3A7TA

Crystal structure of trypsin complexed with 4-formylbenzimidamide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule keywords Cationic trypsin
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7tA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7tA02
1WQSA 1K1LA 1LCYA 4FVBA 1FI8A 1O5GH 3UOPA 2GDEH 2RA3A 4Y76A 4DOQA 2ZHFH 2P16A 1P3EA 1Y3VA 2QXIA 3P8NA 1MTNC 4SGAE 2D8WA 1MU6B 1SGRE 3Q00A 2ZHEH 2ZQ1A 1S6FA 2FI5E 4ABIA 4X1QU 2BD5A 2BM2A 4NIWA 1BHXB 3BTWE 5FHTA 3ZV8A 3C1KA 1A5HA 2Q1JA 4AX9H 4OS6A 1P04A 1XKAC 2OUAA 3P92A 1JRTA 3MH7A 1H4WA 1MQ6A 2Z9GA 3SUEA 4CREA 5ABWA 1GHBG 1O36A 1GG6C 2GVFA 4GHQA 1DWCH 1EKBB 1H8DH 1DE7H 1O2ZA 4I8KA 4CR9A 1GJ9B 2H5CA 2VINA 3H5CB 3M5NA 2O8TA 3RMNH 1V2WT 2ZFTA 3A8AA 3RXFA 5E0HA 1MQ5A 2FOEA 5ETXA 5C5OA 1GHVH 1C1OA 3UNSA 3A82A 4ZHLU 4BANB 1ANEA 1C2KA 4CH2B 2BDHA 3MHWU 4BOHA 2NU2E 3VGCB 2FIRH 2FOHA 3A7TA 5JDUB 3GYMA 3VB4A 4Z6AH 4YTAA 4BTIB 5E8EH 1AFEH 1Y5BT 4OS4A 3AVZA 1C2HA 4ABDA 1G37A 1CBWC 1V2TT 2BHGA 3QLPH 1KLIH 1VITH 2O8WA 5HM9A 4YOIA 2D2DA 1EPTA 2G4TA 2PLXA 3RXDA 4O3TA 1QJ1B 3M5OA 4GPGA 3ZVFA 3CS7A 3LGYA 2EC9H 1C1MA 1P8VC 2ZI2H 3SOSA 1FY4A 1WYKA 1O2LA 5EW1H 5FBIA 5LH8A 2HWLB 4QT8C 4BAOB 1ZOMA 1FXYA 5BRRE 1T8OA 5FPSA 1RIWC 1AZ8A 4YOJA 2BOKA 1DDJA 1W12U 1HXFH 3E1XB 3MTYA 3P95A 4X6MA 2HPPH 2HALA 2Y5HA 1C1NA 1A5IA 1AVGH 1AB9B 1T31A 2FESH 2ZU4A 4I31A 4RKOB 2EEKA 1UJ1A 1VJAU 3DHKH 1W0ZU 3UIRA 1Z71A 5EW2H 1A5GH 2F91A 1O3NA 1OWHA 3M7QA 1O2GH 2G55A 1VITG 2ZF0H 1N6XA 3C27B 3LJOA 4JK6A 3AAUA 1L1GA 3SNEA 1HCGA 1C9TA 1GI0A 3M3SA 2A4RA 4I7YH 4O3UA 3SQHE 1ABJH 1PPZA 1ABIH 1HAIH 1C5XB 2QF0A 1XMNB 1NS3A 2BX3A 1GJ4H 4NWKA 1ORFA 3LIWA 1O37A 3VPKA 3AASA 3W95A 1SGTA 5T6GA 3T27A 1TPOA 1GVLA 3PWCA 5DKMA 1EB2A 1OKXA 3QZQA 1J9CH 3RC6A 4DIHH 1TGNA 2NU0E 3QGJA 4D8NA 1NRRH 1MKXH 4FU9A 1GMDF 3P8GA 3ZZ5A 1C2EA 1CA8B 4D76A 1LKBA 3ZZ7A 2VVCA 1O34A 4B71A 5EG4A 1HXEH 1C5SA 2FODA 4ABHA 2CGAA 3Q77A 5FAHA 1ESAA 4Y71A 4A92A 3GCHC 1C5YB 2GT7A 1P03A 2JKHA 4JZEH 3SI4H 4XBCA 2F83A 4Y10E 3K65B 4NIVA 2VIVA 3FAOA 3FZZA 4UFFH 4YESB 5LGOA 3GCOA 1E38B 5SGAE 4FU7A 4MVNA 2FYQA 1CHGA 1W0YH 1HAPH 2A0QB 1NT1A 4WMDA 3SU6A 5LPRA 1Z1JA 2QAAA 1C1RA 1P57B 2GKVE 1A0LA 3BTFE 1TPAE 1HRTH 2EI7A 1TNIA 2BVSH 5C3NA 1GI4A 1SGFG 1QTFA 2TPIZ 2ZTYA 3ELAH 1C5WB 5I46H 1C2JA 2QGRA 1HAVA 2OLGA 3RXMA 4A7IB 4IN1A 5DP7A 1LKAA 3O8RA 1A3BH 1OWEA 2R9PA 4CRCA 2F9PA 1QHRB 1C2IA 2Z9KA 4UEHH 4K1EA 4Q80A 1EX3A 4H42U 1ELAA 1O5AB 1HB0B 2Z3CA 1BTZA 1O3HA 3SZNA 4E7RG 1DX5M 4X6NA 2CV3A 4YOGA 1H9LB 3CP7A 3M36A 2WYGA 2THFB 1SOZA 3A87A 3MH5A 4JK5A 2I6SA 2ZC9H 1UHBA 2V6NA 2GZ8A 1D3QB 2HNTF 2Z9JA 1KTTB 3MU5A 1O2QA 2J2UA 2ZG0H 1TA2A 2PTCE 1ARCA 2FO9A 2WUCA 2Z7FE 3A8DA 1IQNA 3QDZB 3GISB 1GCTC 4XDEA 1ZSKA 2AMPA 4INLA 1F0TA 8GCHG 3TGIE 3URDA 1GBEA 2AGEX 4AFSA 1O3OA 4JZDH 2P94A 1DS2E 7LPRA 4YLUA 1MBQA 3TU7H 3ZZCA 1WCZA 4XE4A 1OP0A 3VXEH 1XXDA 4IN2A 3ZYDA 1GDNA 1MD8A 1C2FA 1TNGA 1B0EA 1QL7A 1SGYE 4X1NU 2PWXA 1AKSA 1YM0A 1HAGE 3RXJA 5EQQA 1EOJA 1YGCH 1FN6A 5HGGA 1SBWA 2IJOB 3GY8A 5EQRA 1A2CH 2UWLA 1D6WA 1SQTA 4F49A 4H4FA 1TRYA 3ZZ3A 2TBSA 2STBE 3SUDA 2ZHWH 1ACBE 2CF9H 1PPEE 1ZHRA 1OWKA 4K2YA 1AWHB 2BDIA 1AUJA 3S7HB 3FP6E 5HMAA 3TIUA 1LPKB 2Y82A 4MLFB 3SV8A 1EJMA 2SGAA 3Q76A 1FLEE 1RTFB 2ZQ2A 3EAJA 1SGDE 1TAWA 3FFGA 3RU4E 2ZEBA 5A8YA 1TB6H 2QXGA 3F68H 1NFXA 4R0IA 1K1NA 1O3BA 4JYUH 4YM9A 1GBKA 3U69H 1P11E 3RXBA 3MU0A 1QFKH 1C5TA 3P17H 2AMQA 2PKAA 4ABAA 3ENSB 3VXFH 1N1LA 1Q31A 2PKSC 3QWCH 1F92A 1G3DA 1Z8JB 1DSTA 1LO6A 2QIQA 2GMTB 2OBOA 4YT6H 2ZU1A 3K6ZA 2XCNA 1PPGE 3MU8A 3VFEA 2PR3A 4NSVA 2A5IA 1AUTC 4MPUA 1YP9A 3GY7A 5AFZH 3V3MA 3T62A 1NU7B 2A31A 2WPIS 1NFUA 3K9XB 2P8OC 3E16B 3RMMH 1S6HA 2BOHB 1BUIA 2EA3A 3DFJA 6GCHG 3UPEA 1BRBE 5EXLA 1IQLA 1GJAB 1NM6A 3P8FA 3HKIB 3IG6B 1RTKA 4Q7XA 1SLWB 3I78A 1EZXC 1FY1A 1O3IA 1OP8A 3NXPA 3NK8A 4IC6A 4AG1A 1MKXK 1QB6A 1GJ8B 1XUHA 3ATLA 1HAHH 3OY6U 1GBMA 1UO6A 5C5NA 1MTNB 5EQSA 2CMYA 1DXWA 4B76A 2GGVB 1NRSH 3ATWA 2ZDAH 1O3GA 1S0QA 2QYIA 1OPHB 3S7KB 3BEUA 2VGCB 2TGPZ 1NTPA 3TJNA 4CH8B 1GBJA 3DA9B 4NA7A 5FPYA 2BVXH 1UCYH 1BRAA 5DP4A 4U2WA 4DT7B 5J4SA 4FU8A 1B5GH 3ZYEA 2J34A 1C5RA 2Z6BD 1O2VA 3MU1A 1DUEA 5CHAC 2EI6A 3TVJB 1W2KH 3BEFB 4WVPE 5FX5A 4NZQA 2BB4A 1TA6A 3ZV9A 3ZZBA 1MD7A 3GY2A 1NFYA 1PFXC 1UHBB 2TIOA 1BZXE 3RM2H 3PMHB 1MH0A 1XUGA 2VIWA 3OY5U 2Y81A 5HM2A 3NUMA 1C5LH 1O0DH 2A2QH 2ZWLH 4BXSA 2D26C 1KLTA 1ZTJA 1BTWA 4MNYA 1UTMA 5T3HA 2G5NA 1O3LA 1P2OA 3W94A 1KXDA 4FUIA 3PROA 2WPKS 1FV9A 3URCA 1MCVA 2F9UA 3STJA 3U98H 1H8IH 2W5EA 1IQGA 3LU9B 1CBWB 1DXPA 3DT0H 1SQOA 1IQIA 3CS0A 1MTWA 1B7XB 2I6QA 5EPNA 1P9UA 1EOLA 1HLTH 1AVXA 3RXIA 1BTYA 3SV6A 2J95A 2HLCA 1GJ7B 4X2WA 3RMLH 2OC1A 2ODQA 5JB8S 1CQQA 1RXPA 3SNBA 2SGEE 5C67A 3ODFA 1GBLA 3BIUH 2UUYA 3SQEE 1DLEA 1IQKA 1ZMNA 5GWZA 2O8UA 3UQVA 1ZMLA 2Z3DA 1WTHD 4RKJB 1P2KA 4YLQH 5DP6A 1GJDB 4O9VA 1K1IA 1MAXA 3EDXB 1RIWB 1IHTH 1GHYH 1O5EH 1WAYB 2BDAA 2QV1A 4X1PU 2BD4A 3IITA 3HPTB 1P10A 1NRPH 2RG3A 3RC5A 1V2ST 3U1JB 1TOMH 2WPLS 1C1QA 1TIOA 1MMJN 2V3OH 3PTNA 5F8XA 3OU0A 1XVOA 1MCTA 1MU8B 