A 1UVUH 2WV5A 3S9CA 3A84A 2ZHEH 1TMUH 1DXPA 1UHBA 5B6OA 5EW1H 1FUJA 4X6PA 4B1TA 5GPIB 3CS0A 4DCDA 5GJ4B 1F92A 2G5VA 1C1SA 4YOGA 4DGJA 5G4BA 4CRAA 4ABBA 1C5VA 1O2OA 1Z6EA 3PWCA 2Y80A 1HAOH 1A46H 2QCYA 3ODDA 3SJ9A 5DGJA 1YGCH 1WBGB 1N6YA 5TJXA 2AIQA 1ZGVA 1UTJA 1C5ZB 2OQ5A 4H6SB 1H9IE 3AW1A 2R2WU 4Y8YA 2FM2A 3I29A 1FPHH 1AKSB 1OWIA 3R0FA 1DPOA 1BHXB 1GI6A 3ZZ4A 2BVXH 4I32A 3O8CA 2FI5E 3K6YA 2GDDA 2XC5A 5EG4A 1HUTH 1NM6A 3NXPA 4AFSA 3RC5A 3KQCA 4X8VH 2F9OA 3M5LA 1GJCB 3QO6A 3NKKA 1ZHMA 1INCA 1GMHG 2PSXA 5PTPA 3M61U 1EPTA 1ZTJA 1HV7A 1TPSA 4X1RU 5FX6A 3T25A 1HJ9A 1OX1A 3E0NB 2BDGA 1LCYA 3TGKE 1Q3XA 1AHTH 4E7RG 1WTGH 4XOJA 4RKJB 1ZTKA 1BRCE 1EOLA 2O8UA 1O5BB 2ZA5A 2UWPA 2TPIZ 2Q6DA 1IHSH 3VGCB 4JYTA 2G81E 1BTWA 2GZ8A 4Q2KA 1P2KA 4X8SH 1O3EA 2ANMH 3GY4A 1CQQA 1CE5A 3SGAE 4WJG2 5C1XA 4CRGA 1GJAB 2QA9E 1QBNA 2B0FA 3UQVA 3NZIA 3STJA 1C2EA 1ELTA 2XC0A 1AGJA 4Q7ZA 4A5TS 3RC6A 1DOJA 1F0UA 3BTKE 1WTHD 5EXMA 1VGCC 2C8YB 1HCGA 2ZFTA 1ELEE 5GWZA 3OYPA 3SV9A 1HFDA 1C2MA 4K69A 3GDUA 4Y8ZA 1SQOA 2HNTE 1G3EA 3LJJA 1XVMA 3SNBA 2XYAA 3MU4A 3RXGA 1RFNA 3RU4D 2O9QA 3M5MA 4X1SU 2OTVA 1FDPA 2CGAA 2C8ZB 1V2UT 1V2RT 4OGYA 1S6FA 2WINI 3W94A 1SGIB 1V2JT 1IQHA 1DWEH 3SJ8A 1C1RA 1ABIH 2C90B 4MNXA 1WSSH 3Q3YA 1LVOA 1ZRKA 2CV3A 1UVSH 3QTOH 4JYUH 1EJAA 3QZQA 8LPRA 2WPJS 5EXNA 3GY5A 8GCHF 1XUKA 2A7HA 3FANA 1AI8H 1GBIA 1DVAH 3VB3A 3SU4A 3V3MA 2XXLA 3PO1B 1C1UH 2SGPE 1AVWA 3IG6B 5DPAA 1V6DA 3RMLH 2J94A 5E8EH 4ESTE 2BX4A 1QTFA 1E36B 1BA8B 1C1NA 1UCYH 1MTNC 1O2YA 1D3DB 2OBQA 1ANEA 4X6MA 7ESTE 1AE5A 5DP9A 1FY4A 3PTBA 1BMLA 4NWKA 4WVPE 1MKXK 1TLDA 8KME2 2B9LA 1ABJH 1A2CH 1G3DA 4XDEA 4BTUB 1FY1A 5EXLA 1L1JA 1FZZA 5LPRA 1F5LA 4M7GA 2W5EA 1DICA 2ZDLA 2ZPQA 2FXRA 1W13U 1P2OA 3RXLA 3TU7H 1S84A 1Z8JB 1ELCA 3M37A 3TJOA 4U01A 1JOUB 2BY8X 1JRSA 3ENSB 2ZHFH 5EU8A 5F6MA 4D8NA 5SGAE 5JB8S 4I8GA 4MPVA 1GHAG 2VNTA 2STAE 4GSOA 3NPSA 2AH4X 1YPLH 1OP8A 1Q31A 1TAWA 1KTSB 4BAKB 2Y82A 1WV7H 2RA0A 2QAAA 2AMPA 3LH1A 3SO3A 3RDZA 2ZP0H 4DW2U 5IYTA 2P8OB 2A4GA 1A0HB 1SL3A 3GDSA 1GJDB 1TA2A 3QK1A 5A2MH 3U1JB 4YT6H 2HPPH 3BF6H 3A87A 3MH4A 2Z9JA 1P3CA 4KKDA 4Y0ZE 2G00A 3E1XB 3EA9A 5JBBS 1UVPA 2BDYA 4NA9H 3GYLB 1LDTT 3B23B 4E06H 2VB0A 4Y10E 1GI9B 1N1LA 4TPYA 2H6MA 2A7JA 1VGCB 1GBAA 1HPGA 1TNJA 1FJSA 2VIWA 1HIAB 1GBJA 3S0NA 6ESTA 4U2WA 1Y5BT 2ZFFH 2Y7ZA 3TVJB 1LKBA 4AG1A 2BDCA 1TQ0B 2FESH 2W7SA 1EAWA 2ZGJA 2C4FH 2JETB 1TBRH 1SGDE 1J16A 3F9EA 1PQ7A 1TX7A 1SLVB 1VJ9U 1O34A 1H8DH 2JH0D 3F9GA 1AN1E 3MNBA 2CMYA 5DKMA 2A4RA 3ZVGA 3H5CB 1FLEE 1GCDA 1TPPA 1UK3A 5EPYA 1D6RA 1MZDA 1AO5A 4R0IA 3K6ZA 1T31A 4ABHA 4ZH8A 4NFEA 1O0DH 1G3CA 3VB7A 1IQJA 2NWNA 3A8CA 3MO3A 1P05A 1GI5A 1NESE 1IQIA 1AFQC 4MTBA 4OS1A 1SBWA 2FEQH 3LDXH 5GCHG 3P8FA 3A7VA 1S6HA 2PGBB 1HAVA 3TJUA 1CGHA 1SGCA 1BTPA 1TX6A 2P95A 1C1MA 1LKAA 4NIXA 1MCTA 1SGEE 2Y5FA 4ISNA 2A2XH 3EAJA 4J1YA 2W3IA 2SGEE 3AASA 5J4QA 2ZU5A 1ZPCA 2F9NA 1P2MA 2V6NA 1TOMH 4UFDH 1O2NA 1DM4B 1MTWA 2TIOA 2JH5D 1P57B 1GVLA 2ZPSA 3MO6A 3SV8A 2ILNA 2H2ZA 2VWLA 1FQ3A 1CHGA 3PLKA 3GDVA 5TCCA 5C5OA 1WQVH 3EGKH 3ZZ5A 2XNIA 3TLOA 1FXYA 3F9FA 2PFEA 3A88A 1GL0E 3D65E 2PV9B 4A6LA 1QA0A 1LHEH 4AOQA 1V2NT 3UOPA 1NU9A 3HK3B 3M36A 1TIOA 3FP7E 5E0HA 1YC0A 2P93A 1BTUA 3VXFH 3GYMA 1KXFA 1G9IE 1FY3A 1KY9A 1QB6A 1AKSA 1JWTA 1O5CB 2OBOA 2PR3A 1OS8A 2XWAA 1KTTB 1NFXA 2ZTYA 3Q00A 3BSQA 3Q77A 2QXJA 4D76A 4ZAEA 3SU3A 1K28D 2B8OH 5AVDA 1MBQA 4CHAC 1OWHA 1W11U 3SBKA 4NGAH 4MNWA 4XSKU 5DP6A 1ZMLA 1D6WA 5A09A 5AFYH 3V0XA 1V2MT 3MMGA 1O3HA 2BQWB 2BY9X 1O3GA 2P3TB 2FO9A 3RXKA 4WMEA 3PMAB 4AN7A 1SHHB 3RXVA 1T8OA 2BOHB 3A7XA 2WYGA 2K1QA 3C1KA 8ESTE 1GMCG 4LZ1H 1P06A 3S7KB 1C2GA 1MBMA 4ZKOU 1O2MA 5C1YA 3RXPA 4FU7A 1GBFA 2FI3E 2OC1A 3U9AH 4MNYA 2RCEA 4I8JA 2ZPRA 3A7TA 3E16B 1O3NA 5C67A 1LPKB 1SGNE 1V2ST 4HZHA 1ZSJA 5F8ZA 1L4ZA 1Y3YA 1IQLA 1LVBA 1OXGA 1O2SA 4Y8XA 1BRAA 2FPZA 2ZCLP 2PW8H 4Y11E 2EA3A 3ZVBA 4AZ2B 1MKWH 2SFAA 3BIVH 4X8UH 3JZ2B 3AVZA 1O33A 2XRCA 1ACBE 5FBIA 2OCVB 2HWLB 4XBCA 2ZHQH 3SHAH 3O8DA 1FIWA 3EQ0H 1V2PT 3HPTB 3SV7A 1J8AA 3ATWA 1VITH 1ELVA 1VCWA 3A8AA 2ZU2A 1ZTLA 1L1NA 5A8XA 1C5QA 4Y7BA 3KL6A 2HALA 2F9VA 2VIQA 1B0FA 1VZQH 2SNVA 4FUFA 2ANYA 1HAIH 1THRH 2J2UA 3TH2H 2G4UA 1GI3A 1Z7KA 2EC9H 3RXUA 1TNKA 2A45B 1PYTD 3RXCA 