1XUJA 1V2QT 1TNJA 1QL8A 5E0GA 3E3TA 2ZU2A 4IMQA 1LHDH 3GYLB 2PHBA 2BDYA 1CA0C 1QB9A 3T26A 2PGQB 1SLVB 4GAWA 4Y11E 1KDQA 1ELFA 4YO9A 5JYIA 1SI5H 1O2PA 3KQDA 3PO1C 2G8TA 2XXLA 1D4PB 1QBNA 5FCRA 2ZECA 5TJXA 3H7TA 5L2ZH 3QK1A 1AVWA 2BLQA 2ZFFH 4GLYA 1O2SA 4AB9A 2PSYA 2PKAB 1EAWA 4JCNA 2XBWA 5A0BA 3V7TA 3TITA 4K8YA 1UTQA 5EGMA 4F4OC 5IYTA 4I8LA 1JWTA 1GMHF 2VB0A 1NPMA 1P9SA 1KXAA 2PGBB 1EAIA 1EATA 2A5KA 2OC7A 4BAQB 5B6OA 4FUJA 1Y3YA 2Q6DA 1YPGH 1CVWH 4UE7H 1O2IA 1V2LT 1O2TA 2ZKSA 1CGIE 1XVMA 3PTBA 4K60A 3GCTF 5GCHG 1FJSA 1UK3A 8ESTE 2Z9IA 3SNCA 1HBTH 3BTTE 1CO7E 2XTTB 3GCHB 3K6YA 1QA0A 1O2KA 2UWOA 1E34B 2ZHQH 1EAUA 1QQ4A 2VNTA 3TK6A 1PPFE 3FZDA 1NRNH 5DPAA 4XFQA 1ZHMA 1DVAH 2BXTH 2AIQA 4INKA 4JZFH 3U9AH 1TRMA 4ABEA 2B0FA 3UUZA 4NFFA 5G4BA 2BXUH 4DJZB 1ZLRA 4IMZA 1V2VT 1AZZA 2C93B 2V35A 2VH0A 3M3TA 3SBKA 2AIPA 4X8TH 2FXRA 3VEQB 4OGYA 3LJJA 5DP9A 2STAE 4M7GA 4ZKNU 1A4WH 1GHBF 1QJ6B 3D23A 4LK4A 1ELDE 1XKBC 2FOMB 5DGJA 1DFPA 2XBYA 4B2AA 1BITA 1BTXA 2ZP0H 1SLXB 4WMEA 2KAIA 2BD8A 1YCPH 3SU5A 2FEQH 1LHEH 1PQAA 4AGKA 4NGAH 3P8OA 2YNBA 4J2YB 1K22H 3M5MA 1GL0E 1K1PA 2GT8A 3SN8A 2AYWA 1DOJA 2QA9E 2Y6TA 1ANBA 2GDDA 1O2UA 2GZ7A 1UK2A 1FY8E 4X2XA 1T4VH 1TONA 1O35A 1BCUH 1UCYK 1SMFE 2G51A 3QGNB 3RXTA 3BF6H 2BDCA 1KXBA 1PYTC 3RUOA 3UREA 3OX7U 4KGAA 3D49H 1C5QA 4KP0A 4ISNA 1SC8U 2BD2A 2ZIQH 3GCNA 3S9AA 4BNRA 1ZGVA 1W7GH 1FMGA 2OQ5A 2AERH 1SGPE 5T6DA 3U8RH 1GBFA 1TE0A 2ZU5A 4K1SA 2ALVA 2FLRH 1P06A 1RD3B 1BRCE 2QXJA 2ZFSA 1S83A 3EA9A 1MTVA 3U8TH 3RDZA 1M9UA 1HNEE 2ZDMA 1UTJA 4CHAC 3GDVA 2ZCHP 5IDKA 1PQ7A 1P2JA 1SG8B 4E06H 1EUFA 1F0UA 5K7RA 4MPXA 4KKDA 1A0HB 4D9QA 1O2HA 1BTHH 1AD8H 1BTPA 1VITF 1UVOA 2GV7A 3M7UA 1C5OH 3M35A 1SFQB 2SGFE 1QQUA 1Z8RA 5GXPA 3ZVGA 3NKKA 1LHFH 4MNWA 3JZ1B 4A5TS 4CR5A 3SU1A 1F5KU 2CJIA 2UWPA 2ZU3A 3TH3H 1KDQB 1XUKA 1DWEH 1RFNA 1F5RA 1AE5A 1JOUB 1SSXA 1ZSJA 2Y5GA 1ELGA 1Y59T 2OP9A 3EQ0H 4D7FA 2XC0A 4CBNA 1E0FD 1FY3A 2J9NA 3MH6A 4Q2KA 2WINI 2BD7A 4VGCC 2LPRA 3LC5A 4TPYA 2HVXA 2BMGB 5F8TA 2A7CA 4NIXA 2WUBA 1GCDA 2B9LA 1QCPA 1GWAA 2ZGJA 3T29A 1EP6A 2HRVA 3KL6A 4D7GA 1ZMJA 3RU4T 1J8AA 2SNWA 1QNJA 3D65E 1W3CA 2BZAA 4JMYA 4FUGA 4NFEA 2WV4A 3PLKA 3ITIA 1GI2A 1AQ7A 2B7DH 4UONA 1YPEH 1NN6A 3P6ZB 4X0WU 3RXVA 2P3TB 4SGBE 1G3CA 3BTKE 1DY9A 2P8OB 2XNIA 4NIYA 1K1JA 1K2I1 1UVTH 2AFQB 4ZXXH 1GBCA 1TQ7B 1C4V2 4B1TA 3UOUA 2XWBI 4BTTB 2Y7XA 1Z8GA 4UFEH 4ZKOU 4X8UH 5AF9H 2GX4A 1BMLA 1JRSA 1FDPA 1O5BB 1C1PA 1TQ0B 1BBRH 3ZVCA 1O3PB 3RLYH 5JBTA 3T25A 3WY8A 4FVDA 1C5VA 3M5LA 1D3PB 4ZKRU 4ESTE 3BN9A 3V0XA 1SGNE 1O38A 3KGPA 4LOYH 1BMAA 1ZGIA 1SHYA 1CHOG 1OXGA 2BQ7B 3A86A 5DJ7A 3UFAA 4CRDA 1UVSH 3MO9A 1O2MA 2QY0B 1L2EA 1H9IE 4THNH 2KAIB 1GMCG 3TLOA 1CT4E 4ABFA 1N8OC 3RXEA 1A0JA 2XC4A 1AHTH 4I33A 3A7WA 2C4FH 2FM2A 5L2YH 1AWFH 1EXFA 1OYTH 5CHAB 2XYAA 2TGAA 8LPRA 2H2ZA 1ID5H 4CBOA 4FUEA 4IS5A 2W7SA 1T7CA 1XXFA 1KXEA 1K21H 4Y7BA 6CHAC 4TY6A 1D9IA 5LPEA 7ESTE 1EQ9A 1W14U 2P3UB 2SGQE 4TWYA 8GCHF 4NZLA 1GI1A 2NU1E 1TPSA 5EODA 1TNLA 1CGJE 3DUXH 1HJAC 4O97A 1YCPK 2P59A 2F9OA 1GVZA 3UWJH 2ULLA 2AGGX 1PQ5A 3B9FH 1O31A 3QTOH 3TJVA 1UVPA 3UNRA 2OTVA 1UTOA 1SGEE 1UMAH 1EASA 3BTEE 4AGJA 1PQ8A 4TPIZ 4TYDA 1HAOH 3ZZAA 3UR6A 5CMXH 4U30A 1OS8A 4AFZA 4JZIA 1RTLA 3UTUH 1O3JA 3BG4C 4HFPB 1AB9C 4XBBA 3UY9A 2ZCKP 1BA8B 1YCPM 4HTCH 4UFGH 1THSH 4K3JA 2IOTA 1O2OA 3MOCA 2O8MA 1JIMA 1P12E 4WMFA 1TX8A 2H1UA 2ZGCA 1LHGH 2YOLA 1HAZB 4CRGA 5L30H 1FY5A 1DITH 3TGKE 4FUFA 2FOCA 2RA0A 4KTSA 3N7OA 3VB5A 3BTQE 1ZSLA 3SV7A 3UWIA 4ZH8A 1CT0E 1EZSC 3E0NB 2FS8A 4MPVA 1CA0B 4WH8A 1L0ZA 2R0KA 1F5LA 1G32B 1AMHA 1NROH 1DWBH 1NO9H 1C4U2 1O30A 4B2BA 1FN8A 1SQAA 1THPB 2OD3B 3SJOA 4ZROA 4AN7A 2VJ1A 2Y5FA 4ABJA 1GHXH 3F9GA 1G2LA 1PYTD 1DICA 1O3EA 1ARBA 2JH5D 3SU3A 2BD9A 2Z94A 4TY7A 1TNHA 1DM4B 1P2IA 1BTUA 1ELVA 3PYHA 1TPPA 4GCHG 3A7VA 4Y8ZA 1O3KA 1UVUH 3SGBE 7GCHG 4CRBA 1AIXH 1J15A 5F6MA 3ATKA 3QZRA 1F0SA 1ZPZA 4IGDA 3V12A 1YPJH 1NU9A 1CE5A 4FUBA 6GCHF 3HK6B 1QY6A 3GDUA 1V2NT 1GBBA 1GL1A 1MUEB 3NCLA 1GHZA 1O3MA 3ZZ4A 1GI5A 2G4UA 1SGFA 3PMAB 1C4Y2 1YC0A 1S82A 3A83A 5HXFA 2CN0H 3ATIA 4B75A 2GCTC 1P3CA 2FP7B 2V3HH 3GOVB 3BG8A 3GICB 1C2LA 1FPHH 3MO3A 3MU4A 5A8ZA 2ZDNA 5C1YA 2VVUA 1W13U 1ZPCA 2Q6GA 1GG6B 3KQBA 3KQCA 1W8BH 1TALA 1V2KT 4ZXYH 3VB6A 2VWLA 1AFQC 1AO5A 5DP8A 2PSXA 2VIOA 2ALPA 2H9EH 1QRWA 1MKWH 4XOJA 1JMOH 2O8LA 1WBGB 2BDGA 4FUCA 3M37A 3SV9A 3GY6A 3RXRA 1C1WH 2H5DA 1TX6A 3M7TA 1THRH 1TGCA 1BBRK 2AEIH 3LDXH 3BSQA 1KXCA 4DVAU 1TLDA 3L3TA 4Y7AA 4TWWA 1VGCC 1INCA 2OC0A 3A89A 5FCKA 1GI6A 4WJG2 2FOFA 3E0PB 1FIZA 2ZGXH 1IAUA 1EPTC 3VB7A 1P2MA 2NU4E 4DCDA 1LPZB 1C2MA 1MZDA 1YPHC 1AI8H 1Y3XA 2YNAA 3RU4D 2FTMA 4KELA 4DIIH 5C1XA 3QN7A 4X8VH 5F8ZA 1V2PT 1OWDA 3CENA 3O8BA 4U32A 3NWUA 1QR3E 4INHA 1HIAB 2GCHG 2HPQH 3QUMP 1HGTH 1G9IE 1KYNA 1FPCH 3F9EA 1WUNH 1YPMH 1ZZZA 2OXSA 2BX4A 4R8TB 3MMGA 1L4ZA 4WF8A 1S85A 1Z7KA 2ANWA 1ZTKA 3L6PA 4NSYA 2UUJB 1J16A 2ZDVH 3RXLA 1GJCB 2FI3E 1T8MA 1EJNA 2IN2A 4Q7ZA 3TK9A 2B5TB 4AOQA 5JB9S 1NZQH 1ZJDA 1HYLA 1CGHA 2GZ9A 4B74A 4Y79A 2J94A 1H1BA 1FAXA 6LPRA 