1TALA 2WPLS 2BD2A 4CH2B 4OGXA 3U69H 3ATKA 2ZQ2A 1J14A 1AVXA 1O3AA 3PTNA 4ISHH 1BMAA 5AF9H 2ESTE 3BTWE 1SLWB 1K9OE 4FUEA 4X6NA 1SVPA 1QRXA 1OYQA 2BDHA 4AG2A 4UONA 1BTHH 4ABDA 3QGJA 3IWMA 5E2PA 1Y3WA 3VGCC 4OS5A 1U6QA 3SUEA 4GPGA 3A86A 4CR5A 1ELBA 3RXTA 1J9CH 4O3TA 2WUBA 1O2ZA 4NA7A 4AYYB 4BNRA 2FI4E 1EB2A 1P2IA 1Q2WA 1RIWB 4WXVA 4NIWA 1P2JA 1HRTH 4ZXYH 5CMXH 4U30A 3OTJE 1ESAA 4ABAA 4BXSA 5TCAA 5L6NH 4AFZA 1EZSC 4CHAB 3CP7A 3PYHA 5E0JA 2ODYB 1W14U 2A2QH 1XUIA 4I33A 4I7YH 1S85A 5GDSH 1O2PA 1VCQA 1D3QB 4JCNA 5FPSA 1A4WH 3PROA 1XUFA 5HGGA 1GJ6A 3TJNA 7GCHG 3DUXH 1Z8GA 2LNCA 4Q80A 1O3CA 1ZPBA 3ZVAA 1ANCA 1GJBB 4OS6A 1GHYH 1H9LB 4TYDA 3GOVB 1C1VH 1G3BA 3RXHA 4CH8B 2QIQA 1H9HE 3F9HA 2KAIB 1TPOA 3ZZ6A 1O3BA 4AGJA 1ARCA 1LO6A 1L0ZA 4RKOB 1QIXB 2VIPA 1OOKB 1Z1IA 3PO1C 2Z9KA 1UO6A 3ZZ7A 1KXCA 3MH7A 1UVTH 4PROA 2STBE 4FXGH 2EI6A 2Q6GA 1C5SA 1P2QA 1GVKB 3OY5U 3VXEH 1HIAA 2A7CA 2G8TA 2FLRH 4K1TA 2A1DB 1FY5A 4YLUA 1XUGA 1AB9B 2G4TA 2VH6A 2BD4A 4XBDA 1T8MA 1MU8B 4NWLA 1RTFB 1S0RA 3SUGA 3LJOA 2SNWA 1BBRH 2ZFRH 5CHAB 4KTSA 3UR6A 1AU8A 4NZLA 1UTOA 5FCKA 1F7ZA 1C2JA 1DSUA 1MUEB 9LPRA 1QB9A 2Y5HA 2C8XB 4UDWH 3BTGE 2BZ6H 3M7QA 1K1IA 2R3YA 1MQ5A 3D23A 1N8OB 5ABWA 3LKWA 1C5OH 1SGFG 1Z8RA 2VIOA 3GCHC 2ZWLH 1CBWB 1NZQH 3RC4A 1BCUH 1ORFA 1QJ1B 2O8LA 3I78A 2Y81A 1WCZA 1V3XA 3FZZA 1C1QA 2FS8A 1UTQA 4ZKNU 3RLYH 4AX9H 1DX5M 1O2XA 1O3PB 4GUXA 3UWJH 1C5TA 1TA6A 4U32A 2BY7X 1GCTB 2QGRA 2WV4A 2P8OC 4YLQH 5DO4H 3A8BA 1ETSH 4ISOA 1GMCF 3RXMA 3EA7A 5DP3A 1TFXA 3GY8A 4FUCA 1MTSA 2NU4E 2Z9GA 3RXEA 3PLPA 4Z6AH 3AAUA 3RU4E 1K2I1 3B8JA 3KN2A 3EDXB 1GBDA 4XFQA 1VITG 2Y6TA 1SGRE 3HKIB 3Q76A 4NG9H 3S9AA 2TGTA 2BD3A 3ZYDA 1MMJN 5IDKA 1C2DA 1E38B 4DOQA 1NRPH 1QL8A 3ZVEA 1QA7A 3E91A 3WY8A 1GDNA 4DT7B 1HDTH 2C93B 5HM9A 2TGAA 1ZSKA 1VCPA 2ZTXA 3A82A 1RTLA 1NC6A 1C9TA 1WYKA 2FTLE 4TY6A 4WH8A 2BVSH 4ZUHA 1P8VC 1F0SA 2GT8A 2JETC 1O2RA 1LQDB 5A0AE 2BD8A 3T28A 3MU8A 1C4U2 4F49A 2I6SA 5L30H 4X2XA 5A0BA 2GV7A 3AAVA 1HAGE 3GY7A 1SGTA 3A7WA 4YOJA 1CVWH 2Z3DA 1W3CA 4ABFA 2OC8A 1EZUC 1K1OA 2HVXA 2R0KA 1SI5H 5EOKA 1XKBC 4LZ4B 1O2GH 3UIRA 3E8LA 1HAYB 5JYIA 4ABJA 2QYIA 1O5FH 1P12E 3FP6E 3LT3A 2FOHA 2QV1A 1FV9A 2P3UB 3ZZ3A 1PJPA 1EJMA 1MKWK 2BLVA 2XWBI 1Z6JH 2A5KA 1GG6B 1TNHA 4WMFA 2A0QB 4CBNA 2QY0B 4BOHA 3OX7U 1JIRA 1GBTA 1TBQH 2AFQB 2H5DA 4YOIA 4XE4A 1E35B 2OC7A 4FUIA 1PPGE 2GDEH 2BLOA 3K65B 2XCNA 1YM0A 2OQUA 1ZLRA 2IOTA 2WUCA 2XBXA 1XUHA 3A7YA 3GCHB 1GJ8B 4LOYH 4X1QU 4YO9A 3VB4A 1K22H 3TGIE 2XBWA 4X2VA 1B5GH 1LTOA 4B73A 2ZG0H 4ZHLU 1DT2A 3NUMA 2BY5X 1TGBA 3OSYA 1RTKA 1IQNA 4Q7YA 1GHWH 3M7UA 2BXTH 4QT8C 2ZGCA 3SJIA 1BDAA 2GV6A 2FOGA 2OLGA 4Y79A 4WMDA 2P59A 2WYJA 3BTEE 1GPZA 1ELAA 4MPXA 7GCHF 1UVOA 2AERH 3GCTG 2BVRH 2DE9A 3QWCH 2P16A 3TK5A 1YPMH 1BJVA 4ASHA 1Z71A 1ELGA 2R2MB 6GCHG 4IW4E 4CRFA 1JBUH 1J17T 2J92A 5FHTA 1BIOA 1D9IA 3GICB 2XBYA 3TK9A 1QJ6B 3OY6U 1ARBA 4UE7H 2ZNKH 3A8DA 5F8XA 1P9UA 1V2KT 2AIPA 1YKTA 1GMDF 2BQ6B 1EASA 3PM3A 1F2SE 3RXJA 2ZTZA 1SGPE 5EODA 4D9QA 1CO7E 3BN9A 4JZDH 2PGQB 4CREA 1UHBB 2D26C 3MU5A 1T4VH 1FPCH 1YPKH 4K60A 1MCVA 4HGCA 1TYNA 3M5NA 4FUDA 1G36A 2ZDKA 1EATA 1MAXA 3EA8A 2GZ7A 2Z7FE 3P70B 2LPRA 2FLBH 1AUJA 1RD3B 3BV9B 2F9UA 2ZI2H 2F91A 4OS4A 4GLYA 2BHGA 4JZFH 1X7AC 2GX4A 1Z8IB 1YCPH 3HKJB 1GHVH 2FX6A 1PPHE 4KP0A 1PPFE 1TWXB 5ETXA 1HJAC 2PKAB 3UFAA 2BD9A 2H5CA 4IGDA 1GBLA 4NA8A 3SNCA 4WWYA 4ZHMU 2BDAA 3P8NA 1SGFA 4WH6A 1NY22 2GCTB 1KIGH 1V2TT 3T29A 2OC0A 3S69A 1GJ4H 1L2EA 4ABIA 1W0ZU 2WPIS 1JRTA 3ZVCA 1O2WA 3SNEA 3H7TA 2FTMA 1SQAA 2ODPA 4FUJA 4ZMAH 3OU0A 4IBLH 3LPRA 4FU9A 2ZEBA 1LMWB 3L33A 1GDUA 2GT7A 1O2LA 3MHWU 2ZIQH 2BLWA 2UUKB 3MU0A 1GHXH 1FN6A 4DURA 5BPEA 1ELDE 1V2VT 2ZF0H 3LC5A 4A1TA 4ZKSU 2PTNA 1K1MA 3O8RA 3MWIU 2A4OA 1AE8H 2C3SA 2QF0A 4Z0KA 2OUAA 1VITF 2O8TA 2B5TB 2R9PA 3SJOA 1C2LA 1VR1H 1IQMA 1KLJH 3SW2B 5I25A 3ZZDA 1DS2E 3ATLA 2NU3E 3MFJA 2Y5GA 1GBKA 1C5XB 3SI3H 3UOUA 1L1GA 1HLTH 1F0TA 3TNTA 1FY8E 3FAOA 1V2OT 4YT7H 1CU1A 1ETTH 2OXSA 4Y7AA 3SUFA 1RIWC 1TE0A 4MPWA 4IMQA 4DG4A 1O39A 3TPIZ 2BM2A 3UR9A 1XM1A 5HM2A 1CHOF 5JBCS 1ANBA 3GY2A 1MD8A 3GCOA 4IMZA 2GGVB 1UTKA 1O31A 4JMYA 1O3JA 4YZUA 1UK4A 3BEUA 1S82A 2UWLA 2R3UA 4MDSA 2XTTB 1J15A 3BG4C 5A8YA 2TGPZ 3QGNB 1PQAA 1AZZA 1ZOMA 1QGFA 3BTFE 3LGWA 1RGQA 1EOJA 4UEHH 5EQRA 2J34A 1YPGH 1OYTH 4MG3A 1GWAA 2VWOA 3P92A 4SGBE 2PTCE 2DUCA 1TGCA 1WAYB 2ZQ1A 1Y5AT 3DFLA 1ELFA 1LHCH 1CGJE 4ABEA 5AHGH 1AY6H 1CGIE 1F5RA 2Z9IA 3CS7A 2V35A 3SV6A 1DLKB 4JYVH 2GCHG 3UNSA 5H4IB 4B75A 4INHA 1DE7H 4AYVB 5FAHA 3SORA 4X2WA 4O97A 1P01A 2H9EH 1HXEH 1P03A 3LH3A 2UUJB 1NU7B 3LONA 1V2LT 1ANDA 1A3BH 1C1OA 2VGCC 1W8BH 1HJAB 1IQFA 5A0CA 1O2JA 1ZR0A 3BEFB 2ZO3H 1P04A 1GBMA 1O3OA 4ZHAA 1AB9C 1TRMA 5AFZH 1ID5H 1G2LA 1HAXB 2ZDVH 5CHAC 1XVOA 1YBWA 1VJAU 3TGJE 2ZU4A 1MKXH 2A31A 3JZ1B 1XKAC 1T7CA 4K8YA 4LXBH 1UCYK 1MAYA 4NSYA 4X0WU 5HYOA 3QTVH 4B71A 2Y7XA 2CJIA 3MNCA 5T3HA 1T32A 2VU8E 1C5UA 1QQ4A 1W0YH 1EP6A 5EGMA 3U8OH 1H8IH 2JKHA 4E7NA 2OINA 1N8OC 2PSYA 3RMOH 3GCTF 4NSVA 2O8WA 1IQKA 3FP8E 2BTCE 2YNBA 3MH6A 1CBWC 1TRNA
chains in the Genus database with same CATH superfamily
1GGDB 5C0UA 5JBAS 4IS5A 5FBEA 1C2IA 3LGUA 6GCHF 4MVNA 1ZMNA 1B0EA 3BG8A 3FFGA 4NZQA 1XXFA 3RXAA 3UUZA 5C20A 1B7XB 4WF8A 1RRKA 3RXOA 1NRSH 1O5GH 1QQUA 1FNIA 3PMBB 3QUMP 3LOXA 4Y0YE 4NFFA 2O8MA 2XW9A 1GCTC 1A0JA 4BTIB 1K1PA 1YLNA 1C2KA 4X1PU 1C9PA 1E34B 4AB9A 5FCRA 3PV5A 3UNQA 3ESTA 3N7DA 2BOKA 2VIVA 5C5NA 1NFWA 3SU1A 1YPJH 2SGQE 3KCGH 1KYNA 1C4Y2 4YESB 4MLFB 1O32A 1W2KH 2VWMA 1TB6H 2Z3EA 1K1NA 1H1BA 1O2UA 2IJOB 4INLA 4AGKA 3ELAH 3P8OA 2Z9LA 3RXIA 3QN7A 1TGNA 1BRUP 2G52A 5FXLA 4BANB 1O2IA 2G5NA 5FX5A 3RXRA 1O38A 2NU0E 1GBHA 3B9FH 1UTPA 2J38A 3SQEE 1KDQB 2ANWA 2PUQH 3BG4B 3KQDA 1QCPA 1ZYOA 2FOBA 3SNDA 3UB0A 5DP4A 3KQBA 2ALVA 1SFIA 4HFPB 1UCYE 3RUOA 2BB4A 3A81A 1A5HA 1ETRH 2BLQA 2UWOA 5EPNA 2XCFA 4OS2A 5BRRE 1DUAA 1W10U 5F53A 3TH4H 3C27B 2SGFE 1O2TA 3M5OA 1C5PA 1NFYA 2SGAA 3F68H 2VWNA 4B2CA 2GZ9A 2WPMS 1L4DA 2THFB 1PPBH 3P17H 1KLTA 1KXBA 3HATH 1AD8H 1GMDG 3RMMH 1IHTH 2QXHA 5K7RA 3SYJA 1MZAA 1BJUA 4B76A 3HK6B 1YPHC 3W1EA 4VGCB 1SC8U 1GI8B 3N7OA 4JZ1A 1JIMA 5ESBA 3BTHE 2ALPA 1PPZA 3VFEA 1GHBG 5F03A 1S6LA 1TPAE 2VGCB 4KGAA 4XRNA 1FAKH 1A5IA 1QZ8A 3GY3A 3PMJA 3RU4T 1DITH 3SU5A 2FS9A 1PFXC 3A85A 3KYGA 4ZXXH 2FOFA 3RM2H 1FAXA 3LC3A 2ZFPH 1LPGB 1M9UA 4GHQA 1GG6C 4K3JA 1UK2A 1C5LH 1C5MD 4Q7XA 1C5YB 1BT7A 6LPRA 1HGTH 1TGSZ 3DD2H 3ZZCA 3FZDA 1QL9A 4XBBA 1GI4A 2A5AA 2UUYA 4MQAA 2BYAX 3DHKH 1KXEA 3RXQA 4TT3D 2TBSA 3PV4A 2ZU3A 4A1XA 2HPQH 3DFJA 1BRBE 4ZKRU 3CENA 2FYRA 1EB1H 1SB1H 2PWXA 1GDQA 2AGGX 3Q3KA 2PLXA 4CR9A 1YLDA 2EI8A 1D4PB 4TWYA 4TSFD 1YPEH 1SHYA 2J5UA 1PYTC 4HTCH 5T6FA 2PKAA 3NK8A 1IQGA 1O3DA 1NS3A 3E3TA 3QLPH 2BZAA 1XMNB 4AFUA 2I6QA 2FMJA 3STIA 3OE7D 4I31A 2JH6D 1QBVH 1G32B 4RT0A 4F48B 1GJ5H 2ODQA 4MPUA 1S83A 5T6GA 2BQ7B 3D62A 1UTNA 3U8TH 9ESTA 1GJ7B 1EKBB 1F0RA 2RFKC 3ZVDA 3I77A 5GIBA 2W26A 2YOLA 4O03A 1CSOE 2PHBA 1MTVA 2ZGHA 2AMQA 1OPHB 1UTLM 5LPFA 1UMAH 2AEIH 1C5WB 1IOEA 3NRLA 1N6XA 4JZEH 1DWCH 1O36A 1UJ1A 1HBTH 6CHAC 1C2FA 2GCHF 1YY3A 1CA0B 1AMHA 4OM9A 1K21H 5C3NA 1IQEA 4F4OC 3T5FH 3RXFA 2ZCHP 3URDA 3URCA 1MTUA 2ZU1A 1DLEA 1E37B 3UNRA 1OP2A 4FUBA 1HAZB 4RN6A 4I8KA 1SLUB 4WY3A 2D2DA 3P8GA 2ZHDA 1WQSA 2VBCA 4IC6A 1QBOA 2IPQX 2L6OA 3MNSA 1FN8A 4E05H 2A32A 1TOCB 2F3CE 2QN5T 5DP8A 1DWDH 1EX3A 1P3EA 1QY6A 1CHOG 4OS7A 3MQKC 1K1LA 2PKSB 1G2MA 3T27A 4GCHF 1SPJA 4CRDA 5GXPA 1HJ8A 2VVUA 1YYY1 2KX4A 5HXFA 1TRYA 3K2UA 3TIUA 3KIDU 1GBBA 4B6FA 1C4V2 1P2NA 5EQSA 3F6UH 1LPZB 3P6ZB 3QX5H 1ZPZA 1W7GH 5L2ZH 2QF3A 5HIZA 1SQTA 3VPKA 1NRQH 1QURH 2CF9H 2GCTC 2H9HA 5JPMH 1P11E 3PMHB 1YLCA 4CRCA 2HRVA 1P10A 1EPTC 3DT0H 1LHGH 3BTDE 3U1IB 1C1PA 2B7DH 2RG3A 4FUHA 3MH5A 3TITA 1RXPA 3V13A 1QL7A 3GCNA 5DG6A 1P09A 2F83A 1G30B 5EW2H 1T8NA 4ZROA 1TQ7B 4A7IB 3TJVA 3MNXA 4TPIZ 1A5GH 2VINA 3ZYEA 1WU1A 5FPTA 1EJNA 1T8LA 4A1VA 5HKKD 4KTUA 2IPHA 2NU1E 2CXVA 3LIWA 4FUGA 2CN0H 3SNAA 2J97A 4NIVA 2G51A 3UQOA 2Q6FA 2BY6X 4GHTA 4UFEH 1GI7B 1O2KA 2J9NA 3E0PB 4K5ZA 1DY8A 1O35A 4K1EA 3MOCA 3WWBA 2GKVE 1EZXC 2QXGA 7LPRA 1GI2A 1PPEE 3QZRA 2HNTF 3V7TA 3PLBA 1O5AB 2D1JA 2XOKD 1GHZA 5E2OA 2NU2E 3PRBA 5DP5A 3RLWH 4BAMB 2J4IA 3KF2A 1TGTA 5DJ7A 1JXPA 1P9SA 1ZGIA 1ZHRA 2KCOA 1LVMA 3UWIA 3A83A 5T6DA 4B74A 1HNEE 3SU6A 1HYLA 2HGTH 4H42U 1TABE 2WHXA 3F0OA 4I8LA 2SGDE 3A89A 3ITIA 1NPMA 1ZJDA 1O3KA 3TH3H 1DFPA 1TONA 2ASUB 4THNH 3ZZ9A 6CHAB 2ZC9H 4BTTB 2GVFA 4TWWA 1EZQA 3M35A 1GBEA 2UUFB 1ZZZA 3G01A 4B2AA 3FVFB 1BUIA 