1BOQA 1V3XA 5FX6A 4OGXA 1UTLM 1O5CB 2W26A 1O2XA 1O3DA 2ZA5A 3GY5A 1QURH 1D3DB 3L33A 1O2YA 4Y0YE 1ETTH 3A85A 3A84A 1KY9A 2OQUA 1Y5UT 3PM3A 2QN5T 1Y5AT 1WOFA 3RXKA 3SW2B 1TBQH 4LXBH 4BAKB 2ZGBH 4UDWH 3F9FA 1C5MD 3VB3A 3RMOH 1GHAG 2ASUB 1LPGB 2VVVA 1Y3WA 4GVUA 2AS9A 1OWIA 2BTCE 2WV5A 3F6UH 1GVKB 3KNXA 2A32A 1ZRBA 2FMJA 3TNSA 1ELTA 1GGDC 3KHVA 3SGQE 1TYNA 2GMTC 7KMEH 4ISLA 1WV7H 4B73A 1HUTH 1K28D 3TJUA 1P01A 3ATMA 1BB0B 1UTKA 1GBIA 5EXNA 5FXLA 4X1RU 4ZHAA 4VGCB 1NRQH 1QB1A 2C8ZB 3FP8E 5CE1A 1W7XH 1O2NA 2A1DB 2PV9B 2A7HA 3B8JA 1FNIA 2ZPSA 3MWIU 3SV2H 4FUHA 4K69A 5GCHF 2QF3A 2FTLE 2NWNA 3PLBA 1NY22 5DK1A 1KSNA 1GDUA 2C8XB 1RRKA 4HGCA 5A09A 1ZRKA 3A7ZA 2A7JA 1C5PA 2CF8H 1SGIB 3LGTA 4K8BA 2VWOA 1DT2A 1GBHA 5TCAA 2J4IA 1OYQA 2BY9X 5HYOA 1O33A 3E91A 3U1IB 2O9QA 1GI8B 1EP5A 1MBMA 3E90B 3LGVA 4ASHA 1U6QA 1NFWA 1LQDB 3Q3KA 3TNTA 3F1SB 4X2YA 1GDQA 1UCYE 2VGCC 2VU8E 2SGPE 5JBBS 1ZHPA 1MTUA 5EOKA 3S9CA 3LKWA 4B2CA 1O2WA 1YPHE 1PPHE 5DO4H 3UQOA 3M3VA 1E37B 2H6MA 4K5ZA 5FBEA 3T2NA 2R3YA 1GI7B 1YLDA 4ABBA 3SI3H 3HGNA 3GY4A 3EYDA 2XWAA 4Z0KA 2IPHA 3ZVEA 1G36A 4ABGA 1A7SA 4LZ1H 1FIWA 1LTOA 4AG2A 1N8OB 2HOBA 1QIXB 2G00A 1SGQE 2C8YB 3LC3A 3A8CA 3KEEA 4MQAA 2CXVA 4BAMB 3A8BA 1ANCA 1SB1H 3FANA 2SGDE 1BRUP 1O2RA 3KIDU 4JYTA 1C5NH 1GCTB 1UK4A 2CHAC 1F0RA 1BJUA 2H9TH 6CHAB 2R2WU 4HZHA 5C1UA 2OINA 3BTGE 2DE9A 1MKWK 3SHAH 3LONA 1ZTLA 2F3CE 3HATH 1AGJA 1BQYA 2ZHDA 2W3KA 4MG3A 1ETSH 4MDSA 4J1YA 4OS7A 1UTNA 1VCQA 1HJAB 1C5ZB 1SGCA 2ZTZA 4OS1A 2VIQA 1EB1H 4Y0ZE 1BT7A 3PWBA 3RP2A 1VZQH 3LGIA 1B0FA 1HV7A 3AW0A 4MNXA 4WXVA 3U8OH 2ZFRH 4FXGH 3RLWH 1O5DH 4AZ2B 2VWMA 5PTPA 2B8OH 1TMUH 2ZTXA 1IOEA 3QTVH 1A1RA 1LQEA 2FZZA 3UNQA 1MTSA 2JH6D 2G52A 1T8NA 2XW9A 5F03A 1GBTA 4AYVB 4AYYB 3BG4B 5ESTE 2BLWA 5A0CA 3RXAA 3MO6A 1SL3A 3TK5A 2Z3EA 3A7XA 1O5FH 4NG9H 3RXGA 2SNVA 3HK3B 5T6FA 1S0RA 2BDBA 5GDSH 5FPTA 1Z6JH 1LVOA 2FOBA 1FQ3A 3RXHA 3SJ9A 1GJBB 2NU3E 5L6NH 1WQVH 2GP9B 4NA8A 1TOCB 2JH0D 4I8JA 1WU1A 4GSOA 2G81E 4IW4E 1QRXA 1GBDA 1EZQA 1EAXA 1E35B 1EZUC 2QCYA 3KQEA 2JETC 2EI8A 3TJOA 3GDSA 3HGPA 1YPLH 3KCGH 1LVMA 5AHGH 2FOGA 2PKSB 3BTME 3LPRA 1GMDG 4ISOA 4DY7B 3UR9A 1UTPA 1Y8TA 1GJ6A 1N6YA 3T28A 1OWJA 4NCYA 2DUCA 4JYVH 4UFDH 1T8LA 2AMDA 1ZPBA 5GPIB 4WWYA 3ZZ8A 2A5AA 2VIDA 1O32A 1JIRA 2PFEA 4ZUHA 1DY8A 2Y80A 1BDAA 1C1SA 1C1UH 2WPHS 3NZIA 1YYY1 1VCWA 1TBRH 3P70B 3TPIZ 1BIOA 4E7NA 1C1VH 2BD3A 3R0FA 4GHTA 4MTBA 1F7ZA 4Y6DA 1P2NA 2BZ6H 1TWXB 1IQEA 1BJVA 3AAVA 5E0JA 4U01A 3SU0A 5A0AE 4YZUA 5I25A 2Y7ZA 5K0HA 2AGIX 2XRCA 2UUKB 2TGDA 2ZNKH 1PPCE 2AH4X 5DP5A 1ZR0A 4CRAA 1L4DA 2R3UA 3TGJE 5JBAS 1TMBH 2BLVA 3HKJB 1BHXF 2FWWA 2GCTB 3T5FH 1G2MA 1IQMA 1YPKH 4UD9H 3QX5H 3JZ2B 2FS9A 1HAXB 5E2OA 2ODPA 3F9HA 2Q6FA 1CHOF 2ANKH 4K1TA 1A3EH 1QGFA 2HNTC 1TRNA 1AFQB 1GMCF 3VGCC 3SU4A 5EU8A 3ZZDA 2ZDKA 8KME2 4A1VA 3LT3A 1ELCA 3BTHE 4PROA 4RN6A 4Q7YA 1KIGH 2WYJA 3DD2H 1YKTA 3DFLA 1ELEE 4RSPA 1YBWA 5AFYH 2XBXA 4X1SU 3O8CA 1C1TA 2A4QA 5AVDA 1RJXB 4DG4A 3A88A 3TH4H 2P3FH 4I8GA 1KXFA 4IBLH 1O39A 1VGCB 2F9NA 1Q3XA 1ESTA 2RDLA 3G01A 3LGWA 1V2JT 1T4UH 1DPOA 3E8LA 1NESE 1SPJA 1RGQA 1V6DA 1P02A 3OTJE 2BY8X 4DGJA 1EPTB 1GJ5H 3SNAA 1HIAA 3BEIB 2ZO3H 2ODYB 1XM1A 2W7UA 1OP2A 3BTDE 4X6PA 1MAYA 1P09A 1ANDA 3A7YA 4O03A 2WPJS 1YF4A 4GUXA 1V2UT 1AE8H 3RXOA 4AB8A 4H6TA 5JBCS 1RS0A 2A45B 1O2JA 3PMBB 3S69A 1YLCA 2W3IA 2ANMH 1XUIA 2FI4E 1QBOA 3M61U 1OOKB 4MNVA 1ESBA 4A6LA 3SJ8A 2K1QA 1CT2E 1L1JA 2ZZUH 2BYAX 3PMJA 4Y8YA 2PTNA 4XBDA 3EE0B 2C90B 2A2XH 3SGAE 3FP7E 2A4GA 4AFUA 4KTCA 3A81A 1WTGH 2DE8A 1HJ8A 1Z8IB 1JXPA 1FUJA 3RXQA 3SUGA 5LPFA 3S9BA 1EJAA 1J17T 1SVPA 3AW1A 2ZCLP 4I32A 1ZJKA 1FZZA 1K1OA 4X8SH 3PO1B 2ILNA 1QRZA 4DURA 2BQWB 4I8HA 1TNKA 4AORA 1C9PA 4OS2A 2D1JA 4H6SB 1Z6EA 1IHSH 2ZFPH 1C2GA 2FLBH 3QO6A 3EA7A 1SFIA 2ESTE 1S84A 3MH4A 3SUFA 1FAKH 2P95A 1J14A 1HDTH 4ZAEA 5EXMA 3SJIA 1GGDB 1OSSA 4BTUB 1HAYB 2BQ6B 1TGSZ 2UUFB 5DG6A 4WXIA 4GCHF 3SU2A 3IWMA 1ZYOA 2G5VA 2HNTE 1TFXA 5E2PA 7GCHF 1Z1IA 2XCFA 5A8XA 3MYWA 4WH6A 1IQHA 1BMMH 1O3CA 5C20A 2R2MB 3S0NA 1ELBA 3GY3A 3Q3YA 1SR5C 1C2DA 1D3TB 1F2SE 3ZZ6A 1HPGA 2BY5X 2VWNA 2HGTH 3MFJA 2GTBA 2RCEA 2Z9LA 1BBRE 1GBAA 1VCPA 4CRFA 3V13A 3SNDA 2R0LA 3ZVAA 2ZGHA 2LNCA 3H7OA 3MNXA 1QJ7B 2M5TA 3Q3XA 4XSKU 4ISIH 1L1NA 3PB1E 1VR1H 9ESTA 1DLKB 4FUDA 1LVBA 1ETRH 2FX6A 1W11U 1P2QA 1SOTA 2ZFQH 3ZZ9A 2QXHA 5JPMH 3PLPA 1S5SA 1HAVB 1TGBA 1G30B 1TMTH 2J92A 2BY6X 3RXUA 4HI3A 5J4QA 1QA7A 1IQFA 1LDTT 3RXCA 1TBZH 1AY6H 3MNCA 3MNBA 5A2MH 3E6PH 1W10U 4MPWA 3LGUA 2GD4B 2C3SA 1O3FA 3MI4A 1G3BA 3ODDA 3SJKA 3I29A 3ZVBA 4A1TA 1DSUA 5BPEA 3O8DA 3EA8A 3BIVH 2ZPRA 1E36B 4X2VA 1AN1E 3LH3A 3ZVDA 4A1XA 5H4IB 2BY7X 1X7AC 4ISHH 2CHAB 3B23B 1TX7A 1XUFA 1NC6A 2XBVA 2PUXB 2FYRA 2WPMS 2F9VA 1QL9A 3KF2A 1CSOE 2ANYA 1JBUH 4ZHMU 2FOAA 3D62A 4X6OA 4BAHB 2F9BH 1K9OE 2TGTA 1CU1A 1TGTA 2GCHF 2H9HA 1O3AA 3KN2A 5GIBA 5C2ZA 1K1MA 5EPYA 1TABE 1A46H 2SFAA 3SO3A 4OS5A 1AKSB 1AU8A 1KTSB 1LVYA 1V2MT 1Q2WA 3OSYA 1XX9A 2A4OA 1P0SH 2OBQA 3EGKH 1GPZA 3RM0H 1S81A 9LPRA 3BV9B 2BLOA 3ESTA 2VH6A 1DUAA 1FONA 4CHAB 2C8WB 2OCVB 2FDAA 1GI9B 2PUQH 3SHCH 2XC5A 4Y8XA 6ESTA 2TRMA 4NWLA 1PPBH 1IQJA 1V2RT 4YT7H 1VJ9U 5GJ4B 4D9RA 2V0BA 3OYPA 3I77A 1SHHB 3MNSA 2PW8H 2ZPQA 3RXSA 2BVRH 1WSSH 2GV6A 1LHCH 2P93A 3FVFB 4LZ4B 5TCCA 4ZKSU 1G3EA 1H9HE 1C5UA 1OX1A 1V2OT 4DW2U 1HFDA 3LOXA 1GHAF 4IC5A 1GHWH 1KLJH 1QBVH 2J38A 4AFQA 2ZDLA 2VIPA 1P05A 1MZAA 1D6RA 3R3GB 5ESBA 3RXPA 1HJ9A 3STIA 4E05H 4ZMAH 1DWDH 2JETB 1SLUB 1A61H 1BMNH 1GI3A 3K2UA 3PV4A 4JZ1A 1LMWB 4KTUA 4WY3A 1GMHG 2FPZA 3RC4A 2OC8A 1DANH 3NPSA 4NA9H 2QC2A 3A80A 5DP3A 4BXWA 3TH2H 3LH1A 3SORA 1PJPA 3GCTG 1T32A 2FX4A 1Y3UA