2RDLA 4DJZB 3EYDA 1EAXA 3MO9A 1T4UH 3ZV8A 1BMMH 2A5IA 2GP9B 1NTPA 4GAWA 3SGBE 2GTBA 3CNRA 1GHBF 1A0LA 2FZZA 2QC2A 3RXBA 3LGTA 1O5DH 2FP7B 1RS0A 3KGPA 3O8BA 2VH0A 4BAQB 1KXAA 1RJXB 1TBZH 3IITA 1QNJA 5E0GA 3RMNH 3ZZBA 4X8TH 3M3SA 4IN1A 4DIIH 3KQEA 3ZZ8A 5IK2D 1GI0A 3OEHD 2ZGXH 2F9BH 4KTCA 3M3TA 3V12A 4B2BA 1V2WT 3W95A 2BD5A 4IN2A 3L3TA 1NROH 3BTME 1KDQA 1OP0A 4M9FA 1ZRBA 1MH0A 1SMFE 4D7FA 1NN6A 2KZ4A 2AYWA 2VVVA 2HNTC 2AMDA 3L6PA 2ZFQH 1P02A 3ZVFA 1H4WA 3RXDA 1Z1JA 2AGEX 2RA3A 2A4QA 4K2YA 1EPTB 3NWUA 1TX8A 1TNIA 4Y71A 1FONA 1Y59T 3D49H 2ZZUH 5DP7A 1GI1A 3LGIA 5LGOA 2TGDA 2KAIA 1JMOH 2XBVA 1OSSA 4O9VA 1GMHF 2J95A 2G55A 2ZFSA 1MTNB 2W3KA 3MI4A 3OEED 4NIYA 4BAHB 4H6TA 1Y8TA 2ANKH 3F2GA 1BBRK 3A80A 5K0HA 1XUJA 2AS9A 4O3UA 1GGDC 5ESTE 5CDFE 2F9PA 1QR3E 2CHAC 2ZHWH 4SGAE 1A1RA 1D3TB 1LVYA 2CK3D 2WPHS 1DANH 3H7OA 1SLXB 1V2QT 3TNSA 1QRWA 4I8HA 1Y3VA 2FOCA 5A8ZA 1DSTA 3K9XB 3TK6A 1FMGA 4JZIA 3DSOA 4DVAU 3HGPA 1O30A 3UREA 1FI8A 1SOTA 2ZDAH 4AFQA 1SOZA 1MU6B 3ATIA 3SN8A 4INKA 4A92A 3VEQB 1MD7A 3SGQE 4Q4LA 4YM9A 2V3HH 1AIXH 2P3FH 5C2ZA 1HXFH 3SI4H 3T62A 1LQEA 3S7HB 4K1SA 1ESBA 1AWHB 1E79D 1TNGA 5CE1A 2GJGA 3DSGA 2EEKA 2FDAA 2M2AA 3KHVA 1OKXA 2CF8H 2FODA 3Q3XA 2HVYB 2VIDA 1CT0E 4YTAA 4ASUD 3DA9B 3UTUH 3SV2H 1O2VA 1YF4A 1GBCA 2C8WB 1TMBH 1O5EH 1WOFA 3BEIB 4ISLA 4AORA 4BXWA 3VB6A 1S0QA 4UFFH 1BHXF 1YCPM 4RT1A 5DN6D 3F1SB 2HOBA 3E6PH 1YP9A 2FYQA 4H4FA 5LH8A 4X2YA 1YPHE 1GVZA 3PB1E 1SR5C 3U98H 3MU1A 2FOEA 1QJ7B 4BAOB 1CA8B 1EUFA 1NRRH 1QB1A 3MTYA 1LHDH 1QFKH 1NBME 1ESTA 1SQRA 3SU0A 3UPEA 3SHCH 2ULLA 1TMTH 1W7XH 2FOAA 1BITA 1FIZA 1O37A 1HAPH 1DWBH 1WUNH 2R0LA 2GMTC 1BBRE 1XX9A 4F55A 2BXUH 3VB5A 3SUDA 1EP5A 2PUXB 3F3BA 4FVBA 1ZSLA 4VGCC 3NCLA 3H09A 3M3VA 1PQ5A 2D8WA 1NT1A 3KNXA 3S9BA 3GISB 1BMFD 2BMGB 2QXIA 2P94A 4D7GA 2HLCA 4X1NU 3LGVA 1W12U 1C2HA 1SFQB 4FU8A 2BD7A 2F4LA 4YXWD 2W7UA 1THSH 2FX4A 3BTTE 4MNVA 1AVGH 1ZMJA 2FWWA 4DY7B 1BTYA 5EQQA 1UTMA 3SZNA 3HGNA 4UFGH 3AW0A 1THPB 1KXDA 5F8TA 1GJ9B 4ABGA 5C1UA 4GCHG 4Y6DA 1BTZA 3UY9A 3QDZB 5LPEA 3M7TA 1BMNH 3SOSA 1BTXA 2AGIX 2EI7A 3EE0B 1SGYE 1LHFH 2ZDNA 1PPCE 2V0BA 1DDJA 1MQ6A 1IAUA 1OWDA 1BOQA 2WZQA 3SU2A 2VVCA 1GHAF 1AFQB 3BIUH 4I86A 1Y3XA 2VJ1A 1ZHPA 8GCHG 1HAHH 1C5NH 1D3PB 1AWFH 3BTQE 3GY6A 4K8BA 2CHAB 1EAIA 4JK5A 1DY9A 1F5KU 2LELA 2BX3A 2FOMB 3FN8A 1TNLA 1OWKA 2Z3CA 7KMEH 4DIHH 4IC5A 5JBTA 1AZ8A 2Z94A 4CRBA 3A7ZA 2WPKS 1K1JA 5I46H 3ODFA 3RXSA 4GVUA 1XXDA 4FVDA 1OWJA 1P0SH 5L2YH 3T26A 5HMAA 1O3MA 1A3EH 2F43B 4X6OA 2OP9A 2ZGBH 1NFUA 3T2NA 1CT4E 2OD3B 1EXFA 4D9RA 1O3FA 1C5RA 2IN2A 1SG8B 1S81A 3ATMA 1NRNH 4TY7A 1A7SA 5DK1A 3SJKA 2ZECA 2TRMA 1CT2E 1CA0C 5FPYA 3RM0H 5J4SA 2ZKSA 4KELA 2Z6BD 4HI3A 1HB0B 2M5TA 1AFEH 4JK6A 3PWBA 2QF4A 1C1TA 3LGYA 1AQ7A 3SQHE 4AB8A 4WXIA 4NCYA 1O2QA 1QHRB 1SSXA 2ZCKP 1O2HA 4J2YB 2XC4A 2JIZD 1E0FD 2DE8A 4UD9H 1BB0B 2YNAA 1O3LA 1BZXE 1NO9H 2FIRH 4ISIH 2W6ID 1C1WH 1BQYA 2BDBA 3U28C 3E90B 3U8RH 1A61H 2PKSC 1QRZA 4CBOA 2V3OH 2GMTB 2H1UA 5JB9S 1KSNA 1AUTC 2ZDMA 1ZJKA 1DUEA 1Y5UT 1EAUA 2Q1JA 1HAVB 1PQ8A 1KLIH 4RSPA 3KEEA 3ZV9A 2BDIA 4R8TB 2H9TH 1S5SA 5GCHF 2GD4B 4LK4A 2HLDD 1O3IA 1Y3UA 5JDUB 3LU9B 1EQ9A 3R3GB 3MYWA 3ZZAA 1DXWA 1SGQE 1OWEA 3P95A 3RP2A 2KFWA 4Y76A 1YCPK 1GL1A 1G37A 1UVUH 2WV5A 3S9CA 3A84A 2ZHEH 1TMUH 1DXPA 1UHBA 5FL7D 5B6OA 5EW1H 1FUJA 4X6PA 4B1TA 5GPIB 3CS0A 4DCDA 5GJ4B 1F92A 2G5VA 1C1SA 4YOGA 4DGJA 5G4BA 4CRAA 4ABBA 1C5VA 1O2OA 1Z6EA 3PWCA 2Y80A 1HAOH 1A46H 2QCYA 3ODDA 3SJ9A 5DGJA 1YGCH 1WBGB 1N6YA 5TJXA 2AIQA 1ZGVA 3SZEA 1UTJA 1C5ZB 2OQ5A 4H6SB 1H9IE 3AW1A 2R2WU 4Y8YA 2FM2A 3I29A 4Z1MD 1FPHH 1AKSB 1OWIA 3R0FA 1DPOA 1K0HA 1BHXB 1GI6A 3ZZ4A 2BVXH 4I32A 3O8CA 2FI5E 3K6YA 2GDDA 2XC5A 5EG4A 1HUTH 1NM6A 3NXPA 4AFSA 3RC5A 3KQCA 4X8VH 2F9OA 3M5LA 1GJCB 3QO6A 3NKKA 1ZHMA 1INCA 1GMHG 2PSXA 5PTPA 3M61U 1EPTA 1ZTJA 1HV7A 1TPSA 4X1RU 5FX6A 3T25A 1HJ9A 1OX1A 3E0NB 2BDGA 4Q63A 1LCYA 3TGKE 1Q3XA 1AHTH 4E7RG 1WTGH 4XOJA 4RKJB 1ZTKA 1BRCE 1EOLA 2O8UA 1O5BB 2ZA5A 2UWPA 2TPIZ 2Q6DA 1IHSH 3VGCB 4JYTA 2G81E 1BTWA 2GZ8A 4Q2KA 1P2KA 4X8SH 1O3EA 2ANMH 3GY4A 1CQQA 1CE5A 3SGAE 4WJG2 2YMSD 4CRGA 5C1XA 1GJAB 2QA9E 1QBNA 2B0FA 3UQVA 3NZIA 1KMHB 3STJA 1C2EA 1ELTA 2XC0A 1AGJA 4Q7ZA 4A5TS 3RC6A 1DOJA 1F0UA 3BTKE 1WTHD 