chains in the Genus database with same CATH superfamily
1WQSA 1K1LA 1LCYA 4FVBA 1FI8A 1O5GH 3UOPA 2GDEH 2RA3A 4Y76A 4DOQA 2ZHFH 2P16A 1P3EA 1Y3VA 2QXIA 3P8NA 1MTNC 4SGAE 5B6LA 2D8WA 1MU6B 1SGRE 3Q00A 2ZHEH 2ZQ1A 1S6FA 2FI5E 4XRNA 4ABIA 4X1QU 2BD5A 2BM2A 4NIWA 1BHXB 3BTWE 5FHTA 3ZV8A 3C1KA 1A5HA 2Q1JA 4AX9H 4OS6A 1P04A 1XKAC 2OUAA 3P92A 1JRTA 3MH7A 1H4WA 1MQ6A 2Z9GA 3SUEA 4CREA 5ABWA 1GHBG 1O36A 1GG6C 2GVFA 4GHQA 1DWCH 1EKBB 1H8DH 1DE7H 1O2ZA 4I8KA 4CR9A 1GJ9B 2H5CA 2VINA 2XNDD 3H5CB 3M5NA 2O8TA 3RMNH 1V2WT 2ZFTA 3A8AA 3RXFA 5E0HA 1MQ5A 2FOEA 5ETXA 5C5OA 1GHVH 2RDEA 1C1OA 3UNSA 3A82A 4ZHLU 4BANB 1ANEA 1C2KA 4CH2B 2BDHA 3DCLA 3MHWU 4BOHA 2NU2E 3VGCB 2FIRH 2FOHA 3A7TA 5JDUB 3GYMA 3VB4A 4Z6AH 4YTAA 4BTIB 5E8EH 1AFEH 1Y5BT 4OS4A 5KECA 3AVZA 1C2HA 4ABDA 1G37A 1CBWC 1V2TT 2BHGA 3QLPH 1KLIH 1VITH 2O8WA 5HM9A 4YOIA 2D2DA 1EPTA 2G4TA 2PLXA 3RXDA 4O3TA 1QJ1B 3M5OA 4GPGA 3ZVFA 3CS7A 3LGYA 2EC9H 1C1MA 1P8VC 2ZI2H 3SOSA 1FY4A 1WYKA 1O2LA 5EW1H 5FBIA 5LH8A 2HWLB 1FX0B 4QT8C 4BAOB 4Z1MD 1ZOMA 1FXYA 5BRRE 1T8OA 5FPSA 1RIWC 1AZ8A 4YOJA 2BOKA 1DDJA 1W12U 1HXFH 3E1XB 3MTYA 3P95A 4X6MA 2HPPH 2JJ2D 2HALA 2Y5HA 1C1NA 1A5IA 1AVGH 1AB9B 1T31A 2FESH 2ZU4A 4I31A 4RKOB 1BMFD 2EEKA 1UJ1A 1VJAU 3DHKH 1W0ZU 3UIRA 1Z71A 5EW2H 1A5GH 2F91A 5C17A 1O3NA 1OWHA 3M7QA 1O2GH 2G55A 1VITG 2ZF0H 1N6XA 3C27B 3LJOA 4JK6A 3AAUA 1L1GA 4FETA 3SNEA 1HCGA 1C9TA 1GI0A 3M3SA 2A4RA 4I7YH 4O3UA 3SQHE 1ABJH 5FL7D 1PPZA 1ABIH 1HAIH 1C5XB 2QF0A 1XMNB 1NS3A 3WWFA 2BX3A 5DSFA 1GJ4H 4NWKA 1ORFA 2HLDD 1O37A 3LIWA 3VPKA 3AASA 3W95A 1SGTA 5T6GA 3T27A 1TPOA 1GVLA 3PWCA 5DKMA 1EB2A 1OKXA 3QZQA 1J9CH 3RC6A 4DIHH 1TGNA 2NU0E 3QGJA 4D8NA 1NRRH 1MKXH 4FU9A 1GMDF 3P8GA 2EQNA 3ZZ5A 1C2EA 1CA8B 4D76A 1LKBA 3ZZ7A 2VVCA 1O34A 4B71A 5EG4A 4DT4A 1HXEH 1C5SA 2FODA 4ABHA 2CGAA 3Q77A 5FAHA 1ESAA 4Y71A 4A92A 3GCHC 1C5YB 2GT7A 1P03A 2JKHA 4JZEH 3SI4H 4XBCA 2F83A 4Y10E 3K65B 4NIVA 2VIVA 3FAOA 3FZZA 4UFFH 4YESB 5LGOA 3GCOA 1E38B 5SGAE 4FU7A 4MVNA 2FYQA 1CHGA 1W0YH 4RI0A 1HAPH 2A0QB 1NT1A 4WMDA 3SU6A 5LPRA 1Z1JA 2QAAA 1C1RA 1P57B 2GKVE 1A0LA 3BTFE 1TPAE 1HRTH 2EI7A 1TNIA 2BVSH 5C3NA 1GI4A 1SGFG 1QTFA 2TPIZ 2ZTYA 3ELAH 1C5WB 5I46H 1C2JA 2QGRA 1HAVA 1E79D 2OLGA 3RXMA 4A7IB 4IN1A 5DP7A 1LKAA 3O8RA 1A3BH 1OWEA 2R9PA 3UB0A 3U28C 4CRCA 2F9PA 1QHRB 1C2IA 2Z9KA 4UEHH 4K1EA 4Q80A 1EX3A 4H42U 1ELAA 1O5AB 1HB0B 2Z3CA 1BTZA 1O3HA 3SZNA 4E7RG 1DX5M 4X6NA 2CV3A 4YOGA 1H9LB 3CP7A 3M36A 2WYGA 2THFB 1SOZA 3A87A 3MH5A 4JK5A 2I6SA 2ZC9H 1UHBA 2V6NA 2GZ8A 2M2AA 1D3QB 2HNTF 2Z9JA 1KTTB 3MU5A 1O2QA 2J2UA 2ZG0H 3F2GA 1TA2A 2PTCE 1ARCA 2FO9A 2WUCA 2Z7FE 3A8DA 1IQNA 3QDZB 3GISB 1GCTC 4XDEA 1ZSKA 2AMPA 4INLA 1F0TA 8GCHG 3TGIE 3URDA 1GBEA 2AGEX 4AFSA 1O3OA 4JZDH 2P94A 1DS2E 7LPRA 4YLUA 1MBQA 3TU7H 3ZZCA 1WCZA 4XE4A 1OP0A 3VXEH 1XXDA 1H8ED 4IN2A 3ZYDA 1GDNA 1MD8A 1C2FA 1TNGA 1B0EA 1QL7A 1SGYE 4X1NU 2PWXA 1AKSA 1YM0A 1HAGE 3RXJA 5EQQA 1EOJA 1YGCH 1FN6A 5HGGA 1SBWA 2IJOB 3GY8A 3PRBA 3VG8A 5EQRA 1A2CH 2UWLA 1D6WA 1SQTA 2WHXA 4F49A 4H4FA 1TRYA 3ZZ3A 1QZ8A 2TBSA 2STBE 3SUDA 2ZHWH 1ACBE 2CF9H 1PPEE 1ZHRA 1OWKA 4K2YA 1AWHB 2BDIA 4ACBA 1AUJA 3S7HB 3FP6E 5HMAA 3TIUA 1LPKB 2Y82A 4MLFB 3SV8A 1EJMA 2SGAA 2F4LA 3Q76A 1FLEE 1RTFB 2ZQ2A 3EAJA 1SGDE 1TAWA 3FFGA 3RU4E 2ZEBA 5A8YA 1TB6H 2QXGA 3F68H 1NFXA 4R0IA 1K1NA 1O3BA 4JYUH 4YM9A 1GBKA 3U69H 4ACAA 1P11E 3RXBA 3MU0A 1QFKH 1C5TA 3P17H 2AMQA 2PKAA 4ABAA 3ENSB 3VXFH 1N1LA 1Q31A 2PKSC 3QWCH 1F92A 1G3DA 1Z8JB 1DSTA 1LO6A 2QIQA 1EFRD 2GMTB 2OBOA 4YT6H 2ZU1A 3K6ZA 2XCNA 1PPGE 3MU8A 3VFEA 2PR3A 4NSVA 2A5IA 1AUTC 4MPUA 4ZCNA 1YP9A 3GY7A 4AC9A 5AFZH 3F2FA 2LELA 3V3MA 5HIZA 3T62A 1NU7B 2A31A 2WPIS 1NFUA 3K9XB 2J98B 2P8OC 3E16B 3RMMH 1S6HA 2BOHB 1BUIA 2EA3A 3DFJA 6GCHG 3UPEA 1BRBE 5EXLA 1IQLA 1GJAB 1NM6A 3P8FA 3HKIB 3IG6B 1RTKA 4Q7XA 1SLWB 3I78A 1EZXC 1FY1A 1O3IA 1OP8A 3NXPA 3NK8A 4IC6A 4AG1A 1MKXK 1QB6A 1GJ8B 1XUHA 3ATLA 1HAHH 3OY6U 1GBMA 1UO6A 5C5NA 1MTNB 5EQSA 2CMYA 1DXWA 4B76A 2GGVB 1NRSH 1K0HA 3ATWA 2ZDAH 1O3GA 1S0QA 2QYIA 1OPHB 3S7KB 3BEUA 2VGCB 2TGPZ 1NTPA 3TJNA 4CH8B 1GBJA 3DA9B 4NA7A 5FPYA 2BVXH 1UCYH 1BRAA 5DP4A 4U2WA 4DT7B 5J4SA 4FU8A 1B5GH 3ZYEA 2J34A 1C5RA 2Z6BD 1O2VA 3MU1A 3OE7D 1DUEA 5CHAC 2EI6A 3TVJB 1W2KH 3BEFB 4WVPE 5FX5A 4NZQA 2BB4A 1TA6A 3ZV9A 1WDIA 3ZZBA 1MD7A 5EJZA 3GY2A 5T1VA 1NFYA 1PFXC 1UHBB 2TIOA 1BZXE 3RM2H 3PMHB 1MH0A 1XUGA 2VIWA 3OY5U 2Y81A 5HM2A 3NUMA 1C5LH 1O0DH 2A2QH 2ZWLH 4BXSA 2D26C 1KLTA 1ZTJA 1BTWA 4MNYA 3WWBA 