5EXMA 1VGCC 2C8YB 1HCGA 2ZFTA 1ELEE 5GWZA 3OYPA 3SV9A 1HFDA 1C2MA 4K69A 3GDUA 4Y8ZA 1SQOA 2HNTE 3F2FA 1G3EA 3LJJA 1XVMA 3SNBA 2XYAA 3MU4A 3RXGA 1RFNA 3RU4D 2O9QA 3M5MA 3F0PA 4X1SU 3PV2A 2OTVA 1FDPA 2CGAA 2C8ZB 1V2UT 1V2RT 4OGYA 2JDID 1S6FA 2WINI 2OK5A 3W94A 1SGIB 1V2JT 1IQHA 1DWEH 3SJ8A 1C1RA 1ABIH 2C90B 4MNXA 1WSSH 3Q3YA 1LVOA 1ZRKA 2CV3A 2KCYA 1UVSH 3QTOH 4JYUH 1EJAA 3QZQA 8LPRA 2WPJS 5EXNA 3GY5A 8GCHF 1XUKA 2A7HA 2KR7A 2J98B 3FANA 1AI8H 1GBIA 1DVAH 3VB3A 3SU4A 3V3MA 2XXLA 3PO1B 1C1UH 2SGPE 1AVWA 3IG6B 5DPAA 1V6DA 3RMLH 2J94A 5E8EH 4ESTE 2BX4A 1QTFA 3OAAD 1E36B 1BA8B 1C1NA 1UCYH 1MTNC 1O2YA 1D3DB 2OBQA 1ANEA 4X6MA 7ESTE 1AE5A 5DP9A 1FY4A 3PTBA 1BMLA 4NWKA 4WVPE 1MKXK 1TLDA 8KME2 2B9LA 1ABJH 2V7QD 1A2CH 1G3DA 4XDEA 4BTUB 2WPDD 1FY1A 2KM0A 5EXLA 1L1JA 1FZZA 5LPRA 1F5LA 4M7GA 2W5EA 1DICA 2ZDLA 2ZPQA 2FXRA 1W13U 1P2OA 3RXLA 3TU7H 1S84A 1Z8JB 1ELCA 5HIYA 3ZIAD 4ACBA 3M37A 3TJOA 4U01A 1JOUB 2BY8X 1JRSA 3ENSB 2ZHFH 5EU8A 5F6MA 4D8NA 5SGAE 3AK5A 5JB8S 4I8GA 4MPVA 1GHAG 2VNTA 2STAE 4GSOA 3NPSA 2AH4X 1YPLH 5GNDA 1OP8A 1Q31A 1TAWA 1KTSB 4BAKB 2Y82A 1WV7H 2RA0A 2QAAA 2AMPA 3LH1A 3SO3A 3RDZA 2ZP0H 4DW2U 5IYTA 2P8OB 2A4GA 1A0HB 1SL3A 3GDSA 1GJDB 1TA2A 3QK1A 5A2MH 3U1JB 4YT6H 2HPPH 3BF6H 3A87A 3MH4A 2Z9JA 1P3CA 4KKDA 4Y0ZE 2G00A 3E1XB 3EA9A 5JBBS 1UVPA 2BDYA 4NA9H 3GYLB 1LDTT 3B23B 4E06H 2VB0A 4Y10E 1GI9B 1N1LA 4TPYA 2H6MA 2A7JA 1MABB 1VGCB 1GBAA 1HPGA 1TNJA 1FJSA 2VIWA 1HIAB 1GBJA 3S0NA 4AC9A 6ESTA 4U2WA 1Y5BT 2ZFFH 2Y7ZA 3TVJB 1LKBA 4AG1A 2BDCA 1TQ0B 2FESH 2W7SA 1EAWA 2ZGJA 2C4FH 3N7EA 2JETB 5DSFA 1TBRH 5T1VA 1SGDE 1J16A 3F9EA 1PQ7A 1TX7A 1SLVB 1VJ9U 1O34A 1H8DH 2JH0D 2LP6A 1AN1E 3F9GA 3MNBA 2CMYA 1CBWC 5DKMA 2A4RA 5EJZA 3ZVGA 3H5CB 1FLEE 1GCDA 1TPPA 1UK3A 5EPYA 1D6RA 1MZDA 1AO5A 4R0IA 3K6ZA 1T31A 4ABHA 4ZH8A 4NFEA 1O0DH 1G3CA 3VB7A 1IQJA 2NWNA 3A8CA 3MO3A 1P05A 1GI5A 1NESE 1IQIA 1AFQC 4MTBA 4OS1A 1SBWA 2FEQH 3LDXH 5GCHG 3P8FA 3A7VA 1S6HA 2PGBB 1HAVA 3TJUA 1CGHA 1SGCA 1BTPA 1TX6A 2P95A 1C1MA 1LKAA 4NIXA 1MCTA 1SGEE 2Y5FA 5KECA 4ISNA 2A2XH 3EAJA 4J1YA 2W3IA 2SGEE 3AASA 2V3MA 5J4QA 3KYFA 2ZU5A 1ZPCA 2F9NA 1P2MA 2V6NA 1TOMH 4UFDH 1O2NA 1DM4B 1MTWA 2TIOA 2JH5D 1P57B 1GVLA 2ZPSA 2RDEA 3MO6A 3SV8A 2ILNA 2H2ZA 2VWLA 1FQ3A 1CHGA 3PLKA 3GDVA 5TCCA 5C5OA 1WQVH 3EGKH 3ZZ5A 2XNIA 3TLOA 1FXYA 3F9FA 2PFEA 3A88A 1GL0E 3D65E 2PV9B 4A6LA 1QA0A 1LHEH 4P00A 4AOQA 1V2NT 3UOPA 1NU9A 3HK3B 3M36A 1TIOA 3FP7E 5E0HA 1YC0A 2P93A 1BTUA 3VXFH 3GYMA 1KXFA 1G9IE 1FY3A 1KY9A 1QB6A 1AKSA 1JWTA 1O5CB 2OBOA 2PR3A 1OS8A 2XWAA 1KTTB 1NFXA 2ZTYA 3Q00A 3BSQA 3Q77A 2QXJA 4D76A 4ZAEA 3SU3A 1K28D 2B8OH 5AVDA 1MBQA 4CHAC 1OWHA 1W11U 3SBKA 4NGAH 4MNWA 4XSKU 5DP6A 1ZMLA 1D6WA 5A09A 5AFYH 3V0XA 1V2MT 2YMSB 1O3HA 3MMGA 2BQWB 2BY9X 1O3GA 3FO8D 2P3TB 2FO9A 3RXKA 4WMEA 3PMAB 4AN7A 1SHHB 3RXVA 1T8OA 2BOHB 3A7XA 2WYGA 2K1QA 3C1KA 8ESTE 1GMCG 2PP6A 4LZ1H 1P06A 3S7KB 1C2GA 1MBMA 4ZKOU 1O2MA 5C1YA 3RXPA 4FU7A 1GBFA 2FI3E 2OC1A 3U9AH 4MNYA 2RCEA 4I8JA 2ZPRA 3A7TA 3E16B 1O3NA 5C67A 1LPKB 1SGNE 1V2ST 4HZHA 1ZSJA 5F8ZA 1L4ZA 1NBMD 1IQLA 1Y3YA 1LVBA 1OXGA 1O2SA 4Y8XA 2K8IA 1BRAA 2FPZA 2ZCLP 2PW8H 4Y11E 2EA3A 2QF5A 3ZVBA 4AZ2B 1MKWH 2SFAA 3BIVH 4X8UH 3JZ2B 3AVZA 1O33A 2XRCA 3OFND 1ACBE 5FBIA 2OCVB 2HWLB 4XBCA 2ZHQH 3SHAH 3O8DA 1FIWA 3EQ0H 1V2PT 3HPTB 3SV7A 1J8AA 3ATWA 1VITH 3EE7A 1ELVA 1VCWA 3A8AA 2ZU2A 1ZTLA 1L1NA 5A8XA 1C5QA 4Y7BA 3KL6A 2HALA 2F9VA 2VIQA 4RI0A 1B0FA 1VZQH 2SNVA 4FUFA 2ANYA 1HAIH 1THRH 2J2UA 3TH2H 2G4UA 1GI3A 1Z7KA 2EC9H 3RXUA 1TNKA 2A45B 1PYTD 3RXCA 1TALA 2WPLS 2BD2A 4CH2B 4OGXA 3U69H 3ATKA 2ZQ2A 2J98A 1J14A 1AVXA 1O3AA 3PTNA 4ISHH 1BMAA 5AF9H 2ESTE 3BTWE 1SLWB 1K9OE 4FUEA 4X6NA 1SVPA 1QRXA 1OYQA 2BDHA 4AG2A 4UONA 1BTHH 4ABDA 3QGJA 3IWMA 5E2PA 1UW7A 1Y3WA 3VGCC 4OS5A 1U6QA 3SUEA 4GPGA 3A86A 4CR5A 1ELBA 3RXTA 1J9CH 4O3TA 2WUBA 1O2ZA 4NA7A 4AYYB 4BNRA 1H8HD 2FI4E 1EB2A 1P2IA 1Q2WA 1RIWB 4WXVA 4NIWA 1P2JA 1HRTH 4ZXYH 5CMXH 4U30A 3OTJE 1ESAA 4ABAA 4BXSA 5TCAA 5L6NH 4AFZA 1EZSC 4CHAB 3CP7A 3PYHA 5E0JA 2ODYB 1W14U 2A2QH 1XUIA 4I33A 4I7YH 1S85A 5GDSH 1O2PA 1VCQA 1D3QB 4JCNA 5FPSA 1A4WH 3PROA 1XUFA 2K0QA 5HGGA 1GJ6A 3TJNA 7GCHG 3DUXH 1WDIA 1Z8GA 2LNCA 4Q80A 1O3CA 1ZPBA 3ZVAA 1ANCA 1GJBB 5CHBA 4OS6A 1GHYH 1H9LB 4TYDA 