1UTMA 5T3HA 2G5NA 1O3LA 1P2OA 3W94A 1KXDA 4FUIA 3PROA 2WPKS 1FV9A 3URCA 1MCVA 2F9UA 3STJA 3U98H 1H8IH 2W5EA 1IQGA 3LU9B 1CBWB 1DXPA 4I86A 3DT0H 1SQOA 1IQIA 3CS0A 1MTWA 1B7XB 2I6QA 5EPNA 1P9UA 1EOLA 1HLTH 1AVXA 3RXIA 3SZEA 1BTYA 3SV6A 2J95A 2HLCA 1GJ7B 4X2WA 3RMLH 2OC1A 2ODQA 5JB8S 1CQQA 1RXPA 3SNBA 2SGEE 5C67A 4TSFD 3ODFA 1GBLA 2KCPA 2UUYA 3BIUH 3SQEE 1DLEA 1IQKA 1ZMNA 5GWZA 2O8UA 3UQVA 1ZMLA 2Z3DA 1WTHD 4RKJB 2J5UA 1P2KA 4YLQH 5DP6A 1GJDB 4O9VA 1K1IA 1MAXA 3EDXB 1RIWB 1IHTH 1GHYH 1O5EH 1WAYB 2BDAA 2QV1A 5HIYA 4X1PU 2BD4A 3IITA 3HPTB 1P10A 1NRPH 2RG3A 2JIZD 3RC5A 1V2ST 3U1JB 1H8HD 1TOMH 2WPLS 1C1QA 1TIOA 1MMJN 2V3OH 3PTNA 5F8XA 3OU0A 1XVOA 1MCTA 1MU8B 1XUJA 1V2QT 1TNJA 1QL8A 5E0GA 3E3TA 2ZU2A 4IMQA 1LHDH 3GYLB 2PHBA 2BDYA 1CA0C 1QB9A 3T26A 2PGQB 1SLVB 4GAWA 4Y11E 3EE7A 1KDQA 1ELFA 4YO9A 5JYIA 1SI5H 1O2PA 3KQDA 3PO1C 2G8TA 2XXLA 1D4PB 1QBNA 5FCRA 2ZECA 5TJXA 3H7TA 5L2ZH 3QK1A 1AVWA 2BLQA 2ZFFH 4GLYA 1O2SA 5EJLA 2PSYA 4AB9A 2PKAB 1EAWA 4JCNA 2XBWA 5A0BA 3V7TA 3TITA 4K8YA 1UTQA 5EGMA 4F4OC 5IYTA 4I8LA 1JWTA 1GMHF 2VB0A 1NPMA 1P9SA 1KXAA 2PGBB 1EAIA 1EATA 2A5KA 2OC7A 4BAQB 5B6OA 4FUJA 1Y3YA 2Q6DA 1YPGH 1CVWH 2CK3D 4UE7H 1O2IA 1V2LT 1O2TA 2ZKSA 1CGIE 1XVMA 3PTBA 4K60A 3GCTF 5GCHG 1FJSA 1UK3A 2V3MA 3AK5A 8ESTE 1W0JD 2Z9IA 3SNCA 1HBTH 2IJD1 2QF4A 3BTTE 1CO7E 2XTTB 3GCHB 3K6YA 1QA0A 1O2KA 2UWOA 1E34B 2ZHQH 3F3BA 1EAUA 4RT0A 1QQ4A 2VNTA 3TK6A 2OK5A 1PPFE 3FZDA 1NRNH 5DPAA 4XFQA 1ZHMA 1DVAH 2BXTH 2AIQA 4INKA 4JZFH 3U9AH 1TRMA 4ABEA 2B0FA 3UUZA 4NFFA 5G4BA 2BXUH 4DJZB 1ZLRA 1SQRA 4IMZA 1V2VT 1AZZA 2C93B 2V35A 2VH0A 3M3TA 3SBKA 2AIPA 4X8TH 2FXRA 3VEQB 4OGYA 3LJJA 3KQ5A 1YY3A 5DP9A 2STAE 3GS9A 4M7GA 4ZKNU 1A4WH 1GHBF 1QJ6B 3D23A 4LK4A 1ELDE 1XKBC 2FOMB 5DGJA 1DFPA 2XBYA 4B2AA 1BITA 1BTXA 2ZP0H 1YWUA 1SLXB 4WMEA 2KAIA 2BD8A 1YCPH 3SU5A 2FEQH 1LHEH 1PQAA 4AGKA 4NGAH 3P8OA 2YNBA 4J2YB 1K22H 3M5MA 2YMSC 1GL0E 1K1PA 2GT8A 3SN8A 2AYWA 1DOJA 2QA9E 2Y6TA 1ANBA 2GDDA 1O2UA 2GZ7A 1UK2A 1FY8E 4X2XA 1T4VH 1TONA 1O35A 1BCUH 1UCYK 1SMFE 2G51A 3QGNB 3RXTA 3BF6H 2KR7A 2BDCA 1KXBA 1PYTC 2KX4A 3RUOA 3UREA 3OX7U 4KGAA 3D49H 2WPDD 1C5QA 2QE7D 4ISNA 1SC8U 2BD2A 2ZIQH 3GCNA 4KP0A 3S9AA 4BNRA 1ZGVA 1W7GH 1FMGA 5C0UA 2OQ5A 2AERH 1SGPE 5GNDA 5T6DA 3U8RH 1GBFA 1TE0A 2ZU5A 4K1SA 2ALVA 2FLRH 1P06A 1RD3B 1BRCE 2QXJA 2ZFSA 1S83A 2IPQX 4ASUD 3EA9A 1MTVA 3U8TH 3RDZA 1M9UA 1HNEE 2ZDMA 1UTJA 4CHAC 3GDVA 2ZCHP 5IDKA 1PQ7A 1P2JA 1SG8B 4E06H 1EUFA 1F0UA 5K7RA 4MPXA 4KKDA 1A0HB 4D9QA 1O2HA 1BTHH 1AD8H 1BTPA 1VITF 1UVOA 2GV7A 3M7UA 1C5OH 3M35A 1SFQB 2SGFE 1QQUA 1Z8RA 5GXPA 3ZVGA 3NKKA 1LHFH 4MNWA 3JZ1B 4A5TS 4CR5A 3SU1A 1F5KU 2CJIA 2UWPA 2ZU3A 3TH3H 1KDQB 1XUKA 1DWEH 1RFNA 1F5RA 1AE5A 1JOUB 1SSXA 1ZSJA 2KM0A 2Y5GA 1ELGA 1Y59T 2OP9A 3EQ0H 4D7FA 2XC0A 4CBNA 1E0FD 1FY3A 2J9NA 3MH6A 4Q2KA 2WINI 2BD7A 4VGCC 2LPRA 3LC5A 4TPYA 2HVXA 2BMGB 4P02A 5F8TA 2A7CA 3FKSD 4NIXA 2WUBA 1GCDA 2B9LA 1QCPA 1GWAA 2ZGJA 3T29A 2J98A 1EP6A 2HRVA 3KL6A 4D7GA 1ZMJA 3RU4T 1J8AA 2SNWA 1QNJA 3D65E 1W3CA 2BZAA 4JMYA 4FUGA 4NFEA 4F55A 2WV4A 3PLKA 3ITIA 1GI2A 1AQ7A 2B7DH 4UONA 1YPEH 1NN6A 3P6ZB 4X0WU 3RXVA 2P3TB 4SGBE 1G3CA 3BTKE 1DY9A 1WXRA 2P8OB 2XNIA 4NIYA 1K1JA 1K2I1 1UVTH 2AFQB 4ZXXH 1GBCA 1TQ7B 1C4V2 2L6OA 4B1TA 3UOUA 2XWBI 4BTTB 2Y7XA 3N7EA 1Z8GA 4UFEH 4ZKOU 4X8UH 5AF9H 2GX4A 1BMLA 1JRSA 1FDPA 1O5BB 1C1PA 1TQ0B 1BBRH 3ZVCA 1O3PB 3RLYH 5JBTA 3T25A 3WY8A 4FVDA 1C5VA 3M5LA 1D3PB 1NBME 4ZKRU 4ESTE 3BN9A 2KCAA 3V0XA 1SGNE 1O38A 3KGPA 4LOYH 1BMAA 1ZGIA 1SHYA 1CHOG 1OXGA 2BQ7B 3A86A 5DJ7A 3UFAA 4CRDA 5EJ1A 1UVSH 3MO9A 1O2MA 2QY0B 1L2EA 1H9IE 4THNH 2KAIB 1GMCG 3TLOA 1CT4E 4ABFA 1N8OC 3RXEA 1A0JA 3H09A 2XC4A 1AHTH 4I33A 3A7WA 2C4FH 2FM2A 5L2YH 1AWFH 1EXFA 1OYTH 5CHAB 3DSGA 2XYAA 2TGAA 8LPRA 2H2ZA 1ID5H 4CBOA 4FUEA 4OM9A 4IS5A 2W7SA 1T7CA 1XXFA 1KXEA 1K21H 4Y7BA 6CHAC 4TY6A 1D9IA 5LPEA 7ESTE 1EQ9A 1W14U 2P3UB 2SGQE 4TWYA 8GCHF 4NZLA 1GI1A 2NU1E 1TPSA 5EODA 1TNLA 1CGJE 3DUXH 1HJAC 4O97A 1YCPK 2P59A 2F9OA 1GVZA 3UWJH 2ULLA 2AGGX 1PQ5A 3B9FH 1O31A 3QTOH 3TJVA 1UVPA 3UNRA 2OTVA 1UTOA 1SGEE 1YLNA 3DSOA 1UMAH 1EASA 3BTEE 3OAAD 1PQ8A 4AGJA 4TPIZ 4TYDA 1HAOH 3ZZAA 2VBCA 3UR6A 5CMXH 4U30A 1OS8A 4AFZA 4JZIA 1RTLA 3UTUH 1O3JA 3BG4C 4HFPB 1AB9C 4XBBA 3UY9A 2ZCKP 1BA8B 1YCPM 4HTCH 4UFGH 1THSH 4K3JA 2IOTA 1O2OA 3MOCA 2O8MA 1JIMA 1P12E 4WMFA 1TX8A 2H1UA 2AHME 2ZGCA 1LHGH 2YOLA 1HAZB 4CRGA 5L30H 1FY5A 1DITH 3TGKE 4FUFA 2FOCA 2RA0A 4KTSA 3N7OA 3VB5A 3BTQE 1ZSLA 3SV7A 3UWIA 1W0KD 4ZH8A 1CT0E 1EZSC 3E0NB 2YMSD 2FS8A 4MPVA 1CA0B 4WH8A 1L0ZA 2R0KA 1F5LA 1G32B 1AMHA 1NROH 1DWBH 1NO9H 1C4U2 5C0TA 1O30A 4B2BA 1FN8A 1SQAA 1THPB 2OD3B 3SJOA 4ZROA 4AN7A 2VJ1A 5EIYA 2Y5FA 4ABJA 1E1RD 1GHXH 3F9GA 1G2LA 1PYTD 1DICA 1O3EA 1ARBA 2JH5D 3SU3A 2BD9A 2Z94A 4TY7A 1TNHA 1DM4B 1P2IA 1BTUA 1NBMD 1ELVA 3PYHA 1TPPA 4GCHG 3A7VA 4Y8ZA 1O3KA 1UVUH 3SGBE 7GCHG 4CRBA 1AIXH 1J15A 5F6MA 3ATKA 3QZRA 1F0SA 1ZPZA 4IGDA 3V12A 3UAIC 1KMHB 1YPJH 1NU9A 2GJGA 1CE5A 4FUBA 6GCHF 3HK6B 4XD7D 2F43B 1QY6A 3GDUA 1V2NT 1GBBA 2WSSD 1GL1A 1MUEB 3NCLA 1GHZA 