3GOVB 1C1VH 1G3BA 3RXHA 4CH8B 2QIQA 1H9HE 3F9HA 2KAIB 1TPOA 3ZZ6A 1O3BA 4AGJA 1ARCA 1LO6A 1L0ZA 4RKOB 1QIXB 2VIPA 1OOKB 1Z1IA 2EQNA 3PO1C 2Z9KA 1UO6A 3ZZ7A 1KXCA 3MH7A 1UVTH 4PROA 2STBE 4FXGH 2EI6A 2Q6GA 1C5SA 5C0TA 1P2QA 1GVKB 3OY5U 3VXEH 1HIAA 2A7CA 2G8TA 2FLRH 4K1TA 2A1DB 1FY5A 4YLUA 1XUGA 1AB9B 2G4TA 2VH6A 2BD4A 4XBDA 1E1RD 1MU8B 1T8MA 1RTFB 1S0RA 4NWLA 3SUGA 3LJOA 2SNWA 1BBRH 2EY4C 2ZFRH 5CHAB 4KTSA 3UR6A 1AU8A 4NZLA 1UTOA 5FCKA 1F7ZA 1C2JA 1DSUA 1MUEB 9LPRA 1QB9A 2Y5HA 2C8XB 4UDWH 3BTGE 2BZ6H 3M7QA 1K1IA 2R3YA 3DSPA 3GS9A 1MQ5A 3D23A 1N8OB 5ABWA 3LKWA 1C5OH 3DCLA 1SGFG 1Z8RA 4P02A 2VIOA 3GCHC 2ZWLH 1CBWB 1NZQH 3RC4A 1BCUH 1ORFA 1QJ1B 2O8LA 3I78A 2Y81A 1WCZA 1V3XA 3FZZA 1C1QA 2FS8A 4ACAA 1UTQA 4ZKNU 3RLYH 4AX9H 1DX5M 1O2XA 1O3PB 4GUXA 3UWJH 1C5TA 1TA6A 5KGOA 4U32A 2BY7X 1GCTB 2QGRA 2WV4A 2P8OC 4YLQH 5DO4H 3A8BA 1ETSH 4ISOA 5B6LA 1GMCF 3RXMA 3EA7A 5DP3A 1W0KD 1TFXA 3GY8A 4FUCA 1SKYE 1MTSA 2NU4E 2Z9GA 1YWUA 3RXEA 3PLPA 4Z6AH 3AAUA 3RU4E 1K2I1 3B8JA 3KN2A 3EDXB 1GBDA 4XFQA 1VITG 2Y6TA 1SGRE 3HKIB 3Q76A 4NG9H 3S9AA 2TGTA 2BD3A 3ZYDA 1MMJN 5IDKA 1C2DA 1E38B 2KCAA 1NRPH 1QL8A 2WSSD 4DOQA 3ZVEA 1QA7A 3E91A 3WY8A 1GDNA 4DT7B 1HDTH 2C93B 5HM9A 2TGAA 1EFRD 1ZSKA 1VCPA 2ZTXA 3A82A 1RTLA 1NC6A 1C9TA 1WYKA 2FTLE 4TY6A 4WH8A 2BVSH 4ZUHA 1P8VC 1F0SA 2GT8A 2JETC 1O2RA 3KQ5A 1LQDB 5A0AE 2BD8A 3T28A 3MU8A 1C4U2 4F49A 2I6SA 5L30H 4X2XA 5A0BA 2QE7D 2KCPA 2GV7A 3AAVA 1HAGE 3GY7A 1SGTA 3A7WA 4YOJA 1CVWH 2Z3DA 2WV9A 1W3CA 3F2HA 2OC8A 1EZUC 4ABFA 1K1OA 2HVXA 5C17A 2R0KA 1SI5H 5EJLA 1XKBC 5EOKA 4LZ4B 1O2GH 3UIRA 3E8LA 1HAYB 5JYIA 4ABJA 2QYIA 1O5FH 1P12E 3FP6E 3LT3A 2FOHA 2QV1A 1FV9A 2P3UB 3ZZ3A 1PJPA 1EJMA 1MKWK 2BLVA 2XWBI 1Z6JH 2A5KA 1GG6B 1TNHA 4WMFA 2A0QB 4CBNA 2QY0B 4BOHA 3OX7U 1JIRA 1GBTA 1TBQH 2AFQB 2H5DA 2L74A 4YOIA 4XE4A 1E35B 2OC7A 4FUIA 3WWFA 3OTPA 1PPGE 3FKSD 2GDEH 2BLOA 3K65B 2XCNA 1YM0A 2OQUA 1ZLRA 2IOTA 3FOAA 2WUCA 2XBXA 1XUHA 3A7YA 3GCHB 1GJ8B 4LOYH 4X1QU 4YO9A 3VB4A 1K22H 3TGIE 2XBWA 4X2VA 1B5GH 1OHHD 1LTOA 4B73A 2ZG0H 4ZHLU 5C94A 1DT2A 3NUMA 2BY5X 1TGBA 3OSYA 3UAIC 1RTKA 1IQNA 4Q7YA 1GHWH 3M7UA 2BXTH 4QT8C 2ZGCA 3SJIA 1BDAA 2GV6A 2FOGA 2OLGA 4Y79A 4WMDA 2P59A 2WYJA 3BTEE 1GPZA 1ELAA 4MPXA 7GCHF 1UVOA 2AERH 3GCTG 2BVRH 1COWD 2DE9A 3QWCH 2P16A 3TK5A 1YPMH 1BJVA 4ASHA 1Z71A 1ELGA 2R2MB 6GCHG 4IW4E 4CRFA 1JBUH 1J17T 2J92A 5FHTA 1BIOA 1D9IA 3GICB 2XBYA 2XNDD 3TK9A 2YMSC 1QJ6B 3PRDA 3OY6U 1ARBA 4UE7H 2ZNKH 3A8DA 5F8XA 1P9UA 1V2KT 2AIPA 1YKTA 1GMDF 2BQ6B 1EASA 3PM3A 1F2SE 3RXJA 4DT4A 2ZTZA 1SGPE 5EODA 4D9QA 1CO7E 3BN9A 4JZDH 2PGQB 4CREA 1UHBB 2D26C 4FOUC 3MU5A 1T4VH 1FPCH 1YPKH 4K60A 1MCVA 4HGCA 1TYNA 3M5NA 4FUDA 1WXRA 1G36A 2ZDKA 1EATA 1MAXA 3EA8A 2GZ7A 2Z7FE 3P70B 2LPRA 2FLBH 1AUJA 1RD3B 3BV9B 2F9UA 2ZI2H 2F91A 4OS4A 4GLYA 2BHGA 4JZFH 1X7AC 2GX4A 1Z8IB 1YCPH 3HKJB 1GHVH 2FX6A 1PPHE 4KP0A 1PPFE 1TWXB 5ETXA 1HJAC 2PKAB 3UFAA 2BD9A 2H5CA 4IGDA 1GBLA 4NA8A 3SNCA 4WWYA 4HG6A 4ZHMU 2BDAA 3P8NA 1SGFA 4WH6A 1NY22 2GCTB 1KIGH 1V2TT 3T29A 2OC0A 3S69A 1GJ4H 1L2EA 4ABIA 1W0ZU 1FX0B 2WPIS 1JRTA 3ZVCA 1O2WA 3SNEA 2IJD1 3H7TA 2FTMA 1SQAA 2ODPA 4FUJA 4ZMAH 3OU0A 4XD7D 4IBLH 3LPRA 4FU9A 2ZEBA 2JJ2D 1LMWB 3L33A 1GDUA 2GT7A 1O2LA 3MHWU 2ZIQH 2BLWA 2UUKB 3MU0A 1GHXH 1FN6A 4DURA 5BPEA 1ELDE 3VG8A 1V2VT 2ZF0H 3LC5A 4A1TA 4ZKSU 2PTNA 1K1MA 3O8RA 3MWIU 2A4OA 1AE8H 2C3SA 2QF0A 4Z0KA 2OUAA 1VITF 2O8TA 2B5TB 2R9PA 3SJOA 1C2LA 1VR1H 1IQMA 1KLJH 3SW2B 5I25A 3ZZDA 1DS2E 3ATLA 5EIYA 2NU3E 3MFJA 4ZCNA 2Y5GA 1GBKA 1C5XB 3SI3H 3UOUA 1L1GA 1HLTH 1F0TA 3TNTA 1FY8E 3FAOA 1V2OT 4YT7H 1CU1A 1ETTH 2OXSA 4Y7AA 3SUFA 3N99A 1RIWC 1TE0A 4MPWA 4IMQA 4DG4A 2JJ1D 1O39A 3TPIZ 2BM2A 3UR9A 1XM1A 5HM2A 1CHOF 5JBCS 1ANBA 3GY2A 1MD8A 3GCOA 4IMZA 2GGVB 1UTKA 1O31A 4JMYA 1O3JA 4YZUA 1UK4A 3BEUA 1S82A 2UWLA 2R3UA 4MDSA 5KEDA 2XTTB 1J15A 1E1QD 3BG4C 5A8YA 2TGPZ 3QGNB 1PQAA 1AZZA 1ZOMA 1QGFA 3BTFE 3LGWA 1RGQA 1EOJA 4UEHH 5EQRA 2J34A 1YPGH 1OYTH 4MG3A 1GWAA 2VWOA 3P92A 4SGBE 2PTCE 2DUCA 1TGCA 1WAYB 2ZQ1A 1Y5AT 3DFLA 1ELFA 1LHCH 1CGJE 4ABEA 5AHGH 1AY6H 1CGIE 1F5RA 2Z9IA 3CS7A 2V35A 3SV6A 1DLKB 4JYVH 2GCHG 3UNSA 5H4IB 4B75A 4INHA 1DE7H 4AYVB 5FAHA 3SORA 4X2WA 4O97A 1P01A 2H9EH 1HXEH 1P03A 3LH3A 2UUJB 1W0JD 1H8ED 1NU7B 3LONA 1V2LT 1ANDA 3WW7A 1A3BH 1C1OA 2VGCC 1W8BH 2W6JD 1HJAB 1IQFA 5A0CA 1O2JA 1ZR0A 3BEFB 2ZO3H 1P04A 1GBMA 1O3OA 4ZHAA 1AB9C 1TRMA 5AFZH 1ID5H 4FETA 1G2LA 1HAXB 2ZDVH 2AHME 5EJ1A 5CHAC 1XVOA 1YBWA 1VJAU 3TGJE 2ZU4A 1MKXH 2A31A 3JZ1B 1XKAC 1T7CA 4K8YA 4LXBH 1UCYK 1MAYA 4NSYA 4X0WU 5HYOA 3QTVH 4B71A 2Y7XA 2CJIA 3MNCA 5T3HA 1T32A 2VU8E 1C5UA 1QQ4A 1W0YH 1EP6A 5EGMA 3U8OH 1H8IH 2JKHA 4B6EA 4E7NA 2OINA 1N8OC 2PSYA 3RMOH 3GCTF 4NSVA 2O8WA 1IQKA 3FP8E 2BTCE 2YNBA 3MH6A 1VKYA 1TRNA
chains in the Genus database with same CATH topology
1GGDB 5JBAS 4IS5A 5FBEA 1C2IA 3LGUA 6GCHF 4MVNA 1ZMNA 1B0EA 3BG8A 3FFGA 4NZQA 1XXFA 3RXAA 3UUZA 5C20A 1B7XB 4WF8A 1RRKA 3RXOA 1NRSH 1O5GH 1QQUA 1FNIA 3PMBB 3QUMP 3LOXA 4Y0YE 4NFFA 2O8MA 2XW9A 1GCTC 1A0JA 4BTIB 1K1PA 1C2KA 4X1PU 1C9PA 1E34B 4AB9A 5FCRA 3UNQA 3ESTA 2BOKA 2VIVA 5C5NA 1NFWA 3SU1A 1YPJH 2SGQE 3KCGH 1KYNA 1C4Y2 4YESB 4MLFB 1O32A 1W2KH 2VWMA 1TB6H 2Z3EA 1K1NA 1H1BA 1O2UA 2IJOB 4INLA 4AGKA 3ELAH 3P8OA 2Z9LA 3RXIA 3QN7A 1TGNA 1BRUP 2G52A 5FXLA 4BANB 1O2IA 2G5NA 5FX5A 3RXRA 1O38A 2NU0E 1GBHA 3B9FH 1UTPA 2J38A 3SQEE 1KDQB 2ANWA 2PUQH 3BG4B 3KQDA 1QCPA 1ZYOA 2FOBA 3SNDA 5DP4A 3KQBA 2ALVA 1SFIA 4HFPB 1UCYE 3RUOA 2BB4A 3A81A 1A5HA 1ETRH 2BLQA 2UWOA 5EPNA 2XCFA 4OS2A 5BRRE 1DUAA 1W10U 3TH4H 3C27B 2SGFE 1O2TA 3M5OA 1C5PA 1NFYA 2SGAA 3F68H 2VWNA 4B2CA 2GZ9A 2WPMS 1L4DA 2THFB 1PPBH 3P17H 1KLTA 1KXBA 3HATH 1AD8H 1GMDG 3RMMH 1IHTH 2QXHA 5K7RA 1MZAA 1BJUA 4B76A 3HK6B 1YPHC 4VGCB 1SC8U 1GI8B 3N7OA 4JZ1A 1JIMA 5ESBA 3BTHE 2ALPA 1PPZA 3VFEA 1GHBG 5F03A 1TPAE 2VGCB 4KGAA 1FAKH 1A5IA 3GY3A 3PMJA 3RU4T 1DITH 3SU5A 2FS9A 1PFXC 3A85A 4ZXXH 2FOFA 3RM2H 1FAXA 3LC3A 2ZFPH 1LPGB 1M9UA 4GHQA 1GG6C 4K3JA 1UK2A 1C5LH 1C5MD 4Q7XA 1C5YB 1BT7A 6LPRA 1HGTH 1TGSZ 3DD2H 3ZZCA 3FZDA 1QL9A 4XBBA 1GI4A 2A5AA 2UUYA 4MQAA 2BYAX 3DHKH 1KXEA 3RXQA 2TBSA 3PV4A 2ZU3A 4A1XA 2HPQH 3DFJA 1BRBE 4ZKRU 3CENA 2FYRA 1EB1H 1SB1H 2PWXA 1GDQA 2AGGX 3Q3KA 2PLXA 4CR9A 1YLDA 2EI8A 1D4PB 4TWYA 1YPEH 1SHYA 1PYTC 4HTCH 5T6FA 2PKAA 3NK8A 1IQGA 1O3DA 1NS3A 3E3TA 3QLPH 2BZAA 1XMNB 4AFUA 2I6QA 2FMJA 3STIA 4I31A 2JH6D 1QBVH 1G32B 1GJ5H 2ODQA 4MPUA 1S83A 5T6GA 2BQ7B 3D62A 1UTNA 3U8TH 9ESTA 1GJ7B 1EKBB 1F0RA 3ZVDA 3I77A 5GIBA 2W26A 2YOLA 4O03A 1CSOE 2PHBA 1MTVA 2ZGHA 2AMQA 1OPHB 1UTLM 5LPFA 1UMAH 2AEIH 1C5WB 1IOEA 1N6XA 4JZEH 1DWCH 1O36A 1UJ1A 1HBTH 6CHAC 1C2FA 2GCHF 1CA0B 1AMHA 1K21H 5C3NA 1IQEA 4F4OC 3T5FH 3RXFA 2ZCHP 3URDA 3URCA 1MTUA 2ZU1A 1DLEA 1E37B 3UNRA 1OP2A 4FUBA 1HAZB 4RN6A 4I8KA 1SLUB 4WY3A 2D2DA 3P8GA 2ZHDA 1WQSA 4IC6A 1QBOA 3MNSA 1FN8A 4E05H 2A32A 1TOCB 2F3CE 2QN5T 5DP8A 1DWDH 1EX3A 1P3EA 1QY6A 1CHOG 4OS7A 1K1LA 2PKSB 1G2MA 3T27A 4GCHF 1SPJA 4CRDA 5GXPA 1HJ8A 2VVUA 1YYY1 5HXFA 1TRYA 3K2UA 3TIUA 3KIDU 1GBBA 1C4V2 1P2NA 5EQSA 3F6UH 1LPZB 3P6ZB 3QX5H 1ZPZA 1W7GH 5L2ZH 2QF3A 1SQTA 3VPKA 1NRQH 1QURH 2CF9H 2GCTC 2H9HA 5JPMH 1P11E 3PMHB 1YLCA 4CRCA 2HRVA 1P10A 1EPTC 3DT0H 1LHGH 3BTDE 3U1IB 1C1PA 2B7DH 2RG3A 4FUHA 3MH5A 3TITA 1RXPA 3V13A 1QL7A 3GCNA 5DG6A 1P09A 2F83A 1G30B 5EW2H 1T8NA 4ZROA 1TQ7B 4A7IB 3TJVA 3MNXA 4TPIZ 1A5GH 2VINA 3ZYEA 1WU1A 5FPTA 1EJNA 1T8LA 4A1VA 4KTUA 2IPHA 2NU1E 2CXVA 3LIWA 4FUGA 2CN0H 3SNAA 4NIVA 2G51A 3UQOA 2Q6FA 2BY6X 4GHTA 4UFEH 1GI7B 1O2KA 2J9NA 3E0PB 4K5ZA 1DY8A 1O35A 4K1EA 3MOCA 2GKVE 1EZXC 2QXGA 7LPRA 1GI2A 1PPEE 3QZRA 2HNTF 3V7TA 3PLBA 1O5AB 2D1JA 5E2OA 1GHZA 2NU2E 5DP5A 3RLWH 4BAMB 2J4IA 3KF2A 1TGTA 5DJ7A 1JXPA 1P9SA 1ZGIA 1ZHRA 1LVMA 3UWIA 3A83A 5T6DA 4B74A 1HNEE 3SU6A 1HYLA 2HGTH 4H42U 1TABE 4I8LA 2SGDE 3A89A 3ITIA 1NPMA 1ZJDA 1O3KA 3TH3H 1DFPA 1TONA 2ASUB 4THNH 3ZZ9A 6CHAB 2ZC9H 4BTTB 2GVFA 4TWWA 1EZQA 3M35A 1GBEA 2UUFB 1ZZZA 3G01A 4B2AA 3FVFB 1BUIA 2RDLA 4DJZB 3EYDA 1EAXA 3MO9A 1T4UH 3ZV8A 1BMMH 2A5IA 2GP9B 1NTPA 4GAWA 3SGBE 2GTBA 1GHBF 1A0LA 2FZZA 2QC2A 3RXBA 3LGTA 1O5DH 2FP7B 1RS0A 3KGPA 3O8BA 2VH0A 4BAQB 1KXAA 1RJXB 1TBZH 3IITA 1QNJA 5E0GA 3RMNH 3ZZBA 4X8TH 3M3SA 4IN1A 4DIIH 3KQEA 3ZZ8A 1GI0A 2ZGXH 2F9BH 4KTCA 3M3TA 3V12A 4B2BA 1V2WT 3W95A 2BD5A 4IN2A 3L3TA 1NROH 3BTME 1KDQA 1OP0A 1ZRBA 1MH0A 1SMFE 4D7FA 1NN6A 2AYWA 2VVVA 2HNTC 2AMDA 3L6PA 2ZFQH 1P02A 3ZVFA 1H4WA 3RXDA 1Z1JA 2AGEX 2RA3A 2A4QA 4K2YA 1EPTB 3NWUA 1TX8A 1TNIA 4Y71A 1FONA 1Y59T 3D49H 