1O3MA 3ZZ4A 1GI5A 2G4UA 1SGFA 3KYFA 1C4Y2 1YC0A 1S82A 3PMAB 4Q63A 3A83A 5HXFA 2CN0H 3ATIA 4B75A 2GCTC 1P3CA 2FP7B 2V7QD 2V3HH 3GOVB 3BG8A 3GICB 1C2LA 1FPHH 3MO3A 3MU4A 5A8ZA 2ZDNA 5C1YA 2VVUA 1W13U 1ZPCA 2Q6GA 1GG6B 3KQBA 3KQCA 1W8BH 1TALA 1V2KT 4ZXYH 3VB6A 2VWLA 1AFQC 1AO5A 5DP8A 2PSXA 2VIOA 2ALPA 2H9EH 1QRWA 1MKWH 4XOJA 1JMOH 2O8LA 1WBGB 3W1EA 2BDGA 4FUCA 3M37A 3SV9A 3GY6A 3RXRA 1C1WH 3WW7A 2H5DA 1TX6A 3M7TA 1THRH 1TGCA 1BBRK 2AEIH 3LDXH 2W6JD 3BSQA 1KXCA 2YMSB 4DVAU 1TLDA 3L3TA 4Y7AA 4TWWA 1VGCC 1INCA 2OC0A 3A89A 5FCKA 1GI6A 4WJG2 2FOFA 3FOAA 3E0PB 1FIZA 2ZGXH 1IAUA 1EPTC 3VB7A 1P2MA 2NU4E 4DCDA 1LPZB 1C2MA 1MZDA 1YPHC 1AI8H 1Y3XA 2YNAA 3RU4D 2FTMA 4KELA 4DIIH 5C1XA 3QN7A 4X8VH 5F8ZA 1V2PT 1OWDA 3CENA 3O8BA 4U32A 3NWUA 1QR3E 4INHA 1HIAB 2GCHG 2HPQH 3QUMP 1HGTH 1G9IE 1KYNA 1FPCH 3F9EA 1WUNH 1YPMH 1ZZZA 2OXSA 3MQKC 2BX4A 4R8TB 4YXWD 3MMGA 1L4ZA 4WF8A 4B6EA 1S85A 1Z7KA 2ANWA 1ZTKA 3L6PA 4NSYA 2UUJB 4F48B 1J16A 2ZDVH 3RXLA 1GJCB 2FI3E 1T8MA 1EJNA 2IN2A 4Q7ZA 3TK9A 2B5TB 4AOQA 5JB9S 1NZQH 1ZJDA 1HYLA 1CGHA 2GZ9A 4B74A 4Y79A 2J94A 1H1BA 1FAXA 6LPRA 1BOQA 1V3XA 5FX6A 4OGXA 1UTLM 1O5CB 2W26A 1O2XA 1O3DA 2ZA5A 3GY5A 1QURH 2WV9A 1D3DB 3L33A 1O2YA 3ZIAD 4Y0YE 1ETTH 3A85A 3A84A 1KY9A 2OQUA 1Y5UT 3PM3A 2QN5T 1Y5AT 1WOFA 3RXKA 3SW2B 1TBQH 4LXBH 4BAKB 2ZGBH 3F2HA 4UDWH 3F9FA 1C5MD 3VB3A 3RMOH 1GHAG 2ASUB 1LPGB 2VVVA 1Y3WA 4GVUA 1VKYA 2AS9A 1OWIA 2BTCE 2WV5A 3F6UH 1GVKB 3KNXA 2A32A 1ZRBA 2FMJA 3TNSA 1ELTA 1GGDC 3KHVA 3SGQE 1TYNA 2GMTC 7KMEH 4ISLA 1WV7H 4B73A 1HUTH 1K28D 3TJUA 1P01A 3ATMA 1BB0B 1UTKA 4FOUC 1GBIA 4TT3D 5EXNA 5FXLA 4X1RU 4ZHAA 4VGCB 1NRQH 1QB1A 2C8ZB 3FP8E 5CE1A 1W7XH 1O2NA 2A1DB 2PV9B 2A7HA 3B8JA 1FNIA 2ZPSA 3MWIU 3SV2H 4FUHA 4K69A 5GCHF 2QF3A 2FTLE 2NWNA 3PLBA 1NY22 5DK1A 1KSNA 1GDUA 2C8XB 1RRKA 4HGCA 5A09A 1ZRKA 3A7ZA 2A7JA 1C5PA 2CF8H 1COWD 1SGIB 3LGTA 4K8BA 2VWOA 1DT2A 1GBHA 5TCAA 1OHHD 2J4IA 1OYQA 2BY9X 5HYOA 1O33A 3E91A 3U1IB 2O9QA 1GI8B 1EP5A 1MBMA 3E90B 3LGVA 4ASHA 1U6QA 1NFWA 1LQDB 2K8IA 3Q3KA 3TNTA 3F1SB 4X2YA 1GDQA 1UCYE 2VGCC 2VU8E 2SGPE 5JBBS 1ZHPA 1MTUA 5EOKA 3S9CA 3LKWA 4B2CA 1O2WA 1YPHE 1PPHE 5DO4H 3UQOA 3M3VA 1E37B 2H6MA 4K5ZA 5FBEA 3T2NA 2R3YA 1GI7B 1YLDA 4ABBA 3SI3H 3HGNA 3GY4A 2L74A 3EYDA 2XWAA 4Z0KA 2IPHA 3ZVEA 1G36A 4ABGA 1A7SA 4LZ1H 1FIWA 1LTOA 3FN8A 4AG2A 1N8OB 2HOBA 1QIXB 2G00A 1SGQE 2C8YB 3LC3A 3A8CA 3KEEA 4MQAA 2CXVA 4BAMB 3A8BA 1ANCA 1SB1H 3FANA 2SGDE 1BRUP 1O2RA 3KIDU 4JYTA 1C5NH 1GCTB 1UK4A 2CHAC 1F0RA 1BJUA 2H9TH 6CHAB 2R2WU 4HZHA 5C1UA 2OINA 3BTGE 2DE9A 3CNRA 4Q4LA 1MKWK 3SHAH 3LONA 1ZTLA 2F3CE 3HATH 1AGJA 1BQYA 2ZHDA 2W3KA 4MG3A 1ETSH 4MDSA 4J1YA 4OS7A 1UTNA 2QF5A 1VCQA 1HJAB 1C5ZB 1SGCA 2ZTZA 4OS1A 2VIQA 1EB1H 5CDFE 4Y0ZE 1BT7A 3PWBA 3RP2A 1VZQH 5IK2D 3LGIA 1B0FA 1HV7A 3AW0A 4MNXA 4WXVA 3U8OH 2ZFRH 4FXGH 3RLWH 1O5DH 4AZ2B 2VWMA 5PTPA 2B8OH 1TMUH 2ZTXA 1IOEA 3QTVH 1A1RA 1LQEA 2FZZA 3UNQA 1MTSA 2JH6D 2G52A 1T8NA 2XW9A 5F03A 1GBTA 4AYVB 4AYYB 3BG4B 5ESTE 2BLWA 5DN6D 5A0CA 1E1QD 3RXAA 3N7DA 3MO6A 1SL3A 3TK5A 2Z3EA 3A7XA 1O5FH 4NG9H 3RXGA 2SNVA 3HK3B 5T6FA 1S0RA 2BDBA 5GDSH 3PRDA 1Z6JH 5FPTA 1LVOA 2FOBA 1FQ3A 3RXHA 3SJ9A 1GJBB 2NU3E 5L6NH 1WQVH 2GP9B 4NA8A 1TOCB 2JH0D 4I8JA 1WU1A 4GSOA 2G81E 4IW4E 1QRXA 1GBDA 1EZQA 1EAXA 5CHBA 1E35B 1EZUC 2QCYA 3KQEA 2JETC 2EI8A 3TJOA 3GDSA 3HGPA 1YPLH 3KCGH 1LVMA 5AHGH 2FOGA 2PKSB 3BTME 3LPRA 1GMDG 4ISOA 4DY7B 3UR9A 1UTPA 2KCYA 1Y8TA 1GJ6A 1N6YA 3T28A 1OWJA 4NCYA 2DUCA 4JYVH 4UFDH 1T8LA 2AMDA 1ZPBA 5GPIB 4WWYA 3ZZ8A 2A5AA 2VIDA 1O32A 1JIRA 2PFEA 4ZUHA 1DY8A 2Y80A 1BDAA 1C1SA 1C1UH 2WPHS 3NZIA 1YYY1 1VCWA 1TBRH 3F0OA 3P70B 3TPIZ 1BIOA 4E7NA 1C1VH 2BD3A 3R0FA 4GHTA 4MTBA 1F7ZA 4Y6DA 1P2NA 5C94A 2BZ6H 1TWXB 1IQEA 1BJVA 3AAVA 5E0JA 4U01A 3SU0A 5A0AE 4YZUA 5I25A 2Y7ZA 5K0HA 2AGIX 2XRCA 2UUKB 2TGDA 2ZNKH 1PPCE 2AH4X 5DP5A 2WZQA 1ZR0A 4CRAA 1L4DA 2R3UA 3TGJE 5JBAS 1TMBH 2BLVA 3HKJB 1BHXF 2FWWA 2GCTB 3T5FH 1G2MA 1IQMA 1YPKH 4UD9H 3QX5H 3JZ2B 2FS9A 1HAXB 2KCOA 5E2OA 2ODPA 3F9HA 2Q6FA 1CHOF 2ANKH 4K1TA 1A3EH 2KZ4A 1QGFA 2HNTC 1TRNA 1AFQB 1GMCF 3VGCC 3SU4A 1SKYE 5EU8A 3ZZDA 2ZDKA 5F53A 8KME2 4A1VA 3LT3A 1ELCA 3BTHE 4PROA 4RN6A 4Q7YA 1KIGH 2KFWA 2WYJA 3DD2H 1YKTA 3DFLA 1ELEE 4RSPA 3PV2A 1YBWA 5AFYH 2XBXA 4X1SU 3O8CA 1C1TA 2A4QA 5AVDA 1RJXB 4DG4A 3A88A 3TH4H 2P3FH 4I8GA 1KXFA 4IBLH 1O39A 1VGCB 2F9NA 1Q3XA 1ESTA 2RDLA 3G01A 3OEED 3LGWA 1V2JT 1T4UH 1DPOA 3E8LA 5HKKD 1NESE 1SPJA 1RGQA 1V6DA 1P02A 3OTJE 2BY8X 4DGJA 1EPTB 1GJ5H 3SNAA 1HIAA 3BEIB 2ZO3H 2ODYB 1XM1A 2W7UA 1OP2A 3BTDE 4X6PA 1MAYA 1P09A 2J97A 1ANDA 3A7YA 4O03A 2WPJS 1YF4A 3FO8D 4GUXA 1V2UT 1AE8H 3RXOA 4AB8A 4H6TA 5JBCS 1RS0A 2A45B 1O2JA 5KGOA 3PMBB 3S69A 1YLCA 3KYGA 5KEDA 2W3IA 2ANMH 1XUIA 2LP6A 2FI4E 2K0QA 1QBOA 3M61U 1OOKB 4MNVA 1ESBA 4A6LA 3SJ8A 2K1QA 1CT2E 1L1JA 2ZZUH 2BYAX 3PMJA 4Y8YA 2PTNA 3NRLA 4XBDA 3EE0B 4B6FA 2C90B 2A2XH 3SGAE 3FP7E 2A4GA 4AFUA 4KTCA 3A81A 1WTGH 2DE8A 1HJ8A 1Z8IB 1JXPA 1FUJA 3RXQA 3SUGA 5LPFA 3S9BA 1EJAA 1J17T 1SVPA 3AW1A 2ZCLP 4I32A 1ZJKA 1FZZA 1K1OA 4X8SH 3PO1B 2ILNA 1QRZA 4DURA 2BQWB 4I8HA 1TNKA 4AORA 1C9PA 4OS2A 2D1JA 4H6SB 1Z6EA 1IHSH 2ZFPH 1C2GA 2FLBH 3QO6A 3EA7A 1SFIA 2ESTE 4P00A 1S84A 3MH4A 3SUFA 1FAKH 2P95A 1J14A 1HDTH 4ZAEA 5EXMA 3SJIA 1UW7A 1GGDB 1OSSA 4BTUB 1HAYB 2BQ6B 1TGSZ 2UUFB 5DG6A 4WXIA 4GCHF 3SU2A 3IWMA 1ZYOA 2G5VA 2HNTE 1TFXA 5E2PA 3OEHD 1Z1IA 2XCFA 7GCHF 5A8XA 3MYWA 4WH6A 1IQHA 1BMMH 2EY4C 1O3CA 5C20A 2R2MB 3S0NA 1ELBA 3GY3A 3Q3YA 1SR5C 1C2DA 1D3TB 1F2SE 3ZZ6A 1HPGA 2BY5X 2VWNA 2HGTH 3MFJA 2W6ID 2GTBA 2RCEA 2Z9LA 1BBRE 1GBAA 1VCPA 4CRFA 3V13A 3SNDA 2R0LA 3ZVAA 2ZGHA 2LNCA 3H7OA 2JDID 3MNXA 3OTPA 1QJ7B 2M5TA 3Q3XA 4XSKU 4ISIH 1L1NA 3PB1E 1VR1H 9ESTA 1DLKB 4FUDA 1LVBA 1ETRH 2FX6A 1W11U 1P2QA 1SOTA 2ZFQH 3ZZ9A 2QXHA 5JPMH 3PLPA 1S5SA 1HAVB 1TGBA 3F0PA 1G30B 4M9FA 1TMTH 3OFND 2J92A 2BY6X 3RXUA 4HI3A 5J4QA 1QA7A 1IQFA 1LDTT 3DSPA 3RXCA 1TBZH 1AY6H 3MNCA 2XOKD 3MNBA 5A2MH 3E6PH 1W10U 4MPWA 3LGUA 2GD4B 2C3SA 1O3FA 3MI4A 1G3BA 3ODDA 3SJKA 2JJ1D 3I29A 3ZVBA 4A1TA 1DSUA 5BPEA 3O8DA 3EA8A 3BIVH 2ZPRA 1E36B 4X2VA 4HG6A 1AN1E 3LH3A 3ZVDA 4A1XA 5H4IB 2BY7X 1X7AC 4ISHH 2CHAB 3B23B 1TX7A 1XUFA 1NC6A 1MABB 2XBVA 2PUXB 2FYRA 2WPMS 2F9VA 1QL9A 3KF2A 1CSOE 2ANYA 1JBUH 4ZHMU 2FOAA 3D62A 4X6OA 4BAHB 2F9BH 1K9OE 2TGTA 1CU1A 1TGTA 2GCHF 2H9HA 1O3AA 3KN2A 5GIBA 5C2ZA 1K1MA 5EPYA 1TABE 1A46H 2RFKC 2SFAA 3SO3A 4OS5A 1AKSB 1AU8A 1KTSB 1LVYA 1V2MT 1Q2WA 3OSYA 1XX9A 2A4OA 1P0SH 2OBQA 3EGKH 1GPZA 3RM0H 3SYJA 1S81A 9LPRA 3BV9B 2BLOA 3ESTA 2VH6A 1DUAA 2HVYB 1FONA 4CHAB 2C8WB 2OCVB 2FDAA 1GI9B 2PUQH 3SHCH 2XC5A 4Y8XA 6ESTA 2TRMA 4NWLA 1PPBH 1IQJA 1V2RT 4YT7H 1VJ9U 5GJ4B 4D9RA 2V0BA 3OYPA 1S6LA 3I77A 1SHHB 3MNSA 2PW8H 2ZPQA 3RXSA 2BVRH 1WSSH 2GV6A 1LHCH 2P93A 3FVFB 4LZ4B 5TCCA 4ZKSU 3N99A 1G3EA 1H9HE 1C5UA 1OX1A 1V2OT 4DW2U 1HFDA 3LOXA 1GHAF 4IC5A 1GHWH 1KLJH 1QBVH 2J38A 4AFQA 2ZDLA 2VIPA 1P05A 1MZAA 1D6RA 3R3GB 5ESBA 3RXPA 1HJ9A 3STIA 4E05H 4ZMAH 2PP6A 1DWDH 2JETB 1SLUB 4RT1A 1A61H 1BMNH 1GI3A 3K2UA 3PV4A 4JZ1A 1LMWB 4KTUA 4WY3A 1GMHG 2FPZA 3RC4A 2OC8A 1DANH 3NPSA 4NA9H 2QC2A 3A80A 5DP3A 4BXWA 3TH2H 3PV5A 3LH1A 3SORA 1PJPA 3GCTG 1T32A 2FX4A 1Y3UA
chains in the Genus database with same CATH topology
1WQSA 1K1LA 1LCYA 4FVBA 1FI8A 1O5GH 3UOPA 2GDEH 2RA3A 4Y76A 4DOQA 2ZHFH 2P16A 1P3EA 1Y3VA 2QXIA 3P8NA 1MTNC 4SGAE 2D8WA 1MU6B 1SGRE 3Q00A 2ZHEH 2ZQ1A 1S6FA 2FI5E 4ABIA 4X1QU 2BD5A 2BM2A 4NIWA 1BHXB 3BTWE 5FHTA 3ZV8A 3C1KA 1A5HA 2Q1JA 4AX9H 4OS6A 1P04A 1XKAC 2OUAA 3P92A 1JRTA 3MH7A 1H4WA 1MQ6A 2Z9GA 3SUEA 4CREA 5ABWA 1GHBG 1O36A 1GG6C 2GVFA 4GHQA 1DWCH 1EKBB 1H8DH 1DE7H 1O2ZA 4I8KA 4CR9A 1GJ9B 2H5CA 2VINA 3H5CB 3M5NA 2O8TA 3RMNH 1V2WT 2ZFTA 3A8AA 3RXFA 5E0HA 1MQ5A 2FOEA 5ETXA 5C5OA 1GHVH 1C1OA 3UNSA 3A82A 4ZHLU 4BANB 1ANEA 1C2KA 4CH2B 2BDHA 3MHWU 4BOHA 2NU2E 3VGCB 2FIRH 2FOHA 3A7TA 5JDUB 3GYMA 3VB4A 4Z6AH 4YTAA 4BTIB 5E8EH 1AFEH 1Y5BT 4OS4A 3AVZA 1C2HA 4ABDA 1G37A 1CBWC 1V2TT 2BHGA 3QLPH 1KLIH 1VITH 2O8WA 5HM9A 4YOIA 2D2DA 1EPTA 2G4TA 2PLXA 3RXDA 4O3TA 1QJ1B 3M5OA 4GPGA 3ZVFA 3CS7A 3LGYA 2EC9H 1C1MA 1P8VC 2ZI2H 3SOSA 1FY4A 1WYKA 1O2LA 5EW1H 5FBIA 5LH8A 2HWLB 4QT8C 4BAOB 1ZOMA 1FXYA 5BRRE 1T8OA 5FPSA 1RIWC 1AZ8A 4YOJA 2BOKA 1DDJA 1W12U 1HXFH 3E1XB 3MTYA 3P95A 4X6MA 2HPPH 2HALA 2Y5HA 1C1NA 1A5IA 1AVGH 1AB9B 1T31A 2FESH 2ZU4A 4I31A 4RKOB 2EEKA 1UJ1A 1VJAU 3DHKH 1W0ZU 3UIRA 1Z71A 5EW2H 1A5GH 2F91A 1O3NA 1OWHA 3M7QA 1O2GH 2G55A 1VITG 2ZF0H 1N6XA 3C27B 3LJOA 4JK6A 3AAUA 1L1GA 3SNEA 1HCGA 1C9TA 1GI0A 3M3SA 2A4RA 4I7YH 4O3UA 3SQHE 1ABJH 1PPZA 1ABIH 1HAIH 1C5XB 2QF0A 1XMNB 1NS3A 2BX3A 1GJ4H 4NWKA 1ORFA 3LIWA 1O37A 3VPKA 3AASA 3W95A 1SGTA 5T6GA 3T27A 1TPOA 1GVLA 3PWCA 5DKMA 1EB2A 1OKXA 3QZQA 1J9CH 3RC6A 4DIHH 1TGNA 2NU0E 3QGJA 4D8NA 1NRRH 1MKXH 4FU9A 1GMDF 3P8GA 3ZZ5A 1C2EA 1CA8B 4D76A 1LKBA 3ZZ7A 2VVCA 1O34A 4B71A 5EG4A 1HXEH 1C5SA 2FODA 4ABHA 2CGAA 3Q77A 5FAHA 1ESAA 4Y71A 4A92A 3GCHC 1C5YB 2GT7A 1P03A 2JKHA 4JZEH 3SI4H 4XBCA 2F83A 4Y10E 3K65B 4NIVA 2VIVA 3FAOA 3FZZA 4UFFH 4YESB 5LGOA 3GCOA 1E38B 5SGAE 4FU7A 4MVNA 2FYQA 1CHGA 1W0YH 1HAPH 2A0QB 1NT1A 4WMDA 3SU6A 5LPRA 1Z1JA 2QAAA 1C1RA 1P57B 2GKVE 1A0LA 3BTFE 1TPAE 1HRTH 2EI7A 1TNIA 2BVSH 5C3NA 1GI4A 1SGFG 1QTFA 2TPIZ 2ZTYA 3ELAH 1C5WB 5I46H 1C2JA 2QGRA 1HAVA 2OLGA 3RXMA 4A7IB 4IN1A 5DP7A 1LKAA 3O8RA 1A3BH 1OWEA 2R9PA 4CRCA 2F9PA 1QHRB 1C2IA 2Z9KA 4UEHH 4K1EA 4Q80A 1EX3A 4H42U 1ELAA 1O5AB 1HB0B 2Z3CA 1BTZA 1O3HA 3SZNA 4E7RG 1DX5M 4X6NA 2CV3A 4YOGA 1H9LB 3CP7A 3M36A 2WYGA 2THFB 1SOZA 3A87A 3MH5A 4JK5A 2I6SA 2ZC9H 1UHBA 2V6NA 2GZ8A 1D3QB 2HNTF 2Z9JA 1KTTB 3MU5A 1O2QA 2J2UA 2ZG0H 1TA2A 2PTCE 1ARCA 2FO9A 2WUCA 2Z7FE 3A8DA 1IQNA 3QDZB 3GISB 1GCTC 4XDEA 1ZSKA 2AMPA 4INLA 1F0TA 8GCHG 3TGIE 3URDA 1GBEA 2AGEX 4AFSA 1O3OA 4JZDH 2P94A 1DS2E 7LPRA 4YLUA 1MBQA 3TU7H 3ZZCA 1WCZA 4XE4A 1OP0A 3VXEH 1XXDA 4IN2A 3ZYDA 1GDNA 1MD8A 1C2FA 1TNGA 1B0EA 1QL7A 1SGYE 4X1NU 2PWXA 1AKSA 1YM0A 1HAGE 3RXJA 5EQQA 1EOJA 1YGCH 1FN6A 5HGGA 1SBWA 2IJOB 3GY8A 5EQRA 1A2CH 2UWLA 1D6WA 1SQTA 4F49A 4H4FA 1TRYA 3ZZ3A 2TBSA 2STBE 3SUDA 2ZHWH 1ACBE 2CF9H 1PPEE 1ZHRA 1OWKA 4K2YA 1AWHB 