2ZZUH 5DP7A 1GI1A 3LGIA 5LGOA 2TGDA 2KAIA 1JMOH 2XBVA 1OSSA 4O9VA 1GMHF 2J95A 2G55A 2ZFSA 1MTNB 2W3KA 3MI4A 4NIYA 4BAHB 4H6TA 1Y8TA 2ANKH 1BBRK 3A80A 5K0HA 1XUJA 2AS9A 4O3UA 1GGDC 5ESTE 2F9PA 1QR3E 2CHAC 2ZHWH 4SGAE 1A1RA 1D3TB 1LVYA 2WPHS 1DANH 3H7OA 1SLXB 1V2QT 3TNSA 1QRWA 4I8HA 1Y3VA 2FOCA 5A8ZA 1DSTA 3K9XB 3TK6A 1FMGA 4JZIA 4DVAU 3HGPA 1O30A 3UREA 1FI8A 1SOTA 2ZDAH 4AFQA 1SOZA 1MU6B 3ATIA 3SN8A 4INKA 4A92A 3VEQB 1MD7A 3SGQE 4YM9A 2V3HH 1AIXH 2P3FH 5C2ZA 1HXFH 3SI4H 3T62A 1LQEA 3S7HB 4K1SA 1ESBA 1AWHB 1TNGA 5CE1A 2EEKA 2FDAA 3KHVA 1OKXA 2CF8H 2FODA 3Q3XA 2VIDA 1CT0E 4YTAA 3DA9B 3UTUH 3SV2H 1O2VA 1YF4A 1GBCA 2C8WB 1TMBH 1O5EH 1WOFA 3BEIB 4ISLA 4AORA 4BXWA 3VB6A 1S0QA 4UFFH 1BHXF 1YCPM 3F1SB 2HOBA 3E6PH 1YP9A 2FYQA 4H4FA 5LH8A 4X2YA 1YPHE 1GVZA 3PB1E 1SR5C 3U98H 3MU1A 2FOEA 1QJ7B 4BAOB 1CA8B 1EUFA 1NRRH 1QB1A 3MTYA 1LHDH 1QFKH 1ESTA 3SU0A 3UPEA 3SHCH 2ULLA 1TMTH 1W7XH 2FOAA 1BITA 1FIZA 1O37A 1HAPH 1DWBH 1WUNH 2R0LA 2GMTC 1BBRE 1XX9A 2BXUH 3VB5A 3SUDA 1EP5A 2PUXB 4FVBA 1ZSLA 4VGCC 3NCLA 3M3VA 1PQ5A 2D8WA 1NT1A 3KNXA 3S9BA 3GISB 2BMGB 2QXIA 2P94A 4D7GA 2HLCA 4X1NU 3LGVA 1W12U 1C2HA 1SFQB 4FU8A 2BD7A 2W7UA 1THSH 2FX4A 3BTTE 4MNVA 1AVGH 1ZMJA 2FWWA 4DY7B 1BTYA 5EQQA 1UTMA 3SZNA 3HGNA 4UFGH 3AW0A 1THPB 1KXDA 5F8TA 1GJ9B 4ABGA 5C1UA 4GCHG 4Y6DA 1BTZA 3UY9A 3QDZB 5LPEA 3M7TA 1BMNH 3SOSA 1BTXA 2AGIX 2EI7A 3EE0B 1SGYE 1LHFH 2ZDNA 1PPCE 2V0BA 1DDJA 1MQ6A 1IAUA 1OWDA 1BOQA 3SU2A 2VVCA 1GHAF 1AFQB 3BIUH 1Y3XA 2VJ1A 1ZHPA 8GCHG 1HAHH 1C5NH 1D3PB 1AWFH 3BTQE 3GY6A 4K8BA 2CHAB 1EAIA 4JK5A 1DY9A 1F5KU 2BX3A 2FOMB 1TNLA 1OWKA 2Z3CA 7KMEH 4DIHH 4IC5A 5JBTA 1AZ8A 2Z94A 4CRBA 3A7ZA 2WPKS 1K1JA 5I46H 3ODFA 3RXSA 4GVUA 1XXDA 4FVDA 1OWJA 1P0SH 5L2YH 3T26A 5HMAA 1O3MA 1A3EH 4X6OA 2OP9A 2ZGBH 1NFUA 3T2NA 1CT4E 2OD3B 1EXFA 4D9RA 1O3FA 1C5RA 2IN2A 1SG8B 1S81A 3ATMA 1NRNH 4TY7A 1A7SA 5DK1A 3SJKA 2ZECA 2TRMA 1CT2E 1CA0C 5FPYA 3RM0H 5J4SA 2ZKSA 4KELA 2Z6BD 4HI3A 1HB0B 2M5TA 1AFEH 4JK6A 3PWBA 1C1TA 3LGYA 1AQ7A 3SQHE 4AB8A 4WXIA 4NCYA 1O2QA 1QHRB 1SSXA 2ZCKP 1O2HA 4J2YB 2XC4A 1E0FD 2DE8A 4UD9H 1BB0B 2YNAA 1O3LA 1BZXE 1NO9H 2FIRH 4ISIH 1C1WH 1BQYA 2BDBA 3E90B 3U8RH 1A61H 2PKSC 1QRZA 4CBOA 2V3OH 2GMTB 2H1UA 5JB9S 1KSNA 1AUTC 2ZDMA 1ZJKA 1DUEA 1Y5UT 1EAUA 2Q1JA 1HAVB 1PQ8A 1KLIH 4RSPA 3KEEA 3ZV9A 2BDIA 4R8TB 2H9TH 1S5SA 5GCHF 2GD4B 4LK4A 1O3IA 1Y3UA 5JDUB 3LU9B 1EQ9A 3R3GB 3MYWA 3ZZAA 1DXWA 1SGQE 1OWEA 3P95A 3RP2A 4Y76A 1YCPK 1GL1A 1G37A 1UVUH 2WV5A 3S9CA 3A84A 2ZHEH 1TMUH 1DXPA 1UHBA 5B6OA 5EW1H 1FUJA 4X6PA 4B1TA 5GPIB 3CS0A 4DCDA 5GJ4B 1F92A 2G5VA 1C1SA 4YOGA 4DGJA 5G4BA 4CRAA 4ABBA 1C5VA 1O2OA 1Z6EA 3PWCA 2Y80A 1HAOH 1A46H 2QCYA 3ODDA 3SJ9A 5DGJA 1YGCH 1WBGB 1N6YA 5TJXA 2AIQA 1ZGVA 1UTJA 1C5ZB 2OQ5A 4H6SB 1H9IE 3AW1A 2R2WU 4Y8YA 2FM2A 3I29A 1FPHH 1AKSB 1OWIA 3R0FA 1DPOA 1BHXB 1GI6A 3ZZ4A 2BVXH 4I32A 3O8CA 2FI5E 3K6YA 2GDDA 2XC5A 5EG4A 1HUTH 1NM6A 3NXPA 4AFSA 3RC5A 3KQCA 4X8VH 2F9OA 3M5LA 1GJCB 3QO6A 3NKKA 1ZHMA 1INCA 1GMHG 2PSXA 5PTPA 3M61U 1EPTA 1ZTJA 1HV7A 1TPSA 4X1RU 5FX6A 3T25A 1HJ9A 1OX1A 3E0NB 2BDGA 1LCYA 3TGKE 1Q3XA 1AHTH 4E7RG 1WTGH 4XOJA 4RKJB 1ZTKA 1BRCE 1EOLA 2O8UA 1O5BB 2ZA5A 2UWPA 2TPIZ 2Q6DA 1IHSH 3VGCB 4JYTA 2G81E 1BTWA 2GZ8A 4Q2KA 1P2KA 4X8SH 1O3EA 2ANMH 3GY4A 1CQQA 1CE5A 3SGAE 4WJG2 5C1XA 4CRGA 1GJAB 2QA9E 1QBNA 2B0FA 3UQVA 3NZIA 3STJA 1C2EA 1ELTA 2XC0A 1AGJA 4Q7ZA 4A5TS 3RC6A 1DOJA 1F0UA 3BTKE 1WTHD 5EXMA 1VGCC 2C8YB 1HCGA 2ZFTA 1ELEE 5GWZA 3OYPA 3SV9A 1HFDA 1C2MA 4K69A 3GDUA 4Y8ZA 1SQOA 2HNTE 1G3EA 3LJJA 1XVMA 3SNBA 2XYAA 3MU4A 3RXGA 1RFNA 3RU4D 2O9QA 3M5MA 4X1SU 2OTVA 1FDPA 2CGAA 2C8ZB 1V2UT 1V2RT 4OGYA 1S6FA 2WINI 3W94A 1SGIB 1V2JT 1IQHA 1DWEH 3SJ8A 1C1RA 1ABIH 2C90B 4MNXA 1WSSH 3Q3YA 1LVOA 1ZRKA 2CV3A 1UVSH 3QTOH 4JYUH 1EJAA 3QZQA 8LPRA 2WPJS 5EXNA 3GY5A 8GCHF 1XUKA 2A7HA 3FANA 1AI8H 1GBIA 1DVAH 3VB3A 3SU4A 3V3MA 2XXLA 3PO1B 1C1UH 2SGPE 1AVWA 3IG6B 5DPAA 1V6DA 3RMLH 2J94A 5E8EH 4ESTE 2BX4A 1QTFA 1E36B 1BA8B 1C1NA 1UCYH 1MTNC 1O2YA 1D3DB 2OBQA 1ANEA 4X6MA 7ESTE 1AE5A 5DP9A 1FY4A 3PTBA 1BMLA 4NWKA 4WVPE 1MKXK 1TLDA 8KME2 2B9LA 1ABJH 1A2CH 1G3DA 4XDEA 4BTUB 1FY1A 5EXLA 1L1JA 1FZZA 5LPRA 1F5LA 4M7GA 2W5EA 1DICA 2ZDLA 2ZPQA 2FXRA 1W13U 1P2OA 3RXLA 3TU7H 1S84A 1Z8JB