2BDIA 1AUJA 3S7HB 3FP6E 5HMAA 3TIUA 1LPKB 2Y82A 4MLFB 3SV8A 1EJMA 2SGAA 3Q76A 1FLEE 1RTFB 2ZQ2A 3EAJA 1SGDE 1TAWA 3FFGA 3RU4E 2ZEBA 5A8YA 1TB6H 2QXGA 3F68H 1NFXA 4R0IA 1K1NA 1O3BA 4JYUH 4YM9A 1GBKA 3U69H 1P11E 3RXBA 3MU0A 1QFKH 1C5TA 3P17H 2AMQA 2PKAA 4ABAA 3ENSB 3VXFH 1N1LA 1Q31A 2PKSC 3QWCH 1F92A 1G3DA 1Z8JB 1DSTA 1LO6A 2QIQA 2GMTB 2OBOA 4YT6H 2ZU1A 3K6ZA 2XCNA 1PPGE 3MU8A 3VFEA 2PR3A 4NSVA 2A5IA 1AUTC 4MPUA 1YP9A 3GY7A 5AFZH 3V3MA 3T62A 1NU7B 2A31A 2WPIS 1NFUA 3K9XB 2P8OC 3E16B 3RMMH 1S6HA 2BOHB 1BUIA 2EA3A 3DFJA 6GCHG 3UPEA 1BRBE 5EXLA 1IQLA 1GJAB 1NM6A 3P8FA 3HKIB 3IG6B 1RTKA 4Q7XA 1SLWB 3I78A 1EZXC 1FY1A 1O3IA 1OP8A 3NXPA 3NK8A 4IC6A 4AG1A 1MKXK 1QB6A 1GJ8B 1XUHA 3ATLA 1HAHH 3OY6U 1GBMA 1UO6A 5C5NA 1MTNB 5EQSA 2CMYA 1DXWA 4B76A 2GGVB 1NRSH 3ATWA 2ZDAH 1O3GA 1S0QA 2QYIA 1OPHB 3S7KB 3BEUA 2VGCB 2TGPZ 1NTPA 3TJNA 4CH8B 1GBJA 3DA9B 4NA7A 5FPYA 2BVXH 1UCYH 1BRAA 5DP4A 4U2WA 4DT7B 5J4SA 4FU8A 1B5GH 3ZYEA 2J34A 1C5RA 2Z6BD 1O2VA 3MU1A 1DUEA 5CHAC 2EI6A 3TVJB 1W2KH 3BEFB 4WVPE 5FX5A 4NZQA 2BB4A 1TA6A 3ZV9A 3ZZBA 1MD7A 3GY2A 1NFYA 1PFXC 1UHBB 2TIOA 1BZXE 3RM2H 3PMHB 1MH0A 1XUGA 2VIWA 3OY5U 2Y81A 5HM2A 3NUMA 1C5LH 1O0DH 2A2QH 2ZWLH 4BXSA 2D26C 1KLTA 1ZTJA 1BTWA 4MNYA 1UTMA 5T3HA 2G5NA 1O3LA 1P2OA 3W94A 1KXDA 4FUIA 3PROA 2WPKS 1FV9A 3URCA 1MCVA 2F9UA 3STJA 3U98H 1H8IH 2W5EA 1IQGA 3LU9B 1CBWB 1DXPA 3DT0H 1SQOA 1IQIA 3CS0A 1MTWA 1B7XB 2I6QA 5EPNA 1P9UA 1EOLA 1HLTH 1AVXA 3RXIA 1BTYA 3SV6A 2J95A 2HLCA 1GJ7B 4X2WA 3RMLH 2OC1A 2ODQA 5JB8S 1CQQA 1RXPA 3SNBA 2SGEE 5C67A 3ODFA 1GBLA 3BIUH 2UUYA 3SQEE 1DLEA 1IQKA 1ZMNA 5GWZA 2O8UA 3UQVA 1ZMLA 2Z3DA 1WTHD 4RKJB 1P2KA 4YLQH 5DP6A 1GJDB 4O9VA 1K1IA 1MAXA 3EDXB 1RIWB 1IHTH 1GHYH 1O5EH 1WAYB 2BDAA 2QV1A 4X1PU 2BD4A 3IITA 3HPTB 1P10A 1NRPH 2RG3A 3RC5A 1V2ST 3U1JB 1TOMH 2WPLS 1C1QA 1TIOA 1MMJN 2V3OH 3PTNA 5F8XA 3OU0A 1XVOA 1MCTA 1MU8B 1XUJA 1V2QT 1TNJA 1QL8A 5E0GA 3E3TA 2ZU2A 4IMQA 1LHDH 3GYLB 2PHBA 2BDYA 1CA0C 1QB9A 3T26A 2PGQB 1SLVB 4GAWA 4Y11E 1KDQA 1ELFA 4YO9A 5JYIA 1SI5H 1O2PA 3KQDA 3PO1C 2G8TA 2XXLA 1D4PB 1QBNA 5FCRA 2ZECA 5TJXA 3H7TA 5L2ZH 3QK1A 1AVWA 2BLQA 2ZFFH 4GLYA 1O2SA 4AB9A 2PSYA 2PKAB 1EAWA 4JCNA 2XBWA 5A0BA 3V7TA 3TITA 4K8YA 1UTQA 5EGMA 4F4OC 5IYTA 4I8LA 1JWTA 1GMHF 2VB0A 1NPMA 1P9SA 1KXAA 2PGBB 1EAIA 1EATA 2A5KA 2OC7A 4BAQB 5B6OA 4FUJA 1Y3YA 2Q6DA 1YPGH 1CVWH 4UE7H 1O2IA 1V2LT 1O2TA 2ZKSA 1CGIE 1XVMA 3PTBA 4K60A 3GCTF 5GCHG 1FJSA 1UK3A 8ESTE 2Z9IA 3SNCA 1HBTH 3BTTE 1CO7E 2XTTB 3GCHB 3K6YA 1QA0A 1O2KA 2UWOA 1E34B 2ZHQH 1EAUA 1QQ4A 2VNTA 3TK6A 1PPFE 3FZDA 1NRNH 5DPAA 4XFQA 1ZHMA 1DVAH 2BXTH 2AIQA 4INKA 4JZFH 3U9AH 1TRMA 4ABEA 2B0FA 3UUZA 4NFFA 5G4BA 2BXUH 4DJZB 1ZLRA 4IMZA 1V2VT 1AZZA 2C93B 2V35A 2VH0A 3M3TA 3SBKA 2AIPA 4X8TH 2FXRA 3VEQB 4OGYA 3LJJA 5DP9A 2STAE 4M7GA 4ZKNU 1A4WH 1GHBF 1QJ6B 3D23A 4LK4A 1ELDE 1XKBC 2FOMB 5DGJA 1DFPA 2XBYA 4B2AA 1BITA 1BTXA 2ZP0H 1SLXB 4WMEA 2KAIA 2BD8A 1YCPH 3SU5A 2FEQH 1LHEH 1PQAA 4AGKA 4NGAH 3P8OA 2YNBA 4J2YB 1K22H 3M5MA 1GL0E 1K1PA 2GT8A 3SN8A 2AYWA 1DOJA 2QA9E 2Y6TA 1ANBA 2GDDA 1O2UA 2GZ7A 1UK2A 1FY8E 4X2XA 1T4VH 1TONA 1O35A 1BCUH 1UCYK 1SMFE 2G51A 3QGNB 3RXTA 3BF6H 2BDCA 1KXBA 1PYTC 3RUOA 3UREA 3OX7U 4KGAA 3D49H 1C5QA 4KP0A 4ISNA 1SC8U 2BD2A 2ZIQH 3GCNA 3S9AA 4BNRA 1ZGVA 1W7GH 1FMGA 2OQ5A 2AERH 1SGPE 5T6DA 3U8RH 1GBFA 1TE0A 2ZU5A 4K1SA 2ALVA 2FLRH 1P06A 1RD3B 1BRCE 2QXJA 2ZFSA 1S83A 3EA9A 1MTVA 3U8TH 3RDZA 1M9UA 1HNEE 2ZDMA 1UTJA 4CHAC 3GDVA 2ZCHP 5IDKA 1PQ7A 1P2JA 1SG8B 4E06H 1EUFA 1F0UA 5K7RA 4MPXA 4KKDA 1A0HB 4D9QA 1O2HA 1BTHH 1AD8H 1BTPA 1VITF 1UVOA 2GV7A 3M7UA 1C5OH 3M35A 1SFQB 2SGFE 1QQUA 1Z8RA 5GXPA 3ZVGA 3NKKA 1LHFH 4MNWA 3JZ1B 4A5TS 4CR5A 3SU1A 1F5KU 2CJIA 2UWPA 2ZU3A 3TH3H 1KDQB 1XUKA 1DWEH 1RFNA 1F5RA 1AE5A 1JOUB 1SSXA 1ZSJA 2Y5GA 1ELGA 1Y59T 2OP9A 3EQ0H 4D7FA 2XC0A 4CBNA 1E0FD 1FY3A 2J9NA 3MH6A 4Q2KA 2WINI 2BD7A 4VGCC 2LPRA 3LC5A 4TPYA 2HVXA 2BMGB 5F8TA 2A7CA 4NIXA 2WUBA 1GCDA 2B9LA 1QCPA 1GWAA 2ZGJA 3T29A 1EP6A 2HRVA 3KL6A 4D7GA 1ZMJA 3RU4T 1J8AA 2SNWA 1QNJA 3D65E 1W3CA 2BZAA 4JMYA 4FUGA 4NFEA 2WV4A 3PLKA 3ITIA 1GI2A 1AQ7A 2B7DH 4UONA 1YPEH 1NN6A 3P6ZB 4X0WU 3RXVA 2P3TB 4SGBE 1G3CA 3BTKE 1DY9A 2P8OB 2XNIA 4NIYA 1K1JA 1K2I1 1UVTH 2AFQB 4ZXXH 1GBCA 1TQ7B 1C4V2 4B1TA 3UOUA 2XWBI 4BTTB 2Y7XA 1Z8GA 4UFEH 4ZKOU 4X8UH 5AF9H 2GX4A 1BMLA 1JRSA 1FDPA 1O5BB 1C1PA 1TQ0B 1BBRH 3ZVCA 1O3PB 3RLYH 5JBTA 3T25A 3WY8A 4FVDA 1C5VA 3M5LA 1D3PB 4ZKRU 4ESTE 3BN9A 3V0XA 1SGNE 1O38A 3KGPA 4LOYH 1BMAA 1ZGIA 1SHYA 1CHOG 1OXGA 2BQ7B 3A86A 5DJ7A 3UFAA 4CRDA 1UVSH 3MO9A 1O2MA 2QY0B 1L2EA 1H9IE 4THNH 2KAIB 1GMCG 3TLOA 1CT4E 4ABFA 1N8OC 3RXEA 1A0JA 2XC4A 1AHTH 4I33A 3A7WA 2C4FH 2FM2A 5L2YH 1AWFH 1EXFA 1OYTH 5CHAB 2XYAA 2TGAA 8LPRA 2H2ZA 1ID5H 4CBOA 4FUEA 4IS5A 2W7SA 1T7CA 1XXFA 1KXEA 1K21H 4Y7BA 6CHAC 4TY6A 1D9IA 5LPEA 7ESTE 1EQ9A 1W14U 2P3UB 2SGQE 4TWYA 8GCHF 4NZLA 1GI1A 2NU1E 1TPSA 5EODA 1TNLA 1CGJE 3DUXH 1HJAC 4O97A 1YCPK 2P59A 2F9OA 1GVZA 3UWJH 2ULLA 2AGGX 1PQ5A 3B9FH 1O31A 3QTOH 3TJVA 1UVPA 3UNRA 2OTVA 1UTOA 1SGEE 1UMAH 1EASA 3BTEE 4AGJA